1WUUA

Crystal structure of human galactokinase complexed with mgamppnp and galactose
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
391
Chain Sequence
HHAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactokinase
publication title Molecular Structure of Human Galactokinase: IMPLICATIONS FOR TYPE II GALACTOSEMIA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 117
structure length 391
sequence length 393
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.6: Galactokinase.
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
A PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1wuuA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1wuuA01
4JG4A 1N0VC 4LF7I 4NXNI 2UXCI 3ZKDA 4P7AA 4LF6I 2Q2EB 1FJGI 3ZZ0A 1Z0GA 4DV0E 5A2QC 1H72C 3PYEA 4KQVA 4DUYE 3PYDA 1FWKA 4DR4E 3D4JA 3K17A 1HNXE 5IWAE 4DV6E 4Z7YA 1IBKI 2DEJA 4JI3E 2V8PA 2UUCI 3J80Q 5FLXQ 1KKHA 4DR1E 4USMA 1ZXNA 3WU4A 2V2QA 1FNMA 1PIEA 5LL6R 4X64I 3ZM7A 5IT9C 2ZM6E 1ZM2A 2UUBE 1XMOI 4JI2E 3LPSA 4Z7CA 4DPXA 3B8HA 1XNRE 2UUAI 4DR2I 4UTGA 2AJ4A 1N36E 1NZ0A 4DR6E 4JI0E 4GKJE 1DARA 3ZZTA 1Z5BA 4R1FA 4AQYE 4YHHE 1K47A 4PU9A 4FWGA 1Z0WA 1N32I 4LFAI 4DV4I 4DPWA 4PRVA 4LFBI 2UU9I 4HXZA 5LMUE 4WUBA 1HNXI 5IWAI 2HKJA 4DV6I 4URLA 4DR1I 4JI4I 4X65E 4B3TE 2HFSA 4DV1E 2UUBI 2VF3A 1B63A 3QT6A 2V2ZA 2A2CA 4KHPI 2HK2A 4HY1A 1IBME 1Z0VA 1H74A 3J7AM 4ZVIA 1RREA 1H7SA 1N36I 2E5LI 2BM1A 3J81C 1XNQE 3B78A 2NPFA 4JI5I 4DR5E 1I94E 1IBLI 4LF4I 1N33I 1MG7A 4FWHA 4MYTA 3J81Q 3T1YE 4B3RE 3V5RA 3H4LA 4YY3I 4LFCE 5LMUI 4JI8E 4LF8I 4DV2I 4GKKE 4USKA 1KTVA 1ELOA 5LMNI 2A2DA 1J5EE 2HKEA 1XMQE 1FKAE 5A2QQ 4DPUA 3PYGA 2WW4A 1ZM4A 1MU5A 1ZM9A 4LF5E 1N0UA 4X65I 3V2UC 4B3TI 4DV1I 1HR0E 1HNWI 4FWDA 1ZM3A 4B3ME 3OTOE 5BR8E 4X62E 2VQEI 2LJPA 4RPFA 2EFGA 1IBMI 2UXDE 4HYMA 4DR3I 1XNQI 2F4VE 4DPTA 4DR7E 5IT9Q 2HK3A 2X7IA 4DR5I 1I94I 4DUZE 4JYAE 4JI1E 1PKPA 3T1HE 3T1YI 3JAMC 4B3RI 1QZRA 4DV7E 4DV0I 4K0KE 4JI8I 4DUYI 4GKKI 4X66E 4DR4I 4DXLA 3JAMQ 2R42A 4UT4A 1WUUA 4B3SE 4LF9E 4JV5E 4JI3I 1Z0CA 2UXCE 1XHKA 4LF6E 2HFUA 2V2VA 1S4EA 1RR9A 2GS8A 3OTOI 5BR8I 1N34E 2ZM6I 1OJ4A 1UEKA 4JI2I 2UXDI 4MYUA 1XNRI 3M6AA 2F4VI 1IBKE 2UUCE 4DR6I 4JI0I 4GKJI 1ZXMA 3T1HI 3ZZUA 4AQYI 4YHHI 1MX0A 1Z0BA 4X64E 1Z5CA 1XMOE 3WU6A 4NXME 2X36A 4DR2E 4WUCA 3Q1QA 2BV3A 2XEXA 4B3SI 5GMEA 3PYFA 4FN5A 4LF9I 4JV5I 1D6TA 4DU8A 3WU5A 1H7UA 2E1RA 1KIJA 3K1JA 4DV3E 1N32E 1A6FA 3LNUA 4LFAE 1N34I 4HACA 4DV4E 4JI7E 4LFBE 3J80C 5FLXC 2UU9E 2VQFE 2R3VA 4P52A 1H73A 4I3HA 3WU3A 4JI6E 2DEIA 4DPYA 2ZBKB 3CWVA 3J7AG 2J7KA 4JI4E 2HHHE 2BM0A 3GONA 1BKNA 4FW9A 4OX9E 4LFCI 1Z0TA 1Z59A 4NXMI 2V34A 4KHPE 4DV5E 3F0NA 1J5EI 4DU7A 1EA6A 2ZITA 1HNZE 2E5LE 2UXBE 4ED4A 1XMQI 1NHIA 1B62A 4JI5E 1FI4A 4EMDA 3ZKBA 1IBLE 4LF4E 1N33E 4LF5I 4LF7E 4NXNE 1Z0EA 1Z5AA 4DV3I 1FJGE 1HR0I 4YY3E 4JI7I 1KVKA 2VQFI 4B3MI 4LF8E 4X62I 4DV2E 5LMNE 4JI6I 3QT5A 1PVGA 1U2RA 1S16A 5L3JA 3HULA 3QT7A 4HACB 4DR7I 2OI2A 4DUZI 4WUDA 4XTJA 2HHHI 4JYAI 2CZ9A 4JI1I 1HNWE 1FWLA 4DV7I 4OX9I 3B82A 4PRXA 4K0KI 2VQEE 4DV5I 1EI1A 1NHHA 3LTOA 4X66I 5GMDA 3QT8A 1NHJA 1HNZI 2UXBI 1VISA 2UUAE 4DR3E 4M1KA
chains in the Genus database with same CATH superfamily
3UDCA 1EQ0A 4RNFA 3BDEA 1HL6A 3Q0AA 2QMUB 4CLKA 1Q5VA 4OI1A 3GSIA 2LU2A 4ZS6A 2R7OA 2CNOB 2C22A 3M8YA 1N5YA 1WSRA 1DFDA 3ET6A 2XBPA 3G9CA 1S6QB 2B9EA 2H5JB 3H0PA 1JLQA 4ECZA 5A6WA 2YWGA 2AIRB 3BZQA 3UN3A 1MMLA 5HVHA 5DG8A 1GMVA 1PCAA 2B7BB 2C2NA 5DM7Q 1NZAA 5HL7Q 3KLIB 3PS2A 4OO1C 3TZXA 5A0YB 2F3JA 4GKKF 5JMNA 1AUSL 4ZA1A 2U2FA 4JI0E 5HN0A 5DETA 1NJZA 1TELA 5JXSA 4FWGA 4OYXA 2VBZA 1LKZA 1UP1A 5KFMA 4DV3J 3UD5A 1OQ3A 1UJ5A 2JC1A 2F7VA 3W3SA 4DV6I 4OO1E 2QLWA 2IOQA 3VAJA 4FW7A 5EGYA 2ASJA 4DR1I 3CC4S 3VAHA 4BHQA 5G4DA 2J0SD 4DR7J 3FJ2A 1U1LA 4LR8A 1YHQS 4HL9A 4DV5J 1GMWD 4A8SA 2IJNA 3BYRA 2Y8YA 2CJYB 3O2IA 4FWHA 1RTHA 3D3BJ 5IM0A 4NXNJ 3MECA 3IM8A 2E1CA 2DR7A 3PTWA 4K4XA 3BDPA 2L9DA 1WTFA 4DPUA 3M9NB 3PYGA 2G9OA 2FJBB 2VG6A 1F2GA 4OHVA 1IBKJ 2YKAA 4QOTA 3V2UC 2AD9A 2ZNYA 1S9GA 3MMBB 3DM2B 3MFIA 3BSCA 1LK7A 3P76A 2G2ZA 1T03A 3PW5A 2IIHA 5FDLB 3Q6MA 4ZITA 2XMMA 1RWKB 3K89A 3QIPB 4ED3A 2XS7A 1CS4A 4ILRA 3B4DA 1PILA 4XK8C 4UW2A 4LF5F 1BC6A 5K36F 4ZCMA 2GCFA 1HWIA 2OELA 4LFBJ 2FVQA 2NN6A 2PO2A 2GMHA 2KN4A 3R8YA 3ENVA 3OD2A 3IS9A 5K9FA 5BR8F 2DRBA 1IKWA 3PR5B 1WG5A 2LQJA 5DLFA 4UOFA 7FDRA 3NGDA 2IAJA 3H5XA 4NCGB 3BQ1A 5KT7A 3UVJB 2CDRB 4PWDB 1S59A 1WKLA 5DZ6A 2VL1A 3J7AN 3GFZA 3H5UA 1WORA 4DR6I 3CD6S 1FESA 3DRYA 5HVFA 3T5JA 3M7NG 2FQQB 2W2PP 3BREA 4NCAA 4JV5F 5F0WA 4LF6F 3H7HB 3J80U 4UY85 3MAAB 3EPIA 3CJ3A 1TKXB 4KB7A 3ISND 1T11A 3PFEA 1IKXB 3DYAA 2FVCA 1OYRA 1NK9A 2B4UA 5AE1A 4IZKB 2RF2A 2JH3A 4EK2A 1RP5A 3KKFA 5BXIA 4PKDB 2ZH3A 2D9PA 1VQ9S 5C0XC 3W8PA 2HQIA 4NRTA 4P73A 1H98A 3CWVA 3BYPA 4ECQA 3N9UC 1S99A 4KGXB 1ZOTA 2BA1D 4OX8A 4MDTA 3SFUA 4RW6B 2P9GA 3D54A 1WKKA 4OMFG 4M5HA 1AZSA 1ZH5A 4UUWA 4NLGA 3A3PB 4USIA 5LSOA 5C0XE 2BVZA 4MFBB 2BA0G 1HWJA 1B62A 3N5FA 1S6PA 1HMVA 2EG1A 5BJRA 1HBNB 5LT5A 2XMUA 1U2FA 2BJ9A 1EZZB 4C0HA 2C2EA 4NLDA 5AJ3J 2HG4A 2LA6A 3CDUA 1OYPA 1XQIA 2R7WA 4IDKA 2FJVA 3C46A 2E44A 4DI6A 4KHPF 2VHGA 2PIIA 1JLBB 4QIFA 2E5LF 4DV7I 4JI5F 3VR1A 2PO1B 5A76A 3C6UB 4TXSA 2XYHB 2VV5A 1Z1ZA 3NS6A 4HKQA 2I38A 3A8EA 2C2RA 2QIFA 5LMUF 4ATNA 2NCKL 4F02A 2CQPA 1SIWB 5C2GA 4U3BA 3KDOA 3GLJA 1DTTB 3I82A 5KFYA 5A2QC 4E2FB 1S0MA 2GQ2A 3NOGA 2J65A 1NDPA 1QE1A 2UVWA 5I42B 5A8RA 4X4VA 1S1WA 5J2NA 2WW8A 4QYZJ 4XTTA 2X3GA 2DJWA 1G1XA 4FVMA 3CWJA 2AGQA 5HATA 2AKWB 4P2SA 3RG6A 1DLOA 1KVJA 1X9MA 2AYBA 2OKQA 4JI2E 1YQHA 1WHWA 2A10A 2ACYA 3B8HA 3M2RB 4LFCJ 4L73A 3NNCA 4K5SA 3HI9A 5I3QA 3UR3C 3MURP 3P8BB 2M9KA 4KRWA 3RU0A 4DPWA 3O1LA 4M5KA 3NLCA 2CZVC 2V94A 5ETPA 4WK1A 2O1WA 2Z2LA 2CNKB 5L38A 4DF4A 5HO4A 1AW0A 4ECXA 2BE7D 4Z37A 1X8DA 3VWSA 1DQAA 1T95A 2CPEA 3OW2R 3IAS9 4CNZA 4YR3A 3LP2A 1XK8A 4CI0B 4GVBA 2FB0A 2D69A 4JI0F 4IRCA 3MM7B 3LGMA 3DOMA 4C8LA 4L3KA 3J7AM 3NL0A 1IM6A 4TQRA 2MKYA 1VBXA 1C0UA 4IZJA 2KTQA 2FGOA 4LSLB 2HPUA 1KTQA 2VA2A 3V5RA 4CLZA 3D1QA 1URNA 4ZKAA 5CAAA 2ADBA 3PJXA 1KQKA 4BLGA 4G1IA 4QWEA 5J2PA 3RUBL 5ETRA 2HS4A 1LWEA 4IQXA 3L09A 4HEA9 4EYHB 4DV1I 4OZ3A 1J2VA 3M1VB 2ZHOA 2N4DA 2RNEA 2DR6A 4H4KC 4B3ME 3MCMA 3M8PB 3SZ2A 1P1LA 1RKIA 1U1PA 1XMOJ 5E3RA 2RD5C 4C11A 2PMHA 3RW6A 3AD8C 3MGJA 1HFEL 3MM9B 3KJVB 2CXEA 4ZJOA 4DQIA 3QYYA 2B6AB 3FEYB 4DUYI 4K4WA 4DR4I 4O0NA 3QNWB 2UU9J 4UZCA 4JI6F 4Y2MA 3EDRB 5HANA 1DY3A 4FF1A 3W63A 2UXCE 2ZNZA 4IO9Q 2MKSA 2DYAA 1BD6A 4JI4J 1CULA 1B4SA 4W90B 2ZM6I 3M6AA 2V8HA 3I87A 1SJ1A 5MLCV 2FZCB 4AQYI 3C16A 1NHKL 1HWKA 3K8VA 2H54B 1RHRB 3U1YA 2OTLS 5KFWA 1D1UA 3FRYA 2H5IB 1YJTA 2HQ3A 4Q0BA 3PG9A 4PUOA 4HT7A 4ZVPB 2YH0A 3EJMA 4TU9A 1M1GA 2J6TA 1T9TA 2PI5A 4DV3E 2XG8A 2KG1A 2KZMA 3I56S 2DHAA 2XZTB 4WE1B 3IXQA 2AEJA 4JV1A 3MD1A 1NXIA 4IQMA 1B99A 5B0AA 1FVQA 2VQEJ 2I2YA 1Y5YA 4OI2A 4DCJB 2W7PA 2JLFA 1YKWA 1PJ7A 4I56A 3NXZA 3TOQA 5IV4A 3R9LA 2BE2B 4MK9A 6FD1A 2BR2A 2ZHAA 3R2CJ 1Z59A 4RU9A 4DV5E 3QMQA 2ZJQQ 4FF3A 4LSNA 1VQYA 2DRDA 1RHQB 2MZJA 3DHXA 5CYJA 1RB0A 3HFZB 4LIWA 4ICLB 5KAKA 1WC1A 5C25B 4FZVA 1S9EB 2AX0A 4NXNE 4HI2A 1I5OB 2W01A 2K3KA 4KV8A 3VVUA 2ATCB 4ZVQB 3LA0A 1HA1A 4LF8E 4ZMMA 2GQQA 1MMDA 3AA8A 3CCZA 4HLBA 3U1NA 4KO0A 1QSSA 3C14A 2Y1JA 1UVMA 4ZP8A 2ZC4A 5C0XF 2XMVA 3FCHA 3HHLD 2EK1A 1Z2LA 1UVLA 4L6V3 1KDNA 1C2PA 3OPKA 2RT3A 1U1RA 3P3EA 3W65A 3W5YA 4M63A 2RU3A 3G6VA 1CC8A 2V9KA 3MHYA 2HHQA 1FT8A 1OY9A 3J7Z5 4AYBD 2CPIA 2R4FA 3GG0A 3SQGA 1WJ9A 3C8YA 2OHDA 2KO1A 3FCVA 4LQ9A 3H8YA 2XLKA 3M8QB 3FCWA 1U0HB 1HK7A 1D09B 1IBMF 3ENAA 1JMTA 3UCZP 3JSBA 4QR0A 1Q4RA 1KOHA 2K7JA 4O3PA 5JEAD 1YTYA 3WU4A 1FRJA 1NDKA 2ZH9A 1Y4ZB 5M2PA 5U47A 3VALA 1NJIT 4DZDA 2GO4A 5DS7A 2VOPA 3BBFA 1SCJB 2WCXA 4OZEA 4DZ6A 1NEEA 3BR8A 1CJVA 1E6YB 4ALZA 4OZ5A 1C1BA 1JIHA 3MM5A 3JTOA 4OJGA 3QO9A 2ALYB 2DTJA 2YWEA 2EKYA 4X62J 3EZ5A 2XSJA 4URLA 3OXFA 2IM0A 5AE3A 1JLFA 1JJHA 4JI2F 3VGVA 2VONA 1FKOA 2PT0A 2QMXA 2O1TA 1EKSA 2ASYA 2PNZB 4WP3A 2HZVA 1NNDA 3BGLA 2KKHA 2X1BA 2MZSA 6AT1B 4YEAA 3BKFA 2JVOA 1RREA 5KFHA 5KFKA 3LANA 2FLLA 3SCJE 1TVRA 1IBLI 1N33I 3CJTA 1UCNA 1VQ5S 4B3SF 1RAAB 4LBIA 3VAMA 2HHXA 1VQ7S 1HQEA 4ZHRB 3FC9A 2GO9A 4FDFA 1VLOA 4TYAA 2O01C 3TEHB 1TL7A 2DNZA 2CZ4A 1J5EE 3ZNJ1 3SCKE 3P3CA 5LM7E 2BW2A 3QZ8A 3T1AA 3LGNA 4P2MA 1NH7A 4DQPA 4IH6A 5K5MA 1ZM3A 3HFKA 2CGEA 3N79A 1N6QB 5DRRA 2A3JA 3DHWC 2C38B 3JSYA 5ETNA 5IT9Q 1C4AA 2E29A 3TA2A 1S1TA 2FJEB 3POTB 4UF4A 1RCOB 1SQGA 2MLYA 4IKAA 3I55S 3CC7S 4F36A 4GKKI 2DK2A 1CBKA 3DOLA 1WELA 3D6TB 3M2UA 3TX8A 4J7CA 2W4PA 1KLMA 3MEEB 3GSDA 4B3MF 2M52A 2WVCA 2QLBB 2Q66A 1U25A 5KFZA 4Y6IA 5F3TA 4PG5A 1RAEB 2VB6A 1U1KA 2ZEJA 2Z8QA 3GLLA 1SVDA 4NLPA 4MIBA 1VQ4S 3CNQP 4PYDA 2Z56B 4GMKA 2C2KB 2UUCE 2GJIA 7AT1B 4PXEA 4K59A 2WVFA 1IVZA 3UI3A 3K5MA 1VJQA 4X64E 1ROFA 3EZOA 1RT4B 4YDDB 2UXCF 3OHBA 2OGUA 3OSNA 4YY3J 2LCWA 4YS2A 4NZ6A 3TRGA 2ILZA 2V4JA 2XZDB 4QPXA 3E01A 1KIJA 2KXFA 1TTHB 1A6FA 3RRHA 2EC0A 2R8JA 3KMQA 1RJJA 3KYLA 3FBBA 4DDFA 3ZTPA 2ZH8A 5C42A 3ZTQA 3QAEA 3V6HA 4RBTA 5J2MB 3CCES 2CG4A 4CLUA 2QO3A 3PY8A 3FFIA 2JEBA 1FNXH 3MMJA 1QAYA 3TYTA 1QAXA 4DV3F 4JI8J 3D1HA 5FIIA 5HBMA 2O66A 1X4CA 2HNYB 4ZVSB 4LF5I 1JKHA 1IXKA 3AJ1A 2UV8G 4IG3B 3M8SA 1R89A 4LRBA 4CO0A 2JLGA 1WI8A 3FGVA 3ADAC 3AQOA 4I4BA 1DQ8A 4ILMA 3UFCX 1UFKA 2PNLA 2B7CB 1PVGA 2CPDA 2W8KA 4DQSA 1RHYA 5LJ3Y 2IVFB 4BA2B 1TKZB 2ZH5A 1VQNS 1VRTB 3NGTA 4ED8A 1K0VA 1S0NA 3T1HJ 1Q7YT 2ZFHA 4PPDA 4C0OC 2EBGA 3BPDA 5A8WA 3DRPB 4DS5A 1DAXA 3HMJG 4BBYA 1W2IA 2EBEA 2MZTA 4USJC 2RKIA 1NHUA 4LF8F 2CPXA 4JG4A 2NXUA 4YN3B 2QLXA 4LF9J 4F3QA 4LF6I 3RBEA 2Z4PA 1U49A 4DV0E 4C3LA 2W9AA 1ACMB 2U1AA 4KQVA 1MN7A 4X65F 3KLGB 4URGA 2YX4A 2ZUGA 2CQCA 1SUQA 3PM9A 4C6AA 1R8CA 1URRA 3K2YA 2GVDB 4DL0C 3J80Q 2CJQA 2RQ4A 2UZAA 4ZPDA 1QSYA 1XNQF 3FEXB 1SKRA 2JFDA 2MZ1A 3GIMA 1S1XA 5K36D 3IA0A 2LXFA 2HRYA 1RTZA 4OO1A 2R2TA 1YRXA 2HYIB 2AJ4A 1ZYQA 3PRBA 2OUGA 2CPFA 1NZ0A 3F73A 3KLFB 5KFCA 2KFZA 1DARA 3HVAA 3BSNA 2HBZB 1IKYB 1RT3B 5J1PA 3IR5B 1XXEA 3TR5A 4NWBA 3CCRS 4JI7J 2QYCA 2MY8A 3Q8QB 1SV5A 2AJ2A 3Q8RB 3LOUA 1LEOA 2UXDF 2BJEA 4DG1B 2ZBQA 3S01A 3P45B 2R2SA 3QGHA 4WYLA 4FP9A 3W2VB 4F0MA 4DUZJ 4JBCA 4D3GA 3CDIA 5A2QU 4KHPI 4OX9J 2HK2A 3H5YA 1Y6ZA 1Z0VA 1H74A 3CCLS 2E5LI 2MEWA 3J81C 2YQ3A 4JI5I 2IMOA 4QYRA 1RUSA 4BCAA 5IT4A 1PGZA 4OI0A 1VK8A 5LMUI 1S72S 1XTZA 3K5NA 1ELOA 1A6LA 1N34F 1RYSA 3EVOA 4WU3A 2VJUA 1C1CA 1HR0E 3CCMS 5IQQA 4F26A 1MLAA 2OPRB 2PD1A 4WP9A 3SDEA 5GAGI 1NKCA 4LT6A 1OY6A 4NPOA 3M85G 1R3NA 2E7VA 2V50A 1J5OA 1AT1B 3KHGA 5I4MA 4AXJA 1J5EF 2VPXB 3RGIA 3KLHA 2Z0GA 3EGNA 2MKCA 5KT5A 2XSFA 4RUCA 5ETOA 1UJ6A 3PCOB 4X4PA 2JEAB 1DURA 2I5JB 2C3MA 3HVTB 4N5SA 1NPKA 1RT6A 2KI2A 4NL5A 1HNXJ 1CVJA 2KM8B 3RJMB 3B4TA 4RW7B 4OYBA 2GNKA 3HM9A 2VOOA 1QUPA 1Q82T 2V2VA 2PO0B 2ZC3A 2Y1IA 1W26A 1A9NB 3Q8UA 3L3CA 1P27B 2VICA 3M32A 4X4UA 4N41A 3VVTA 4JI0I 4BWMA 2F9DA 2XZWA 3ZZUA 1J27A 4EU0A 1SH2A 4K7QA 1UWAA 4CWBA 2HLTA 1GAOA 2YKMA 1PC5A 3V6DA 2VU5A 1F3VA 4C2MA 3AOAA 3MCNA 3N4WA 1FX2A 2R7XA 1IR1A 2BXJA 4WFZA 1AUDA 3W5ZA 3W66A 5KFJA 2JNJA 2HMIA 1ZPVA 2OPSA 3VZHA 4YQWA 2VIHA 1VJWA 2BYCA 3KK2B 3LF0A 1R6LA 2Y8WA 2DR5A 1IKVB 4O4GB 2UUCF 1TFYA 1LWCA 4M5DB 3TNVA 5FLXC 4QPTA 2DNNA 2YKNB 2J6SA 4X64F 4FF2A 2RDDA 2YNGA 1HYSA 2G2OA 1OS5A 2F65A 2F5GA 2O3DA 4GO5X 1OPIA 3HHLA 1I94J 3M2VB 2ALZA 4A46A 1LK5A 4HHUA 1DTQB 5F8GA 1TAUA 1N56A 5IOLA 4B3RJ 1VBYA 1U48A 1Q53A 2HVEA 2RQCA 3THVA 2OEMA 1FDNA 1KHWA 2A6MA 2ZBIA 2OFHX 1NRKA 1IR0A 3ZZYA 2OFGX 2EFPA 2RHQB 4F4KA 3KNGA 2ZE2B 2J9CA 1KQGB 2MQ8A 4XAKA 5ETQA 2DHSA 1R8AA 4QNJA 2QEXS 4WFAQ 1YG0A 1REGX 4JI6I 4FPRA 3OTOJ 3QFWA 1UDQA 3BEGB 3A8IA 2QG9B 2F4VJ 4XTJA 5JEAA 4KH1B 1N36F 4GRSA 2ZJPQ 1FWLA 1VI7A 5THWA 1QDUB 3IRWP 5KFFA 4DWIA 1YIJS 1FTCA 1V3ZA 4LOMA 2R2UA 5CCMA 1WHYA 1XJWB 2HGLA 2ZZTA 2DKOB 4OHWA 4R0EA 1WF0A 2GIFA 2KYZA 4MIWA 4PQUB 3ZTSA 1IR2A 2XNRA 4I6AA 4FW5A 3KJFB 1TV6B 1FWKA 3D4JA 3PHEA 3PEHA 3N6NA 1CG2A 3DOKA 5F9NA 4GC6A 1H38A 1L3KA 1RTDB 2YNFA 3Q22A 1WG4A 3FQKA 1HI1A 1Q16B 2B3TB 2GC8A 3DKDA 4YB7A 3PZPA 1YJUA 4AM3A 2JLEA 4X2BA 4F4XA 4KQZA 2DGTA 1ZM2A 4MQYA 3RR8A 4DHVA 4DV0F 1XNRE 4J9SA 1JJCB 1S79A 3KHHA 4KH0B 3UE2A 4R8UA 4OL8A 4MU4A 4YHHE 1B0VA 4EBCA 3D0HE 1S1VB 3T5KA 3TVKA 3JB9k 1YJ9S 2CPZA 4WUBA 2J7WA 4NYPA 3PW7A 2V67A 3N28A 2HKJA 2KFYA 5K8PA 4WP8A 2AV5A 2QE5A 3OL8A 3R27A 4DUTA 3JAMY 3OTEA 3GCMA 2VG7A 1RA7A 4IFDB 5LOQA 2W9CA 2OMLA 2JJ4D 1HBMB 1TMMA 1DRZA 3MF5A 5KG3A 3VAKA 4X66J 2F40A 2K1RA 4XDDA 2NN6E 4NRUA 1O51A 3NGKA 2I8EA 3F56A 2HWTA 2GHVC 1B0TA 4J9RA 3ILOA 1FTRA 2DISA 1I6JA 3RBXA 4JI8E 1KTVA 1VIXA 3HXMA 2H9ZA 2O1VA 1FNOA 1XMQE 3K5PA 4HVZA 2HRTA 3G2XA 5HMXA 4DFMA 2W2NP 1VIOA 4FWDA 2O1UA 1GH8A 1HNVA 2VPZB 4WXOA 1JJ4A 2VJVA 4RPFA 1IBMI 2B4OA 1S6OA 1XWLA 4PG7A 4WYWA 5HROA 1T3NA 4KGZB 4QW8A 3MMAA 2Z5CA 4LSZB 2NYIA 1RSCA 4FYYB 3TJ9A 2BR0A 1TQLA 4JYAE 1U8WA 3I0RA 3T1HE 3L7ZB 4YP3A 4C8KA 1WDTA 1VQLS 3ITHA 1WACA 1F0XA 1HR0F 1UVKA 3FBCA 4DX6A 4A4JA 1HNIA 2BDPA 3CCTA 3M9MB 1HHTP 1RTHB 1VC5A 1KNZA 1NSKL 3K8WA 4LF9E 4DV6J 3I9ZA 2B9XA 3P96A 2B5JB 2X1FA 1XHKA 2HQDA 5IQ6A 4DR1J 2QL9B 4OJHA 3H40A 4M94A 3MEGA 3HD1A 1UEKA 2HHHF 1REVB 4JI2I 2JE6A 5DG7A 5DGAA 2XULA 2BUNA 2IJRA 2E9RX 3OR2A 4DMZA 4OHXA 1HNZF 3O6QA 4YUDA 5J1NA 7FD1A 5ETKA 1VK3A 4F4YA 5KOWA 5F8JA 2AW0A 2FD2A 1X31C 2PGCA 4F4AA 4TNOA 1VQ6S 5DQGA 4WUCA 5FD1A 4YB6A 4B3SI 1R43A 4Y2CA 2RS8A 5D4LA 4IH7A 1YBTA 1NK8A 2K3IA 5ETLA 5K8OA 2NN6B 2PO2B 4WBFA 4LRFA 1KHVA 3I6PA 4JI7E 1IKWB 3DGPB 4OYWA 2FJWA 4QWAA 2IAJB 5KG4A 5JVHQ 3CULA 1T05A 2XWXA 2GAGC 1GEHA 3DNCA 3RAXA 3GV5B 2RQKA 1HQ2A 2DGQA 2QGFB 2KHCA 1VYAA 4ETXA 1BKNA 1X5PA 4OX9E 1TL3B 3IO1A 2BEFA 2PI4A 4DU7A 2JC0A 4DQRA 1TZ0A 4CLPA 1TL1A 2CDQA 1E6VA 2MZQA 2RIJA 1NZ8A 5CQGA 2XY5A 1FD8A 1B0PA 1WOOA 3E3XA 2VQFI 4RW9A 4B3MI 3DYAB 4CLYA 2VH7A 3QT5A 3HK2A 1RTJB 2RF2B 2KZZA 2IESA 3QAUA 3L7PA 4Q2LA 2NPIA 3IWLA 1S9FA 3CGIA 4DR6J 4LRAA 1FX4A 4Y65A 1JXEA 2OPPB 2EKNA 1NHHA 3LTOA 3MOZA 1IN0A 3UD4P 5DROA 4NI2A 1M1HA 4DR3E 1ZZNA 4URSA 1LXJA 1F5BA 1AZSB 1N0VC 4Q44A 4OYAA 2DGWA 3Q2TC 2UXCI 1R0BG 3H1CA 3PW4A 3D0GE 2E7WA 4MH8A 3M7ND 4ED2A 5H9EK 3QGGA 4B3TF 1U1MA 1OSCA 1HMVB 1N5VA 2RU9A 1HNXE 1VHIA 1YBUA 1EETA 3CMQA 1QUVA 3NGRA 4ZVTB 2C2ZB 1ZXNA 2AJ1A 2VD3A 2C37A 4DR5F 1PIEA 4IDKB 5CZVA 3DDNA 5BYQA 2QL5B 2GO8A 4ZLLA 1UZDA 4Y3CA 1O5JA 3L95X 2EFVA 1Z5BA 2QMWA 2EFOA 1K47A 3IP0A 4G6VB 1QTNB 3HHKA 4TY8A 2DB1A 4KHMA 4WU2A 2ZBCA 3TUIC 2JEGA 1W7WA 3BGOP 3OFHA 3TQEA 2RS2A 2F63A 3NCQA 2BA0D 2XM3A 2BX6A 2LDIA 2AMCB 4O4RA 1XNRF 4OHYA 2DGVA 3IC1A 3R7SB 2MPUA 3WIVA 1QE1B 3QT6A 4YHHF 4DV7J 1S1WB 3R3TA 4V19J 3N5BA 2CQ3A 1KQSR 4K4SA 3B78A 1DLOB 3K57A 1KS2A 4RWWA 1I94E 1NKEA 1UFLA 1BHNA 3J81Q 4B3RE 2J76E 4FNHA 4MK7A 1TL4A 1CJUB 4B9TA 3UD3P 1X7VA 3I5AA 4LF8I 1FFWB 3SSRA 1HKAA 5KG5A 2HAIA 4ES1A 2Q79A 2IERA 1Y5NB 3HSJA 1M5PC 1U1QA 4F3MA 4X65I 3RB0A 1WC0A 3V4IA 3VAIA 2NN6F 4G65A 2Z5EA 4D3HA 1RWPB 2YKOA 3NCRA 4IUFA 4N77A 4MKYA 3FEZA 3OTOE 4F4WA 1OPZA 2K06A 5EHHA 5D8HB 4NLWA 2GW8A 1XNQI 2F4VE 2DGUA 4JI8F 4CH1A 2X7IA 4GVBB 1KOOA 3MR3A 1XMQF 5E5NA 2A18A 3Q86A 3SMZA 4ZOSA 4K0KE 4P6QA 1UPPA 3OTDA 1C0UB 2M2BA 4IZJB 1T9YA 4ECUA 2XGQA 3MAHA 3VAFA 3L7OA 2IOPA 3DM2A 2NXEA 1YBAA 1NJYA 4P9SA 1QAIA 1JLAB 1X4EA 4CTAB 4NLSA 3BKTA 1S48A 1S0OA 1RZMA 5J2PB 4TY9A 4JYAF 3U27A 2GAHC 3T1HF 4X4RA 2UXDI 1LWEB 2C28A 3QIPA 3FSYA 2CQ4A 4BA1A 4PG8A 3BN7A 3R2DJ 2XWYA 1KBRA 1ZXMA 1PAUB 3T5LA 3F44A 1FJ7A 5DDPC 4LF9F 2XMKA 4L74A 1MW7A 3DGVA 3SI8A 1UW9A 1WNEA 5HLFA 1RTIB 5KG2A 3Q1QA 4KIAA 4NCGA 2Q43A 1S57A 2KT3A 3CO0P 4WIIA 4IOAQ 3UVJA 2MMYA 2ATLA 4TYBA 3AB2B 2BA1G 3HSDA 2HWHA 1QM9A 4KGKA 4B9NA 1N34I 4ETZA 2WBRA 4DV1J 1EQMA 5HK4A 4M5JA 4P7VA 3MXHP 3N6LA 2HHTA 4QIVA 3CDJA 4OI3A 2CPJA 2HVHA 2AYEA 2YKPA 1CULB 5C24A 3J7AG 2UUAF 4HT5A 4LJMA 2OEJA 3HLUA 4CLLA 2BM0A 3I0SA 4CM2A 4ED0A 1G7CB 3F0NA 3QZ7A 3QPIA 1S97A 5BYSA 4DUYJ 1J5EI 1YLXA 3C16B 2KFNA 4DR4J 4AIDA 4JI7F 2Q6CA 2QZ8A 1NUEA 4Q43A 3M6VA 3QIDA 2ZJRQ 3KLEB 2CWXA 3BSAA 3PACA 3W60A 3CJQA 1FCAA 2E1PA 2LA4A 3AQPA 4Q0BB 3MR6A 4DV2E 1LWXA 2LQ5A 4ZPVR 2ZM6J 3GIIA 3TEGA 2IBOA 3H25A 4OX9F 4CT8A 1LNQA 2N7YA 3BH6B 1QVFR 4J9LA 1FXRA 4AT1B 2KT5A 4P10A 3NP5A 2XGPA 4MFBA 4AQYJ 4PR6A 4J9QA 2DH8A 2ASDA 3KRNA 3NWRA 3P5BP 1HBNA 3AODA 4JOUA 5FLXU 2I9SA 2JFKA 3BO4A 1AXQA 4Q8FA 5A8KB 4ANEA 3OVSA 1IJEB 3NKYA 2GIRA 4EI2A 2DHHA 3A4TA 3C6TB 1Z0GA 4LSNB 2H65B 3I4HX 3VHQA 3OL9A 5KG1A 2ZH2A 2NSCA 3K17A 5E3AA 2DPJA 3GFYA 3M05A 2E5GA 2Z2MA 3DDIA 4DV6E 1F9FA 4QJVA 2UUCI 4KV8B 2CVIA 2LVWA 2MKJA 1QTMA 2IRXA 4DR1E 4DR3F 1FK9A 1SC6A 5GAEU 1FRKA 2XY6A 4X64I 2AGPA 1H6KX 4OYOA 4RBUA 4WIQA 2W24A 2D9OA 1TU0B 3HJVA 3D6HB 3OTCA 1DTTA 4U3DA 2AJFE 4J3DA 1SJ4P 4FF4A 1KWMA 2MKKA 3GB0A 3KWMA 4ZLJA 2VFSA 1TK0A 5E2QA 3MMCA 1DJ0A 1Z0WA 5D0RA 1NJXA 5I42A 2DCLA 3P4UB 3ISNC 4CLSA 2PC6A 4RUHA 3SQGB 1ULRA 5CYQA 4C8NA 2D74B 1UKUA 1P42A 1WD6A 1PYSB 2VF3A 4P71A 4DFJA 1D8ZA 2V2ZA 4CLTA 4CYUA 2H3EB 3LW5C 5HJXA 3M6WA 1N36I 4OYIA 1H3DA 2H1YA 1CJTA 3N01A 3A3NB 3V4MA 3OJSA 2JEFA 3D2WA 1Y60A 3GU0A 2DNLA 2ACMA 1GXTA 4ED5A 2B9YA 1CJVB 2HIQA 3T41A 1FKAE 4DL3A 3CB4A 1C1BB 5MAOA 3MM5B 4IRKA 3HZEA 3QO9B 2ZBRA 1IUJA 2FJDB 5RUBA 3AJDA 3JAMU 3IG1A 1I94F 2VASA 1JLFB 2CQDA 4EEYA 2QA4G 5L1KA 1FKOB 8ATCB 5KG6A 3E51A 1HQUA 4G3IA 4J9PA 5DGBA 3FK4A 3RTVA 3TANA 2F9JA 5HMWA 4DV0I 2PMZD 1YHCA 5L46A 5HJYA 3EGZA 4ECWA 1MSWD 2OH2A 3A8JA 2KJVA 3HHDA 4HR2A 3U1LA 4DSLA 1RAHB 1NCLA 4IFVB 4KGMA 5CD4A 1FRXA 3M1VA 3OTOF 2EPIA 2F8EX 4FS1A 1RLCL 1HQEB 3GCWP 4ITSA 2VPYB 2MB0B 2E7XA 3PJ9A 1TL7B 3IBWA 1HARA 2PNMA 1BWVA 5KFLA 1GXLA 5F8IA 2BKPA 4DCOB 2W2QP 4K0KF 1JLEA 1MWYA 1UA1A 3CD0A 2J0XA 3ZFVA 3MUVP 4O3RA 1IBLJ 3M7VA 1N33J 5E3CA 3W9IA 2E66A 2WTFA 4N76A 2IMWP 3L7UA 1ZBTA 2ZKTA 1RHMB 3TW0A 4WTYA 2PE8A 3QRRA 2XCPA 4FYWB 4DPOA 3PRYA 4KFBB 4UY8T 3HKMA 3M2UB 3H4DA 1VCTA 4W98A 3FVYA 1NBEB 2HGNA 2E1AA 3FZ2A 3ONQA 4I3HA 4UOGA 2FVSA 3MD3A 2XB2D 3QSYB 3AB4B 1E3HA 3A1YG 4TQSA 1XC9A 4JUZA 2RB7A 2ZVIA 1F60B 3GYGA 3CCJS 3GJQB 5AXLA 3UDLA 1UWBB 2CIMA 3J7YU 2QSFA 1SJFA 1HI0P 3AXMA 4CZCA 5JVGQ 4GKKJ 2ZITA 4K4YA 1T3OA 3TA0A 2CJ9A 4AL5A 3W64A 3JYTB 4WE1A 2IM3A 5IWAF 1R31A 1UETA 4C8ZA 2R7VA 2QYGA 4F3OA 1HR0I 2XHWA 3OL6A 4AD6A 2V4JB 1JLCA 5LMNE 1JB0C 3E01B 4EFAC 2UUBF 3AJ2A 2HAFA 5H9EJ 1UL3A 1RHJB 1A0OB 4WUDA 3LH2S 3TZZA 2YNIA 2HHHI 1HNWE 4F50A 5CXTA 2FHJA 1U6BA 4RUBA 4ICLA 1U0SA 3GP9A 2HS0A 3PO5A 1HNZI 4M8LA 3THTA 2JSXA 2H51B 4NBQA 4WJBA 3D6FB 4DV2F 3FFIB 3W8GA 4AL6A 3TI0A 5KFSA 2K7KA 2AGOA 2IYGA 4PEOA 1JKHB 2GMJA 5A6PA 3GV8B 4LUBA 1M5OC 1U24A 1IQTA 2LMIA 4AL7A 4JI3E 3X3UA 2LEBA 1RAOA 4IG0B 1U02A 4FKYA 2IBKA 1HI8A 2ZKUA 4Y2IA 1DZ5A 1HLWA 2DNKA 4CLWA 5IT9C 3O5TB 5JUMA 5F8HA 3T1YF 2CADA 3ILIA 2FC9A 3HD2A 4OYPA 2R7UA 1K44A 2KJWA 2XMJA 1QD1A 2COLA 4GKJE 5LXYA 5A8WB 1T94A 4USVA 1WEXA 4B9SA 3GR1A 2DGXA 4LF5J 3M8QA 4MAKA 3UDVA 3GG1A 2RKIB 4CH7A 4J9UE 4I7FA 4WZMA 1MROA 2E5JA 2HSEB 5HP1B 3Q24A 2AE8A 3IRXB 2HHVA 1KVIA 3GMEA 3H4BA 3A13A 2X1AA 1UTAA 5C5JA 2GQCA 4ZPTR 4DV1E 1RAIB 1SUQB 4W4MA 3D66A 5L8RC 4DL4A 2A2CA 2W2OP 1ZAXA 2DXDA 1JXVA 2PA3A 1E6YA 4NMXA 3MCSA 3B4MA 4QIGA 4DF8A 2RSQA 2GGPB 3MR2A 3RBZA 4OO1B 2D1CA 1VBKA 1U1OA 2FHMA 1USUA 4LF6J 3NY0A 1VQMS 2XMAA 3IBCB 1CC7A 3T5HA 3WIUA 2HKEA 2PNZA 2HS3A 4DS4A 4YB5A 3JTNA 4DSJA 5GAEI 4PRFA 2V5HG 1NPRA 4B3TI 4RW8A 3Q8YA 1D9FA 5KFOA 4RBVA 2UUTA 3RW7A 4NEYA 1XMBA 1OYDA 3GV7B 4MU0A 1WF1A 2P9EA 1UPMB 2F8HA 2R8HA 1N5QA 4ZN3A 2JVRA 4DR5I 1Y11A 2VPWB 1LQ9A 4TN2A 2IRYA 4JI1E 3HHLC 3OBIA 1QZRA 4ER8A 2YWHA 2X51A 2QA2A 2ZWPA 1VFJA 4KC5A 3K5OA 3VGUA 9RUBA 4IFDD 1M5SA 5GVQA 3DLEA 4I2QA 2M5YA 2MQNA 1U6FA 4GVLA 3M8ZA 1N6QA 2M88A 1S4EA 2IYIA 5KOXA 3DC2A 1XNRI 1BLUA 1EB0A 4QZVB 2ZHBA 2M3DA 3VZIA 4KHPJ 3C19A 1Y5LB 2E5LJ 3SDEB 4CLFA 1J5OB 2ZVSA 3TA1A 5JEAC 4YHHI 4JI5J 5G0RA 4PXBA 1S49A 1TK8A 2JX2A 1KSPA 3MEEA 4LF7F 2EW9A 1CLFA 3QGPA 3NG8A 4DR2E 2XEXA 2Y3YA 3KLHB 5LMUJ 3NGSA 2MY7A 4L3NA 2H4YB 3QRQA 3GILA 2Z30B 1RT1A 4HDHA 5JEAE 3OTBA 1EHWA 1N32E 4NLRA 2G1DA 3LNUA 4LFAE 1Q8LA 3RBDA 4DV4E 3J80C 3OFGA 4P52A 2HNZB 5FWKA 3CD7A 1SJRA 4N47A 2NSBA 5KG7A 2ZOMA 1LWFA 3OLAA 1RKJA 4DFKA 4EO6A 4B3OA 2H48B 3MDFA 1NH8A 1F3FA 4F0KA 5A2QY 4QIWD 1RHUB 1LW2A 5IC4B 4CCHA 4ZVHA 2MQOA 4NXMI 3M32B 1EKRA 1P1TA 3M85D 1C0TB 3LPEA 1XMQI 1N52B 1XR7A 1ICEB 4USUA 5I3PA 2YKMB 4NOHA 1RWOB 4FS2A 3KUHA 2QC3A 3V6DB 1KR4A 4LF4E 2DIUA 2J7UA 8RUCA 2YXLA 1H2UX 2VDHA 3WQPA 2WVEA 1CEZA 4QWCA 3TUZC 2HMIB 3EVWA 2OPSB 5DJBA 3DDKA 1YDLA 5EN1A 3BN4A 3GZ7A 1Q81T 1LWCB 4TKTA 5C0XB 3R7NB 3QFHA 3O8WA 4JYAI 3SIPB 2NUUG 4Q45A 4JI0J 2CQIA 1S76D 1RT5A 1JLGB 2HHWA 1HYSB 4N7TA 3M30B 4ID5B 4KTQA 2GHWA 1VISA 2HURA 2DXFA 1UDNA 3R5JB 3BB5A 5LMNF 3MZIA 4UUXA 4OO1F 1PJ5A 2HZAA 1NAQA 3OUYA 1FJGI 1YK9A 4ZCLA 5D0HA 1V5VA 4ZVFA 3PYDA 3RYLA 2VG5B 3ZO7A 1TKZA 3I4PA 5JJBA 1HNWF 1DBDA 5T7LA 3HKZD 3AAWB 3J7ZT 5B0FA 2EI5A 1R8PA 3Q8VA 1Y4UA 2Z5BA 3FNNA 5T41A 5HVGA 3J7YI 3PX0A 1SQEA 3ZM7A 1F5CA 2HVZA 4TLRA 4RZRA 5KFUA 2UUAI 4A8YA 4UTGA 1VR6A 1S10A 4WFXA 2BJ3A 3H90A 2HHUA 2OP5A 1FRHA 3PJWA 1B64A 4R1FA 2YNHB 2WB4A 3H2LA 3US5A 4CT9A 4PU9A 3RRKA 3GYXB 4YR0A 4JI3F 4KHRA 3GMGA 1YJRA 3CJSA 5IFMA 2UVRA 3AOCA 1T7PA 4JI6J 1IM4A 4WFYA 1ZPWX 3CCSS 3MM6A 1Q7LB 2V8DA 2WZ1A 1Q1KA 4KBIA 1YJNS 3IR7B 2C3UA 2YNFB 4GKJF 2GVZA 2XO6A 3RAMA 1SJQA 1IKYA 4DN0A 1Q95G 1RT3A 4A8KA 3W2WA 3HVWA 2NPFA 3P3DA 3BO3A 4U9RA 3UQSA 4KKOA 4P72A 1TUVA 2E9TA 4R8UB 1IQZA 2WNRA 4GKKE 3PEJA 2O67A 4DV1F 4XPCA 2H4WB 5IC6B 2NYHA 9ATCB 2N3OA 3R5DA 1AB8A 1ZM4A 4HHJA 3QBCA 3L9ZA 2Z57B 1EARA 4Q5VA 3G6YA 3NMRA 2B9WA 1TFWA 2HBYB 2MQQA 1I51B 2PFDA 3NWGA 5SZTA 4OZLA 4FBUA 4KJIA 5CD4H 4U7CA 4DR3I 2VG7B 3DXBA 2DRAA 4O3SA 3PR4A 4DR7E 1X5TA 1R0AA 2W9BA 2W9CB 1YITS 3BO2A 1WHXA 2ZD1B 1HW9A 1GTEA 4GC7A 4FXWA 3RR7A 2J5AA 5DO2A 1WOSA 3FBFA 4I64A 2R8KA 2M0GB 2QRRA 2R7RA 2AEFA 5E0OA 2JEJA 3FMBA 4I2PA 2QV6A 2HHPA 1I3OB 1VRQC 1Q86T 4AIMA 4UT4A 4ELVA 2OO4A 2D7SA 5CYMA 3R5CA 4USWA 2J6UA 2YBVA 4Y2KA 2FDNA 1TKTB 4G1QB 3WZ0A 1VLYA 4HH0A 2KB2A 3UCUP 4R0JA 2B51A 4YR2A 5LXRA 3OV7A 4JI1F 3G82A 4NLTA 4LBHA 3H59A 4RR5A 2EVZA 1IBKE 3M6UA 4ZJQA 4ZPAA 2DD8S 2IVYA 4IYQA 1AYEA 1FJCA 1O6XA 2I5JA 3HVTA 5K36C 5HAOA 2G0IA 4KT0C 3E8OA 4LCGA 3SEOA 2Z5CB 3DU6A 4J9OA 2GV1A 4RW7A 4HTJA 3I0RB 4FW6A 2JHEA 3A3OB 3CO9A 2PSZA 4A8QA 2PO0A 1D6TA 2A6OA 3MEDB 5HQLA 2BJ1A 2C3PA 3IWNC 4NLXA 2M4MA 1F9EB 1IWGA 5D78A 3ITHB 2QX0A 1HNIB 2YX1A 5K36E 1LV5A 4I0WA 4LFBE 1XR6A 1X5SA 1H73A 3PKYA 1M90T 4IRDA 2H5EA 1IBMJ 3IWXA 1KQFB 4C9DA 3CT9A 1B3TA 1P9QC 1MU2A 4DR2F 2JZ5A 2J7KA 3AH6A 4IZJD 2W4DA 3OLBA 3KUEA 3C15A 3LALA 5GAGU 2V34A 3OR2B 4FNIA 4OLOA 1GMWA 1S7HA 5JEAF 3NAHA 2ZZNA 1N32F 4RNOA 4LFAF 1IBCB 4DV4F 3E2EA 5CCLA 1IKVA 3PX6A 4TU7A 5DDOC 4F2SA 1CSJA 2WONA 1M5KC 3HDSA 3NNHA 5AXNA 1VMBA 2EC2A 1FJEB 1TAQA 2MJUA 2C39A 4JI2J 4ZPBA 1S16A 5L3JA 1IJFB 2EFQA 1DTQA 2RE1A 3ZXWA 1K1QA 3PRVA 3CCUS 1XERA 2CPYA 3BV8A 2PN6A 4K0KI 4LF4F 1LXNA 3DFEA 1T05B 4C3MA 2WB1D 3QT8A 1HPZA 4A48A 1RI7A 2IFXA 2UXBI 2DT9A 1SI9A 4B3SJ 3IR6B 3ZKDA 1OO0B 4P7AA 2Q2EB 4B9LA 4HDGA 4ZCKA 3ZZ0A 5AXKA 2FHOB 1E6VB 3AXKA 3KK3A 4AXIA 4OHZA 4EZ9A 4ZVGA 4FVCA 3HSZA 2V8PA 1U6ZA 3CMAS 5H9FJ 1KKHA 4FW4A 2OIHA 3MM8B 1UA0A 1RWWB 4M5NA 4K4TA 2FVPA 4EWTA 4C3KA 4PXCA 1X0FA 4DPXA 2IC3B 1FF2A 4U8VA 2HFZA 3A12A 5CH7B 4MTPA 2Z2YB 4PQUA 1TV6A 3KHRA 4NI2B 5DQHA 1Q8BA 4O44A 5K14B 5EDWA 4PQAA 3K5LA 1BQNA 2GA7A 4PRVA 1K73T 4K5RA 4OV1A 5LMUE 3KG1A 1YSJA 2VQFJ 4B3MJ 4CM0A 2FHKA 5IWAI 4QNKA 2WOMB 4NASA 1S12A 2HHSA 3ENWA 4G1PA 2HVDA 5KFGA 3H2UB 2UUBI 3O3LA 1EETB 3K85A 1B63A 3J7A1 1AFJA 1YRUA 2V0NA 1RHKB 3PS1A 2C37B 2VUGA 1OWXA 1S1VA 2GIQA 4OKGA 3D6MB 5E41A 4PG6A 2XHCA 1U26A 1NJWA 4MYTA 3D0IE 2UXCJ 4I6WA 1Y4SA 1B7FA 4LFCE 1N4LA 5KFTA 4KR0B 1IWAA 3DI6A 4DV2I 5IT9U 4UOHA 1H2VZ 2A2DA 4H4OA 1BGXT 3NMAA 4ELTA 3PS3A 4IFDA 4TY8B 3KMSA 1ZM9A 2DHGA 4ID8A 4NE9C 2BJ8A 1HBMA 4MU3A 2BANB 2P5VA 1PSDA 2FLOA 4FYVB 1S6UA 5DG9A 4ISAA 4QWDA 2FY8A 3FMWA 1XN9A 3D3CJ 3S8SA 3ZTRA 4PABA 2O5DA 2OSRA 2HK3A 4ZVUB 3T1YI 2RDIA 1E3PA 5GMKa 1SKSA 1OMSA 2CJBA 1WC4A 1RDRA 3SBMA 1K8AT 2DY1A 2DXEA 2LQ9A 5B0GA 3TVZA 4C8OA 4M95A 2NR0A 1UVIA 1UDOA 2IHR1 1EP4A 1Z0CA 3MPWA 3MPVA 2PA8D 3W62A 1NSPA 4DR7F 5BR8I 3IGVA 2HQCA 1BQMA 4MYUA 1NK7A 4O3OA 4CP5A 3V4IB 3L7ZA 2HVIA 4DV5F 1RBLA 1GQEA 1K0TA 4CNYA 3NEKA 1T02A 1K1SA 2IPOB 3W9HA 5HQ8A 2EXUA 1MX0A 2VFVA 4NXNF 1XMOE 5B0DA 1SB6A 2B5JA 2JT2A 2HZCA 1R27B 2WAQD 3SQOP 3P5TL 4LF8J 2BOAA 3KDNA 3EXYA 3PYFA 4JV5I 1RACB 3DMJB 3ETOA 4ECRA 1REVA 2E1MC 2V2KA 3C3LA 1IBKF 5B7WA 2YQ1A 2Q6BA 3SCIE 4FBTA 3CDWA 4X65J 2P2CB 5AE2A 3D9BA 4F04B 2RRNA 2UU9E 2C1EB 2QFJA 3IBFB 4EO8A 1D9AA 4JI6E 2DEIA 2LXUA 2ZH1A 1RT2A 4RW4A 4LCHA 4X4NA 3M9OB 4FXVA 1NHVA 1OYEA 1LW0B 1XNQJ 1O0PA 4JI4E 2HLUA 2OMOA 3PX4A 4BA1B 2Z2ZA 4FW9A 1TUGB 3BH7B 3Q83A 3I9V9 4HI1A 4AUKA 2W25A 2IJFA 4ED4A 4OJ3A 4LFBF 3PIOQ 1NHIA 2CFXA 2L9NA 3DGPA 5LSLA 1Q8IA 3HT3A 5L1LA 2GHPA 5HLFB 5DLGA 3GFXA 1NSQA 1WG1A 2ZH7A 3ELHA 2YQ0A 5F8MA 3OL7A 2NZ4A 5CABA 4ECTA 1WKJA 1NKBA 2N4CA 1T9VA 5CHCB 2UXDJ 5KFAA 2W8LA 3AA9A 1TL3A 4K2JA 2C2DA 1GFWB 3SV4A 4MMOA 2VQEE 5C24B 3HZGA 1M5HA 1OY8A 1G6BA 3RB6A 1ZS6A 3I0SB 1KC8T 2DNQA 2NQPA 4F4ZA 3DLKA 4LF7I 3KJQB 4M5IA 5D4OA 4MKAA 1RTJA 1UZHA 3C66A 3R5GA 4WZQA 1N34J 1HD0A 4O23A 5J2QA 3U1MA 3TAMB 3J81Y 5J1EB 5I3UB 4I67A 2OPPA 3G8TA 5IZHA 2MGZA 2FUG9 4ECYA 1FNMA 1Y7PA 1BE4A 3HF5A 1HBOB 3DRRA 1UW4A 5DM6Q 3ZZPA 4X4SA 2R2RA 2MHEA 1F1BB 4LR7A 4LIRA 1FVSA 3QRPA 2DNPA 3MPUB 1FEEA 1T9UA 1RWNB 1U47A 1J5EJ 2QTWA 2CG8A 5B0EA 2DBBA 4J5OA 4CIOA 2CPHA 4DEZA 2OD6A 4TU8A 4RU2A 1VGYA 1GMUA 3CJ5A 3PIPQ 3HX9A 3G4SS 5AJ3F 4J91A 3DLJA 4H4MA 4N56A 2ZDOA 1B7YB 2WVDA 5L39A 1HWLA 4KPYA 2O3ZA 4ZVRB 2XY7A 2XTJP 3D67A 2RVJA 3GIJA 4PAAA 1N5SA 3NOCA 3DLBA 4F7VA 2UUWA 4I1TA 1IBME 1WC6A 1VOMA 4RNHA 1FK9B 2GJFA 1T9WA 4I6YA 4IFYA 2NXJA 4XO0A 4DLEA 4USHA 1MG7A 5F9LA 3DU5A 3H4LA 2DPIA 3LP0A 4EZ6A 3BBBA 3V81A 3MMCB 4USKA 3TZYA 5LMNI 2VC1A 4AE5A 2NXCA 5E7OB 4QWBA 1Q5YA 1HIYA 1Y5IB 4NA3A 1FFGB 4U96A 1AROP 2UUCJ 2CQ0A 1HNWI 3MAQA 3CF5Q 4X62E 4X64J 4KY3A 5CYQB 2POKA 4LFCF 4DPTA 1CJUA 3OXLA 3BM7A 3OJUA 4CYUB 4ZN1A 4ERDA 1RU1A 4L75A 2PMWA 5FLXY 1CJTB 5AT1B 4OI6A 4R5PA 4KE5A 4DXLA 3DRSB 2NS1B 2FPHX 1NK4A 4WKRA 1ZTTA 4B3SE 2C2OB 4JI3I 1F6TA 3BGRB 2G0JA 1D0EA 2AF6A 2HIYA 2KYXA 3FSIA 2OPQA 4LR9A 5C7PA 1H2TZ 2QLJB 1R6VA 3HT0A 2W7OA 1JXLA 4OO1D 3NNAA 3PVXA 3TARA 3VCDA 3M8RA 5D6GA 4WFNQ 2DR9A 1N36J 1NSAA 3IG1B 1PBAA 4GKJI 1UFWA 1FA0A 5EKWA 2Q3PA 5F41A 2MLZA 1W2BR 2JEIA 5EWGA 3CUNA 3ETMA 3UWTA 2HFNA 4C48A 4LRCA 1HQUB 1JWWA 3LP1A 2X36A 3DD6A 1JLAA 2XMTA 1OQ6A 3QGIA 2L41A 4C8MA 4CTAA 1FD2A 3BQ0A 3L4BC 2CQHA 4OZ0A 1CJKA 2MZRA 2KH9A 4L76A 3Q8SB 2BZ2A 2VQFE 4HTIA 4DL7A 2RILA 4J9MA 2XI3A 3H5SA 1OIAA 1ZA2B 3EMTA 5CZXA 1XMOF 3ZTOA 2ZBKB 5F0UA 4A8WA 2YPZA 2GMLA 4BS2A 1RTIA 4B08A 3GONA 1S1UA 1WC5A 1Z0TA 1JLEB 4DV0J 4P2FA 3OXGA 4A8FA 3NZKA 2UU9F 2OTJS 4X4TA 4ELUA 3ZKBA 3TJAA 1QAJA 1NM2A 3CIMA 4O3NA 2R7TA 5DDRC 2BQUA 1N54B 3DXSX 4YY3E 4ZVEA 4U67Q 4JI4F 1N48A 2QT7A 4LQ3A 5KT2A 2N7CA 2LU1A 5ETSA 3UNYA 3VQTA 2AEMA 1HW8A 1N5YB 3OHAA 3VGTA 2ROEA 4JI1I 3MR7A 4PZVA 1ZA1B 3ET6B 3DLGA 2BJDA 2PEBA 3GQCA 1JLQB 2YVSA 3MI7X 3CPWR 3KLEA 4F67A 3KG4A 2WK4A 3M4XA 1UDSA 2HFOA 4FYDA 2QA4S 1KRPA 4OZNA 3N6MA 3NBPA 4NLYA 2YWFA 2C3YA 4ILLA 4QU6A 3LUYA 2KHDA 4J9KA 4U95A 1Z2ZA 2Q1LA 1FDAA 5DQIA 3TZWA 2RAQA 2HW3A 1RT7A 6FDRA 2VQEF 1JLCB 1FXDA 5A8KA 3PNIA 3CJ2A 4L72B 3O44A 1SH0A 1SH3A 4OIXA 1RA6A 4PXDA 1WEYA 2YNIB 4DR2I 3C6TA 1MWQA 2FJXA 4JB8B 4E0DA 3KNAA 3ENQA 5EX0A 4MIAA 2ZH4A 3W1YC 1U45A 3QWUA 4M5LA 1N32I 3GJSB 3JSMA 4LFAI 4DCPB 4DV4I 1HR0J 2CG9A 2HNDA 1FKPA 5C0XD 3CTRA 1JQGA 5IM0B 3OR1A 1JJ2R 3MECB 1M5VC 5D3GA 3Q23A 2XLIA 2A1BA 5KG0A 3KG0A 4PCQA 4X65E 2M70A 1RQ0A 2HHHJ 3EGVA 2VG6B 2FY1A 3PHTA 4RJVA 4OYMA 2MTLA 2ASLA 2YX7A 1S9GB 3H20A 2QA1A 3CE8A 1VBZA 1XNQE 1HNZJ 1SKUB 4BC9A 3V6KA 1T03B 4LF4I 2YH1A 3CDBA 3HFVA 4XPEA 1LFPA 1GNKA 1SXLA 3W5XA 4PG4A 2CQ1A 2VFTA 3T6JA 2I0XA 1CS4B 2IDLA 1FDDA 2V4QA 4P7TA 2P8IA 3UPFA 4I7FB 4Y28C 1MROB 4QQBA 2HQFA 2YKQA 4FPIA 4RKUC 3AFGA 2AYGA 3IS9B 3JQKA 3K59A 3LQVA 3T6BA 4NLVA 4MKBA 2UXDE 2CJXB 2HEKA 2OD4A 1V5IB 2G4BA 3QLHA 2W2MP 3GYNA 4DUZE 1F5AA 1T8EA 2VESA 3KK1A 1HBUA 2EFNA 2ADCA 3AD7C 2LEPA 3KOAA 3ILLA 4F8RA 1V6HA 1KD1T 5DZ7A 2D3OR 3TVYA 2C2MB 2R42A 5E33A 4X62F 3TX0A 2WVBA 2ZUAA 2XCAA 2K8GA 2HFUA 3UNGC 3CJKA 5CA5A 5GAHU 4WXWA 3R1HA 1N34E 4LCFA 1ZAVA 4OZJA 2ERRA 4DQQA 4DJBA 1U4BA 3W9JA 4RW8B 3T19A 4QR2A 5ADZA 2ZDPA 5L1JA 5K36A 2M7SA 2DNYA 1Z0BA 2JL9A 4IFVA 2UVUA 1RBAA 4LPFA 2RMLA 3G87A 1FEHA 5KFIA 3RB4A 3T3FA 4X4OA 2KXNB 2MDAA 3CD5A 5D0GA 3BBCA 1OSDA 1VRUA 2WP8A 1APSA 2BE9B 3S7RA 1C4CA 2QLFB 2DR8A 1Z4UA 5HMYA 4HACA 4B3TJ 2V8GA 1S6PB 3SCLE 3DLEB 4I2QB 5DRPA 3Q6NA 3QSIA 2HWIA 2VKZG 2Z58B 4DPYA 1X4HA 4EBEA 1RADB 4NA1A 4GQUA 2WBMA 4DR5J 2F4FA 3UHMA 3NGUA 3G71S 4KFBA 1S5ZA 1EA6A 1WTBA 1L3UA 3H2VE 5G0RB 1T0TV 2MXYA 2VQFF 4ENOA 3CSKA 4U6PA 4DV3I 4NLOA 3DCAA 1YWXA 5GADU 4X84A 3FUYA 5IXUA 3PFOA 2V69A 1FRLA 4DFPA 1NPPA 1S6QA 4UQTA 3TAPA 1SL0A 1BWEA 2AZ1A 2DY9A 3HO1A 2AP6A 1P6TA 1WF2A 1SC4B 2CAJA 1RT1B 1UWBA 2MQMA 3HULA 1KONA 1XNRJ 4ZP7A 4DR7I 2OI2A 3KLIA 2KT2A 4BWJA 2CZ9A 1U7LA 2FGCA 3JSRA 1BQXA 5A0YA 1LWFB 1JK9B 5A8RB 4YHHJ 5DRQA 1R7IA 1PJ6A 5J2NB 4DV5I 1Y10A 4EGLA 3JYTA 4B3OB 2DNOA 2FIUA 4YY3F 4ED6A 5KFBA 1LW2B 1N88A 4NXNI 4LBPA 1Q0NA 2LYVA 3CMES 1YGYA 3P3GA 1VC6A 4TLQA 3PYEA 3G6XA 4Z2XA 2KRRA 3HSGA 3UW1A 8AT1B 5ELWA 4RUAA 2CRLA 5D0EA 4Z7YA 2ZH6A 1IBKI 4LVNP 2CQGA 2XO7A 3H98A 3R5BA 4USMA 1FFSB 2HRUA 2OEKA 2DH9A 3BJYA 1SC1B 2X1GA 2ZOFA 4KYZA 5D4PA 5KT4A 2FLNA 2W1BA 1Q79A 4MT1A 4Q8EA 1UMJA 4ZLNA 5EWEA 2J9DA 3FSXA 4NXMJ 3LP2B 1N36E 3FZBA 1RT5B 2D41A 2D3O1 3DOMB 2J9EA 1XMQJ 2XC9A 2L08A 4F25A 4O0IA 1UAWA 5LSRA 4LFBI 1R8BA 3NRBA 1MWZA 4M5GA 5KFPA 4IG0A 2LP4A 4HHHA 3GIRA 4FXDA 3MMBA 3OUYB 2VBYA 3LO3A 4C98A 3TUPA 3J81U 4I69A 2BBEA 4V1Ak 5T7LB 2X3DA 5FDLA 4DL6A 1WHVA 3TP2A 2PDAA 2BOPA 4JYAJ 4ANCA 2Z5BB 1Q78A 3AHPA 2L9WA 1JNZB 5IV3A 3CIZA 5H1SV 4B9MA 2NZCA 3H42A 4ZVOB 3EX7B 5HP1A 2OSQA 1Y9OA 4U8YA 3IRXA 4C11B 1FJGJ 3TQ1A 4U7UD 3KUGA 2KM8C 4NYZA 5A2QQ 4QCLA 1VQOS 3JQJA 4PWDA 2XYGB 2VC0A 4I68A 1PKUA 2BRLA 1RWUA 4Y00A 3D28A 1VQSA 5D15A 4IOCQ 1UEUA 5K8NA 2XLJA 1XIQA 1NK0A 2GGPA 1YJVA 3MM6B 1QVGR 2AT1B 1BUXA 1D8YA 2UUAJ 2F1FA 2GZOA 2XNQA 3RZAA 2YY3A 2GVZB 4KAIA 5K20B 1TL5A 2G13A 3MAAA 2G2YA 1TKXA 3NS7B 4RWXA 1X4BA 2G0CA 1IKXA 4ZP6A 3W2WB 4X66E 4IZKA 4P2XA 4KKOB 1KN6A 2F1DA 2I6WA 1ZAWA 2BKOA 1F2HA 3NS5A 3CCQS 2MJNA 1S77D 1PO6A 2WNRB 3KXDA 2KL8A 4PUOB 4TVAB 4DUZF 3KFWX 2Y1LB 2KXHA 4P74A 1P9YA 4RW6A 1NMEB 2BW7A 2BQ3A 1LFWA 1PBUA 1WC3A 4IOBA 1Y3JA 2XQCA 1FHTA 3EDQB 1X9SA 1S7IA 1NK5A 3GPAA 4CO2A 1R0AB 1NDLA 2W9BB 5HMZA 3P06A 1FXLA 2BV3A 3IM9A 4CO4A 4NA2A 2R9LA 4MKVA 2BR2B 4FN5A 5C2CA 2DNRA 3RAQA 2RHSB 4I2PB 2E1RA 2Y9HA 2DHXA 3MFHA 3K1JA 4BDPA 5K8MA 5IT0A 1JLBA 1FERA 1X60A 5CYMB 3ICLA 5D77A 3VTIA 3HCXA 2XS5A 2PO1A 1VQPS 3C6UA 4ZCIA 1FE0A 3M8WA 4DR3J 2PO4A 1YVFA 3G96A 3G82B 2HHHE 4UZBA 2CQ2A 2OAUA 4CRJA 3R7BB 4GO7X 3BKUA 2FTRA 4LFCI 4KO0B 3C14B 4EBDA 5KTQA 2WSCC 3G6ES 4ED7A 1RCXB 1ZZFA 5KT6A 1HNZE 3OSPA 2B0GA 2CA9A 1HNXF 3DLLQ 3HPOA 2HNZA 1CPZA 1U1NA 2WSFC 3WC2A 5GAHI 3J81j 4MJKA 3MUTP 4YB1P 3TJ8A 4QIEA 1PYOB 4LVOP 3MPYA 2JWNA 3PDNA 3AT1B 3JS9A 4DL5A 2Y1RI 1FWPA 1BXNA 3M2RA 5ETVA 4K8RA 1UJ4A 1WDDA 1S4FA 4KSEB 4ECVA 4OFZA 2ABYA 1C0TA 4ES2A 1RE1B 5D4NA 5LL6d 1MU2B 5GMDA 2RQMA 3U02A 2AU0A 2CYYA 2E5IA 2EK6A 3C15B 1RWVB 3MR5A 1AFIA 1NU4A 4M1KA 3QJLA 1SL1A 3SSQA 3CEDA 3HHNB 4KPCA 3IAM9 5KFDA 1A7GE 1QSLA 1P8GA 2WONB 5C0XA 3MEKA 2XS2A 3EM1A 2D3ZA 2ILYA 4R25A 1BMQB 1JLGA 3OFEA 4IFDC 2ROPA 3MM7A 3WX8A 3M30A 4ID5A 1HHSA 3PW0A 4NMLA 2XSJB 4Q7AA 2C39B 5LL6R 4DX5A 4PPZA 1XMOI 4LSLA 4B3RF 4K50A 2R7SA 3T9ZA 4LF1A 5M2UA 2MKIA 4IFDE 4DR6E 2VG5A 4OZ1A 4DBQA 5GADI 2B8PA 4CH0S 1HPZB 2L48A 4F2RA 1H7XA 5L9XA 3CDAA 3SSSA 1TVRB 5F8NA 2UU9I 4ZK7M 4YMEA 3IGNA 2QJ3A 4NZ7A 3THPA 3EVMA 3M8PA 4OI4A 3MPDA 3KK3B 2F4VF 4JI4I 1FE4A 3GR0A 4B3TE 3T9NA 2FC8A 3B6BA 2CUYA 2LKZA 4KGVB 2R8GA 3MM9A 2B43A 1QJHA 3KJVA 2YNHA 4K0KJ 5E3QA 1H7SA 2LDYA 2BM1A 2B6AA 3QWPA 2KDOA 2UXBJ 2ROGA 4DR5E 1NB2A 2DIVA 3S6EA 2HFVA 1U2CA 3MTJA 4O3QA 2UVVA 1HHQA 1WEZA 1S1TB 2YWWA 2CVEA 2DVIA 4O44B 3FQLA 1MU5A 1BQNB 3DOLB 4DSFA 1KLMB 1UVNA 3P6YC 2VQEI 2EFGA 3R97A 1KEKA 2RUGA 2HBRB 4OV6A 4J9VA 5FJ4A 4RX6A 2IA0A 4PWWA 4YOEA 5HSPA 2BKNA 5ITHA 1YZ6A 3JAMC 4DV7E 1PC4A 3C2PA 4CO1A 1SBRA 3CJ0A 4UQGA 2NN6C 2LXIA 5IWAJ 2VODA 2XYPB 5DDQC 3DI6B 2FLPA 2GJ2A 4H4OB 2XI2A 5F3ZA 3AD9C 1U8SA 1OJ4A 2ZD1A 1VQ8S 2LECA 2UUBJ 2BE2A 2QL7B 1EX8A 5B0BA 3CJ4A 2NLWA 4X66F 1L3VA 5E3PA 3QATA 5C42B 1Z5CA 3OFFA 5C25A 1RYRA 1S9EA 2LFVA 4NXME 1H0HB 1NB7A 4H54A 1TKTA 4G1QA 4DV2J 2J0QD 4LRDA 2JEBB 5GMEA 4PYAA 3NCPA 1D9DA 4DU8A 2MHNA 3Q2SC 3QQCD 4WTOB 4H4KA 5HBMB 3WBZA 4A8OA 3QJPA 4DN9A 3G8QA 1EP4B 3HJCA 2DGOA 1UEVA 1RK8A 5DNLA 2CNNB 5LJ5Y 3VQSA 1MNEA 3DRXA 2R8IA 1QLNA 1BQMB 4WF9Q 3G8SA 3BPSP 5HI7A 2P9CA 3RRGA 3T1YJ 4OJ1A 2KU7A 4P75A 3MEDA 4B9UA 3PRDA 4NLQA 2IA6A 4ZDNA 1X4FA 3HKWA 2F8MA 4ZP9A 3EXCX 4B9VA 2V8VA 2RDJA 1R6YA 4DV6F 2MQPA 1FJGE 1U0HA 1R8HA 2NXNA 2GX8A 4DR1F 1MMNA 5IT9Y 3VF0B 5H9FK 4X62I 4YDXA 3SXLA 5BR8J 1DHMA 4IH5A 2IM2A 1NK6A 4S0MA 5KFEA 1MN9A 3QT7A 1TKDA 2GO3A 1KLNA 2DH7A 2EG2A 2WRMA 4N8NA 1KFDA 2MQLA 3CCVS 2R7QA 3EPGA 3R6LB 4NCBA 2GQ0A 1RT2B 4RW4B 2DNHA 4MU1A 2EWHA 3W61A 4PRXA 1YJ7A 2DGSA 2FVRA 3SV3A 3K7RA 3UDEA 2UUAE 1S1XB 1NO8A 2RRAA 3N0VA 3BSOA 1NLKL 4JV5J 1WWHA 2IY5B 2VKRA 3D5MA 4LF2A 1H72C 1QY7A 3KHLA 3ZZRA 4DUYE 4DR4E 2C42A 3CDEA 5EX3A 5F8LA 4QBUA 4RLEA 2BJ7A 1TMJA 4WCEQ 2BQRA 3KTQA 3DN9A 3ZC4A 4Y2AA 1SV5B 4N3OA 4XDCA 2W7AA 2DNMA 2ZM6E 4ZPCA 2K2PA 2YWKA 2WSEC 3LPSA 4ZIWA 4Z7CA 4WPAA 4J9NA 4UOCA 5B0CA 4ZHRA 3V6JA 4C4WA 1N8RT 1FKAF 4AQYE 3VV2B 1G3OA 3GIKA 2DNGA 2L3MA 1LOUA 1YJWS 3BR9A 2DO4A 3ZZOA 1RWMB 4HXZA 3DLKB 2VZ9A 3MM8A 3IMQJ 1X4GA 3MCOA 4QW9A 3X1LB 4E8UA 3GCXP 2ZBPA 1YH8A 1VS3A 1RAGB 2IC3A 3OT9A 3GJRB 2C38A 5J2QB 4B02A 3B54A 4IFDF 4DR6F 3VAGA 4IS9A 3FRZA 1RXOB 1WSVA 3POTA 2RJZA 4HY1A 1C1CB 4ZVIA 4ED1A 2OLWA 2MGZB 5K14A 4ZIVA 3OVAA 3AY0A 4QU7A 3DRRB 3ZZZA 4A8MP 4OX7A 2HBQB 3EUNA 3MTKA 4Y34A 4LF7J 1GX6A 2MSSA 4YY3I 1GT8A 2WOMA 1R6MA 5IS2A 2V68A 1GXUA 1EIYB 4AFFA 3ILJA 3WX4A 3I5BA 1N0UA 1Y0HA 4C97A 3ULHA 2DCUB 1VC0A 1G2EA 1RAFB 1RT6B 3IN5A 4YFUA 4H4MB 4C7QA 5ETTA 1HWUA 3TAQA 2LJPA 3CXCR 2FHJD 3MOJB 4LREA 2P6SA 2B8QA 1RT4A 2VBWA 2VBXA 4FYXB 3M6XA 1RISA 5BYRA 1SQFA 2LLZA 2AJ0A 3PKMA 3NAIA 2BA9A 4CO5A 4X4QA 1PKPA 1JX4A 3BGUA 2KVIA 5KFXA 1L5UA 3J80Y 4JI8I 4IFYB 2WHOA 3PXGa 3G86A 4K4VA 2JOQA 1FO1A 5HQMA 2RRBA 1H7WA 4DSIA 4DL2A 2BANA 4K4ZA 1V3SA 3LP0B 1T9XA 3V81B 2ZOGA 3UN2A 2Y0SD 5KT3A 4URQU 4U7UK 2GS8A 3FDSA 5J2MA 1YZ7A 2PFFB 3BGFA 4K2XA 2B4PA 3KJNB 4HYKA 4DV7F 3EYZA 2AYMA 5B09A 3VGSA 3PV8A 1G4CA 1GK8A 1X9WA 3KLVA 2VA3A 4ECSA 1BY9A 3T1HI 4J90A 4NYOA 3TWZA 1WI6A 2YTCA 3I32A 3BF4A 3WDOA 1SKWA 2YNGB 2MSTA 2HNYA 4B17A 4NX9A 3HHLB 4IG3A 3GTYX 1O8BA 1XBWA 2BACA 2NN6D 5LMNJ 4LF9I 3MWBA 5KFNA 1H7UA 2CNLB 4WWSA 2KVQE 4R5PB 3U7JA 2MLXA 2NREA 4BA2A 4V19X 3GWCA 1HNWJ 3Q8PB 1VRTA 2CJKA 1SC3B 4NZ0A 5T14A 2VFRA 5KFVA 2C3OA 3DRPA 2OPQB 4NEZA 5L9NA 4NXMF 3JQMA 3OVBA 4EYIB 5DRKA 1X5OA 2PEHA 1RLDA 1EJ7L 2QN6B 3EWGA 3WC0A 3A8KA 1GTHA 3LWLA 1X4DA 5JEAB 3DMJA 1L3SA 1VDHA 3CCWA 2UXBE 1FI4A 4F0HA 3KLGA 4E98A 1IBLE 4RO0A 1N33E 3R1LA 3CVKA 2DITA 3I5CA 3LP1B 4JI3J 1CQNA 3GFHA 2BMBA 4JI7I 2GVDA 3ZNUA 2AZ3A 1M0SA 2XMWA 1LW0A 2KRBA 1U2RA 1CJKB 4QR1A 2LQ8A 4DUZI 1EAYC 3DOKB 1VQKS 1PAEX 4GKJJ 2V6AA 4OX9I 3KLFA 2N3LA 1KP6A 5DNXA 3K0JA 2G1HA 5KFQA 1NHJA 1FJGF 2DO0A 1VHFA 4C8YA 1GX5A 2B56A 1S1UB 1SPBP 4W92B 1ZETA 4DOZA 4M5MA 2V9WA 2APOA 3CJ8A 4RNNA 3W7BA 2CWKA 3CJRA 1S0VA 4DG1A 2BRKA 2V4RA 3W2VA 3LPYA 3GE9A 3GJTB 4DSKA 5IWAE 2DEJA 4ZLPA 1N5TA 5FLXQ 1PYTA 1XR5A 3BQ2A 2HGMA 2V2QA 1WOPA 1UVJA 1W25A 2B4VA 2UUBE 1ITPA 1Y3KA 4CO3A 2IM1A 3R6GB 1RAJA 2LEAA 1Y00A 2HQGA 2M8HA 4DUYF 3DLGB 4DR4F 1RBOB 3K58A 3QJJA 3ZZTA 3P49B 1HD1A 3FBEA 2EEYA 2K1RB 3TAMA 5J1EA 5I3UA 2P6TA 4QYZK 1OYSA 5M2RA 1USVA 1HNXI 3NBPB 2ZM6F 2OPRA 1HBOA 1TR0A 4IR9A 2AX1A 3CW2C 3HP6A 3LAKA 2O1PA 4MK8A 2M8DB 5EWFA 2HFSA 1RT7B 5AXMA 1ZTWA 4JV2A 4JI1J 1SL2A 4AQYF 4OZ2A 1X0PA 4Y0FA 3HVRA 3CC2S 3I96A 1HNVB 3TUJC 2UP1A 2IDEA 1RABB 3TO8A 3LWMA 2JEAA 2IVMA 3WHIA 5HROB 2J8SA 3T1YE 3MMAB 3UCGA 1B70B 3HHEA 4OQJA 3EZUA 5KFRA 3PO4A 1SIZA 3JSMB 2WW4A 3LAMA 4LF5E 3ISZA 2Y0BB 2HNDB 1FKPB 4ES3A 2W4CA 4DX8H 2ZZMA 3OR1B 5D3GB 5BR8E 3JXOA 1FRMA 2BABA 3UO0A 4NLUA 4HYMA 3MEGB 1RWXB 4DR2J 1I94I 5EUHA 3OQ2A 2JE6B 3Q89A 4B3RI 2VDIA 1FRIA 3RB3A 4N8OA 2AHOB 5SUHA 4WK3A 2ZWOA 3KK2A 1N32J 1F9HA 2GFFA 4LFAJ 3S1TA 2NUHA 3JAMQ 4DV4J 4O4GA 1V9OA 2CJAA 4M5DA 4C0BA 2N82B 1WUUA 2IRUA 4OX6A 2YKNA 4JV5E 4A47A 1RU2A 1K9MT 5B08A 4LF6E 3UR0A 1TK5A 4DSEA 3JTPA 4RL1A 1RR9A 2AQ4A 2E9ZA 4XIUA 2KG0A 3OTOI 2LQBA 1YRTA 3M2VA 4J37A 2RH3A 2F4VI 2JDJA 4FW3A 1YI2S 3EGWB 2MKHA 3DRSA 2JRSA 4LF4J 2MYFA 2QSWA 1XEZA 3WU6A 3SFGA 3QLHB 3BGRA 2ZE2A 1M1KT 3IFEA 2AJQA 4EUVA 4LMZA 4JV0A 3KK1B 1HBUB 3I31A 4ZJLA 2FZGB 3WU5A 5EL9A 1JNRB 1YX2A 1TP7A 3MUMP 1U09A 1TL1B 4K4UA 2QFIA 1Q8KA 2R3VA 3EE3A 1DQ9A 3WU3A 2J0WA 3CJKB 1X4AA 4HH1A 2CQBA 4CDIA 4RW9B 3DLHA 3F41A 1NDCA 3D7SB 2UV8A 1R0CB 3PW2A 3D68A 3U1KA 4WFBQ 2AWZA 2J8AA 5L1IA 1AA1B 4IO1A 4USTA 1L3TA 3D1OA 4KHPE 3AOBA 4OLPA 1D3WA 5K36B 4OYZA 2E5LE 1SJ3P 2A0FB 4DX7A 4A8XA 3EICA 4JI5E 3BS9A 4FKXA 3SYZA 4IR1A 2FZKB 4EMDA 2CKWA 1V3RA 4BC7A 4LF7E 2D3UA 1Z0EA 1Z5AA 1RTDA 2FYXA 4PWUA 4ZPWR 2RUSA 4JP8A 4RNMA 4DLGA 2V63A 1VRUB 2WP8B 1KVKA 1I1GA 1TUWA 3LGHA 2VFUA 4ANDA 1KFSA 3FKBA 2OJ3A 2J9DE 2E5HA 4Q2MA 4HACB 4WKYA 2YPYA 3HJFA 2UXBF 3R5AA 3UN5A 2SXLA 1PG5B 3B82A 5ETMA 2I1RA 1IBLF 1N33F 1EI1A 2FJAB 4X66I 1FDBA 1CQMA 1RGVA 4CQ1A
chains in the Genus database with same CATH topology
4JG4A 1N0VC 4LF7I 4NXNI 2UXCI 3ZKDA 4P7AA 4LF6I 2Q2EB 1FJGI 3ZZ0A 1Z0GA 4DV0E 5A2QC 1H72C 3PYEA 4KQVA 4DUYE 3PYDA 1FWKA 4DR4E 3D4JA 3K17A 1HNXE 5IWAE 4DV6E 4Z7YA 1IBKI 1HK7A 1Y4UA 2DEJA 2Z5BA 4JI3E 2V8PA 2UUCI 3J80Q 5FLXQ 1KKHA 4DR1E 4USMA 1ZXNA 4N3OA 3WU4A 2V2QA 1FNMA 1PIEA 5LL6R 4X64I 3ZM7A 5IT9C 2ZM6E 1ZM2A 2UUBE 1XMOI 4JI2E 3LPSA 4Z7CA 4DPXA 3B8HA 1XNRE 2UUAI 4DR2I 4UTGA 2AJ4A 1N36E 1NZ0A 4DR6E 4JI0E 4GKJE 1DARA 3ZZTA 1Z5BA 4R1FA 4AQYE 4YHHE 1K47A 4PU9A 4FWGA 1Z0WA 1N32I 4LFAI 4DV4I 4DPWA 4PRVA 4LFBI 2UU9I 4HXZA 5LMUE 4WUBA 1USVA 2CG9A 2O1WA 1HNXI 5IWAI 2HKJA 4DV6I 4URLA 2IOQA 4DR1I 4JI4I 2O1TA 4X65E 4B3TE 2HFSA 4DV1E 2UUBI 2VF3A 3K85A 1B63A 3QT6A 2Z5BB 2V2ZA 2A2CA 4KHPI 2HK2A 1Y6ZA 4HY1A 1IBME 1Z0VA 1H74A 3J7AM 4ZVIA 1RREA 1H7SA 1N36I 2E5LI 2BM1A 3J81C 1XNQE 3B78A 2NPFA 4IZJA 4JI5I 4DR5E 1I94E 1IBLI 4LF4I 1N33I 1MG7A 4FWHA 4MYTA 3J81Q 3T1YE 4B3RE 3V5RA 3H4LA 1Y4SA 4YY3I 1USUA 4LFCE 5LMUI 4JI8E 4LF8I 4DV2I 4GKKE 4USKA 1KTVA 1ELOA 5LMNI 2A2DA 1J5EE 2HKEA 2O1VA 1XMQE 1FKAE 5A2QQ 4DPUA 3PYGA 2WW4A 1ZM4A 1MU5A 1ZM9A 4LF5E 1N0UA 4X65I 3V2UC 4B3TI 4DV1I 1HR0E 1HNWI 2Z5EA 4FWDA 2O1UA 1ZM3A 4B3ME 2CGEA 3OTOE 5BR8E 4X62E 2VQEI 2LJPA 4RPFA 2EFGA 1IBMI 2UXDE 4HYMA 4DR3I 1XNQI 2F4VE 3Q6MA 4DPTA 2Z5CA 4DR7E 5IT9Q 2HK3A 2X7IA 4DR5I 1I94I 4DUZE 4JYAE 4JI1E 1PKPA 3T1HE 3T1YI 3JAMC 4B3RI 1QZRA 4DV7E 4DV0I 4K0KE 4JI8I 4DUYI 4GKKI 4IZJB 4X66E 4DR4I 4IZKA 4DXLA 3JAMQ 2R42A 4UT4A 2IOPA 1WUUA 4B3SE 4LF9E 4JV5E 4JI3I 1Z0CA 2UXCE 1XHKA 4LF6E 2HFUA 2V2VA 1S4EA 1RR9A 2GS8A 3OTOI 5BR8I 1N34E 2ZM6I 1OJ4A 1UEKA 2PNMA 4JI2I 2UXDI 4MYUA 1XNRI 3M6AA 2F4VI 1IBKE 2UUCE 4DR6I 4JI0I 4GKJI 1ZXMA 3T1HI 3ZZUA 4AQYI 4YHHI 1MX0A 1Z0BA 4X64E 1Z5CA 2Z5CB 3WU6A 1XMOE 3P06A 4NXME 2X36A 4DR2E 4WUCA 3Q1QA 2BV3A 2XEXA 4B3SI 5GMEA 3PYFA 4FN5A 4LF9I 4JV5I 1D6TA 4DU8A 3WU5A 1H7UA 3PRYA 2E1RA 4IZKB 1KIJA 3K1JA 4DV3E 1N32E 1A6FA 3LNUA 4LFAE 1N34I 4HACA 4DV4E 4JI7E 4LFBE 3J80C 5FLXC 2UU9E 2VQFE 2R3VA 4P52A 5FWKA 1H73A 3HJCA 4I3HA 3WU3A 3Q6NA 4JI6E 2DEIA 4DPYA 2ZBKB 3CWVA 3J7AG 2J7KA 4JI4E 4IZJD 2HHHE 2BM0A 3GONA 1BKNA 4FW9A 4OX9E 4LFCI 1Z0TA 1Z59A 4NXMI 2V34A 4KHPE 4DV5E 3F0NA 1J5EI 4DU7A 1EA6A 2ZITA 1HNZE 2E5LE 2UXBE 4ED4A 1XMQI 1NHIA 1B62A 4JI5E 1FI4A 4EMDA 3ZKBA 1IBLE 4LF4E 1N33E 4LF5I 4LF7E 4NXNE 1Z0EA 1Z5AA 4DV3I 1FJGE 1HR0I 4YY3E 4JI7I 1KVKA 2VQFI 4B3MI 4LF8E 4X62I 4DV2E 2PNLA 5LMNE 4JI6I 3QT5A 1PVGA 1U2RA 1S16A 5L3JA 3HULA 3QT7A 4HACB 4DR7I 2OI2A 4DUZI 4WUDA 4XTJA 2HHHI 4JYAI 2CZ9A 4JI1I 1HNWE 1FWLA 2GQ0A 4DV7I 4OX9I 3B82A 4PRXA 4K0KI 2VQEE 4DV5I 1EI1A 1NHHA 3LTOA 4X66I 5GMDA 3QT8A 1NHJA 1HNZI 2UXBI 1VISA 2UUAE 4DR3E 4M1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JG4 A;  1N0V C;  4LF7 I;  4NXN I;  2UXC I;  3ZKD A;  4P7A A;  4LF6 I;  2Q2E B;  1FJG I;  3ZZ0 A;  1Z0G A;  4DV0 E;  5A2Q C;  1H72 C;  3PYE A;  4KQV A;  4DUY E;  3PYD A;  1FWK A;  4DR4 E;  3D4J A;  3K17 A;  1HNX E;  5IWA E;  4DV6 E;  4Z7Y A;  1IBK I;  2DEJ A;  4JI3 E;  2V8P A;  2UUC I;  3J80 Q;  5FLX Q;  1KKH A;  4DR1 E;  4USM A;  1ZXN A;  3WU4 A;  2V2Q A;  1FNM A;  1PIE A;  5LL6 R;  4X64 I;  3ZM7 A;  5IT9 C;  2ZM6 E;  1ZM2 A;  2UUB E;  1XMO I;  4JI2 E;  3LPS A;  4Z7C A;  4DPX A;  3B8H A;  1XNR E;  2UUA I;  4DR2 I;  4UTG A;  2AJ4 A;  1N36 E;  1NZ0 A;  4DR6 E;  4JI0 E;  4GKJ E;  1DAR A;  3ZZT A;  1Z5B A;  4R1F A;  4AQY E;  4YHH E;  1K47 A;  4PU9 A;  4FWG A;  1Z0W A;  1N32 I;  4LFA I;  4DV4 I;  4DPW A;  4PRV A;  4LFB I;  2UU9 I;  4HXZ A;  5LMU E;  4WUB A;  1HNX I;  5IWA I;  2HKJ A;  4DV6 I;  4URL A;  4DR1 I;  4JI4 I;  4X65 E;  4B3T E;  2HFS A;  4DV1 E;  2UUB I;  2VF3 A;  1B63 A;  3QT6 A;  2V2Z A;  2A2C A;  4KHP I;  2HK2 A;  4HY1 A;  1IBM E;  1Z0V A;  1H74 A;  3J7A M;  4ZVI A;  1RRE A;  1H7S A;  1N36 I;  2E5L I;  2BM1 A;  3J81 C;  1XNQ E;  3B78 A;  2NPF A;  4JI5 I;  4DR5 E;  1I94 E;  1IBL I;  4LF4 I;  1N33 I;  1MG7 A;  4FWH A;  4MYT A;  3J81 Q;  3T1Y E;  4B3R E;  3V5R A;  3H4L A;  4YY3 I;  4LFC E;  5LMU I;  4JI8 E;  4LF8 I;  4DV2 I;  4GKK E;  4USK A;  1KTV A;  1ELO A;  5LMN I;  2A2D A;  1J5E E;  2HKE A;  1XMQ E;  1FKA E;  5A2Q Q;  4DPU A;  3PYG A;  2WW4 A;  1ZM4 A;  1MU5 A;  1ZM9 A;  4LF5 E;  1N0U A;  4X65 I;  3V2U C;  4B3T I;  4DV1 I;  1HR0 E;  1HNW I;  4FWD A;  1ZM3 A;  4B3M E;  3OTO E;  5BR8 E;  4X62 E;  2VQE I;  2LJP A;  4RPF A;  2EFG A;  1IBM I;  2UXD E;  4HYM A;  4DR3 I;  1XNQ I;  2F4V E;  4DPT A;  4DR7 E;  5IT9 Q;  2HK3 A;  2X7I A;  4DR5 I;  1I94 I;  4DUZ E;  4JYA E;  4JI1 E;  1PKP A;  3T1H E;  3T1Y I;  3JAM C;  4B3R I;  1QZR A;  4DV7 E;  4DV0 I;  4K0K E;  4JI8 I;  4DUY I;  4GKK I;  4X66 E;  4DR4 I;  4DXL A;  3JAM Q;  2R42 A;  4UT4 A;  1WUU A;  4B3S E;  4LF9 E;  4JV5 E;  4JI3 I;  1Z0C A;  2UXC E;  1XHK A;  4LF6 E;  2HFU A;  2V2V A;  1S4E A;  1RR9 A;  2GS8 A;  3OTO I;  5BR8 I;  1N34 E;  2ZM6 I;  1OJ4 A;  1UEK A;  4JI2 I;  2UXD I;  4MYU A;  1XNR I;  3M6A A;  2F4V I;  1IBK E;  2UUC E;  4DR6 I;  4JI0 I;  4GKJ I;  1ZXM A;  3T1H I;  3ZZU A;  4AQY I;  4YHH I;  1MX0 A;  1Z0B A;  4X64 E;  1Z5C A;  1XMO E;  3WU6 A;  4NXM E;  2X36 A;  4DR2 E;  4WUC A;  3Q1Q A;  2BV3 A;  2XEX A;  4B3S I;  5GME A;  3PYF A;  4FN5 A;  4LF9 I;  4JV5 I;  1D6T A;  4DU8 A;  3WU5 A;  1H7U A;  2E1R A;  1KIJ A;  3K1J A;  4DV3 E;  1N32 E;  1A6F A;  3LNU A;  4LFA E;  1N34 I;  4HAC A;  4DV4 E;  4JI7 E;  4LFB E;  3J80 C;  5FLX C;  2UU9 E;  2VQF E;  2R3V A;  4P52 A;  1H73 A;  4I3H A;  3WU3 A;  4JI6 E;  2DEI A;  4DPY A;  2ZBK B;  3CWV A;  3J7A G;  2J7K A;  4JI4 E;  2HHH E;  2BM0 A;  3GON A;  1BKN A;  4FW9 A;  4OX9 E;  4LFC I;  1Z0T A;  1Z59 A;  4NXM I;  2V34 A;  4KHP E;  4DV5 E;  3F0N A;  1J5E I;  4DU7 A;  1EA6 A;  2ZIT A;  1HNZ E;  2E5L E;  2UXB E;  4ED4 A;  1XMQ I;  1NHI A;  1B62 A;  4JI5 E;  1FI4 A;  4EMD A;  3ZKB A;  1IBL E;  4LF4 E;  1N33 E;  4LF5 I;  4LF7 E;  4NXN E;  1Z0E A;  1Z5A A;  4DV3 I;  1FJG E;  1HR0 I;  4YY3 E;  4JI7 I;  1KVK A;  2VQF I;  4B3M I;  4LF8 E;  4X62 I;  4DV2 E;  5LMN E;  4JI6 I;  3QT5 A;  1PVG A;  1U2R A;  1S16 A;  5L3J A;  3HUL A;  3QT7 A;  4HAC B;  4DR7 I;  2OI2 A;  4DUZ I;  4WUD A;  4XTJ A;  2HHH I;  4JYA I;  2CZ9 A;  4JI1 I;  1HNW E;  1FWL A;  4DV7 I;  4OX9 I;  3B82 A;  4PRX A;  4K0K I;  2VQE E;  4DV5 I;  1EI1 A;  1NHH A;  3LTO A;  4X66 I;  5GMD A;  3QT8 A;  1NHJ A;  1HNZ I;  2UXB I;  1VIS A;  2UUA E;  4DR3 E;  4M1K A; 
#chains in the Genus database with same CATH topology
 3UDC A;  1EQ0 A;  4RNF A;  3BDE A;  1HL6 A;  3Q0A A;  2QMU B;  4CLK A;  1Q5V A;  4OI1 A;  3GSI A;  2LU2 A;  4ZS6 A;  2R7O A;  2CNO B;  2C22 A;  3M8Y A;  1N5Y A;  1WSR A;  1DFD A;  3ET6 A;  2XBP A;  3G9C A;  1S6Q B;  2B9E A;  2H5J B;  3H0P A;  1JLQ A;  4ECZ A;  5A6W A;  2YWG A;  2AIR B;  3BZQ A;  3UN3 A;  1MML A;  5HVH A;  5DG8 A;  1GMV A;  1PCA A;  2B7B B;  2C2N A;  5DM7 Q;  1NZA A;  5HL7 Q;  3KLI B;  3PS2 A;  4OO1 C;  3TZX A;  5A0Y B;  2F3J A;  4GKK F;  5JMN A;  1AUS L;  4ZA1 A;  2U2F A;  4JI0 E;  5HN0 A;  5DET A;  1NJZ A;  1TEL A;  5JXS A;  4FWG A;  4OYX A;  2VBZ A;  1LKZ A;  1UP1 A;  5KFM A;  4DV3 J;  3UD5 A;  1OQ3 A;  1UJ5 A;  2JC1 A;  2F7V A;  3W3S A;  4DV6 I;  4OO1 E;  2QLW A;  2IOQ A;  3VAJ A;  4FW7 A;  5EGY A;  2ASJ A;  4DR1 I;  3CC4 S;  3VAH A;  4BHQ A;  5G4D A;  2J0S D;  4DR7 J;  3FJ2 A;  1U1L A;  4LR8 A;  1YHQ S;  4HL9 A;  4DV5 J;  1GMW D;  4A8S A;  2IJN A;  3BYR A;  2Y8Y A;  2CJY B;  3O2I A;  4FWH A;  1RTH A;  3D3B J;  5IM0 A;  4NXN J;  3MEC A;  3IM8 A;  2E1C A;  2DR7 A;  3PTW A;  4K4X A;  3BDP A;  2L9D A;  1WTF A;  4DPU A;  3M9N B;  3PYG A;  2G9O A;  2FJB B;  2VG6 A;  1F2G A;  4OHV A;  1IBK J;  2YKA A;  4QOT A;  3V2U C;  2AD9 A;  2ZNY A;  1S9G A;  3MMB B;  3DM2 B;  3MFI A;  3BSC A;  1LK7 A;  3P76 A;  2G2Z A;  1T03 A;  3PW5 A;  2IIH A;  5FDL B;  3Q6M A;  4ZIT A;  2XMM A;  1RWK B;  3K89 A;  3QIP B;  4ED3 A;  2XS7 A;  1CS4 A;  4ILR A;  3B4D A;  1PIL A;  4XK8 C;  4UW2 A;  4LF5 F;  1BC6 A;  5K36 F;  4ZCM A;  2GCF A;  1HWI A;  2OEL A;  4LFB J;  2FVQ A;  2NN6 A;  2PO2 A;  2GMH A;  2KN4 A;  3R8Y A;  3ENV A;  3OD2 A;  3IS9 A;  5K9F A;  5BR8 F;  2DRB A;  1IKW A;  3PR5 B;  1WG5 A;  2LQJ A;  5DLF A;  4UOF A;  7FDR A;  3NGD A;  2IAJ A;  3H5X A;  4NCG B;  3BQ1 A;  5KT7 A;  3UVJ B;  2CDR B;  4PWD B;  1S59 A;  1WKL A;  5DZ6 A;  2VL1 A;  3J7A N;  3GFZ A;  3H5U A;  1WOR A;  4DR6 I;  3CD6 S;  1FES A;  3DRY A;  5HVF A;  3T5J A;  3M7N G;  2FQQ B;  2W2P P;  3BRE A;  4NCA A;  4JV5 F;  5F0W A;  4LF6 F;  3H7H B;  3J80 U;  4UY8 5;  3MAA B;  3EPI A;  3CJ3 A;  1TKX B;  4KB7 A;  3ISN D;  1T11 A;  3PFE A;  1IKX B;  3DYA A;  2FVC A;  1OYR A;  1NK9 A;  2B4U A;  5AE1 A;  4IZK B;  2RF2 A;  2JH3 A;  4EK2 A;  1RP5 A;  3KKF A;  5BXI A;  4PKD B;  2ZH3 A;  2D9P A;  1VQ9 S;  5C0X C;  3W8P A;  2HQI A;  4NRT A;  4P73 A;  1H98 A;  3CWV A;  3BYP A;  4ECQ A;  3N9U C;  1S99 A;  4KGX B;  1ZOT A;  2BA1 D;  4OX8 A;  4MDT A;  3SFU A;  4RW6 B;  2P9G A;  3D54 A;  1WKK A;  4OMF G;  4M5H A;  1AZS A;  1ZH5 A;  4UUW A;  4NLG A;  3A3P B;  4USI A;  5LSO A;  5C0X E;  2BVZ A;  4MFB B;  2BA0 G;  1HWJ A;  1B62 A;  3N5F A;  1S6P A;  1HMV A;  2EG1 A;  5BJR A;  1HBN B;  5LT5 A;  2XMU A;  1U2F A;  2BJ9 A;  1EZZ B;  4C0H A;  2C2E A;  4NLD A;  5AJ3 J;  2HG4 A;  2LA6 A;  3CDU A;  1OYP A;  1XQI A;  2R7W A;  4IDK A;  2FJV A;  3C46 A;  2E44 A;  4DI6 A;  4KHP F;  2VHG A;  2PII A;  1JLB B;  4QIF A;  2E5L F;  4DV7 I;  4JI5 F;  3VR1 A;  2PO1 B;  5A76 A;  3C6U B;  4TXS A;  2XYH B;  2VV5 A;  1Z1Z A;  3NS6 A;  4HKQ A;  2I38 A;  3A8E A;  2C2R A;  2QIF A;  5LMU F;  4ATN A;  2NCK L;  4F02 A;  2CQP A;  1SIW B;  5C2G A;  4U3B A;  3KDO A;  3GLJ A;  1DTT B;  3I82 A;  5KFY A;  5A2Q C;  4E2F B;  1S0M A;  2GQ2 A;  3NOG A;  2J65 A;  1NDP A;  1QE1 A;  2UVW A;  5I42 B;  5A8R A;  4X4V A;  1S1W A;  5J2N A;  2WW8 A;  4QYZ J;  4XTT A;  2X3G A;  2DJW A;  1G1X A;  4FVM A;  3CWJ A;  2AGQ A;  5HAT A;  2AKW B;  4P2S A;  3RG6 A;  1DLO A;  1KVJ A;  1X9M A;  2AYB A;  2OKQ A;  4JI2 E;  1YQH A;  1WHW A;  2A10 A;  2ACY A;  3B8H A;  3M2R B;  4LFC J;  4L73 A;  3NNC A;  4K5S A;  3HI9 A;  5I3Q A;  3UR3 C;  3MUR P;  3P8B B;  2M9K A;  4KRW A;  3RU0 A;  4DPW A;  3O1L A;  4M5K A;  3NLC A;  2CZV C;  2V94 A;  5ETP A;  4WK1 A;  2O1W A;  2Z2L A;  2CNK B;  5L38 A;  4DF4 A;  5HO4 A;  1AW0 A;  4ECX A;  2BE7 D;  4Z37 A;  1X8D A;  3VWS A;  1DQA A;  1T95 A;  2CPE A;  3OW2 R;  3IAS 9;  4CNZ A;  4YR3 A;  3LP2 A;  1XK8 A;  4CI0 B;  4GVB A;  2FB0 A;  2D69 A;  4JI0 F;  4IRC A;  3MM7 B;  3LGM A;  3DOM A;  4C8L A;  4L3K A;  3J7A M;  3NL0 A;  1IM6 A;  4TQR A;  2MKY A;  1VBX A;  1C0U A;  4IZJ A;  2KTQ A;  2FGO A;  4LSL B;  2HPU A;  1KTQ A;  2VA2 A;  3V5R A;  4CLZ A;  3D1Q A;  1URN A;  4ZKA A;  5CAA A;  2ADB A;  3PJX A;  1KQK A;  4BLG A;  4G1I A;  4QWE A;  5J2P A;  3RUB L;  5ETR A;  2HS4 A;  1LWE A;  4IQX A;  3L09 A;  4HEA 9;  4EYH B;  4DV1 I;  4OZ3 A;  1J2V A;  3M1V B;  2ZHO A;  2N4D A;  2RNE A;  2DR6 A;  4H4K C;  4B3M E;  3MCM A;  3M8P B;  3SZ2 A;  1P1L A;  1RKI A;  1U1P A;  1XMO J;  5E3R A;  2RD5 C;  4C11 A;  2PMH A;  3RW6 A;  3AD8 C;  3MGJ A;  1HFE L;  3MM9 B;  3KJV B;  2CXE A;  4ZJO A;  4DQI A;  3QYY A;  2B6A B;  3FEY B;  4DUY I;  4K4W A;  4DR4 I;  4O0N A;  3QNW B;  2UU9 J;  4UZC A;  4JI6 F;  4Y2M A;  3EDR B;  5HAN A;  1DY3 A;  4FF1 A;  3W63 A;  2UXC E;  2ZNZ A;  4IO9 Q;  2MKS A;  2DYA A;  1BD6 A;  4JI4 J;  1CUL A;  1B4S A;  4W90 B;  2ZM6 I;  3M6A A;  2V8H A;  3I87 A;  1SJ1 A;  5MLC V;  2FZC B;  4AQY I;  3C16 A;  1NHK L;  1HWK A;  3K8V A;  2H54 B;  1RHR B;  3U1Y A;  2OTL S;  5KFW A;  1D1U A;  3FRY A;  2H5I B;  1YJT A;  2HQ3 A;  4Q0B A;  3PG9 A;  4PUO A;  4HT7 A;  4ZVP B;  2YH0 A;  3EJM A;  4TU9 A;  1M1G A;  2J6T A;  1T9T A;  2PI5 A;  4DV3 E;  2XG8 A;  2KG1 A;  2KZM A;  3I56 S;  2DHA A;  2XZT B;  4WE1 B;  3IXQ A;  2AEJ A;  4JV1 A;  3MD1 A;  1NXI A;  4IQM A;  1B99 A;  5B0A A;  1FVQ A;  2VQE J;  2I2Y A;  1Y5Y A;  4OI2 A;  4DCJ B;  2W7P A;  2JLF A;  1YKW A;  1PJ7 A;  4I56 A;  3NXZ A;  3TOQ A;  5IV4 A;  3R9L A;  2BE2 B;  4MK9 A;  6FD1 A;  2BR2 A;  2ZHA A;  3R2C J;  1Z59 A;  4RU9 A;  4DV5 E;  3QMQ A;  2ZJQ Q;  4FF3 A;  4LSN A;  1VQY A;  2DRD A;  1RHQ B;  2MZJ A;  3DHX A;  5CYJ A;  1RB0 A;  3HFZ B;  4LIW A;  4ICL B;  5KAK A;  1WC1 A;  5C25 B;  4FZV A;  1S9E B;  2AX0 A;  4NXN E;  4HI2 A;  1I5O B;  2W01 A;  2K3K A;  4KV8 A;  3VVU A;  2ATC B;  4ZVQ B;  3LA0 A;  1HA1 A;  4LF8 E;  4ZMM A;  2GQQ A;  1MMD A;  3AA8 A;  3CCZ A;  4HLB A;  3U1N A;  4KO0 A;  1QSS A;  3C14 A;  2Y1J A;  1UVM A;  4ZP8 A;  2ZC4 A;  5C0X F;  2XMV A;  3FCH A;  3HHL D;  2EK1 A;  1Z2L A;  1UVL A;  4L6V 3;  1KDN A;  1C2P A;  3OPK A;  2RT3 A;  1U1R A;  3P3E A;  3W65 A;  3W5Y A;  4M63 A;  2RU3 A;  3G6V A;  1CC8 A;  2V9K A;  3MHY A;  2HHQ A;  1FT8 A;  1OY9 A;  3J7Z 5;  4AYB D;  2CPI A;  2R4F A;  3GG0 A;  3SQG A;  1WJ9 A;  3C8Y A;  2OHD A;  2KO1 A;  3FCV A;  4LQ9 A;  3H8Y A;  2XLK A;  3M8Q B;  3FCW A;  1U0H B;  1HK7 A;  1D09 B;  1IBM F;  3ENA A;  1JMT A;  3UCZ P;  3JSB A;  4QR0 A;  1Q4R A;  1KOH A;  2K7J A;  4O3P A;  5JEA D;  1YTY A;  3WU4 A;  1FRJ A;  1NDK A;  2ZH9 A;  1Y4Z B;  5M2P A;  5U47 A;  3VAL A;  1NJI T;  4DZD A;  2GO4 A;  5DS7 A;  2VOP A;  3BBF A;  1SCJ B;  2WCX A;  4OZE A;  4DZ6 A;  1NEE A;  3BR8 A;  1CJV A;  1E6Y B;  4ALZ A;  4OZ5 A;  1C1B A;  1JIH A;  3MM5 A;  3JTO A;  4OJG A;  3QO9 A;  2ALY B;  2DTJ A;  2YWE A;  2EKY A;  4X62 J;  3EZ5 A;  2XSJ A;  4URL A;  3OXF A;  2IM0 A;  5AE3 A;  1JLF A;  1JJH A;  4JI2 F;  3VGV A;  2VON A;  1FKO A;  2PT0 A;  2QMX A;  2O1T A;  1EKS A;  2ASY A;  2PNZ B;  4WP3 A;  2HZV A;  1NND A;  3BGL A;  2KKH A;  2X1B A;  2MZS A;  6AT1 B;  4YEA A;  3BKF A;  2JVO A;  1RRE A;  5KFH A;  5KFK A;  3LAN A;  2FLL A;  3SCJ E;  1TVR A;  1IBL I;  1N33 I;  3CJT A;  1UCN A;  1VQ5 S;  4B3S F;  1RAA B;  4LBI A;  3VAM A;  2HHX A;  1VQ7 S;  1HQE A;  4ZHR B;  3FC9 A;  2GO9 A;  4FDF A;  1VLO A;  4TYA A;  2O01 C;  3TEH B;  1TL7 A;  2DNZ A;  2CZ4 A;  1J5E E;  3ZNJ 1;  3SCK E;  3P3C A;  5LM7 E;  2BW2 A;  3QZ8 A;  3T1A A;  3LGN A;  4P2M A;  1NH7 A;  4DQP A;  4IH6 A;  5K5M A;  1ZM3 A;  3HFK A;  2CGE A;  3N79 A;  1N6Q B;  5DRR A;  2A3J A;  3DHW C;  2C38 B;  3JSY A;  5ETN A;  5IT9 Q;  1C4A A;  2E29 A;  3TA2 A;  1S1T A;  2FJE B;  3POT B;  4UF4 A;  1RCO B;  1SQG A;  2MLY A;  4IKA A;  3I55 S;  3CC7 S;  4F36 A;  4GKK I;  2DK2 A;  1CBK A;  3DOL A;  1WEL A;  3D6T B;  3M2U A;  3TX8 A;  4J7C A;  2W4P A;  1KLM A;  3MEE B;  3GSD A;  4B3M F;  2M52 A;  2WVC A;  2QLB B;  2Q66 A;  1U25 A;  5KFZ A;  4Y6I A;  5F3T A;  4PG5 A;  1RAE B;  2VB6 A;  1U1K A;  2ZEJ A;  2Z8Q A;  3GLL A;  1SVD A;  4NLP A;  4MIB A;  1VQ4 S;  3CNQ P;  4PYD A;  2Z56 B;  4GMK A;  2C2K B;  2UUC E;  2GJI A;  7AT1 B;  4PXE A;  4K59 A;  2WVF A;  1IVZ A;  3UI3 A;  3K5M A;  1VJQ A;  4X64 E;  1ROF A;  3EZO A;  1RT4 B;  4YDD B;  2UXC F;  3OHB A;  2OGU A;  3OSN A;  4YY3 J;  2LCW A;  4YS2 A;  4NZ6 A;  3TRG A;  2ILZ A;  2V4J A;  2XZD B;  4QPX A;  3E01 A;  1KIJ A;  2KXF A;  1TTH B;  1A6F A;  3RRH A;  2EC0 A;  2R8J A;  3KMQ A;  1RJJ A;  3KYL A;  3FBB A;  4DDF A;  3ZTP A;  2ZH8 A;  5C42 A;  3ZTQ A;  3QAE A;  3V6H A;  4RBT A;  5J2M B;  3CCE S;  2CG4 A;  4CLU A;  2QO3 A;  3PY8 A;  3FFI A;  2JEB A;  1FNX H;  3MMJ A;  1QAY A;  3TYT A;  1QAX A;  4DV3 F;  4JI8 J;  3D1H