1WUUA

Crystal structure of human galactokinase complexed with mgamppnp and galactose
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
391
Chain Sequence
b'HHAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactokinase
publication title Molecular Structure of Human Galactokinase: IMPLICATIONS FOR TYPE II GALACTOSEMIA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 117
structure length 391
sequence length 393
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.6: Galactokinase.
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
A PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1wuuA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1wuuA01
2HK3A 4JI0E 2XEXA 1XHKA 1Z0TA 5LMNI 4HYMA 4LF9E 4XTJA 4LF5E 4DR1E 1Z5BA 3Q1QA 4JI8E 4DV6E 1FWLA 3B78A 2UUAI 2UUCE 4AQYE 2Q2EB 3V5RA 1QZRA 2ZITA 4I3HA 4X65E 4DU7A 1FNMA 2V8PA 1MX0A 1HR0I 3F0NA 4JI3I 1IBLE 1NZ0A 4USMA 3H4LA 4X62I 1N33I 2VQFE 3T1YE 4B3MI 1KKHA 4JV5I 1WUUA 4JI4I 2UXBI 1H72C 1HNXI 4JYAI 5GMDA 2DEJA 4DR7E 1XMOI 4HY1A 4B3TI 4X64E 4FWDA 1HNZE 4DR2I 3PYFA 1PVGA 3GONA 1Z0GA 4Z7YA 5FLXC 1IBME 1Z0CA 4JI5E 4DUZI 1N32I 2UXDE 1FJGI 4LF4E 2BM0A 3J80C 4B3SE 2HKEA 4DV1E 4PU9A 3ZZUA 3LTOA 2A2DA 4DXLA 5LL6R 1N34I 4DV7E 4WUBA 2UU9E 1DARA 4JI6E 1B62A 4K0KE 1Z0BA 4DV4I 4FWGA 4DU8A 4WUCA 1IBKE 1ZXNA 3PYDA 4DUYE 3QT5A 1VISA 1S4EA 1Z0VA 2HHHI 5IT9C 1IBLI 1UEKA 2DEIA 4URLA 3T1YI 4LFAE 1RREA 4NXNE 1N36I 1B63A 1J5EI 2E5LI 1PKPA 4GKKE 4DV2I 2E1RA 4JI1E 1EA6A 2UUBI 4DR5E 4YHHE 4DR7I 1EI1A 1N0VC 2EFGA 4JI2I 3J7AG 4GKJE 4WUDA 4MYTA 3JAMQ 4JI5I 2UXDI 5BR8E 4B3SI 4LF7I 4DV3I 4DR3I 2WW4A 2OI2A 4DPUA 4PRXA 3WU4A 1XMQI 4DR4E 2HFSA 4DV7I 5GMEA 3B8HA 5IT9Q 4NXME 3J7AM 2ZBKB 4R1FA 4LFCE 3WU5A 2V2QA 5A2QC 3OTOI 1KVKA 5LMUI 3J81C 4LF6E 3HULA 2UXCI 4YY3I 2HK2A 3T1HI 4LFBE 4DR6E 4X66E 1XNRE 1I94E 2R42A 1ELOA 1H7UA 3WU3A 2VQEE 4DPWA 1XNQE 2F4VE 4EMDA 1HNWE 4FWHA 5LMNE 1MG7A 1U2RA 2LJPA 1FKAE 4KHPE 2UUAE 4JI0I 4UT4A 1D6TA 4GKJI 4LF9I 1Z5CA 4LF5I 1FI4A 4DR1I 4RPFA 1HR0E 4JI7E 4JI8I 4DV6I 1KIJA 2UUCI 1NHIA 2J7KA 3J81Q 4AQYI 4USKA 5BR8I 4X65I 4X62E 1N33E 2ZM6E 4B3ME 4DPTA 4JV5E 5FLXQ 2V34A 1HNXE 4JYAE 4FN5A 2VQFI 1XMOE 1ZM3A 3J80Q 4DR2E 4KQVA 4P52A 1MU5A 4LF6I 2X7IA 1N0UA 4ED4A 1H7SA 1N32E 4X64I 1HNZI 4DV5E 2BV3A 4LFBI 1IBMI 3WU6A 1I94I 2VQEI 4JG4A 5IWAE 4LF8E 4DV0E 4LF4I 3PYGA 4DV1I 1K47A 1FWKA 4OX9E 3D4JA 4HACB 4MYUA 4UTGA 2HFUA 2UU9I 4KHPI 2R3VA 4DV4E 4JI6I 4ZVIA 4K0KI 4JI7I 3ZZ0A 1NHHA 3V2UC 2A2CA 1H74A 1ZM9A 4M1KA 2HHHE 4DPXA 1IBKI 4Z7CA 4DUYI 1H73A 1ZXMA 1Z59A 2HKJA 2VF3A 2ZM6I 1N36E 1J5EE 4B3RE 2E5LE 4DV2E 1RR9A 1ZM2A 2UUBE 1Z5AA 4LFAI 4NXNI 4JI2E 3K17A 4FW9A 4GKKI 1OJ4A 4JI1I 1S16A 4DR5I 4YHHI 3QT7A 3ZM7A 4DV5I 3PYEA 3QT6A 3CWVA 2GS8A 4PRVA 1A6FA 4P7AA 4LF7E 4DV3E 4DR3E 5A2QQ 1Z0EA 2AJ4A 1XMQE 5IWAI 1ZM4A 3ZKBA 4JI3E 2NPFA 4LF8I 4DV0I 4HXZA 2V2VA 3JAMC 4OX9I 4DR4I 4JI4E 3OTOE 2UXBE 5LMUE 2BM1A 5L3JA 4NXMI 4LFCI 4B3TE 2UXCE 4YY3E 3K1JA 3T1HE 2X36A 4DUZE 3ZKDA 3LPSA 2CZ9A 1KTVA 2V2ZA 1Z0WA 1FJGE 4DR6I 4HACA 4X66I 1XNRI 3LNUA 1NHJA 1PIEA 4B3RI 4DPYA 3B82A 3ZZTA 1N34E 1BKNA 1XNQI 2F4VI 3M6AA 1HNWI 3QT8A
chains in the Genus database with same CATH superfamily
5ETOA 5LT5A 3V81A 3HKZD 1VLOA 2ZEJA 3KK2B 5KFQA 4LF5E 3WDOA 2CQBA 1R43A 1WHYA 1JMTA 1HHQA 4DFJA 1E6VA 3H8YA 1Q86T 1RAOA 3LALA 3N5FA 4JI3I 2DHHA 2DHGA 2LXUA 2IOQA 1SH2A 3I9ZA 3T1YE 1FDNA 2QE5A 4Q44A 1TTHB 1P1LA 2VQFJ 3WX4A 2V4RA 3LO3A 3OUYB 3HHLC 1T0TV 3J81j 1JK9B 4C3MA 3DM2B 4LPFA 3BJYA 4B17A 1IJEB 5J1EB 3EYZA 4U95A 2YBVA 3UDVA 2NSCA 2UXDE 1UWBA 3AAWB 3M7VA 4YN3B 1XNRF 2A3JA 2CPEA 4NLWA 4IZKB 4DSKA 4NLTA 1GTEA 3JSYA 1R0CB 2JEBB 1YJWS 3PEHA 8ATCB 3HHLB 3RB0A 2Y1LB 5C5JA 1Q81T 1TUWA 1VRTB 4PG8A 3TQ1A 2C2MB 3M9MB 1TAQA 3MM9A 3QMQA 5LMUJ 1LWXA 4M95A 1KN6A 2QLWA 2HHXA 1X31C 1S4EA 1Z0VA 1Q5YA 1VQMS 4RZRA 1NDPA 1Y7PA 4ZVTB 4X4NA 4DG1A 4O44A 3G96A 1NNDA 3AOAA 3AB2B 4DR5E 4CNYA 2GAHC 5E5NA 3FRYA 3EVWA 1NBEB 4K4ZA 2CQ4A 1S49A 3RAQA 3J7Z5 1VQNS 4H4KC 2CZ4A 4Y6IA 2MJUA 5DDOC 3JXOA 4JI8J 3RYLA 1JLEB 3T6JA 2F40A 4A4JA 4PRXA 2B7CB 3L7ZA 1RQ0A 2V0NA 4ZPCA 3UD3P 4I6WA 4IRDA 3RRHA 1P42A 4NXME 3PS3A 3U1NA 4HI1A 1KVKA 4ZN1A 1QAJA 2HVZA 1KD1T 3ENVA 1V9OA 2BA0D 3X1LB 2HK2A 3DRRA 4ZPDA 2WB4A 4M5MA 2IVFB 4M5DB 2VFTA 4EZ9A 2ILYA 4IS9A 4DV2F 1HPZA 4W92B 5KFHA 2SXLA 1NK4A 3BO3A 3QIPA 3MPDA 4PXDA 4ISAA 3ZZOA 3CCLS 3K58A 1JKHA 3NGTA 4USKA 1UVMA 4Y2IA 4RW6B 2V2KA 4O0NA 3LUYA 4C8NA 4MJKA 1RTHA 2DNMA 5FLXQ 5C0XA 5IT9Y 3OQ2A 4OHWA 3KRNA 4KO0B 2XS2A 4ZVPB 2PEBA 4KQVA 4FZVA 2HEKA 1DTTB 1K44A 2VIHA 2LU2A 3FBBA 2L3MA 3PRYA 5JEAE 1F60B 4CO0A 3HHKA 4LF8J 2CJAA 3EM1A 4A47A 2RMLA 1N34F 2QA4G 4HACB 3T6BA 2BOPA 3TUJC 1ROFA 2H4WB 4LFCJ 3IM9A 5K36E 4Y2CA 3J81Y 3P3CA 1IKVB 3C2PA 2QFJA 3PVXA 1TKXB 1H73A 2EPIA 2CQ2A 2DGOA 2MKJA 2ZM6I 1PYSB 4IFYB 4C98A 1WDTA 4NLYA 2DR5A 4A8MP 1Z5AA 3SQGA 4UOFA 1WG4A 4JI2E 3K17A 4FW9A 5JEAA 4BWJA 4X64F 1JLFA 1BXNA 2MKHA 1X5SA 1NO8A 3MUMP 3D6HB 5GMKa 2V8HA 1RAFB 1UP1A 2IA0A 2Y1IA 2JEFA 2IHR1 4QYZJ 3CCTA 2VC0A 4LF4F 4KHMA 2OEJA 2HQGA 2M8DB 3BKFA 1S1VB 5GAGU 2ADCA 3AJDA 2MLZA 2RU9A 5KG3A 2PO0A 2A10A 5CYQA 3I31A 1IKWA 1RHJB 2YXLA 3AB4B 3MHYA 1SVDA 1MN9A 3FUYA 2ZJPQ 3LPSA 2IRXA 4LVOP 1HMVA 2M70A 4M5IA 3I6PA 2GHPA 4DR6I 3BBCA 1SKRA 4FXWA 3H40A 1S0NA 3VAMA 3B82A 1YBAA 2X1AA 1GMWA 3LWMA 1K73T 1Q82T 3N28A 5LSOA 4R0JA 5LMNI 3DCAA 1EQMA 4DR1E 4DV6E 1YJNS 1K8AT 2J0QD 2EFVA 1WTFA 3QWPA 1UTAA 4UY85 2APOA 2DNNA 2JWNA 3ET6A 5BR8F 4PXBA 3GV8B 3ADAC 2WNRB 3GJRB 1YG0A 4KT0C 2C38B 1RTIA 1FDBA 4DR7J 1S9EB 2R7OA 2ZNYA 2YX4A 5EWEA 5M2RA 1EIYB 1R6LA 4DSIA 1YBUA 1L5UA 2VBYA 2OIHA 4DV1J 1RHRB 7FD1A 1NJWA 4CDIA 3WHIA 5HANA 2LVWA 4N77A 1AUDA 3FVYA 4K0KE 2QTWA 2H65B 2FJBB 5CH7B 2Y8YA 2JZ5A 5HSPA 2YPZA 2J9EA 1QTNB 2LYVA 1MWQA 5HROA 1IBKJ 3SBMA 3OR1B 3HFVA 3PXGa 2VG6A 1R8BA 4H4OB 2QV6A 3K5NA 4IR9A 3P49B 3OR2A 4DS4A 1YVFA 4NXNE 1Y3JA 3EUNA 1DRZA 1HI1A 2VG7B 2VPWB 3MECA 5G0RA 2CYYA 5B08A 2XMUA 3P3DA 2EEYA 2KT3A 5H9FK 2B4UA 3FSYA 1V5VA 3RBDA 2NQPA 5F9LA 2PNLA 4MK7A 4ANEA 1VJWA 5CAAA 1TK8A 4DV3I 2NS1B 3NS7B 2I5JA 1NK5A 3W8PA 2QIFA 1N54B 1U09A 2WRMA 4QWBA 4J9UE 2JL9A 2M52A 2BA0G 2EFOA 3UN3A 4M63A 2W2NP 3THVA 4AUKA 3PW4A 3N0VA 2I38A 3T1HI 2XMWA 2H48B 1VQYA 2HHHF 1I94E 3PW0A 1RT1A 1T9UA 5J2QA 3D7SB 5DGBA 1HFEL 1OYSA 1FRKA 2F8MA 3VAHA 3KLIA 1FRLA 2GHWA 3J80U 1T9VA 4Y0FA 2JE6A 1S4FA 3GG1A 4IG0A 4P7TA 2KDOA 2O1WA 4UUXA 2W25A 1VQLS 3SSQA 3D1QA 2YWEA 1SCJB 4A8YA 4N56A 4YB5A 3O8WA 2JEAB 2ALYB 4GMKA 1LWCB 3C66A 3ZTRA 2IOPA 2GO4A 1XMOJ 2F5GA 4M5KA 1RYRA 1MU5A 5F8JA 1U45A 4BBYA 5JVGQ 1HNZI 1RT6B 4P71A 2P8IA 2YWFA 3EX7B 2BQUA 4DV5J 4BA1B 2NCKL 1PILA 3OTDA 2Z56B 3TAPA 4ID5B 1M5SA 2YKMA 4IRKA 1LFWA 4KGZB 3HHDA 4DV0J 4QPXA 1K47A 4OX9E 2PEHA 2BX6A 2CPZA 4JI0F 1A6LA 4FVCA 4GKJF 3QYYA 3IWLA 2AD9A 4GQUA 4XDDA 3AJ1A 2F1FA 3KK3B 3R5AA 3HK2A 5K5MA 1H3DA 3M8SA 3DLHA 1T9TA 2HKJA 2WVCA 3DOKB 4DMZA 4URGA 3V4IB 2MLYA 5HK4A 1HWUA 2E9RX 2O01C 3DU5A 4TXSA 1TELA 3MMBB 3CCZA 3ZM7A 2E5IA 1Q8LA 2V6AA 3KYLA 1CQNA 3QT6A 4PRVA 1IBMF 1QSLA 3OSNA 2V50A 3DU6A 3AJ2A 1NH8A 4LF7J 2MMYA 1NSQA 2RRBA 2N7YA 2AIRB 5KT4A 2C28A 4OO1C 3MCOA 1YHCA 2V2VA 1SL0A 4FPRA 4WCEQ 2FHOB 2R7QA 3DI6A 2UU9F 1RGVA 1RBLA 2C3UA 4DF4A 1AZSA 2W24A 4A46A 2I1RA 3AOBA 4DUZE 4F4AA 3QZ7A 1Z0WA 1N32J 5HVGA 3G6VA 1W2BR 3FCHA 3AY0A 4FXDA 4OO1B 3M8QA 4C11A 2K8GA 1X0FA 1RWOB 4WZMA 4RBTA 2CPXA 2VDHA 2J65A 4OYMA 2F4VI 3O2IA 3LP0B 1HNWI 1S10A 3M85D 2XEXA 1F5AA 4LF9E 3D28A 2J6SA 4YHHF 4L3NA 3HVTB 3Q1QA 1M1GA 2GX8A 3OT9A 1FWLA 2UUAI 4ZLNA 2FHKA 1PBAA 5A2QY 1HR0I 3MM6A 2HMIA 3GU0A 1NRKA 3NMAA 4GO7X 2ZH5A 2C2ZB 5KT7A 4J9MA 4X62I 4DSLA 1Y10A 2FC9A 2MB0B 1E6VB 4JI4I 2MZJA 2C42A 2KFYA 5GAEU 2KH9A 4DQSA 1RWPB 4B3TI 1MSWD 1BQMA 4DR2I 4K4XA 1PJ7A 3ZZPA 2M8HA 3NOGA 1RHQB 1FVSA 4PWWA 2DY9A 4WFBQ 3OXGA 4C8YA 5D0HA 3CXCR 4C48A 2LQJA 3ZZUA 4B3SJ 3H1CA 2HVIA 4QJVA 4DLGA 3GR1A 2CQ1A 2W8KA 2AMCB 2FYXA 1YRXA 1UWBB 1Q8BA 1KSPA 4JI6E 3Q24A 1R8PA 4ZPTR 5SZTA 4F25A 1QD1A 2B9XA 4F04B 3MGJA 2AJ2A 3D3BJ 4JI7F 4OO1D 2D9OA 1S1TA 2HIQA 2XLJA 3OFEA 2JDJA 3OBIA 5A8KA 2FZCB 1IBLI 2DHAA 5LXRA 3MM9B 4O4RA 3TJ8A 4LFAE 1RREA 4LRBA 2OUGA 4WWSA 1FE0A 1PKPA 2P9CA 2ZZTA 4QCLA 4LCHA 2PDAA 4OL8A 4DL6A 4DG1B 4O44B 2JSXA 5HMXA 4XTTA 3A4TA 2XMVA 2XCAA 1HWIA 2MQ8A 3P8BB 5IFMA 1DQAA 2M3DA 1HLWA 2KJWA 2HHUA 1EB0A 2E66A 4DL7A 4A8QA 4NMLA 4A8FA 5I42A 1NSAA 1WEZA 2QC3A 3ZTQA 3T5LA 4RX6A 2PGCA 3POTA 5J1PA 2CPJA 1REVA 4I0WA 3L7ZB 4YY3I 4ZCIA 4RUHA 3DXBA 2ZH8A 4LFBJ 1SB6A 2R42A 5A6PA 3H5XA 1RT7A 2UUTA 3U02A 4ZKAA 1UJ4A 4QIVA 3IWNC 1OYEA 4CLYA 2MKIA 4ZS6A 4NCGA 4USIA 3DRRB 1EX8A 5ELWA 2PO1A 1RB0A 1VBXA 5HMYA 2HIYA 1XTZA 3KMQA 1NB7A 1FI4A 4NA2A 5C0XC 3A3NB 4M5HA 1Y5NB 2UUCI 1HPZB 1V3SA 2MPUA 2RIJA 3QIPB 4JI3F 3K5PA 3ITHA 2HW3A 3BGUA 4K2XA 3LGNA 1JKHB 1H6KX 4QZVB 1TMJA 3DHXA 2VQFI 3HVAA 1TL5A 2LDYA 3MEEA 3KDOA 1G6BA 5LMUF 1TKTA 1RTHB 2PFDA 1ZAXA 3HSJA 1JNZB 5G4DA 4JI1J 5C0XB 2FJDB 5DS7A 3T9NA 2V67A 4LJMA 4DUTA 4IFDE 1LXJA 1YBTA 4UUWA 4AT1B 2BDPA 4UOCA 1GMVA 2R8IA 2CJ9A 3OTCA 4K4UA 1YHQS 3TJAA 1TFYA 2BYCA 4DBQA 2LLZA 2AYEA 2RRNA 4JI8F 3MCMA 1SKSA 2BVZA 2WVDA 4F4YA 3NWGA 3K57A 1NKBA 5CZVA 3GJTB 2C3YA 4WXWA 3C6UA 4Z7CA 1ZXMA 4FBTA 5JEAC 4WFNQ 4O3NA 2YKNA 1SV5A 4ED6A 1N36E 2IRUA 4DN0A 2UUBE 5KFJA 4IFDA 2EBGA 3A8KA 1KOOA 4ZVHA 4M5GA 1S79A 1PC5A 4K7QA 2QG9B 4N76A 5L1IA 1X9SA 2RH3A 3SQGB 2K1RA 2E1AA 5JEAB 3R8YA 3UCZP 3IMQJ 1USVA 1JLFB 1MMLA 5EN1A 3I55S 3RU0A 5EUHA 3MR5A 3FBEA 5C0XD 1NJIT 2WTFA 3G2XA 3PX0A 1N88A 2J7WA 3DD6A 1N56A 3N79A 1U1RA 4GVLA 1CJVA 1B0VA 2Z2YB 1KRPA 2J5AA 1F9EB 5CCLA 4OZJA 3J7YU 1SQGA 4ED1A 4Q0BA 2OEMA 2WSCC 2PO0B 4OZ3A 3M85G 5CYQB 1IKWB 5CABA 2E7VA 1SIZA 3JB9k 1HBMA 4IZJA 1HMVB 3MFHA 1HARA 2O1TA 1NHKL 3DLEA 1S0OA 1B70B 1S0VA 1TK0A 3OL7A 1X9MA 3M2RB 3L7UA 8AT1B 2HGNA 2WK4A 4X4PA 2ZITA 4X65E 4ILLA 2ALZA 2HWTA 4LF8F 3BO2A 6FDRA 2PE8A 3MWBA 5ETLA 2EC0A 1N33I 2IC3A 1VQ4S 2UXBI 5GMDA 4LFCF 2J76E 3ET6B 3H20A 4ZCKA 2Q1LA 3EGWB 2DNRA 2J0XA 1PVGA 3GONA 4N8OA 2XBPA 4JI5E 2DCLA 1Z2ZA 4AE5A 2ZOGA 2IPOB 3JSBA 1RTIB 3NOCA 1UDNA 3HZGA 1FEEA 5JVHQ 2A2DA 2AZ1A 4NLGA 4FYDA 2DH8A 2DH7A 3FMWA 3MUVP 1TL1A 5BXIA 2M9KA 5E3PA 2DY1A 5K14A 2ABYA 3D5MA 1KONA 2XYHB 4WUCA 1Y5YA 1N5QA 1MN7A 3L7PA 2CNLB 2YVSA 3B4DA 3WIUA 1I3OB 1FXRA 2M0GB 4KE5A 1UFLA 1XERA 1QAIA 3D6MB 1R8CA 1D3WA 1WC3A 3UCUP 1UEKA 2KO1A 5KG7A 3KNAA 4TN2A 2DNPA 3T1YI 2GV1A 2E7XA 2HLUA 1B63A 3P76A 5AE1A 3VHQA 1M5PC 5HROB 1EA6A 3RTVA 1T94A 1N0VC 2MQLA 2VG6B 3NWRA 3CW2C 2VOPA 2W9BA 3OR2B 2X1GA 4HHHA 4RKUC 3RZAA 4LF5J 2UXDI 4DX8H 3KJVA 5G0RB 3MECB 3D54A 3GFYA 2LU1A 2ZDPA 1XMQI 4DR4E 2V9WA 1U1KA 4QIGA 4ZVUB 5LM7E 1HKAA 3OL6A 4ZCLA 5E0OA 2V5HG 2DO0A 2UV8A 2MSSA 2I5JB 1FTRA 4LF6J 3BGRA 1Q1KA 4BC9A 3CJ4A 4P73A 1A7GE 3AD7C 4OHYA 5KFKA 5ETRA 1YITS 2YKAA 4CLTA 2VQEJ 4HDGA 1UZDA 4KGVB 4LF1A 1M5OC 4DR7F 2LJPA 1X4CA 1RWXB 3TAQA 1RAAB 1RT1B 3OTBA 5J2QB 5D78A 4WYLA 1RABB 5DDRC 4K5RA 1UCNA 4NLUA 3C46A 1KQGB 1NHIA 3OFFA 5C2CA 4E98A 4NCBA 3HI9A 3KLIB 5EX3A 2XNQA 3TX8A 2JE6B 4IG0B 2PMZD 3BGFA 1T05A 4J7CA 2XY5A 3MM7A 2CFXA 3PM9A 4RNHA 2ZE2A 2AX0A 3PACA 5DETA 1B99A 4DR5J 1UJ6A 1Y4SA 2Q66A 4F3OA 1BQNA 5F8MA 2CG9A 1M1HA 1URNA 4ES3A 3VGVA 4I1TA 3HJFA 3PYGA 1TL4A 4CLFA 4OIXA 4DV1I 1Y0HA 2L9WA 3W9JA 1B4SA 4KR0B 2HBYB 3I0SA 1DLOA 2YKMB 4NXMJ 1S9FA 3GMEA 1I6JA 1IBKI 5C7PA 4FYYB 4LF2A 4L6V3 3SIPB 3AODA 1FERA 2HFVA 4QWAA 1KTQA 1RR9A 2Y1JA 3FJ2A 1FJ7A 5HI7A 1QE1A 4K2JA 4HYKA 3EXCX 1OJ4A 2HBQB 2VDIA 3G8QA 3L09A 3MD3A 2POKA 2RQMA 3NG8A 5C25A 4AM3A 4OYOA 4RJVA 2Q6CA 4U8VA 2DD8S 1Y4ZB 3FFIA 1F5CA 5DG9A 2C1EB 1K1QA 1SJFA 4WK3A 4WZQA 4LSLA 4E8UA 3BR8A 3RBEA 4XPEA 3NEKA 2MZRA 4HTJA 1GQEA 4W98A 2DNGA 3LP2A 2QSWA 1SJ4P 1FJEB 4NRTA 5KFEA 2YH1A 5D0GA 4AL6A 1QUVA 1JLCA 3DI6B 1MU2A 2LKZA 5H9EJ 2FJWA 3DMJA 1AZSB 4DSFA 1FJGJ 4RBVA 2MJNA 3PKMA 3O6QA 4KIAA 4MIAA 3GMGA 2WB1D 2RQKA 1Y5IB 3M6AA 3KMSA 1WJ9A 3PIPQ 1RT3A 4GKKF 1XR7A 3QJLA 2V68A 1WOSA 2KXHA 3M8QB 4C11B 5ETSA 1TUVA 2Z2LA 4ED5A 1JJCB 2VICA 2DNOA 1ZA1B 1QM9A 2V8PA 3E01A 2LXIA 5GAHI 4R8UA 3DLJA 1ZH5A 5DG8A 4N47A 4R5PA 1HNVA 3ETMA 3SDEA 3TJ9A 3N01A 1R0BG 3MM6B 2HMIB 2DEJA 3G8TA 1IQTA 1XMOI 3D2WA 3THTA 1NK8A 3QGGA 1HI0P 1IR0A 3FK4A 1WD6A 1XIQA 2CWXA 1RADB 2OPRA 1X9WA 4KFBA 4ZVEA 2GC8A 1BQMB 3MZIA 4ZJLA 2FIUA 2GQ0A 1L3VA 1WEYA 4RUBA 3QIDA 3MAAA 3M8PA 1NPRA 4P9SA 4IKAA 1AB8A 4CCHA 4DV4I 2ZHBA 1YJRA 1OO0B 1IJFB 4USHA 3C6TA 4CT8A 3T1AA 3TW0A 2DGXA 4UOHA 1KLMA 1J5EI 1S1TB 5E33A 1X4DA 2MZQA 2V69A 5A8KB 4ETZA 3HVWA 5E2QA 4ILRA 1VBZA 2HGMA 1X5OA 5LSRA 2AJ1A 4LR9A 3NS6A 3T9ZA 2FLPA 2NSBA 1N32F 2R8KA 1S6QA 5ETPA 3CO9A 3FEXB 2FHMA 1OY9A 4LF7I 1U1PA 4DR3I 1R3NA 1YI2S 1B7FA 4DPUA 1U1MA 2G0IA 4QBUA 5I4MA 2AEFA 3R9LA 3TP2A 3PS1A 3ZNUA 1VIOA 1EAYC 2UXCI 1FCAA 2NN6F 1F2GA 3J7A1 4DR6E 2ZBQA 5I42B 1JLAA 1XNRJ 4WK1A 4MU4A 3POTB 2MKCA 3LAKA 3TZXA 1REVB 2VB6A 4EMDA 3DHWC 5LMNE 1VQ5S 1FXLA 2IA6A 3CD6S 4KHPE 1AXQA 5K9FA 1RT7B 1N8RT 2J6TA 5DZ6A 1BGXT 2HYIB 1WKLA 3CO0P 3R6LB 4YMEA 4NCGB 4MKYA 4K0KJ 4AQYI 2PO1B 3UCGA 1AUSL 3FDSA 3Q23A 4B3SF 2PNZA 5ETQA 2RT3A 3VZIA 2ACMA 2HNDA 4EYIB 3OVAA 1U2CA 1VQPS 5J1NA 2XQCA 1GT8A 3Q8YA 4JI4F 3ITHB 4B02A 1APSA 2ZVIA 2DGUA 2OMLA 3MEEB 1KQSR 1I94I 1IR1A 1UJ5A 5DGAA 1EKSA 1TKTB 2IRYA 3L7OA 1WOOA 2ZH9A 4NX9A 4WBFA 2GNKA 4O3PA 4Q8EA 3SFUA 3GIKA 5DLFA 4P7VA 1RAEB 2D74B 4I56A 4RNNA 1WHWA 1FJCA 2ASDA 1NHHA 5ETTA 5SUHA 2D3O1 4IFDC 1WTBA 3H7HB 4MKBA 1RTZA 4E0DA 1ITPA 1VS3A 4YP3A 4FBUA 4LMZA 2H3EB 2J9CA 1X4BA 2KL8A 2CNNB 3BSCA 2NXNA 1N6QA 3C6UB 4J9NA 2WCXA 1SV5B 2YKNB 4C8OA 5L8RC 1JLBA 2JEJA 2CQDA 1FE4A 2M2BA 4IFDB 2C22A 2R7XA 4DV3E 3EGVA 2GMLA 4L72B 3ZKBA 1H7WA 1RAGB 2OPQA 3PRDA 1YK9A 2D1CA 2NUHA 2DXDA 4O3RA 1F1BB 4KC5A 5IC4B 3CIMA 4OX9I 5LJ5Y 1SXLA 2BM1A 2K1RB 1L3UA 4DS5A 4PPDA 5AJ3J 2KKHA 4RUCA 3H5SA 3T1HE 2WOMB 5D0EA 2V2ZA 2BOAA 4X84A 3MM8A 1IR2A 1PIEA 3MI7X 5DO2A 5IZHA 3ZZTA 1CJVB 1FO1A 3PX6A 1BKNA 1XNQI 3PG9A 4AL7A 3US5A 3QT8A 4OYPA 1N34J 2VPZB 4ZPAA 4JI1F 1SI9A 4Q0BB 3KHLA 1P9YA 3Q8RB 4XTJA 1B64A 1L3SA 1Z5BA 4MDTA 3CMES 1X0PA 2CG4A 3QGIA 3I4PA 3IFEA 4FVMA 4FYVB 1HBMB 1SIWB 4IZJB 4J9QA 2DHSA 3DLEB 2NXJA 3W2WA 3J7AN 2ZH3A 5U47A 2RRAA 1AA1B 2F63A 3MUTP 4USMA 2O1VA 4DQQA 4B3MI 2HQIA 3UD5A 2OLWA 2V8GA 5B0AA 1VQ9S 2NREA 1HNXI 4H4MA 4ZN3A 1HK7A 1HNZE 4G65A 2M4MA 3FZBA 1P1TA 3K89A 2IC3B 4DUZI 4C8MA 5BYSA 2CNOB 1ZZNA 5J2MA 2WHOA 1RHUB 4X4TA 4U9RA 2QA4S 2DPIA 4LF4J 1HD0A 3TA2A 4ZIWA 2BEFA 2XTJP 3OXFA 3M6UA 4DV7J 5IOLA 2ZJQQ 3PJ9A 6AT1B 4G1IA 3ISZA 5KG2A 1Z1ZA 1X4GA 1Y5LB 4HL9A 4J9VA 1ZXNA 3MMCA 1RISA 1TL1B 1Y3KA 2EG1A 3UDEA 3BGLA 4DOZA 2KZZA 3MM5A 5K14B 1CJTA 2YNHA 3R5CA 4LSNA 4URLA 4BA2A 1UETA 4A8WA 4RWXA 1KLNA 4JYAF 2E1RA 4C8ZA 1TKZA 1X4AA 1EI1A 1VC6A 4IZJD 5L9XA 4GKJE 4HEA9 2R8GA 2VFRA 5I3QA 3G82A 2JVOA 4BC7A 2OEKA 1YTYA 2CPFA 3IM8A 2HVHA 2DGQA 4ZLJA 5BR8J 1T7PA 3W63A 4OV1A 3NNAA 4HR2A 2W9BB 3R1LA 3RAXA 4LCGA 1KHVA 4FNIA 1SL1A 1NSKL 2O3ZA 1WC5A 1F2HA 1FKOA 3OTOI 1UMJA 3BQ1A 5DQHA 1FWPA 2C3MA 3R2DJ 1HWJA 2W4DA 4MFBA 4CLZA 4N41A 2CIMA 4KB7A 4NCAA 1R6VA 3KWMA 2B9EA 5L9NA 2YQ1A 1Q5VA 3P4UB 4ZPBA 2F4VE 3CDBA 1HNWE 5DDPC 3LOUA 1ZA2B 3EGNA 4NA1A 2J0SD 3V6JA 1HQUA 3BGRB 3E51A 4U67Q 3KHRA 1GX5A 2UUAE 3CCQS 4UT4A 4Q8FA 5D3GA 1YJUA 3G71S 2ZH6A 4CH0S 1HR0E 1OWXA 2XG8A 4JI6J 2XYGB 4WIIA 2BZ2A 1XBWA 5L1JA 3ONQA 3BSOA 2B9WA 2NN6A 4X62E 5T14A 3NAIA 2F9JA 3EDQB 4WTOB 4OZEA 2XMKA 1Q8KA 4I6AA 3UN2A 5GADU 3QPIA 3EWGA 4DR2E 4M94A 3R3TA 4JB8B 2W4CA 1N0UA 2R2UA 1VQKS 2QYCA 5E3AA 2BV3A 3M32A 1LW2A 4I64A 3AH6A 1T05B 1VI7A 3MM7B 1R89A 2D9PA 5IWAE 1S7IA 2ZE2B 3P3EA 2HZAA 2ZH2A 2EKNA 3R7BB 1FWKA 1BQNB 3W3SA 2VG5A 3ELHA 4ZP8A 1FRIA 1VR6A 4WYWA 5C42A 2E1PA 2A1BA 2DRAA 2Z8QA 1U1QA 4LF5F 5E41A 2CJYB 1NJYA 3P5BP 2XMMA 4DPXA 3T5HA 5K8MA 2DNHA 2HHHJ 2ASJA 3PX4A 3I0SB 1DLOB 1X5TA 3IRXA 4P2SA 3T1YF 2GAGC 2E44A 3IP0A 2R2SA 3SV3A 3W61A 2ATCB 3QFHA 1FHTA 1S16A 3H25A 4ZVQB 2BANA 3O1LA 2G13A 1RKJA 1QE1B 1RWWB 5BYRA 1NKEA 1TP7A 5C25B 3UN5A 3PHEA 5DQIA 2WSEC 4YR3A 3IXQA 3FFIB 3MR6A 4YY3E 2YPYA 2IIHA 3PNIA 4LSLB 5DJBA 3C15A 2AYMA 5KFUA 4ILMA 4X66I 3LP2B 1FNXH 6FD1A 3W5XA 4IFVA 2RSQA 3MPUB 2W8LA 2DB1A 4ECYA 2YWWA 1VQ8S 1JLCB 3KUHA 5LJ3Y 1MU2B 4DR5F 3DMJB 4JI0J 1CS4A 1OY6A 3GCWP 1VIXA 4J9PA 2UUCE 2PA3A 2VD3A 3M2UA 2G0JA 5EX0A 1ACMB 5HN0A 3L9ZA 1MWYA 4RL1A 1RT3B 2W7PA 4RU9A 4ZVSB 4ZP9A 3G87A 3W9HA 2VH7A 2R7WA 3L4BC 2VQFE 4NLQA 4JV5I 1G7CB 2NYIA 4NXMF 3CE8A 3GCXP 1KVIA 3E01B 5D4NA 3MTJA 1HBNA 1W7WA 4R8UB 2UUBJ 4I2QA 4PYAA 3R7SB 4EGLA 1HNVB 3SDEB 2ZVSA 4R5PB 2DYAA 2HHSA 3RB6A 5FLXC 3R97A 1KQKA 1FTCA 4NA3A 1HWLA 2M5YA 5JJBA 2AP6A 3RRKA 3KJNB 2BM0A 1TV6A 4WKRA 1XC9A 2QYGA 1OMSA 2VOOA 2QZ8A 1USUA 2UU9J 2RQ4A 5K20B 2OPRB 4KFBB 2G2OA 4KPYA 1Z0BA 2KG0A 1U26A 2GIQA 3RBZA 4DU8A 3MAAB 3M8PB 4ES2A 3UHMA 2XYPB 2JHEA 4IUFA 3CDIA 4KRWA 4PEOA 1NSPA 2EXUA 4ZLLA 5AE2A 2E5LI 2LCWA 3C6TB 3LPEA 2RQCA 3MOJB 2EFGA 2XGQA 1QLNA 3JAMQ 4JI5I 1KLMB 4QYZK 1GXUA 3MOZA 2BW7A 2FQQB 2J9DE 5JEAF 1R31A 2PT0A 3F41A 2KM8C 4LCFA 1T9WA 5KFZA 1PGZA 1S6QB 5D0RA 3J7AM 2VHGA 1Q16B 2YNFA 1CJUA 2HURA 1S48A 1ZS6A 3V6HA 4X4UA 2AYBA 1KVJA 5K36F 4C97A 3OTEA 2HVEA 1H7UA 1S12A 3PS2A 3BO4A 5KFSA 3GJSB 2KM8B 4N8NA 1WKKA 3K8WA 2P2CB 1UDOA 2BJ8A 4BS2A 4KV8A 1HNIA 4CNZA 4DCJB 4JP8A 4C4WA 1JLAB 4JI2F 1Z5CA 3VV2B 2BE2A 5KFNA 4RW4A 3G9CA 1V6HA 1NAQA 4JI7J 5EGYA 2J6UA 2W4PA 3GFXA 2CG8A 1N33E 1ZAWA 1Y60A 1XK8A 3A3PB 4DPTA 2WSFC 3M8YA 1RTJA 1WDDA 1F0XA 1RBOB 2DISA 1ZM3A 2PNZB 2HNDB 2IY5B 5KFMA 2MZTA 2HWHA 1YJVA 3MEKA 4J3DA 2CQHA 4IG3A 2ZOMA 3NY0A 1CG2A 5HMWA 4RUAA 1HHSA 1S6OA 4NMXA 3PW7A 2RDDA 4LF8E 4PXEA 2AGOA 2HHPA 3BPDA 1HHTP 3BDEA 4QU6A 4MYUA 1OQ6A 3N6LA 2KU7A 2HFUA 4DR4J 4CO1A 1AW0A 2UV8G 2ZH7A 2BBEA 4NLVA 5D15A 4DR1F 5A0YA 3W7BA 4DV6F 4ZVIA 2HS0A 4I6YA 3RG6A 2PI5A 1F6TA 1MWZA 4Y2AA 4OI4A 5EDWA 4O23A 4DUYI 3OFGA 4A48A 3RGIA 3CDUA 3MPVA 2UVRA 3ZTPA 3IBCB 5CHCB 4UQTA 4Q5VA 1KOHA 3LP1A 4B3RJ 2EK1A 2D69A 4HT5A 2OMOA 3P45B 4ITSA 2R8JA 3KUGA 4B9VA 2HRUA 2BACA 3E3XA 4OZLA 5CA5A 3NBPA 4OQJA 2GS8A 1UZHA 3AD8C 1UDSA 1BHNA 2V8DA 1N6QB 3IR7B 1Z0EA 1XMQE 4CTAA 3VZHA 1YDLA 2D3UA 9ATCB 4JI3J 1JLBB 3W2VA 3G6YA 4ED7A 4EBCA 1PYTA 4URQU 5HLFA 1FNOA 3SSRA 2OPQB 1SC3B 3K1JA 4K0KF 4JBCA 3HZEA 2W2OP 2CQCA 1SC1B 5GADI 1GXLA 3TRGA 3HVRA 4RNOA 1XNRI 2AQ4A 1NK7A 4PABA 2CQIA 4B08A 2YQ0A 2KVQE 4NXNF 4EYHB 1Z4UA 1FFSB 2C2NA 1JXEA 3MM8B 1OYPA 3BZQA 4USWA 2NPIA 4F67A 3JSRA 5EKWA 2K7JA 4DU7A 2VODA 2MY8A 1C0TA 2V4JA 4GC6A 1UPPA 5A76A 4OJ1A 4QOTA 3ZZRA 4X4QA 2W7OA 3VAJA 2AHOB 2BABA 2GMJA 3JSMA 4DR7E 3W2WB 4C3KA 4NLRA 4NI2A 1Z0GA 4Z7YA 4OZNA 2DR9A 1IN0A 3HHLD 3EPIA 2F4FA 4IDKA 4H4MB 1I94F 4GVBA 4DV1E 3UDLA 4PU9A 1UW4A 2MQPA 5KFXA 3PFEA 3W62A 4OZ2A 2R7RA 4LT6A 4CP5A 1LK7A 1NCLA 2LQ5A 1P27B 4K5SA 5J2MB 2GO3A 4MT1A 2Z57B 3EXYA 1VQSA 3PIOQ 4MKAA 1IBKE 3CJQA 2GVDA 4V1Ak 3QT5A 1VQ7S 2IM2A 4PQAA 4WE1A 3VTIA 2LEPA 5IT9C 2DEIA 5F8LA 3MAHA 3MMCB 1X7VA 5AJ3F 4DV2I 2AX1A 2QLBB 3MM5B 4WUDA 1CJTB 2YNHB 4LSNB 4BA2B 2MYFA 5KFRA 3BEGB 2CADA 3H42A 3CCMS 1G3OA 1TKZB 2J0WA 2ZNZA 3I56S 3V4MA 4NRUA 2BE9B 3B4TA 2VC1A 3M05A 3BKTA 2NZ4A 3GIMA 3G82B 4WIQA 2ZBKB 4OX9F 1DTQA 2Y0BB 4OX8A 2K06A 5HJYA 3R5BA 3J81C 2ZBCA 4J5OA 1NDLA 3A12A 4OLOA 2B8PA 1LFPA 3KLHA 4L74A 1JJ4A 3TYTA 1FKOB 1T02A 4CT9A 4ZJOA 2FLNA 3TAMA 4DEZA 4KSEB 5HL7Q 3NCQA 2OGUA 2DNYA 4MFBB 5HP1A 5CD4H 5DLGA 2NN6C 1HYSA 1LQ9A 1U49A 4RPFA 2IMOA 1RBAA 1KIJA 1HQUB 1D9FA 5CQGA 2RD5C 3JAMU 2OJ3A 5D3GB 5K36A 4LVNP 3AOCA 4DV7F 3SYZA 2U2FA 3BKUA 2ZM6J 5MLCV 4OZ5A 3LAMA 1XMOE 4NYOA 3FBCA 2NN6B 1YH8A 3CC4S 1I51B 2HFNA 2L9NA 4X64I 4DV5E 2CUYA 2W2QP 2YKPA 4CIOA 2BR0A 2C2KB 3D1OA 2IESA 4DV0E 4LF4I 3M32B 1LW2B 1S72S 2FJEB 2GQCA 5F3TA 2RDIA 5D4LA 3KG1A 3FC9A 4KHPI 4W4MA 4DX6A 4LF9F 5HQLA 4DV4E 2H1YA 1DQ8A 2GIRA 4WF9Q 2FVPA 5FDLA 2A2CA 3QWUA 1ZM9A 2RDJA 3UE2A 2VG5B 3O3LA 2ZKUA 4X4VA 2BJ7A 5C42B 2VKRA 1UAWA 1J5EE 3LF0A 3HFKA 1ZM2A 2RUGA 2QL7B 3TANA 4DCPB 2H5JB 3M6XA 2P9EA 3JTOA 3P3GA 3HM9A 5B0FA 4OX7A 2M88A 4ZHRA 3IRXB 4KQZA 1EKRA 3I5CA 4D3GA 2YWKA 4LF7E 4DR3E 2ZH1A 4OHXA 1RT4A 3W1YC 3BYPA 5KG1A 4RW7A 3JTPA 2BANB 2NN6D 2FVCA 3L3CA 4DDFA 5HVHA 3QSYB 1DTTA 2MQNA 2MZSA 1BE4A 2D3ZA 5DM7Q 1ZYQA 4C0BA 1WORA 2IM0A 4JI6F 2UXCE 2R8HA 4DJBA 2OFGX 2L41A 4PKDB 2C37A 2UVUA 2ZD1A 4HACA 3JQMA 3KLEA 1NHJA 2RB7A 2CDQA 3W65A 3BV8A 2J8AA 4DCOB 2YNIA 4UOGA 4YFUA 4ZIVA 2A18A 4LFAF 3C15B 5J2PA 4DL4A 3GP9A 4HI2A 4TQRA 5DNLA 2LDIA 4PCQA 1SQFA 4HYMA 2DNLA 5KFTA 3SEOA 4IFVB 4AQYE 1RP5A 2XY6A 2HQCA 1TZ0A 4YB1P 4RR5A 4LBPA 1NUEA 3H2VE 5HJXA 2DXEA 1CS4B 2QLJB 1RXOB 3K5LA 4IOCQ 4TVAB 3M2UB 4NLXA 3Q8UA 1OYRA 1NZAA 2ACYA 3GV5B 2DGTA 1VK8A 4BHQA 4FWDA 2QA1A 4YR0A 2FC8A 2MDAA 3NCRA 3PHTA 2MHNA 1OY8A 2PA8D 3EPGA 1R0AA 4B3SE 3MEGA 2BJ1A 1HBNB 5FIIA 4I2QB 1QVFR 3CIZA 4DV3J 2JFDA 2NR0A 1FRMA 5DDQC 1MLAA 1T95A 4WUBA 4PYDA 5DG7A 2NXEA 4WTYA 1YQHA 2C2DA 5RUBA 3IS9A 3T41A 1W26A 1TV6B 2EC2A 2ZKTA 3VQSA 2EK6A 4B3OA 3H90A 3PO4A 4G1QA 1SBRA 1FDAA 3NL0A 2MTLA 3CPWR 2HGLA 3M9NB 5ITHA 2W9AA 2HHHI 2G0CA 2VPXB 2YNGA 3QBCA 2XCPA 3VCDA 1HA1A 2I6WA 1LWFA 1SKUB 2HWIA 3A13A 1S1WA 1CVJA 2HLTA 2NXCA 3IA0A 4GKKJ 2DK2A 5L1LA 8RUCA 2EW9A 4CLUA 4NWBA 3BDPA 2KT5A 2G2ZA 2X51A 3A8EA 2N3OA 2HSEB 4A8OA 1Q8IA 4IFDF 5DNXA 2CKWA 2GJFA 3Q0AA 1FD8A 3PCOB 2ZWPA 4ETXA 3GYXB 1F3FA 3ILJA 2C2RA 2PI4A 1AYEA 3W5ZA 2Y9HA 3B8HA 2LECA 5IT9Q 1NK9A 4R1FA 2IVMA 4CWBA 2D3OR 2ZFHA 1WACA 1N5VA 3HDSA 3OL9A 3MPYA 2BJDA 1S6UA 4ED8A 1D0EA 3TEGA 3CSKA 2ZUAA 5K8OA 2R7VA 4LFBE 1HNZJ 1T11A 3GV7B 3NGRA 2YNFB 1CJUB 3WU3A 4CH1A 1W2IA 1RLDA 1U47A 4ZITA 1AFIA 1RAHB 3LH2S 1XNQE 1N36F 3HF5A 3J80Y 1WF2A 4FWHA 2CJBA 5FLXU 2UUBF 1UVKA 1FKAE 2XWXA 2O67A 4JI0I 4GKJI 7AT1B 3PV8A 4O3QA 2LA4A 4ZJQA 4WXOA 4KV8B 3J81Q 3VQTA 3FCVA 1HNIB 4ZOSA 2CPIA 5B0DA 1FK9A 1KWMA 4FKYA 5K8PA 1RK8A 1RWVB 3GYGA 5KFPA 4B3ME 4AXIA 2BE2B 2RS8A 3ISNC 3P96A 4RW4B 1SJ3P 1KEKA 3G4SS 1HNXE 5AE3A 1XEZA 2LMIA 5C24A 4X2BA 1RU1A 1HBUA 1RTJB 2RF2A 3BYRA 1IBMI 2EFNA 2B6AA 1O8BA 4USTA 3E8OA 2EBEA 1NDKA 2HHTA 3IAM9 2OFHX 4ERDA 2EWHA 4EZ6A 2O3DA 1URRA 4IG3B 2UU9I 1R8HA 3ZFVA 1WC6A 3HMJG 2ASLA 2GFFA 2A6OA 1NPPA 5KFBA 4DF8A 3AD9C 3V81B 2IBOA 4X65F 2HFOA 2HAIA 3AQOA 4U8YA 1N52B 5A0YB 1KC8T 4USJC 2H4YB 4W90B 4DLEA 1GH8A 4HT7A 3HHNB 2LEAA 2ZH4A 1HNWJ 4NYZA 4OI1A 5K8NA 2BE7D 2KHDA 1MW7A 4X4SA 4YHHI 2U1AA 4ZVOB 3QT7A 3CDWA 3LP1B 4JI5F 4KY3A 2UUAJ 4P7AA 5IWAI 1ZM4A 2H54B 4Z2XA 3NBPB 4LRFA 1KP6A 2ZDOA 5KT5A 3NAHA 1UPMB 3QRPA 2KYZA 1CJKA 2VL1A 4BWMA 3WBZA 2Y8WA 3OTOE 2FPHX 2XC9A 5E3RA 3PR4A 2N4CA 4JI4J 4CYUA 4CTAB 4DFPA 2XY7A 1S97A 1G2EA 3W2VB 4B3TJ 5GAGI 4DR2J 3ISND 3QSIA 4FF1A 3M2VA 3C14A 5HLFB 3LNUA 1M0SA 1UW9A 4PWUA 2ZBPA 1YKWA 2BJ3A 3QJJA 3TWZA 3HFZB 3U7JA 1XHKA 2E5HA 1K0VA 4V19X 4WFZA 4KH0B 3B78A 5F8NA 1RT2A 3R27A 5B09A 2GQ2A 3V4IA 4OI3A 2VUGA 1X4HA 4IRCA 3IBWA 3H4LA 4L75A 3DRXA 3GZ7A 2ZZMA 1IBLJ 4DR4F 4ID8A 4OO1E 4NLDA 4CO5A 5HATA 4KPCA 1T3OA 2QRRA 1VOMA 1C0TB 2V4JB 2W2PP 2NYHA 4PUOA 1O6XA 1RWMB 3CJTA 4F02A 2QT7A 3AXMA 3GFZA 3TZYA 3FNNA 1RE1B 4EBDA 3JSMB 2Q6BA 3PO5A 2GO8A 4NI2B 4B3RF 3MTKA 1DQ9A 2VBZA 4OX6A 4IDKB 1B62A 4GVBB 5DQGA 1U6BA 3GB0A 3DRPA 3WC2A 4CRJA 1UFKA 2UP1A 1N5SA 2B0GA 2FGOA 2B4VA 3PEJA 3CJSA 1RWNB 4NEZA 2J8SA 1NMEB 2F65A 2HS3A 4WP8A 5EL9A 2WVEA 1U4BA 2K3IA 4OKGA 2GVDB 2JLGA 1U1NA 4Q2LA 2BUNA 4WE1B 4AIDA 3NGKA 2FLOA 2YKQA 2XI3A 1TAUA 5IM0A 1X4EA 4ZCMA 2XGPA 2HQ3A 4V19J 3MXHP 2HFZA 2Q79A 2HBZB 3ZTSA 4BLGA 1QTMA 4N5SA 2BRKA 2HRYA 5E3QA 2UUCJ 4ER8A 1M5KC 3AXKA 2DIUA 5IS2A 3H4DA 3WU4A 1YRUA 2FTRA 2DRBA 5KT3A 3PW5A 3GR0A 4XDCA 4AFFA 3THPA 3OL8A 2ZC4A 5ETVA 2KG1A 4EEYA 2ROGA 1NZ8A 3ENQA 2DGVA 2I9SA 2PFFB 4KKOA 3D6FB 5LMUI 4LF6E 3TARA 4Q7AA 3CCSS 2CWKA 2DXFA 2QJ3A 4X66E 5H9EK 2JFKA 2IM3A 1DTQB 3UVJA 2VU5A 2VQEE 1QJHA 2V4QA 1LKZA 1S1XA 1HW9A 1YLXA 4ELTA 3KLHB 1QY7A 2CXEA 2FHJA 3CCWA 1E3HA 1J5OA 2CJKA 4JV1A 3MMAA 3KG4A 3TAMB 1FX2A 5K36C 3QZ8A 4Y65A 4JI8I 4YB7A 1Q95G 5CZXA 5HP1B 2YH0A 2IJNA 1UVLA 4NEYA 3CNQP 4CLLA 3S01A 1HYSB 4U6PA 4JV5E 4F36A 3T19A 1WC0A 5GVQA 3HT0A 2HPUA 3EJMA 3TR5A 1SQEA 4MU1A 4JYAJ 3J80Q 1M90T 5AXLA 2KFNA 1IKXA 2E9ZA 3SCIE 1VLYA 3CUNA 5K36B 3IR6B 3I0RA 5IT9U 4ED4A 3M8ZA 2IERA 3KKFA 4EUVA 2PO2A 3D0HE 1Q4RA 3DC2A 1U1OA 2ATLA 4EI2A 1IWGA 1FF2A 1FKPA 3T5KA 4IO1A 2F1DA 4DSJA 2Z0GA 1AFJA 4DQIA 2PNMA 3TOQA 4ZDNA 3VR1A 3HD2A 3V2UC 5C0XE 4M1KA 2WZ1A 3DLGA 3KTQA 1WI8A 1WWHA 4TNOA 3H0PA 1VRUA 4OHZA 3RB3A 3FCWA 4XAKA 2E5LE 3J81U 5CXTA 3AA9A 5FDLB 2I8EA 2GVZA 4TU9A 3MCNA 4G6VB 3T5JA 1V5IB 2IDLA 2G1HA 3IG1A 4K4SA 4LR7A 5D6GA 3FGVA 2RJZA 1N4LA 5JEAD 3CMQA 4C2MA 1Z2LA 1CEZA 3PR5B 1RTDA 2AU0A 1A6FA 1Q0NA 4LREA 5A2QQ 3TEHB 2LA6A 4QPTA 2AE8A 5DROA 3D3CJ 1CULA 4LF8I 4GO5X 4NL5A 4ZHRB 1QAYA 3MMJA 5K36D 2B8QA 2CQ3A 2XS5A 1N33J 2LFVA 1RT4B 1RCXB 5L3JA 2UXBJ 2R7UA 4LFCI 2CZVC 1VQOS 4IH5A 4RW7B 4B9SA 4FP9A 4K4TA 2HHVA 4S0MA 1PKUA 2RHSB 2GQQA 1Q79A 1IM4A 2XHCA 1FJGE 2B4PA 2ZM6F 2ROEA 4IH6A 1NU4A 2OSRA 3K85A 4ZVRB 4EFAC 4CO3A 1JXLA 3M6WA 1GMWD 3NNHA 4WJBA 2C37B 3K2YA 4FW4A 3VVUA 2ZD1B 1X4FA 3KLEB 3RW7A 2YNIB 3MD1A 1QZRA 5J2PB 2PMHA 2BJEA 1XJWB 2MKSA 4L76A 1WOPA 3A3OB 3KXDA 4NPOA 2AJQA 4FS2A 2HZCA 4O4GA 1U24A 4J9LA 2FGCA 2DGSA 3VAIA 3T1YJ 1H72C 4DZ6A 4HY1A 3Q22A 2WVFA 3JTNA 2DGWA 2FVSA 1SC4B 2JVRA 2XM3A 5GAEI 4MH8A 3FQLA 4DR6F 2UXDJ 3ZZZA 4CM0A 2IJRA 1XMQJ 4PRFA 5LMNF 1R0AB 2J7UA 4F4KA 3MEGB 4DWIA 3BM7A 4Z37A 4KHPF 2A6MA 1S76D 2OPSA 4DL0C 4Q45A 4OYWA 4X4RA 2QMXA 3PYDA 1R27B 4DUYE 1VISA 5IV4A 4WFXA 3E2EA 1BC6A 3IS9B 1VHFA 1FDDA 3C16A 4B3OB 3A8IA 4G1QB 2O66A 4C7QA 4KHRA 1FFGB 3UI3A 3M2RA 4P74A 1WSRA 1VC5A 4YEAA 4DR7I 2GHVC 2YNGB 4MMOA 2P9GA 5F8HA 1LWFB 1S1WB 2XLIA 4MK8A 2OTJS 4RNMA 3GPAA 3NP5A 3CMAS 2M7SA 3R6GB 3KJFB 2DR8A 3H59A 1S0MA 1NKCA 4DL5A 3ZZYA 2K7KA 4DQRA 2QFIA 3F73A 3BQ0A 2AYGA 1S6PA 3W66A 3QO9A 2RUSA 3CJKA 3HULA 2NXUA 4PG5A 2MEWA 3GILA 1O5JA 2BKPA 2KRRA 2MKKA 3DRYA 3GIJA 1XNRE 3V6DA 1EP4A 2X1BA 4HH1A 4M5LA 3CB4A 5F0UA 2BMBA 2R7SA 4M5NA 5HQMA 3GJQB 3P6YC 1ICEB 4M8LA 3KJQB 3GTYX 2XZDB 4ED0A 1WHXA 1N48A 1FESA 4E2FB 3UPFA 2UVVA 4I67A 1A0OB 4DV3F 4C0OC 2LEBA 1SJRA 2WONA 4NLSA 2N82B 3HJCA 1MNEA 1D1UA 3CEDA 2RKIA 2P6TA 1FK9B 3DN9A 3NS5A 2X7IA 4QWDA 4NZ6A 5F9NA 4A8SA 4KYZA 3T1HF 2OPPA 2NLWA 4CQ1A 2HG4A 4C8KA 2P5VA 3ZO7A 2BJ9A 4FNHA 3SSSA 2OKQA 5C24B 2CQ0A 2DR7A 4P72A 5KFVA 1HBUB 7FDRA 2FJXA 3MFIA 2RF2B 2KJVA 3WX8A 4J37A 1GTHA 1SJ1A 4DPOA 2N4DA 4I4BA 2FD2A 3KLVA 2AEJA 1DAXA 4FYXB 2UVWA 3DLBA 2F3JA 3KUEA 2B6AB 3NGDA 5M2UA 2KXNB 4J91A 4F8RA 4DQPA 2WVBA 2YX1A 3IRWP 3S7RA 4MK9A 4IQMA 3IWXA 2BQRA 2DITA 3BSAA 3MR2A 1S9GA 2CA9A 3PDNA 2HBRB 4DV2E 4JV2A 3KK1A 4BCAA 4RNFA 4HH0A 2RILA 4MU0A 3VGTA 3EVOA 2RVJA 4GKKI 2XLKA 1R6MA 4Y28C 4ED2A 4JI2J 1HNZF 3DFEA 4OYZA 4DV5I 4P6QA 1SUQA 2CPDA 4DN9A 3NMRA 1WEXA 3CJ3A 3UD4P 1VJQA 4DFKA 2KXFA 1V3ZA 1YIJS 4B9MA 3GE9A 2H9ZA 4DV0I 3VAKA 2Y3YA 1X5PA 2HRTA 3U27A 3BN4A 3HJVA 1LWEA 4OYXA 4OHVA 3LGHA 2VONA 2DT9A 2W7AA 4TLRA 4ZPVR 3TO8A 2CAJA 1FVQA 1MROA 3BB5A 1S57A 1UA0A 4LOMA 1GX6A 3RB4A 4OJGA 1CJKB 3UO0A 2CZ9A 1SKWA 3UFCX 2DNZA 3CD0A 2KFZA 3AFGA 4CYUB 3F44A 2E1CA 2O1PA 4QNJA 1TU0B 5AXMA 1SH0A 3K8VA 4HVZA 3CD5A 3AHPA 4IR1A 1N34E 1JQGA 1C1BA 1LOUA 1FX4A 1M5HA 3J7YI 2HK3A 3M2VB 2K3KA 2QEXS 3C14B 4DR1J 2WAQD 4DV6J 3OHAA 1IM6A 1FNMA 4DV4J 1RI7A 2Q3PA 3ZTOA 3CJ5A 2MZ1A 1LEOA 4LQ9A 2ILZA 5IQ6A 3PRBA 2PN6A 1RT2B 5A2QU 3M8WA 3PKYA 3BR9A 3ICLA 1J5EJ 4X64E 1JLGA 3PYFA 5FD1A 3DOMA 3TVKA 1Z0CA 4EU0A 2VESA 1OSCA 2KYXA 1N32I 2G9OA 4HTIA 1UVNA 4K4VA 2LQBA 4LF4E 3WC0A 1Q7LB 1PSDA 4MQYA 1FT8A 4PUOB 4DR3J 3VAFA 4CLWA 2F4VF 1C1CA 4DV7E 1Q7YT 1HNWF 3FRZA 2FDNA 2GJ2A 1S77D 4Q2MA 2EKYA 1PBUA 3MCSA 2FJVA 5HBMA 1DARA 2UUAF 3CWJA 1T8EA 2XSFA 4BDPA 4FWGA 1HR0F 5A8RA 3OLAA 2UXCJ 5IT0A 3N6NA 4ZVGA 4ZPWR 4X62F 1DZ5A 3I4HX 3DRPB 1J2VA 2QL5B 3ENAA 4TYBA 2CPYA 3VF0B 1T9YA 5ADZA 4NXNJ 4KGMA 4B3TF 3Q8SB 4DR2F 4OMFG 1CLFA 3F56A 2E5GA 3LGMA 2B51A 1UA1A 5DZ7A 2VA2A 5BR8E 1PG5B 4CLSA 4F4ZA 1BWVA 4B3SI 3MR3A 2XMTA 4AQYJ 2OI2A 5IWAF 1SPBP 2AT1B 3GIIA 1TL7A 2HFSA 2MLXA 2PO4A 5IM0B 5FWKA 4LBHA 1I5OB 3RR7A 4NBQA 5CYMA 2EFPA 2G4BA 1MMDA 1BD6A 2XO6A 3PTWA 2B5JA 5D4PA 3TNVA 3SI8A 2C3PA 4FF4A 1RCOB 4OI6A 1TQLA 1VDHA 4KKOB 1IBLF 1NHUA 1I94J 5J2NA 4DPWA 2B3TB 3G6ES 4K59A 2FUG9 1ZETA 4H54A 1K1SA 4HLBA 1PO6A 3IGVA 3UVJB 4RW8A 2DRDA 3UNGC 1WG5A 1X8DA 1S1XB 2IYGA 3QAEA 2DPJA 1ZBTA 3R1HA 4U7UK 4HHUA 3OVBA 2GMHA 1J5OB 2ERRA 1NJXA 3VGUA 3QGHA 1H2VZ 3GLJA 3MMAB 2E9TA 1NPKA 3GSDA 2Z30B 1KFSA 2V34A 1RJJA 2AWZA 3JQKA 4FN5A 1EQ0A 2KTQA 1PAEX 3DOLA 1FD2A 2MHEA 3J7ZT 4P52A 3M8RA 4FXVA 5KAKA 4YY3F 1U48A 2HAFA 4LFBI 4TLQA 4MTPA 1NJZA 3DDIA 1HIYA 4Y3CA 3WU6A 1RYSA 4JG4A 1IKXB 2IDEA 3GIRA 3I0RB 4QW9A 4ES1A 4ECZA 3X3UA 2PO2B 3FEZA 4OX9J 3W5YA 3O5TB 5B0EA 1MMNA 3A1YG 1JB0C 3CVKA 3ILLA 3MAQA 4FW6A 1FKPB 2UUCF 4OV6A 5F0WA 4WU3A 2HHHE 4TU7A 4PQUA 5B0GA 3GLLA 2HHWA 1P9QC 1TMMA 2N7CA 4ECRA 4P2FA 5D8HB 3K5MA 2VQFF 1JJ2R 4FF3A 4IFDD 3DLGB 1XNQJ 3KFWX 2I2YA 4JI1I 1VRUB 3ZNJ1 2FHJD 3CJ0A 2ZOFA 5KFOA 1B0TA 4HDHA 5H9FJ 2E29A 2GVZB 2W01A 3D66A 1HQEA 4IO9Q 3IG1B 3M9OB 1I1GA 2NPFA 1DFDA 1F9FA 3BF4A 2JLFA 5KOWA 1RTDB 4U7UD 3JAMC 1Q53A 4B3MJ 2CGEA 1PCAA 3Q6NA 4OZ0A 2YKOA 3H98A 4LSZB 1CULB 1HNXJ 3H2UB 2X36A 2KT2A 4WFYA 1WC1A 4DUZJ 4FKXA 5DRKA 2VV5A 4C6AA 4LBIA 1TKDA 4L73A 3QGPA 3JS9A 1FRJA 3LA0A 2EFQA 1Y6ZA 2ZBRA 5D77A 1ZZFA 2Z5EA 1NM2A 3D9BA 1RUSA 4JI0E 1KHWA 1Z0TA 4I68A 4CM2A 4EO6A 3V6KA 3Q2SC 5GAHU 3C19A 4LF9J 3Q6MA 3D68A 2HZVA 1FEHA 3QQCD 3TI0A 5KFFA 1RA7A 4K4WA 5B0CA 4J9RA 1TK5A 3MPWA 2RS2A 2XSJA 2G1DA 3SCKE 4OYAA 2B7BB 3CJ8A 2DNQA 1OQ3A 3RRGA 3BREA 3KJVB 2CQGA 3M1VA 3L95X 1B7YB 4DSEA 2AW0A 4JYAI 1LV5A 4ZK7M 2MSTA 4G1PA 4F3QA 3A8JA 5EWFA 4GC7A 3BS9A 1WI6A 1IBME 4O4GB 1YX2A 4KGKA 5F8IA 2W9CA 1CQMA 4YR2A 1HL6A 5KFWA 2JRSA 3KLFA 4FDFA 3DLKA 2FLLA 4MKVA 2JNJA 1XR5A 4ECWA 2JJ4D 3FEYB 2BRLA 1PJ6A 2C2OB 3TUZC 3FBFA 1U6FA 2UU9E 4RW9A 2HS4A 2QLFB 2WOMA 2FZKB 3D67A 1S59A 5IQQA 3MR7A 2YX7A 5IXUA 3OTOJ 2OHDA 3R5JB 2GGPA 2X3DA 5A6WA 4YS2A 3SZ2A 1F5BA 1VQ6S 3OLBA 1WF0A 4IH7A 4UW2A 3CTRA 3S6EA 2OPSB 1N33F 3VGSA 2UXBF 5B7WA 2KB2A 2Y1RI 4LFAJ 5HO4A 2OAUA 2CJXB 4YHHE 1WSVA 3C16B 4UY8T 4ECSA 4RLEA 4NZ0A 4MYTA 4PAAA 1WF1A 3K0JA 2WP8A 3IAS9 1VYAA 3GWCA 4O0IA 5HAOA 1O51A 4DI6A 4ICLA 2Q43A 1PJ5A 4MIWA 5HQ8A 5KFDA 4Q43A 3W9IA 4LRDA 4YDDB 3EZUA 3Q86A 4F4XA 1Y9OA 5A8WA 3Q89A 1P8GA 1YWXA 2I0XA 1A9NB 3DRSA 3IC1A 4FYWB 1NK0A 2CRLA 2W2MP 5C2GA 2H51B 2UUWA 1S6PB 1UVIA 3QO9B 2Y0SD 3CJKB 4I2PA 2FVQA 4KJIA 1XMBA 1YJ7A 2LXFA 3ILOA 2EVZA 1S7HA 1VCTA 1BWEA 3HCXA 3MEDA 1EP4B 3V6DB 3CD7A 2CQPA 2ASYA 1O0PA 4LF5I 4M5JA 4JI7E 2UXDF 2GO9A 4NE9C 3QJPA 3OW2R 1KFDA 1XMQF 1JWWA 1IKYA 2WBRA 3NKYA 2XS7A 2FY1A 4WPAA 3KLGA 4TU8A 3FZ2A 1RHMB 2WONB 3I5AA 4LF6I 1ULRA 4DHVA 2JX2A 2PMWA 1QSYA 5KOXA 4U7CA 2RKIB 2BKOA 2ZZNA 2VQEI 3OXLA 2IJFA 2VZ9A 5KFYA 2KZMA 3FMBA 2OPPB 4LUBA 1S99A 2OELA 2Z5BA 1YSJA 3B6BA 3DNCA 1R7IA 2YQ3A 1U25A 1NLKL 3M6VA 2V8VA 3CULA 3W60A 1IWAA 1HW8A 1WNEA 3TX0A 3U1KA 4O3OA 1N5YA 4XK8C 1WC4A 1QDUB 2ZUGA 4Y2KA 3ILIA 2FZGB 2WW8A 4CZCA 4FW5A 4JOUA 2HNZA 4X66J 2JEGA 4B3RE 1N36J 2Z4PA 4I7FA 3ULHA 1Q78A 4KTQA 2Z2MA 1L3TA 1E6YA 2FB0A 3Q8VA 5KTQA 4ECUA 4O3SA 2C39A 4QYRA 1L3KA 4DR5I 1S9GB 3NZKA 1UEUA 1DY3A 2QLXA 2VKZG 3KK1B 1XXEA 4USUA 3BBFA 1V3RA 3P06A 4KGXB 1KR4A 3CT9A 2XMAA 2XNRA 4JI3E 3LW5C 2ZC3A 4NOHA 4DV1F 3LPYA 4J9OA 4B9LA 1SUQB 4N7TA 4U3DA 1NK6A 3HKMA 5F41A 2YWGA 4AIMA 4C8LA 5LMUE 4JV5J 1T03A 4NXMI 1DBDA 2DBBA 1Y11A 1IBKF 1LWEB 2IAJA 1FXDA 2XO7A 3C8YA 3FKBA 2KRBA 2CNKB 1XWLA 2OD4A 1D9AA 1CC8A 2K2PA 2B4OA 2IBKA 4YDXA 2R4FA 1MROB 3HSGA 5KT6A 1VC0A 2H5EA 1VGYA 4JI8E 4QWEA 1HBOA 1RDRA 2AV5A 2E1MC 2Q2EB 1C1BB 5H1SV 1QSSA 4X65J 4P75A 5KG0A 3VALA 1NZ0A 1KKHA 4FPIA 1WUUA 4KAIA 5BYQA 5AT1B 2E5LJ 1K0TA 4USVA 1VMBA 2GA7A 3EDRB 1XR6A 5B0BA 1AROP 5KFAA 1VRQC 4F26A 2IFXA 4CO4A 4MAKA 3NLCA 3DYAA 4JI5J 2RNEA 5KFGA 1FJGI 2ZHAA 2V63A 4PG4A 1YZ7A 2HKEA 1JLGB 4FF2A 1WHVA 3DOMB 4OI2A 3HT3A 5LL6R 1S1UA 1JLQA 3DGPA 2J9DA 2DCUB 3O44A 4GRSA 4G3IA 3EE3A 1G1XA 2GIFA 2XB2D 3M30A 1TVRA 1C1CB 1JNRB 3KNGA 2QN6B 2BR2A 1T3NA 1EZZB 4XPCA 4XO0A 5HBMB 3IN5A 3NGUA 1VHIA 2IM1A 3GQCA 4UF4A 3CCVS 3M7ND 2QO3A 1H38A 5A8RB 1OIAA 3QFWA 1S5ZA 1W25A 1XMOF 1KDNA 4WFAQ 3HO1A 4JI2I 3I87A 2DIVA 3QLHA 4EWTA 2XWYA 4OLPA 3KHHA 2AGQA 2JC0A 4DV5F 3QATA 4ZLPA 3D0GE 3KG0A 2KI2A 1GFWB 2LQ9A 2XHWA 4J9KA 4DV0F 2JLEA 4RWWA 2EG2A 4UZBA 4DFMA 3PRVA 1HQ2A 2MGZA 4LFCE 3WU5A 2YTCA 2HVDA 1OPZA 5IC6B 2XI2A 2GCFA 4X4OA 3RJMB 2QX0A 4DV4F 2G2YA 1REGX 1TL7B 1TR0A 3SQOP 4NZ7A 2AEMA 3OVSA 4TQSA 2HNYA 1WELA 4QU7A 1SL2A 5LL6d 5CYMB 1RT5A 4DX7A 5D4OA 5I3UA 1J5EF 2B5JB 3R5GA 4J90A 3HX9A 4PR6A 3C3LA 3I9V9 4K50A 1U0SA 2CVIA 3HKWA 2JC1A 5J2NB 4DR1I 4DV6I 4ELUA 3G8SA 4TY8A 3TUIC 2J7KA 2BA1D 1KS2A 3AT1B 1TL3A 4LF7F 3HSDA 4DR3F 2DO4A 4RW8B 2VA3A 3UNYA 1RU2A 4PZVA 2ZM6E 4DUYJ 2RHQB 2MQOA 4DL2A 2D41A 4YB6A 1F3VA 4QWCA 4B9TA 5L39A 2UXCF 1H7SA 1LK5A 3EZOA 1H0HB 3DOLB 4CI0B 3HSZA 3K7RA 3CCUS 1KBRA 5EHHA 5T7LA 3DXSX 1C4CA 5F8GA 3D4JA 4CLPA 3JYTA 4OZ1A 1U0HA 3BQ2A 2MY7A 3GFHA 2R3VA 4ZP6A 4F2RA 3IO1A 1C0UA 5I3PA 1NB2A 1JJHA 4K0KI 5LOQA 4ZVFA 3ZZ0A 4MU3A 4AQYF 1AT1B 1RLCL 3CJ2A 3LWLA 3OHBA 1Z59A 3BPSP 4TY9A 4L3KA 2O5DA 3OD2A 2MXYA 4HKQA 3EGZA 4ALZA 1RHYA 1FRXA 4NXNI 2L08A 4PQUB 2PD1A 2R2TA 3LQVA 3QAUA 1R8AA 3S8SA 3TQEA 2DKOB 4WP9A 4A8XA 2V94A 1SC6A 1XN9A 4JV0A 2PSZA 3D6TB 3IBFB 4OJHA 2E5JA 3RW6A 2Z5CA 1D8ZA 1EETA 2BKNA 1KQFB 4PWDA 1IVZA 3EMTA 4U3BA 2KHCA 1HQEB 2DR6A 3KOAA 4ATNA 4LRCA 4OYBA 4QIFA 1NDCA 4MIBA 4ENOA 2VFSA 4F0KA 3OPKA 1LW0A 4ZMMA 2C2EA 1VK3A 3I96A 4F50A 3AA8A 4FW7A 1CPZA 2ROPA 2NUUG 3KK2A 2OD6A 2N3LA 2DJWA 3GSIA 5JXSA 1U02A 5KFCA 1M1KT 4QIWD 2YY3A 4FW3A 2ZWOA 5JMNA 4UQGA 2YWHA 4RO0A 2X3GA 2DVIA 1SH3A 1UVJA 2DHXA 3CDEA 1Y00A 2RAQA 3V5RA 2BQ3A 4I3HA 1UFWA 3QRRA 3OUYA 4EBEA 3OFHA 5L46A 3G6XA 3CC7S 3DM2A 4ELVA 5KG4A 3PFOA 3BBBA 5J1EA 3W64A 4HHJA 3GCMA 3CCRS 1XQIA 5LSLA 4F0MA 3BH7B 2XSJB 4DV2J 2JT2A 2AF6A 4IZKA 4OFZA 4F2SA 2OH2A 3BN7A 1GMUA 1BY9A 4ZP7A 2JEBA 3DDKA 3M1VB 3HHLA 4LFBF 1RZMA 2VPYB 3CGIA 2R9LA 3RR8A 1VRTA 1WKJA 4QNKA 1RKIA 5L1KA 3LTOA 5EWGA 1N34I 1XNQF 3IGNA 2F8HA 4K4YA 2O1UA 2W9CB 2L48A 3KLFB 3DLKB 1FKAF 4QW8A 3PJWA 3GYNA 3H4BA 1IUJA 1QUPA 1D8YA 1OPIA 1D09B 1UL3A 1RA6A 3OSPA 4RW9B 5BJRA 3M7NG 2X1FA 1GK8A 1C2PA 2GGPB 4B3MF 3I82A 3UQSA 1JX4A 2CJQA 4QR1A 2QL9B 2VFUA 2ZJRQ 5JUMA 1HNXF 4GKKE 2QMWA 3Q2TC 3CF5Q 1JLEA 3NNCA 2FY8A 4DUZF 3K5OA 4DZDA 5KFIA 1D9DA 2CPHA 3PZPA 4YOEA 1BMQB 1G4CA 4H4KA 2FVRA 3MURP 2WP8B 4DV7I 5GMEA 1NHVA 5THWA 4ICLB 2V2QA 4NLPA 4M5DA 1GEHA 3MF5A 4X64J 5T41A 3Q83A 5A8WB 5F3ZA 4P10A 4DR6J 1ELOA 4RU2A 3B54A 3LANA 3ENWA 3DRSB 5DM6Q 1MG7A 1U2RA 5LMNJ 3RBXA 3JQJA 2H5IB 4RW6A 2JOQA 3U1YA 3W8GA 4I2PB 4C0HA 1IQZA 3IR5B 2BA1G 2COLA 3JAMY 4LF9I 1H2TZ 4KHPJ 1ZAVA 4ECQA 3UW1A 1RWKB 4KO0A 5BR8I 3MEDB 4D3HA 2W1BA 2VASA 3FSXA 1FA0A 2QGFB 1GXTA 3QRQA 4URSA 1ZPWX 3WQPA 3OTOF 1U7LA 3BGOP 1QAXA 5AXKA 1YJ9S 1N32E 1IKYB 1KNZA 1BUXA 3SCLE 2VJUA 5CYJA 3KLGB 1VBKA 3EVMA 2GZOA 1ZOTA 2MQMA 1YRTA 3DLLQ 2HHQA 1DURA 3N9UC 1CC7A 4R0EA 4C3LA 1EHWA 3TZWA 1IKVA 2EI5A 4LRAA 2PC6A 1TKXA 3EICA 4Y34A 4CLKA 4IFYA 4JI6I 2Z58B 5CCMA 2NN6E 2FJAB 2C3OA 2RU3A 3DKDA 4IQXA 1CSJA 2Z5BB 3B4MA 1IBCB 4B9UA 3HPOA 3U1MA 4J9SA 4WP3A 4IOAQ 4LIWA 2Z2ZA 4ANDA 3TA0A 1BQXA 4Y00A 3TZZA 3UDCA 4OI0A 1N5YB 3HXMA 3NGSA 4OO1F 3UR0A 4LFAI 3UR3C 5ETNA 4AD6A 5E7OB 5CD4A 3H5UA 3WZ0A 2HNZB 4PPZA 1GNKA 3PYEA 1RHKB 1IXKA 1S1VA 4I7FB 2DTJA 2GJIA 3SCJE 3TA1A 1E6YB 3UWTA 2OO4A 2UZAA 1F9HA 1EJ7L 2C39B 1DHMA 1H98A 2DNKA 3I5BA 2A0FB 4ED3A 1ZPVA 3TUPA 2ZBIA 2BW2A 1WG1A 4JI4E 2OP5A 1PC4A 3SXLA 4ANCA 1LNQA 3OJSA 2BXJA 1GAOA 5DRRA 4B3TE 1U8SA 3D0IE 4ECVA 3PJXA 4UZCA 3CJRA 4P2MA 1VFJA 3CCES 3T1HJ 1OS5A 3ZKDA 4PXCA 1T03B 1RAIB 1HWKA 1UDQA 4AXJA 4DPYA 2ADBA 3N4WA 2IAJB 2RE1A 2HQFA 2PIIA 5KT2A 4QQBA 4P2XA 4R25A 4YUDA 3RUBL 4WU2A 2WNRA 4A8KA 3DGVA 3AQPA 1HD1A 1MX0A 2MKYA 3F0NA 3I32A 2C38A 3HD1A 3R2CJ 1JXVA 3R5DA 1IBLE 1FRHA 2B43A 5L38A 5ETMA 1HBOB 1S9EA 2JH3A 1HI8A 5AXNA 1DJ0A 1RACB 2KVIA 4F3MA 5IT4A 1J27A 3QNWB 1BLUA 2ZHOA 4LF6F 4LR8A 3BSNA 3S1TA 1ZTWA 2R2RA 2B56A 1U1LA 4X66F 2VBXA 3NCPA 3J80C 1B3TA 1LXNA 2VQEF 2AJFE 4K8RA 2XZTB 4LQ3A 4DXLA 2L9DA 2LP4A 3MDFA 3KHGA 3DYAB 2HQDA 5KG5A 1U8WA 3OR1A 4PG7A 2LQ8A 3CDAA 3D1HA 4H4OA 1T9XA 5E3CA 2XULA 2CVEA 1S1UB 3TVZA 4YQWA 1JLQB 3DGPB 2VJVA 2VG7A 1QVGR 3N6MA 2VFVA 1CBKA 1FFWB 4JV5F 3M30B 1TVRB 2IMWP 2QSFA 2QA2A 3EZ5A 1N36I 4XIUA 4B9NA 2BR2B 1UWAA 3SFGA 4JI1E 5FJ4A 2OTLS 2UUBI 2GW8A 3RAMA 1ZTTA 3J7AG 1YJTA 3H5YA 4GKJJ 2CDRB 1P6TA 3CCJS 4KH1B 3FSIA 1RWUA 1H7XA 2WW4A 2DH9A 3QLHB 4QIEA 2AZ3A 5MAOA 5A2QC 1NH7A 1R6YA 5DRQA 1OSDA 3Q8QB 2E7WA 1OYDA 5KG6A 3PW2A 1YGYA 4QR2A 3H2LA 1NXIA 4F0HA 2MGZB 5C0XF 5FLXY 3DDNA 2F9DA 4DL3A 2WBMA 1IBMJ 4DX5A 2OSQA 3VVTA 4I69A 4KBIA 2E5LF 1VBYA 3VWSA 2F4VJ 3ZXWA 5DRPA 3P5TL 2HNYB 2AGPA 1JIHA 3CC2S 3HLUA 4NASA 1D6TA 1RT5B 4PG6A 3OJUA 2D7SA 5I3UB 3VAGA 4OJ3A 1EARA 3T3FA 1HR0J 2JEAA 3NXZA 4QR0A 1LWCA 4X65I 4IOBA 3GG0A 4AL5A 2AJ0A 4X62J 1UKUA 1RT6A 4OYIA 4JYAE 2R7TA 4TY8B 4BA1A 1C4AA 1TL3B 1U6ZA 4RBUA 4ID5A 2F7VA 5ETKA 4YHHJ 4C9DA 4ZA1A 1RAJA 2F8EX 3SMZA 3N5BA 1N5TA 5LXYA 5IV3A 1FJGF 5HMZA 4FS1A 1UEVA 5IWAJ 1SJQA 1PYOB 3K59A 2P6SA 9RUBA 1M5VC 4CH7A 3KK3A 4UTGA 2NZCA 2VBWA 3PY8A 5T7LB 1NEEA 1TFWA 4JI7I 4NYPA 3DOKA 2IYIA 1H74A 2AKWB 4IYQA 3KDNA 3JYTB 1U0HB 1RSCA 2VF3A 3MMBA 1TUGB 3HP6A 2XMJA 3WIVA 2B9YA 1C0UB 1H2UX 4U96A 3ETOA 2MQQA 4TKTA 3SV4A 4ECXA 4F4WA 4LIRA 4WKYA 3CDJA 4EO8A 2V9KA 4F7VA 3ZC4A 3HHEA 3R7NB 3U1LA 1E3PA 4NLOA 3CWVA 1X60A 3OV7A 4AYBD 2AJ4A 2XZWA 5HVFA 4EK2A 4Y2MA 3G86A 1PAUB 4HXZA 3NRBA 4DR4I 2UXBE 2BA9A 3FQKA 4JUZA 4CO2A 3M4XA 1K9MT 3TVYA 4OO1A 2Z5CB 1EETB 5M2PA 4YY3J 1U2FA 4PWDB 2IVYA 3BH6B 5KFLA 3Q8PB 3LP0A 1KTVA 4DUYF 3HVTA 1LW0B 4N3OA 4B3RI 2QMUB 2KN4A 4ECTA 4TYAA 1B0PA 2JEIA 1Y4UA 1YZ6A
chains in the Genus database with same CATH topology
2HK3A 4JI0E 2XEXA 1XHKA 1Z0TA 5LMNI 2O1TA 4HYMA 4LF9E 4XTJA 4LF5E 4DR1E 1Z5BA 3Q1QA 4JI8E 4DV6E 1FWLA 3Q6MA 3B78A 2UUAI 2UUCE 4AQYE 2Q2EB 3V5RA 1QZRA 2ZITA 4I3HA 4X65E 4DU7A 4IZJB 1FNMA 2V8PA 1MX0A 1HR0I 3F0NA 4JI3I 1IBLE 1NZ0A 4USMA 3H4LA 4X62I 2IOQA 1N33I 2O1VA 2VQFE 3T1YE 4B3MI 1KKHA 4JV5I 1WUUA 4JI4I 2UXBI 1H72C 1HNXI 4JYAI 5GMDA 2DEJA 4DR7E 1XMOI 4HY1A 1HK7A 4X64E 4FWDA 4IZKA 1HNZE 4B3TI 4DR2I 3PYFA 1PVGA 3GONA 1Z0GA 4Z7YA 5FLXC 1IBME 1Z0CA 4JI5E 4DUZI 1N32I 2UXDE 1FJGI 4LF4E 2BM0A 3J80C 4B3SE 2HKEA 4IZKB 4DV1E 4PU9A 3ZZUA 3LTOA 2GQ0A 2A2DA 4DXLA 5LL6R 1N34I 4DV7E 4WUBA 2UU9E 2O1UA 1USUA 1DARA 4JI6E 1B62A 4K0KE 1Z0BA 4DV4I 4FWGA 4DU8A 4WUCA 1IBKE 1ZXNA 3PYDA 4DUYE 3QT5A 1VISA 1S4EA 1Z0VA 2HHHI 5IT9C 1IBLI 1UEKA 2DEIA 4URLA 3T1YI 4LFAE 1RREA 4NXNE 1N36I 1B63A 1J5EI 2E5LI 1PKPA 4GKKE 4DV2I 2E1RA 4JI1E 1EA6A 2UUBI 4DR5E 4YHHE 4DR7I 1EI1A 1N0VC 4IZJD 2EFGA 4JI2I 3J7AG 4GKJE 4WUDA 4MYTA 3JAMQ 4JI5I 2UXDI 2PNLA 5BR8E 4B3SI 4LF7I 4DV3I 4DR3I 2WW4A 2OI2A 4DPUA 4PRXA 3WU4A 1XMQI 4DR4E 5FWKA 2HFSA 4DV7I 5GMEA 3B8HA 5IT9Q 4NXME 3J7AM 2ZBKB 4R1FA 4LFCE 3WU5A 2V2QA 5A2QC 3OTOI 1KVKA 5LMUI 3J81C 4LF6E 3HULA 2UXCI 4YY3I 2HK2A 3T1HI 4LFBE 4DR6E 4X66E 1XNRE 1I94E 2R42A 1ELOA 1H7UA 3WU3A 2VQEE 4DPWA 1XNQE 2F4VE 4EMDA 1HNWE 4FWHA 5LMNE 1MG7A 1U2RA 2LJPA 1FKAE 4KHPE 2UUAE 4JI0I 4UT4A 1D6TA 4GKJI 4LF9I 1Z5CA 4LF5I 1FI4A 4DR1I 4RPFA 1HR0E 4JI7E 4JI8I 4DV6I 1KIJA 2UUCI 1NHIA 2J7KA 2O1WA 3J81Q 4AQYI 4USKA 5BR8I 4X65I 4X62E 1N33E 2ZM6E 4B3ME 4DPTA 4JV5E 5FLXQ 3HJCA 2V34A 1HNXE 4JYAE 4FN5A 2VQFI 1XMOE 1ZM3A 2IOPA 3J80Q 4DR2E 4KQVA 4P52A 1MU5A 4LF6I 2X7IA 1N0UA 4ED4A 1H7SA 1N32E 4X64I 1HNZI 4DV5E 2BV3A 1Y4SA 4LFBI 1IBMI 3WU6A 1I94I 2CG9A 3PRYA 2VQEI 4JG4A 5IWAE 4LF8E 4DV0E 4LF4I 3PYGA 4DV1I 1K47A 1FWKA 2Z5BA 4OX9E 3D4JA 4HACB 4MYUA 4UTGA 2HFUA 2UU9I 4KHPI 2R3VA 4DV4E 4JI6I 4ZVIA 4K0KI 2PNMA 4JI7I 3ZZ0A 1NHHA 3V2UC 2A2CA 1H74A 1ZM9A 2Z5BB 4M1KA 2HHHE 4DPXA 1IBKI 4Z7CA 4DUYI 1H73A 1ZXMA 1Z59A 2HKJA 2VF3A 2ZM6I 1N36E 1J5EE 4B3RE 2E5LE 4DV2E 1RR9A 1ZM2A 2UUBE 1Z5AA 4LFAI 4NXNI 4JI2E 3K17A 4FW9A 4GKKI 1OJ4A 4JI1I 1S16A 4DR5I 4YHHI 3QT7A 3ZM7A 4DV5I 3PYEA 3QT6A 3CWVA 2GS8A 4PRVA 1A6FA 4P7AA 4LF7E 4DV3E 4DR3E 3P06A 5A2QQ 1Z0EA 2AJ4A 1XMQE 5IWAI 1ZM4A 3ZKBA 4JI3E 2NPFA 4LF8I 4DV0I 1USVA 2Z5CA 4HXZA 2V2VA 3JAMC 4OX9I 4DR4I 4JI4E 3OTOE 2UXBE 2CGEA 2BM1A 5LMUE 3Q6NA 5L3JA 4NXMI 4LFCI 4B3TE 2UXCE 4YY3E 3K1JA 2Z5CB 3T1HE 2X36A 4DUZE 3ZKDA 3LPSA 2CZ9A 1KTVA 2V2ZA 1Z0WA 1FJGE 4DR6I 4HACA 4X66I 1XNRI 3LNUA 1NHJA 1PIEA 4N3OA 3K85A 4B3RI 1Y6ZA 4DPYA 3B82A 3ZZTA 1N34E 2Z5EA 1BKNA 1XNQI 2F4VI 3M6AA 1HNWI 4IZJA 1Y4UA 3QT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  4JI0 E;  2XEX A;  1XHK A;  1Z0T A;  5LMN I;  4HYM A;  4LF9 E;  4XTJ A;  4LF5 E;  4DR1 E;  1Z5B A;  3Q1Q A;  4JI8 E;  4DV6 E;  1FWL A;  3B78 A;  2UUA I;  2UUC E;  4AQY E;  2Q2E B;  3V5R A;  1QZR A;  2ZIT A;  4I3H A;  4X65 E;  4DU7 A;  1FNM A;  2V8P A;  1MX0 A;  1HR0 I;  3F0N A;  4JI3 I;  1IBL E;  1NZ0 A;  4USM A;  3H4L A;  4X62 I;  1N33 I;  2VQF E;  3T1Y E;  4B3M I;  1KKH A;  4JV5 I;  1WUU A;  4JI4 I;  2UXB I;  1H72 C;  1HNX I;  4JYA I;  5GMD A;  2DEJ A;  4DR7 E;  1XMO I;  4HY1 A;  4B3T I;  4X64 E;  4FWD A;  1HNZ E;  4DR2 I;  3PYF A;  1PVG A;  3GON A;  1Z0G A;  4Z7Y A;  5FLX C;  1IBM E;  1Z0C A;  4JI5 E;  4DUZ I;  1N32 I;  2UXD E;  1FJG I;  4LF4 E;  2BM0 A;  3J80 C;  4B3S E;  2HKE A;  4DV1 E;  4PU9 A;  3ZZU A;  3LTO A;  2A2D A;  4DXL A;  5LL6 R;  1N34 I;  4DV7 E;  4WUB A;  2UU9 E;  1DAR A;  4JI6 E;  1B62 A;  4K0K E;  1Z0B A;  4DV4 I;  4FWG A;  4DU8 A;  4WUC A;  1IBK E;  1ZXN A;  3PYD A;  4DUY E;  3QT5 A;  1VIS A;  1S4E A;  1Z0V A;  2HHH I;  5IT9 C;  1IBL I;  1UEK A;  2DEI A;  4URL A;  3T1Y I;  4LFA E;  1RRE A;  4NXN E;  1N36 I;  1B63 A;  1J5E I;  2E5L I;  1PKP A;  4GKK E;  4DV2 I;  2E1R A;  4JI1 E;  1EA6 A;  2UUB I;  4DR5 E;  4YHH E;  4DR7 I;  1EI1 A;  1N0V C;  2EFG A;  4JI2 I;  3J7A G;  4GKJ E;  4WUD A;  4MYT A;  3JAM Q;  4JI5 I;  2UXD I;  5BR8 E;  4B3S I;  4LF7 I;  4DV3 I;  4DR3 I;  2WW4 A;  2OI2 A;  4DPU A;  4PRX A;  3WU4 A;  1XMQ I;  4DR4 E;  2HFS A;  4DV7 I;  5GME A;  3B8H A;  5IT9 Q;  4NXM E;  3J7A M;  2ZBK B;  4R1F A;  4LFC E;  3WU5 A;  2V2Q A;  5A2Q C;  3OTO I;  1KVK A;  5LMU I;  3J81 C;  4LF6 E;  3HUL A;  2UXC I;  4YY3 I;  2HK2 A;  3T1H I;  4LFB E;  4DR6 E;  4X66 E;  1XNR E;  1I94 E;  2R42 A;  1ELO A;  1H7U A;  3WU3 A;  2VQE E;  4DPW A;  1XNQ E;  2F4V E;  4EMD A;  1HNW E;  4FWH A;  5LMN E;  1MG7 A;  1U2R A;  2LJP A;  1FKA E;  4KHP E;  2UUA E;  4JI0 I;  4UT4 A;  1D6T A;  4GKJ I;  4LF9 I;  1Z5C A;  4LF5 I;  1FI4 A;  4DR1 I;  4RPF A;  1HR0 E;  4JI7 E;  4JI8 I;  4DV6 I;  1KIJ A;  2UUC I;  1NHI A;  2J7K A;  3J81 Q;  4AQY I;  4USK A;  5BR8 I;  4X65 I;  4X62 E;  1N33 E;  2ZM6 E;  4B3M E;  4DPT A;  4JV5 E;  5FLX Q;  2V34 A;  1HNX E;  4JYA E;  4FN5 A;  2VQF I;  1XMO E;  1ZM3 A;  3J80 Q;  4DR2 E;  4KQV A;  4P52 A;  1MU5 A;  4LF6 I;  2X7I A;  1N0U A;  4ED4 A;  1H7S A;  1N32 E;  4X64 I;  1HNZ I;  4DV5 E;  2BV3 A;  4LFB I;  1IBM I;  3WU6 A;  1I94 I;  2VQE I;  4JG4 A;  5IWA E;  4LF8 E;  4DV0 E;  4LF4 I;  3PYG A;  4DV1 I;  1K47 A;  1FWK A;  4OX9 E;  3D4J A;  4HAC B;  4MYU A;  4UTG A;  2HFU A;  2UU9 I;  4KHP I;  2R3V A;  4DV4 E;  4JI6 I;  4ZVI A;  4K0K I;  4JI7 I;  3ZZ0 A;  1NHH A;  3V2U C;  2A2C A;  1H74 A;  1ZM9 A;  4M1K A;  2HHH E;  4DPX A;  1IBK I;  4Z7C A;  4DUY I;  1H73 A;  1ZXM A;  1Z59 A;  2HKJ A;  2VF3 A;  2ZM6 I;  1N36 E;  1J5E E;  4B3R E;  2E5L E;  4DV2 E;  1RR9 A;  1ZM2 A;  2UUB E;  1Z5A A;  4LFA I;  4NXN I;  4JI2 E;  3K17 A;  4FW9 A;  4GKK I;  1OJ4 A;  4JI1 I;  1S16 A;  4DR5 I;  4YHH I;  3QT7 A;  3ZM7 A;  4DV5 I;  3PYE A;  3QT6 A;  3CWV A;  2GS8 A;  4PRV A;  1A6F A;  4P7A A;  4LF7 E;  4DV3 E;  4DR3 E;  5A2Q Q;  1Z0E A;  2AJ4 A;  1XMQ E;  5IWA I;  1ZM4 A;  3ZKB A;  4JI3 E;  2NPF A;  4LF8 I;  4DV0 I;  4HXZ A;  2V2V A;  3JAM C;  4OX9 I;  4DR4 I;  4JI4 E;  3OTO E;  2UXB E;  5LMU E;  2BM1 A;  5L3J A;  4NXM I;  4LFC I;  4B3T E;  2UXC E;  4YY3 E;  3K1J A;  3T1H E;  2X36 A;  4DUZ E;  3ZKD A;  3LPS A;  2CZ9 A;  1KTV A;  2V2Z A;  1Z0W A;  1FJG E;  4DR6 I;  4HAC A;  4X66 I;  1XNR I;  3LNU A;  1NHJ A;  1PIE A;  4B3R I;  4DPY A;  3B82 A;  3ZZT A;  1N34 E;  1BKN A;  1XNQ I;  2F4V I;  3M6A A;  1HNW I;  3QT8 A; 
#chains in the Genus database with same CATH topology
 5ETO A;  5LT5 A;  3V81 A;  3HKZ D;  1VLO A;  2ZEJ A;  3KK2 B;  5KFQ A;  4LF5 E;  3WDO A;  2CQB A;  1R43 A;  1WHY A;  1JMT A;  1HHQ A;  4DFJ A;  1E6V A;  3H8Y A;  1Q86 T;  1RAO A;  3LAL A;  3N5F A;  4JI3 I;  2DHH A;  2DHG A;  2LXU A;  2IOQ A;  1SH2 A;  3I9Z A;  3T1Y E;  1FDN A;  2QE5 A;  4Q44 A;  1TTH B;  1P1L A;  2VQF J;  3WX4 A;  2V4R A;  3LO3 A;  3OUY B;  3HHL C;  1T0T V;  3J81 j;  1JK9 B;  4C3M A;  3DM2 B;  4LPF A;  3BJY A;  4B17 A;  1IJE B;  5J1E B;  3EYZ A;  4U95 A;  2YBV A;  3UDV A;  2NSC A;  2UXD E;  1UWB A;  3AAW B;  3M7V A;  4YN3 B;  1XNR F;  2A3J A;  2CPE A;  4NLW A;  4IZK B;  4DSK A;  4NLT A;  1GTE A;  3JSY A;  1R0C B;  2JEB B;  1YJW S;  3PEH A;  8ATC B;  3HHL B;  3RB0 A;  2Y1L B;  5C5J A;  1Q81 T;  1TUW A;  1VRT B;  4PG8 A;  3TQ1 A;  2C2M B;  3M9M B;  1TAQ A;  3MM9 A;  3QMQ A;  5LMU J;  1LWX A;  4M95 A;  1KN6 A;  2QLW A;  2HHX A;  1X31 C;  1S4E A;  1Z0V A;  1Q5Y A;  1VQM S;  4RZR A;  1NDP A;  1Y7P A;  4ZVT B;  4X4N A;  4DG1 A;  4O44 A;  3G96 A;  1NND A;  3AOA A;  3AB2 B;  4DR5 E;  4CNY A;  2GAH C;  5E5N A;  3FRY A;  3EVW A;  1NBE B;  4K4Z A;  2CQ4 A;  1S49 A;  3RAQ A;  3J7Z 5;  1VQN S;  4H4K C;  2CZ4 A;  4Y6I A;  2MJU A;  5DDO C;  3JXO A;  4JI8 J;  3RYL A;  1JLE B;  3T6J A;  2F40 A;  4A4J A;  4PRX A;  2B7C B;  3L7Z A;  1RQ0 A;  2V0N A;  4ZPC A;  3UD3 P;  4I6W A;  4IRD A;  3RRH A;  1P42 A;  4NXM E;  3PS3 A;  3U1N A;  4HI1 A;  1KVK A;  4ZN1 A;  1QAJ A;  2HVZ A;  1KD1 T;  3ENV A;  1V9O A;  2BA0 D;  3X1L B;  2HK2 A;  3DRR A;  4ZPD A;  2WB4 A;  4M5M A;  2IVF B;  4M5D B;  2VFT A;  4EZ9 A;  2ILY A;  4IS9 A;  4DV2 F;  1HPZ A;  4W92 B;  5KFH A;  2SXL A;  1NK4 A;  3BO3 A;  3QIP A;  3MPD A;  4PXD A;  4ISA A;  3ZZO A;  3CCL S;  3K58 A;  1JKH A;  3NGT A;  4USK A;  1UVM A;  4Y2I A;  4RW6 B;  2V2K A;  4O0N A;  3LUY A;  4C8N A;  4MJK A;  1RTH A;  2DNM A;  5FLX Q;  5C0X A;  5IT9 Y;  3OQ2 A;  4OHW A;  3KRN A;  4KO0 B;  2XS2 A;  4ZVP B;  2PEB A;  4KQV A;  4FZV A;  2HEK A;  1DTT B;  1K44 A;  2VIH A;  2LU2 A;  3FBB A;  2L3M A;  3PRY A;  5JEA E;  1F60 B;  4CO0 A;  3HHK A;  4LF8 J;  2CJA A;  3EM1 A;  4A47 A;  2RML A;  1N34 F;  2QA4 G;  4HAC B;  3T6B A;  2BOP A;  3TUJ C;  1ROF A;  2H4W B;  4LFC J;  3IM9 A;  5K36 E;  4Y2C A;  3J81 Y;  3P3C A;  1IKV B;  3C2P A;  2QFJ A;  3PVX A;  1TKX B;  1H73 A;  2EPI A;  2CQ2 A;  2DGO A;  2MKJ A;  2ZM6 I;  1PYS B;  4IFY B;  4C98 A;  1WDT A;  4NLY A;  2DR5 A;  4A8M P;  1Z5A A;  3SQG A;  4UOF A;  1WG4 A;  4JI2 E;  3K17 A;  4FW9 A;  5JEA A;  4BWJ A;  4X64 F;  1JLF A;  1BXN A;  2MKH A;  1X5S A;  1NO8 A;  3MUM P;  3D6H B;  5GMK a;  2V8H A;  1RAF B;  1UP1 A;  2IA0 A;  2Y1I A;  2JEF A;  2IHR 1;  4QYZ J;  3CCT A;  2VC0 A;  4LF4 F;  4KHM A;  2OEJ A;  2HQG A;  2M8D B;  3BKF A;  1S1V B;  5GAG U;  2ADC A;  3AJD A;  2MLZ A;  2RU9 A;  5KG3 A;  2PO0 A;  2A10 A;  5CYQ A;  3I31 A;  1IKW A;  1RHJ B;  2YXL A;  3AB4 B;  3MHY A;  1SVD A;  1MN9 A;  3FUY A;  2ZJP Q;  3LPS A;  2IRX A;  4LVO P;  1HMV A;  2M70 A;  4M5I A;  3I6P A;  2GHP A;  4DR6 I;  3BBC A;  1SKR A;  4FXW A;  3H40 A;  1S0N A;  3VAM A;  3B82 A;  1YBA A;  2X1A A;  1GMW A;  3LWM A;  1K73 T;  1Q82 T;  3N28 A;  5LSO A;  4R0J A;  5LMN I;  3DCA A;  1EQM A;  4DR1 E;  4DV6 E;  1YJN S;  1K8A T;  2J0Q D;  2EFV A;  1WTF A;  3QWP A;  1UTA A;  4UY8 5;  2APO A;  2DNN A;  2JWN A;  3ET6 A;  5BR8 F;  4PXB A;  3GV8 B;  3ADA C;  2WNR B;  3GJR B;  1YG0 A;  4KT0 C;  2C38 B;  1RTI A;  1FDB A;  4DR7 J;  1S9E B;  2R7O A;  2ZNY A;  2YX4 A;  5EWE A;  5M2R A;  1EIY B;  1R6L A;  4DSI A;  1YBU A;  1L5U A;  2VBY A;  2OIH A;  4DV1 J;  1RHR B;  7FD1 A;  1NJW A;  4CDI A;  3WHI A;  5HAN A;  2LVW A;  4N77 A;  1AUD A;  3FVY A;  4K0K E;  2QTW A;  2H65 B;  2FJB B;  5CH7 B;  2Y8Y A;  2JZ5 A;  5HSP A;  2YPZ A;  2J9E A;  1QTN B;  2LYV A;  1MWQ A;  5HRO A;  1IBK J;  3SBM A;  3OR1 B;  3HFV A;  3PXG a;  2VG6 A;  1R8B A;  4H4O B;  2QV6 A;  3K5N A;  4IR9 A;  3P49 B;  3OR2 A;  4DS4 A;  1YVF A;  4NXN E;  1Y3J A;  3EUN A;  1DRZ A;  1HI1 A;  2VG7 B;  2VPW B;  3MEC A;  5G0R A;  2CYY A;  5B08 A;  2XMU A;  3P3D A;  2EEY A;  2KT3 A;  5H9F K;  2B4U A;  3FSY A;  1V5V A;  3RBD A;  2NQP A;  5F9L A;  2PNL A;  4MK7 A;  4ANE A;  1VJW A;  5CAA A;  1TK8 A;  4DV3 I;  2NS1 B;  3NS7 B;  2I5J A;  1NK5 A;  3W8P A;  2QIF A;  1N54 B;  1U09 A;  2WRM A;  4QWB A;  4J9U E;  2JL9 A;  2M52 A;  2BA0 G;  2EFO A;  3UN3 A;  4M63 A;  2W2N P;  3THV A;  4AUK A;  3PW4 A;  3N0V A;  2I38 A;  3T1H I;  2XMW A;  2H48 B;  1VQY A;  2HHH F;  1I94 E;  3PW0 A;  1RT1 A;  1T9U A;  5J2Q A;  3D7S B;  5DGB A;  1HFE L;  1OYS A;  1FRK A;  2F8M A;  3VAH A;  3KLI A;  1FRL A;  2GHW A;  3J80 U;  1T9V A;  4Y0F A;  2JE6 A;  1S4F A;  3GG1 A;  4IG0 A;  4P7T A;  2KDO A;  2O1W A;  4UUX A;  2W25 A;  1VQL S;  3SSQ A;  3D1Q A;  2YWE A;  1SCJ B;  4A8Y A;  4N56 A;  4YB5 A;  3O8W A;  2JEA B;  2ALY B;  4GMK A;  1LWC B;  3C66 A;  3ZTR A;  2IOP A;  2GO4 A;  1XMO J;  2F5G A;  4M5K A;  1RYR A;  1MU5 A;  5F8J A;  1U45 A;  4BBY A;  5JVG Q;  1HNZ I;  1RT6 B;  4P71 A;  2P8I A;  2YWF A;  3EX7 B;  2BQU A;  4DV5 J;  4BA1 B;  2NCK L;  1PIL A;  3OTD A;  2Z56 B;  3TAP A;  4ID5 B;  1M5S A;  2YKM A;  4IRK A;  1LFW A;  4KGZ B;  3HHD A;  4DV0 J;  4QPX A;  1K47 A;  4OX9 E;  2PEH A;  2BX6 A;  2CPZ A;  4JI0 F;  1A6L A;  4FVC A;  4GKJ F;  3QYY A;  3IWL A;  2AD9 A;  4GQU A;  4XDD A;  3AJ1 A;  2F1F A;  3KK3 B;  3R5A A;  3HK2 A;  5K5M A;  1H3D A;  3M8S A;  3DLH A;  1T9T A;  2HKJ A;  2WVC A;  3DOK B;  4DMZ A;  4URG A;  3V4I B;  2MLY A;  5HK4 A;  1HWU A;  2E9R X;  2O01 C;  3DU5 A;  4TXS A;  1TEL A;  3MMB B;  3CCZ A;  3ZM7 A;  2E5I A;  1Q8L A;  2V6A A;  3KYL A;  1CQN A;  3QT6 A;  4PRV A;  1IBM F;  1QSL A;  3OSN A;  2V50 A;  3DU6 A;  3AJ2 A;  1NH8 A;  4LF7 J;  2MMY A;  1NSQ A;  2RRB A;  2N7Y A;  2AIR B;  5KT4 A;  2C28 A;  4OO1 C;  3MCO A;  1YHC A;  2V2V A;  1SL0 A;  4FPR A;  4WCE Q;  2FHO B;  2R7Q A;  3DI6 A;  2UU9 F;  1RGV A;  1RBL A;  2C3U A;  4DF4 A;  1AZS A;  2W24 A;  4A46 A;  2I1R A;  3AOB A;  4DUZ E;  4F4A A;  3QZ7 A;  1Z0W A;  1N32 J;  5HVG A;  3G6V A;  1W2B R;  3FCH A;  3AY0 A;  4FXD A;  4OO1 B;  3M8Q A;  4C11 A;  2K8G A;  1X0F A;  1RWO B;  4WZM A;  4RBT A;  2CPX A;  2VDH A;  2J65 A;  4OYM A;  2F4V I;  3O2I A;  3LP0 B;  1HNW I;  1S10 A;  3M85 D;  2XEX A;  1F5A A;  4LF9 E;  3D28 A;  2J6S A;  4YHH F;  4L3N A;  3HVT B;  3Q1Q A;  1M1G A;  2GX8 A;  3OT9 A;  1FWL A;  2UUA I;  4ZLN A;  2FHK A;  1PBA A;  5A2Q Y;  1HR0 I;  3MM6 A;  2HMI A;  3GU0 A;  1NRK A;  3NMA A;  4GO7 X;  2ZH5 A;  2C2Z B;  5KT7 A;  4J9M A;  4X62 I;  4DSL A;  1Y10 A;  2FC9 A;  2MB0 B;  1E6V B;  4JI4 I;  2MZJ A;  2C42 A;  2KFY A;  5GAE U;  2KH9 A;  4DQS A;  1RWP B;  4B3T I;  1MSW D;  1BQM A;  4DR2 I;  4K4X A;  1PJ7 A;  3ZZP A;  2M8H A;  3NOG A;  1RHQ B;  1FVS A;  4PWW A;  2DY9 A;  4WFB Q;  3OXG A;  4C8Y A;  5D0H A;  3CXC R;  4C48 A;  2LQJ A;  3ZZU A;  4B3S J;  3H1C A;  2HVI A;  4QJV A;  4DLG A;  3GR1 A;  2CQ1 A;  2W8K A;  2AMC B;  2FYX A;  1YRX A;  1UWB B;  1Q8B A;  1KSP A;  4JI6 E;  3Q24 A;  1R8P A;  4ZPT R;  5SZT A;  4F25 A;  1QD1 A;  2B9X A;  4F04 B;  3MGJ A;  2AJ2 A;  3D3B J;  4JI7 F;  4OO1 D;  2D9O A;  1S1T A;  2HIQ A;  2XLJ A;  3OFE A;  2JDJ A;  3OBI A;  5A8K A;  2FZC B;  1IBL I;  2DHA A;  5LXR A;  3MM9 B;  4O4R A;  3TJ8 A;  4LFA E;  1RRE A;  4LRB A;  2OUG A;  4WWS A;  1FE0 A;  1PKP A;  2P9C A;  2ZZT A;  4QCL A;  4LCH A;  2PDA A;  4OL8 A;  4DL6 A;  4DG1 B;  4O44 B;  2JSX A;  5HMX A;  4XTT A;  3A4T A;  2XMV A;  2XCA A;  1HWI A;  2MQ8 A;  3P8B B;  5IFM A;  1DQA A;  2M3D A;  1HLW A;  2KJW A;  2HHU A;  1EB0 A;  2E66 A;  4DL7 A;  4A8Q A;  4NML A;  4A8F A;  5I42 A;  1NSA A;  1WEZ A;  2QC3 A;  3ZTQ A;  3T5L A;  4RX6 A;  2PGC A;  3POT A;  5J1P A;  2CPJ A;  1REV A;  4I0W A;  3L7Z B;  4YY3 I;  4ZCI A;  4RUH A;  3DXB A;  2ZH8 A;  4LFB J;  1SB6 A;  2R42 A;  5A6P A;  3H5X A;  1RT7 A;  2UUT A;  3U02 A;  4ZKA A;  1UJ4 A;  4QIV A;  3IWN C;  1OYE A;  4CLY A;  2MKI A;  4ZS6 A;  4NCG A;  4USI A;  3DRR B;  1EX8 A;  5ELW A;  2PO1 A;  1RB0 A;  1VBX A;  5HMY A;  2HIY A;  1XTZ A;  3KMQ A;  1NB7 A;  1FI4 A;  4NA2 A;  5C0X C;  3A3N B;  4M5H A;  1Y5N B;  2UUC I;  1HPZ B;  1V3S A;  2MPU A;  2RIJ A;  3QIP B;  4JI3 F;  3K5P A;  3ITH A;  2HW3 A;  3BGU A;  4K2X A;  3LGN A;  1JKH B;  1H6K X;  4QZV B;  1TMJ A;  3DHX A;  2VQF I;  3HVA A;  1TL5 A;  2LDY A;  3MEE A;  3KDO A;  1G6B A;  5LMU F;  1TKT A;  1RTH B;  2PFD A;  1ZAX A;  3HSJ A;  1JNZ B;  5G4D A;  4JI1 J;  5C0X B;  2FJD B;  5DS7 A;  3T9N A;  2V67 A;  4LJM A;  4DUT A;  4IFD E;  1LXJ A;  1YBT A;  4UUW A;  4AT1 B;  2BDP A;  4UOC A;  1GMV A;  2R8I A;  2CJ9 A;  3OTC A;  4K4U A;  1YHQ S;  3TJA A;  1TFY A;  2BYC A;  4DBQ A;  2LLZ A;  2AYE A;  2RRN A;  4JI8 F;  3MCM A;  1SKS A;  2BVZ A;  2WVD A;  4F4Y A;  3NWG A;  3K57 A;  1NKB A;  5C