1WUUA

Crystal structure of human galactokinase complexed with mgamppnp and galactose
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
391
Chain Sequence
HHAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactokinase
publication title Molecular Structure of Human Galactokinase: IMPLICATIONS FOR TYPE II GALACTOSEMIA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 117
structure length 391
sequence length 393
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.6: Galactokinase.
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
A PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1wuuA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1wuuA01
4LF4I 3Q1QA 3CWVA 2WW4A 4Z7CA 5IWAI 5LMNI 1N32E 4DV1E 4JI0E 4B3MI 1FJGE 4USKA 2DEIA 3PYGA 2A2DA 4DR4I 1Z5CA 2UXCI 4JI3I 4X64E 3ZZTA 4GKKE 4JI1E 1ELOA 4B3TI 4X66I 4JI2E 2LJPA 4DV6I 1IBME 4WUDA 2NPFA 1IBLE 4DUZE 2HK3A 3T1HI 3J80C 3HULA 4JV5I 4EMDA 4X65I 2UUAI 1FKAE 1H74A 3LNUA 2UXBE 2VF3A 1H7UA 4YHHI 1N34I 4LF5I 2F4VE 1I94I 2E5LE 1Z0CA 1K47A 2UUCE 4DV2I 1IBKE 1HR0I 4LFAI 2BM1A 5IT9C 4DPUA 1Z59A 4LFCE 4ZVIA 1N33I 5L3JA 4DR6I 1QZRA 1XNRI 1HNWE 1ZM3A 4JI7I 3K1JA 4HYMA 1ZXNA 2A2CA 4LF8E 4UTGA 1ZXMA 4M1KA 2HFSA 3WU5A 3WU4A 4DV4E 3WU6A 1MX0A 2HKJA 1H7SA 4DV5I 4MYUA 4LF7E 1N32I 4DV1I 4DV3E 1FJGI 1XNQE 2UUBE 5A2QC 3T1YE 4DUYE 4GKKI 4X64I 4JYAE 4JI1I 4JI2I 2HHHE 2HFUA 1ZM2A 1IBMI 3J80Q 4FWHA 4HY1A 1IBLI 2VQFE 2UXBI 1A6FA 1WUUA 3J7AG 4Z7YA 2F4VI 3B8HA 1XMQE 2UUCI 3J7AM 4YY3E 4DV7E 1EA6A 1MG7A 1IBKI 4WUBA 2UU9E 3QT7A 5IT9Q 4PRXA 4JI8E 4GKJE 1KTVA 1KVKA 2HKEA 4LFCI 4P7AA 3OTOI 3PYFA 1XMOE 4DR1E 2VQEI 4USMA 2R42A 4HXZA 2GS8A 1HNWI 2V34A 4I3HA 2UXDE 4JI5E 4LF8I 2BM0A 2EFGA 4DPYA 3JAMC 4FWGA 4LF4E 2V2VA 4AQYI 1PIEA 4NXNE 4FWDA 4B3SE 4LF7I 4DV3I 5A2QQ 4B3ME 1XNQI 2UUBI 4XTJA 5LMUE 3T1YI 4DUYI 2UXCE 4JYAI 4JI3E 2HHHI 1N36E 4B3TE 1ZM9A 3F0NA 1Z0VA 4LF6E 1S4EA 4DR2E 3B78A 4K0KE 1Z0WA 1OJ4A 3QT6A 2ZBKB 2J7KA 4X62E 4URLA 2VQFI 4KQVA 2UUAE 1UEKA 1J5EE 4LFBE 1NHHA 5BR8E 4DPXA 3V5RA 3WU3A 1N0UA 4PRVA 3J81C 4OX9E 4KHPE 1H72C 4DXLA 4DPTA 4B3RE 1B63A 4JI0I 4MYTA 1I94E 1S16A 1XMQI 4JI4E 5LL6R 2BV3A 1NHIA 2ZM6E 4YY3I 2HK2A 1Z5AA 1RR9A 4DV7I 2UU9I 4DV2E 4WUCA 4DUZI 4GKJI 4JI8I 4LFAE 3B82A 3QT8A 4HACA 1XMOI 4DR1I 1N33E 4JG4A 2E1RA 1Z0TA 4JI6E 1HNXE 2E5LI 3ZM7A 1NZ0A 4DV0E 4JI5I 2ZITA 3GONA 3JAMQ 3QT5A 1HNZE 5GMDA 1NHJA 4LF9E 4NXNI 4DV5E 4B3SI 4DR5E 3PYEA 1PVGA 1PKPA 4FW9A 4DR3E 5LMUI 4DR7E 1N36I 5FLXC 4NXME 4LF6I 2OI2A 1VISA 4DR2I 4K0KI 2X7IA 4X62I 1FNMA 2V8PA 1J5EI 4LFBI 5BR8I 3LPSA 3J81Q 4DPWA 4DV4I 1D6TA 1DARA 1U2RA 4OX9I 4KHPI 2XEXA 5IWAE 4B3RI 5LMNE 3D4JA 3ZZUA 2X36A 4JI4I 2V2ZA 4DR4E 2DEJA 2AJ4A 4R1FA 4RPFA 2ZM6I 4X66E 5GMEA 3ZKDA 4DV6E 4DU7A 1B62A 3T1HE 1Z0GA 4JV5E 4X65E 1Z5BA 3M6AA 3OTOE 3ZZ0A 4PU9A 1Z0BA 2VQEE 2CZ9A 4YHHE 1N34E 1MU5A 4LF5E 4JI6I 4ED4A 1HNXI 4UT4A 1EI1A 4DV0I 4HACB 1HNZI 4FN5A 1HR0E 2R3VA 4AQYE 4LF9I 1ZM4A 4DR5I 1Z0EA 1RREA 1KIJA 4DR3I 3K17A 5FLXQ 1H73A 3PYDA 4DR7I 4DU8A 4NXMI 4DR6E 2Q2EB 1FWKA 1FI4A 3LTOA 3ZKBA 1XNRE 4P52A 4JI7E 1N0VC 1BKNA 1XHKA 2UXDI 1KKHA 1FWLA 3V2UC 2V2QA 3H4LA
chains in the Genus database with same CATH superfamily
4QWAA 4CCHA 3FNNA 3VQSA 4DHVA 3N01A 4LRBA 4OL8A 5HI7A 1X60A 2DR9A 3MF5A 1P9YA 1PO6A 1X4FA 2RH3A 2NSBA 2MQ8A 1M5KC 1WDTA 4NYZA 2YX1A 2MQQA 3QYYA 3QLHB 4IFDA 3CJ4A 4JI3J 4X65I 3LALA 2UV8A 2R2SA 2RDDA 4DR2J 3KLFB 3LNUA 4X4UA 4DL3A 3K2YA 4LF5F 3X3UA 3Q8QB 4LBHA 3OV7A 4LT6A 2YNIA 2FHKA 2Z58B 3ENWA 3I87A 4YP3A 4ZVHA 3TAQA 2Q3PA 4E2FB 1KQKA 3BJYA 1FRMA 2VH7A 5C25A 3BDEA 2DGWA 1LWCB 3LUYA 2AF6A 3BYPA 3M30A 3QMQA 1GXUA 1Y60A 1USVA 2ERRA 2HNYA 2DYAA 4IFDC 5DGBA 4ECZA 5M2RA 4DSJA 1WOSA 2A2CA 4NCBA 3OL8A 2RSQA 3C66A 3WU5A 5GAHU 3JTOA 3CD0A 1S9GA 2HKJA 4J91A 1NH7A 1N32I 1G6BA 2ZH3A 4U7UD 1YBTA 1SJ3P 3LQVA 2AEJA 1TFYA 4RBTA 3KFWX 2BJ1A 4XDDA 5DETA 4DR7J 1A9NB 1YX2A 4TLRA 4RKUC 2YPYA 5HROB 1RWNB 3M32B 1BUXA 3TJ8A 3ZNJ1 3CD5A 2ZH9A 2XS5A 3B8HA 2BJEA 3LPEA 1SJ4P 4EGLA 3PKYA 5IWAJ 1U1OA 4WXWA 3GJRB 2XG8A 5CYMA 3PR4A 3KJVB 2E1AA 4M8LA 1WHYA 4J9KA 2DH7A 3T41A 1Q1KA 4DQSA 4OO1B 7FD1A 3MMJA 3T1AA 2VQEI 2MQMA 3DRYA 1TL1B 1OYSA 2IA0A 3R9LA 1WKLA 4HL9A 1J5OB 3HF5A 2UXDE 1LNQA 2I5JA 1VIXA 2JEBA 3GZ7A 4U9RA 1S1XA 2DNRA 2GMLA 3D68A 1PIEA 3D6FB 5JEAB 5KG2A 5IC4B 4N47A 2P9CA 1R6MA 3BN4A 5B08A 3OFHA 2FC9A 3T5KA 1F6TA 2HRUA 1N36E 4NMLA 2O1WA 3JQKA 3B78A 1IKYA 4DL2A 5D4OA 2ZBKB 4KQVA 5DQGA 2QLBB 4XTTA 4Y28C 1RT4A 1CEZA 3I0RA 2PFDA 4PG8A 4DG1B 3LP1B 4Q5VA 3DYAA 2CYYA 4ZP8A 4GKJF 1UDSA 2EG2A 3OFFA 1HNVA 2XY6A 4DR3F 2QIFA 1T03A 2ASLA 2IC3A 1IBLJ 1TL4A 1NPRA 1DTTB 5F8MA 4LUBA 2KYZA 5HJXA 4OZ0A 1HA1A 4ZVQB 4PZVA 2CNNB 1FFSB 4Z37A 1AXQA 1YHQS 2DCUB 4LBPA 4F50A 3BSOA 4QU6A 2KH9A 1Z4UA 2NXUA 4FS2A 1RB0A 3CPWR 3JSBA 5KG3A 4BC9A 1REVB 3AJDA 4OI0A 2C3OA 3A3OB 3BQ1A 3OXFA 1TMMA 4LFBF 5BR8F 3PS2A 2M0GB 1FNMA 2QEXS 4OLPA 2NYHA 1WOOA 3EGZA 1I94F 1UPMB 4OZ5A 3NS5A 2PIIA 4HT7A 2ZUAA 5A2QY 3OR2A 2R7SA 3EDRB 3W5XA 5FDLB 4UUWA 1R0AA 2V4JB 4OJHA 1XNQJ 2QL5B 4IO1A 2E1PA 3C16B 4HLBA 3N9UC 3P3CA 3JSMB 2MLYA 1TKZA 1SL2A 1OQ3A 2XSJB 4DL7A 2CXEA 3G9CA 3CJKB 4JI6I 2J0XA 2BYCA 4HHJA 4UOGA 1IR0A 2RNEA 3KHGA 4WE1A 2L9WA 4LF9F 4OYOA 2LKZA 2AYBA 2X51A 3D1OA 1VC0A 1RTIA 1RLDA 3CC2S 1TKXA 1TK5A 2E1CA 4K4VA 2MKHA 4F8RA 5KG6A 3X1LB 3EPIA 1DHMA 2V5HG 4KV8B 8ATCB 3U1MA 3CWVA 5KFRA 2KG1A 2B7CB 5CHCB 3H2VE 4DV1E 2JFDA 2PNLA 3W9IA 2VJVA 4XK8C 4O4GB 2NR0A 4X66I 3FGVA 3WQPA 2FVRA 5A8RA 4RU2A 5ETMA 1KN6A 4DSLA 4NRTA 4UOCA 4F4ZA 2XLKA 1NK0A 1IWGA 4EWTA 4F02A 4USTA 2XMUA 2NN6B 1HR0F 2CWXA 5D4LA 1QVGR 1RP5A 3F73A 4U7CA 5F3ZA 4ZLLA 3Q2TC 4LFCE 1U4BA 1YRXA 1XNRI 2OELA 7AT1B 1HWLA 2CPZA 2BJDA 3C6TA 2OEMA 1DTQA 2CNKB 3K5MA 2KN4A 2CJYB 3P5TL 5HMYA 1KOOA 5JEAF 1CJTA 3K5NA 2N4DA 2GMJA 1SB6A 3BDPA 1RT2A 2HHHE 4NL5A 1P6TA 3FMBA 3C14B 4F3QA 4K4SA 3JTPA 3T6BA 3F56A 1RBAA 3HHLA 5C24A 3TX8A 4PR6A 4MMOA 4FVCA 1IBCB 1OS5A 3BSNA 3CTRA 1UA0A 2ASDA 2UUCF 3MR3A 4ED7A 4LF1A 3QZ8A 1Z1ZA 4NA2A 1M90T 1RT6A 1CPZA 2JEAB 1MG7A 1S7IA 3GQCA 4ECWA 4FW4A 2WNRB 4WTYA 2GQ2A 3Q0AA 1H2VZ 3DD6A 3OHAA 3UPFA 4ZDNA 4CLLA 3PYFA 4GVBA 1HNWF 3G86A 5F8LA 3DM2B 4M5DA 5EL9A 3BQ2A 4C11A 2VFVA 2PFFB 3HHLC 2XTJP 3TWZA 1FXRA 4USWA 4FWGA 3NY0A 4KHPF 4KGXB 2V2VA 4GQUA 3VWSA 3U02A 1C4CA 1WORA 4FW5A 5AE1A 4FYDA 2JT2A 2BA0G 4JYAF 4DL5A 4M5GA 3H2UB 2MTLA 3P5BP 3VVUA 1VHIA 2CQPA 4K0KE 2DGOA 4EK2A 1A0OB 4W4MA 3CDEA 1VQ8S 3PO4A 1XTZA 4JI7J 4V19X 2G1HA 1K0VA 2CZVC 4DF8A 3AB4B 1XMQF 3FCWA 1UW9A 1VBXA 3ETMA 2I1RA 1B4SA 3AXKA 1K9MT 1PJ5A 5E3RA 2Q79A 5J1PA 4YEAA 4YY3I 2PMHA 4JI0J 4DV2E 2RB7A 3J80U 1C1BA 1F9HA 2FTRA 4IZKB 4GKKJ 1QE1A 4C4WA 1VC5A 3KG4A 3QT8A 4HACA 1IBMJ 5I3QA 1XMOI 2RUGA 1GTHA 1YHCA 4C8YA 2MKYA 2K3KA 2XMTA 4H4MA 3CJSA 2E5IA 4FF4A 3SCIE 4CRJA 5E3AA 3U1LA 4DV0E 1NZ0A 1N54B 4PWDB 4KKOB 4NXNF 3AB2B 2CRLA 4W90B 3MFIA 4Q2MA 2DXFA 1FFWB 4B3TF 5EX3A 4LSLB 3CD7A 2UUAF 2O5DA 2IY5B 4ZJLA 4IH6A 1RHYA 4F04B 1VRUB 5HQMA 3QO9B 4LF8J 2CAJA 5KFIA 2NZ4A 2OPSB 1VQNS 4B3RI 4QW9A 2YNHB 4KFBA 4UZCA 2PO0A 3PR5B 2X36A 1TZ0A 3IP0A 2HLTA 2B9EA 3P06A 5HVGA 4FPRA 2GHPA 2JDJA 4N56A 4DV3J 3K7RA 2R8JA 1RAAB 2W8KA 3H7HB 1Z0GA 2YX7A 4C8OA 4HKQA 3SCKE 4JBCA 3LAMA 3NWGA 3TQEA 4IDKA 3H90A 5IQQA 1Z0BA 4PKDB 2HQGA 1S1WA 2ZC4A 3K8VA 2B9YA 3TVYA 4R5PA 2GO9A 4ZPAA 3OVSA 4A46A 3GJTB 3Q89A 4KGVB 2BACA 3A3PB 3TQ1A 5FLXQ 1OIAA 3ZNUA 1QLNA 2LQ5A 3KLIA 1CS4A 3TZWA 4TY9A 1VCTA 3DLKA 2GAHC 1K0TA 5CH7B 4TYBA 4Y65A 3JAMU 1OSCA 3CXCR 2KT3A 1LFPA 4FYWB 2CPEA 4ED0A 3HKWA 5CD4H 5J2PA 1NCLA 2DEIA 2RMLA 2YKOA 1Z5CA 3B4TA 3ZZTA 2EEYA 4DV6I 4X65F 3DXSX 3ILLA 2CPJA 3R7BB 3D3BJ 3DCAA 2YH1A 1ZAWA 1ZA1B 1FKAE 4XO0A 2WTFA 2BR2A 2XYPB 3KK2B 1RJJA 4JV2A 2CQ4A 1AZSA 2CWKA 2CQBA 5EDWA 3KNGA 4CQ1A 2F4VE 2WB1D 4ZIVA 1Q81T 2YNFB 5K36D 1OY6A 4ECRA 1JXLA 3P49B 3DFEA 3IN5A 3I0SA 4EYIB 1REGX 3R5JB 5DG8A 3FRYA 3JSRA 3O8WA 5IT9C 1RHJB 1YJ9S 1P42A 3UNYA 1N33I 1UTAA 2H48B 3J7A1 3OL6A 3QPIA 4FYYB 2RS2A 1TUWA 3TYTA 3M7VA 2CQIA 2KXFA 2GJ2A 3BV8A 5K5MA 2X3DA 1SKWA 4AFFA 5HJYA 3WU4A 4NLOA 5C0XA 5KOWA 1N32F 2MZQA 4RW4B 3DLGA 3DRSA 2IDEA 2GO3A 4KR0B 4TNOA 1NXIA 4CNYA 1UEUA 3GJQB 2WOMB 4G3IA 4N77A 4WK3A 4ZVPB 1D0EA 3MR2A 4ANCA 1HD0A 3M7NG 1YK9A 2GGPA 5CYJA 2ZUGA 3ET6A 2IDLA 1HMVA 1YKWA 2UXBI 3TUIC 2IAJB 4Y2IA 1EETB 1HW8A 3T19A 1N6QA 3B4DA 4OYPA 1T11A 4WIQA 3ENVA 2Y8WA 1XBWA 3OXLA 5C0XC 5LMNJ 2OKQA 4DCJB 4DV7E 4OHYA 4EU0A 4GC6A 1Q8BA 3MM7A 3V6JA 3AH6A 4J9PA 4P71A 3OTOI 2O01C 1Q0NA 1IKXB 4KY3A 1SC4B 4JV5J 2UP1A 2C28A 1X5OA 5KFHA 3ILOA 3PRBA 2F8MA 2FJDB 4EBDA 2CPXA 2XO7A 2LXIA 5GADU 2EFGA 2FZGB 4DV4F 1X4CA 1V6HA 4WF9Q 4C8LA 2JOQA 2QRRA 2IRYA 3PIOQ 2IESA 1CJVB 2IJRA 1U47A 3DOMB 5KFDA 3PM9A 1VOMA 1Z0VA 2KHDA 3OL9A 2XHWA 1VQOS 3QT6A 4URQU 2Z4PA 1MROB 1LV5A 2GVZA 2ZKUA 1NRKA 4MK7A 4Q2LA 3B6BA 1C1CA 1H72C 2IM1A 4MU1A 2EBEA 2OEKA 3CVKA 1M5OC 3LWLA 4AUKA 4DFKA 1ZETA 1MN7A 3V6KA 5J2MB 4P73A 3N0VA 2Y0BB 4I64A 1FERA 1S57A 4CH1A 2DHAA 3TARA 1S1TA 3RB6A 4DUZJ 5DNLA 2F1FA 3SV4A 3LGHA 4J5OA 1HNXE 4LF4F 2YH0A 2YKQA 3US5A 5IWAF 2QMXA 2Z2LA 1C0TA 4C97A 5L8RC 1K44A 1OY9A 1PKPA 3M85G 4HTIA 1F5AA 3DRXA 5KG1A 3VV2B 2IVMA 2MJNA 2V67A 2COLA 4URGA 2H51B 3TJ9A 3GIJA 1WI8A 1AUSL 4U3BA 1EQ0A 4LSNA 1RT3B 4NOHA 4JUZA 4CO5A 5BJRA 3BF4A 4DN9A 3I56S 1A7GE 1UKUA 1NSQA 1F5BA 4P75A 1HI1A 2GA7A 4J9OA 4LCFA 4ED5A 4JI4I 2W9BB 5GVQA 1IJFB 3E01A 3ELHA 2I38A 4IFYB 1F9EB 3CCJS 1B62A 2DHGA 3T1HE 1RUSA 1IN0A 5I4MA 3TA2A 4LMZA 2KTQA 2RRNA 2BA0D 2HHWA 2VQEE 2NXJA 4JI6F 2OTJS 2VQFJ 2GHVC 4ZIWA 1S48A 3GV7B 2Z5BA 4CTAA 1HNZI 2PD1A 3BZQA 2LXUA 2BOPA 4JB8B 4BA2B 2DHHA 1VQLS 4DPOA 1PYSB 3GR1A 4ISAA 2R7RA 4ZKAA 1HI0P 1YSJA 3G4SS 1KIJA 4NLYA 4XPCA 4NPOA 4LPFA 1YRTA 2Y1IA 4UY85 2Q2EB 1SJ1A 1Y6ZA 3H25A 1EP4B 2J76E 2H1YA 4R8UB 4DR1J 4F7VA 5E7OB 4RUCA 4H4OA 2ZDOA 2BVZA 5ETRA 1SPBP 2IOQA 2LVWA 4O0IA 5F8IA 3GP9A 2OFHX 5DDRC 3MEEB 4RW7B 2BMBA 2AGOA 4EBEA 2KM8C 1KNZA 3MM8B 1PC4A 4X66F 2V8HA 4WPAA 2RF2B 1SC1B 2HHVA 4JI3I 4JI1E 5HQLA 4PXBA 2CJXB 4C3KA 2PSZA 2MLZA 5KFLA 1NB2A 2LQ9A 4H4KA 1FJEB 3RUBL 1CJKA 2DXEA 5A6WA 2XWXA 2AQ4A 3HFKA 1BQXA 1L5UA 1H98A 2RQKA 4OX9J 1WF1A 3W5YA 5K36E 1LWEB 2G0CA 4PQUA 3WIVA 4HHHA 1XNQF 5CCMA 2H5JB 4DSIA 3ONQA 2A18A 1NK5A 4KO0B 1XNRF 1HWKA 2VL1A 4LFAJ 5L3JA 3QFWA 1QD1A 5EWGA 3K1JA 3HSGA 2X1GA 4H4KC 5AT1B 4FPIA 5IOLA 1U6ZA 4Q43A 4A8KA 2LDIA 1FKOA 4X2BA 3H4DA 4AT1B 7FDRA 2CJBA 1FJGI 2ZOFA 1HNIB 2E7XA 3I9ZA 4DZ6A 4DV5J 1BWEA 1OYEA 2ZNZA 1DJ0A 4HY1A 2XM3A 3SQGA 1FTCA 4IS9A 5K36A 1EHWA 2F8HA 2HGLA 5EKWA 1CSJA 2R7TA 1WUUA 5JEAD 2E5LF 1JIHA 3C8YA 5CQGA 2QYGA 3MZIA 3D6TB 1BHNA 3FBFA 4M95A 4DR4J 1U45A 4EYHB 3MPVA 1U02A 1KLNA 2MHNA 4USIA 3HP6A 2Z2MA 4B17A 3UCZP 2GFFA 3IS9B 4ZP6A 1E3HA 4M5KA 3SFGA 2EC2A 5L46A 3FMWA 5F8JA 1D1UA 2OP5A 2O67A 4WFYA 2UVRA 5DDQC 4JI5E 4I2PA 1HBNA 2C3UA 4YHHJ 1RYSA 3PW7A 5FIIA 4QYZJ 2GO8A 2DD8S 3BR8A 3AOBA 2HHPA 1UJ5A 2ADCA 4B3SE 2YWGA 2PC6A 4ZJQA 1UFLA 3JQJA 1TVRB 2UUBI 4MU0A 4DLEA 5D77A 3ZZPA 2NS1B 5KFGA 4JOUA 4RW9A 4U8VA 1KC8T 4M63A 2QV6A 1W25A 4C0HA 2HVEA 4N7TA 4BA1B 4DXLA 5DZ6A 3UE2A 1JLEB 1VIOA 4MYTA 4ERDA 5FWKA 4A47A 4YY3F 1PKUA 1VJQA 2XMJA 1JJ2R 2XCPA 1YH8A 1B70B 5HMZA 4X64J 3W65A 1FWPA 3PS3A 2HGNA 4NBQA 3RR8A 2EC0A 2V94A 3QFHA 5GAEU 4RW8B 1HLWA 5IS2A 3M9NB 2YWEA 5LSRA 3JAMY 3KG0A 4O0NA 2JSXA 2BR0A 1T94A 3FZBA 1S6PA 1B64A 3M7ND 2XI3A 3N5FA 2LA6A 1FNXH 3KK1B 3MR7A 1XXEA 3MPYA 2FQQB 4DR3E 1R8HA 5LMUI 1XMBA 3M8PB 3L7PA 3POTB 4NXME 4L74A 2WSEC 5HATA 2FGOA 3BEGB 4X62I 5LT5A 1EIYB 3ZO7A 4B3RF 3AJ1A 2VBXA 3S8SA 3HFVA 1F0XA 3QJLA 3IM9A 2BA9A 3HVTB 2YKMA 1WACA 2ZM6I 3ZKDA 5D3GB 3WX4A 3MCOA 2QA1A 1CULA 1WSVA 3T1YJ 4DUYJ 2AJQA 1KONA 4NLUA 2HMIA 1LWXA 4QYZK 2MQOA 3MECA 5E33A 3MAQA 1ZTTA 4JI7F 1YTYA 4P2SA 1P8GA 2CZ9A 1RTZA 5K8OA 2X1AA 4WFBQ 2PO2B 3V4IB 2QLFB 2YNGA 3R27A 4MIBA 5CABA 4BBYA 5EGYA 1Y4ZB 2ZE2B 2Q6BA 3UDVA 1RCOB 2OPQB 3R8YA 3KUHA 4JI8J 2P5VA 2YPZA 1HQUB 2R9LA 1FI4A 4NLWA 1EARA 3LP2A 3J7YU 3BGFA 5EWEA 2XULA 2D41A 1X5PA 3CSKA 1RWMB 1VFJA 5IFMA 3T6JA 4RNMA 1FTRA 4FVMA 3L3CA 3OJUA 2POKA 4QQBA 2YWHA 2A2DA 4DV6F 2PO1A 5A0YA 4JI2E 3Q8UA 3IBFB 4B3MJ 1D9DA 2HHSA 4OI1A 5KFOA 2YX4A 5HVFA 2W25A 2LDYA 3HULA 3ITHB 3PHTA 2UXCJ 4ES3A 3R6GB 2D3UA 1MLAA 4LF6J 3EE3A 4Q0BB 3MUVP 3OJSA 4F2SA 2AYMA 2B4VA 4FYXB 3G8QA 2N7CA 3JYTB 1U26A 1S6UA 3QLHA 1FKPB 1YJWS 1H6KX 1Z0CA 5DRPA 2C2MB 2AU0A 4ZS6A 3OFEA 5KFXA 2J9CA 3AT1B 4GC7A 2O1VA 1HBMB 2J8AA 4DV3F 1YZ6A 3J81j 2DNPA 2ATCB 2UZAA 1RLCL 4EBCA 4DR6I 1QZRA 2E29A 1W2BR 1HBOB 1X4BA 1LWCA 5L38A 1Y00A 3IMQJ 1J27A 5D6GA 3UVJB 5D8HB 1LK5A 3MXHP 3HLUA 4K50A 1W26A 1VBZA 1WEXA 3K85A 3DI6A 3RB4A 1OYDA 3DU5A 5H9EJ 4OO1E 2C22A 3UD4P 1RWPB 4FF1A 1L3VA 9RUBA 2UXBF 2VDIA 1S9EA 4B9SA 2EBGA 3MUMP 3DOKB 5HQ8A 4ZHRB 3GIIA 4Z7YA 5JEAE 2L9DA 2K1RB 1SCJB 4J9UE 5HROA 3QGIA 3M32A 5ETLA 4OMFG 3OFGA 3HHNB 2OPPB 2B9XA 1U8SA 2HKEA 5K9FA 4P7AA 1X0FA 2FVSA 2KHCA 2GS8A 1U1PA 3EDQB 2W01A 4RNOA 2FZCB 4OO1A 1VQSA 4ZITA 5KFJA 2DJWA 4LF5J 3I4HX 3OVAA 3H5SA 1H7WA 1TL1A 2ZDPA 3UI3A 4F67A 1J5OA 4NZ6A 2CJQA 4IKAA 2HNDB 2YKNB 5CCLA 1QUVA 4AE5A 2J0WA 4DBQA 2ATLA 4R0EA 4YB6A 2A6MA 2IIHA 3MDFA 4LRAA 4URLA 1RT5B 4CLYA 4KHMA 4NLPA 1J5EE 4DUTA 5DQIA 3WU3A 2O3DA 4JV1A 2H3EB 8AT1B 3W2WB 1KHVA 2ZVIA 1L3TA 4KHPE 1WG4A 1NDPA 5K8PA 1FA0A 4JI0I 4OO1C 3NL0A 3PKMA 1MWZA 3CGIA 2DGUA 5KFTA 5E3QA 1Y11A 4ENOA 1RTDA 3CCTA 5KG4A 4NMXA 4QW8A 3LP1A 3DU6A 1N33E 3VGUA 3CUNA 1NSAA 4KAIA 5H9EK 4J7CA 3KLGB 3MOZA 4M5JA 5DG9A 3AD8C 4WYWA 4YUDA 4RL1A 2CDQA 3QT5A 3VZIA 3OSNA 2WK4A 3FEXB 5LMNF 4PQAA 3CJRA 2HQIA 4DR5E 2ZH5A 4ECXA 2MPUA 5BYQA 2FLNA 1FRHA 3RAMA 2MY7A 3WBZA 2XMMA 1N36I 3G2XA 2MSSA 3KOAA 2Y8YA 1S1UB 4DX8H 4C9DA 3VF0B 5ETTA 2GMHA 5B0CA 3LPSA 1REVA 4TVAB 3JQMA 5AJ3F 3HHEA 2V68A 1F9FA 4JI4F 4B3OB 3THTA 3BO4A 1DAXA 1VLOA 3PEHA 2V2ZA 2XMAA 4PWWA 3EGNA 4X4QA 5GMEA 1NU4A 1YJUA 3UD5A 3MMAA 2D9OA 1QY7A 1APSA 4LRDA 5KFCA 2LU2A 5FDLA 3OTOE 1NZ8A 2XS7A 2V4JA 4ZVGA 1N5SA 1EB0A 4TU8A 2ZBPA 2FLLA 3OUYB 3DDNA 1KLMB 5LM7E 2JH3A 1VQ5S 3C16A 3GWCA 2VPWB 2AMCB 3BKFA 2JFKA 3JSMA 5L1LA 2GNKA 1CQMA 5HP1B 2HHUA 2XSJA 2BKPA 3CCES 5H9FK 2KXHA 1FVSA 2ASYA 2G1DA 4U3DA 3PYDA 4GKJJ 4DU8A 1RYRA 3UN3A 1U1NA 1MWYA 4PXDA 1BKNA 3V81B 2JEGA 1JJHA 1D8YA 2RJZA 1IKVA 2ZD1B 3Q1QA 2QA4G 2NN6E 1VMBA 2KO1A 3ETOA 4KJIA 1KP6A 1BE4A 4KPYA 2BE7D 3VAHA 4N41A 3PYGA 2CPFA 2C38A 2LFVA 2RVJA 2DNNA 4OLOA 4CT8A 4M94A 2HK3A 3GCWP 3J80C 2W4PA 2CGEA 1T3NA 3CDAA 4DSKA 1H74A 4ZVTB 1ZZNA 1RT1B 4FKXA 2EKYA 1RHMB 3AA9A 1X31C 4LFBJ 2I8EA 5BR8J 1IJEB 1LXJA 2KJWA 1WTBA 3P3EA 2QYCA 2LYVA 4ED2A 1O8BA 1I94J 1IBKE 1GMWD 2F63A 2RIJA 5LXYA 1RU2A 2BM1A 3GFZA 2HBQB 1IUJA 4ILLA 4CI0B 1KVJA 2NN6A 2AT1B 4KQZA 1NPKA 3IBCB 3KJQB 5KFPA 1SJRA 1D9FA 1HD1A 3QAUA 1UJ4A 4N5SA 2B8QA 1U2FA 4UTGA 4QR0A 1R8PA 2ZWOA 3BBBA 2NYIA 1N5QA 3IGVA 4YN3B 4NI2B 5IQ6A 5LJ5Y 3S01A 5KFNA 1FJGF 1HBUB 4WP9A 4F4AA 4DV1I 2QA4S 4ES2A 4LF9J 3J7Z5 5LSLA 1T02A 5I3UB 4NZ0A 2HS0A 4NLGA 3OR1A 1B0VA 3QRQA 4DR1F 2NN6C 2IYIA 3BGRB 1Y5LB 1Q95G 3C14A 3J7AG 1UA1A 1Q78A 1S99A 1WJ9A 1H7XA 4PAAA 3P8BB 3UN5A 3F44A 1JLCB 2B7BB 2UU9E 2EI5A 2R2TA 2BJ7A 1RAJA 1VQYA 1R0BG 5IT9Q 4P2FA 1KVKA 3VCDA 4LFCI 3J7AN 3UDEA 4USUA 5FD1A 2E9ZA 2KYXA 2JEAA 3RR7A 3IG1B 2WNRA 1NO8A 3VAGA 2HFOA 3UR0A 3HD1A 4DPYA 4EZ6A 3JAMC 3DM2A 2DH8A 2V69A 2Y9HA 1YBUA 4KH1B 4RBVA 5C7PA 2UUBF 4J9RA 1NJIT 3MEKA 2RHSB 1HR0J 4XTJA 4LSZB 5B7WA 2V9KA 4JI3E 3FEYB 2HHHI 2YWKA 2LMIA 1LWFA 4LIWA 3UN2A 3FFIB 4DR2E 4I0WA 5G0RB 4PUOB 3HVAA 2KRRA 3GIRA 1NHHA 2RQ4A 2A1BA 3J81C 2AJFE 4V1Ak 3VAKA 2CPDA 3EVMA 5K14B 3HKMA 4MKVA 4NASA 4MAKA 1S12A 2W2MP 1YLXA 2K06A 2HFZA 4DUZI 1NK4A 3UHMA 1EJ7L 1YVFA 3L95X 1QJHA 1HFEL 1RAHB 5CYQB 5CYMB 1O0PA 2K7JA 3PIPQ 4JG4A 1FO1A 4WIIA 4IZKA 4I68A 3UR3C 1AW0A 4CT9A 3KLEB 2ILYA 1LEOA 1UWAA 5GMDA 1QTMA 3MCNA 2UUCJ 2PEHA 5LMUF 1VGYA 1MWQA 5DROA 4P7TA 5J1EB 4UQTA 2HIQA 3OTDA 3LGNA 4KKOA 4DR7E 3OL7A 4K0KI 3HKZD 5IT4A 2ZH1A 2KU7A 4RW6B 3PACA 3PFEA 1HNWJ 1M1GA 4WWSA 3FK4A 3GR0A 4LSLA 1TL7A 3GFHA 1IKYB 5IWAE 1VRQC 3CCLS 4L6V3 2ZM6F 4FBTA 2DEJA 1TU0B 4LF7J 1I1GA 3QO9A 4WYLA 2OPSA 2MGZB 4JYAJ 2YNHA 3GV8B 3I82A 2QN6B 2V8VA 4ZVOB 3BGOP 4Y3CA 3HSZA 1NHUA 3PV8A 1BQNB 1R8CA 3R2CJ 4UT4A 1SC6A 4DV0I 1T03B 2IC3B 2AEFA 4FF3A 2FD2A 3D54A 3CMES 4DWIA 3K89A 4ED6A 3MM6B 2GQQA 5D0GA 1XMQJ 1WEYA 1UDQA 5F0WA 1SH3A 3MFHA 1U49A 3LANA 4XPEA 2PA3A 3KG1A 4LR9A 3MD1A 4J3DA 1LQ9A 2JJ4D 2F3JA 1T3OA 4M5IA 1ACMB 2F40A 3ISNC 1N5YA 3OW2R 4A8SA 4KPCA 3EXCX 4DDFA 2AD9A 4NXNJ 2P6TA 2E7VA 3I4PA 1ELOA 3AFGA 2H5IB 2NPFA 1IBLE 3SFUA 2RKIA 2FJEB 3PJ9A 1TMJA 4EMDA 3FCVA 2C2RA 4B3TJ 4PEOA 1NDKA 1ZPVA 1R0AB 4CO2A 3DN9A 3QATA 2PI4A 3KKFA 4URSA 3O6QA 3A1YG 1TP7A 2UUAJ 3AXMA 2MKSA 3T9NA 4IFDF 1JLFB 2WVFA 4L3KA 4AQYF 1KQSR 2KKHA 2DB1A 4Y2CA 2LA4A 3D6HB 4A8XA 3HJVA 1I6JA 4LFAI 5BYSA 2YNFA 1RBLA 1Z59A 4ZVIA 2X3GA 4ETXA 4ZPCA 2HNZB 5DM7Q 1VDHA 2WVDA 1KQFB 2QJ3A 1ZXNA 1EZZB 1KR4A 5CD4A 2WP8A 1B0TA 2GJIA 4M1KA 2K3IA 3Q24A 4ZVUB 1G4CA 4DV5I 2BBEA 5GAGI 1XNQE 5FLXY 2GIFA 4TLQA 5B0BA 1GEHA 3OQ2A 3MAAB 2VPXB 3KJFB 3H59A 2QTWA 1ZM2A 3NS7B 4ZVSB 1T9YA 3D67A 4RW4A 2J5AA 3SI8A 1HYSB 3HZEA 1IR2A 2H5EA 4QIEA 2UVUA 3CDWA 3M8WA 2DXDA 4TY8B 1UCNA 3DMJB 2F4VI 2APOA 3PHEA 2QFJA 4IRDA 2N82B 1TAQA 1S4FA 4LR7A 2ZWPA 3J7AM 2IAJA 3BQ0A 4WUBA 1YGYA 4IZJD 3D7SB 1JX4A 1EETA 4TKTA 3BPDA 1V9OA 5KFSA 4RLEA 3NZKA 1BC6A 1TUVA 3I6PA 3FKBA 5C42B 2ZOGA 4PG7A 4X65J 2VG7A 1U7LA 1VQ4S 3M2UB 1OMSA 3R5DA 1HHSA 2ROPA 4K4YA 4YR2A 4RNFA 4ZCIA 1NK9A 2HBZB 1OPIA 1ITPA 1WC6A 3BKUA 4IG0B 4CDIA 3DOLB 2KJVA 4XAKA 2GV1A 4ZCKA 1SL1A 3WHIA 4NCGA 2HIYA 2MKIA 1S4EA 4NLQA 2FZKB 1OJ4A 2C2ZB 4FYVB 2J9EA 1CJVA 1UEKA 1NH8A 5L1IA 3CJ8A 1RT2B 3DOMA 1SBRA 3NBPB 4DPXA 1N0UA 3FSXA 4ID8A 2ZZTA 5CAAA 1RBOB 2C2OB 1N52B 5EWFA 2ZBQA 1NPPA 6FD1A 3HHLB 5LL6R 1MROA 4HEA9 1N32J 4DV7I 3CMQA 1F60B 4X4RA 1RACB 1TUGB 5C2GA 4QWCA 3MGJA 1F2GA 1S77D 3ZTPA 4YB1P 5J2MA 2X1BA 3R1HA 2EK1A 3GIMA 2UXDF 3JB9k 1OYRA 3MCMA 2C3PA 2MHEA 5KT6A 3A8KA 4M5DB 4ZCLA 1G7CB 1UW4A 1N36F 1UDOA 4OZEA 2Y3YA 3N5BA 1NK6A 3G96A 1R8BA 2R4FA 3SCLE 2HHTA 1TL3B 1DQAA 3L7ZB 1FK9B 2ZEJA 4BWJA 1N34F 3D3CJ 1U1QA 2JVOA 3WX8A 1DLOB 4I2QB 3OTBA 3W2VB 2ZBRA 5LOQA 4WBFA 4F0KA 4DV4J 3RW6A 1RT3A 4RPFA 1X4HA 4BCAA 1AROP 2UV8G 2WZ1A 3MM5B 1ZS6A 3PFOA 4ZVFA 3H98A 4NA3A 4YDDB 2W9BA 4ES1A 2HVIA 3H1CA 4XDCA 2VONA 4IFYA 1QE1B 4PYAA 1HNXI 4HACB 1NUEA 3S1TA 5MAOA 1KS2A 1GXLA 1UWBA 5D4NA 4H4MB 4BWMA 2OPRB 5D0EA 1FE0A 3TAPA 3TVKA 2FJVA 3D6MB 3RZAA 3GTYX 2M4MA 1QTNB 1U1RA 2BA1G 4BA2A 4OZ1A 2BX6A 1V5IB 2VDHA 4JI7E 3NMRA 2WHOA 2IBOA 2XZTB 3KHHA 2V2QA 3PCOB 3LWMA 4M5MA 4DFPA 1EP4A 5JVGQ 4CO4A 4R8UA 1SI9A 4LF4J 1X5SA 5G4DA 4JI0E 3HJFA 4B3MI 2GIQA 3TZXA 3GILA 1CC7A 2JNJA 5KFEA 2UXCI 4GKKE 1IBME 5IM0A 3MEEA 4RW7A 3MEGB 3T1HI 3FRZA 1RTHB 1VR6A 2DRDA 5AE2A 3MM8A 5B0FA 1RWXB 2RF2A 2EFVA 1NAQA 4LQ3A 3H5UA 4CLZA 3MMBA 4WZQA 3CWJA 4DQIA 3R7SB 4NLXA 4RUHA 1ULRA 4I6AA 4IDKB 2MKKA 2K2PA 1M5VC 2VV5A 1JLBB 2XY7A 1HWUA 3ZTQA 5DM6Q 1VK8A 2J0QD 3CF5Q 1XN9A 2QL9B 4CLSA 1Y4UA 1RABB 1LWEA 2XMKA 2CA9A 2HRYA 4ZP7A 5MLCV 4KGKA 3BM7A 2OIHA 1RQ0A 4LF8E 4F26A 3G87A 2HQCA 4JI6J 4KO0A 2RRBA 2CADA 3KLIB 4F4KA 4DV1F 1H7SA 4QZVB 5AE3A 3DLKB 3L7OA 4DV3E 1Q79A 2E9RX 3V6HA 2EVZA 1DURA 3IR6B 4JI1I 3T5LA 4FWHA 2BW7A 4MIAA 3PW4A 4I69A 3SBMA 1HNIA 2U1AA 4EFAC 2CQDA 1RWOB 2J8SA 4ELTA 1I51B 2G2YA 1A6FA 3Q8PB 1I3OB 4F2RA 2G0JA 2G9OA 1MMNA 4ED1A 1TKTB 3L09A 2BR2B 4I6YA 2FIUA 3IWXA 3IAM9 1EA6A 4P9SA 1VC6A 4LFCF 2LXFA 3M2RB 1NM2A 1SKRA 4X66J 2VIHA 1M1HA 4F4YA 1QSLA 3M6UA 4USMA 4HXZA 4A8FA 2CG8A 3GB0A 1KSPA 1U24A 4N3OA 4C48A 5E41A 1BQMA 1BD6A 1D3WA 2H65B 4O3NA 4KRWA 4PRFA 2PNZB 2AWZA 2ROGA 3W9HA 5KT5A 2DT9A 1ZAVA 2HHHF 3M8RA 3UW1A 2BKOA 3DHXA 2D3ZA 3IR7B 2W7PA 2V9WA 5C0XB 3ENAA 3QGGA 4YS2A 3U1NA 5T7LB 2JWNA 1QAJA 4ALZA 2QX0A 5DJBA 2WVEA 3SV3A 1RA7A 4RWXA 2NXCA 1TVRA 1XNRJ 2HW3A 1QVFR 3P76A 1DQ8A 4FW7A 1RHQB 3KLHB 2JLFA 1WEZA 5IT0A 3RTVA 2OJ3A 2GAGC 4KYZA 1NHIA 2VC1A 2DO4A 2VG6B 3NXZA 5SUHA 3CJ2A 4QIVA 3T3FA 3KXDA 1SQEA 1JLEA 4WP8A 5GAHI 2BE2B 3G82B 3J7ZT 4NEZA 3C46A 3QJJA 3NCPA 5DDOC 3PX0A 2DY9A 1URNA 2E1RA 3M1VB 3C2PA 3TANA 2W24A 4K5RA 4LOMA 3ZM7A 4JI5I 1KFDA 1FVQA 4RW8A 2E5LJ 2CQGA 2DHXA 3K5PA 4B3SI 5KT3A 4L73A 1I5OB 4WJBA 2B6AB 1OYPA 4K8RA 1LK7A 4IUFA 3KK3B 1VISA 3GSDA 1UMJA 2Z0GA 3M8ZA 3KK1A 3GJSB 4A8YA 3VAFA 1WSRA 1S7HA 3M8PA 1T9UA 4X4VA 4P6QA 2IM3A 5LMNE 3AD9C 3R1LA 1TL5A 3IAS9 4NRUA 4DV2F 1H3DA 1CJUA 4RNNA 3FSYA 1ZBTA 3NWRA 4EZ9A 3EVOA 4JV5E 4O4RA 5DG7A 4NLDA 4IR1A 4N76A 5D3GA 4CNZA 4DV0F 5IV4A 4DSEA 3KYLA 1FFGB 4CO1A 1HQEA 3E2EA 3LPYA 1D09B 2FVCA 3Q6MA 2V0NA 5RUBA 3MCSA 4YY3J 2PO2A 4K2JA 3V4IA 3UDLA 4DR3I 2K8GA 3I5AA 3TOQA 2MQPA 5LL6d 4NXMI 1NJWA 1C0TB 4P10A 2HVHA 2AJ1A 1TV6B 1AB8A 2ZE2A 3G6ES 2GVDA 2Z5CB 5L1KA 2QSFA 3V2UC 2HAFA 1ZYQA 1RGVA 2M5YA 2GW8A 1KWMA 1MMDA 1N4LA 1HQUA 2FDNA 1QSYA 1KBRA 2H54B 2C1EB 5KFYA 1IQZA 3IXQA 2PO4A 4LSNB 4USKA 4Y2MA 2HYIB 4L72B 3ZC4A 1OO0B 3W60A 4DUZE 2YKPA 1SXLA 1Y9OA 3G6VA 1MU2B 3GYGA 2Z2YB 3E01B 1H7UA 1X8DA 4HH1A 4J9VA 3THVA 1FNOA 2DNYA 3ITHA 1I94I 3CDBA 2JX2A 3AA8A 4Q0BA 4ZN3A 4B3RJ 2ZKTA 4LF7F 3BREA 3D9BA 2QG9B 3JYTA 3THPA 2VFSA 2MZJA 4DPUA 4P74A 2W9CA 4MJKA 3EGWB 3HZGA 1HBMA 2KDOA 4IFDD 2W1BA 1PJ6A 1M5SA 3C19A 2C39B 4O3SA 2FHOB 1NKBA 2HFSA 3TW0A 3A3NB 2WAQD 3O44A 4IH7A 3NNAA 4PWUA 3RBXA 3RJMB 1ZAXA 1HBOA 2W4DA 1SC3B 4B9VA 1NDLA 2VESA 4JI2I 2F9DA 5C0XF 3J80Q 3UVJA 2FYXA 2DNHA 2AW0A 3FBCA 2VQFE 1S6QA 1RKIA 4FNHA 3O1LA 3BGUA 1DQ9A 1VRTA 4AD6A 4U8YA 2KT5A 3TZYA 3M05A 1RAGB 2F4VF 2R7XA 2DRBA 2CNLB 4Q8EA 1SQFA 2RILA 2EW9A 2BA1D 4C8NA 2RDJA 3HSDA 3LAKA 1NLKL 4NCAA 3MMCB 4OX8A 5K8MA 4E0DA 3SZ2A 2NSCA 3UCUP 4BDPA 2DGXA 1R43A 4DV6J 2NCKL 4AYBD 1H0HB 1VJWA 4DR1E 3GPAA 2H9ZA 2R42A 1AFJA 2ZJPQ 3M9OB 3SYZA 2AZ3A 4YDXA 3KMSA 4P7VA 3PXGa 4E8UA 5F8GA 5F41A 3ZTRA 3PW0A 1FD8A 4F0MA 2WONA 2FY8A 3SMZA 5I42B 1R6LA 1NBEB 1FKOB 2DNMA 3CJQA 4X4TA 3CDUA 3CJ0A 3H42A 1Z0WA 3SDEA 2A3JA 5HMXA 3I55S 1RSCA 2HNDA 1S0VA 2YKNA 4LIRA 4OX9E 2AKWB 4U6PA 3KWMA 3RW7A 2LEBA 2ABYA 3TAMB 4DV7F 2CJ9A 1FE4A 4Q45A 1PAUB 2VG5A 2ZNYA 2O1UA 2QSWA 3GFYA 3W2WA 1S6OA 3M2VB 4QIGA 1FJCA 5HLFB 4QYRA 4TN2A 4LFAE 2ZHBA 3U7JA 1N48A 3B82A 2AYEA 2V63A 2F65A 3D0GE 3GG0A 1GT8A 1IM4A 3WC0A 3S6EA 3LO3A 3E8OA 3LH2S 2UXBJ 3SCJE 2NXNA 1R31A 3GONA 3JAMQ 2R2UA 1WTFA 5KT7A 4K4UA 2QL7B 4A8OA 3U27A 4ER8A 1UETA 1X4GA 3KLGA 4DV5E 3Q23A 3ICLA 3IRWP 1BLUA 3RGIA 2I2YA 3VALA 5D78A 3PRYA 5JXSA 3UFCX 2LQBA 1VQKS 1USUA 2KZMA 2BANB 2X7IA 3EUNA 4C8KA 2DTJA 1V3ZA 3WIUA 4NE9C 4F3OA 1J5EI 2MJUA 1LW0A 5A76A 2E7WA 1XQIA 3J81Q 4C8ZA 4DPWA 1UAWA 3CIZA 4C7QA 1PBAA 4LREA 4KHPI 3CCWA 4CM2A 2CKWA 1S1UA 4B9MA 1AT1B 1YJTA 2Z56B 5KTQA 4DR4E 4YR3A 1RI7A 5GMKa 3CJTA 1RDRA 1VQPS 1JNRB 2C37B 3QSIA 2OO4A 2GJFA 4B3OA 3GG1A 3SSSA 4ED8A 3M6AA 3ZZ0A 3H8YA 5ETVA 3FQLA 1B7YB 5HN0A 4YHHE 1HNXF 1T8EA 2D1CA 3BO2A 2HPUA 2D7SA 1UZHA 1VQ9S 1FF2A 1HI8A 1L3KA 3OUYA 2R3VA 1KLMA 4DR5I 4ZPBA 2R7VA 2V4RA 2IA6A 1S6PB 4DOZA 3C6UB 4CLTA 1M5PC 4NLRA 4C2MA 5AXNA 1MNEA 4I1TA 4FBUA 4F4XA 3AODA 2JEFA 4CIOA 3W3SA 3QSYB 2GZOA 2ZD1A 4X64E 1HHQA 4B3TI 3T1HF 4Y6IA 2PI5A 5KFBA 1UVIA 3JXOA 3TA1A 1TELA 4ZJOA 3CNQP 4ZK7M 2UUAI 1LXNA 2VQEF 2IJFA 1S9FA 3DLEB 5DZ7A 4H54A 1RTJB 2HQDA 1CULB 4PG6A 4X4SA 2MB0B 2D69A 3NLCA 2BJ8A 5AJ3J 1RT1A 5A8KB 4JI4J 1WC4A 4IG3B 2DNKA 1T05B 1Y5YA 4FDFA 2CQ3A 4K2XA 4AL7A 2U2FA 1U1MA 2JC0A 2XLJA 4ECYA 4ILMA 4I4BA 4LCGA 4KE5A 3V6DB 5F3TA 1X4EA 3VAMA 1SV5B 3OT9A 3TUPA 1HNZJ 1QDUB 3LP2B 1W7WA 4MYUA 3MM9B 3MURP 4JI1F 5A2QC 3T1YE 4DUYE 3NCQA 4PXEA 1U8WA 2B3TB 1HBUA 5ETPA 5HVHA 3GV5B 3UD3P 3MTKA 2PO1B 5A0YB 4J9NA 3CCSS 2CDRB 5I3UA 4AL5A 1N56A 3UNGC 3CJ5A 5K36F 3FBBA 4FXWA 3M8QB 4DCOB 4ELUA 2DR6A 3N4WA 1VYAA 3BGRA 1IBKI 4NYOA 4DF4A 4WU3A 2D74B 4JI8E 3DDKA 5K8NA 2YBVA 3K0JA 1JLCA 3NGDA 2V34A 1PJ7A 4WP3A 1JKHB 1HPZB 4RNHA 3HHLD 3BH7B 2L08A 3H5YA 2VOOA 1R27B 2AZ1A 3NGRA 2DNGA 3IG1A 4HVZA 1FT8A 3FEZA 4B3ME 1HARA 2BJ9A 2UXCE 4PXCA 3FUYA 2AGQA 3IWLA 4LF6E 4CYUB 1BWVA 2MEWA 3DI6B 3TRGA 4PG4A 3PEJA 1NSPA 3IBWA 4HYKA 3EZ5A 3FFIA 5G0RA 3LF0A 2BQ3A 4ZVRB 2XYGB 4PUOA 1SIZA 1SKSA 1FRKA 2BV3A 1S9EB 2D3OR 2F1DA 4OX6A 2UU9I 3DXBA 1FJGJ 2VASA 4P2XA 2BRLA 2XCAA 1IXKA 1CVJA 2AX1A 3HHDA 4FKYA 5K14A 2CQ1A 3LOUA 2P8IA 4JI5F 2JHEA 2PDAA 1JLGA 2HVDA 3VAIA 2F5GA 5CYQA 1ROFA 1PBUA 1UP1A 4B3SF 1NHJA 5IT9Y 3D2WA 3JTNA 5CA5A 1U0HB 2HFVA 3HDSA 1YJ7A 2X1FA 2AV5A 3IWNC 1CQNA 3KLEA 3C3LA 1DBDA 4J90A 2GQCA 1IQTA 4DR2I 5H1SV 4TU7A 5HBMB 1KDNA 5J1EA 4DV4I 2MKJA 1C4AA 2XEXA 3ZZUA 1FDDA 4RW6A 2YWWA 3O3LA 1T9XA 2AJ4A 1RWKB 3W7BA 3CEDA 3FQKA 5GADI 2NQPA 3CCQS 2UUBJ 2NLWA 2XQCA 4G1IA 4YQWA 3CCRS 5CXTA 4G1QB 1Z5BA 2KB2A 2JLEA 1UVMA 4DLGA 1N5VA 1M5HA 1RAIB 3BYRA 2KT2A 2OLWA 1RTDB 2L3MA 1E6VB 2JLGA 3FSIA 4HT5A 1N34E 2OFGX 4WZMA 1UVLA 3G8SA 4LF5E 2MGZA 4ZN1A 3NAIA 1YJNS 2D3O1 3DNCA 2O1TA 3DLBA 5B09A 1Q4RA 4O3OA 3R3TA 4JP8A 4ZPDA 2LP4A 1BQNA 1U6FA 1R6VA 2ZH2A 4NXMF 4DR7I 4DSFA 2FC8A 3MM6A 2QMUB 4MKBA 3FCHA 1Q82T 3TUZC 2FVQA 2AGPA 4LF4I 2HS3A 3ZZZA 2IMOA 1TK8A 9ATCB 3D1QA 2M3DA 5IWAI 1WKKA 3QJPA 1GAOA 4ZP9A 1NDCA 2CVEA 2CUYA 2YQ1A 4O3PA 2QLXA 4CWBA 2HBYB 1OY8A 2BE9B 4WUDA 2Y1JA 4OZNA 4OKGA 1G3OA 5LMUJ 1X5TA 2CQHA 5T41A 2EFNA 2VKRA 2PE8A 1NHKL 3MMAB 4X62J 4MDTA 6AT1B 1LOUA 3E51A 2VBWA 2DR7A 1JNZB 1FRXA 5K36C 2IVYA 5ELWA 4C3MA 1B0PA 1KHWA 3W8PA 3CCMS 1UFWA 3MUTP 3K5OA 4UZBA 1KEKA 2HFNA 3Q86A 4ANEA 2LU1A 2IYGA 1JLFA 2ZM6J 4K7QA 3TX0A 2W4CA 4UOFA 4IRKA 3R5CA 1RWUA 1FEHA 2HWTA 4IZJB 3PW5A 2M7SA 4HYMA 1YJVA 4ZLNA 3EWGA 3BKTA 4WTOB 2HNZA 2HVZA 2DO0A 2I0XA 2P2CB 2DIUA 3WU6A 1KQGB 3GU0A 4RUBA 4F4WA 5KFAA 3V4MA 2MQNA 1FDBA 2FHMA 1SUQB 4JI2F 1IKVB 2R7UA 3K58A 3B4MA 3CC4S 1FX2A 2EFQA 2NXEA 2IFXA 1WG5A 3LP0A 3O2IA 1IBLI 1IM6A 1FD2A 2KFZA 3R2DJ 1XMOF 2OD4A 2C38B 1KRPA 3MAAA 3DLHA 1KTQA 4ID5B 1SQGA 4QIFA 3ZZOA 2XLIA 3H5XA 4OHZA 4I7FA 1FXLA 1HYSA 4MU4A 1XERA 1JLQB 2JRSA 3MHYA 1ZPWX 5C0XD 4J9LA 2DGSA 4TY8A 3C15B 1VI7A 4GKJE 3DMJA 1X9WA 2XZWA 4NYPA 2MSTA 2N4CA 4MKYA 1Q8IA 1RE1B 2W2PP 2G4BA 3Q8SB 2IOPA 5EX0A 5E5NA 2R7OA 1EKRA 5C42A 5ETOA 2GO4A 4HHUA 2WW8A 4FWDA 4M5NA 3M2UA 1VLYA 4DJBA 4V19J 1C0UB 2HQ3A 1XNQI 5L1JA 4OO1F 5F0UA 4AQYJ 1W2IA 5J1NA 1QAIA 2E66A 2YXLA 4OI3A 4IG0A 2VFUA 3W64A 3DOLA 4DR6J 4LFBE 5B0GA 1VHFA 2XC9A 5BR8E 1RHKB 4DS5A 2LQ8A 4B9NA 2FGCA 4ZPWR 3OR1B 1B63A 2GCFA 2RE1A 1I94E 3HHKA 4MU3A 4CLPA 3NBPA 1HIYA 1HKAA 1KOHA 2RAQA 5F8HA 1KFSA 2EWHA 5DS7A 4ZMMA 1UEVA 3OLBA 3FVYA 2E5LI 2VU5A 1M1KT 2WB4A 2B5JA 1AYEA 4LF9E 1AFIA 4YMEA 4CLWA 2YY3A 3W5ZA 4IFVA 1U1LA 1P27B 3QIPB 1IKWB 4NZ7A 2V8GA 3QBCA 3BO3A 1J5EF 3W66A 4DZDA 2CJAA 5HAOA 1RAOA 1X0PA 2MYFA 1LWFB 3VAJA 2XWYA 1VQ7S 3M85D 4OYWA 4FXVA 1IWAA 1YWXA 2YWFA 3UCGA 4PYDA 2W7OA 1NMEB 4QCLA 4O44B 1TL3A 5E2QA 1BMQB 3L7ZA 1FK9A 4DX6A 3KLFA 1X7VA 1DLOA 4I2QA 3W2VA 2F7VA 1U0SA 1LKZA 2P6SA 1F3FA 1PYOB 4LBIA 1N33F 5ETNA 3A4TA 1YZ7A 3NGKA 2B0GA 3SIPB 2E5JA 3CCZA 2PMWA 4I67A 3GE9A 1WC5A 3MM5A 4ZPTR 2GX8A 4ECSA 1UFKA 5EUHA 4Y34A 2HZVA 1XWLA 2XZDB 3CD6S 4DR5F 5L9XA 1HR0E 1ZM4A 2J6SA 2R8IA 3P4UB 2E44A 2G13A 2WSFC 1CBKA 4K4TA 1S72S 3HCXA 2OPRA 3GCMA 2Y1RI 2VICA 4Y00A 5E3CA 1ZOTA 1R0CB 2YQ3A 2W2NP 1X4AA 4U67Q 1VK3A 3AQOA 2UXDJ 2AEMA 2DPIA 4MIWA 2WW4A 4Z7CA 4CM0A 4YB7A 3MR6A 3TZZA 2CQ2A 3HD2A 2MLXA 2MXYA 5GAEI 2J7WA 4BLGA 5J2NB 4LQ9A 3HVWA 2OSRA 4ZA1A 2LJPA 2AYGA 1TL7B 5LXRA 2HZCA 3W8GA 3RAXA 1XR7A 3OTOF 1N36J 1YITS 5DLFA 5JUMA 3VGVA 3NKYA 2WRMA 2KFYA 3KJVA 3H20A 1TTHB 4M5HA 3MEGA 3OTCA 1LW2B 2MMYA 4GO7X 1RTHA 1FDAA 2PA8D 2UUCE 1N34J 4QPXA 2JVRA 3AD7C 2K7KA 3EJMA 3DRPB 3ZTOA 1U09A 3UDCA 1XR6A 2Q66A 1Q86T 3OD2A 4AIDA 3NG8A 3TA0A 3M6WA 1E6YB 1NJYA 2RT3A 1HNWE 1JLBA 4YR0A 5JEAA 4JI7I 2ZBCA 3VGSA 3MTJA 1V3SA 2DHSA 2NN6F 4N8OA 3HJCA 5H9FJ 2HBRB 4ICLB 4FW6A 4LF7E 5FJ4A 3VHQA 1VQMS 2PMZD 2NUUG 5FLXU 2VKZG 4GKKI 4JYAE 5B0EA 2RS8A 3GIKA 3MI7X 1N5YB 1IBMI 2ROEA 2A0FB 2R2RA 4LJMA 2QZ8A 2XMWA 4DG1A 4OHWA 3CULA 4UF4A 4CP5A 3HXMA 4OYBA 5JEAC 1WELA 3MEDB 4UOHA 3B54A 2RKIB 3PZPA 5D0HA 3QGPA 3DRRB 2HS4A 4YOEA 1XMQE 1IBKF 3DGPB 2AE8A 1GX5A 1DTTA 5KFMA 3J7YI 2IRUA 2Z8QA 1BXNA 2J0SD 5KT2A 5C0XE 1OSDA 4UW2A 3CJ3A 1TKTA 2BQUA 5AXLA 3J81U 3RBDA 4LRFA 1G2EA 4N8NA 1FESA 3M2RA 2P9GA 4ELVA 2KZZA 4LF8I 3SXLA 3VR1A 1JJCB 1JLAB 3QNWB 4DQPA 4QOTA 4NX9A 1GTEA 4NXNE 4DL4A 3P96A 4DV3I 2WP8B 5IC6B 3NMAA 2XI2A 2C2KB 4B3TE 2PNZA 3UO0A 1X9SA 4ED3A 3ZFVA 5A8WB 2UUAE 2ZVSA 4TU9A 3V5RA 2ZHAA 2XMVA 1B3TA 1S1VB 2M8DB 1YJRA 5T7LA 2ZH6A 1R7IA 1HNZF 1JK9B 2UU9F 2CPHA 2ADBA 1LFWA 4DV1J 1RR9A 4WUCA 1HL6A 5J2QB 1VBYA 2ZZMA 3KLHA 1SH2A 3CJKA 1YDLA 4MFBB 4Q7AA 4TQSA 2QA2A 2DGTA 3IRXB 4HTJA 4OI6A 4ZPVR 4WFXA 2E5GA 4OYZA 2VG6A 3ZTSA 1VQ6S 3HFZB 2CQCA 4F0HA 4A4JA 4OZ2A 2BE2A 3G82A 2V4QA 1RT7B 3T5JA 3K8WA 4MH8A 2L9NA 5KAKA 4OZJA 2VG7B 3M8YA 3RB3A 3PJXA 4WKYA 3M1VA 4QU7A 4OYIA 3PYEA 3ADAC 1YI2S 3HSJA 4JI3F 5M2UA 4KV8A 4B02A 2CG4A 4DR2F 1V5VA 4LFCJ 2OI2A 1H2TZ 1JXVA 1HQ2A 1KD1T 1Q8KA 1JMTA 3BBCA 2BEFA 3DC2A 4NCGB 4O4GA 2B6AA 3KK3A 3TEHB 4OIXA 3S7RA 3W63A 5KFUA 3QWPA 5F9LA 3EYZA 4OZ3A 2CPIA 2JE6B 2HURA 3H40A 2FJBB 3W9JA 1YG0A 2HHHJ 1U25A 4X65E 1HHTP 1S49A 1UZDA 1RISA 4AXIA 1MU5A 3KHRA 4OYAA 2HWHA 2R8KA 1EI1A 2BDPA 3KLVA 2E1MC 2GQ0A 1DY3A 4MKAA 1K1QA 3MAHA 4DR7F 4DEZA 2RUSA 1H73A 4DS4A 4OX7A 1Q53A 2VJUA 2VBZA 3K57A 3ZKBA 1KKHA 1GNKA 1XC9A 3O5TB 4UY8T 2QFIA 2YQ0A 5D15A 2QMWA 2XNQA 3A8IA 1C2PA 1MMLA 3PG9A 4OQJA 3WZ0A 4IFDB 1H2UX 5LMNI 1TV6A 1WKJA 1N32E 1ICEB 1X4DA 4OHVA 2Z5CA 4QWDA 3U1YA 4USJC 1RZMA 3OLAA 2VD3A 1Y3JA 1S0OA 2RU9A 4ATNA 2YNIB 3AJ2A 4JV5I 2N3OA 4X4OA 4K0KJ 3ZZYA 4OJ3A 4BHQA 4KTQA 1JQGA 2AX0A 2EK6A 5C25B 2WVBA 1MU2A 3M30B 2DBBA 1UL3A 3D0HE 1QAYA 4ILRA 3KRNA 3W62A 2HNYB 2J7UA 1CLFA 3A12A 1ZTWA 2ZH4A 3I5BA 4DV2J 3AHPA 1UWBB 4A8QA 1S9GB 2DY1A 4OZLA 4GRSA 3GCXP 1WF0A 3RBEA 3HK2A 1TK0A 3ILJA 1FRIA 1ZXMA 4U7UK 1PGZA 2PNMA 1CG2A 4DV4E 4DV0J 1D8ZA 4FW3A 2B4UA 1WC0A 4J37A 1FEEA 2C39A 3ULHA 5D4PA 5KG0A 3TO8A 2PN6A 1IBLF 5DDPC 2HFUA 1TAUA 4L76A 1IVZA 3GFXA 1RK8A 1IR1A 2NZCA 2AIRB 4QR2A 2CQ0A 4CLUA 4G1PA 3I96A 4AXJA 2OAUA 2IRXA 5IM0B 1R3NA 2E5HA 1EAYC 2KL8A 4X84A 1RHRB 5KFZA 1NK7A 3NNHA 1YIJS 2VZ9A 2HLUA 3QT7A 3MMBB 3TR5A 4NEYA 2BUNA 3IC1A 2I5JB 4PWDA 2JEBB 1NJXA 1S1XB 2HHQA 3MMCA 2RQMA 5ITHA 3GMEA 4X62F 2QLWA 4JV0A 4I3HA 3M4XA 4LF4E 1WHXA 2FJWA 4YB5A 3BBFA 2J9DE 2XBPA 2XHCA 5A2QQ 1OQ6A 5KFFA 4XIUA 1WC3A 1VRUA 5CZXA 4KIAA 1RT4B 1A6LA 2IM2A 1TQLA 3OVBA 1RA6A 3I0RB 2RRAA 2UVVA 1P1LA 2XNRA 3SSQA 2VQFI 3DYAB 1O5JA 3BSAA 5I42A 5KT4A 1NHVA 4CH7A 1HNVB 3W1YC 3LGMA 1QAXA 4OO1D 3NS6A 5DRKA 2V6AA 2QE5A 3J80Y 1Z5AA 3MR5A 5AXKA 1URRA 3SSRA 3VTIA 5C2CA 2BOAA 3TAMA 2KRBA 5LSOA 1RWWB 4DR1I 2J9DA 3N28A 5M2PA 1F2HA 4ZLPA 3LA0A 1R89A 4QIWD 5U47A 1U48A 3M2VA 1T7PA 4OJGA 4JI6E 5HLFA 1JB0C 2CPYA 4U96A 2F4VJ 5KFWA 4A8MP 3R5BA 2CJKA 2C3YA 4QWEA 1BQMB 4RBUA 2ASJA 3IO1A 2ZH8A 1NSKL 2B51A 3BS9A 1MN9A 1RAFB 2BQRA 2BW2A 3OR2B 1HWJA 5LJ3Y 1WDDA 2UUTA 3D66A 2DCLA 4OX9I 5CZVA 4J9MA 2BANA 1S10A 4QNKA 2Y0SD 4LF2A 2AP6A 1TKZB 3ENQA 3KK2A 4X66E 3ZZRA 3CCUS 4EO6A 1UJ6A 2E9TA 3NAHA 5IZHA 3I5CA 3BR9A 2WSCC 4WE1B 4ZOSA 3HPOA 4DR6F 2I6WA 4PU9A 4KH0B 4C6AA 1SJFA 4PPZA 5BXIA 1Q7LB 1FHTA 2VPZB 2C37A 1EX8A 1RTIB 4AL6A 1TKXB 1XR5A 1SJQA 4MK8A 5ETKA 3NNCA 2FVPA 1EQMA 3AY0A 2AHOB 4QWBA 1WHVA 3N6MA 4DL6A 2H4WB 3TI0A 4AIMA 4DQRA 5ETQA 1RCXB 4DV7J 4D3HA 3K17A 2ZJRQ 1O6XA 1PC5A 4RZRA 3LTOA 1XNRE 4G6VB 3OHBA 2QO3A 1T95A 3PDNA 3I32A 3UWTA 2BKNA 2MQLA 3C6UA 2M9KA 2QT7A 2WOMA 1GMWA 4MT1A 2OD6A 3FZ2A 5A8RB 3Q2SC 1WD6A 2DR8A 1FRLA 2B4OA 4CO3A 1U6BA 2DISA 4OJ1A 4DR4I 3R7NB 3PX6A 3R6LB 2WBRA 2CFXA 2HGMA 1K1SA 3DGVA 3EGVA 2C2DA 1Y4SA 3EZOA 1F3VA 2M8HA 2DGVA 4HDHA 4GMKA 2R8HA 2EPIA 3J81Y 3OTEA 1CJUB 1WF2A 2F8EX 2RHQB 3MPDA 4EEYA 4YHHI 2Z57B 4KGMA 3CC7S 2NPIA 3CCVS 3MD3A 4Y2AA 4KBIA 2E5LE 3QGHA 2DNQA 1BY9A 1WC1A 3DLEA 1IKXA 3HX9A 1RTJA 4BS2A 2IMWP 3CO9A 1FCAA 1HQEB 3C6TB 2GHWA 1DTQB 1RADB 2YKAA 2MDAA 2ALZA 4WKRA 3I31A 2IBKA 3CB4A 5A8KA 1RKJA 2VHGA 1CJTB 4IG3A 1T05A 3PRVA 2WBMA 3ISZA 3RRHA 2B9WA 4Q44A 1GK8A 1HNXJ 2VA3A 2OHDA 1MX0A 3L4BC 1S0NA 4RU9A 4JI0F 3KDNA 2GVDB 1UDNA 2M2BA 1GH8A 4GKKF 4IR9A 2DITA 2GC8A 2ILZA 3V6DA 5C24B 4K4ZA 1IBMF 4USHA 4X64I 2YVSA 3D5MA 4BC7A 1SV5A 1Q7YT 5C5JA 1Q5VA 3BSCA 1FJ7A 5IV3A 3HI9A 2Z30B 1U1KA 3MM9A 2NN6D 3PW2A 3P3DA 1ZZFA 1RT6B 4TYAA 1N88A 2HRTA 3PRDA 1T9TA 4GVBB 2VODA 3TVZA 4ECUA 4YY3E 3RB0A 1X9MA 5L39A 3G71S 1P9QC 3EM1A 4C11B 4DMZA 2ZH7A 4RO0A 4W92B 2VOPA 2OUGA 3M8QA 1XMOE 3T1HJ 4O3RA 3R5AA 5KG5A 4W98A 3HMJG 4LF8F 2W9CB 2VQEJ 2DNLA 4ECQA 2DPJA 1TFWA 2HZAA 3A8EA 2CZ4A 4AQYI 5BYRA 1AUDA 1GMVA 1JKHA 2EFOA 5ADZA 1HPZA 2CVIA 1FDNA 3T1YI 1AA1B 4DUYI 3FDSA 2XSFA 1ZM9A 3F0NA 1U2CA 2DIVA 2J7KA 2B56A 3GMGA 2LCWA 3PY8A 2W9AA 2G2OA 2DKOB 4EO8A 2B4PA 3TNVA 2W2OP 2O3ZA 2FJAB 3G6XA 1C1BB 4CYUA 3GSIA 4LVOP 4DPTA 4B3RE 1S6QB 4FF2A 2C2NA 2DNOA 1VRTB 4WXOA 2HK2A 3EX7B 4A48A 3IA0A 4JI8I 2A10A 4JI1J 1MSWD 2ZZNA 1TKDA 1F5CA 3MWBA 2HAIA 1Y10A 2HEKA 4DFMA 3IGNA 2FY1A 4B9LA 3GLJA 5DLGA 3EMTA 4A8WA 3OBIA 4RUAA 2HSEB 4G65A 3QQCD 3AOAA 2C3MA 1Y5IB 4LF6I 3DLLQ 4OHXA 1U0HA 2SXLA 4ECVA 1DFDA 3FJ2A 4KFBB 2WONB 4TXSA 2PO0B 3Q22A 2I9SA 1GFWB 1PYTA 5F8NA 1D6TA 4NLVA 2MZRA 2WCXA 5HK4A 2M70A 2W7AA 3SDEB 3RBZA 2YTCA 3U1KA 1PAEX 4CZCA 5HBMA 4LRCA 1G1XA 2CNOB 1GX6A 1M0SA 1S1WB 4RR5A 4DV6E 4DFJA 8RUCA 3JSYA 4ITSA 2ZHOA 4ETZA 5A6PA 4R5PB 2HG4A 4UQGA 2VG5B 2W2QP 1MW7A 4PABA 5IXUA 3TEGA 4CO0A 1V3RA 5DRQA 4ED4A 4KHRA 2ALYB 4G1QA 1OWXA 1EKSA 3OPKA 1E6VA 1JXEA 2LEAA 4B08A 1CS4B 2FB0A 5EHHA 1RREA 3QWUA 1L3UA 1K8AT 3EZUA 3RAQA 2B8PA 3NOCA 2KI2A 5I3PA 1VS3A 4IH5A 2RQCA 1Y3KA 4P52A 1XHKA 2UXDI 1UVNA 5J2PB 2DH9A 1FWLA 1B99A 3ILIA 2UVWA 3NGUA 2WVCA 5B0DA 2ZFHA 4HI2A 3ISND 4JI5J 4D3GA 2XB2D 3SQOP 4AM3A 2J65A 1NB7A 3N79A 1LW0B 4TQRA 4B3SJ 5KOXA 1AZSB 4JV5F 2HWIA 4M5LA 4E98A 1Q5YA 1XIQA 3VVTA 2FLPA 2L41A 1L3SA 2UXBE 3I0SB 2J6TA 5HO4A 2VF3A 1K73T 1N34I 3RRKA 4LF5I 2EKNA 5JJBA 4YFUA 2BJ3A 1RU1A 1K47A 3GYNA 3IS9A 3PTWA 4PCQA 3WC2A 3CW2C 5HANA 4EI2A 4ZCMA 3TP2A 1SH0A 1Q16B 3D1HA 2DRAA 3QAEA 2HQFA 5ETSA 3AOCA 3VZHA 4R25A 1XEZA 3DLGB 4DQQA 2MY8A 3DRSB 2XYHB 3KUGA 4QJVA 2OH2A 4P2MA 4FZVA 3T5HA 4IZJA 4OYMA 2GGPB 3ET6B 1HMVB 4KT0C 3HO1A 2DGQA 4DUZF 2MKCA 3F41A 2QLJB 4DR3J 1N6QB 4LCHA 4BA1A 3CIMA 4HR2A 1SUQA 1YBAA 4NXMJ 2BXJA 6FDRA 4B9TA 4IRCA 2OSQA 3TJAA 3CDIA 4L75A 4QPTA 2JC1A 4Y0FA 5KFVA 3QIDA 3NGTA 4Z2XA 3MM7B 4I56A 4WK1A 2DVIA 3NOGA 3GLLA 1KVIA 3QRPA 4ID5A 1RXOB 1HWIA 4PRXA 1KTVA 2VBYA 3FC9A 3EPGA 2KG0A 1JLQA 4K0KF 5JVHQ 2VFRA 3EVWA 4NLTA 5JMNA 2FLOA 4FS1A 4OI4A 3C15A 3I9V9 3K5LA 3RU0A 2VUGA 4Q8FA 1N8RT 4RWWA 3POTA 3A13A 2R7WA 3NP5A 2NREA 2JZ5A 2V8DA 5B0AA 2VFTA 2GVZB 2AJ0A 4J9QA 3Q6NA 1C1CB 2JEIA 2VQFF 3AQPA 1CC8A 2FPHX 4ECTA 5KG7A 3HM9A 3NGSA 2O66A 2GIRA 1C0UA 4O23A 3KJNB 3KNAA 1NJZA 3HVTA 1P1TA 4F25A 1UVJA 1Z2ZA 1T9WA 1S1TB 1QUPA 2DK2A 4JI4E 4WCEQ 2QC3A 1Z2LA 2V50A 2EXUA 2D9PA 4CH0S 4GKJI 3ZXWA 4JI2J 4WFAQ 1WNEA 3PNIA 1QM9A 4I6WA 2FHJD 4X4NA 2HHXA 2UUWA 1Z0TA 3BH6B 1XMOJ 2M52A 1FX4A 2KVQE 1Y5NB 2ZITA 1S79A 3QRRA 1HNZE 1GQEA 2OPQA 2O1PA 2LLZA 3L9ZA 1NEEA 4NA1A 5IT9U 2IHR1 3GYXB 2VPYB 3JS9A 4OFZA 4NLSA 2W8LA 2FUG9 3IR5B 5FLXC 2QGFB 4O3QA 1UPPA 1SVDA 2XGQA 2CG9A 1NK8A 1OPZA 4KSEB 3D0IE 4KB7A 2RDIA 4LFBI 5E3PA 5BR8I 4OX9F 1Y7PA 3KTQA 3QIPA 3CO0P 1DARA 1U2RA 1IKWA 4WFZA 4C98A 2KFNA 3RRGA 3DHWC 2VC0A 1HK7A 4GVLA 2M88A 3CMAS 2PT0A 2BRKA 3KHLA 4HI1A 1D9AA 3PVXA 4LFAF 4IYQA 4C0OC 3E3XA 1FKPA 2IERA 2Z5BB 4CTAB 4LR8A 3SEOA 2OMOA 4O44A 2KM8B 5GAGU 4U95A 4LVNP 4QR1A 2ZOMA 1S5ZA 4C8MA 1DRZA 3Q8VA 3NEKA 2N3LA 3M8SA 4FN5A 4DV5F 2ZJQQ 1ZA2B 4LF9I 2PGCA 2ACMA 2MZ1A 1JLGB 4H4OB 3VGTA 4IO9Q 3EICA 2RU3A 2RD5C 3Q8YA 1VBKA 2Q1LA 4ZVEA 1FWKA 3WDOA 1TR0A 1N0VC 5KFKA 3TUJC 1FKAF 3DKDA 1WHWA 3BPSP 4C0BA 3HVRA 1NZAA 3H4LA 3PX4A 1PILA 4L3NA 5DNXA 1RHUB 1PCAA 4DR4F 4RX6A 2H4YB 1FJGE 1SKUB 4DCPB 1CJKB 2IM0A 4MTPA 5AXMA 1BGXT 3DDIA 3DOKA 4USVA 2Q43A 4ZHRA 3KDOA 1T0TV 2K1RA 5J2NA 4YHHF 2IPOB 2NUHA 3H2LA 4PPDA 1WWHA 4PQUB 4EUVA 1J5EJ 5HMWA 3UQSA 5F9NA 1O51A 2OPPA 5A2QU 4FNIA 3RYLA 4KHPJ 4IQXA 2AJ2A 4DV2I 1S76D 1HR0I 4OV1A 4IOCQ 1LW2A 2OEJA 2EG1A 5DQHA 3W61A 3G6YA 2Y1LB 1J2VA 5E0OA 2VB6A 2Z5EA 1ZM3A 3DRPA 1FXDA 4OV6A 2OTLS 1N33J 3QZ7A 3DLJA 2XO6A 2L48A 4S0MA 1SIWB 1Q8LA 1E6YA 2IVFB 4MQYA 3M6VA 3SQGB 3NRBA 2XS2A 1YQHA 2F4FA 4X64F 3Q8RB 5K36B 4QBUA 1RT5A 1YRUA 2UUBE 3MOJB 5HL7Q 4DR5J 2F9JA 2V2KA 1NKCA 4ICLA 4F36A 4DI6A 3H4BA 1H38A 3R5GA 4DN0A 3M6XA 2XGPA 1XK8A 4K5SA 2JL9A 5HSPA 3HT0A 5KFQA 4C3LA 3PS1A 2UUCI 2LECA 3D28A 3BN7A 1N5TA 3BB5A 2IJNA 2R7QA 2R8GA 4DX5A 1F1BB 4K59A 3MEDA 1WI6A 3G8TA 3DRRA 3CDJA 4RJVA 4I2PB 5L9NA 1HBNB 4X4PA 4NWBA 3DGPA 2VA2A 4IQMA 1XJWB 3M9MB 3Q83A 1HNWI 3T9ZA 2ZBIA 3OTOJ 3NCRA 1JWWA 1S0MA 1PSDA 2BM0A 5DO2A 4K4XA 2KXNB 1S97A 3HT3A 5SZTA 4LF7I 3T1YF 4DUYF 3KUEA 4RW9B 4CLKA 2ACYA 3VQTA 1UVKA 5LMUE 1JLAA 2G2ZA 4JYAI 2LQJA 3R97A 4DX7A 3AAWB 1WOPA 2FJXA 4X62E 2Z2ZA 2BZ2A 4PG5A 4CLFA 4UUXA 3IFEA 4WFNQ 1ZH5A 2PEBA 3N6LA 4PRVA 3LP0B 4ZLJA 2KVIA 2OGUA 2C42A 5DRRA 4FP9A 1NNDA 4Y2KA 5A8WA 1S16A 4KGZB 4B9UA 3MPUB 1XMQI 2DNZA 2DR5A 2P9EA 2ZM6E 5THWA 4P72A 4JI8F 3EXYA 1S1VA 2G0IA 4OI2A 4HDGA 4IOAQ 2B43A 4I7FB 2JEJA 3OSPA 4GO5X 4FXDA 4IOBA 1Y0HA 1NKEA 4QNJA 2A6OA 5J2QA 5HP1A 3CE8A 1WG1A 1T9VA 3P6YC 3L7UA 2MZTA 1QSSA 4MFBA 2CIMA 3P3GA 3IRXA 3A8JA 1RAEB 1R6YA 2Q6CA 1GXTA 3P45B 3PO5A 4R0JA 1S59A 4NXNI 4B3MF 2N7YA 1PVGA 3OXGA 4WU2A 2UXCF 3V81A 1IBKJ 4FW9A 5T14A 1RT7A 2BABA 4LF6F 4K4WA 3CT9A 5EN1A 1JJ4A 3BGLA 5K20B 4KC5A 3LW5C 2V8PA 2LEPA 2YKMB 4MK9A 1PG5B 1B7FA 1FRJA 1RWVB 3D4JA 2HMIB 2J6UA 4DL0C 5D0RA 2EFPA 4HH0A 3H0PA 3MECB 4R1FA 2FHJA 4J9SA 4DU7A 3K59A 1DZ5A 3KMQA 2ZC3A 2OMLA 2YNGB 1SL0A 2MZSA 2JE6A 4F3MA 3MPWA 4IFDE 4OYXA 5DGAA 3N6NA 1GMUA 4AQYE 3FBEA 1Z0EA 1R8AA 1HW9A 2UU9J 2B5JB 3RG6A 3PJWA 4DR6E 4NI2A 2C2EA 2XY5A 4ANDA 4IFVB 3IM8A 1E3PA
chains in the Genus database with same CATH topology
4LF4I 2IOQA 3Q1QA 3CWVA 2WW4A 4Z7CA 5IWAI 5LMNI 1N32E 4DV1E 2Z5CA 2PNLA 4JI0E 4B3MI 1FJGE 4USKA 2DEIA 3PYGA 2A2DA 4DR4I 1Z5CA 2UXCI 4JI3I 4X64E 3ZZTA 4GKKE 4JI1E 1ELOA 4B3TI 4X66I 4JI2E 2LJPA 4DV6I 1IBME 4WUDA 1Y4SA 2NPFA 1IBLE 4DUZE 2HK3A 3T1HI 3J80C 3HULA 2CGEA 4JV5I 4EMDA 4X65I 2UUAI 1FKAE 1H74A 3LNUA 2UXBE 2VF3A 1H7UA 4YHHI 1N34I 4LF5I 2F4VE 1I94I 2E5LE 1Z0CA 1K47A 2UUCE 4DV2I 1IBKE 2O1VA 1HR0I 4LFAI 2BM1A 5IT9C 4DPUA 1Z59A 4LFCE 4ZVIA 1N33I 1USVA 5L3JA 4DR6I 1Y4UA 1QZRA 4IZJB 2Z5EA 1XNRI 1HNWE 1ZM3A 4JI7I 3K1JA 4HYMA 1ZXNA 2A2CA 4LF8E 4UTGA 1ZXMA 4M1KA 2HFSA 2PNMA 3WU5A 3WU4A 3HJCA 4DV4E 3WU6A 1MX0A 2HKJA 4IZJA 1H7SA 4DV5I 4MYUA 4LF7E 1N32I 4DV1I 4DV3E 1FJGI 3K85A 1XNQE 2UUBE 5A2QC 3T1YE 4DUYE 4GKKI 4X64I 4JYAE 4JI1I 4JI2I 2HHHE 2HFUA 1ZM2A 1IBMI 3J80Q 4FWHA 4HY1A 1IBLI 2VQFE 2UXBI 1A6FA 1WUUA 3J7AG 4Z7YA 2F4VI 3B8HA 1XMQE 2UUCI 3J7AM 4YY3E 4DV7E 1EA6A 1MG7A 1IBKI 4WUBA 2UU9E 4IZJD 3QT7A 5IT9Q 4PRXA 4JI8E 4GKJE 1KTVA 1KVKA 2HKEA 4LFCI 4P7AA 3OTOI 3PYFA 1XMOE 4DR1E 2VQEI 4USMA 2R42A 4HXZA 2GS8A 1HNWI 2V34A 4N3OA 2IOPA 4I3HA 2UXDE 4JI5E 4LF8I 2BM0A 2EFGA 4DPYA 3JAMC 4FWGA 4LF4E 2V2VA 4AQYI 1PIEA 4NXNE 4FWDA 4B3SE 4LF7I 4DV3I 5A2QQ 4B3ME 1XNQI 2UUBI 4XTJA 5LMUE 3T1YI 4DUYI 2UXCE 4JYAI 4JI3E 2HHHI 1N36E 4B3TE 1ZM9A 3Q6NA 3F0NA 1Z0VA 4LF6E 1S4EA 2O1WA 4DR2E 3B78A 4K0KE 1Z0WA 1OJ4A 3QT6A 2ZBKB 2J7KA 4X62E 4URLA 2VQFI 4KQVA 2UUAE 1UEKA 1J5EE 4LFBE 1NHHA 5BR8E 4DPXA 3V5RA 3WU3A 1N0UA 4PRVA 3J81C 4OX9E 4KHPE 1H72C 4DXLA 4DPTA 4B3RE 1B63A 4JI0I 4MYTA 1I94E 5FWKA 1S16A 1XMQI 4JI4E 5LL6R 2BV3A 1NHIA 2ZM6E 4YY3I 2HK2A 2O1UA 1Z5AA 1RR9A 4DV7I 2UU9I 4DV2E 4WUCA 4DUZI 4IZKB 4GKJI 4JI8I 4LFAE 3B82A 3QT8A 4HACA 1XMOI 4DR1I 1N33E 4JG4A 2E1RA 1Z0TA 4IZKA 4JI6E 1HNXE 2E5LI 3ZM7A 1NZ0A 4DV0E 4JI5I 2ZITA 3GONA 3JAMQ 3QT5A 1HNZE 5GMDA 1NHJA 4LF9E 4NXNI 4DV5E 4B3SI 4DR5E 3PYEA 1PVGA 1PKPA 4FW9A 4DR3E 5LMUI 4DR7E 1N36I 5FLXC 3PRYA 4NXME 4LF6I 2OI2A 1VISA 1USUA 4DR2I 2CG9A 4K0KI 2X7IA 4X62I 1FNMA 2V8PA 1J5EI 4LFBI 5BR8I 3LPSA 3J81Q 4DPWA 4DV4I 1D6TA 1DARA 1U2RA 4OX9I 4KHPI 2XEXA 5IWAE 4B3RI 1HK7A 5LMNE 3D4JA 3ZZUA 2X36A 4JI4I 2V2ZA 4DR4E 2DEJA 2AJ4A 4R1FA 3P06A 4RPFA 2ZM6I 4X66E 5GMEA 3ZKDA 4DV6E 4DU7A 1B62A 3T1HE 1Z0GA 4JV5E 2Z5BB 4X65E 1Z5BA 3M6AA 3OTOE 3ZZ0A 4PU9A 1Z0BA 2VQEE 2CZ9A 4YHHE 1N34E 1MU5A 4LF5E 4JI6I 4ED4A 2Z5BA 1HNXI 4UT4A 1EI1A 4DV0I 4HACB 1HNZI 2O1TA 2GQ0A 4FN5A 3Q6MA 1HR0E 2R3VA 4AQYE 4LF9I 1ZM4A 4DR5I 1Z0EA 1RREA 1KIJA 4DR3I 3K17A 5FLXQ 1H73A 3PYDA 4DR7I 4DU8A 4NXMI 4DR6E 2Q2EB 1FWKA 1Y6ZA 1FI4A 3LTOA 3ZKBA 1XNRE 4P52A 4JI7E 1N0VC 1BKNA 1XHKA 2Z5CB 2UXDI 1KKHA 1FWLA 3V2UC 2V2QA 3H4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 I;  3Q1Q A;  3CWV A;  2WW4 A;  4Z7C A;  5IWA I;  5LMN I;  1N32 E;  4DV1 E;  4JI0 E;  4B3M I;  1FJG E;  4USK A;  2DEI A;  3PYG A;  2A2D A;  4DR4 I;  1Z5C A;  2UXC I;  4JI3 I;  4X64 E;  3ZZT A;  4GKK E;  4JI1 E;  1ELO A;  4B3T I;  4X66 I;  4JI2 E;  2LJP A;  4DV6 I;  1IBM E;  4WUD A;  2NPF A;  1IBL E;  4DUZ E;  2HK3 A;  3T1H I;  3J80 C;  3HUL A;  4JV5 I;  4EMD A;  4X65 I;  2UUA I;  1FKA E;  1H74 A;  3LNU A;  2UXB E;  2VF3 A;  1H7U A;  4YHH I;  1N34 I;  4LF5 I;  2F4V E;  1I94 I;  2E5L E;  1Z0C A;  1K47 A;  2UUC E;  4DV2 I;  1IBK E;  1HR0 I;  4LFA I;  2BM1 A;  5IT9 C;  4DPU A;  1Z59 A;  4LFC E;  4ZVI A;  1N33 I;  5L3J A;  4DR6 I;  1QZR A;  1XNR I;  1HNW E;  1ZM3 A;  4JI7 I;  3K1J A;  4HYM A;  1ZXN A;  2A2C A;  4LF8 E;  4UTG A;  1ZXM A;  4M1K A;  2HFS A;  3WU5 A;  3WU4 A;  4DV4 E;  3WU6 A;  1MX0 A;  2HKJ A;  1H7S A;  4DV5 I;  4MYU A;  4LF7 E;  1N32 I;  4DV1 I;  4DV3 E;  1FJG I;  1XNQ E;  2UUB E;  5A2Q C;  3T1Y E;  4DUY E;  4GKK I;  4X64 I;  4JYA E;  4JI1 I;  4JI2 I;  2HHH E;  2HFU A;  1ZM2 A;  1IBM I;  3J80 Q;  4FWH A;  4HY1 A;  1IBL I;  2VQF E;  2UXB I;  1A6F A;  1WUU A;  3J7A G;  4Z7Y A;  2F4V I;  3B8H A;  1XMQ E;  2UUC I;  3J7A M;  4YY3 E;  4DV7 E;  1EA6 A;  1MG7 A;  1IBK I;  4WUB A;  2UU9 E;  3QT7 A;  5IT9 Q;  4PRX A;  4JI8 E;  4GKJ E;  1KTV A;  1KVK A;  2HKE A;  4LFC I;  4P7A A;  3OTO I;  3PYF A;  1XMO E;  4DR1 E;  2VQE I;  4USM A;  2R42 A;  4HXZ A;  2GS8 A;  1HNW I;  2V34 A;  4I3H A;  2UXD E;  4JI5 E;  4LF8 I;  2BM0 A;  2EFG A;  4DPY A;  3JAM C;  4FWG A;  4LF4 E;  2V2V A;  4AQY I;  1PIE A;  4NXN E;  4FWD A;  4B3S E;  4LF7 I;  4DV3 I;  5A2Q Q;  4B3M E;  1XNQ I;  2UUB I;  4XTJ A;  5LMU E;  3T1Y I;  4DUY I;  2UXC E;  4JYA I;  4JI3 E;  2HHH I;  1N36 E;  4B3T E;  1ZM9 A;  3F0N A;  1Z0V A;  4LF6 E;  1S4E A;  4DR2 E;  3B78 A;  4K0K E;  1Z0W A;  1OJ4 A;  3QT6 A;  2ZBK B;  2J7K A;  4X62 E;  4URL A;  2VQF I;  4KQV A;  2UUA E;  1UEK A;  1J5E E;  4LFB E;  1NHH A;  5BR8 E;  4DPX A;  3V5R A;  3WU3 A;  1N0U A;  4PRV A;  3J81 C;  4OX9 E;  4KHP E;  1H72 C;  4DXL A;  4DPT A;  4B3R E;  1B63 A;  4JI0 I;  4MYT A;  1I94 E;  1S16 A;  1XMQ I;  4JI4 E;  5LL6 R;  2BV3 A;  1NHI A;  2ZM6 E;  4YY3 I;  2HK2 A;  1Z5A A;  1RR9 A;  4DV7 I;  2UU9 I;  4DV2 E;  4WUC A;  4DUZ I;  4GKJ I;  4JI8 I;  4LFA E;  3B82 A;  3QT8 A;  4HAC A;  1XMO I;  4DR1 I;  1N33 E;  4JG4 A;  2E1R A;  1Z0T A;  4JI6 E;  1HNX E;  2E5L I;  3ZM7 A;  1NZ0 A;  4DV0 E;  4JI5 I;  2ZIT A;  3GON A;  3JAM Q;  3QT5 A;  1HNZ E;  5GMD A;  1NHJ A;  4LF9 E;  4NXN I;  4DV5 E;  4B3S I;  4DR5 E;  3PYE A;  1PVG A;  1PKP A;  4FW9 A;  4DR3 E;  5LMU I;  4DR7 E;  1N36 I;  5FLX C;  4NXM E;  4LF6 I;  2OI2 A;  1VIS A;  4DR2 I;  4K0K I;  2X7I A;  4X62 I;  1FNM A;  2V8P A;  1J5E I;  4LFB I;  5BR8 I;  3LPS A;  3J81 Q;  4DPW A;  4DV4 I;  1D6T A;  1DAR A;  1U2R A;  4OX9 I;  4KHP I;  2XEX A;  5IWA E;  4B3R I;  5LMN E;  3D4J A;  3ZZU A;  2X36 A;  4JI4 I;  2V2Z A;  4DR4 E;  2DEJ A;  2AJ4 A;  4R1F A;  4RPF A;  2ZM6 I;  4X66 E;  5GME A;  3ZKD A;  4DV6 E;  4DU7 A;  1B62 A;  3T1H E;  1Z0G A;  4JV5 E;  4X65 E;  1Z5B A;  3M6A A;  3OTO E;  3ZZ0 A;  4PU9 A;  1Z0B A;  2VQE E;  2CZ9 A;  4YHH E;  1N34 E;  1MU5 A;  4LF5 E;  4JI6 I;  4ED4 A;  1HNX I;  4UT4 A;  1EI1 A;  4DV0 I;  4HAC B;  1HNZ I;  4FN5 A;  1HR0 E;  2R3V A;  4AQY E;  4LF9 I;  1ZM4 A;  4DR5 I;  1Z0E A;  1RRE A;  1KIJ A;  4DR3 I;  3K17 A;  5FLX Q;  1H73 A;  3PYD A;  4DR7 I;  4DU8 A;  4NXM I;  4DR6 E;  2Q2E B;  1FWK A;  1FI4 A;  3LTO A;  3ZKB A;  1XNR E;  4P52 A;  4JI7 E;  1N0V C;  1BKN A;  1XHK A;  2UXD I;  1KKH A;  1FWL A;  3V2U C;  2V2Q A;  3H4L A; 
#chains in the Genus database with same CATH topology
 4QWA A;  4CCH A;  3FNN A;  3VQS A;  4DHV A;  3N01 A;  4LRB A;  4OL8 A;  5HI7 A;  1X60 A;  2DR9 A;  3MF5 A;  1P9Y A;  1PO6 A;  1X4F A;  2RH3 A;  2NSB A;  2MQ8 A;  1M5K C;  1WDT A;  4NYZ A;  2YX1 A;  2MQQ A;  3QYY A;  3QLH B;  4IFD A;  3CJ4 A;  4JI3 J;  4X65 I;  3LAL A;  2UV8 A;  2R2S A;  2RDD A;  4DR2 J;  3KLF B;  3LNU A;  4X4U A;  4DL3 A;  3K2Y A;  4LF5 F;  3X3U A;  3Q8Q B;  4LBH A;  3OV7 A;  4LT6 A;  2YNI A;  2FHK A;  2Z58 B;  3ENW A;  3I87 A;  4YP3 A;  4ZVH A;  3TAQ A;  2Q3P A;  4E2F B;  1KQK A;  3BJY A;  1FRM A;  2VH7 A;  5C25 A;  3BDE A;  2DGW A;  1LWC B;  3LUY A;  2AF6 A;  3BYP A;  3M30 A;  3QMQ A;  1GXU A;  1Y60 A;  1USV A;  2ERR A;  2HNY A;  2DYA A;  4IFD C;  5DGB A;  4ECZ A;  5M2R A;  4DSJ A;  1WOS A;  2A2C A;  4NCB A;  3OL8 A;  2RSQ A;  3C66 A;  3WU5 A;  5GAH U;  3JTO A;  3CD0 A;  1S9G A;  2HKJ A;  4J91 A;  1NH7 A;  1N32 I;  1G6B A;  2ZH3 A;  4U7U D;  1YBT A;  1SJ3 P;  3LQV A;  2AEJ A;  1TFY A;  4RBT A;  3KFW X;  2BJ1 A;  4XDD A;  5DET A;  4DR7 J;  1A9N B;  1YX2 A;  4TLR A;  4RKU C;  2YPY A;  5HRO B;  1RWN B;  3M32 B;  1BUX A;  3TJ8 A;  3ZNJ 1;  3CD5 A;  2ZH9 A;  2XS5 A;  3B8H A;  2BJE A;  3LPE A;  1SJ4 P;  4EGL A;  3PKY A;  5IWA J;  1U1O A;  4WXW A;  3GJR B;  2XG8 A;  5CYM A;  3PR4 A;  3KJV B;  2E1A A;  4M8L A;  1WHY A;  4J9K A;  2DH7 A;  3T41 A;  1Q1K A;  4DQS A;  4OO1 B;  7FD1 A;  3MMJ A;  3T1A A;  2VQE I;  2MQM A;  3DRY A;  1TL1 B;  1OYS A;  2IA0 A;  3R9L A;  1WKL A;  4HL9 A;  1J5O B;  3HF5 A;  2UXD E;  1LNQ A;  2I5J A;  1VIX A;  2JEB A;  3GZ7 A;  4U9R A;  1S1X A;  2DNR A;  2GML A;  3D68 A;  1PIE A;  3D6F B;  5JEA B;  5KG2 A;  5IC4 B;  4N47 A;  2P9C A;  1R6M A;  3BN4 A;  5B08 A;  3OFH A;  2FC9 A;  3T5K A;  1F6T A;  2HRU A;  1N36 E;  4NML A;  2O1W A;  3JQK A;  3B78 A;  1IKY A;  4DL2 A;  5D4O A;  2ZBK B;  4KQV A;  5DQG A;  2QLB B;  4XTT A;  4Y28 C;  1RT4 A;  1CEZ A;  3I0R A;  2PFD A;  4PG8 A;  4DG1 B;  3LP1 B;  4Q5V A;  3DYA A;  2CYY A;  4ZP8 A;  4GKJ F;  1UDS A;  2EG2 A;  3OFF A;  1HNV A;  2XY6 A;  4DR3 F;  2QIF A;  1T03 A;  2ASL A;  2IC3 A;  1IBL J;  1TL4 A;  1NPR A;  1DTT B;  5F8M A;  4LUB A;  2KYZ A;  5HJX A;  4OZ0 A;  1HA1 A;  4ZVQ B;  4PZV A;  2CNN B;  1FFS B;  4Z37 A;  1AXQ A;  1YHQ S;  2DCU B;  4LBP A;  4F50 A;  3BSO A;  4QU6 A;  2KH9 A;  1Z4U A;  2NXU A;  4FS2 A;  1RB0 A;  3CPW R;  3JSB A;  5KG3 A;  4BC9 A;  1REV B;  3AJD A;  4OI0 A;  2C3O A;  3A3O B;  3BQ1 A;  3OXF A;  1TMM A;  4LFB F;  5BR8 F;  3PS2 A;  2M0G B;  1FNM A;  2QEX S;  4OLP A;  2NYH A;  1WOO A;  3EGZ A;  1I94 F;  1UPM B;  4OZ5 A;  3NS5 A;  2PII A;  4HT7 A;  2ZUA A;  5A2Q Y;  3OR2 A;  2R7S A;  3EDR B;  3W5X A;  5FDL B;  4UUW A;  1R0A A;  2V4J B;  4OJH A;  1XNQ J;  2QL5 B;  4IO1 A;  2E1P A;  3C16 B;  4HLB A;  3N9U C;  3P3C A;  3JSM B;  2MLY A;  1TKZ A;  1SL2 A;  1OQ3 A;  2XSJ B;  4DL7 A;  2CXE A;  3G9C A;  3CJK B;  4JI6 I;  2J0X A;  2BYC A;  4HHJ A;  4UOG A;  1IR0 A;  2RNE A;  3KHG A;  4WE1 A;  2L9W A;  4LF9 F;  4OYO A;  2LKZ A;  2AYB A;  2X51 A;  3D1O A;  1VC0 A;  1RTI A;  1RLD A;  3CC2 S;  1TKX A;  1TK5 A;  2E1C A;  4K4V A;  2MKH A;  4F8R A;  5KG6 A;  3X1L B;  3EPI A;  1DHM A;  2V5H G;  4KV8 B;  8ATC B;  3U1M A;  3CWV A;  5KFR A;  2KG1 A;  2B7C B;  5CHC B;  3H2V E;  4DV1 E;  2JFD A;  2PNL A;  3W9I A;  2VJV A;  4XK8 C;  4O4G B;  2NR0 A;  4X66 I;  3FGV A;  3WQP A;  2FVR A;  5A8R A;  4RU2 A;  5ETM A;  1KN6 A;  4DSL A;  4NRT A;  4UOC A;  4F4Z A;  2XLK A;  1NK0 A;  1IWG A;  4EWT A;  4F02 A;  4UST A;  2XMU A;  2NN6 B;  1HR0 F;  2CWX A;  5D4L A;  1QVG R;  1RP5 A;  3F73 A;  4U7C A;  5F3Z A;  4ZLL A;  3Q2T C;  4LFC E;  1U4B A;  1YRX A;  1XNR I;  2OEL A;  7AT1 B;  1HWL A;  2CPZ A;  2BJD A;  3C6T A;  2OEM A;  1DTQ A;  2CNK B;  3K5M A;  2KN4 A;  2CJY B;  3P5T L;  5HMY A;  1KOO A;  5JEA F;  1CJT A;  3K5N A;  2N4D A;  2GMJ A;  1SB6 A;  3BDP A;  1RT2 A;  2HHH E;  4NL5 A;  1P6T A;  3FMB A;  3C14 B;  4F3Q A;  4K4S A;  3JTP A;  3T6B A;  3F56 A;  1RBA A;  3HHL A;  5C24 A;  3TX8 A;  4PR6 A;  4MMO A;  4FVC A;  1IBC B;  1OS5 A;  3BSN A;  3CTR A;  1UA0 A;  2ASD A;  2UUC F;  3MR3 A;  4ED7 A;  4LF1 A;  3QZ8 A;  1Z1Z A;  4NA2 A;  1M90 T;  1RT6 A;  1CPZ A;  2JEA B;  1MG7 A;  1S7I A;  3GQC A;  4ECW A;  4FW4 A;  2WNR B;  4WTY A;  2GQ2 A;  3Q0A A;  1H2V Z;  3DD6 A;  3OHA A;  3UPF A;  4ZDN A;  4CLL A;  3PYF A;  4GVB A;  1HNW F;  3G86 A;  5F8L A;  3DM2 B;  4M5D A;  5EL9 A;  3BQ2 A;  4C11 A;  2VFV A;  2PFF B;  3HHL C;  2XTJ P;  3TWZ A;  1FXR A;  4USW A;  4FWG A;  3NY0 A;  4KHP F;  4KGX B;  2V2V A;  4GQU A;  3VWS A;  3U02 A;  1C4C A;  1WOR A;  4FW5 A;  5AE1 A;  4FYD A;  2JT2 A;  2BA0 G;  4JYA F;  4DL5 A;  4M5G A;  3H2U B;  2MTL A;  3P5B P;  3VVU A;  1VHI A;  2CQP A;  4K0K E;  2DGO A;  4EK2 A;  1A0O B;  4W4M A;  3CDE A;  1VQ8 S;  3PO4 A;  1XTZ A;  4JI7 J;  4V19 X;  2G1H A;  1K0V A;  2CZV C;  4DF8 A;  3AB4 B;  1XMQ F;  3FCW A;  1UW9 A;  1VBX A;  3ETM A;  2I1R A;  1B4S A;  3AXK A;  1K9M T;  1PJ5 A;  5E3R A;  2Q79 A;  5J1P A;  4YEA A;  4YY3 I;  2PMH A;  4JI0 J;  4DV2 E;  2RB7 A;  3J80 U;  1C1B A;  1F9H A;  2FTR A;  4IZK B;  4GKK J;  1QE1 A;  4C4W A;  1VC5 A;  3KG4 A;  3QT8 A;  4HAC A;  1IBM J;  5I3Q A;  1XMO I;  2RUG A;  1GTH A;  1YHC A;  4C8Y A;  2MKY A;  2K3K A;  2XMT A;  4H4M A;  3CJS A;  2E5I A;  4FF4 A;  3SCI E;  4CRJ A;  5E3A A;  3U1L A;  4DV0 E;  1NZ0 A;  1N54 B;  4PWD B;  4KKO B;  4NXN F;  3AB2 B;  2CRL A;  4W90 B;  3MFI A;  4Q2M A;  2DXF A;  1FFW B;  4B3T F;  5EX3 A;  4LSL B;  3CD7 A;  2UUA F;  2O5D A;  2IY5 B;  4ZJL A;  4IH6 A;  1RHY A;  4F04 B;  1VRU B;  5HQM A;  3QO9 B;  4LF8 J;  2CAJ A;  5KFI A;  2NZ4 A;  2OPS B;  1VQN S;  4B3R I;  4QW9 A;  2YNH B;  4KFB A;  4UZC A;  2PO0 A;  3PR5 B;  2X36 A;  1TZ0 A;  3IP0 A;  2HLT A;  2B9E A;  3P06 A;  5HVG A;  4FPR A;  2GHP A;  2JDJ A;  4N56 A;  4DV3 J;  3K7R A;  2R8J A;  1RAA B;  2W8K A;  3H7H B;  1Z0G A;  2YX7 A;  4C8O A;  4HKQ A;  3SCK E;  4JBC A;  3LAM A;  3NWG A;  3TQE A;  4IDK A;  3H90 A;  5IQQ A;  1Z0B A;  4PKD B;  2HQG A;  1S1W A;  2ZC4 A;  3K8V A;  2B9Y A;  3TVY A;  4R5P A;  2GO9 A;  4ZPA A;  3OVS A;  4A46 A;  3GJT B;  3Q89 A;  4KGV B;  2BAC A;  3A3P B;  3TQ1 A;  5FLX Q;  1OIA A;  3ZNU A;  1QLN A;  2LQ5 A;  3KLI A;  1CS4 A;  3TZW A;  4TY9 A;  1VCT A;  3DLK A;  2GAH C;  1K0T A;  5CH7 B;  4TYB A;  4Y65 A;  3JAM U;  1OSC A;  3CXC R;  2KT3 A;  1LFP A;  4FYW B;  2CPE A;  4ED0 A;  3HKW A;  5CD4 H;  5J2P A;  1NCL A;  2DEI A;  2RML A;  2YKO A;  1Z5C A;  3B4T A;  3ZZT A;  2EEY A;  4DV6 I;  4X65 F;  3DXS X;  3ILL A;  2CPJ A;  3R7B B;  3D3B J;  3DCA A;  2YH1 A;  1ZAW A;  1ZA1 B;  1FKA E;  4XO0 A;  2WTF A;  2BR2 A;  2XYP B;  3KK2 B;  1RJJ A;  4JV2 A;  2CQ4 A;  1AZS A;  2CWK A;  2CQB A;  5EDW A;  3KNG A;  4CQ1 A;  2F4V E;  2WB1 D;  4ZIV A;  1Q81 T;  2YNF B;  5K36 D;  1OY6 A;  4ECR A;  1JXL A;  3P49 B;  3DFE A;  3IN5 A;  3I0S A;  4EYI B;  1REG X;  3R5J B;  5DG8 A;  3FRY A;  3JSR A;  3O8W A;  5IT9 C;  1RHJ B;  1YJ9 S;  1P42 A;  3UNY A;  1N33 I;  1UTA A;  2H48 B;  3J7A 1;  3OL6 A;  3QPI A;  4FYY B;  2RS2 A;  1TUW A;  3TYT A;  3M7V A;  2CQI A;  2KXF A;  2GJ2 A;  3BV8 A;  5K5M A;  2X3D A;  1SKW A;  4AFF A;  5HJY A;  3WU4 A;  4NLO A;  5C0X A;  5KOW A;  1N32 F;  2MZQ A;  4RW4 B;  3DLG A;  3DRS A;  2IDE A;  2GO3 A;  4KR0 B;  4TNO A;  1NXI A;  4CNY A;  1UEU A;  3GJQ B;  2WOM B;  4G3I A;  4N77 A;  4WK3 A;  4ZVP B;  1D0E A;  3MR2 A;  4ANC A;  1HD0 A;  3M7N G;  1YK9 A;  2GGP A;  5CYJ A;  2ZUG A;  3ET6 A;  2IDL A;  1HMV A;  1YKW A;  2UXB I;  3TUI C;  2IAJ B;  4Y2I A;  1EET B;  1HW8 A;  3T19 A;  1N6Q A;  3B4D A;  4OYP A;  1T11 A;  4WIQ A;  3ENV A;  2Y8W A;  1XBW A;  3OXL A;  5C0X C;  5LMN J;  2OKQ A;  4DCJ B;  4DV7 E;  4OHY A;  4EU0 A;  4GC6 A;  1Q8B A;  3MM7 A;  3V6J A;  3AH6 A;  4J9P A;  4P71 A;  3OTO I;  2O01 C;  1Q0N A;  1IKX B;  4KY3 A;  1SC4 B;  4JV5 J;  2UP1 A;  2C28 A;  1X5O A;  5KFH A;  3ILO A;  3PRB A;  2F8M A;  2FJD B;  4EBD A;  2CPX A;  2XO7 A;  2LXI A;  5GAD U;  2EFG A;  2FZG B;  4DV4 F;  1X4C A;  1V6H A;  4WF9 Q;  4C8L A;  2JOQ A;  2QRR A;  2IRY A;  3PIO Q;  2IES A;  1CJV B;  2IJR A;  1U47 A;  3DOM B;  5KFD A;  3PM9 A;  1VOM A;  1Z0V A;  2KHD A;  3OL9 A;  2XHW A;  1VQO S;  3QT6 A;  4URQ U;  2Z4P A;  1MRO B;  1LV5 A;  2GVZ A;  2ZKU A;  1NRK A;  4MK7 A;  4Q2L A;  3B6B A;  1C1C A;  1H72 C;  2IM1 A;  4MU1 A;  2EBE A;  2OEK A;  3CVK A;  1M5O C;  3LWL A;  4AUK A;  4DFK A;  1ZET A;  1MN7 A;  3V6K A;  5J2M B;  4P73 A;  3N0V A;  2Y0B B;  4I64 A;  1FER A;  1S57 A;  4CH1 A;  2DHA A;  3TAR A;  1S1T A;  3RB6 A;  4DUZ J;  5DNL A;  2F1F A;  3SV4 A;  3LGH A;  4J5O A;  1HNX E;  4LF4 F;  2YH0 A;  2YKQ A;  3US5 A;  5IWA F;  2QMX A;  2Z2L A;  1C0T A;  4C97 A;  5L8R C;  1K44 A;  1OY9 A;  1PKP A;  3M85 G;  4HTI A;  1F5A A;  3DRX A;  5KG1 A;  3VV2 B;  2IVM A;  2MJN A;  2V67 A;  2COL