4LF6I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf6I00
3D4JA 1H72C 4DPTA 4DV1I 4DV7E 4B3SE 4JI2E 1Z5AA 2HHHE 5GMDA 1FKAE 4JI4E 4DV6I 4P7AA 3PYDA 2VQFI 4KHPI 5LMNI 2CZ9A 2WW4A 1EI1A 4DR7I 2VQEI 4AQYE 2BM1A 1H74A 1KVKA 1Z0TA 5IWAE 4JI0I 3T1YE 5A2QQ 1Z5BA 4LF7I 2ZBKB 1IBKI 2R3VA 4UT4A 4LF9I 2J7KA 2A2DA 2HKEA 3J80Q 4B3TI 2UUAE 2BM0A 2F4VI 3B78A 1XHKA 1PKPA 4JI8E 4ZVIA 1OJ4A 4DR2I 2NPFA 4NXME 4DV7I 4B3SI 4JI2I 2UXCI 1S4EA 2HHHI 4LF5I 4JI4I 4JV5E 1XMQE 1A6FA 2HK2A 1Z0CA 1XNRE 4AQYI 1B62A 1Z59A 3J81C 1NZ0A 1NHIA 4JG4A 2X7IA 2UXDE 4Z7CA 3K1JA 1XNQE 2OI2A 2VQEE 3B8HA 5GMEA 2ZM6E 4JI5E 2GS8A 4WUDA 4YY3E 1H73A 1IBKE 1U2RA 1RREA 3QT6A 1IBLE 4JI7I 4LFBE 4B3TE 3QT5A 2F4VE 1ZM9A 1Z5CA 4B3RI 2XEXA 2UUCE 4DPUA 1J5EE 4DR2E 5LL6R 4USKA 4WUBA 1ZXMA 1XMQI 4JV5I 1D6TA 1MG7A 3OTOE 2UXCE 4MYTA 4LF5E 4X66E 1XNRI 3WU6A 4DUYE 2V34A 5IT9C 2UXDI 5BR8I 1XNQI 3Q1QA 3ZKBA 3PYEA 2ZM6I 2HK3A 1N0UA 4JI5I 1KTVA 4DU8A 4YY3I 2UXBE 3JAMC 4MYUA 3HULA 3ZZ0A 4Z7YA 1UEKA 2A2CA 1IBLI 4DR6E 1EA6A 4DR4E 4LFBI 4JI6E 3GONA 3M6AA 1N32I 1H7SA 4FW9A 1ZXNA 4DR1I 1HR0E 2UUCI 3LTOA 1J5EI 4JI7E 4B3ME 3OTOI 4FWGA 3ZM7A 4X66I 1N34I 4DUYI 4B3RE 1H7UA 4X62I 4DV4I 4DUZI 5FLXC 4HY1A 1KKHA 1MX0A 3V2UC 1Z0EA 4DV3I 3ZKDA 3PYFA 4M1KA 1RR9A 5BR8E 1PIEA 2DEJA 2UXBI 1ZM3A 2VF3A 4UTGA 4LFAI 2V2QA 4USMA 4P52A 2E1RA 3QT7A 2E5LE 4DR6I 4DR4I 4JI6I 4PRVA 1Z0GA 4DPYA 5A2QC 2AJ4A 4OX9E 4DV2I 1HR0I 4FWHA 4DR3E 4I3HA 4HYMA 4B3MI 1N32E 4HXZA 4X65E 1N33E 3LPSA 3PYGA 4WUCA 4DR1E 2ZITA 3J80C 4LF8E 1HNZE 3J7AM 1N34E 4X62E 4DV4E 4DUZE 3H4LA 4URLA 1VISA 3J81Q 3B82A 4HACB 4XTJA 4DV3E 4LF6E 1HNWE 1KIJA 1FI4A 3WU4A 4DV5E 2UU9I 4JI1E 4JYAE 2E5LI 1K47A 4LFAE 4K0KE 3T1HE 1Z0WA 3WU3A 2EFGA 4OX9I 1FJGI 1QZRA 1FWLA 1DARA 4DR3I 4NXNE 2BV3A 2HFSA 4GKKE 5LMUE 4JI3E 3J7AG 4YHHI 4X65I 1N33I 1IBMI 4FWDA 1HNXE 3WU5A 4DV2E 4DR5E 4R1FA 4FN5A 4KQVA 4LF8I 1Z0BA 1HNZI 4DV0E 4X64E 2HKJA 4LFCE 1B63A 2R42A 1XMOE 1Z0VA 2DEIA 4LF4E 1ELOA 5L3JA 2Q2EB 2V2VA 1N36E 4PU9A 2UUBE 3QT8A 1I94E 4GKJE 5IT9Q 3LNUA 4LF6I 1ZM2A 3CWVA 1HNWI 4DXLA 4DV1E 1PVGA 4DV5I 4JI1I 4JYAI 2V8PA 4DPWA 4PRXA 2HFUA 3F0NA 4K0KI 1NHJA 3T1HI 4DV6E 1FNMA 1WUUA 4DPXA 2VQFE 2UU9E 3V5RA 3JAMQ 1ZM4A 4KHPE 4NXNI 5LMNE 4GKKI 5IWAI 5LMUI 4JI3I 3T1YI 4DR7E 1S16A 1FJGE 1HNXI 4DR5I 1FWKA 4RPFA 4JI0E 4DV0I 4DU7A 4YHHE 1NHHA 1IBME 4X64I 4EMDA 4LFCI 3ZZTA 4LF7E 1XMOI 3K17A 4ED4A 4LF4I 2X36A 2UUAI 1N0VC 3ZZUA 4HACA 4LF9E 1N36I 2V2ZA 4JI8I 2UUBI 1BKNA 1MU5A 4NXMI 1I94I 4GKJI 2LJPA 5FLXQ
chains in the Genus database with same CATH superfamily
3D4JA 1H72C 4DPTA 4DV1I 3UHMA 5FWKA 5EKWA 4DV7E 4B3SE 4JI2E 4IFDC 1Z5AA 2HHHE 5GMDA 1FKAE 2Z5EA 4JI4E 4DV6I 4P7AA 2CGEA 2IESA 1UDNA 3PYDA 3PS1A 2VQFI 4KHPI 3P3CA 5LMNI 2CZ9A 2O1UA 2PNMA 3P3EA 5JEAA 2WW4A 4IZKA 1EI1A 4DR7I 4GQUA 2VQEI 4AQYE 4OO1D 3L7ZA 2BR2B 2BM1A 1H74A 2O1VA 1KVKA 1Z0TA 4AIMA 5IWAE 4JI0I 3T1YE 5A2QQ 4OO1F 1Z5BA 4LF7I 4OO1E 2ZBKB 4IZKB 1IBKI 2R3VA 4UT4A 3P76A 4LF9I 2J7KA 3L7ZB 2A2DA 1E3HA 2F1DA 5DNXA 2HKEA 3J80Q 4B3TI 2UUAE 2IOPA 2BM0A 2F4VI 2JE6B 1XHKA 3B78A 1PKPA 4FW5A 1USVA 4ZVIA 4JI8E 2WNRA 1OJ4A 4DR2I 2NPFA 4NXME 4DV7I 4B3SI 4JI2I 5K36F 2UXCI 5DRQA 1S4EA 2HHHI 4LF5I 4JI4I 3CDIA 3NZKA 2BA1D 4U3DA 4IFDD 4JV5E 1XMQE 1A6FA 2HK2A 1Z0CA 1XNRE 2WNRB 4AQYI 1B62A 4IFDF 2GO4A 1Z59A 3J81C 1NZ0A 1UDOA 1NHIA 4IFDE 4JG4A 2X7IA 2UXDE 2PO0B 4Z7CA 2JT2A 4N3OA 3K1JA 1XNQE 2BA0D 2OI2A 2WP8B 4IZJA 2VQEE 3B8HA 2C39A 5GMEA 2ZM6E 2IERA 4JI5E 2GS8A 4LCHA 4WUDA 4YY3E 1H73A 1IBKE 1U2RA 4IZJB 1RREA 2PNZA 2C39B 3K85A 3P3GA 3PRYA 5K36C 3QT6A 1IBLE 4JI7I 1Y6ZA 4LFBE 4B3TE 3PS3A 5DNLA 5C0XF 3QT5A 2F4VE 2BA0G 1ZM9A 1Z5CA 4B3RI 3HKMA 2XEXA 4MU3A 4DPUA 1J5EE 2UUCE 4DR2E 5LL6R 4USKA 4WUBA 1ZXMA 1XMQI 4JV5I 1D6TA 1MG7A 2BR2A 2PNZB 3OTOE 4BA2A 2UXCE 5DRRA 4MYTA 4OO1A 4X66E 4LF5E 1XNRI 2GO3A 3WU6A 4DUYE 2V34A 1OYSA 5IT9C 2UXDI 5BR8I 1XNQI 3Q1QA 1HK7A 2CG9A 4ISAA 3ZKBA 2PO2A 4BA2B 3PYEA 4OO1B 2ZM6I 2HK3A 1N0UA 4JI5I 1YHCA 1KTVA 4DU8A 4YY3I 2UXBE 2JE6A 1UDSA 1OYPA 3JAMC 4MYUA 3HULA 3ZZ0A 4NBQA 4Z7YA 3PS2A 1UEKA 2PO2B 4MU4A 2CVEA 1Y4SA 2A2CA 5C0XC 1IBLI 1R6LA 5ELWA 1EA6A 4DR4E 4DR6E 4LFBI 4JI6E 3GONA 3M6AA 1N32I 4AIDA 1H7SA 4FW9A 5JEAD 5K36D 1ZXNA 4DR1I 1HR0E 2UUCI 3LTOA 1J5EI 3B4TA 2NN6C 4JI7E 3GLLA 3CDJA 5JEAF 4B3ME 3OTOI 4FWGA 3ZM7A 4X66I 2PO0A 2PNLA 3M85D 4DUYI 1N34I 4B3RE 5K36E 1H7UA 2WP8A 4X62I 4DV4I 4DUZI 4OZEA 4IFDB 5FLXC 4HY1A 4MU1A 1KKHA 1MX0A 3V2UC 1Z0EA 4DV3I 3ZKDA 3PYFA 4M1KA 1RR9A 4FW3A 4LPFA 5BR8E 1PIEA 3GMEA 2C38B 1R6MA 2DEJA 2UXBI 1ZM3A 2VF3A 4UTGA 4LFAI 2PO1B 4AM3A 2V2QA 4USMA 4P52A 2E1RA 3QT7A 2BA1G 2AE8A 4J3DA 2E5LE 4DR6I 3GCMA 4DR4I 4IS9A 4JI6I 4PRVA 1Z0GA 4DPYA 1OYRA 5A2QC 2AJ4A 4OX9E 5C0XD 5JEAC 4DV2I 1HR0I 4FWHA 4DR3E 4MDTA 4I3HA 4HYMA 3DD6A 4B3MI 1N32E 4HXZA 4X65E 1N33E 2J65A 3LPSA 2JEBA 2NN6D 3PYGA 3Q6NA 5C0XE 2C37A 4WUCA 4DR1E 2Z5BA 2ZITA 1USUA 2GQ0A 3J80C 4LF8E 1RHYA 1HNZE 3J7AM 2NN6F 1N34E 2NN6E 4X62E 4FW4A 4DV4E 4LCFA 4DUZE 3H4LA 4URLA 2JEBB 2C37B 1VISA 2Z5BB 1P42A 3J81Q 3B82A 4HACB 4XTJA 4DV3E 4LF6E 1HNWE 1KIJA 1FI4A 2VESA 4QNKA 5DRPA 3WU4A 4DV5E 2UU9I 4JI1E 4JYAE 2E5LI 4U3BA 1K47A 4LFAE 4K0KE 5K36A 3T1HE 3P06A 3H1CA 1Z0WA 3WU3A 2EFGA 4OX9I 1FJGI 2Z5CA 3HJCA 1QZRA 1FWLA 1DARA 4DR3I 4NXNE 2BV3A 2HFSA 4GKKE 5LMUE 4JI3E 3J7AG 4YHHI 3U1KA 4X65I 1N33I 1IBMI 2O3ZA 4FWDA 4IFDA 1HNXE 3WU5A 4DV2E 4DR5E 2O1TA 4R1FA 5JEAB 5K36B 4FN5A 4KQVA 4LF8I 1Z0BA 1VI7A 1HNZI 2Z5CB 4DV0E 4X64E 2HKJA 4LFCE 5JEAE 1B63A 2R42A 1XMOE 3KRNA 2C38A 1Z0VA 2DEIA 2O1WA 4LF4E 1ELOA 5L3JA 2Q2EB 2V2VA 1N36E 4FW7A 4PU9A 3U1YA 4OKGA 2UUBE 2PO1A 3QT8A 1I94E 4MU0A 4GKJE 4QNJA 5IT9Q 3LNUA 4LF6I 1ZM2A 3CWVA 4BA1A 1HNWI 4DXLA 4LCGA 1Y4UA 4DV1E 1PVGA 4DV5I 4JI1I 4JYAI 2V8PA 4DPWA 4PRXA 2HFUA 3F0NA 4K0KI 1NHJA 1Y60A 4LOMA 5C0XA 3T1HI 3M7ND 4DV6E 1FNMA 1WUUA 2JEAA 5DROA 2IOQA 3M85G 4DPXA 2VQFE 4BA1B 2UU9E 3V5RA 4OO1C 3JAMQ 1ZM4A 4KHPE 4NXNI 5LMNE 4GKKI 5IWAI 3Q6MA 5LMUI 4JI3I 3T1YI 4DR7E 2NN6A 1Y5YA 1S16A 1FJGE 1HNXI 4DR5I 1FWKA 4MQYA 4RPFA 5C0XB 1XXEA 2JEAB 4JI0E 4DV0I 4DU7A 4YHHE 1NHHA 4X64I 1IBME 4EMDA 4LFCI 3ZZTA 4LF7E 1XMOI 3K17A 4FW6A 4IZJD 1UDQA 4ED4A 2NN6B 4LF4I 2X36A 2UUAI 1N0VC 3ZZUA 4HACA 4LF9E 3M7NG 1N36I 2V2ZA 4JI8I 2UUBI 1BKNA 1MU5A 4NXMI 1I94I 5EL9A 4GKJI 2LJPA 1YH8A 5FLXQ 1E3PA
chains in the Genus database with same CATH topology
3D4JA 1H72C 4DPTA 4DV1I 5FWKA 4DV7E 4B3SE 4JI2E 1Z5AA 2HHHE 5GMDA 1FKAE 2Z5EA 4JI4E 4DV6I 4P7AA 2CGEA 3PYDA 2VQFI 4KHPI 5LMNI 2CZ9A 2O1UA 2PNMA 2WW4A 4IZKA 1EI1A 4DR7I 2VQEI 4AQYE 2BM1A 1H74A 2O1VA 1KVKA 1Z0TA 5IWAE 4JI0I 3T1YE 5A2QQ 1Z5BA 4LF7I 2ZBKB 4IZKB 1IBKI 2R3VA 4UT4A 4LF9I 2J7KA 2A2DA 2HKEA 3J80Q 4B3TI 2UUAE 2IOPA 2BM0A 2F4VI 3B78A 1XHKA 1PKPA 1USVA 4ZVIA 4JI8E 1OJ4A 4DR2I 2NPFA 4NXME 4DV7I 4B3SI 4JI2I 2UXCI 1S4EA 2HHHI 4LF5I 4JI4I 4JV5E 1XMQE 1A6FA 2HK2A 1Z0CA 1XNRE 4AQYI 1B62A 1Z59A 3J81C 1NZ0A 1NHIA 4JG4A 2X7IA 2UXDE 4Z7CA 4N3OA 3K1JA 1XNQE 2OI2A 4IZJA 2VQEE 3B8HA 5GMEA 2ZM6E 4JI5E 2GS8A 4WUDA 4YY3E 1H73A 1IBKE 1U2RA 4IZJB 1RREA 3K85A 3PRYA 3QT6A 1IBLE 4JI7I 1Y6ZA 4LFBE 4B3TE 3QT5A 2F4VE 1ZM9A 1Z5CA 4B3RI 2XEXA 4DPUA 1J5EE 2UUCE 4DR2E 5LL6R 4USKA 4WUBA 1ZXMA 1XMQI 4JV5I 1D6TA 1MG7A 3OTOE 2UXCE 4MYTA 4LF5E 4X66E 1XNRI 3WU6A 4DUYE 2V34A 5IT9C 2UXDI 5BR8I 1XNQI 3Q1QA 1HK7A 2CG9A 3ZKBA 3PYEA 2ZM6I 2HK3A 1N0UA 4JI5I 1KTVA 4DU8A 4YY3I 2UXBE 3JAMC 4MYUA 3HULA 3ZZ0A 4Z7YA 1UEKA 1Y4SA 2A2CA 1IBLI 4DR6E 1EA6A 4DR4E 4LFBI 4JI6E 3GONA 3M6AA 1N32I 1H7SA 4FW9A 1ZXNA 4DR1I 1HR0E 2UUCI 3LTOA 1J5EI 4JI7E 4B3ME 3OTOI 4FWGA 3ZM7A 4X66I 2PNLA 4DUYI 1N34I 4B3RE 1H7UA 4X62I 4DV4I 4DUZI 5FLXC 4HY1A 1KKHA 1MX0A 3V2UC 1Z0EA 4DV3I 3ZKDA 3PYFA 4M1KA 1RR9A 5BR8E 1PIEA 2DEJA 2UXBI 1ZM3A 2VF3A 4UTGA 4LFAI 2V2QA 4USMA 4P52A 2E1RA 3QT7A 2E5LE 4DR6I 4DR4I 4JI6I 4PRVA 1Z0GA 4DPYA 5A2QC 2AJ4A 4OX9E 4DV2I 1HR0I 4FWHA 4DR3E 4I3HA 4HYMA 4B3MI 1N32E 4HXZA 4X65E 1N33E 3LPSA 3Q6NA 3PYGA 4DR1E 4WUCA 2Z5BA 2ZITA 1USUA 2GQ0A 3J80C 4LF8E 1HNZE 3J7AM 1N34E 4X62E 4DV4E 4DUZE 3H4LA 4URLA 1VISA 2Z5BB 3J81Q 3B82A 4HACB 4XTJA 4DV3E 4LF6E 1HNWE 1KIJA 1FI4A 3WU4A 4DV5E 2UU9I 4JI1E 4JYAE 2E5LI 1K47A 4LFAE 4K0KE 3T1HE 3P06A 1Z0WA 3WU3A 2EFGA 4OX9I 1FJGI 2Z5CA 3HJCA 1QZRA 1FWLA 1DARA 4DR3I 4NXNE 2BV3A 2HFSA 4GKKE 5LMUE 4JI3E 3J7AG 4YHHI 4X65I 1N33I 1IBMI 4FWDA 1HNXE 3WU5A 4DV2E 4DR5E 2O1TA 4R1FA 4FN5A 4KQVA 4LF8I 1Z0BA 1HNZI 2Z5CB 4DV0E 4X64E 2HKJA 4LFCE 1B63A 2R42A 1XMOE 1Z0VA 2DEIA 2O1WA 4LF4E 1ELOA 5L3JA 2Q2EB 2V2VA 1N36E 4PU9A 2UUBE 3QT8A 1I94E 4GKJE 5IT9Q 3LNUA 4LF6I 1ZM2A 3CWVA 1HNWI 4DXLA 1Y4UA 4DV1E 1PVGA 4DV5I 4JI1I 4JYAI 2V8PA 4DPWA 4PRXA 2HFUA 3F0NA 4K0KI 1NHJA 3T1HI 4DV6E 1FNMA 1WUUA 2IOQA 4DPXA 2VQFE 2UU9E 3V5RA 3JAMQ 1ZM4A 4KHPE 4NXNI 5LMNE 4GKKI 5IWAI 3Q6MA 5LMUI 4JI3I 3T1YI 4DR7E 1S16A 1FJGE 1HNXI 4DR5I 1FWKA 4RPFA 4JI0E 4DV0I 4DU7A 4YHHE 1NHHA 4X64I 1IBME 4EMDA 4LFCI 3ZZTA 4LF7E 1XMOI 3K17A 4IZJD 4ED4A 4LF4I 2X36A 2UUAI 1N0VC 3ZZUA 4HACA 4LF9E 1N36I 2V2ZA 4JI8I 2UUBI 1BKNA 1MU5A 4NXMI 1I94I 4GKJI 2LJPA 5FLXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4J A;  1H72 C;  4DPT A;  4DV1 I;  4DV7 E;  4B3S E;  4JI2 E;  1Z5A A;  2HHH E;  5GMD A;  1FKA E;  4JI4 E;  4DV6 I;  4P7A A;  3PYD A;  2VQF I;  4KHP I;  5LMN I;  2CZ9 A;  2WW4 A;  1EI1 A;  4DR7 I;  2VQE I;  4AQY E;  2BM1 A;  1H74 A;  1KVK A;  1Z0T A;  5IWA E;  4JI0 I;  3T1Y E;  5A2Q Q;  1Z5B A;  4LF7 I;  2ZBK B;  1IBK I;  2R3V A;  4UT4 A;  4LF9 I;  2J7K A;  2A2D A;  2HKE A;  3J80 Q;  4B3T I;  2UUA E;  2BM0 A;  2F4V I;  3B78 A;  1XHK A;  1PKP A;  4JI8 E;  4ZVI A;  1OJ4 A;  4DR2 I;  2NPF A;  4NXM E;  4DV7 I;  4B3S I;  4JI2 I;  2UXC I;  1S4E A;  2HHH I;  4LF5 I;  4JI4 I;  4JV5 E;  1XMQ E;  1A6F A;  2HK2 A;  1Z0C A;  1XNR E;  4AQY I;  1B62 A;  1Z59 A;  3J81 C;  1NZ0 A;  1NHI A;  4JG4 A;  2X7I A;  2UXD E;  4Z7C A;  3K1J A;  1XNQ E;  2OI2 A;  2VQE E;  3B8H A;  5GME A;  2ZM6 E;  4JI5 E;  2GS8 A;  4WUD A;  4YY3 E;  1H73 A;  1IBK E;  1U2R A;  1RRE A;  3QT6 A;  1IBL E;  4JI7 I;  4LFB E;  4B3T E;  3QT5 A;  2F4V E;  1ZM9 A;  1Z5C A;  4B3R I;  2XEX A;  2UUC E;  4DPU A;  1J5E E;  4DR2 E;  5LL6 R;  4USK A;  4WUB A;  1ZXM A;  1XMQ I;  4JV5 I;  1D6T A;  1MG7 A;  3OTO E;  2UXC E;  4MYT A;  4LF5 E;  4X66 E;  1XNR I;  3WU6 A;  4DUY E;  2V34 A;  5IT9 C;  2UXD I;  5BR8 I;  1XNQ I;  3Q1Q A;  3ZKB A;  3PYE A;  2ZM6 I;  2HK3 A;  1N0U A;  4JI5 I;  1KTV A;  4DU8 A;  4YY3 I;  2UXB E;  3JAM C;  4MYU A;  3HUL A;  3ZZ0 A;  4Z7Y A;  1UEK A;  2A2C A;  1IBL I;  4DR6 E;  1EA6 A;  4DR4 E;  4LFB I;  4JI6 E;  3GON A;  3M6A A;  1N32 I;  1H7S A;  4FW9 A;  1ZXN A;  4DR1 I;  1HR0 E;  2UUC I;  3LTO A;  1J5E I;  4JI7 E;  4B3M E;  3OTO I;  4FWG A;  3ZM7 A;  4X66 I;  1N34 I;  4DUY I;  4B3R E;  1H7U A;  4X62 I;  4DV4 I;  4DUZ I;  5FLX C;  4HY1 A;  1KKH A;  1MX0 A;  3V2U C;  1Z0E A;  4DV3 I;  3ZKD A;  3PYF A;  4M1K A;  1RR9 A;  5BR8 E;  1PIE A;  2DEJ A;  2UXB I;  1ZM3 A;  2VF3 A;  4UTG A;  4LFA I;  2V2Q A;  4USM A;  4P52 A;  2E1R A;  3QT7 A;  2E5L E;  4DR6 I;  4DR4 I;  4JI6 I;  4PRV A;  1Z0G A;  4DPY A;  5A2Q C;  2AJ4 A;  4OX9 E;  4DV2 I;  1HR0 I;  4FWH A;  4DR3 E;  4I3H A;  4HYM A;  4B3M I;  1N32 E;  4HXZ A;  4X65 E;  1N33 E;  3LPS A;  3PYG A;  4WUC A;  4DR1 E;  2ZIT A;  3J80 C;  4LF8 E;  1HNZ E;  3J7A M;  1N34 E;  4X62 E;  4DV4 E;  4DUZ E;  3H4L A;  4URL A;  1VIS A;  3J81 Q;  3B82 A;  4HAC B;  4XTJ A;  4DV3 E;  4LF6 E;  1HNW E;  1KIJ A;  1FI4 A;  3WU4 A;  4DV5 E;  2UU9 I;  4JI1 E;  4JYA E;  2E5L I;  1K47 A;  4LFA E;  4K0K E;  3T1H E;  1Z0W A;  3WU3 A;  2EFG A;  4OX9 I;  1FJG I;  1QZR A;  1FWL A;  1DAR A;  4DR3 I;  4NXN E;  2BV3 A;  2HFS A;  4GKK E;  5LMU E;  4JI3 E;  3J7A G;  4YHH I;  4X65 I;  1N33 I;  1IBM I;  4FWD A;  1HNX E;  3WU5 A;  4DV2 E;  4DR5 E;  4R1F A;  4FN5 A;  4KQV A;  4LF8 I;  1Z0B A;  1HNZ I;  4DV0 E;  4X64 E;  2HKJ A;  4LFC E;  1B63 A;  2R42 A;  1XMO E;  1Z0V A;  2DEI A;  4LF4 E;  1ELO A;  5L3J A;  2Q2E B;  2V2V A;  1N36 E;  4PU9 A;  2UUB E;  3QT8 A;  1I94 E;  4GKJ E;  5IT9 Q;  3LNU A;  4LF6 I;  1ZM2 A;  3CWV A;  1HNW I;  4DXL A;  4DV1 E;  1PVG A;  4DV5 I;  4JI1 I;  4JYA I;  2V8P A;  4DPW A;  4PRX A;  2HFU A;  3F0N A;  4K0K I;  1NHJ A;  3T1H I;  4DV6 E;  1FNM A;  1WUU A;  4DPX A;  2VQF E;  2UU9 E;  3V5R A;  3JAM Q;  1ZM4 A;  4KHP E;  4NXN I;  5LMN E;  4GKK I;  5IWA I;  5LMU I;  4JI3 I;  3T1Y I;  4DR7 E;  1S16 A;  1FJG E;  1HNX I;  4DR5 I;  1FWK A;  4RPF A;  4JI0 E;  4DV0 I;  4DU7 A;  4YHH E;  1NHH A;  1IBM E;  4X64 I;  4EMD A;  4LFC I;  3ZZT A;  4LF7 E;  1XMO I;  3K17 A;  4ED4 A;  4LF4 I;  2X36 A;  2UUA I;  1N0V C;  3ZZU A;  4HAC A;  4LF9 E;  1N36 I;  2V2Z A;  4JI8 I;  2UUB I;  1BKN A;  1MU5 A;  4NXM I;  1I94 I;  4GKJ I;  2LJP A;  5FLX Q; 
#chains in the Genus database with same CATH topology
 3D4J A;  1H72 C;  4DPT A;  4DV1 I;  3UHM A;  5FWK A;  5EKW A;  4DV7 E;  4B3S E;  4JI2 E;  4IFD C;  1Z5A A;  2HHH E;  5GMD A;  1FKA E;  2Z5E A;  4JI4 E;  4DV6 I;  4P7A A;  2CGE A;  2IES A;  1UDN A;  3PYD A;  3PS1 A;  2VQF I;  4KHP I;  3P3C A;  5LMN I;  2CZ9 A;  2O1U A;  2PNM A;  3P3E A;  5JEA A;  2WW4 A;  4IZK A;  1EI1 A;  4DR7 I;  4GQU A;  2VQE I;  4AQY E;  4OO1 D;  3L7Z A;  2BR2 B;  2BM1 A;  1H74 A;  2O1V A;  1KVK A;  1Z0T A;  4AIM A;  5IWA E;  4JI0 I;  3T1Y E;  5A2Q Q;  4OO1 F;  1Z5B A;  4LF7 I;  4OO1 E;  2ZBK B;  4IZK B;  1IBK I;  2R3V A;  4UT4 A;  3P76 A;  4LF9 I;  2J7K A;  3L7Z B;  2A2D A;  1E3H A;  2F1D A;  5DNX A;  2HKE A;  3J80 Q;  4B3T I;  2UUA E;  2IOP A;  2BM0 A;  2F4V I;  2JE6 B;  1XHK A;  3B78 A;  1PKP A;  4FW5 A;  1USV A;  4ZVI A;  4JI8 E;  2WNR A;  1OJ4 A;  4DR2 I;  2NPF A;  4NXM E;  4DV7 I;  4B3S I;  4JI2 I;  5K36 F;  2UXC I;  5DRQ A;  1S4E A;  2HHH I;  4LF5 I;  4JI4 I;  3CDI A;  3NZK A;  2BA1 D;  4U3D A;  4IFD D;  4JV5 E;  1XMQ E;  1A6F A;  2HK2 A;  1Z0C A;  1XNR E;  2WNR B;  4AQY I;  1B62 A;  4IFD F;  2GO4 A;  1Z59 A;  3J81 C;  1NZ0 A;  1UDO A;  1NHI A;  4IFD E;  4JG4 A;  2X7I A;  2UXD E;  2PO0 B;  4Z7C A;  2JT2 A;  4N3O A;  3K1J A;  1XNQ E;  2BA0 D;  2OI2 A;  2WP8 B;  4IZJ A;  2VQE E;  3B8H A;  2C39 A;  5GME A;  2ZM6 E;  2IER A;  4JI5 E;  2GS8 A;  4LCH A;  4WUD A;  4YY3 E;  1H73 A;  1IBK E;  1U2R A;  4IZJ B;  1RRE A;  2PNZ A;  2C39 B;  3K85 A;  3P3G A;  3PRY A;  5K36 C;  3QT6 A;  1IBL E;  4JI7 I;  1Y6Z A;  4LFB E;  4B3T E;  3PS3 A;  5DNL A;  5C0X F;  3QT5 A;  2F4V E;  2BA0 G;  1ZM9 A;  1Z5C A;  4B3R I;  3HKM A;  2XEX A;  4MU3 A;  4DPU A;  1J5E E;  2UUC E;  4DR2 E;  5LL6 R;  4USK A;  4WUB A;  1ZXM A;  1XMQ I;  4JV5 I;  1D6T A;  1MG7 A;  2BR2 A;  2PNZ B;  3OTO E;  4BA2 A;  2UXC E;  5DRR A;  4MYT A;  4OO1 A;  4X66 E;  4LF5 E;  1XNR I;  2GO3 A;  3WU6 A;  4DUY E;  2V34 A;  1OYS A;  5IT9 C;  2UXD I;  5BR8 I;  1XNQ I;  3Q1Q A;  1HK7 A;  2CG9 A;  4ISA A;  3ZKB A;  2PO2 A;  4BA2 B;  3PYE A;  4OO1 B;  2ZM6 I;  2HK3 A;  1N0U A;  4JI5 I;  1YHC A;  1KTV A;  4DU8 A;  4YY3 I;  2UXB E;  2JE6 A;  1UDS A;  1OYP A;  3JAM C;  4MYU A;  3HUL A;  3ZZ0 A;  4NBQ A;  4Z7Y A;  3PS2 A;  1UEK A;  2PO2 B;  4MU4 A;  2CVE A;  1Y4S A;  2A2C A;  5C0X C;  1IBL I;  1R6L A;  5ELW A;  1EA6 A;  4DR4 E;  4DR6 E;  4LFB I;  4JI6 E;  3GON A;  3M6A A;  1N32 I;  4AID A;  1H7S A;  4FW9 A;  5JEA D;  5K36 D;  1ZXN A;  4DR1 I;  1HR0 E;  2UUC I;  3LTO A;  1J5E I;  3B4T A;  2NN6 C;  4JI7 E;  3GLL A;  3CDJ A;  5JEA F;  4B3M E;  3OTO I;  4FWG A;  3ZM7 A;  4X66 I;  2PO0 A;  2PNL A;  3M85 D;  4DUY I;  1N34 I;  4B3R E;  5K36 E;  1H7U A;  2WP8 A;  4X62 I;  4DV4 I;  4DUZ I;  4OZE A;  4IFD B;  5FLX C;  4HY1 A;  4MU1 A;  1KKH A;  1MX0 A;  3V2U C;  1Z0E A;  4DV3 I;  3ZKD A;  3PYF A;  4M1K A;  1RR9 A;  4FW3 A;  4LPF A;  5BR8 E;  1PIE A;  3GME A;  2C38 B;  1R6M A;  2DEJ A;  2UXB I;  1ZM3 A;  2VF3 A;  4UTG A;  4LFA I;  2PO1 B;  4AM3 A;  2V2Q A;  4USM A;  4P52 A;  2E1R A;  3QT7 A;  2BA1 G;  2AE8 A;  4J3D A;  2E5L E;  4DR6 I;  3GCM A;  4DR4 I;  4IS9 A;  4JI6 I;  4PRV A;  1Z0G A;  4DPY A;  1OYR A;  5A2Q C;  2AJ4 A;  4OX9 E;  5C0X D;  5JEA C;  4DV2 I;  1HR0 I;  4FWH A;  4DR3 E;  4MDT A;  4I3H A;  4HYM A;  3DD6 A;  4B3M I;  1N32 E;  4HXZ A;  4X65 E;  1N33 E;  2J65 A;  3LPS A;  2JEB A;  2NN6 D;  3PYG A;  3Q6N A;  5C0X E;  2C37 A;  4WUC A;  4DR1 E;  2Z5B A;  2ZIT A;  1USU A;  2GQ0 A;  3J80 C;  4LF8 E;  1RHY A;  1HNZ E;  3J7A M;  2NN6 F;  1N34 E;  2NN6 E;  4X62 E;  4FW4 A;  4DV4 E;  4LCF A;  4DUZ E;  3H4L A;  4URL A;  2JEB B;  2C37 B;  1VIS A;  2Z5B B;  1P42 A;  3J81 Q;  3B82 A;  4HAC B;  4XTJ A;  4DV3 E;  4LF6 E;  1HNW E;  1KIJ A;  1FI4 A;  2VES A;  4QNK A;  5DRP A;  3WU4 A;  4DV5 E;  2UU9 I;  4JI1 E;  4JYA E;  2E5L I;  4U3B A;  1K47 A;  4LFA E;  4K0K E;  5K36 A;  3T1H E;  3P06 A;  3H1C A;  1Z0W A;  3WU3 A;  2EFG A;  4OX9 I;  1FJG I;  2Z5C A;  3HJC A;  1QZR A;  1FWL A;  1DAR A;  4DR3 I;  4NXN E;  2BV3 A;  2HFS A;  4GKK E;  5LMU E;  4JI3 E;  3J7A G;  4YHH I;  3U1K A;  4X65 I;  1N33 I;  1IBM I;  2O3Z A;  4FWD A;  4IFD A;  1HNX E;  3WU5 A;  4DV2 E;  4DR5 E;  2O1T A;  4R1F A;  5JEA B;  5K36 B;  4FN5 A;  4KQV A;  4LF8 I;  1Z0B A;  1VI7 A;  1HNZ I;  2Z5C B;  4DV0 E;  4X64 E;  2HKJ A;  4LFC E;  5JEA E;  1B63 A;  2R42 A;  1XMO E;  3KRN A;  2C38 A;  1Z0V A;  2DEI A;  2O1W A;  4LF4 E;  1ELO A;  5L3J A;  2Q2E B;  2V2V A;  1N36 E;  4FW7 A;  4PU9 A;  3U1Y A;  4OKG A;  2UUB E;  2PO1 A;  3QT8 A;  1I94 E;  4MU0 A;  4GKJ E;  4QNJ A;  5IT9 Q;  3LNU A;  4LF6 I;  1ZM2 A;  3CWV A;  4BA1 A;  1HNW I;  4DXL A;  4LCG A;  1Y4U A;  4DV1 E;  1PVG A;  4DV5 I;  4JI1 I;  4JYA I;  2V8P A;  4DPW A;  4PRX A;  2HFU A;  3F0N A;  4K0K I;  1NHJ A;  1Y60 A;  4LOM A;  5C0X A;  3T1H I;  3M7N D;  4DV6 E;  1FNM A;  1WUU A;  2JEA A;  5DRO A;  2IOQ A;  3M85 G;  4DPX A;  2VQF E;  4BA1 B;  2UU9 E;  3V5R A;  4OO1 C;  3JAM Q;  1ZM4 A;  4KHP E;  4NXN I;  5LMN E;  4GKK I;  5IWA I;  3Q6M A;  5LMU I;  4JI3 I;  3T1Y I;  4DR7 E;  2NN6 A;  1Y5Y A;  1S16 A;  1FJG E;  1HNX I;  4DR5 I;  1FWK A;  4MQY A;  4RPF A;  5C0X B;  1XXE A;  2JEA B;  4JI0 E;  4DV0 I;  4DU7 A;  4YHH E;  1NHH A;  4X64 I;  1IBM E;  4EMD A;  4LFC I;  3ZZT A;  4LF7 E;  1XMO I;  3K17 A;  4FW6 A;  4IZJ D;  1UDQ A;  4ED4 A;  2NN6 B;  4LF4 I;  2X36 A;  2UUA I;  1N0V C;  3ZZU A;  4HAC A;  4LF9 E;  3M7N G;  1N36 I;  2V2Z A;  4JI8 I;  2UUB I;  1BKN A;  1MU5 A;  4NXM I;  1I94 I;  5EL9 A;  4GKJ I;  2LJP A;  1YH8 A;  5FLX Q;  1E3P A; 
#chains in the Genus database with same CATH homology
 3D4J A;  1H72 C;  4DPT A;  4DV1 I;  5FWK A;  4DV7 E;  4B3S E;  4JI2 E;  1Z5A A;  2HHH E;  5GMD A;  1FKA E;  2Z5E A;  4JI4 E;  4DV6 I;  4P7A A;  2CGE A;  3PYD A;  2VQF I;  4KHP I;  5LMN I;  2CZ9 A;  2O1U A;  2PNM A;  2WW4 A;  4IZK A;  1EI1 A;  4DR7 I;  2VQE I;  4AQY E;  2BM1 A;  1H74 A;  2O1V A;  1KVK A;  1Z0T A;  5IWA E;  4JI0 I;  3T1Y E;  5A2Q Q;  1Z5B A;  4LF7 I;  2ZBK B;  4IZK B;  1IBK I;  2R3V A;  4UT4 A;  4LF9 I;  2J7K A;  2A2D A;  2HKE A;  3J80 Q;  4B3T I;  2UUA E;  2IOP A;  2BM0 A;  2F4V I;  3B78 A;  1XHK A;  1PKP A;  1USV A;  4ZVI A;  4JI8 E;  1OJ4 A;  4DR2 I;  2NPF A;  4NXM E;  4DV7 I;  4B3S I;  4JI2 I;  2UXC I;  1S4E A;  2HHH I;  4LF5 I;  4JI4 I;  4JV5 E;  1XMQ E;  1A6F A;  2HK2 A;  1Z0C A;  1XNR E;  4AQY I;  1B62 A;  1Z59 A;  3J81 C;  1NZ0 A;  1NHI A;  4JG4 A;  2X7I A;  2UXD E;  4Z7C A;  4N3O A;  3K1J A;  1XNQ E;  2OI2 A;  4IZJ A;  2VQE E;  3B8H A;  5GME A;  2ZM6 E;  4JI5 E;  2GS8 A;  4WUD A;  4YY3 E;  1H73 A;  1IBK E;  1U2R A;  4IZJ B;  1RRE A;  3K85 A;  3PRY A;  3QT6 A;  1IBL E;  4JI7 I;  1Y6Z A;  4LFB E;  4B3T E;  3QT5 A;  2F4V E;  1ZM9 A;  1Z5C A;  4B3R I;  2XEX A;  4DPU A;  1J5E E;  2UUC E;  4DR2 E;  5LL6 R;  4USK A;  4WUB A;  1ZXM A;  1XMQ I;  4JV5 I;  1D6T A;  1MG7 A;  3OTO E;  2UXC E;  4MYT A;  4LF5 E;  4X66 E;  1XNR I;  3WU6 A;  4DUY E;  2V34 A;  5IT9 C;  2UXD I;  5BR8 I;  1XNQ I;  3Q1Q A;  1HK7 A;  2CG9 A;  3ZKB A;  3PYE A;  2ZM6 I;  2HK3 A;  1N0U A;  4JI5 I;  1KTV A;  4DU8 A;  4YY3 I;  2UXB E;  3JAM C;  4MYU A;  3HUL A;  3ZZ0 A;  4Z7Y A;  1UEK A;  1Y4S A;  2A2C A;  1IBL I;  4DR6 E;  1EA6 A;  4DR4 E;  4LFB I;  4JI6 E;  3GON A;  3M6A A;  1N32 I;  1H7S A;  4FW9 A;  1ZXN A;  4DR1 I;  1HR0 E;  2UUC I;  3LTO A;  1J5E I;  4JI7 E;  4B3M E;  3OTO I;  4FWG A;  3ZM7 A;  4X66 I;  2PNL A;  4DUY I;  1N34 I;  4B3R E;  1H7U A;  4X62 I;  4DV4 I;  4DUZ I;  5FLX C;  4HY1 A;  1KKH A;  1MX0 A;  3V2U C;  1Z0E A;  4DV3 I;  3ZKD A;  3PYF A;  4M1K A;  1RR9 A;  5BR8 E;  1PIE A;  2DEJ A;  2UXB I;  1ZM3 A;  2VF3 A;  4UTG A;  4LFA I;  2V2Q A;  4USM A;  4P52 A;  2E1R A;  3QT7 A;  2E5L E;  4DR6 I;  4DR4 I;  4JI6 I;  4PRV A;  1Z0G A;  4DPY A;  5A2Q C;  2AJ4 A;  4OX9 E;  4DV2 I;  1HR0 I;  4FWH A;  4DR3 E;  4I3H A;  4HYM A;  4B3M I;  1N32 E;  4HXZ A;  4X65 E;  1N33 E;  3LPS A;  3Q6N A;  3PYG A;  4DR1 E;  4WUC A;  2Z5B A;  2ZIT A;  1USU A;  2GQ0 A;  3J80 C;  4LF8 E;  1HNZ E;  3J7A M;  1N34 E;  4X62 E;  4DV4 E;  4DUZ E;  3H4L A;  4URL A;  1VIS A;  2Z5B B;  3J81 Q;  3B82 A;  4HAC B;  4XTJ A;  4DV3 E;  4LF6 E;  1HNW E;  1KIJ A;  1FI4 A;  3WU4 A;  4DV5 E;  2UU9 I;  4JI1 E;  4JYA E;  2E5L I;  1K47 A;  4LFA E;  4K0K E;  3T1H E;  3P06 A;  1Z0W A;  3WU3 A;  2EFG A;  4OX9 I;  1FJG I;  2Z5C A;  3HJC A;  1QZR A;  1FWL A;  1DAR A;  4DR3 I;  4NXN E;  2BV3 A;  2HFS A;  4GKK E;  5LMU E;  4JI3 E;  3J7A G;  4YHH I;  4X65 I;  1N33 I;  1IBM I;  4FWD A;  1HNX E;  3WU5 A;  4DV2 E;  4DR5 E;  2O1T A;  4R1F A;  4FN5 A;  4KQV A;  4LF8 I;  1Z0B A;  1HNZ I;  2Z5C B;  4DV0 E;  4X64 E;  2HKJ A;  4LFC E;  1B63 A;  2R42 A;  1XMO E;  1Z0V A;  2DEI A;  2O1W A;  4LF4 E;  1ELO A;  5L3J A;  2Q2E B;  2V2V A;  1N36 E;  4PU9 A;  2UUB E;  3QT8 A;  1I94 E;  4GKJ E;  5IT9 Q;  3LNU A;  4LF6 I;  1ZM2 A;  3CWV A;  1HNW I;  4DXL A;  1Y4U A;  4DV1 E;  1PVG A;  4DV5 I;  4JI1 I;  4JYA I;  2V8P A;  4DPW A;  4PRX A;  2HFU A;  3F0N A;  4K0K I;  1NHJ A;  3T1H I;  4DV6 E;  1FNM A;  1WUU A;  2IOQ A;  4DPX A;  2VQF E;  2UU9 E;  3V5R A;  3JAM Q;  1ZM4 A;  4KHP E;  4NXN I;  5LMN E;  4GKK I;  5IWA I;  3Q6M A;  5LMU I;  4JI3 I;  3T1Y I;  4DR7 E;  1S16 A;  1FJG E;  1HNX I;  4DR5 I;  1FWK A;  4RPF A;  4JI0 E;  4DV0 I;  4DU7 A;  4YHH E;  1NHH A;  4X64 I;  1IBM E;  4EMD A;  4LFC I;  3ZZT A;  4LF7 E;  1XMO I;  3K17 A;  4IZJ D;  4ED4 A;  4LF4 I;  2X36 A;  2UUA I;  1N0V C;  3ZZU A;  4HAC A;  4LF9 E;  1N36 I;  2V2Z A;  4JI8 I;  2UUB I;  1BKN A;  1MU5 A;  4NXM I;  1I94 I;  4GKJ I;  2LJP A;  5FLX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...