4LF6I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf6I00
1HNXI 4M1KA 1KKHA 1VISA 1H73A 1XMQI 4RPFA 1PVGA 4DR5I 4DR1I 4LF6I 1XNQE 4LFCE 2UXDI 3PYGA 3B8HA 3JAMQ 4NXMI 2ZM6E 4DV5E 4FWHA 4DV7I 3ZKDA 1RREA 3T1HE 2VQFE 1ZXMA 4B3RE 4JI3E 5A2QC 5BR8E 2CZ9A 5FLXQ 3J81C 4DR3E 1HNWE 4LF7E 4URLA 4B3ME 2UXCI 4FN5A 2F4VI 1FWLA 4MYTA 4LFBE 1H72C 2GS8A 1HNZI 2UXBE 1EI1A 3OTOE 4WUDA 4JI8I 4X62I 2UUCI 5LMUE 4LF8I 4HY1A 1Z0CA 1EA6A 1H7SA 4DR6E 1K47A 2EFGA 4YY3E 4X66I 1XNRE 4HACA 4X65I 4DR7E 4DV1I 3QT8A 5IWAI 3D4JA 1ELOA 1N33I 3B78A 4AQYE 4DV6I 1HR0E 1Z0WA 2Q2EB 2UU9I 1A6FA 4DV5I 4JI6E 4XTJA 2XEXA 4LFAE 3JAMC 1B63A 4I3HA 4GKKI 4DUZE 1N0VC 2VQFI 1H74A 3F0NA 1IBME 1J5EE 1Z0GA 4DPUA 4B3TE 3J80Q 3M6AA 2E5LE 1N36E 2HFUA 3CWVA 4KHPE 4LFBI 4JV5I 5FLXC 2R3VA 2HKJA 3OTOI 1Z0VA 4JI5E 4DR4E 2UUBE 4USMA 3WU6A 4DV4E 4HYMA 2HHHI 4JI0I 4DR2I 4JI1E 1MU5A 1H7UA 1PKPA 4PRVA 2V2QA 4DR7I 3GONA 2AJ4A 4KQVA 4B3SI 2LJPA 1NZ0A 1XMOE 1N34I 4LF9I 2BM1A 4NXNI 1FNMA 2VQEI 4K0KE 5LMNE 1ZXNA 2UUAI 2ZBKB 3ZM7A 3K17A 3PYDA 4DU8A 4PU9A 2R42A 4JG4A 4YHHE 4DV0E 4OX9E 4GKJI 3QT7A 1N36I 1D6TA 4WUBA 4JYAE 1MG7A 4LF4E 4LF5E 3J80C 1IBLI 2HK3A 2UUBI 2HFSA 4DV3E 1I94I 4JI7I 1ZM9A 4R1FA 5LL6R 4JI1I 1N32E 4MYUA 3B82A 2HKEA 1IBKE 3T1YE 4Z7CA 1FJGE 1PIEA 2BM0A 1DARA 4JI2E 3ZKBA 1XNQI 1WUUA 4LFCI 4JI4E 1HNXE 2E1RA 1U2RA 1XMQE 3LPSA 2ZM6I 5LMNI 2DEJA 4DR5E 1Z59A 4P7AA 4DR1E 4LF6E 3ZZ0A 4DXLA 4FWDA 3T1HI 2X7IA 4B3RI 4JI3I 1BKNA 3PYEA 3WU5A 4FW9A 5BR8I 1Z0EA 4DPWA 4YHHI 4OX9I 4USKA 4DR3I 3WU4A 2V2VA 4LF7I 1HNWI 4B3MI 4EMDA 4DUYE 4DV7E 1Z5BA 1S4EA 1KVKA 2UXBI 4LF5I 3J7AM 1ZM2A 5LMUI 4DV3I 1NHHA 5IT9Q 4DR6I 2UXCE 2HK2A 2F4VE 1OJ4A 2WW4A 1XNRI 4YY3I 2DEIA 1HNZE 4JI8E 4X62E 1Z0TA 2VF3A 2UUCE 4ED4A 4LF8E 2V2ZA 1FKAE 4AQYI 4DPYA 1HR0I 4X66E 4X65E 4DV2E 3Q1QA 1S16A 4DV1E 4JI6I 5IWAE 4DPXA 3LTOA 4LFAI 1N33E 4DUZI 2A2DA 1ZM4A 3PYFA 4DV6E 1IBMI 1Z5CA 1J5EI 4B3TI 1I94E 1ZM3A 2UU9E 3V2UC 1QZRA 2E5LI 3QT5A 4DUYI 3WU3A 4GKKE 4KHPI 4JI5I 4DR4I 4DV4I 2V8PA 4X64E 4DU7A 2A2CA 3K1JA 4JV5E 3HULA 1KTVA 3H4LA 5IT9C 1XHKA 4WUCA 3ZZUA 2HHHE 1MX0A 1XMOI 4JI0E 4DR2E 2ZITA 3J7AG 4K0KI 3QT6A 4Z7YA 4DV2I 1Z5AA 1NHJA 1RR9A 1UEKA 2BV3A 4B3SE 5L3JA 2X36A 2UXDE 4HXZA 1N34E 4LF9E 4NXNE 5GMEA 1KIJA 4NXME 2VQEE 4HACB 2OI2A 4DV0I 1NHIA 2UUAE 5A2QQ 4DPTA 1N0UA 3V5RA 3J81Q 4JYAI 3LNUA 4PRXA 4LF4I 1B62A 1Z0BA 4P52A 4GKJE 2NPFA 4FWGA 4X64I 3ZZTA 1N32I 2V34A 4ZVIA 1IBKI 3T1YI 2J7KA 1FWKA 1FJGI 1IBLE 4JI2I 5GMDA 4UT4A 1FI4A 4UTGA 4JI7E 4JI4I
chains in the Genus database with same CATH superfamily
1HNXI 4M1KA 2BR2A 1KKHA 1VISA 1H73A 3P3GA 1XMQI 2WP8B 4RPFA 5C0XC 1PVGA 4DR5I 4IFDA 4DR1I 1UDOA 4OO1F 4LF6I 1XNQE 4LFCE 2UXDI 3PYGA 2Z5CB 3PS2A 3L7ZA 3B8HA 1YH8A 3JAMQ 4MQYA 4NXMI 2ZM6E 2C38B 4FW5A 4DV5E 4FWHA 4FW3A 2PO1A 4DV7I 4N3OA 2BA0G 4AIDA 4IFDD 3ZKDA 1RREA 3T1HE 2VQFE 1ZXMA 4B3RE 4JI3E 5A2QC 2AE8A 5C0XA 2PO2B 5BR8E 2CZ9A 5FLXQ 3J81C 4DR3E 1HNWE 4LF7E 4URLA 2C37B 4B3ME 1USUA 2UXCI 4FN5A 2NN6C 2F4VI 1FWLA 4MYTA 4LFBE 1H72C 2GS8A 1HNZI 2UXBE 4U3DA 1EI1A 3OTOE 3P3CA 2Z5BA 4WUDA 1OYSA 4JI8I 2CVEA 4X62I 3PS1A 2UUCI 3B4TA 5LMUE 4LF8I 4HY1A 4BA2A 5C0XD 1Z0CA 1EA6A 1H7SA 4DR6E 1K47A 1HK7A 1OYPA 2EFGA 4YY3E 5JEAF 4X66I 1XNRE 2C39B 4HACA 4X65I 4DR7E 4AIMA 4DV1I 3QT8A 5IWAI 3D4JA 1ELOA 4BA1A 1N33I 3B78A 4AQYE 2NN6A 4DV6I 1HR0E 1Z0WA 2Q2EB 2NN6F 1A6FA 2UU9I 4DV5I 5DRQA 4JI6E 5K36E 4FW6A 4XTJA 4IZJB 2XEXA 4LFAE 3JAMC 1P42A 1B63A 2IOQA 5EL9A 4I3HA 4GKKI 4DUZE 1N0VC 2VQFI 4FW4A 1H74A 3F0NA 1IBME 5FWKA 1J5EE 1Z0GA 4DPUA 4B3TE 2J65A 1Y4SA 2NN6D 2BA0D 3J80Q 3M6AA 2E5LE 1N36E 2CGEA 2HFUA 3CWVA 4KHPE 4LFBI 3M7NG 4JV5I 5FLXC 2R3VA 2HKJA 3OTOI 1Z0VA 4JI5E 4DR4E 2UUBE 4USMA 3WU6A 4DV4E 1RHYA 2O1TA 3P76A 4LPFA 4HYMA 2HHHI 4JI0I 3HJCA 4DR2I 4JI1E 2Z5CA 1UDSA 1MU5A 1H7UA 4MU0A 2V2QA 4PRVA 4DR7I 2C38A 3GONA 5DNLA 2AJ4A 4KQVA 4B3SI 4IFDF 2LJPA 1NZ0A 1XMOE 1N34I 4LF9I 2BM1A 2Z5EA 4NXNI 1FNMA 2VQEI 4K0KE 5LMNE 1ZXNA 5K36C 2UUAI 2ZBKB 4U3BA 3ZM7A 1E3PA 4LCGA 4FW7A 3K17A 3PYDA 4DU8A 2C37A 2IOPA 4PU9A 2BR2B 2R42A 2JE6A 3CDJA 5EKWA 4IZKA 2GO4A 4JG4A 4YHHE 4DV0E 4OO1B 4OX9E 5C0XF 4GQUA 4GKJI 3QT7A 1N36I 1D6TA 4OZEA 4WUBA 4JYAE 3L7ZB 1MG7A 4LF4E 4LF5E 3J80C 1IBLI 1UDQA 2PNLA 5K36A 2HK3A 2UUBI 4OO1E 2HFSA 2O1UA 4DV3E 1E3HA 4MDTA 1I94I 4JI7I 5K36F 2BA1D 3M7ND 3Q6MA 2PO1B 2JEBB 1ZM9A 4R1FA 5LL6R 4JI1I 1N32E 4MYUA 3B82A 3HKMA 2HKEA 1IBKE 2JT2A 3T1YE 4Z7CA 1FJGE 1PIEA 2BM0A 1DARA 4JI2E 4IS9A 3ZKBA 1XNQI 1WUUA 4LFCI 2PNZB 4JI4E 5K36D 1HNXE 2E1RA 2PO0A 2WNRB 1U2RA 1XMQE 3LPSA 2ZM6I 5LMNI 2DEJA 4DR5E 1Z59A 4P7AA 2JEAB 4DR1E 1VI7A 4BA2B 1USVA 4LF6E 3ZZ0A 5JEAB 4DXLA 4FWDA 1R6LA 3T1HI 2X7IA 4B3RI 4JI3I 1BKNA 5ELWA 2O1WA 3PYEA 3WU5A 4FW9A 5BR8I 1Z0EA 4DPWA 4YHHI 4OX9I 4USKA 4DR3I 3WU4A 2V2VA 4LF7I 1HNWI 4B3MI 4BA1B 4EMDA 4DUYE 4DV7E 1Z5BA 2BA1G 2NN6B 1S4EA 1KVKA 2UXBI 5JEAE 2WP8A 4LF5I 4OO1C 3J7AM 1R6MA 2CG9A 1ZM2A 5LMUI 2F1DA 4DV3I 1NHHA 5IT9Q 4DR6I 2UXCE 2HK2A 1XXEA 2F4VE 1OJ4A 2WW4A 5DRRA 1XNRI 4NBQA 4YY3I 1UDNA 2DEIA 1HNZE 1OYRA 4JI8E 4X62E 2PNMA 1Z0TA 2VF3A 2UUCE 4ED4A 4LF8E 2V2ZA 1FKAE 1Y6ZA 3P06A 4AQYI 3CDIA 4DPYA 1HR0I 4X66E 2PO2A 4X65E 4DV2E 3Q1QA 4OO1A 1S16A 4DV1E 4JI6I 1YHCA 5IWAE 4DPXA 3LTOA 2O1VA 4LFAI 3M85G 1Y4UA 1N33E 4DUZI 2A2DA 1ZM4A 3PYFA 4DV6E 3GMEA 1IBMI 1Z5CA 1J5EI 4B3TI 4JI7E 1I94E 1ZM3A 4IFDB 4LCFA 1QZRA 3V2UC 2UU9E 2E5LI 3QT5A 5JEAC 2IESA 2GO3A 4OO1D 4DUYI 2JEBA 3Q6NA 3WU3A 4GKKE 4KHPI 2C39A 4JI5I 4DR4I 2VESA 4DV4I 4J3DA 2V8PA 4LOMA 4IFDE 4X64E 3GCMA 2PNZA 4DU7A 2A2CA 2JE6B 2WNRA 3K1JA 4JV5E 3HULA 1KTVA 5C0XB 3P3EA 4IZKB 3H4LA 5IT9C 1XHKA 4WUCA 3GLLA 2JEAA 4IZJA 3ZZUA 4LCHA 2HHHE 1MX0A 1XMOI 4ISAA 4JI0E 5JEAA 5DNXA 4QNKA 4DR2E 1Y60A 2ZITA 3J7AG 4K0KI 3QT6A 4MU3A 3PS3A 4Z7YA 2Z5BB 3PRYA 4DV2I 1Z5AA 5K36B 5C0XE 1NHJA 1RR9A 1UEKA 2BV3A 4B3SE 5L3JA 2X36A 2UXDE 4HXZA 1N34E 4OKGA 4QNJA 4LF9E 4NXNE 3KRNA 5GMEA 1KIJA 4NXME 2VQEE 4HACB 5DRPA 4IZJD 2OI2A 4MU4A 4DV0I 1NHIA 5JEAD 2UUAE 3M85D 5A2QQ 4DPTA 1N0UA 3V5RA 3J81Q 4JYAI 3UHMA 3LNUA 2PO0B 4PRXA 4LF4I 1B62A 2GQ0A 4IFDC 3U1YA 1Z0BA 3NZKA 4P52A 4GKJE 2NPFA 4FWGA 4X64I 3ZZTA 3U1KA 3DD6A 2IERA 1N32I 2V34A 4AM3A 2O3ZA 4MU1A 2NN6E 4ZVIA 1IBKI 3T1YI 2J7KA 1FWKA 3K85A 1FJGI 1IBLE 5DROA 4JI2I 5GMDA 1Y5YA 4UT4A 3H1CA 1FI4A 4UTGA 1PKPA 4JI4I
chains in the Genus database with same CATH topology
1HNXI 4M1KA 1KKHA 1VISA 1H73A 1XMQI 4RPFA 1PVGA 4DR5I 4DR1I 4LF6I 1XNQE 4LFCE 2UXDI 3PYGA 2Z5CB 3B8HA 3JAMQ 4NXMI 2ZM6E 4DV5E 4FWHA 4DV7I 4N3OA 3ZKDA 1RREA 3T1HE 2VQFE 1ZXMA 4B3RE 4JI3E 5A2QC 5BR8E 2CZ9A 5FLXQ 3J81C 4DR3E 1HNWE 4LF7E 4URLA 4B3ME 1USUA 2UXCI 4FN5A 2F4VI 1FWLA 4MYTA 4LFBE 1H72C 2GS8A 1HNZI 2UXBE 1EI1A 3OTOE 2Z5BA 4WUDA 4JI8I 4X62I 2UUCI 5LMUE 4LF8I 4HY1A 1Z0CA 1EA6A 1H7SA 4DR6E 1K47A 1HK7A 2EFGA 4YY3E 4X66I 1XNRE 4HACA 4X65I 4DR7E 4DV1I 3QT8A 5IWAI 3D4JA 1ELOA 1N33I 3B78A 4AQYE 4DV6I 1HR0E 1Z0WA 2Q2EB 1A6FA 2UU9I 4DV5I 4JI6E 4XTJA 4IZJB 2XEXA 4LFAE 3JAMC 1B63A 2IOQA 4I3HA 4GKKI 4DUZE 1N0VC 2VQFI 1H74A 3F0NA 1IBME 5FWKA 1J5EE 1Z0GA 4DPUA 4B3TE 1Y4SA 3J80Q 3M6AA 2E5LE 1N36E 2CGEA 2HFUA 3CWVA 4KHPE 4LFBI 4JV5I 5FLXC 2R3VA 2HKJA 3OTOI 1Z0VA 4JI5E 4DR4E 2UUBE 4USMA 3WU6A 4DV4E 2O1TA 4HYMA 2HHHI 4JI0I 3HJCA 4DR2I 4JI1E 2Z5CA 1MU5A 1H7UA 1PKPA 4PRVA 2V2QA 4DR7I 3GONA 2AJ4A 4KQVA 4B3SI 2LJPA 1NZ0A 1XMOE 1N34I 4LF9I 2BM1A 2Z5EA 4NXNI 1FNMA 2VQEI 4K0KE 5LMNE 1ZXNA 2UUAI 2ZBKB 3ZM7A 3K17A 3PYDA 4DU8A 2IOPA 4PU9A 2R42A 4IZKA 4JG4A 4YHHE 4DV0E 4OX9E 4GKJI 3QT7A 1N36I 1D6TA 4WUBA 4JYAE 1MG7A 4LF4E 4LF5E 3J80C 1IBLI 2PNLA 2HK3A 2UUBI 2HFSA 2O1UA 4DV3E 1I94I 4JI7I 3Q6MA 1ZM9A 4R1FA 5LL6R 4JI1I 1N32E 4MYUA 3B82A 2HKEA 1IBKE 3T1YE 4Z7CA 1FJGE 1PIEA 2BM0A 1DARA 4JI2E 3ZKBA 1XNQI 1WUUA 4LFCI 4JI4E 1HNXE 2E1RA 1U2RA 1XMQE 3LPSA 2ZM6I 5LMNI 2DEJA 4DR5E 1Z59A 4P7AA 4DR1E 1USVA 4LF6E 3ZZ0A 4DXLA 4FWDA 3T1HI 2X7IA 4B3RI 4JI3I 1BKNA 2O1WA 3PYEA 3WU5A 4FW9A 5BR8I 1Z0EA 4DPWA 4YHHI 4OX9I 4USKA 4DR3I 3WU4A 2V2VA 4LF7I 1HNWI 4B3MI 4EMDA 4DUYE 4DV7E 1Z5BA 1S4EA 1KVKA 2UXBI 4LF5I 3J7AM 2CG9A 1ZM2A 5LMUI 4DV3I 1NHHA 5IT9Q 4DR6I 2UXCE 2HK2A 2F4VE 1OJ4A 2WW4A 1XNRI 4YY3I 2DEIA 1HNZE 4JI8E 4X62E 2PNMA 1Z0TA 2VF3A 2UUCE 4ED4A 4LF8E 2V2ZA 1FKAE 1Y6ZA 3P06A 4AQYI 4DPYA 1HR0I 4X66E 4X65E 4DV2E 3Q1QA 1S16A 4DV1E 4JI6I 5IWAE 4DPXA 3LTOA 2O1VA 4LFAI 1Y4UA 1N33E 4DUZI 2A2DA 1ZM4A 3PYFA 4DV6E 1IBMI 1Z5CA 1J5EI 4B3TI 1I94E 1ZM3A 3V2UC 1QZRA 2UU9E 2E5LI 3QT5A 4DUYI 3Q6NA 3WU3A 4GKKE 4KHPI 4JI5I 4DR4I 4DV4I 2V8PA 4X64E 4DU7A 2A2CA 3K1JA 4JV5E 3HULA 1KTVA 4IZKB 3H4LA 5IT9C 1XHKA 4WUCA 4IZJA 3ZZUA 2HHHE 1MX0A 1XMOI 4JI0E 4DR2E 2ZITA 3J7AG 4K0KI 3QT6A 4Z7YA 2Z5BB 3PRYA 4DV2I 1Z5AA 1NHJA 1RR9A 1UEKA 2BV3A 4B3SE 5L3JA 2X36A 2UXDE 4HXZA 1N34E 4LF9E 4NXNE 5GMEA 1KIJA 4NXME 2VQEE 4HACB 4IZJD 2OI2A 4DV0I 1NHIA 2UUAE 5A2QQ 4DPTA 1N0UA 3V5RA 3J81Q 4JYAI 3LNUA 4PRXA 4LF4I 1B62A 2GQ0A 1Z0BA 4P52A 4GKJE 2NPFA 4FWGA 4X64I 3ZZTA 1N32I 2V34A 4ZVIA 1IBKI 3T1YI 2J7KA 1FWKA 3K85A 1FJGI 1IBLE 4JI2I 5GMDA 4UT4A 1FI4A 4UTGA 4JI7E 4JI4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX I;  4M1K A;  1KKH A;  1VIS A;  1H73 A;  1XMQ I;  4RPF A;  1PVG A;  4DR5 I;  4DR1 I;  4LF6 I;  1XNQ E;  4LFC E;  2UXD I;  3PYG A;  3B8H A;  3JAM Q;  4NXM I;  2ZM6 E;  4DV5 E;  4FWH A;  4DV7 I;  3ZKD A;  1RRE A;  3T1H E;  2VQF E;  1ZXM A;  4B3R E;  4JI3 E;  5A2Q C;  5BR8 E;  2CZ9 A;  5FLX Q;  3J81 C;  4DR3 E;  1HNW E;  4LF7 E;  4URL A;  4B3M E;  2UXC I;  4FN5 A;  2F4V I;  1FWL A;  4MYT A;  4LFB E;  1H72 C;  2GS8 A;  1HNZ I;  2UXB E;  1EI1 A;  3OTO E;  4WUD A;  4JI8 I;  4X62 I;  2UUC I;  5LMU E;  4LF8 I;  4HY1 A;  1Z0C A;  1EA6 A;  1H7S A;  4DR6 E;  1K47 A;  2EFG A;  4YY3 E;  4X66 I;  1XNR E;  4HAC A;  4X65 I;  4DR7 E;  4DV1 I;  3QT8 A;  5IWA I;  3D4J A;  1ELO A;  1N33 I;  3B78 A;  4AQY E;  4DV6 I;  1HR0 E;  1Z0W A;  2Q2E B;  2UU9 I;  1A6F A;  4DV5 I;  4JI6 E;  4XTJ A;  2XEX A;  4LFA E;  3JAM C;  1B63 A;  4I3H A;  4GKK I;  4DUZ E;  1N0V C;  2VQF I;  1H74 A;  3F0N A;  1IBM E;  1J5E E;  1Z0G A;  4DPU A;  4B3T E;  3J80 Q;  3M6A A;  2E5L E;  1N36 E;  2HFU A;  3CWV A;  4KHP E;  4LFB I;  4JV5 I;  5FLX C;  2R3V A;  2HKJ A;  3OTO I;  1Z0V A;  4JI5 E;  4DR4 E;  2UUB E;  4USM A;  3WU6 A;  4DV4 E;  4HYM A;  2HHH I;  4JI0 I;  4DR2 I;  4JI1 E;  1MU5 A;  1H7U A;  1PKP A;  4PRV A;  2V2Q A;  4DR7 I;  3GON A;  2AJ4 A;  4KQV A;  4B3S I;  2LJP A;  1NZ0 A;  1XMO E;  1N34 I;  4LF9 I;  2BM1 A;  4NXN I;  1FNM A;  2VQE I;  4K0K E;  5LMN E;  1ZXN A;  2UUA I;  2ZBK B;  3ZM7 A;  3K17 A;  3PYD A;  4DU8 A;  4PU9 A;  2R42 A;  4JG4 A;  4YHH E;  4DV0 E;  4OX9 E;  4GKJ I;  3QT7 A;  1N36 I;  1D6T A;  4WUB A;  4JYA E;  1MG7 A;  4LF4 E;  4LF5 E;  3J80 C;  1IBL I;  2HK3 A;  2UUB I;  2HFS A;  4DV3 E;  1I94 I;  4JI7 I;  1ZM9 A;  4R1F A;  5LL6 R;  4JI1 I;  1N32 E;  4MYU A;  3B82 A;  2HKE A;  1IBK E;  3T1Y E;  4Z7C A;  1FJG E;  1PIE A;  2BM0 A;  1DAR A;  4JI2 E;  3ZKB A;  1XNQ I;  1WUU A;  4LFC I;  4JI4 E;  1HNX E;  2E1R A;  1U2R A;  1XMQ E;  3LPS A;  2ZM6 I;  5LMN I;  2DEJ A;  4DR5 E;  1Z59 A;  4P7A A;  4DR1 E;  4LF6 E;  3ZZ0 A;  4DXL A;  4FWD A;  3T1H I;  2X7I A;  4B3R I;  4JI3 I;  1BKN A;  3PYE A;  3WU5 A;  4FW9 A;  5BR8 I;  1Z0E A;  4DPW A;  4YHH I;  4OX9 I;  4USK A;  4DR3 I;  3WU4 A;  2V2V A;  4LF7 I;  1HNW I;  4B3M I;  4EMD A;  4DUY E;  4DV7 E;  1Z5B A;  1S4E A;  1KVK A;  2UXB I;  4LF5 I;  3J7A M;  1ZM2 A;  5LMU I;  4DV3 I;  1NHH A;  5IT9 Q;  4DR6 I;  2UXC E;  2HK2 A;  2F4V E;  1OJ4 A;  2WW4 A;  1XNR I;  4YY3 I;  2DEI A;  1HNZ E;  4JI8 E;  4X62 E;  1Z0T A;  2VF3 A;  2UUC E;  4ED4 A;  4LF8 E;  2V2Z A;  1FKA E;  4AQY I;  4DPY A;  1HR0 I;  4X66 E;  4X65 E;  4DV2 E;  3Q1Q A;  1S16 A;  4DV1 E;  4JI6 I;  5IWA E;  4DPX A;  3LTO A;  4LFA I;  1N33 E;  4DUZ I;  2A2D A;  1ZM4 A;  3PYF A;  4DV6 E;  1IBM I;  1Z5C A;  1J5E I;  4B3T I;  1I94 E;  1ZM3 A;  2UU9 E;  3V2U C;  1QZR A;  2E5L I;  3QT5 A;  4DUY I;  3WU3 A;  4GKK E;  4KHP I;  4JI5 I;  4DR4 I;  4DV4 I;  2V8P A;  4X64 E;  4DU7 A;  2A2C A;  3K1J A;  4JV5 E;  3HUL A;  1KTV A;  3H4L A;  5IT9 C;  1XHK A;  4WUC A;  3ZZU A;  2HHH E;  1MX0 A;  1XMO I;  4JI0 E;  4DR2 E;  2ZIT A;  3J7A G;  4K0K I;  3QT6 A;  4Z7Y A;  4DV2 I;  1Z5A A;  1NHJ A;  1RR9 A;  1UEK A;  2BV3 A;  4B3S E;  5L3J A;  2X36 A;  2UXD E;  4HXZ A;  1N34 E;  4LF9 E;  4NXN E;  5GME A;  1KIJ A;  4NXM E;  2VQE E;  4HAC B;  2OI2 A;  4DV0 I;  1NHI A;  2UUA E;  5A2Q Q;  4DPT A;  1N0U A;  3V5R A;  3J81 Q;  4JYA I;  3LNU A;  4PRX A;  4LF4 I;  1B62 A;  1Z0B A;  4P52 A;  4GKJ E;  2NPF A;  4FWG A;  4X64 I;  3ZZT A;  1N32 I;  2V34 A;  4ZVI A;  1IBK I;  3T1Y I;  2J7K A;  1FWK A;  1FJG I;  1IBL E;  4JI2 I;  5GMD A;  4UT4 A;  1FI4 A;  4UTG A;  4JI7 E;  4JI4 I; 
#chains in the Genus database with same CATH topology
 1HNX I;  4M1K A;  2BR2 A;  1KKH A;  1VIS A;  1H73 A;  3P3G A;  1XMQ I;  2WP8 B;  4RPF A;  5C0X C;  1PVG A;  4DR5 I;  4IFD A;  4DR1 I;  1UDO A;  4OO1 F;  4LF6 I;  1XNQ E;  4LFC E;  2UXD I;  3PYG A;  2Z5C B;  3PS2 A;  3L7Z A;  3B8H A;  1YH8 A;  3JAM Q;  4MQY A;  4NXM I;  2ZM6 E;  2C38 B;  4FW5 A;  4DV5 E;  4FWH A;  4FW3 A;  2PO1 A;  4DV7 I;  4N3O A;  2BA0 G;  4AID A;  4IFD D;  3ZKD A;  1RRE A;  3T1H E;  2VQF E;  1ZXM A;  4B3R E;  4JI3 E;  5A2Q C;  2AE8 A;  5C0X A;  2PO2 B;  5BR8 E;  2CZ9 A;  5FLX Q;  3J81 C;  4DR3 E;  1HNW E;  4LF7 E;  4URL A;  2C37 B;  4B3M E;  1USU A;  2UXC I;  4FN5 A;  2NN6 C;  2F4V I;  1FWL A;  4MYT A;  4LFB E;  1H72 C;  2GS8 A;  1HNZ I;  2UXB E;  4U3D A;  1EI1 A;  3OTO E;  3P3C A;  2Z5B A;  4WUD A;  1OYS A;  4JI8 I;  2CVE A;  4X62 I;  3PS1 A;  2UUC I;  3B4T A;  5LMU E;  4LF8 I;  4HY1 A;  4BA2 A;  5C0X D;  1Z0C A;  1EA6 A;  1H7S A;  4DR6 E;  1K47 A;  1HK7 A;  1OYP A;  2EFG A;  4YY3 E;  5JEA F;  4X66 I;  1XNR E;  2C39 B;  4HAC A;  4X65 I;  4DR7 E;  4AIM A;  4DV1 I;  3QT8 A;  5IWA I;  3D4J A;  1ELO A;  4BA1 A;  1N33 I;  3B78 A;  4AQY E;  2NN6 A;  4DV6 I;  1HR0 E;  1Z0W A;  2Q2E B;  2NN6 F;  1A6F A;  2UU9 I;  4DV5 I;  5DRQ A;  4JI6 E;  5K36 E;  4FW6 A;  4XTJ A;  4IZJ B;  2XEX A;  4LFA E;  3JAM C;  1P42 A;  1B63 A;  2IOQ A;  5EL9 A;  4I3H A;  4GKK I;  4DUZ E;  1N0V C;  2VQF I;  4FW4 A;  1H74 A;  3F0N A;  1IBM E;  5FWK A;  1J5E E;  1Z0G A;  4DPU A;  4B3T E;  2J65 A;  1Y4S A;  2NN6 D;  2BA0 D;  3J80 Q;  3M6A A;  2E5L E;  1N36 E;  2CGE A;  2HFU A;  3CWV A;  4KHP E;  4LFB I;  3M7N G;  4JV5 I;  5FLX C;  2R3V A;  2HKJ A;  3OTO I;  1Z0V A;  4JI5 E;  4DR4 E;  2UUB E;  4USM A;  3WU6 A;  4DV4 E;  1RHY A;  2O1T A;  3P76 A;  4LPF A;  4HYM A;  2HHH I;  4JI0 I;  3HJC A;  4DR2 I;  4JI1 E;  2Z5C A;  1UDS A;  1MU5 A;  1H7U A;  4MU0 A;  2V2Q A;  4PRV A;  4DR7 I;  2C38 A;  3GON A;  5DNL A;  2AJ4 A;  4KQV A;  4B3S I;  4IFD F;  2LJP A;  1NZ0 A;  1XMO E;  1N34 I;  4LF9 I;  2BM1 A;  2Z5E A;  4NXN I;  1FNM A;  2VQE I;  4K0K E;  5LMN E;  1ZXN A;  5K36 C;  2UUA I;  2ZBK B;  4U3B A;  3ZM7 A;  1E3P A;  4LCG A;  4FW7 A;  3K17 A;  3PYD A;  4DU8 A;  2C37 A;  2IOP A;  4PU9 A;  2BR2 B;  2R42 A;  2JE6 A;  3CDJ A;  5EKW A;  4IZK A;  2GO4 A;  4JG4 A;  4YHH E;  4DV0 E;  4OO1 B;  4OX9 E;  5C0X F;  4GQU A;  4GKJ I;  3QT7 A;  1N36 I;  1D6T A;  4OZE A;  4WUB A;  4JYA E;  3L7Z B;  1MG7 A;  4LF4 E;  4LF5 E;  3J80 C;  1IBL I;  1UDQ A;  2PNL A;  5K36 A;  2HK3 A;  2UUB I;  4OO1 E;  2HFS A;  2O1U A;  4DV3 E;  1E3H A;  4MDT A;  1I94 I;  4JI7 I;  5K36 F;  2BA1 D;  3M7N D;  3Q6M A;  2PO1 B;  2JEB B;  1ZM9 A;  4R1F A;  5LL6 R;  4JI1 I;  1N32 E;  4MYU A;  3B82 A;  3HKM A;  2HKE A;  1IBK E;  2JT2 A;  3T1Y E;  4Z7C A;  1FJG E;  1PIE A;  2BM0 A;  1DAR A;  4JI2 E;  4IS9 A;  3ZKB A;  1XNQ I;  1WUU A;  4LFC I;  2PNZ B;  4JI4 E;  5K36 D;  1HNX E;  2E1R A;  2PO0 A;  2WNR B;  1U2R A;  1XMQ E;  3LPS A;  2ZM6 I;  5LMN I;  2DEJ A;  4DR5 E;  1Z59 A;  4P7A A;  2JEA B;  4DR1 E;  1VI7 A;  4BA2 B;  1USV A;  4LF6 E;  3ZZ0 A;  5JEA B;  4DXL A;  4FWD A;  1R6L A;  3T1H I;  2X7I A;  4B3R I;  4JI3 I;  1BKN A;  5ELW A;  2O1W A;  3PYE A;  3WU5 A;  4FW9 A;  5BR8 I;  1Z0E A;  4DPW A;  4YHH I;  4OX9 I;  4USK A;  4DR3 I;  3WU4 A;  2V2V A;  4LF7 I;  1HNW I;  4B3M I;  4BA1 B;  4EMD A;  4DUY E;  4DV7 E;  1Z5B A;  2BA1 G;  2NN6 B;  1S4E A;  1KVK A;  2UXB I;  5JEA E;  2WP8 A;  4LF5 I;  4OO1 C;  3J7A M;  1R6M A;  2CG9 A;  1ZM2 A;  5LMU I;  2F1D A;  4DV3 I;  1NHH A;  5IT9 Q;  4DR6 I;  2UXC E;  2HK2 A;  1XXE A;  2F4V E;  1OJ4 A;  2WW4 A;  5DRR A;  1XNR I;  4NBQ A;  4YY3 I;  1UDN A;  2DEI A;  1HNZ E;  1OYR A;  4JI8 E;  4X62 E;  2PNM A;  1Z0T A;  2VF3 A;  2UUC E;  4ED4 A;  4LF8 E;  2V2Z A;  1FKA E;  1Y6Z A;  3P06 A;  4AQY I;  3CDI A;  4DPY A;  1HR0 I;  4X66 E;  2PO2 A;  4X65 E;  4DV2 E;  3Q1Q A;  4OO1 A;  1S16 A;  4DV1 E;  4JI6 I;  1YHC A;  5IWA E;  4DPX A;  3LTO A;  2O1V A;  4LFA I;  3M85 G;  1Y4U A;  1N33 E;  4DUZ I;  2A2D A;  1ZM4 A;  3PYF A;  4DV6 E;  3GME A;  1IBM I;  1Z5C A;  1J5E I;  4B3T I;  4JI7 E;  1I94 E;  1ZM3 A;  4IFD B;  4LCF A;  1QZR A;  3V2U C;  2UU9 E;  2E5L I;  3QT5 A;  5JEA C;  2IES A;  2GO3 A;  4OO1 D;  4DUY I;  2JEB A;  3Q6N A;  3WU3 A;  4GKK E;  4KHP I;  2C39 A;  4JI5 I;  4DR4 I;  2VES A;  4DV4 I;  4J3D A;  2V8P A;  4LOM A;  4IFD E;  4X64 E;  3GCM A;  2PNZ A;  4DU7 A;  2A2C A;  2JE6 B;  2WNR A;  3K1J A;  4JV5 E;  3HUL A;  1KTV A;  5C0X B;  3P3E A;  4IZK B;  3H4L A;  5IT9 C;  1XHK A;  4WUC A;  3GLL A;  2JEA A;  4IZJ A;  3ZZU A;  4LCH A;  2HHH E;  1MX0 A;  1XMO I;  4ISA A;  4JI0 E;  5JEA A;  5DNX A;  4QNK A;  4DR2 E;  1Y60 A;  2ZIT A;  3J7A G;  4K0K I;  3QT6 A;  4MU3 A;  3PS3 A;  4Z7Y A;  2Z5B B;  3PRY A;  4DV2 I;  1Z5A A;  5K36 B;  5C0X E;  1NHJ A;  1RR9 A;  1UEK A;  2BV3 A;  4B3S E;  5L3J A;  2X36 A;  2UXD E;  4HXZ A;  1N34 E;  4OKG A;  4QNJ A;  4LF9 E;  4NXN E;  3KRN A;  5GME A;  1KIJ A;  4NXM E;  2VQE E;  4HAC B;  5DRP A;  4IZJ D;  2OI2 A;  4MU4 A;  4DV0 I;  1NHI A;  5JEA D;  2UUA E;  3M85 D;  5A2Q Q;  4DPT A;  1N0U A;  3V5R A;  3J81 Q;  4JYA I;  3UHM A;  3LNU A;  2PO0 B;  4PRX A;  4LF4 I;  1B62 A;  2GQ0 A;  4IFD C;  3U1Y A;  1Z0B A;  3NZK A;  4P52 A;  4GKJ E;  2NPF A;  4FWG A;  4X64 I;  3ZZT A;  3U1K A;  3DD6 A;  2IER A;  1N32 I;  2V34 A;  4AM3 A;  2O3Z A;  4MU1 A;  2NN6 E;  4ZVI A;  1IBK I;  3T1Y I;  2J7K A;  1FWK A;  3K85 A;  1FJG I;  1IBL E;  5DRO A;  4JI2 I;  5GMD A;  1Y5Y A;  4UT4 A;  3H1C A;  1FI4 A;  4UTG A;  1PKP A;  4JI4 I; 
#chains in the Genus database with same CATH homology
 1HNX I;  4M1K A;  1KKH A;  1VIS A;  1H73 A;  1XMQ I;  4RPF A;  1PVG A;  4DR5 I;  4DR1 I;  4LF6 I;  1XNQ E;  4LFC E;  2UXD I;  3PYG A;  2Z5C B;  3B8H A;  3JAM Q;  4NXM I;  2ZM6 E;  4DV5 E;  4FWH A;  4DV7 I;  4N3O A;  3ZKD A;  1RRE A;  3T1H E;  2VQF E;  1ZXM A;  4B3R E;  4JI3 E;  5A2Q C;  5BR8 E;  2CZ9 A;  5FLX Q;  3J81 C;  4DR3 E;  1HNW E;  4LF7 E;  4URL A;  4B3M E;  1USU A;  2UXC I;  4FN5 A;  2F4V I;  1FWL A;  4MYT A;  4LFB E;  1H72 C;  2GS8 A;  1HNZ I;  2UXB E;  1EI1 A;  3OTO E;  2Z5B A;  4WUD A;  4JI8 I;  4X62 I;  2UUC I;  5LMU E;  4LF8 I;  4HY1 A;  1Z0C A;  1EA6 A;  1H7S A;  4DR6 E;  1K47 A;  1HK7 A;  2EFG A;  4YY3 E;  4X66 I;  1XNR E;  4HAC A;  4X65 I;  4DR7 E;  4DV1 I;  3QT8 A;  5IWA I;  3D4J A;  1ELO A;  1N33 I;  3B78 A;  4AQY E;  4DV6 I;  1HR0 E;  1Z0W A;  2Q2E B;  1A6F A;  2UU9 I;  4DV5 I;  4JI6 E;  4XTJ A;  4IZJ B;  2XEX A;  4LFA E;  3JAM C;  1B63 A;  2IOQ A;  4I3H A;  4GKK I;  4DUZ E;  1N0V C;  2VQF I;  1H74 A;  3F0N A;  1IBM E;  5FWK A;  1J5E E;  1Z0G A;  4DPU A;  4B3T E;  1Y4S A;  3J80 Q;  3M6A A;  2E5L E;  1N36 E;  2CGE A;  2HFU A;  3CWV A;  4KHP E;  4LFB I;  4JV5 I;  5FLX C;  2R3V A;  2HKJ A;  3OTO I;  1Z0V A;  4JI5 E;  4DR4 E;  2UUB E;  4USM A;  3WU6 A;  4DV4 E;  2O1T A;  4HYM A;  2HHH I;  4JI0 I;  3HJC A;  4DR2 I;  4JI1 E;  2Z5C A;  1MU5 A;  1H7U A;  1PKP A;  4PRV A;  2V2Q A;  4DR7 I;  3GON A;  2AJ4 A;  4KQV A;  4B3S I;  2LJP A;  1NZ0 A;  1XMO E;  1N34 I;  4LF9 I;  2BM1 A;  2Z5E A;  4NXN I;  1FNM A;  2VQE I;  4K0K E;  5LMN E;  1ZXN A;  2UUA I;  2ZBK B;  3ZM7 A;  3K17 A;  3PYD A;  4DU8 A;  2IOP A;  4PU9 A;  2R42 A;  4IZK A;  4JG4 A;  4YHH E;  4DV0 E;  4OX9 E;  4GKJ I;  3QT7 A;  1N36 I;  1D6T A;  4WUB A;  4JYA E;  1MG7 A;  4LF4 E;  4LF5 E;  3J80 C;  1IBL I;  2PNL A;  2HK3 A;  2UUB I;  2HFS A;  2O1U A;  4DV3 E;  1I94 I;  4JI7 I;  3Q6M A;  1ZM9 A;  4R1F A;  5LL6 R;  4JI1 I;  1N32 E;  4MYU A;  3B82 A;  2HKE A;  1IBK E;  3T1Y E;  4Z7C A;  1FJG E;  1PIE A;  2BM0 A;  1DAR A;  4JI2 E;  3ZKB A;  1XNQ I;  1WUU A;  4LFC I;  4JI4 E;  1HNX E;  2E1R A;  1U2R A;  1XMQ E;  3LPS A;  2ZM6 I;  5LMN I;  2DEJ A;  4DR5 E;  1Z59 A;  4P7A A;  4DR1 E;  1USV A;  4LF6 E;  3ZZ0 A;  4DXL A;  4FWD A;  3T1H I;  2X7I A;  4B3R I;  4JI3 I;  1BKN A;  2O1W A;  3PYE A;  3WU5 A;  4FW9 A;  5BR8 I;  1Z0E A;  4DPW A;  4YHH I;  4OX9 I;  4USK A;  4DR3 I;  3WU4 A;  2V2V A;  4LF7 I;  1HNW I;  4B3M I;  4EMD A;  4DUY E;  4DV7 E;  1Z5B A;  1S4E A;  1KVK A;  2UXB I;  4LF5 I;  3J7A M;  2CG9 A;  1ZM2 A;  5LMU I;  4DV3 I;  1NHH A;  5IT9 Q;  4DR6 I;  2UXC E;  2HK2 A;  2F4V E;  1OJ4 A;  2WW4 A;  1XNR I;  4YY3 I;  2DEI A;  1HNZ E;  4JI8 E;  4X62 E;  2PNM A;  1Z0T A;  2VF3 A;  2UUC E;  4ED4 A;  4LF8 E;  2V2Z A;  1FKA E;  1Y6Z A;  3P06 A;  4AQY I;  4DPY A;  1HR0 I;  4X66 E;  4X65 E;  4DV2 E;  3Q1Q A;  1S16 A;  4DV1 E;  4JI6 I;  5IWA E;  4DPX A;  3LTO A;  2O1V A;  4LFA I;  1Y4U A;  1N33 E;  4DUZ I;  2A2D A;  1ZM4 A;  3PYF A;  4DV6 E;  1IBM I;  1Z5C A;  1J5E I;  4B3T I;  1I94 E;  1ZM3 A;  3V2U C;  1QZR A;  2UU9 E;  2E5L I;  3QT5 A;  4DUY I;  3Q6N A;  3WU3 A;  4GKK E;  4KHP I;  4JI5 I;  4DR4 I;  4DV4 I;  2V8P A;  4X64 E;  4DU7 A;  2A2C A;  3K1J A;  4JV5 E;  3HUL A;  1KTV A;  4IZK B;  3H4L A;  5IT9 C;  1XHK A;  4WUC A;  4IZJ A;  3ZZU A;  2HHH E;  1MX0 A;  1XMO I;  4JI0 E;  4DR2 E;  2ZIT A;  3J7A G;  4K0K I;  3QT6 A;  4Z7Y A;  2Z5B B;  3PRY A;  4DV2 I;  1Z5A A;  1NHJ A;  1RR9 A;  1UEK A;  2BV3 A;  4B3S E;  5L3J A;  2X36 A;  2UXD E;  4HXZ A;  1N34 E;  4LF9 E;  4NXN E;  5GME A;  1KIJ A;  4NXM E;  2VQE E;  4HAC B;  4IZJ D;  2OI2 A;  4DV0 I;  1NHI A;  2UUA E;  5A2Q Q;  4DPT A;  1N0U A;  3V5R A;  3J81 Q;  4JYA I;  3LNU A;  4PRX A;  4LF4 I;  1B62 A;  2GQ0 A;  1Z0B A;  4P52 A;  4GKJ E;  2NPF A;  4FWG A;  4X64 I;  3ZZT A;  1N32 I;  2V34 A;  4ZVI A;  1IBK I;  3T1Y I;  2J7K A;  1FWK A;  3K85 A;  1FJG I;  1IBL E;  4JI2 I;  5GMD A;  4UT4 A;  1FI4 A;  4UTG A;  4JI7 E;  4JI4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...