4LF6I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf6I00
1N32E 4NXME 4Z7YA 4DPXA 5LMUI 4LF4E 1Z59A 5A2QQ 4DUZI 4DR4E 2V2VA 5BR8I 2R42A 1Z0CA 3HULA 1ZM9A 1DARA 1ZM2A 1IBKI 2HK2A 4DUYI 4DR2I 4LFBE 2UU9I 4DU8A 4KHPE 3WU4A 3B78A 3ZZTA 3J7AG 2HK3A 4DV5E 4JI1E 1XNRE 3WU3A 4LF8E 1ZXMA 1NHJA 3H4LA 5IWAI 4WUBA 1MX0A 2VQEE 3D4JA 3K17A 1XMQI 1XNQI 2UUBE 4FWHA 2UXBI 5LMUE 5GMEA 4DR1E 4HXZA 1N0UA 1Z0WA 1J5EI 5BR8E 3PYFA 3T1HI 3M6AA 4DR5I 3J7AM 3ZKBA 3PYDA 3JAMC 1H74A 3WU5A 1H7SA 4DR2E 2UU9E 2VF3A 3PYEA 3J80C 1HR0E 1PKPA 4LF4I 2HKEA 3CWVA 1UEKA 2UXCI 3Q1QA 4JV5I 1HNZE 4JI4E 1Z5CA 1MG7A 3ZM7A 1XMQE 4WUCA 1KKHA 1XNQE 3QT7A 1NZ0A 4DR7I 2UXBE 2VQFE 4KHPI 3PYGA 2HFUA 4I3HA 4X66E 1VISA 4DV6E 3T1HE 4DR5E 4LFAE 4DR6E 4DV3I 3LPSA 3QT8A 4HACA 4DV0E 1FNMA 1XMOI 2HKJA 4LF7E 1IBMI 2UUAI 1KVKA 4DR1I 4GKKE 3ZZUA 1H72C 2UXCE 4JV5E 3QT6A 5LMNE 1Z5BA 2UUCI 4Z7CA 3LNUA 1BKNA 4DR7E 4DV7I 2X36A 1ZM4A 1HR0I 4LF9E 2J7KA 5IT9C 5FLXC 4B3SI 1HNWI 1HNZI 1ELOA 1FJGI 4JI4I 4DV3E 4DV4E 1XHKA 1XMOE 1WUUA 5L3JA 2VQFI 2A2DA 2V34A 1IBLI 3V2UC 3F0NA 1IBME 1HNXI 2UUAE 4JI2I 4X66I 1FKAE 4DV6I 3LTOA 4DR3I 4LFAI 1N36E 4DR6I 1Z0EA 2UUCE 1B62A 1H7UA 4DV0I 2F4VE 4JI5I 4R1FA 1S4EA 4JI8I 3K1JA 4LF7I 5GMDA 4DV7E 4GKKI 2OI2A 4PRVA 2E5LE 4JG4A 4B3SE 1HNWE 4P52A 4FN5A 5A2QC 1FJGE 5LMNI 4JI6E 2R3VA 1N33I 1B63A 4P7AA 1EI1A 4X62E 5IT9Q 2HHHI 5FLXQ 1IBLE 2E1RA 4LF9I 3QT5A 4DV2E 1HNXE 3ZZ0A 1N34E 4JI2E 2BM0A 4AQYE 4DPUA 1ZXNA 4FWGA 4DR3E 2A2CA 4NXNE 1Z0VA 1Z0BA 2ZM6E 4DV4I 2V2QA 4LF5E 4LF6I 1I94I 4JI5E 4JI8E 4X65E 4URLA 4X64E 1Z0GA 2Q2EB 3OTOI 3JAMQ 1MU5A 1Z0TA 4PRXA 1PVGA 1FWLA 1N36I 4OX9E 4DV1I 2NPFA 3J80Q 1N33E 2V2ZA 2F4VI 4UTGA 2V8PA 2HHHE 2ZITA 3V5RA 4YY3I 2EFGA 4HYMA 2BM1A 4HY1A 5LL6R 4UT4A 2E5LI 4B3RE 2LJPA 4USMA 4JI7I 4PU9A 2AJ4A 4B3TI 4MYUA 4GKJI 1S16A 4JI6I 3WU6A 4YHHI 4X62I 4LF6E 2XEXA 3B8HA 2GS8A 1FWKA 4EMDA 1I94E 4DPTA 4LFCE 2UXDI 4B3MI 1KTVA 4DV2I 1N34I 2ZBKB 1NHHA 4AQYI 4JYAI 4DPYA 4K0KI 3OTOE 3T1YE 4FW9A 4USKA 4NXNI 1FI4A 1ZM3A 2ZM6I 3J81C 4LF5I 4DV1E 2HFSA 1RR9A 4XTJA 4JI0I 1EA6A 4X65I 1Z5AA 4X64I 1D6TA 4ZVIA 4YY3E 1A6FA 4DUZE 1U2RA 1RREA 4MYTA 4FWDA 4JI7E 1QZRA 4WUDA 4B3TE 4OX9I 4GKJE 1IBKE 4M1KA 2X7IA 4KQVA 4JI3I 4DUYE 1N32I 4NXMI 4YHHE 1NHIA 2CZ9A 2WW4A 4DU7A 2UXDE 1KIJA 4B3ME 4RPFA 4DR4I 4JYAE 4B3RI 4K0KE 3GONA 4ED4A 4DPWA 5IWAE 2DEIA 4HACB 1OJ4A 1PIEA 4LFBI 4DXLA 4JI0E 4DV5I 4LFCI 4JI1I 1XNRI 3J81Q 1J5EE 4LF8I 3T1YI 1N0VC 2DEJA 3B82A 1K47A 1H73A 3ZKDA 2VQEI 2BV3A 2UUBI 4JI3E
chains in the Genus database with same CATH superfamily
1N32E 4NXME 2JEBB 1USUA 4Z7YA 2PNZA 4DPXA 3P76A 5LMUI 2WP8A 2O3ZA 4LF4E 1Z59A 5A2QQ 4DUZI 4DR4E 2V2VA 5BR8I 4IZKB 2NN6D 2R42A 5DRPA 4OO1B 1Z0CA 3HULA 1DARA 1ZM9A 1ZM2A 1IBKI 2HK2A 4DUYI 4DR2I 4LFBE 2UU9I 2C37B 4N3OA 4DU8A 4KHPE 5DNLA 3WU4A 3B78A 1R6LA 3ZZTA 3J7AG 1R6MA 2HK3A 4DV5E 4JI1E 1XNRE 3WU3A 2PO2A 2O1VA 4AIDA 3M85G 4LF8E 1ZXMA 1NHJA 1VI7A 3HJCA 3H4LA 5IWAI 2PO0B 4WUBA 1MX0A 2VQEE 5JEAA 3GCMA 3D4JA 3K17A 1XMQI 1XNQI 2O1TA 2UUBE 4FWHA 5K36A 4LOMA 2UXBI 4IFDC 5DRQA 4BA2A 5LMUE 5GMEA 4DR1E 4HXZA 1N0UA 1Z0WA 1J5EI 5BR8E 3PYFA 4IFDF 3T1HI 3M6AA 4DR5I 3J7AM 1OYPA 2IERA 4QNJA 3ZKBA 3PYDA 2C38A 3JAMC 2IOPA 1H74A 2BA1D 4MU3A 3WU5A 1H7SA 4DR2E 2UU9E 2VF3A 3PYEA 3J80C 1HR0E 1PKPA 4LF4I 2HKEA 3CWVA 1UEKA 4BA1B 2UXCI 3Q1QA 4JV5I 1HNZE 4JI4E 1Z5CA 1MG7A 4IZJB 3PS3A 4IS9A 3ZM7A 1XMQE 4WUCA 1KKHA 1XNQE 3P3GA 4FW3A 3QT7A 1NZ0A 4DR7I 2UXBE 2VQFE 4KHPI 3PYGA 2HFUA 4I3HA 4X66E 1VISA 4DV6E 2NN6C 2J65A 2WNRA 4QNKA 4DR5E 3T1HE 4GQUA 4LFAE 2BA0D 4DV3I 4DR6E 3LPSA 3QT8A 2NN6F 4HACA 4MU4A 3M7NG 4DV0E 2IOQA 5EL9A 1FNMA 1XMOI 2HKJA 3L7ZA 4LF7E 4U3BA 1IBMI 3DD6A 2UUAI 2CVEA 1KVKA 4DR1I 4IFDA 4GKKE 3ZZUA 2O1WA 1H72C 2UXCE 5JEAD 4JV5E 3QT6A 2CGEA 5LMNE 1Z5BA 2UUCI 4Z7CA 5K36D 3LNUA 5C0XD 3CDIA 1BKNA 2JEBA 2PO1B 4AIMA 4DR7E 2NN6E 4DV7I 2X36A 1ZM4A 1HR0I 4LF9E 2J7KA 2F1DA 5IT9C 4IZKA 4MDTA 4OO1A 5FLXC 4B3SI 1HNWI 1HNZI 1ELOA 3PS1A 1FJGI 4JI4I 4DV3E 1UDQA 2NN6B 4DV4E 1XHKA 3P3CA 5DROA 2C37A 1YH8A 1XMOE 5EKWA 1WUUA 5L3JA 2VQFI 2A2DA 5C0XA 2V34A 1IBLI 4FW5A 3V2UC 3F0NA 3K85A 1IBME 1HNXI 2UUAE 4JI2I 4X66I 1FKAE 4DV6I 3LTOA 4FW6A 4DR3I 2Z5BA 2PO0A 4LFAI 1N36E 4DR6I 1Z0EA 2UUCE 1B62A 2JT2A 2C38B 1H7UA 1P42A 4DV0I 2F4VE 4JI5I 4R1FA 1S4EA 4JI8I 3K1JA 4LF7I 5GMDA 4J3DA 4DV7E 2CG9A 4GKKI 2Z5CB 2GQ0A 1OYSA 2OI2A 4PRVA 2E5LE 4JG4A 1Y4UA 4B3SE 1HNWE 4P52A 4FN5A 5A2QC 5DRRA 5LMNI 1FJGE 4JI6E 2R3VA 1N33I 1B63A 4P7AA 1EI1A 4X62E 5IT9Q 5FWKA 2HHHI 5FLXQ 2VESA 4U3DA 2PNLA 1IBLE 2E1RA 4IFDD 4LF9I 3QT5A 2C39B 1HK7A 4DV2E 1HNXE 3ZZ0A 1N34E 4OZEA 4JI2E 4LCGA 2BM0A 4BA1A 4DPUA 1ZXNA 4AQYE 4FWGA 1Y4SA 4LCHA 2A2CA 4DR3E 4NXNE 3M85D 1Z0VA 2JE6B 5K36C 1Z0BA 3HKMA 2ZM6E 4DV4I 2V2QA 4LF5E 2PNMA 4LF6I 1XXEA 2JEAB 1I94I 4JI5E 2BR2B 5K36F 4JI8E 4X65E 2PNZB 4URLA 4X64E 1Z0GA 4OO1D 2WP8B 2Q2EB 3OTOI 3JAMQ 1MU5A 1E3PA 1Z0TA 4PRXA 1PVGA 1FWLA 1OYRA 2O1UA 1N36I 4OX9E 2BA1G 4DV1I 3P3EA 2NPFA 3J80Q 1N33E 2V2ZA 4FW7A 2F4VI 2GO4A 4UTGA 1USVA 3NZKA 2V8PA 2HHHE 3B4TA 5JEAE 3KRNA 2ZITA 3V5RA 4YY3I 2AE8A 1YHCA 5K36E 2EFGA 4HYMA 5C0XE 2BM1A 4HY1A 3Q6NA 2PO2B 4LPFA 5LL6R 4UT4A 2E5LI 2LJPA 4B3RE 4USMA 4JI7I 4PU9A 2AJ4A 4B3TI 4MYUA 4GKJI 3GLLA 1S16A 4JI6I 1Y5YA 3WU6A 5JEAB 2PO1A 4YHHI 4X62I 4LF6E 2XEXA 3B8HA 2GS8A 1FWKA 4EMDA 1UDSA 5K36B 1I94E 3PRYA 5C0XB 2Z5EA 4MQYA 3P06A 4DPTA 4LFCE 2UXDI 4B3MI 1KTVA 4DV2I 1N34I 4BA2B 2ZBKB 1NHHA 4AQYI 1Y6ZA 4JYAI 4DPYA 4AM3A 3U1YA 4K0KI 3OTOE 2BA0G 3T1YE 2Z5BB 4FW9A 4USKA 4NXNI 1FI4A 2NN6A 3UHMA 1ZM3A 2IESA 2ZM6I 3J81C 4LF5I 4DV1E 2HFSA 1Y60A 1RR9A 3M7ND 4XTJA 4JI0I 5DNXA 1EA6A 4X65I 1Z5AA 4MU1A 4X64I 3H1CA 1D6TA 4ZVIA 4YY3E 1A6FA 4DUZE 1U2RA 4IZJD 1RREA 4MYTA 3U1KA 4FWDA 4JI7E 4FW4A 1QZRA 4WUDA 4B3TE 4OX9I 4GKJE 1IBKE 4M1KA 1RHYA 2X7IA 4KQVA 4JI3I 4DUYE 1N32I 4NXMI 4LCFA 4YHHE 1NHIA 1UDNA 2CZ9A 2WW4A 4DU7A 3CDJA 4OO1C 2UXDE 1KIJA 4B3ME 4RPFA 2Z5CA 4DR4I 1UDOA 4JYAE 4B3RI 4K0KE 3GONA 5JEAC 2WNRB 4ED4A 4DPWA 4OO1F 5IWAE 2DEIA 4IZJA 4IFDE 5C0XC 4HACB 1OJ4A 1PIEA 5JEAF 4OKGA 4LFBI 4DXLA 4JI0E 3L7ZB 3PS2A 5C0XF 4MU0A 4DV5I 4LFCI 2C39A 4JI1I 3GMEA 1XNRI 2GO3A 1E3HA 3J81Q 1J5EE 4LF8I 4IFDB 3T1YI 2JE6A 1N0VC 4ISAA 2DEJA 3B82A 1H73A 1K47A 3ZKDA 5ELWA 3Q6MA 2VQEI 2BV3A 2JEAA 2UUBI 4OO1E 4JI3E 4NBQA 2BR2A
chains in the Genus database with same CATH topology
1N32E 4NXME 1USUA 4Z7YA 4DPXA 5LMUI 4LF4E 1Z59A 5A2QQ 4DUZI 4DR4E 2V2VA 5BR8I 4IZKB 2R42A 1Z0CA 3HULA 1ZM9A 1DARA 1ZM2A 1IBKI 2HK2A 4DUYI 4DR2I 4LFBE 2UU9I 4N3OA 4DU8A 4KHPE 3WU4A 3B78A 3ZZTA 3J7AG 2HK3A 4DV5E 4JI1E 1XNRE 3WU3A 2O1VA 4LF8E 1ZXMA 1NHJA 3HJCA 3H4LA 5IWAI 4WUBA 1MX0A 2VQEE 3D4JA 3K17A 1XMQI 1XNQI 2O1TA 2UUBE 4FWHA 2UXBI 5LMUE 5GMEA 4DR1E 4HXZA 1N0UA 1Z0WA 1J5EI 5BR8E 3PYFA 3T1HI 3M6AA 4DR5I 3J7AM 3ZKBA 3PYDA 3JAMC 2IOPA 1H74A 3WU5A 1H7SA 4DR2E 2UU9E 2VF3A 3PYEA 3J80C 1HR0E 1PKPA 4LF4I 2HKEA 3CWVA 1UEKA 2UXCI 3Q1QA 4JV5I 1HNZE 4JI4E 1Z5CA 1MG7A 4IZJB 3ZM7A 1XMQE 4WUCA 1KKHA 1XNQE 3QT7A 1NZ0A 4DR7I 2UXBE 2VQFE 4KHPI 3PYGA 2HFUA 4I3HA 4X66E 1VISA 4DV6E 3T1HE 4DR5E 4LFAE 4DR6E 4DV3I 3LPSA 3QT8A 4HACA 4DV0E 2IOQA 1FNMA 1XMOI 2HKJA 4LF7E 1IBMI 2UUAI 1KVKA 4DR1I 4GKKE 3ZZUA 2O1WA 1H72C 2UXCE 4JV5E 3QT6A 2CGEA 5LMNE 1Z5BA 2UUCI 4Z7CA 3LNUA 1BKNA 4DR7E 4DV7I 2X36A 1ZM4A 1HR0I 4LF9E 2J7KA 5IT9C 4IZKA 5FLXC 4B3SI 1HNWI 1HNZI 1ELOA 1FJGI 4JI4I 4DV3E 4DV4E 1XHKA 1XMOE 1WUUA 5L3JA 2VQFI 2A2DA 2V34A 1IBLI 3V2UC 3F0NA 3K85A 1IBME 1HNXI 2UUAE 4JI2I 4X66I 1FKAE 4DV6I 3LTOA 4DR3I 2Z5BA 4LFAI 1N36E 4DR6I 1Z0EA 2UUCE 1B62A 1H7UA 4DV0I 2F4VE 4JI5I 4R1FA 1S4EA 4JI8I 3K1JA 4LF7I 5GMDA 4DV7E 2CG9A 4GKKI 2Z5CB 2GQ0A 2OI2A 4PRVA 2E5LE 4JG4A 1Y4UA 4B3SE 1HNWE 4P52A 4FN5A 5A2QC 1FJGE 5LMNI 4JI6E 2R3VA 1N33I 1B63A 4P7AA 1EI1A 4X62E 5IT9Q 5FWKA 2HHHI 5FLXQ 2PNLA 1IBLE 2E1RA 4LF9I 3QT5A 4DV2E 1HK7A 1HNXE 3ZZ0A 1N34E 4JI2E 2BM0A 4AQYE 4DPUA 1ZXNA 4FWGA 1Y4SA 4DR3E 2A2CA 4NXNE 1Z0VA 1Z0BA 2ZM6E 4DV4I 2V2QA 4LF5E 2PNMA 4LF6I 1I94I 4JI5E 4JI8E 4X65E 4URLA 4X64E 1Z0GA 2Q2EB 3OTOI 3JAMQ 1MU5A 1Z0TA 4PRXA 1PVGA 1FWLA 2O1UA 1N36I 4OX9E 4DV1I 2NPFA 3J80Q 1N33E 2V2ZA 2F4VI 4UTGA 1USVA 2V8PA 2HHHE 2ZITA 3V5RA 4YY3I 2EFGA 4HYMA 2BM1A 4HY1A 3Q6NA 5LL6R 4UT4A 2E5LI 4B3RE 2LJPA 4USMA 4JI7I 4PU9A 2AJ4A 4B3TI 4MYUA 4GKJI 1S16A 4JI6I 3WU6A 4YHHI 4X62I 4LF6E 2XEXA 3B8HA 2GS8A 1FWKA 4EMDA 1I94E 3PRYA 2Z5EA 3P06A 4DPTA 4LFCE 2UXDI 4B3MI 1KTVA 4DV2I 1N34I 2ZBKB 1NHHA 4AQYI 1Y6ZA 4JYAI 4DPYA 4K0KI 3OTOE 3T1YE 2Z5BB 4FW9A 4USKA 4NXNI 1FI4A 1ZM3A 2ZM6I 3J81C 4LF5I 4DV1E 2HFSA 1RR9A 4XTJA 4JI0I 1EA6A 4X65I 1Z5AA 4X64I 1D6TA 4ZVIA 4YY3E 1A6FA 4DUZE 1U2RA 4IZJD 1RREA 4MYTA 4FWDA 4JI7E 1QZRA 4WUDA 4B3TE 4OX9I 4GKJE 1IBKE 4M1KA 2X7IA 4KQVA 4JI3I 4DUYE 1N32I 4NXMI 4YHHE 1NHIA 2CZ9A 2WW4A 4DU7A 2UXDE 1KIJA 4B3ME 4RPFA 2Z5CA 4DR4I 4JYAE 4B3RI 4K0KE 3GONA 4ED4A 4DPWA 5IWAE 2DEIA 4IZJA 4HACB 1OJ4A 1PIEA 4LFBI 4DXLA 4JI0E 4DV5I 4LFCI 4JI1I 1XNRI 3J81Q 1J5EE 4LF8I 3T1YI 1N0VC 2DEJA 3B82A 1K47A 1H73A 3ZKDA 3Q6MA 2VQEI 2BV3A 2UUBI 4JI3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 E;  4NXM E;  4Z7Y A;  4DPX A;  5LMU I;  4LF4 E;  1Z59 A;  5A2Q Q;  4DUZ I;  4DR4 E;  2V2V A;  5BR8 I;  2R42 A;  1Z0C A;  3HUL A;  1ZM9 A;  1DAR A;  1ZM2 A;  1IBK I;  2HK2 A;  4DUY I;  4DR2 I;  4LFB E;  2UU9 I;  4DU8 A;  4KHP E;  3WU4 A;  3B78 A;  3ZZT A;  3J7A G;  2HK3 A;  4DV5 E;  4JI1 E;  1XNR E;  3WU3 A;  4LF8 E;  1ZXM A;  1NHJ A;  3H4L A;  5IWA I;  4WUB A;  1MX0 A;  2VQE E;  3D4J A;  3K17 A;  1XMQ I;  1XNQ I;  2UUB E;  4FWH A;  2UXB I;  5LMU E;  5GME A;  4DR1 E;  4HXZ A;  1N0U A;  1Z0W A;  1J5E I;  5BR8 E;  3PYF A;  3T1H I;  3M6A A;  4DR5 I;  3J7A M;  3ZKB A;  3PYD A;  3JAM C;  1H74 A;  3WU5 A;  1H7S A;  4DR2 E;  2UU9 E;  2VF3 A;  3PYE A;  3J80 C;  1HR0 E;  1PKP A;  4LF4 I;  2HKE A;  3CWV A;  1UEK A;  2UXC I;  3Q1Q A;  4JV5 I;  1HNZ E;  4JI4 E;  1Z5C A;  1MG7 A;  3ZM7 A;  1XMQ E;  4WUC A;  1KKH A;  1XNQ E;  3QT7 A;  1NZ0 A;  4DR7 I;  2UXB E;  2VQF E;  4KHP I;  3PYG A;  2HFU A;  4I3H A;  4X66 E;  1VIS A;  4DV6 E;  3T1H E;  4DR5 E;  4LFA E;  4DR6 E;  4DV3 I;  3LPS A;  3QT8 A;  4HAC A;  4DV0 E;  1FNM A;  1XMO I;  2HKJ A;  4LF7 E;  1IBM I;  2UUA I;  1KVK A;  4DR1 I;  4GKK E;  3ZZU A;  1H72 C;  2UXC E;  4JV5 E;  3QT6 A;  5LMN E;  1Z5B A;  2UUC I;  4Z7C A;  3LNU A;  1BKN A;  4DR7 E;  4DV7 I;  2X36 A;  1ZM4 A;  1HR0 I;  4LF9 E;  2J7K A;  5IT9 C;  5FLX C;  4B3S I;  1HNW I;  1HNZ I;  1ELO A;  1FJG I;  4JI4 I;  4DV3 E;  4DV4 E;  1XHK A;  1XMO E;  1WUU A;  5L3J A;  2VQF I;  2A2D A;  2V34 A;  1IBL I;  3V2U C;  3F0N A;  1IBM E;  1HNX I;  2UUA E;  4JI2 I;  4X66 I;  1FKA E;  4DV6 I;  3LTO A;  4DR3 I;  4LFA I;  1N36 E;  4DR6 I;  1Z0E A;  2UUC E;  1B62 A;  1H7U A;  4DV0 I;  2F4V E;  4JI5 I;  4R1F A;  1S4E A;  4JI8 I;  3K1J A;  4LF7 I;  5GMD A;  4DV7 E;  4GKK I;  2OI2 A;  4PRV A;  2E5L E;  4JG4 A;  4B3S E;  1HNW E;  4P52 A;  4FN5 A;  5A2Q C;  1FJG E;  5LMN I;  4JI6 E;  2R3V A;  1N33 I;  1B63 A;  4P7A A;  1EI1 A;  4X62 E;  5IT9 Q;  2HHH I;  5FLX Q;  1IBL E;  2E1R A;  4LF9 I;  3QT5 A;  4DV2 E;  1HNX E;  3ZZ0 A;  1N34 E;  4JI2 E;  2BM0 A;  4AQY E;  4DPU A;  1ZXN A;  4FWG A;  4DR3 E;  2A2C A;  4NXN E;  1Z0V A;  1Z0B A;  2ZM6 E;  4DV4 I;  2V2Q A;  4LF5 E;  4LF6 I;  1I94 I;  4JI5 E;  4JI8 E;  4X65 E;  4URL A;  4X64 E;  1Z0G A;  2Q2E B;  3OTO I;  3JAM Q;  1MU5 A;  1Z0T A;  4PRX A;  1PVG A;  1FWL A;  1N36 I;  4OX9 E;  4DV1 I;  2NPF A;  3J80 Q;  1N33 E;  2V2Z A;  2F4V I;  4UTG A;  2V8P A;  2HHH E;  2ZIT A;  3V5R A;  4YY3 I;  2EFG A;  4HYM A;  2BM1 A;  4HY1 A;  5LL6 R;  4UT4 A;  2E5L I;  4B3R E;  2LJP A;  4USM A;  4JI7 I;  4PU9 A;  2AJ4 A;  4B3T I;  4MYU A;  4GKJ I;  1S16 A;  4JI6 I;  3WU6 A;  4YHH I;  4X62 I;  4LF6 E;  2XEX A;  3B8H A;  2GS8 A;  1FWK A;  4EMD A;  1I94 E;  4DPT A;  4LFC E;  2UXD I;  4B3M I;  1KTV A;  4DV2 I;  1N34 I;  2ZBK B;  1NHH A;  4AQY I;  4JYA I;  4DPY A;  4K0K I;  3OTO E;  3T1Y E;  4FW9 A;  4USK A;  4NXN I;  1FI4 A;  1ZM3 A;  2ZM6 I;  3J81 C;  4LF5 I;  4DV1 E;  2HFS A;  1RR9 A;  4XTJ A;  4JI0 I;  1EA6 A;  4X65 I;  1Z5A A;  4X64 I;  1D6T A;  4ZVI A;  4YY3 E;  1A6F A;  4DUZ E;  1U2R A;  1RRE A;  4MYT A;  4FWD A;  4JI7 E;  1QZR A;  4WUD A;  4B3T E;  4OX9 I;  4GKJ E;  1IBK E;  4M1K A;  2X7I A;  4KQV A;  4JI3 I;  4DUY E;  1N32 I;  4NXM I;  4YHH E;  1NHI A;  2CZ9 A;  2WW4 A;  4DU7 A;  2UXD E;  1KIJ A;  4B3M E;  4RPF A;  4DR4 I;  4JYA E;  4B3R I;  4K0K E;  3GON A;  4ED4 A;  4DPW A;  5IWA E;  2DEI A;  4HAC B;  1OJ4 A;  1PIE A;  4LFB I;  4DXL A;  4JI0 E;  4DV5 I;  4LFC I;  4JI1 I;  1XNR I;  3J81 Q;  1J5E E;  4LF8 I;  3T1Y I;  1N0V C;  2DEJ A;  3B82 A;  1K47 A;  1H73 A;  3ZKD A;  2VQE I;  2BV3 A;  2UUB I;  4JI3 E; 
#chains in the Genus database with same CATH topology
 1N32 E;  4NXM E;  2JEB B;  1USU A;  4Z7Y A;  2PNZ A;  4DPX A;  3P76 A;  5LMU I;  2WP8 A;  2O3Z A;  4LF4 E;  1Z59 A;  5A2Q Q;  4DUZ I;  4DR4 E;  2V2V A;  5BR8 I;  4IZK B;  2NN6 D;  2R42 A;  5DRP A;  4OO1 B;  1Z0C A;  3HUL A;  1DAR A;  1ZM9 A;  1ZM2 A;  1IBK I;  2HK2 A;  4DUY I;  4DR2 I;  4LFB E;  2UU9 I;  2C37 B;  4N3O A;  4DU8 A;  4KHP E;  5DNL A;  3WU4 A;  3B78 A;  1R6L A;  3ZZT A;  3J7A G;  1R6M A;  2HK3 A;  4DV5 E;  4JI1 E;  1XNR E;  3WU3 A;  2PO2 A;  2O1V A;  4AID A;  3M85 G;  4LF8 E;  1ZXM A;  1NHJ A;  1VI7 A;  3HJC A;  3H4L A;  5IWA I;  2PO0 B;  4WUB A;  1MX0 A;  2VQE E;  5JEA A;  3GCM A;  3D4J A;  3K17 A;  1XMQ I;  1XNQ I;  2O1T A;  2UUB E;  4FWH A;  5K36 A;  4LOM A;  2UXB I;  4IFD C;  5DRQ A;  4BA2 A;  5LMU E;  5GME A;  4DR1 E;  4HXZ A;  1N0U A;  1Z0W A;  1J5E I;  5BR8 E;  3PYF A;  4IFD F;  3T1H I;  3M6A A;  4DR5 I;  3J7A M;  1OYP A;  2IER A;  4QNJ A;  3ZKB A;  3PYD A;  2C38 A;  3JAM C;  2IOP A;  1H74 A;  2BA1 D;  4MU3 A;  3WU5 A;  1H7S A;  4DR2 E;  2UU9 E;  2VF3 A;  3PYE A;  3J80 C;  1HR0 E;  1PKP A;  4LF4 I;  2HKE A;  3CWV A;  1UEK A;  4BA1 B;  2UXC I;  3Q1Q A;  4JV5 I;  1HNZ E;  4JI4 E;  1Z5C A;  1MG7 A;  4IZJ B;  3PS3 A;  4IS9 A;  3ZM7 A;  1XMQ E;  4WUC A;  1KKH A;  1XNQ E;  3P3G A;  4FW3 A;  3QT7 A;  1NZ0 A;  4DR7 I;  2UXB E;  2VQF E;  4KHP I;  3PYG A;  2HFU A;  4I3H A;  4X66 E;  1VIS A;  4DV6 E;  2NN6 C;  2J65 A;  2WNR A;  4QNK A;  4DR5 E;  3T1H E;  4GQU A;  4LFA E;  2BA0 D;  4DV3 I;  4DR6 E;  3LPS A;  3QT8 A;  2NN6 F;  4HAC A;  4MU4 A;  3M7N G;  4DV0 E;  2IOQ A;  5EL9 A;  1FNM A;  1XMO I;  2HKJ A;  3L7Z A;  4LF7 E;  4U3B A;  1IBM I;  3DD6 A;  2UUA I;  2CVE A;  1KVK A;  4DR1 I;  4IFD A;  4GKK E;  3ZZU A;  2O1W A;  1H72 C;  2UXC E;  5JEA D;  4JV5 E;  3QT6 A;  2CGE A;  5LMN E;  1Z5B A;  2UUC I;  4Z7C A;  5K36 D;  3LNU A;  5C0X D;  3CDI A;  1BKN A;  2JEB A;  2PO1 B;  4AIM A;  4DR7 E;  2NN6 E;  4DV7 I;  2X36 A;  1ZM4 A;  1HR0 I;  4LF9 E;  2J7K A;  2F1D A;  5IT9 C;  4IZK A;  4MDT A;  4OO1 A;  5FLX C;  4B3S I;  1HNW I;  1HNZ I;  1ELO A;  3PS1 A;  1FJG I;  4JI4 I;  4DV3 E;  1UDQ A;  2NN6 B;  4DV4 E;  1XHK A;  3P3C A;  5DRO A;  2C37 A;  1YH8 A;  1XMO E;  5EKW A;  1WUU A;  5L3J A;  2VQF I;  2A2D A;  5C0X A;  2V34 A;  1IBL I;  4FW5 A;  3V2U C;  3F0N A;  3K85 A;  1IBM E;  1HNX I;  2UUA E;  4JI2 I;  4X66 I;  1FKA E;  4DV6 I;  3LTO A;  4FW6 A;  4DR3 I;  2Z5B A;  2PO0 A;  4LFA I;  1N36 E;  4DR6 I;  1Z0E A;  2UUC E;  1B62 A;  2JT2 A;  2C38 B;  1H7U A;  1P42 A;  4DV0 I;  2F4V E;  4JI5 I;  4R1F A;  1S4E A;  4JI8 I;  3K1J A;  4LF7 I;  5GMD A;  4J3D A;  4DV7 E;  2CG9 A;  4GKK I;  2Z5C B;  2GQ0 A;  1OYS A;  2OI2 A;  4PRV A;  2E5L E;  4JG4 A;  1Y4U A;  4B3S E;  1HNW E;  4P52 A;  4FN5 A;  5A2Q C;  5DRR A;  5LMN I;  1FJG E;  4JI6 E;  2R3V A;  1N33 I;  1B63 A;  4P7A A;  1EI1 A;  4X62 E;  5IT9 Q;  5FWK A;  2HHH I;  5FLX Q;  2VES A;  4U3D A;  2PNL A;  1IBL E;  2E1R A;  4IFD D;  4LF9 I;  3QT5 A;  2C39 B;  1HK7 A;  4DV2 E;  1HNX E;  3ZZ0 A;  1N34 E;  4OZE A;  4JI2 E;  4LCG A;  2BM0 A;  4BA1 A;  4DPU A;  1ZXN A;  4AQY E;  4FWG A;  1Y4S A;  4LCH A;  2A2C A;  4DR3 E;  4NXN E;  3M85 D;  1Z0V A;  2JE6 B;  5K36 C;  1Z0B A;  3HKM A;  2ZM6 E;  4DV4 I;  2V2Q A;  4LF5 E;  2PNM A;  4LF6 I;  1XXE A;  2JEA B;  1I94 I;  4JI5 E;  2BR2 B;  5K36 F;  4JI8 E;  4X65 E;  2PNZ B;  4URL A;  4X64 E;  1Z0G A;  4OO1 D;  2WP8 B;  2Q2E B;  3OTO I;  3JAM Q;  1MU5 A;  1E3P A;  1Z0T A;  4PRX A;  1PVG A;  1FWL A;  1OYR A;  2O1U A;  1N36 I;  4OX9 E;  2BA1 G;  4DV1 I;  3P3E A;  2NPF A;  3J80 Q;  1N33 E;  2V2Z A;  4FW7 A;  2F4V I;  2GO4 A;  4UTG A;  1USV A;  3NZK A;  2V8P A;  2HHH E;  3B4T A;  5JEA E;  3KRN A;  2ZIT A;  3V5R A;  4YY3 I;  2AE8 A;  1YHC A;  5K36 E;  2EFG A;  4HYM A;  5C0X E;  2BM1 A;  4HY1 A;  3Q6N A;  2PO2 B;  4LPF A;  5LL6 R;  4UT4 A;  2E5L I;  2LJP A;  4B3R E;  4USM A;  4JI7 I;  4PU9 A;  2AJ4 A;  4B3T I;  4MYU A;  4GKJ I;  3GLL A;  1S16 A;  4JI6 I;  1Y5Y A;  3WU6 A;  5JEA B;  2PO1 A;  4YHH I;  4X62 I;  4LF6 E;  2XEX A;  3B8H A;  2GS8 A;  1FWK A;  4EMD A;  1UDS A;  5K36 B;  1I94 E;  3PRY A;  5C0X B;  2Z5E A;  4MQY A;  3P06 A;  4DPT A;  4LFC E;  2UXD I;  4B3M I;  1KTV A;  4DV2 I;  1N34 I;  4BA2 B;  2ZBK B;  1NHH A;  4AQY I;  1Y6Z A;  4JYA I;  4DPY A;  4AM3 A;  3U1Y A;  4K0K I;  3OTO E;  2BA0 G;  3T1Y E;  2Z5B B;  4FW9 A;  4USK A;  4NXN I;  1FI4 A;  2NN6 A;  3UHM A;  1ZM3 A;  2IES A;  2ZM6 I;  3J81 C;  4LF5 I;  4DV1 E;  2HFS A;  1Y60 A;  1RR9 A;  3M7N D;  4XTJ A;  4JI0 I;  5DNX A;  1EA6 A;  4X65 I;  1Z5A A;  4MU1 A;  4X64 I;  3H1C A;  1D6T A;  4ZVI A;  4YY3 E;  1A6F A;  4DUZ E;  1U2R A;  4IZJ D;  1RRE A;  4MYT A;  3U1K A;  4FWD A;  4JI7 E;  4FW4 A;  1QZR A;  4WUD A;  4B3T E;  4OX9 I;  4GKJ E;  1IBK E;  4M1K A;  1RHY A;  2X7I A;  4KQV A;  4JI3 I;  4DUY E;  1N32 I;  4NXM I;  4LCF A;  4YHH E;  1NHI A;  1UDN A;  2CZ9 A;  2WW4 A;  4DU7 A;  3CDJ A;  4OO1 C;  2UXD E;  1KIJ A;  4B3M E;  4RPF A;  2Z5C A;  4DR4 I;  1UDO A;  4JYA E;  4B3R I;  4K0K E;  3GON A;  5JEA C;  2WNR B;  4ED4 A;  4DPW A;  4OO1 F;  5IWA E;  2DEI A;  4IZJ A;  4IFD E;  5C0X C;  4HAC B;  1OJ4 A;  1PIE A;  5JEA F;  4OKG A;  4LFB I;  4DXL A;  4JI0 E;  3L7Z B;  3PS2 A;  5C0X F;  4MU0 A;  4DV5 I;  4LFC I;  2C39 A;  4JI1 I;  3GME A;  1XNR I;  2GO3 A;  1E3H A;  3J81 Q;  1J5E E;  4LF8 I;  4IFD B;  3T1Y I;  2JE6 A;  1N0V C;  4ISA A;  2DEJ A;  3B82 A;  1H73 A;  1K47 A;  3ZKD A;  5ELW A;  3Q6M A;  2VQE I;  2BV3 A;  2JEA A;  2UUB I;  4OO1 E;  4JI3 E;  4NBQ A;  2BR2 A; 
#chains in the Genus database with same CATH homology
 1N32 E;  4NXM E;  1USU A;  4Z7Y A;  4DPX A;  5LMU I;  4LF4 E;  1Z59 A;  5A2Q Q;  4DUZ I;  4DR4 E;  2V2V A;  5BR8 I;  4IZK B;  2R42 A;  1Z0C A;  3HUL A;  1ZM9 A;  1DAR A;  1ZM2 A;  1IBK I;  2HK2 A;  4DUY I;  4DR2 I;  4LFB E;  2UU9 I;  4N3O A;  4DU8 A;  4KHP E;  3WU4 A;  3B78 A;  3ZZT A;  3J7A G;  2HK3 A;  4DV5 E;  4JI1 E;  1XNR E;  3WU3 A;  2O1V A;  4LF8 E;  1ZXM A;  1NHJ A;  3HJC A;  3H4L A;  5IWA I;  4WUB A;  1MX0 A;  2VQE E;  3D4J A;  3K17 A;  1XMQ I;  1XNQ I;  2O1T A;  2UUB E;  4FWH A;  2UXB I;  5LMU E;  5GME A;  4DR1 E;  4HXZ A;  1N0U A;  1Z0W A;  1J5E I;  5BR8 E;  3PYF A;  3T1H I;  3M6A A;  4DR5 I;  3J7A M;  3ZKB A;  3PYD A;  3JAM C;  2IOP A;  1H74 A;  3WU5 A;  1H7S A;  4DR2 E;  2UU9 E;  2VF3 A;  3PYE A;  3J80 C;  1HR0 E;  1PKP A;  4LF4 I;  2HKE A;  3CWV A;  1UEK A;  2UXC I;  3Q1Q A;  4JV5 I;  1HNZ E;  4JI4 E;  1Z5C A;  1MG7 A;  4IZJ B;  3ZM7 A;  1XMQ E;  4WUC A;  1KKH A;  1XNQ E;  3QT7 A;  1NZ0 A;  4DR7 I;  2UXB E;  2VQF E;  4KHP I;  3PYG A;  2HFU A;  4I3H A;  4X66 E;  1VIS A;  4DV6 E;  3T1H E;  4DR5 E;  4LFA E;  4DR6 E;  4DV3 I;  3LPS A;  3QT8 A;  4HAC A;  4DV0 E;  2IOQ A;  1FNM A;  1XMO I;  2HKJ A;  4LF7 E;  1IBM I;  2UUA I;  1KVK A;  4DR1 I;  4GKK E;  3ZZU A;  2O1W A;  1H72 C;  2UXC E;  4JV5 E;  3QT6 A;  2CGE A;  5LMN E;  1Z5B A;  2UUC I;  4Z7C A;  3LNU A;  1BKN A;  4DR7 E;  4DV7 I;  2X36 A;  1ZM4 A;  1HR0 I;  4LF9 E;  2J7K A;  5IT9 C;  4IZK A;  5FLX C;  4B3S I;  1HNW I;  1HNZ I;  1ELO A;  1FJG I;  4JI4 I;  4DV3 E;  4DV4 E;  1XHK A;  1XMO E;  1WUU A;  5L3J A;  2VQF I;  2A2D A;  2V34 A;  1IBL I;  3V2U C;  3F0N A;  3K85 A;  1IBM E;  1HNX I;  2UUA E;  4JI2 I;  4X66 I;  1FKA E;  4DV6 I;  3LTO A;  4DR3 I;  2Z5B A;  4LFA I;  1N36 E;  4DR6 I;  1Z0E A;  2UUC E;  1B62 A;  1H7U A;  4DV0 I;  2F4V E;  4JI5 I;  4R1F A;  1S4E A;  4JI8 I;  3K1J A;  4LF7 I;  5GMD A;  4DV7 E;  2CG9 A;  4GKK I;  2Z5C B;  2GQ0 A;  2OI2 A;  4PRV A;  2E5L E;  4JG4 A;  1Y4U A;  4B3S E;  1HNW E;  4P52 A;  4FN5 A;  5A2Q C;  1FJG E;  5LMN I;  4JI6 E;  2R3V A;  1N33 I;  1B63 A;  4P7A A;  1EI1 A;  4X62 E;  5IT9 Q;  5FWK A;  2HHH I;  5FLX Q;  2PNL A;  1IBL E;  2E1R A;  4LF9 I;  3QT5 A;  4DV2 E;  1HK7 A;  1HNX E;  3ZZ0 A;  1N34 E;  4JI2 E;  2BM0 A;  4AQY E;  4DPU A;  1ZXN A;  4FWG A;  1Y4S A;  4DR3 E;  2A2C A;  4NXN E;  1Z0V A;  1Z0B A;  2ZM6 E;  4DV4 I;  2V2Q A;  4LF5 E;  2PNM A;  4LF6 I;  1I94 I;  4JI5 E;  4JI8 E;  4X65 E;  4URL A;  4X64 E;  1Z0G A;  2Q2E B;  3OTO I;  3JAM Q;  1MU5 A;  1Z0T A;  4PRX A;  1PVG A;  1FWL A;  2O1U A;  1N36 I;  4OX9 E;  4DV1 I;  2NPF A;  3J80 Q;  1N33 E;  2V2Z A;  2F4V I;  4UTG A;  1USV A;  2V8P A;  2HHH E;  2ZIT A;  3V5R A;  4YY3 I;  2EFG A;  4HYM A;  2BM1 A;  4HY1 A;  3Q6N A;  5LL6 R;  4UT4 A;  2E5L I;  4B3R E;  2LJP A;  4USM A;  4JI7 I;  4PU9 A;  2AJ4 A;  4B3T I;  4MYU A;  4GKJ I;  1S16 A;  4JI6 I;  3WU6 A;  4YHH I;  4X62 I;  4LF6 E;  2XEX A;  3B8H A;  2GS8 A;  1FWK A;  4EMD A;  1I94 E;  3PRY A;  2Z5E A;  3P06 A;  4DPT A;  4LFC E;  2UXD I;  4B3M I;  1KTV A;  4DV2 I;  1N34 I;  2ZBK B;  1NHH A;  4AQY I;  1Y6Z A;  4JYA I;  4DPY A;  4K0K I;  3OTO E;  3T1Y E;  2Z5B B;  4FW9 A;  4USK A;  4NXN I;  1FI4 A;  1ZM3 A;  2ZM6 I;  3J81 C;  4LF5 I;  4DV1 E;  2HFS A;  1RR9 A;  4XTJ A;  4JI0 I;  1EA6 A;  4X65 I;  1Z5A A;  4X64 I;  1D6T A;  4ZVI A;  4YY3 E;  1A6F A;  4DUZ E;  1U2R A;  4IZJ D;  1RRE A;  4MYT A;  4FWD A;  4JI7 E;  1QZR A;  4WUD A;  4B3T E;  4OX9 I;  4GKJ E;  1IBK E;  4M1K A;  2X7I A;  4KQV A;  4JI3 I;  4DUY E;  1N32 I;  4NXM I;  4YHH E;  1NHI A;  2CZ9 A;  2WW4 A;  4DU7 A;  2UXD E;  1KIJ A;  4B3M E;  4RPF A;  2Z5C A;  4DR4 I;  4JYA E;  4B3R I;  4K0K E;  3GON A;  4ED4 A;  4DPW A;  5IWA E;  2DEI A;  4IZJ A;  4HAC B;  1OJ4 A;  1PIE A;  4LFB I;  4DXL A;  4JI0 E;  4DV5 I;  4LFC I;  4JI1 I;  1XNR I;  3J81 Q;  1J5E E;  4LF8 I;  3T1Y I;  1N0V C;  2DEJ A;  3B82 A;  1K47 A;  1H73 A;  3ZKD A;  3Q6M A;  2VQE I;  2BV3 A;  2UUB I;  4JI3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...