5JEAA

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
299
structure length
299
Chain Sequence
AKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGEQIIVHPVNEREPVPLGILHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 77
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaA00
1E3HA 2NN6D 5C0XB 2NN6A 2WP8A 3M7ND 4IFDF 2PO2A 1UDNA 3GLLA 5K36F 4OO1D 1UDOA 2PNZB 2JEBA 4BA2B 5JEAE 2BA0G 5C0XE 4OO1C 3L7ZB 5K36D 4BA1B 2PO1B 5K36A 4IFDC 4AIMA 2BA1G 3GMEA 2WNRB 5K36C 2C37B 2JE6B 4IFDB 2NN6C 2JEAB 2C39A 1E3PA 2C38A 5JEAF 1OYRA 5C0XF 4OO1E 3KRNA 3U1KA 3DD6A 2NN6B 4AIDA 2BA1D 3L7ZA 4IFDE 2BR2B 2PO0B 5JEAD 2JEBB 5JEAA 3M7NG 4OO1B 5C0XD 5C0XA 1OYSA 2NN6E 5JEAC 2BA0D 3M85G 1UDQA 5C0XC 5K36B 4AM3A 3GCMA 2PNZA 2JEAA 4BA2A 2WP8B 4NBQA 3CDJA 1UDSA 2PO2B 3B4TA 4BA1A 2PO1A 5K36E 1R6LA 2C39B 2BR2A 2C38B 2PO0A 3M85D 2WNRA 4OO1A 3CDIA 2NN6F 2C37A 2JE6A 4IFDD 1OYPA 4IFDA 3H1CA 3HKMA 1R6MA 4OO1F 5JEAB
chains in the Genus database with same CATH superfamily
4KHPI 3ZKBA 1N33I 4JI1E 4DPXA 2CG9A 3P76A 4FW4A 4PRVA 1Z0CA 1I94E 3F0NA 2AE8A 4X64E 4FW3A 1ELOA 3ZZTA 4LF6E 4JV5I 2Z5CA 4OO1D 2PNZB 3J7AM 3PS3A 4NXME 4JI6I 4BA2B 1H7SA 4DV5E 2UXCI 1N33E 1Z5AA 4DR3E 4OO1C 3L7ZB 1ZM9A 3WU4A 4IZJA 2UUCE 5K36A 1P42A 4LF5I 4B3RI 4LFAI 4X66I 4JV5E 2GQ0A 1QZRA 2HHHI 2V8PA 1FNMA 1HNZI 4GQUA 4USMA 3WU3A 1S16A 1Z0VA 4XTJA 2JEAB 2C39A 4UT4A 1UEKA 4I3HA 2GO4A 4B3RE 3ZKDA 4LFAE 4X66E 2Q2EB 2V34A 2O1TA 4FW5A 4AIDA 2UUAI 2BA1D 4K0KE 1HNZE 5FLXC 4DR4I 2BR2B 3PYGA 2Z5CB 1D6TA 5JEAA 4ISAA 2DEJA 5C0XA 3OTOI 1H73A 4DPUA 3D4JA 4AQYI 4LFCI 1OYSA 4MU3A 1H7UA 2BA0D 4RPFA 3M85G 1UDQA 4YY3I 4P52A 4IZJB 2UUAE 5K36B 4JI3I 2GS8A 1MX0A 4N3OA 1XMOI 2WP8B 1A6FA 2ZBKB 1UDSA 2PO2B 5LL6R 5L3JA 1IBKI 1Y60A 1ZXMA 2VESA 4AQYE 3B4TA 3T1YE 2ZM6E 4U3DA 2F4VI 4JI0I 2E1RA 3PS2A 5BR8I 2C39B 3GONA 4LFBE 1XNQI 4LF4I 4DR1I 2WNRA 4OO1A 4U3BA 1XMOE 1RREA 2AJ4A 1KTVA 2UUBE 3K17A 2C37A 2CVEA 2JE6A 4IFDD 2VQEI 2O1UA 5ELWA 1FWLA 3HULA 1Y4UA 2HK2A 2V2VA 1HR0I 4JI4I 3HKMA 1R6MA 2F4VE 2F1DA 1FWKA 4JI0E 1HNWI 5JEAB 1E3HA 2NN6D 4LF4E 3LNUA 5C0XB 4DR1E 4DR7I 1N34E 3ZZ0A 4IFDF 4WUCA 3B8HA 3PYEA 3GLLA 2VQEE 5K36F 4DR5I 1H72C 3T1HE 1UDOA 4JI4E 3J81Q 5DRQA 5DROA 1Z59A 2A2CA 2A2DA 2BA0G 4LF9I 4MU0A 1Z0GA 4DR7E 4JYAI 1IBMI 1NHJA 1Z5CA 1N36I 4B3TE 4DR5E 2R3VA 4AIMA 4DUYI 4DR6I 2WNRB 4USKA 4LF9E 2C37B 2JE6B 1XNRI 1IBME 2IESA 4DV6E 4ZVIA 1N36E 1E3PA 2C38A 5JEAF 3Q6MA 1Z0WA 4KHPE 4FW7A 1OYRA 4DUYE 4IS9A 5C0XF 4DR6E 3U1KA 3LTOA 1XMQI 4MU1A 2O3ZA 2V2ZA 5GMDA 2VQFI 4IFDE 4DV7I 4JI8I 1DARA 1Y4SA 1HK7A 4X62I 4JI6E 2WW4A 2UXCE 5IT9Q 5EKWA 3QT6A 4FW9A 1S4EA 2NN6E 4PRXA 1XMQE 2O1WA 1Z5BA 2VQFE 3JAMC 4MDTA 4PU9A 4LF5E 5LMUI 4IZKA 1YHCA 4J3DA 2HHHE 1YH8A 1ZM3A 3PYFA 5FWKA 3CDJA 3PS1A 3B78A 2VF3A 2IERA 1EI1A 4BA1A 1IBLI 4DPTA 1R6LA 1VI7A 4X65I 1WUUA 2C38B 2PO0A 2UU9I 2O1VA 4DPYA 4DV3I 3P3GA 1USVA 4DV2I 4HY1A 1Y6ZA 1OYPA 2V2QA 1OJ4A 1ZM4A 3H1CA 1KIJA 3WU6A 4DR4E 4FWHA 4WUDA 4X65E 1J5EI 4QNKA 1B62A 1ZM2A 3PYDA 1HNXI 1Z0EA 3OTOE 2ZITA 4FW6A 3M7ND 4LFCE 3UHMA 1UDNA 4YY3E 4GKKI 4FWGA 3M6AA 4JI3E 3HJCA 2E5LI 4B3SI 4FN5A 4IZKB 2EFGA 1J5EE 4UTGA 1HNXE 5EL9A 1IBKE 2CGEA 4IZJD 5K36D 4BA1B 1N0VC 3J81C 5BR8E 4IFDC 1XNQE 2BA1G 4B3SE 2HKEA 3GMEA 1PIEA 3ZZUA 5K36C 2J65A 4OZEA 5A2QC 4B3MI 4DV0I 1USUA 4HACA 3QT7A 2NN6C 3K85A 3P3EA 1HR0E 4M1KA 1HNWE 4DV1I 2BM1A 5IWAI 4B3ME 4NXNI 3QT5A 2BV3A 1U2RA 2IOQA 4LF8I 3L7ZA 5DRRA 3J80Q 4LCGA 5JEAD 1Z0BA 3M7NG 4GKJI 4OO1B 5LMNI 5C0XD 4DV1E 4LF7I 3B82A 4JI1I 4P7AA 2OI2A 4JYAE 2UXBI 1I94I 2UXDI 5JEAC 2HFUA 3J7AG 5C0XC 4LF8E 3NZKA 4LF6I 1FKAE 3LPSA 4NXMI 2JEAA 1KKHA 4NBQA 5LMNE 4LF7E 2Z5EA 4DR3I 5DRPA 1XNRE 2UXBE 4JI7I 4HACB 2UXDE 1B63A 2UUCI 2PO1A 3H4LA 5K36E 2Z5BA 2BR2A 4EMDA 3Q1QA 3Q6NA 4JI5I 3M85D 3P3CA 1RHYA 1RR9A 3WU5A 2IOPA 1K47A 1Y5YA 4IFDA 1VISA 4JI7E 4DV7E 1FJGI 4LPFA 4JI8E 4HXZA 4DV4I 2HKJA 4X62E 4OO1F 4Z7CA 1BKNA 4JI5E 4JI2I 2NN6A 2WP8A 2PO2A 4K0KI 5GMEA 4R1FA 1FJGE 5LMUE 2JEBA 4DV4E 5JEAE 2CZ9A 4MYTA 1ZXNA 5C0XE 4JI2E 1N32I 4DU8A 4MYUA 4OKGA 1XHKA 1IBLE 2NPFA 2PO1B 1NHIA 2LJPA 2Z5BB 3CWVA 4MU4A 2UU9E 3JAMQ 4DV3E 1H74A 4DV2E 4JG4A 3T1YI 2XEXA 2HK3A 1N32E 4DXLA 4IFDB 2R42A 2ZM6I 1FI4A 4FWDA 4DR2I 5DNLA 5FLXQ 1N0UA 1EA6A 4LFBI 4LCFA 1NZ0A 4DU7A 1MU5A 4KQVA 4OO1E 3KRNA 2HFSA 3DD6A 2NN6B 3ZM7A 2UUBI 4YHHI 4GKKE 4DPWA 4OX9I 2PO0B 1PKPA 2E5LE 2J7KA 2GO3A 4HYMA 4DR2E 2JEBB 1N34I 4Z7YA 2X36A 4URLA 2PNMA 1NHHA 4YHHE 2DEIA 4DUZI 3V2UC 3J80C 4WUBA 4AM3A 4LOMA 3GCMA 3T1HI 3QT8A 2PNZA 4OX9E 4LCHA 4BA2A 2X7IA 3K1JA 4DV0E 1KVKA 3P06A 2JT2A 4DUZE 4B3TI 1PVGA 5DNXA 1MG7A 3CDIA 5IWAE 2NN6F 4MQYA 3V5RA 1Z0TA 1XXEA 4NXNE 4X64I 5A2QQ 3U1YA 4DV6I 4ED4A 3PRYA 2BM0A 2PNLA 5IT9C 4DV5I 4QNJA 4GKJE
chains in the Genus database with same CATH topology
1E3HA 2NN6D 5C0XB 2NN6A 2WP8A 3M7ND 4IFDF 2PO2A 1UDNA 3GLLA 5K36F 4OO1D 1UDOA 2PNZB 2JEBA 4BA2B 5JEAE 2BA0G 5C0XE 4OO1C 3L7ZB 5K36D 4BA1B 2PO1B 5K36A 4IFDC 4AIMA 2BA1G 3GMEA 2WNRB 5K36C 2C37B 2JE6B 4IFDB 2NN6C 2JEAB 2C39A 1E3PA 2C38A 5JEAF 1OYRA 5C0XF 4OO1E 3KRNA 3U1KA 3DD6A 2NN6B 4AIDA 2BA1D 3L7ZA 4IFDE 2BR2B 2PO0B 5JEAD 2JEBB 5JEAA 3M7NG 4OO1B 5C0XD 5C0XA 1OYSA 2NN6E 5JEAC 2BA0D 3M85G 1UDQA 5C0XC 5K36B 4AM3A 3GCMA 2PNZA 2JEAA 4BA2A 2WP8B 4NBQA 3CDJA 1UDSA 2PO2B 3B4TA 4BA1A 2PO1A 5K36E 1R6LA 2C39B 2BR2A 2C38B 2PO0A 3M85D 2WNRA 4OO1A 3CDIA 2NN6F 2C37A 2JE6A 4IFDD 1OYPA 4IFDA 3H1CA 3HKMA 1R6MA 4OO1F 5JEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3H A;  2NN6 D;  5C0X B;  2NN6 A;  2WP8 A;  3M7N D;  4IFD F;  2PO2 A;  1UDN A;  3GLL A;  5K36 F;  4OO1 D;  1UDO A;  2PNZ B;  2JEB A;  4BA2 B;  5JEA E;  2BA0 G;  5C0X E;  4OO1 C;  3L7Z B;  5K36 D;  4BA1 B;  2PO1 B;  5K36 A;  4IFD C;  4AIM A;  2BA1 G;  3GME A;  2WNR B;  5K36 C;  2C37 B;  2JE6 B;  4IFD B;  2NN6 C;  2JEA B;  2C39 A;  1E3P A;  2C38 A;  5JEA F;  1OYR A;  5C0X F;  4OO1 E;  3KRN A;  3U1K A;  3DD6 A;  2NN6 B;  4AID A;  2BA1 D;  3L7Z A;  4IFD E;  2BR2 B;  2PO0 B;  5JEA D;  2JEB B;  5JEA A;  3M7N G;  4OO1 B;  5C0X D;  5C0X A;  1OYS A;  2NN6 E;  5JEA C;  2BA0 D;  3M85 G;  1UDQ A;  5C0X C;  5K36 B;  4AM3 A;  3GCM A;  2PNZ A;  2JEA A;  4BA2 A;  2WP8 B;  4NBQ A;  3CDJ A;  1UDS A;  2PO2 B;  3B4T A;  4BA1 A;  2PO1 A;  5K36 E;  1R6L A;  2C39 B;  2BR2 A;  2C38 B;  2PO0 A;  3M85 D;  2WNR A;  4OO1 A;  3CDI A;  2NN6 F;  2C37 A;  2JE6 A;  4IFD D;  1OYP A;  4IFD A;  3H1C A;  3HKM A;  1R6M A;  4OO1 F;  5JEA B; 
#chains in the Genus database with same CATH topology
 4KHP I;  3ZKB A;  1N33 I;  4JI1 E;  4DPX A;  2CG9 A;  3P76 A;  4FW4 A;  4PRV A;  1Z0C A;  1I94 E;  3F0N A;  2AE8 A;  4X64 E;  4FW3 A;  1ELO A;  3ZZT A;  4LF6 E;  4JV5 I;  2Z5C A;  4OO1 D;  2PNZ B;  3J7A M;  3PS3 A;  4NXM E;  4JI6 I;  4BA2 B;  1H7S A;  4DV5 E;  2UXC I;  1N33 E;  1Z5A A;  4DR3 E;  4OO1 C;  3L7Z B;  1ZM9 A;  3WU4 A;  4IZJ A;  2UUC E;  5K36 A;  1P42 A;  4LF5 I;  4B3R I;  4LFA I;  4X66 I;  4JV5 E;  2GQ0 A;  1QZR A;  2HHH I;  2V8P A;  1FNM A;  1HNZ I;  4GQU A;  4USM A;  3WU3 A;  1S16 A;  1Z0V A;  4XTJ A;  2JEA B;  2C39 A;  4UT4 A;  1UEK A;  4I3H A;  2GO4 A;  4B3R E;  3ZKD A;  4LFA E;  4X66 E;  2Q2E B;  2V34 A;  2O1T A;  4FW5 A;  4AID A;  2UUA I;  2BA1 D;  4K0K E;  1HNZ E;  5FLX C;  4DR4 I;  2BR2 B;  3PYG A;  2Z5C B;  1D6T A;  5JEA A;  4ISA A;  2DEJ A;  5C0X A;  3OTO I;  1H73 A;  4DPU A;  3D4J A;  4AQY I;  4LFC I;  1OYS A;  4MU3 A;  1H7U A;  2BA0 D;  4RPF A;  3M85 G;  1UDQ A;  4YY3 I;  4P52 A;  4IZJ B;  2UUA E;  5K36 B;  4JI3 I;  2GS8 A;  1MX0 A;  4N3O A;  1XMO I;  2WP8 B;  1A6F A;  2ZBK B;  1UDS A;  2PO2 B;  5LL6 R;  5L3J A;  1IBK I;  1Y60 A;  1ZXM A;  2VES A;  4AQY E;  3B4T A;  3T1Y E;  2ZM6 E;  4U3D A;  2F4V I;  4JI0 I;  2E1R A;  3PS2 A;  5BR8 I;  2C39 B;  3GON A;  4LFB E;  1XNQ I;  4LF4 I;  4DR1 I;  2WNR A;  4OO1 A;  4U3B A;  1XMO E;  1RRE A;  2AJ4 A;  1KTV A;  2UUB E;  3K17 A;  2C37 A;  2CVE A;  2JE6 A;  4IFD D;  2VQE I;  2O1U A;  5ELW A;  1FWL A;  3HUL A;  1Y4U A;  2HK2 A;  2V2V A;  1HR0 I;  4JI4 I;  3HKM A;  1R6M A;  2F4V E;  2F1D A;  1FWK A;  4JI0 E;  1HNW I;  5JEA B;  1E3H A;  2NN6 D;  4LF4 E;  3LNU A;  5C0X B;  4DR1 E;  4DR7 I;  1N34 E;  3ZZ0 A;  4IFD F;  4WUC A;  3B8H A;  3PYE A;  3GLL A;  2VQE E;  5K36 F;  4DR5 I;  1H72 C;  3T1H E;  1UDO A;  4JI4 E;  3J81 Q;  5DRQ A;  5DRO A;  1Z59 A;  2A2C A;  2A2D A;  2BA0 G;  4LF9 I;  4MU0 A;  1Z0G A;  4DR7 E;  4JYA I;  1IBM I;  1NHJ A;  1Z5C A;  1N36 I;  4B3T E;  4DR5 E;  2R3V A;  4AIM A;  4DUY I;  4DR6 I;  2WNR B;  4USK A;  4LF9 E;  2C37 B;  2JE6 B;  1XNR I;  1IBM E;  2IES A;  4DV6 E;  4ZVI A;  1N36 E;  1E3P A;  2C38 A;  5JEA F;  3Q6M A;  1Z0W A;  4KHP E;  4FW7 A;  1OYR A;  4DUY E;  4IS9 A;  5C0X F;  4DR6 E;  3U1K A;  3LTO A;  1XMQ I;  4MU1 A;  2O3Z A;  2V2Z A;  5GMD A;  2VQF I;  4IFD E;  4DV7 I;  4JI8 I;  1DAR A;  1Y4S A;  1HK7 A;  4X62 I;  4JI6 E;  2WW4 A;  2UXC E;  5IT9 Q;  5EKW A;  3QT6 A;  4FW9 A;  1S4E A;  2NN6 E;  4PRX A;  1XMQ E;  2O1W A;  1Z5B A;  2VQF E;  3JAM C;  4MDT A;  4PU9 A;  4LF5 E;  5LMU I;  4IZK A;  1YHC A;  4J3D A;  2HHH E;  1YH8 A;  1ZM3 A;  3PYF A;  5FWK A;  3CDJ A;  3PS1 A;  3B78 A;  2VF3 A;  2IER A;  1EI1 A;  4BA1 A;  1IBL I;  4DPT A;  1R6L A;  1VI7 A;  4X65 I;  1WUU A;  2C38 B;  2PO0 A;  2UU9 I;  2O1V A;  4DPY A;  4DV3 I;  3P3G A;  1USV A;  4DV2 I;  4HY1 A;  1Y6Z A;  1OYP A;  2V2Q A;  1OJ4 A;  1ZM4 A;  3H1C A;  1KIJ A;  3WU6 A;  4DR4 E;  4FWH A;  4WUD A;  4X65 E;  1J5E I;  4QNK A;  1B62 A;  1ZM2 A;  3PYD A;  1HNX I;  1Z0E A;  3OTO E;  2ZIT A;  4FW6 A;  3M7N D;  4LFC E;  3UHM A;  1UDN A;  4YY3 E;  4GKK I;  4FWG A;  3M6A A;  4JI3 E;  3HJC A;  2E5L I;  4B3S I;  4FN5 A;  4IZK B;  2EFG A;  1J5E E;  4UTG A;  1HNX E;  5EL9 A;  1IBK E;  2CGE A;  4IZJ D;  5K36 D;  4BA1 B;  1N0V C;  3J81 C;  5BR8 E;  4IFD C;  1XNQ E;  2BA1 G;  4B3S E;  2HKE A;  3GME A;  1PIE A;  3ZZU A;  5K36 C;  2J65 A;  4OZE A;  5A2Q C;  4B3M I;  4DV0 I;  1USU A;  4HAC A;  3QT7 A;  2NN6 C;  3K85 A;  3P3E A;  1HR0 E;  4M1K A;  1HNW E;  4DV1 I;  2BM1 A;  5IWA I;  4B3M E;  4NXN I;  3QT5 A;  2BV3 A;  1U2R A;  2IOQ A;  4LF8 I;  3L7Z A;  5DRR A;  3J80 Q;  4LCG A;  5JEA D;  1Z0B A;  3M7N G;  4GKJ I;  4OO1 B;  5LMN I;  5C0X D;  4DV1 E;  4LF7 I;  3B82 A;  4JI1 I;  4P7A A;  2OI2 A;  4JYA E;  2UXB I;  1I94 I;  2UXD I;  5JEA C;  2HFU A;  3J7A G;  5C0X C;  4LF8 E;  3NZK A;  4LF6 I;  1FKA E;  3LPS A;  4NXM I;  2JEA A;  1KKH A;  4NBQ A;  5LMN E;  4LF7 E;  2Z5E A;  4DR3 I;  5DRP A;  1XNR E;  2UXB E;  4JI7 I;  4HAC B;  2UXD E;  1B63 A;  2UUC I;  2PO1 A;  3H4L A;  5K36 E;  2Z5B A;  2BR2 A;  4EMD A;  3Q1Q A;  3Q6N A;  4JI5 I;  3M85 D;  3P3C A;  1RHY A;  1RR9 A;  3WU5 A;  2IOP A;  1K47 A;  1Y5Y A;  4IFD A;  1VIS A;  4JI7 E;  4DV7 E;  1FJG I;  4LPF A;  4JI8 E;  4HXZ A;  4DV4 I;  2HKJ A;  4X62 E;  4OO1 F;  4Z7C A;  1BKN A;  4JI5 E;  4JI2 I;  2NN6 A;  2WP8 A;  2PO2 A;  4K0K I;  5GME A;  4R1F A;  1FJG E;  5LMU E;  2JEB A;  4DV4 E;  5JEA E;  2CZ9 A;  4MYT A;  1ZXN A;  5C0X E;  4JI2 E;  1N32 I;  4DU8 A;  4MYU A;  4OKG A;  1XHK A;  1IBL E;  2NPF A;  2PO1 B;  1NHI A;  2LJP A;  2Z5B B;  3CWV A;  4MU4 A;  2UU9 E;  3JAM Q;  4DV3 E;  1H74 A;  4DV2 E;  4JG4 A;  3T1Y I;  2XEX A;  2HK3 A;  1N32 E;  4DXL A;  4IFD B;  2R42 A;  2ZM6 I;  1FI4 A;  4FWD A;  4DR2 I;  5DNL A;  5FLX Q;  1N0U A;  1EA6 A;  4LFB I;  4LCF A;  1NZ0 A;  4DU7 A;  1MU5 A;  4KQV A;  4OO1 E;  3KRN A;  2HFS A;  3DD6 A;  2NN6 B;  3ZM7 A;  2UUB I;  4YHH I;  4GKK E;  4DPW A;  4OX9 I;  2PO0 B;  1PKP A;  2E5L E;  2J7K A;  2GO3 A;  4HYM A;  4DR2 E;  2JEB B;  1N34 I;  4Z7Y A;  2X36 A;  4URL A;  2PNM A;  1NHH A;  4YHH E;  2DEI A;  4DUZ I;  3V2U C;  3J80 C;  4WUB A;  4AM3 A;  4LOM A;  3GCM A;  3T1H I;  3QT8 A;  2PNZ A;  4OX9 E;  4LCH A;  4BA2 A;  2X7I A;  3K1J A;  4DV0 E;  1KVK A;  3P06 A;  2JT2 A;  4DUZ E;  4B3T I;  1PVG A;  5DNX A;  1MG7 A;  3CDI A;  5IWA E;  2NN6 F;  4MQY A;  3V5R A;  1Z0T A;  1XXE A;  4NXN E;  4X64 I;  5A2Q Q;  3U1Y A;  4DV6 I;  4ED4 A;  3PRY A;  2BM0 A;  2PNL A;  5IT9 C;  4DV5 I;  4QNJ A;  4GKJ E; 
#chains in the Genus database with same CATH homology
 1E3H A;  2NN6 D;  5C0X B;  2NN6 A;  2WP8 A;  3M7N D;  4IFD F;  2PO2 A;  1UDN A;  3GLL A;  5K36 F;  4OO1 D;  1UDO A;  2PNZ B;  2JEB A;  4BA2 B;  5JEA E;  2BA0 G;  5C0X E;  4OO1 C;  3L7Z B;  5K36 D;  4BA1 B;  2PO1 B;  5K36 A;  4IFD C;  4AIM A;  2BA1 G;  3GME A;  2WNR B;  5K36 C;  2C37 B;  2JE6 B;  4IFD B;  2NN6 C;  2JEA B;  2C39 A;  1E3P A;  2C38 A;  5JEA F;  1OYR A;  5C0X F;  4OO1 E;  3KRN A;  3U1K A;  3DD6 A;  2NN6 B;  4AID A;  2BA1 D;  3L7Z A;  4IFD E;  2BR2 B;  2PO0 B;  5JEA D;  2JEB B;  5JEA A;  3M7N G;  4OO1 B;  5C0X D;  5C0X A;  1OYS A;  2NN6 E;  5JEA C;  2BA0 D;  3M85 G;  1UDQ A;  5C0X C;  5K36 B;  4AM3 A;  3GCM A;  2PNZ A;  2JEA A;  4BA2 A;  2WP8 B;  4NBQ A;  3CDJ A;  1UDS A;  2PO2 B;  3B4T A;  4BA1 A;  2PO1 A;  5K36 E;  1R6L A;  2C39 B;  2BR2 A;  2C38 B;  2PO0 A;  3M85 D;  2WNR A;  4OO1 A;  3CDI A;  2NN6 F;  2C37 A;  2JE6 A;  4IFD D;  1OYP A;  4IFD A;  3H1C A;  3HKM A;  1R6M A;  4OO1 F;  5JEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...