5JEAA

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
299
structure length
299
Chain Sequence
b'AKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGEQIIVHPVNEREPVPLGILHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 77
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaA00
4NBQA 3L7ZB 2C39A 4OO1A 5C0XD 3DD6A 4AM3A 3KRNA 1E3HA 4BA1B 4AIDA 2JEAB 2NN6E 2NN6C 3M85D 2PO2B 1OYPA 3CDIA 4OO1F 1E3PA 2BA1D 4BA2B 1R6LA 5K36D 3L7ZA 4IFDC 4BA1A 5K36B 1R6MA 1UDOA 2JEAA 2BA1G 1UDNA 2BA0G 2PO2A 2BR2B 3GMEA 5JEAB 2PNZB 4BA2A 5C0XF 5C0XE 5C0XC 2PO0B 4OO1E 1OYRA 4OO1C 5K36A 3CDJA 2C37B 3M7ND 2NN6D 3M85G 2BR2A 2NN6B 2JEBB 5JEAA 2PNZA 2PO0A 5JEAD 4IFDD 2PO1B 4IFDB 3HKMA 2C38B 2C37A 3H1CA 1OYSA 2WNRB 2NN6A 2JE6B 2JEBA 3U1KA 2WP8B 5C0XB 4OO1D 2PO1A 5K36F 4IFDA 5K36E 5K36C 2C39B 2C38A 4OO1B 2NN6F 1UDQA 3M7NG 2WNRA 3GCMA 2JE6A 2BA0D 2WP8A 5JEAF 4AIMA 5JEAE 5JEAC 4IFDF 4IFDE 1UDSA 5C0XA 3GLLA 3B4TA
chains in the Genus database with same CATH superfamily
4DUZE 4EMDA 1E3HA 4YY3I 4DXLA 2HK3A 5DRRA 2HHHI 2GS8A 1ZM9A 2OI2A 2HFSA 2JEAB 1D6TA 2WW4A 3PYDA 4LF9I 2NN6E 1UEKA 4QNJA 4DV5I 1HNZE 4DR6I 3D4JA 4KHPI 2BA1D 4B3MI 4DR5E 1XMOE 1QZRA 3PYEA 3P3CA 2ZM6E 1IBKI 1EI1A 4BA1A 4JI4I 4NXNE 1OJ4A 4B3TI 4JYAE 1R6MA 3Q6MA 4GKKI 4Z7YA 2UXBI 2F4VE 1UDNA 2PO2A 4DPXA 3T1HE 5IT9C 2X7IA 4N3OA 3PRYA 2UU9I 1FJGE 3LTOA 1H72C 4BA2A 3J81Q 4LCGA 3JAMC 3OTOE 2HFUA 4DPUA 4IZKB 3CDJA 2UXCI 4DR5I 4JI6I 4FW9A 4OX9E 1Y4SA 2CVEA 2NN6B 2JEBB 4DV1E 5JEAA 5ELWA 4JYAI 3NZKA 1U2RA 5IT9Q 1N32I 5A2QC 2LJPA 2Z5CB 2IESA 5GMEA 3T1HI 4IFDB 3B82A 4DUYE 3H4LA 3PS3A 4X62I 3QT7A 2V2QA 3PYFA 1OYSA 1PKPA 4AQYE 4JI0I 1I94I 1H74A 3OTOI 2VESA 2ZBKB 2JE6B 4OKGA 3QT8A 4KQVA 4K0KE 1MU5A 4WUBA 1IBLI 4JI8E 1Y6ZA 1Y5YA 1HR0E 1N0VC 5K36C 2C38A 4DR7E 5A2QQ 1Y60A 2JT2A 4DV1I 3M7NG 2WNRA 4Z7CA 4X65E 3PS1A 4DPTA 1Z0TA 1MG7A 1WUUA 1XXEA 1N33I 1Z0WA 2WP8A 4X66I 1UDSA 2PNMA 3P3GA 2X36A 2DEJA 3GLLA 1YHCA 2O1TA 4YY3E 3ZM7A 3L7ZB 2C39A 2HKJA 3KRNA 4AIDA 3WU3A 2A2DA 1S4EA 4I3HA 3ZZ0A 2V8PA 1HR0I 4DR3I 4DR6E 3P3EA 4JG4A 3M85D 4QNKA 4B3ME 4DR7I 4WUDA 2UUCE 4JI4E 5K36D 5LMUI 2IOQA 4B3TE 4LF5E 4FW6A 2UUAI 3F0NA 4DV3E 4GKKE 3V2UC 4LFBI 1RREA 2UXBE 5FLXC 4HACA 2BA1G 4MYUA 4IZJD 4MDTA 2UU9E 3J7AM 4P7AA 4ISAA 4DR4I 2PNZB 5C0XC 5BR8I 4DV4I 4OO1C 1A6FA 5K36A 1VISA 2UXCE 4FW7A 4JI6E 1VI7A 2V2ZA 5EKWA 3ZKDA 4GKJI 1P42A 2UUCI 5FLXQ 4LF5I 2CZ9A 2BR2A 4IZJA 2BM1A 4DV3I 4NXMI 1N32E 1PIEA 5FWKA 4B3SI 1N0UA 1FWKA 2PO0A 5JEAD 4PU9A 4USMA 4JI7I 2PO1B 4X62E 2C37A 1DARA 2AJ4A 1I94E 4DV2E 4JI0E 1Z59A 1XNQE 1NHIA 2VF3A 4MU4A 2HK2A 4OZEA 1IBLE 2Z5BB 1YH8A 4B3RE 2E5LI 1KTVA 3T1YE 3B78A 4RPFA 3B8HA 3P76A 4OO1D 4FWDA 4M1KA 1XMQE 2CG9A 3ZZTA 2AE8A 1UDQA 3GCMA 1N33E 1KVKA 2BV3A 4JV5E 4LCHA 3JAMQ 1ELOA 1HNWI 3V5RA 4FN5A 4X66E 3J7AG 3QT5A 1RR9A 5JEAF 5JEAE 2J65A 4DV2I 5C0XA 1XNQI 3LNUA 4DV6E 1ZM4A 4NBQA 4OO1A 3DD6A 5LL6R 2O1UA 4BA1B 2CGEA 1FNMA 1Z0CA 4DR3E 4B3RI 3T1YI 3U1YA 3CWVA 4MQYA 2NN6C 2E1RA 4JI2I 2PO2B 1XMQI 4DR2I 4OO1F 4LF6E 1E3PA 3WU5A 5LMUE 1Z5BA 4BA2B 4LCFA 1R6LA 4HYMA 2UUAE 4JV5I 3M6AA 1NZ0A 4FW4A 4LFBE 4IFDC 1MX0A 2IOPA 5DROA 1B62A 2A2CA 3K1JA 4LFCE 2JEAA 1ZXMA 1H73A 3P06A 4FWHA 4DV6I 1HK7A 2BA0G 4DV7I 4DR4E 1HNXI 3GMEA 4URLA 5BR8E 5JEAB 1PVGA 1H7UA 4DV4E 2R3VA 3HULA 4HXZA 4GKJE 4LF6I 4XTJA 4LFAE 3M7ND 4J3DA 2J7KA 2NN6D 5IWAI 1BKNA 1J5EI 4NXME 4HY1A 3K85A 4B3SE 4FW3A 2GO3A 4LFCI 1IBME 2VQFE 4ZVIA 4MYTA 1XNRI 4JI7E 4IFDD 2HKEA 2V34A 5EL9A 4DR1I 3Q1QA 2O1VA 3ZKBA 1N36E 4IZKA 1KIJA 3HKMA 1USVA 2C38B 4YHHI 1ZM3A 3GONA 2O1WA 2XEXA 4LF8E 4JI5I 3PYGA 2IERA 3H1CA 2WNRB 4JI1I 3WU6A 1Y4UA 1N34E 2NN6A 2E5LE 1Z0EA 2JEBA 4U3DA 4UT4A 1H7SA 2R42A 3U1KA 2WP8B 4DU7A 2VQEI 4LFAI 4DU8A 2Z5CA 5LMNI 4LOMA 5K36F 4IFDA 5K36E 2C39B 4LF4I 1ZM2A 2NN6F 1IBMI 3UHMA 2VQFI 1HNWE 3J81C 1Z5CA 2GQ0A 2JE6A 4FW5A 1N36I 1S16A 3ZZUA 3Q6NA 4AIMA 4IFDF 4LF7E 4IFDE 4LF8I 3QT6A 4LPFA 4AM3A 5C0XD 1N34I 1NHHA 4DUZI 4X64E 4PRVA 4GQUA 4JI2E 2NPFA 2O3ZA 4HACB 4DR2E 4USKA 2UUBE 1FI4A 1OYPA 3CDIA 2UXDE 4MU0A 4UTGA 1HNZI 1K47A 4FWGA 3L7ZA 1XMOI 2BM0A 2V2VA 4U3BA 5K36B 3WU4A 4LF7I 2ZM6I 1Z0GA 1UDOA 4DV7E 4NXNI 4DPYA 1HNXE 3LPSA 3PS2A 4DV0E 4X64I 1KKHA 2BR2B 4IZJB 2F4VI 1EA6A 1RHYA 3HJCA 5DRPA 1Z0BA 2PNLA 2ZITA 5C0XF 5C0XE 1FJGI 2PO0B 4JI3E 4OO1E 1OYRA 4PRXA 2Z5EA 2UUBI 2UXDI 5IWAE 2C37B 1B63A 1J5EE 2EFGA 4IS9A 5GMDA 1USUA 3K17A 3M85G 5DRQA 1XNRE 4OX9I 2PNZA 4DR1E 3J80C 4MU3A 4DV0I 1NHJA 4YHHE 1Z0VA 2Q2EB 5L3JA 4JI5E 4MU1A 2GO4A 4JI1E 4P52A 4DUYI 4WUCA 1Z5AA 4JI3I 4R1FA 2VQEE 5DNXA 2DEIA 4AQYI 1ZXNA 2HHHE 5LMNE 5C0XB 4K0KI 4LF9E 4LF4E 2PO1A 2F1DA 4JI8I 3J80Q 1XHKA 4OO1B 4DV5E 4KHPE 4ED4A 2BA0D 1IBKE 1FWLA 2Z5BA 4X65I 5JEAC 1FKAE 4DPWA 5DNLA 3B4TA
chains in the Genus database with same CATH topology
4NBQA 3L7ZB 2C39A 4OO1A 5C0XD 3DD6A 4AM3A 3KRNA 1E3HA 4BA1B 4AIDA 2JEAB 2NN6E 2NN6C 3M85D 2PO2B 1OYPA 3CDIA 4OO1F 1E3PA 2BA1D 4BA2B 1R6LA 5K36D 3L7ZA 4IFDC 4BA1A 5K36B 1R6MA 1UDOA 2JEAA 2BA1G 1UDNA 2BA0G 2PO2A 2BR2B 3GMEA 5JEAB 2PNZB 4BA2A 5C0XF 5C0XE 5C0XC 2PO0B 4OO1E 1OYRA 4OO1C 5K36A 3CDJA 2C37B 3M7ND 2NN6D 3M85G 2BR2A 2NN6B 2JEBB 5JEAA 2PNZA 2PO0A 5JEAD 4IFDD 2PO1B 4IFDB 3HKMA 2C38B 2C37A 3H1CA 1OYSA 2WNRB 2NN6A 2JE6B 2JEBA 3U1KA 2WP8B 5C0XB 4OO1D 2PO1A 5K36F 4IFDA 5K36E 5K36C 2C39B 2C38A 4OO1B 2NN6F 1UDQA 3M7NG 2WNRA 3GCMA 2JE6A 2BA0D 2WP8A 5JEAF 4AIMA 5JEAE 5JEAC 4IFDF 4IFDE 1UDSA 5C0XA 3GLLA 3B4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBQ A;  3L7Z B;  2C39 A;  4OO1 A;  5C0X D;  3DD6 A;  4AM3 A;  3KRN A;  1E3H A;  4BA1 B;  4AID A;  2JEA B;  2NN6 E;  2NN6 C;  3M85 D;  2PO2 B;  1OYP A;  3CDI A;  4OO1 F;  1E3P A;  2BA1 D;  4BA2 B;  1R6L A;  5K36 D;  3L7Z A;  4IFD C;  4BA1 A;  5K36 B;  1R6M A;  1UDO A;  2JEA A;  2BA1 G;  1UDN A;  2BA0 G;  2PO2 A;  2BR2 B;  3GME A;  5JEA B;  2PNZ B;  4BA2 A;  5C0X F;  5C0X E;  5C0X C;  2PO0 B;  4OO1 E;  1OYR A;  4OO1 C;  5K36 A;  3CDJ A;  2C37 B;  3M7N D;  2NN6 D;  3M85 G;  2BR2 A;  2NN6 B;  2JEB B;  5JEA A;  2PNZ A;  2PO0 A;  5JEA D;  4IFD D;  2PO1 B;  4IFD B;  3HKM A;  2C38 B;  2C37 A;  3H1C A;  1OYS A;  2WNR B;  2NN6 A;  2JE6 B;  2JEB A;  3U1K A;  2WP8 B;  5C0X B;  4OO1 D;  2PO1 A;  5K36 F;  4IFD A;  5K36 E;  5K36 C;  2C39 B;  2C38 A;  4OO1 B;  2NN6 F;  1UDQ A;  3M7N G;  2WNR A;  3GCM A;  2JE6 A;  2BA0 D;  2WP8 A;  5JEA F;  4AIM A;  5JEA E;  5JEA C;  4IFD F;  4IFD E;  1UDS A;  5C0X A;  3GLL A;  3B4T A; 
#chains in the Genus database with same CATH topology
 4DUZ E;  4EMD A;  1E3H A;  4YY3 I;  4DXL A;  2HK3 A;  5DRR A;  2HHH I;  2GS8 A;  1ZM9 A;  2OI2 A;  2HFS A;  2JEA B;  1D6T A;  2WW4 A;  3PYD A;  4LF9 I;  2NN6 E;  1UEK A;  4QNJ A;  4DV5 I;  1HNZ E;  4DR6 I;  3D4J A;  4KHP I;  2BA1 D;  4B3M I;  4DR5 E;  1XMO E;  1QZR A;  3PYE A;  3P3C A;  2ZM6 E;  1IBK I;  1EI1 A;  4BA1 A;  4JI4 I;  4NXN E;  1OJ4 A;  4B3T I;  4JYA E;  1R6M A;  3Q6M A;  4GKK I;  4Z7Y A;  2UXB I;  2F4V E;  1UDN A;  2PO2 A;  4DPX A;  3T1H E;  5IT9 C;  2X7I A;  4N3O A;  3PRY A;  2UU9 I;  1FJG E;  3LTO A;  1H72 C;  4BA2 A;  3J81 Q;  4LCG A;  3JAM C;  3OTO E;  2HFU A;  4DPU A;  4IZK B;  3CDJ A;  2UXC I;  4DR5 I;  4JI6 I;  4FW9 A;  4OX9 E;  1Y4S A;  2CVE A;  2NN6 B;  2JEB B;  4DV1 E;  5JEA A;  5ELW A;  4JYA I;  3NZK A;  1U2R A;  5IT9 Q;  1N32 I;  5A2Q C;  2LJP A;  2Z5C B;  2IES A;  5GME A;  3T1H I;  4IFD B;  3B82 A;  4DUY E;  3H4L A;  3PS3 A;  4X62 I;  3QT7 A;  2V2Q A;  3PYF A;  1OYS A;  1PKP A;  4AQY E;  4JI0 I;  1I94 I;  1H74 A;  3OTO I;  2VES A;  2ZBK B;  2JE6 B;  4OKG A;  3QT8 A;  4KQV A;  4K0K E;  1MU5 A;  4WUB A;  1IBL I;  4JI8 E;  1Y6Z A;  1Y5Y A;  1HR0 E;  1N0V C;  5K36 C;  2C38 A;  4DR7 E;  5A2Q Q;  1Y60 A;  2JT2 A;  4DV1 I;  3M7N G;  2WNR A;  4Z7C A;  4X65 E;  3PS1 A;  4DPT A;  1Z0T A;  1MG7 A;  1WUU A;  1XXE A;  1N33 I;  1Z0W A;  2WP8 A;  4X66 I;  1UDS A;  2PNM A;  3P3G A;  2X36 A;  2DEJ A;  3GLL A;  1YHC A;  2O1T A;  4YY3 E;  3ZM7 A;  3L7Z B;  2C39 A;  2HKJ A;  3KRN A;  4AID A;  3WU3 A;  2A2D A;  1S4E A;  4I3H A;  3ZZ0 A;  2V8P A;  1HR0 I;  4DR3 I;  4DR6 E;  3P3E A;  4JG4 A;  3M85 D;  4QNK A;  4B3M E;  4DR7 I;  4WUD A;  2UUC E;  4JI4 E;  5K36 D;  5LMU I;  2IOQ A;  4B3T E;  4LF5 E;  4FW6 A;  2UUA I;  3F0N A;  4DV3 E;  4GKK E;  3V2U C;  4LFB I;  1RRE A;  2UXB E;  5FLX C;  4HAC A;  2BA1 G;  4MYU A;  4IZJ D;  4MDT A;  2UU9 E;  3J7A M;  4P7A A;  4ISA A;  4DR4 I;  2PNZ B;  5C0X C;  5BR8 I;  4DV4 I;  4OO1 C;  1A6F A;  5K36 A;  1VIS A;  2UXC E;  4FW7 A;  4JI6 E;  1VI7 A;  2V2Z A;  5EKW A;  3ZKD A;  4GKJ I;  1P42 A;  2UUC I;  5FLX Q;  4LF5 I;  2CZ9 A;  2BR2 A;  4IZJ A;  2BM1 A;  4DV3 I;  4NXM I;  1N32 E;  1PIE A;  5FWK A;  4B3S I;  1N0U A;  1FWK A;  2PO0 A;  5JEA D;  4PU9 A;  4USM A;  4JI7 I;  2PO1 B;  4X62 E;  2C37 A;  1DAR A;  2AJ4 A;  1I94 E;  4DV2 E;  4JI0 E;  1Z59 A;  1XNQ E;  1NHI A;  2VF3 A;  4MU4 A;  2HK2 A;  4OZE A;  1IBL E;  2Z5B B;  1YH8 A;  4B3R E;  2E5L I;  1KTV A;  3T1Y E;  3B78 A;  4RPF A;  3B8H A;  3P76 A;  4OO1 D;  4FWD A;  4M1K A;  1XMQ E;  2CG9 A;  3ZZT A;  2AE8 A;  1UDQ A;  3GCM A;  1N33 E;  1KVK A;  2BV3 A;  4JV5 E;  4LCH A;  3JAM Q;  1ELO A;  1HNW I;  3V5R A;  4FN5 A;  4X66 E;  3J7A G;  3QT5 A;  1RR9 A;  5JEA F;  5JEA E;  2J65 A;  4DV2 I;  5C0X A;  1XNQ I;  3LNU A;  4DV6 E;  1ZM4 A;  4NBQ A;  4OO1 A;  3DD6 A;  5LL6 R;  2O1U A;  4BA1 B;  2CGE A;  1FNM A;  1Z0C A;  4DR3 E;  4B3R I;  3T1Y I;  3U1Y A;  3CWV A;  4MQY A;  2NN6 C;  2E1R A;  4JI2 I;  2PO2 B;  1XMQ I;  4DR2 I;  4OO1 F;  4LF6 E;  1E3P A;  3WU5 A;  5LMU E;  1Z5B A;  4BA2 B;  4LCF A;  1R6L A;  4HYM A;  2UUA E;  4JV5 I;  3M6A A;  1NZ0 A;  4FW4 A;  4LFB E;  4IFD C;  1MX0 A;  2IOP A;  5DRO A;  1B62 A;  2A2C A;  3K1J A;  4LFC E;  2JEA A;  1ZXM A;  1H73 A;  3P06 A;  4FWH A;  4DV6 I;  1HK7 A;  2BA0 G;  4DV7 I;  4DR4 E;  1HNX I;  3GME A;  4URL A;  5BR8 E;  5JEA B;  1PVG A;  1H7U A;  4DV4 E;  2R3V A;  3HUL A;  4HXZ A;  4GKJ E;  4LF6 I;  4XTJ A;  4LFA E;  3M7N D;  4J3D A;  2J7K A;  2NN6 D;  5IWA I;  1BKN A;  1J5E I;  4NXM E;  4HY1 A;  3K85 A;  4B3S E;  4FW3 A;  2GO3 A;  4LFC I;  1IBM E;  2VQF E;  4ZVI A;  4MYT A;  1XNR I;  4JI7 E;  4IFD D;  2HKE A;  2V34 A;  5EL9 A;  4DR1 I;  3Q1Q A;  2O1V A;  3ZKB A;  1N36 E;  4IZK A;  1KIJ A;  3HKM A;  1USV A;  2C38 B;  4YHH I;  1ZM3 A;  3GON A;  2O1W A;  2XEX A;  4LF8 E;  4JI5 I;  3PYG A;  2IER A;  3H1C A;  2WNR B;  4JI1 I;  3WU6 A;  1Y4U A;  1N34 E;  2NN6 A;  2E5L E;  1Z0E A;  2JEB A;  4U3D A;  4UT4 A;  1H7S A;  2R42 A;  3U1K A;  2WP8 B;  4DU7 A;  2VQE I;  4LFA I;  4DU8 A;  2Z5C A;  5LMN I;  4LOM A;  5K36 F;  4IFD A;  5K36 E;  2C39 B;  4LF4 I;  1ZM2 A;  2NN6 F;  1IBM I;  3UHM A;  2VQF I;  1HNW E;  3J81 C;  1Z5C A;  2GQ0 A;  2JE6 A;  4FW5 A;  1N36 I;  1S16 A;  3ZZU A;  3Q6N A;  4AIM A;  4IFD F;  4LF7 E;  4IFD E;  4LF8 I;  3QT6 A;  4LPF A;  4AM3 A;  5C0X D;  1N34 I;  1NHH A;  4DUZ I;  4X64 E;  4PRV A;  4GQU A;  4JI2 E;  2NPF A;  2O3Z A;  4HAC B;  4DR2 E;  4USK A;  2UUB E;  1FI4 A;  1OYP A;  3CDI A;  2UXD E;  4MU0 A;  4UTG A;  1HNZ I;  1K47 A;  4FWG A;  3L7Z A;  1XMO I;  2BM0 A;  2V2V A;  4U3B A;  5K36 B;  3WU4 A;  4LF7 I;  2ZM6 I;  1Z0G A;  1UDO A;  4DV7 E;  4NXN I;  4DPY A;  1HNX E;  3LPS A;  3PS2 A;  4DV0 E;  4X64 I;  1KKH A;  2BR2 B;  4IZJ B;  2F4V I;  1EA6 A;  1RHY A;  3HJC A;  5DRP A;  1Z0B A;  2PNL A;  2ZIT A;  5C0X F;  5C0X E;  1FJG I;  2PO0 B;  4JI3 E;  4OO1 E;  1OYR A;  4PRX A;  2Z5E A;  2UUB I;  2UXD I;  5IWA E;  2C37 B;  1B63 A;  1J5E E;  2EFG A;  4IS9 A;  5GMD A;  1USU A;  3K17 A;  3M85 G;  5DRQ A;  1XNR E;  4OX9 I;  2PNZ A;  4DR1 E;  3J80 C;  4MU3 A;  4DV0 I;  1NHJ A;  4YHH E;  1Z0V A;  2Q2E B;  5L3J A;  4JI5 E;  4MU1 A;  2GO4 A;  4JI1 E;  4P52 A;  4DUY I;  4WUC A;  1Z5A A;  4JI3 I;  4R1F A;  2VQE E;  5DNX A;  2DEI A;  4AQY I;  1ZXN A;  2HHH E;  5LMN E;  5C0X B;  4K0K I;  4LF9 E;  4LF4 E;  2PO1 A;  2F1D A;  4JI8 I;  3J80 Q;  1XHK A;  4OO1 B;  4DV5 E;  4KHP E;  4ED4 A;  2BA0 D;  1IBK E;  1FWL A;  2Z5B A;  4X65 I;  5JEA C;  1FKA E;  4DPW A;  5DNL A;  3B4T A; 
#chains in the Genus database with same CATH homology
 4NBQ A;  3L7Z B;  2C39 A;  4OO1 A;  5C0X D;  3DD6 A;  4AM3 A;  3KRN A;  1E3H A;  4BA1 B;  4AID A;  2JEA B;  2NN6 E;  2NN6 C;  3M85 D;  2PO2 B;  1OYP A;  3CDI A;  4OO1 F;  1E3P A;  2BA1 D;  4BA2 B;  1R6L A;  5K36 D;  3L7Z A;  4IFD C;  4BA1 A;  5K36 B;  1R6M A;  1UDO A;  2JEA A;  2BA1 G;  1UDN A;  2BA0 G;  2PO2 A;  2BR2 B;  3GME A;  5JEA B;  2PNZ B;  4BA2 A;  5C0X F;  5C0X E;  5C0X C;  2PO0 B;  4OO1 E;  1OYR A;  4OO1 C;  5K36 A;  3CDJ A;  2C37 B;  3M7N D;  2NN6 D;  3M85 G;  2BR2 A;  2NN6 B;  2JEB B;  5JEA A;  2PNZ A;  2PO0 A;  5JEA D;  4IFD D;  2PO1 B;  4IFD B;  3HKM A;  2C38 B;  2C37 A;  3H1C A;  1OYS A;  2WNR B;  2NN6 A;  2JE6 B;  2JEB A;  3U1K A;  2WP8 B;  5C0X B;  4OO1 D;  2PO1 A;  5K36 F;  4IFD A;  5K36 E;  5K36 C;  2C39 B;  2C38 A;  4OO1 B;  2NN6 F;  1UDQ A;  3M7N G;  2WNR A;  3GCM A;  2JE6 A;  2BA0 D;  2WP8 A;  5JEA F;  4AIM A;  5JEA E;  5JEA C;  4IFD F;  4IFD E;  1UDS A;  5C0X A;  3GLL A;  3B4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...