5JEAA

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
299
structure length
299
Chain Sequence
AKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGEQIIVHPVNEREPVPLGILHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 77
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaA00
4OO1B 4BA1B 2C38B 2WNRB 5K36E 2JE6A 3M85D 2NN6A 2BA1G 2PNZB 5JEAD 4BA1A 2C38A 2WNRA 4IFDE 3L7ZB 2PO2B 2JEBB 1E3HA 3CDIA 3M85G 2NN6D 2PNZA 3DD6A 2BR2B 5C0XE 2PO2A 1OYSA 2JEBA 1UDQA 3HKMA 4OO1C 2JEAB 3GMEA 4AIDA 2BR2A 5K36F 5K36B 4AIMA 2JEAA 5JEAC 4IFDF 3CDJA 4NBQA 4IFDB 2C37A 5K36A 2NN6C 1R6LA 5C0XD 3M7ND 5C0XF 5JEAE 1OYPA 2WP8B 4IFDA 5C0XB 2BA0D 2C39B 5K36D 3U1KA 4BA2B 1R6MA 2C37B 3M7NG 1OYRA 1UDSA 4OO1E 2WP8A 4IFDD 5C0XA 2C39A 4BA2A 4IFDC 3KRNA 2PO0B 3B4TA 3GCMA 4OO1A 5JEAF 5C0XC 2PO0A 2PO1B 5JEAB 3H1CA 2NN6E 3GLLA 5K36C 2NN6F 1UDNA 2BA0G 2JE6B 4OO1D 2NN6B 4AM3A 2BA1D 4OO1F 1E3PA 1UDOA 2PO1A 5JEAA 3L7ZA
chains in the Genus database with same CATH superfamily
4JI8I 1Z0WA 2C38B 1Z59A 4MU3A 2AJ4A 2V8PA 4DR6I 4KHPE 4IZJA 4B3MI 2NN6A 4U3DA 3P3EA 4DUZI 4QNJA 2PNLA 3HJCA 2WNRA 3Q6MA 1Z0CA 4X64E 4DV2I 2UXCE 4AQYI 2F4VE 5EL9A 4JV5E 2GQ0A 2VQFE 2ZBKB 5EKWA 1ZM4A 1J5EE 1P42A 5C0XE 1USUA 2WW4A 2PO2A 4DR5I 4JG4A 1FWLA 4FW9A 5LMUI 3GMEA 4URLA 4LF7E 3P06A 4AIDA 1NZ0A 4GKJI 4GKKE 5L3JA 1XNRE 1NHIA 4JI7E 4AIMA 3K85A 5JEAC 3JAMQ 1H7UA 4EMDA 2V2QA 1Y5YA 3T1YE 1NHJA 1ZM3A 2NN6C 1FWKA 1USVA 1OYPA 3PS2A 2NPFA 2BA0D 3PRYA 5GMEA 3M6AA 3NZKA 1DARA 5K36D 1XHKA 4B3TI 4DR3I 1Z5CA 1OYRA 5IWAI 3CWVA 4OO1E 2WP8A 3OTOI 4IFDD 4X65E 2HFSA 1IBMI 5DRPA 1UEKA 4B3SI 4BA2A 1K47A 4LFCI 5DROA 4DV4I 1H73A 1FJGE 1ELOA 1N32I 3HULA 3B4TA 3UHMA 1N33I 2BM1A 4OX9E 2A2DA 1FKAE 2PO0A 2A2CA 2HK2A 3QT7A 4DV3I 4DPYA 2OI2A 1OJ4A 5LMNI 3GLLA 2JE6B 2BA1D 2Z5BA 4HACA 4LF8I 1E3PA 2ZM6I 2PO1A 4YHHE 4DV7I 3Q1QA 3QT6A 4BA1B 2GO3A 1D6TA 4J3DA 4DV5I 2HHHI 1XMOI 5K36E 4DUYE 3M85D 4DV1I 3V5RA 4MU0A 5IT9C 1EI1A 2IESA 5JEAD 4JI5I 4HACB 4B3RI 2C38A 4IFDE 4HY1A 5FLXC 4DR1I 4NXMI 4FW7A 2JEBB 1Z0GA 3LNUA 1E3HA 4X66E 2XEXA 4IZJD 2UUAI 2NN6D 4P7AA 2BM0A 2HK3A 4MU4A 4JI8E 4X62I 1YH8A 2CG9A 4FWHA 4DR6E 1OYSA 1ZXMA 4B3ME 1UDQA 2E1RA 4KQVA 2JEAB 4DUZE 4R1FA 3ZZUA 2O1TA 4DV2E 2GS8A 3J7AM 4AQYE 3PYFA 4DV6E 4K0KI 2V34A 4NBQA 4DR2I 4DR5E 1YHCA 2EFGA 4N3OA 2C37A 4MYUA 2J7KA 1KIJA 1HNZI 2UUBI 5LMUE 4FWGA 1HK7A 1PVGA 5C0XF 5JEAE 4GKJE 4JI3I 2UXDI 5C0XB 2UU9I 1Z0EA 3K1JA 2HKEA 2C39B 4JI0I 1HNWI 1R6MA 2UUCI 2C37B 1A6FA 2E5LI 3D4JA 2VESA 2ZITA 4LF4I 3M7NG 1BKNA 4LFAI 1XMQI 1I94I 2CVEA 4DPTA 1J5EI 4LF6I 4JI2I 1Y6ZA 3J80C 1MG7A 4JYAI 4LF9I 1U2RA 3ZM7A 5DRQA 4OO1A 4B3TE 4DR3E 5C0XC 4MQYA 5IWAE 3H1CA 3OTOE 2DEIA 1IBME 4LOMA 4YY3I 4DR4I 4B3SE 4LFCE 4USMA 4DV4E 4OO1F 1N32E 1ZM2A 3L7ZA 5DNLA 4OO1B 4DU7A 1EA6A 1N0VC 3U1YA 1HR0I 4LF5I 2JE6A 2PNZB 4WUCA 4DV3E 1Y4SA 2IERA 4NXNI 2UXBI 3WU4A 4BA1A 4ZVIA 2CZ9A 2O3ZA 5LMNE 3L7ZB 4HYMA 4JI6I 3CDIA 4M1KA 4LF8E 2ZM6E 4UTGA 5IT9Q 4DV7E 1IBLI 1N34I 3WU5A 2BR2B 2VQEI 4DV5E 2HHHE 1XMOE 2DEJA 2F1DA 5FLXQ 4FN5A 4HXZA 2JEBA 1PIEA 3HKMA 4DV1E 4OO1C 4FW4A 4JI4I 3H4LA 1VISA 4JI5E 4B3RE 4FW6A 4DR1E 4OKGA 5K36F 4NXME 1N36I 4JI1I 1HNXI 1B62A 5K36B 2UUAE 3F0NA 1IBKI 1Z5AA 2V2ZA 4RPFA 3WU3A 4X62E 2JEAA 4LFBI 4IFDF 3CDJA 4DU8A 4IFDB 2Z5EA 4QNKA 2R42A 1B63A 1R6LA 1XNQI 5C0XD 4DV0I 4DXLA 2HFUA 4DR7I 5BR8I 1RREA 4DPWA 2Z5CA 4IZKA 3ZZ0A 2IOPA 3PS3A 3ZKBA 3J7AG 4K0KE 1UDSA 4DR2E 1FNMA 3K17A 5C0XA 3ZKDA 4LCFA 3P3GA 1QZRA 2C39A 4LCGA 1HNZE 2UUBE 4MYTA 1Z0VA 2CGEA 2Z5CB 1MX0A 4IZKB 5GMDA 5A2QC 5DRRA 3KRNA 4IFDC 3T1HI 3V2UC 4JI3E 2UXDE 2UU9E 1RHYA 4P52A 4JI0E 1HNWE 5FWKA 4KHPI 2UUCE 3P3CA 5JEAF 2E5LE 3J81C 4LF4E 4UT4A 2BV3A 5JEAB 1S16A 4LFAE 2NN6E 1XMQE 4PRVA 1I94E 1ZM9A 1RR9A 4X64I 4DV6I 2NN6F 3J80Q 1UDNA 4IZJB 2UXCI 4PU9A 4OO1D 2NN6B 4AM3A 4LF6E 1Z5BA 4JI2E 2F4VI 1FI4A 4JV5I 2VQFI 2WNRB 1NHHA 2O1UA 4JYAE 4LF9E 4USKA 2BA1G 4GQUA 1N0UA 4LF7I 1H72C 2JT2A 3PYGA 4WUBA 4DPUA 4YY3E 4DR4E 4GKKI 2PO2B 3M85G 1Z0BA 1XNRI 4JI7I 4Z7CA 2GO4A 2PNZA 3B78A 2HKJA 3DD6A 1H7SA 5LL6R 2AE8A 2X36A 3T1YI 1S4EA 1N33E 4FWDA 1KTVA 1HR0E 4LF5E 2IOQA 3LTOA 4PRXA 4IS9A 3JAMC 4NXNE 2UXBE 2BR2A 4DPXA 4JI6E 2R3VA 4MDTA 1KVKA 2V2VA 1IBLE 2PNMA 1N34E 2VQEE 2LJPA 4XTJA 1VI7A 3B82A 4OZEA 5K36A 4X65I 1WUUA 2O1VA 5DNXA 4MU1A 4JI4E 3M7ND 1FJGI 3LPSA 2WP8B 4IFDA 1N36E 1XXEA 4JI1E 1HNXE 3GONA 3U1KA 1MU5A 1IBKE 4BA2B 4OX9I 4LFBE 1KKHA 3WU6A 2O1WA 1PKPA 1Y4UA 1Z0TA 4ED4A 4ISAA 1Y60A 1XNQE 2Q2EB 3PS1A 4DV0E 2PO0B 4DR7E 3B8HA 5BR8E 4LPFA 4YHHI 3PYEA 4LCHA 5ELWA 1ZXNA 3GCMA 4I3HA 3PYDA 4DUYI 2X7IA 3QT5A 2Z5BB 3ZZTA 3QT8A 1H74A 2J65A 5A2QQ 2PO1B 4FW5A 2VF3A 4U3BA 3P76A 5K36C 4FW3A 2BA0G 4X66I 4WUDA 3Q6NA 3T1HE 3J81Q 1UDOA 5JEAA 4Z7YA
chains in the Genus database with same CATH topology
4OO1B 4BA1B 2C38B 2WNRB 5K36E 2JE6A 3M85D 2NN6A 2BA1G 2PNZB 5JEAD 4BA1A 2C38A 2WNRA 4IFDE 3L7ZB 2PO2B 2JEBB 1E3HA 3CDIA 3M85G 2NN6D 2PNZA 3DD6A 2BR2B 5C0XE 2PO2A 1OYSA 2JEBA 1UDQA 3HKMA 4OO1C 2JEAB 3GMEA 4AIDA 2BR2A 5K36F 5K36B 4AIMA 2JEAA 5JEAC 4IFDF 3CDJA 4NBQA 4IFDB 2C37A 5K36A 2NN6C 1R6LA 5C0XD 3M7ND 5C0XF 5JEAE 1OYPA 2WP8B 4IFDA 5C0XB 2BA0D 2C39B 5K36D 3U1KA 4BA2B 1R6MA 2C37B 3M7NG 1OYRA 1UDSA 4OO1E 2WP8A 4IFDD 5C0XA 2C39A 4BA2A 4IFDC 3KRNA 2PO0B 3B4TA 3GCMA 4OO1A 5JEAF 5C0XC 2PO0A 2PO1B 5JEAB 3H1CA 2NN6E 3GLLA 5K36C 2NN6F 1UDNA 2BA0G 2JE6B 4OO1D 2NN6B 4AM3A 2BA1D 4OO1F 1E3PA 1UDOA 2PO1A 5JEAA 3L7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 B;  4BA1 B;  2C38 B;  2WNR B;  5K36 E;  2JE6 A;  3M85 D;  2NN6 A;  2BA1 G;  2PNZ B;  5JEA D;  4BA1 A;  2C38 A;  2WNR A;  4IFD E;  3L7Z B;  2PO2 B;  2JEB B;  1E3H A;  3CDI A;  3M85 G;  2NN6 D;  2PNZ A;  3DD6 A;  2BR2 B;  5C0X E;  2PO2 A;  1OYS A;  2JEB A;  1UDQ A;  3HKM A;  4OO1 C;  2JEA B;  3GME A;  4AID A;  2BR2 A;  5K36 F;  5K36 B;  4AIM A;  2JEA A;  5JEA C;  4IFD F;  3CDJ A;  4NBQ A;  4IFD B;  2C37 A;  5K36 A;  2NN6 C;  1R6L A;  5C0X D;  3M7N D;  5C0X F;  5JEA E;  1OYP A;  2WP8 B;  4IFD A;  5C0X B;  2BA0 D;  2C39 B;  5K36 D;  3U1K A;  4BA2 B;  1R6M A;  2C37 B;  3M7N G;  1OYR A;  1UDS A;  4OO1 E;  2WP8 A;  4IFD D;  5C0X A;  2C39 A;  4BA2 A;  4IFD C;  3KRN A;  2PO0 B;  3B4T A;  3GCM A;  4OO1 A;  5JEA F;  5C0X C;  2PO0 A;  2PO1 B;  5JEA B;  3H1C A;  2NN6 E;  3GLL A;  5K36 C;  2NN6 F;  1UDN A;  2BA0 G;  2JE6 B;  4OO1 D;  2NN6 B;  4AM3 A;  2BA1 D;  4OO1 F;  1E3P A;  1UDO A;  2PO1 A;  5JEA A;  3L7Z A; 
#chains in the Genus database with same CATH topology
 4JI8 I;  1Z0W A;  2C38 B;  1Z59 A;  4MU3 A;  2AJ4 A;  2V8P A;  4DR6 I;  4KHP E;  4IZJ A;  4B3M I;  2NN6 A;  4U3D A;  3P3E A;  4DUZ I;  4QNJ A;  2PNL A;  3HJC A;  2WNR A;  3Q6M A;  1Z0C A;  4X64 E;  4DV2 I;  2UXC E;  4AQY I;  2F4V E;  5EL9 A;  4JV5 E;  2GQ0 A;  2VQF E;  2ZBK B;  5EKW A;  1ZM4 A;  1J5E E;  1P42 A;  5C0X E;  1USU A;  2WW4 A;  2PO2 A;  4DR5 I;  4JG4 A;  1FWL A;  4FW9 A;  5LMU I;  3GME A;  4URL A;  4LF7 E;  3P06 A;  4AID A;  1NZ0 A;  4GKJ I;  4GKK E;  5L3J A;  1XNR E;  1NHI A;  4JI7 E;  4AIM A;  3K85 A;  5JEA C;  3JAM Q;  1H7U A;  4EMD A;  2V2Q A;  1Y5Y A;  3T1Y E;  1NHJ A;  1ZM3 A;  2NN6 C;  1FWK A;  1USV A;  1OYP A;  3PS2 A;  2NPF A;  2BA0 D;  3PRY A;  5GME A;  3M6A A;  3NZK A;  1DAR A;  5K36 D;  1XHK A;  4B3T I;  4DR3 I;  1Z5C A;  1OYR A;  5IWA I;  3CWV A;  4OO1 E;  2WP8 A;  3OTO I;  4IFD D;  4X65 E;  2HFS A;  1IBM I;  5DRP A;  1UEK A;  4B3S I;  4BA2 A;  1K47 A;  4LFC I;  5DRO A;  4DV4 I;  1H73 A;  1FJG E;  1ELO A;  1N32 I;  3HUL A;  3B4T A;  3UHM A;  1N33 I;  2BM1 A;  4OX9 E;  2A2D A;  1FKA E;  2PO0 A;  2A2C A;  2HK2 A;  3QT7 A;  4DV3 I;  4DPY A;  2OI2 A;  1OJ4 A;  5LMN I;  3GLL A;  2JE6 B;  2BA1 D;  2Z5B A;  4HAC A;  4LF8 I;  1E3P A;  2ZM6 I;  2PO1 A;  4YHH E;  4DV7 I;  3Q1Q A;  3QT6 A;  4BA1 B;  2GO3 A;  1D6T A;  4J3D A;  4DV5 I;  2HHH I;  1XMO I;  5K36 E;  4DUY E;  3M85 D;  4DV1 I;  3V5R A;  4MU0 A;  5IT9 C;  1EI1 A;  2IES A;  5JEA D;  4JI5 I;  4HAC B;  4B3R I;  2C38 A;  4IFD E;  4HY1 A;  5FLX C;  4DR1 I;  4NXM I;  4FW7 A;  2JEB B;  1Z0G A;  3LNU A;  1E3H A;  4X66 E;  2XEX A;  4IZJ D;  2UUA I;  2NN6 D;  4P7A A;  2BM0 A;  2HK3 A;  4MU4 A;  4JI8 E;  4X62 I;  1YH8 A;  2CG9 A;  4FWH A;  4DR6 E;  1OYS A;  1ZXM A;  4B3M E;  1UDQ A;  2E1R A;  4KQV A;  2JEA B;  4DUZ E;  4R1F A;  3ZZU A;  2O1T A;  4DV2 E;  2GS8 A;  3J7A M;  4AQY E;  3PYF A;  4DV6 E;  4K0K I;  2V34 A;  4NBQ A;  4DR2 I;  4DR5 E;  1YHC A;  2EFG A;  4N3O A;  2C37 A;  4MYU A;  2J7K A;  1KIJ A;  1HNZ I;  2UUB I;  5LMU E;  4FWG A;  1HK7 A;  1PVG A;  5C0X F;  5JEA E;  4GKJ E;  4JI3 I;  2UXD I;  5C0X B;  2UU9 I;  1Z0E A;  3K1J A;  2HKE A;  2C39 B;  4JI0 I;  1HNW I;  1R6M A;  2UUC I;  2C37 B;  1A6F A;  2E5L I;  3D4J A;  2VES A;  2ZIT A;  4LF4 I;  3M7N G;  1BKN A;  4LFA I;  1XMQ I;  1I94 I;  2CVE A;  4DPT A;  1J5E I;  4LF6 I;  4JI2 I;  1Y6Z A;  3J80 C;  1MG7 A;  4JYA I;  4LF9 I;  1U2R A;  3ZM7 A;  5DRQ A;  4OO1 A;  4B3T E;  4DR3 E;  5C0X C;  4MQY A;  5IWA E;  3H1C A;  3OTO E;  2DEI A;  1IBM E;  4LOM A;  4YY3 I;  4DR4 I;  4B3S E;  4LFC E;  4USM A;  4DV4 E;  4OO1 F;  1N32 E;  1ZM2 A;  3L7Z A;  5DNL A;  4OO1 B;  4DU7 A;  1EA6 A;  1N0V C;  3U1Y A;  1HR0 I;  4LF5 I;  2JE6 A;  2PNZ B;  4WUC A;  4DV3 E;  1Y4S A;  2IER A;  4NXN I;  2UXB I;  3WU4 A;  4BA1 A;  4ZVI A;  2CZ9 A;  2O3Z A;  5LMN E;  3L7Z B;  4HYM A;  4JI6 I;  3CDI A;  4M1K A;  4LF8 E;  2ZM6 E;  4UTG A;  5IT9 Q;  4DV7 E;  1IBL I;  1N34 I;  3WU5 A;  2BR2 B;  2VQE I;  4DV5 E;  2HHH E;  1XMO E;  2DEJ A;  2F1D A;  5FLX Q;  4FN5 A;  4HXZ A;  2JEB A;  1PIE A;  3HKM A;  4DV1 E;  4OO1 C;  4FW4 A;  4JI4 I;  3H4L A;  1VIS A;  4JI5 E;  4B3R E;  4FW6 A;  4DR1 E;  4OKG A;  5K36 F;  4NXM E;  1N36 I;  4JI1 I;  1HNX I;  1B62 A;  5K36 B;  2UUA E;  3F0N A;  1IBK I;  1Z5A A;  2V2Z A;  4RPF A;  3WU3 A;  4X62 E;  2JEA A;  4LFB I;  4IFD F;  3CDJ A;  4DU8 A;  4IFD B;  2Z5E A;  4QNK A;  2R42 A;  1B63 A;  1R6L A;  1XNQ I;  5C0X D;  4DV0 I;  4DXL A;  2HFU A;  4DR7 I;  5BR8 I;  1RRE A;  4DPW A;  2Z5C A;  4IZK A;  3ZZ0 A;  2IOP A;  3PS3 A;  3ZKB A;  3J7A G;  4K0K E;  1UDS A;  4DR2 E;  1FNM A;  3K17 A;  5C0X A;  3ZKD A;  4LCF A;  3P3G A;  1QZR A;  2C39 A;  4LCG A;  1HNZ E;  2UUB E;  4MYT A;  1Z0V A;  2CGE A;  2Z5C B;  1MX0 A;  4IZK B;  5GMD A;  5A2Q C;  5DRR A;  3KRN A;  4IFD C;  3T1H I;  3V2U C;  4JI3 E;  2UXD E;  2UU9 E;  1RHY A;  4P52 A;  4JI0 E;  1HNW E;  5FWK A;  4KHP I;  2UUC E;  3P3C A;  5JEA F;  2E5L E;  3J81 C;  4LF4 E;  4UT4 A;  2BV3 A;  5JEA B;  1S16 A;  4LFA E;  2NN6 E;  1XMQ E;  4PRV A;  1I94 E;  1ZM9 A;  1RR9 A;  4X64 I;  4DV6 I;  2NN6 F;  3J80 Q;  1UDN A;  4IZJ B;  2UXC I;  4PU9 A;  4OO1 D;  2NN6 B;  4AM3 A;  4LF6 E;  1Z5B A;  4JI2 E;  2F4V I;  1FI4 A;  4JV5 I;  2VQF I;  2WNR B;  1NHH A;  2O1U A;  4JYA E;  4LF9 E;  4USK A;  2BA1 G;  4GQU A;  1N0U A;  4LF7 I;  1H72 C;  2JT2 A;  3PYG A;  4WUB A;  4DPU A;  4YY3 E;  4DR4 E;  4GKK I;  2PO2 B;  3M85 G;  1Z0B A;  1XNR I;  4JI7 I;  4Z7C A;  2GO4 A;  2PNZ A;  3B78 A;  2HKJ A;  3DD6 A;  1H7S A;  5LL6 R;  2AE8 A;  2X36 A;  3T1Y I;  1S4E A;  1N33 E;  4FWD A;  1KTV A;  1HR0 E;  4LF5 E;  2IOQ A;  3LTO A;  4PRX A;  4IS9 A;  3JAM C;  4NXN E;  2UXB E;  2BR2 A;  4DPX A;  4JI6 E;  2R3V A;  4MDT A;  1KVK A;  2V2V A;  1IBL E;  2PNM A;  1N34 E;  2VQE E;  2LJP A;  4XTJ A;  1VI7 A;  3B82 A;  4OZE A;  5K36 A;  4X65 I;  1WUU A;  2O1V A;  5DNX A;  4MU1 A;  4JI4 E;  3M7N D;  1FJG I;  3LPS A;  2WP8 B;  4IFD A;  1N36 E;  1XXE A;  4JI1 E;  1HNX E;  3GON A;  3U1K A;  1MU5 A;  1IBK E;  4BA2 B;  4OX9 I;  4LFB E;  1KKH A;  3WU6 A;  2O1W A;  1PKP A;  1Y4U A;  1Z0T A;  4ED4 A;  4ISA A;  1Y60 A;  1XNQ E;  2Q2E B;  3PS1 A;  4DV0 E;  2PO0 B;  4DR7 E;  3B8H A;  5BR8 E;  4LPF A;  4YHH I;  3PYE A;  4LCH A;  5ELW A;  1ZXN A;  3GCM A;  4I3H A;  3PYD A;  4DUY I;  2X7I A;  3QT5 A;  2Z5B B;  3ZZT A;  3QT8 A;  1H74 A;  2J65 A;  5A2Q Q;  2PO1 B;  4FW5 A;  2VF3 A;  4U3B A;  3P76 A;  5K36 C;  4FW3 A;  2BA0 G;  4X66 I;  4WUD A;  3Q6N A;  3T1H E;  3J81 Q;  1UDO A;  5JEA A;  4Z7Y A; 
#chains in the Genus database with same CATH homology
 4OO1 B;  4BA1 B;  2C38 B;  2WNR B;  5K36 E;  2JE6 A;  3M85 D;  2NN6 A;  2BA1 G;  2PNZ B;  5JEA D;  4BA1 A;  2C38 A;  2WNR A;  4IFD E;  3L7Z B;  2PO2 B;  2JEB B;  1E3H A;  3CDI A;  3M85 G;  2NN6 D;  2PNZ A;  3DD6 A;  2BR2 B;  5C0X E;  2PO2 A;  1OYS A;  2JEB A;  1UDQ A;  3HKM A;  4OO1 C;  2JEA B;  3GME A;  4AID A;  2BR2 A;  5K36 F;  5K36 B;  4AIM A;  2JEA A;  5JEA C;  4IFD F;  3CDJ A;  4NBQ A;  4IFD B;  2C37 A;  5K36 A;  2NN6 C;  1R6L A;  5C0X D;  3M7N D;  5C0X F;  5JEA E;  1OYP A;  2WP8 B;  4IFD A;  5C0X B;  2BA0 D;  2C39 B;  5K36 D;  3U1K A;  4BA2 B;  1R6M A;  2C37 B;  3M7N G;  1OYR A;  1UDS A;  4OO1 E;  2WP8 A;  4IFD D;  5C0X A;  2C39 A;  4BA2 A;  4IFD C;  3KRN A;  2PO0 B;  3B4T A;  3GCM A;  4OO1 A;  5JEA F;  5C0X C;  2PO0 A;  2PO1 B;  5JEA B;  3H1C A;  2NN6 E;  3GLL A;  5K36 C;  2NN6 F;  1UDN A;  2BA0 G;  2JE6 B;  4OO1 D;  2NN6 B;  4AM3 A;  2BA1 D;  4OO1 F;  1E3P A;  1UDO A;  2PO1 A;  5JEA A;  3L7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...