5JEAA

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
299
structure length
299
Chain Sequence
AKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGEQIIVHPVNEREPVPLGILHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 77
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaA00
5JEAA 2JEBA 2PO1B 4OO1C 2BR2B 4AIMA 5C0XC 4OO1A 3KRNA 5C0XA 4IFDD 1R6LA 4BA2B 2PO1A 3M85D 1UDOA 2BR2A 5K36D 1E3PA 4NBQA 3M7ND 2BA1G 2NN6C 4IFDF 1E3HA 5JEAC 4IFDE 5K36F 4BA2A 1OYPA 5K36E 2C38B 2C39B 2PO2B 4IFDB 3CDIA 3U1KA 5K36B 2WP8A 3L7ZB 2C38A 2C39A 2PO2A 3CDJA 3GMEA 4BA1B 3B4TA 3L7ZA 2C37B 2NN6F 1R6MA 1UDQA 4OO1D 2BA0D 5C0XD 3DD6A 4BA1A 2JE6B 3M85G 4OO1F 2PNZB 3M7NG 5C0XF 4IFDC 2JEBB 4OO1E 4AM3A 5C0XE 4IFDA 5K36C 2NN6D 4OO1B 5K36A 5JEAD 2PNZA 2BA1D 4AIDA 5JEAF 2NN6E 2PO0B 1UDSA 3H1CA 5JEAE 2JEAB 3GCMA 3HKMA 2NN6B 2WNRB 3GLLA 1UDNA 5JEAB 2C37A 1OYRA 2PO0A 1OYSA 2JEAA 2WP8B 2JE6A 5C0XB 2NN6A 2WNRA 2BA0G
chains in the Genus database with same CATH superfamily
4KHPE 4LFBE 4DR2E 3QT5A 2E5LE 3B82A 4N3OA 2V2QA 4USKA 4DV6I 3J81C 4AIMA 5C0XC 4LF7I 2OI2A 2Z5BA 3P76A 4IFDD 1MX0A 1HK7A 1H72C 1DARA 2O1UA 4GKJI 1ZM3A 4MDTA 5K36D 4NBQA 1N36I 1N0UA 3K17A 4ISAA 4JI4E 1ELOA 3B8HA 3WU6A 5DNLA 2HFSA 3ZZTA 2F1DA 2HHHI 1B63A 4IFDB 3K85A 4OX9I 1FJGI 3K1JA 2UUCE 5K36B 1ZXNA 4JYAE 1N32E 4DV5E 2ZM6E 2F4VI 2XEXA 4R1FA 3Q6NA 1RHYA 4IZJD 1D6TA 3CDJA 4DU8A 1KTVA 1XNRE 4XTJA 4DV5I 4LF8E 1Z5AA 3PS3A 2UUBE 5DRPA 2X7IA 1R6MA 1J5EE 4OO1D 2BA0D 1VI7A 1XNRI 1ZM9A 2O1TA 1Z59A 5LMNI 4QNKA 4DPXA 3T1HE 2HK2A 2BA0G 3M85G 5GMDA 2PNZB 4JI1E 1J5EI 4DV3E 4IFDC 2A2DA 2AJ4A 4DU7A 3T1HI 5K36C 1YHCA 1S16A 3ZZ0A 3P3GA 2CGEA 2O1WA 4OO1B 4EMDA 5JEAD 4WUBA 4JV5E 4JI1I 4DV7E 4DV3I 4DPWA 4JI0I 2PNZA 1Z0CA 4KQVA 3UHMA 3ZZUA 1Y6ZA 5LMUE 4DV1I 3T1YE 4DUZI 2PO0B 4DR7E 1H7UA 1IBLI 4DV4E 4HY1A 3HKMA 3QT8A 1UDNA 5JEAB 1H7SA 2C37A 4B3TE 2O3ZA 5DRRA 4LF6E 4FN5A 1OYRA 2PO0A 4WUDA 2PNMA 4DV4I 2GS8A 2WP8B 5BR8E 4LOMA 5C0XB 1MU5A 4LCHA 5JEAA 1Z0EA 2JEBA 4OO1C 4U3DA 4LF4E 1XHKA 4LF9I 5C0XA 2UXBI 4MU1A 4YY3E 3HULA 2UXCI 1IBME 4JI6E 3M85D 1E3PA 3F0NA 3QT6A 5A2QQ 4DV6E 1IBKI 5JEAC 4LF7E 1IBMI 1PKPA 3QT7A 1OJ4A 1OYPA 4FW5A 1S4EA 3CDIA 2BV3A 4JI3I 4YHHE 4GKJE 1N36E 3PYDA 1B62A 1RR9A 3D4JA 4YHHI 3OTOI 3PRYA 1RREA 3ZKDA 2HHHE 4BA1B 3V2UC 4OX9E 4DUYI 2HFUA 1FJGE 5GMEA 3B4TA 1ZXMA 2J65A 1UDQA 4UTGA 4AQYI 5DROA 2F4VE 2BM1A 4NXMI 4BA1A 4GKKE 2JE6B 3P06A 1N33I 2Z5CB 2GQ0A 5DRQA 2LJPA 3M7NG 2NPFA 3M6AA 1Z5BA 4AM3A 1Y4UA 1HNZE 5C0XE 4Z7CA 4IFDA 4GKKI 2NN6D 3U1YA 3H4LA 5K36A 4FW6A 4FW9A 2CZ9A 2Z5CA 4DR3I 4X65I 5LMNE 1HNZI 3ZKBA 3P3CA 4DR6I 1U2RA 2IERA 4M1KA 4LFCI 1H73A 1KIJA 3V5RA 4IZJB 2NN6B 2WNRB 1I94I 2VQEI 3P3EA 4JI0E 2ZITA 1OYSA 2GO4A 1UEKA 4JI8I 4U3BA 4DR4I 4DV1E 1XMQI 4DUZE 4IZJA 2NN6A 2WNRA 1IBLE 2A2CA 2VF3A 4MYUA 2PO1B 2BR2B 3LNUA 4MQYA 2ZBKB 4K0KI 4PU9A 4OO1A 4IS9A 3KRNA 1KVKA 4LFAI 4B3SI 1R6LA 4BA2B 3GONA 2PO1A 2BR2A 1Z0WA 4DV0E 4HYMA 4X66E 3M7ND 2JT2A 2BA1G 2NN6C 4LF9E 4IFDE 4Z7YA 4B3ME 4BA2A 4DV0I 2UXBE 4X66I 4LF5I 5K36E 2UXCE 2C39B 2PO2B 4MU0A 1XMOE 4B3RI 2WP8A 4B3MI 2BM0A 1XNQI 2X36A 2EFGA 4FW7A 2UUAI 5IT9Q 4X64I 2C39A 1XMOI 2PO2A 4DR5E 1K47A 1Z0TA 1Z0GA 1ZM2A 4JI3E 5L3JA 4URLA 4DXLA 4QNJA 4DR5I 5ELWA 2VQFI 3DD6A 4HACB 3OTOE 1EI1A 1PIEA 1N34E 4JI7I 1HR0I 2UXDI 5C0XF 4OZEA 3PYEA 4DUYE 4OO1E 1FKAE 1FI4A 2Z5EA 2IOQA 4HACA 4AQYE 4PRXA 1N34I 1WUUA 4DR1I 4MU3A 4FWGA 4NXME 3WU4A 2IESA 2BA1D 3CWVA 1N33E 3J80Q 1FWLA 4WUCA 4OKGA 1HNWI 4LPFA 3B78A 4JG4A 1XXEA 3H1CA 3PS1A 4FW4A 4KHPI 5JEAE 2JEAB 4P7AA 4LFBI 4DR2I 2E5LI 3HJCA 2R42A 1N0VC 2V2VA 4FW3A 4DR3E 1Z0VA 4X65E 1P42A 4JI5E 2DEJA 2HK3A 4DR6E 2JEAA 2PNLA 1MG7A 4ZVIA 4P52A 2JE6A 4LFCE 4JI2E 2CVEA 2HKJA 2CG9A 4ED4A 4JI5I 3J7AM 2R3VA 5FLXQ 1I94E 4RPFA 2VQEE 3J7AG 5IT9C 4JI4I 2E1RA 4JI2I 2VESA 5EKWA 1NHIA 4JI8E 4DR4E 5A2QC 4DV2E 1EA6A 1Y4SA 1XMQE 2UUCI 1UDOA 4LCGA 4MU4A 3JAMQ 4JYAI 2IOPA 3PS2A 2J7KA 1N32I 1A6FA 4JI6I 2ZM6I 4IFDF 2Q2EB 1E3HA 2V2ZA 4DV2I 1FWKA 4K0KE 5K36F 4LFAE 4NXNE 2C38B 5FWKA 4B3SE 1NHHA 3U1KA 4LF8I 1H74A 2O1VA 2UUBI 1BKNA 2HKEA 1Z0BA 4NXNI 3J81Q 3L7ZB 2C38A 4LF5E 3GMEA 1NZ0A 1USUA 3WU5A 1NHJA 2AE8A 3J80C 4B3RE 2GO3A 3L7ZA 4FWDA 2C37B 2NN6F 1XNQE 1Y60A 5C0XD 2UUAE 4X64E 4JV5I 4DV7I 3NZKA 4HXZA 5EL9A 1VISA 4OO1F 5LMUI 2DEIA 4MYTA 3T1YI 1QZRA 1FNMA 1Y5YA 4I3HA 2JEBB 4IZKB 1USVA 4DR7I 4GQUA 1Z5CA 5LL6R 2VQFE 5FLXC 1ZM4A 2V34A 4B3TI 4LF6I 4PRVA 4AIDA 3Q6MA 4USMA 3PYGA 4IZKA 4JI7E 5IWAE 5DNXA 1HR0E 2UXDE 5JEAF 5BR8I 2NN6E 1UDSA 3LPSA 3LTOA 2WW4A 3GCMA 3JAMC 1YH8A 4X62E 1HNXE 4FWHA 2UU9E 4J3DA 3GLLA 4UT4A 4LCFA 5IWAI 4DR1E 1IBKE 3Q1QA 1KKHA 4LF4I 4DPYA 1PVGA 2V8PA 4YY3I 4X62I 3WU3A 1HNXI 2Z5BB 2UU9I 1HNWE 3ZM7A 4DPUA 4DPTA 3PYFA
chains in the Genus database with same CATH topology
5JEAA 2JEBA 2PO1B 4OO1C 2BR2B 4AIMA 5C0XC 4OO1A 3KRNA 5C0XA 4IFDD 1R6LA 4BA2B 2PO1A 3M85D 1UDOA 2BR2A 5K36D 1E3PA 4NBQA 3M7ND 2BA1G 2NN6C 4IFDF 1E3HA 5JEAC 4IFDE 5K36F 4BA2A 1OYPA 5K36E 2C38B 2C39B 2PO2B 4IFDB 3CDIA 3U1KA 5K36B 2WP8A 3L7ZB 2C38A 2C39A 2PO2A 3CDJA 3GMEA 4BA1B 3B4TA 3L7ZA 2C37B 2NN6F 1R6MA 1UDQA 4OO1D 2BA0D 5C0XD 3DD6A 4BA1A 2JE6B 3M85G 4OO1F 2PNZB 3M7NG 5C0XF 4IFDC 2JEBB 4OO1E 4AM3A 5C0XE 4IFDA 5K36C 2NN6D 4OO1B 5K36A 5JEAD 2PNZA 2BA1D 4AIDA 5JEAF 2NN6E 2PO0B 1UDSA 3H1CA 5JEAE 2JEAB 3GCMA 3HKMA 2NN6B 2WNRB 3GLLA 1UDNA 5JEAB 2C37A 1OYRA 2PO0A 1OYSA 2JEAA 2WP8B 2JE6A 5C0XB 2NN6A 2WNRA 2BA0G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA A;  2JEB A;  2PO1 B;  4OO1 C;  2BR2 B;  4AIM A;  5C0X C;  4OO1 A;  3KRN A;  5C0X A;  4IFD D;  1R6L A;  4BA2 B;  2PO1 A;  3M85 D;  1UDO A;  2BR2 A;  5K36 D;  1E3P A;  4NBQ A;  3M7N D;  2BA1 G;  2NN6 C;  4IFD F;  1E3H A;  5JEA C;  4IFD E;  5K36 F;  4BA2 A;  1OYP A;  5K36 E;  2C38 B;  2C39 B;  2PO2 B;  4IFD B;  3CDI A;  3U1K A;  5K36 B;  2WP8 A;  3L7Z B;  2C38 A;  2C39 A;  2PO2 A;  3CDJ A;  3GME A;  4BA1 B;  3B4T A;  3L7Z A;  2C37 B;  2NN6 F;  1R6M A;  1UDQ A;  4OO1 D;  2BA0 D;  5C0X D;  3DD6 A;  4BA1 A;  2JE6 B;  3M85 G;  4OO1 F;  2PNZ B;  3M7N G;  5C0X F;  4IFD C;  2JEB B;  4OO1 E;  4AM3 A;  5C0X E;  4IFD A;  5K36 C;  2NN6 D;  4OO1 B;  5K36 A;  5JEA D;  2PNZ A;  2BA1 D;  4AID A;  5JEA F;  2NN6 E;  2PO0 B;  1UDS A;  3H1C A;  5JEA E;  2JEA B;  3GCM A;  3HKM A;  2NN6 B;  2WNR B;  3GLL A;  1UDN A;  5JEA B;  2C37 A;  1OYR A;  2PO0 A;  1OYS A;  2JEA A;  2WP8 B;  2JE6 A;  5C0X B;  2NN6 A;  2WNR A;  2BA0 G; 
#chains in the Genus database with same CATH topology
 4KHP E;  4LFB E;  4DR2 E;  3QT5 A;  2E5L E;  3B82 A;  4N3O A;  2V2Q A;  4USK A;  4DV6 I;  3J81 C;  4AIM A;  5C0X C;  4LF7 I;  2OI2 A;  2Z5B A;  3P76 A;  4IFD D;  1MX0 A;  1HK7 A;  1H72 C;  1DAR A;  2O1U A;  4GKJ I;  1ZM3 A;  4MDT A;  5K36 D;  4NBQ A;  1N36 I;  1N0U A;  3K17 A;  4ISA A;  4JI4 E;  1ELO A;  3B8H A;  3WU6 A;  5DNL A;  2HFS A;  3ZZT A;  2F1D A;  2HHH I;  1B63 A;  4IFD B;  3K85 A;  4OX9 I;  1FJG I;  3K1J A;  2UUC E;  5K36 B;  1ZXN A;  4JYA E;  1N32 E;  4DV5 E;  2ZM6 E;  2F4V I;  2XEX A;  4R1F A;  3Q6N A;  1RHY A;  4IZJ D;  1D6T A;  3CDJ A;  4DU8 A;  1KTV A;  1XNR E;  4XTJ A;  4DV5 I;  4LF8 E;  1Z5A A;  3PS3 A;  2UUB E;  5DRP A;  2X7I A;  1R6M A;  1J5E E;  4OO1 D;  2BA0 D;  1VI7 A;  1XNR I;  1ZM9 A;  2O1T A;  1Z59 A;  5LMN I;  4QNK A;  4DPX A;  3T1H E;  2HK2 A;  2BA0 G;  3M85 G;  5GMD A;  2PNZ B;  4JI1 E;  1J5E I;  4DV3 E;  4IFD C;  2A2D A;  2AJ4 A;  4DU7 A;  3T1H I;  5K36 C;  1YHC A;  1S16 A;  3ZZ0 A;  3P3G A;  2CGE A;  2O1W A;  4OO1 B;  4EMD A;  5JEA D;  4WUB A;  4JV5 E;  4JI1 I;  4DV7 E;  4DV3 I;  4DPW A;  4JI0 I;  2PNZ A;  1Z0C A;  4KQV A;  3UHM A;  3ZZU A;  1Y6Z A;  5LMU E;  4DV1 I;  3T1Y E;  4DUZ I;  2PO0 B;  4DR7 E;  1H7U A;  1IBL I;  4DV4 E;  4HY1 A;  3HKM A;  3QT8 A;  1UDN A;  5JEA B;  1H7S A;  2C37 A;  4B3T E;  2O3Z A;  5DRR A;  4LF6 E;  4FN5 A;  1OYR A;  2PO0 A;  4WUD A;  2PNM A;  4DV4 I;  2GS8 A;  2WP8 B;  5BR8 E;  4LOM A;  5C0X B;  1MU5 A;  4LCH A;  5JEA A;  1Z0E A;  2JEB A;  4OO1 C;  4U3D A;  4LF4 E;  1XHK A;  4LF9 I;  5C0X A;  2UXB I;  4MU1 A;  4YY3 E;  3HUL A;  2UXC I;  1IBM E;  4JI6 E;  3M85 D;  1E3P A;  3F0N A;  3QT6 A;  5A2Q Q;  4DV6 E;  1IBK I;  5JEA C;  4LF7 E;  1IBM I;  1PKP A;  3QT7 A;  1OJ4 A;  1OYP A;  4FW5 A;  1S4E A;  3CDI A;  2BV3 A;  4JI3 I;  4YHH E;  4GKJ E;  1N36 E;  3PYD A;  1B62 A;  1RR9 A;  3D4J A;  4YHH I;  3OTO I;  3PRY A;  1RRE A;  3ZKD A;  2HHH E;  4BA1 B;  3V2U C;  4OX9 E;  4DUY I;  2HFU A;  1FJG E;  5GME A;  3B4T A;  1ZXM A;  2J65 A;  1UDQ A;  4UTG A;  4AQY I;  5DRO A;  2F4V E;  2BM1 A;  4NXM I;  4BA1 A;  4GKK E;  2JE6 B;  3P06 A;  1N33 I;  2Z5C B;  2GQ0 A;  5DRQ A;  2LJP A;  3M7N G;  2NPF A;  3M6A A;  1Z5B A;  4AM3 A;  1Y4U A;  1HNZ E;  5C0X E;  4Z7C A;  4IFD A;  4GKK I;  2NN6 D;  3U1Y A;  3H4L A;  5K36 A;  4FW6 A;  4FW9 A;  2CZ9 A;  2Z5C A;  4DR3 I;  4X65 I;  5LMN E;  1HNZ I;  3ZKB A;  3P3C A;  4DR6 I;  1U2R A;  2IER A;  4M1K A;  4LFC I;  1H73 A;  1KIJ A;  3V5R A;  4IZJ B;  2NN6 B;  2WNR B;  1I94 I;  2VQE I;  3P3E A;  4JI0 E;  2ZIT A;  1OYS A;  2GO4 A;  1UEK A;  4JI8 I;  4U3B A;  4DR4 I;  4DV1 E;  1XMQ I;  4DUZ E;  4IZJ A;  2NN6 A;  2WNR A;  1IBL E;  2A2C A;  2VF3 A;  4MYU A;  2PO1 B;  2BR2 B;  3LNU A;  4MQY A;  2ZBK B;  4K0K I;  4PU9 A;  4OO1 A;  4IS9 A;  3KRN A;  1KVK A;  4LFA I;  4B3S I;  1R6L A;  4BA2 B;  3GON A;  2PO1 A;  2BR2 A;  1Z0W A;  4DV0 E;  4HYM A;  4X66 E;  3M7N D;  2JT2 A;  2BA1 G;  2NN6 C;  4LF9 E;  4IFD E;  4Z7Y A;  4B3M E;  4BA2 A;  4DV0 I;  2UXB E;  4X66 I;  4LF5 I;  5K36 E;  2UXC E;  2C39 B;  2PO2 B;  4MU0 A;  1XMO E;  4B3R I;  2WP8 A;  4B3M I;  2BM0 A;  1XNQ I;  2X36 A;  2EFG A;  4FW7 A;  2UUA I;  5IT9 Q;  4X64 I;  2C39 A;  1XMO I;  2PO2 A;  4DR5 E;  1K47 A;  1Z0T A;  1Z0G A;  1ZM2 A;  4JI3 E;  5L3J A;  4URL A;  4DXL A;  4QNJ A;  4DR5 I;  5ELW A;  2VQF I;  3DD6 A;  4HAC B;  3OTO E;  1EI1 A;  1PIE A;  1N34 E;  4JI7 I;  1HR0 I;  2UXD I;  5C0X F;  4OZE A;  3PYE A;  4DUY E;  4OO1 E;  1FKA E;  1FI4 A;  2Z5E A;  2IOQ A;  4HAC A;  4AQY E;  4PRX A;  1N34 I;  1WUU A;  4DR1 I;  4MU3 A;  4FWG A;  4NXM E;  3WU4 A;  2IES A;  2BA1 D;  3CWV A;  1N33 E;  3J80 Q;  1FWL A;  4WUC A;  4OKG A;  1HNW I;  4LPF A;  3B78 A;  4JG4 A;  1XXE A;  3H1C A;  3PS1 A;  4FW4 A;  4KHP I;  5JEA E;  2JEA B;  4P7A A;  4LFB I;  4DR2 I;  2E5L I;  3HJC A;  2R42 A;  1N0V C;  2V2V A;  4FW3 A;  4DR3 E;  1Z0V A;  4X65 E;  1P42 A;  4JI5 E;  2DEJ A;  2HK3 A;  4DR6 E;  2JEA A;  2PNL A;  1MG7 A;  4ZVI A;  4P52 A;  2JE6 A;  4LFC E;  4JI2 E;  2CVE A;  2HKJ A;  2CG9 A;  4ED4 A;  4JI5 I;  3J7A M;  2R3V A;  5FLX Q;  1I94 E;  4RPF A;  2VQE E;  3J7A G;  5IT9 C;  4JI4 I;  2E1R A;  4JI2 I;  2VES A;  5EKW A;  1NHI A;  4JI8 E;  4DR4 E;  5A2Q C;  4DV2 E;  1EA6 A;  1Y4S A;  1XMQ E;  2UUC I;  1UDO A;  4LCG A;  4MU4 A;  3JAM Q;  4JYA I;  2IOP A;  3PS2 A;  2J7K A;  1N32 I;  1A6F A;  4JI6 I;  2ZM6 I;  4IFD F;  2Q2E B;  1E3H A;  2V2Z A;  4DV2 I;  1FWK A;  4K0K E;  5K36 F;  4LFA E;  4NXN E;  2C38 B;  5FWK A;  4B3S E;  1NHH A;  3U1K A;  4LF8 I;  1H74 A;  2O1V A;  2UUB I;  1BKN A;  2HKE A;  1Z0B A;  4NXN I;  3J81 Q;  3L7Z B;  2C38 A;  4LF5 E;  3GME A;  1NZ0 A;  1USU A;  3WU5 A;  1NHJ A;  2AE8 A;  3J80 C;  4B3R E;  2GO3 A;  3L7Z A;  4FWD A;  2C37 B;  2NN6 F;  1XNQ E;  1Y60 A;  5C0X D;  2UUA E;  4X64 E;  4JV5 I;  4DV7 I;  3NZK A;  4HXZ A;  5EL9 A;  1VIS A;  4OO1 F;  5LMU I;  2DEI A;  4MYT A;  3T1Y I;  1QZR A;  1FNM A;  1Y5Y A;  4I3H A;  2JEB B;  4IZK B;  1USV A;  4DR7 I;  4GQU A;  1Z5C A;  5LL6 R;  2VQF E;  5FLX C;  1ZM4 A;  2V34 A;  4B3T I;  4LF6 I;  4PRV A;  4AID A;  3Q6M A;  4USM A;  3PYG A;  4IZK A;  4JI7 E;  5IWA E;  5DNX A;  1HR0 E;  2UXD E;  5JEA F;  5BR8 I;  2NN6 E;  1UDS A;  3LPS A;  3LTO A;  2WW4 A;  3GCM A;  3JAM C;  1YH8 A;  4X62 E;  1HNX E;  4FWH A;  2UU9 E;  4J3D A;  3GLL A;  4UT4 A;  4LCF A;  5IWA I;  4DR1 E;  1IBK E;  3Q1Q A;  1KKH A;  4LF4 I;  4DPY A;  1PVG A;  2V8P A;  4YY3 I;  4X62 I;  3WU3 A;  1HNX I;  2Z5B B;  2UU9 I;  1HNW E;  3ZM7 A;  4DPU A;  4DPT A;  3PYF A; 
#chains in the Genus database with same CATH homology
 5JEA A;  2JEB A;  2PO1 B;  4OO1 C;  2BR2 B;  4AIM A;  5C0X C;  4OO1 A;  3KRN A;  5C0X A;  4IFD D;  1R6L A;  4BA2 B;  2PO1 A;  3M85 D;  1UDO A;  2BR2 A;  5K36 D;  1E3P A;  4NBQ A;  3M7N D;  2BA1 G;  2NN6 C;  4IFD F;  1E3H A;  5JEA C;  4IFD E;  5K36 F;  4BA2 A;  1OYP A;  5K36 E;  2C38 B;  2C39 B;  2PO2 B;  4IFD B;  3CDI A;  3U1K A;  5K36 B;  2WP8 A;  3L7Z B;  2C38 A;  2C39 A;  2PO2 A;  3CDJ A;  3GME A;  4BA1 B;  3B4T A;  3L7Z A;  2C37 B;  2NN6 F;  1R6M A;  1UDQ A;  4OO1 D;  2BA0 D;  5C0X D;  3DD6 A;  4BA1 A;  2JE6 B;  3M85 G;  4OO1 F;  2PNZ B;  3M7N G;  5C0X F;  4IFD C;  2JEB B;  4OO1 E;  4AM3 A;  5C0X E;  4IFD A;  5K36 C;  2NN6 D;  4OO1 B;  5K36 A;  5JEA D;  2PNZ A;  2BA1 D;  4AID A;  5JEA F;  2NN6 E;  2PO0 B;  1UDS A;  3H1C A;  5JEA E;  2JEA B;  3GCM A;  3HKM A;  2NN6 B;  2WNR B;  3GLL A;  1UDN A;  5JEA B;  2C37 A;  1OYR A;  2PO0 A;  1OYS A;  2JEA A;  2WP8 B;  2JE6 A;  5C0X B;  2NN6 A;  2WNR A;  2BA0 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...