1HNZI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzI00
4PRVA 4X65E 1IBKI 4DXLA 4DUYI 4KHPE 1IBME 1BKNA 4DR5E 1N33I 3B8HA 1ZXMA 4GKJI 2F4VE 2F4VI 1B62A 4P52A 4JI0E 1H73A 1J5EI 4DR4E 2LJPA 1FKAE 2UXCE 4HXZA 1ELOA 2V2VA 4X65I 2UXBE 4WUCA 1N0VC 3WU4A 2HHHE 4LFAE 4K0KI 1HR0I 2VQFE 4HACB 1MG7A 4XTJA 1H74A 4DR2E 4B3RI 4NXMI 4LFBE 4B3SE 4JI6I 1K47A 1MU5A 4LF5I 1Z0GA 1FNMA 4DV0E 1KVKA 2BM0A 1RREA 5GMDA 4LF5E 3QT8A 1FJGE 5LMUI 3J81C 4LFAI 4X62E 1N32I 3J80C 4DUZI 4HACA 4DPWA 3ZZ0A 1HR0E 1D6TA 4B3SI 2HK2A 3WU6A 1EA6A 4LF4I 1XNRE 4I3HA 1Z0TA 4DR4I 3OTOI 1HNXE 4JI1E 2Q2EB 4LFCE 2UUBE 4B3TE 4DU8A 2VQFI 1Z0BA 4DUYE 3H4LA 1N34I 4DV5I 4JI5I 4FWGA 5IT9Q 1IBLI 2V34A 3T1HI 2UXDE 3LPSA 1KIJA 2E1RA 1A6FA 3T1YE 1IBLE 4DR1E 4OX9E 3J7AM 2UUCI 2UU9I 1HNXI 1ZM9A 4JV5E 4DPYA 3PYEA 4RPFA 3ZKDA 1ZM3A 1WUUA 1NHIA 2WW4A 3ZZUA 4DV6E 1Z0CA 4X62I 1XHKA 1Z5AA 4DV4I 2ZITA 1XMQE 1Z0VA 5IT9C 2A2DA 3F0NA 4NXNI 4X64E 4JI7I 4LF9E 3B78A 4DR3I 3JAMQ 4URLA 1N0UA 2CZ9A 1S16A 4DV0I 3GONA 5A2QQ 3QT5A 2VQEI 5A2QC 4DUZE 2ZM6I 1N32E 1Z0EA 3ZM7A 2OI2A 1UEKA 1OJ4A 4DV7I 1XMOE 1VISA 4B3RE 1XNQE 4DR7I 4DV6I 4DR7E 4WUBA 4DV4E 4FWDA 1FWKA 2HK3A 4Z7CA 1NZ0A 2BV3A 4DR3E 2EFGA 1J5EE 4YHHE 4JI0I 2UUCE 4JI4I 3J80Q 2XEXA 3WU5A 1Z0WA 4LF6I 4JI8E 4DV2I 2VF3A 1HNZI 2HHHI 4PRXA 2HFUA 4JG4A 1IBKE 1N34E 1NHHA 4DV1I 4JYAE 4GKJE 4DV5E 2DEIA 4Z7YA 4JI2I 3LNUA 4OX9I 1S4EA 4JI1I 2HFSA 3PYFA 4DR6I 3V2UC 1Z59A 2UU9E 4FW9A 4P7AA 1H7SA 4ZVIA 3D4JA 4DV3I 1IBMI 2V8PA 1N33E 5L3JA 4MYTA 5GMEA 3M6AA 1PKPA 1NHJA 1I94I 4X66I 3J7AG 4B3MI 4EMDA 1U2RA 4USKA 5LL6R 4JI4E 1HNZE 2X7IA 1RR9A 2X36A 3OTOE 3ZZTA 2V2ZA 1H72C 2DEJA 4HYMA 4GKKE 1XMQI 4JI6E 4NXME 4LFBI 1I94E 4X64I 3Q1QA 1ZXNA 2UUAI 2ZBKB 3LTOA 2HKJA 4R1FA 4AQYI 4UT4A 1ZM2A 4X66E 4KQVA 2HKEA 4K0KE 2UXCI 5LMUE 3V5RA 2E5LE 1HNWE 1PIEA 5LMNI 2VQEE 5IWAI 2R42A 4YY3E 1Z5CA 3K1JA 1N36E 3T1HE 1PVGA 1H7UA 3ZKBA 4JI5E 4DR1I 1FWLA 2AJ4A 5FLXQ 4JI3E 4MYUA 4LF8I 4WUDA 3PYGA 3QT7A 1QZRA 4DU7A 3WU3A 4JI2E 4JI8I 2BM1A 4DV1E 4JYAI 3J81Q 4DV3E 4DR5I 4KHPI 4YY3I 3K17A 1ZM4A 1XNRI 4LF8E 2A2CA 2V2QA 4YHHI 4AQYE 1Z5BA 2E5LI 2UUAE 1HNWI 3PYDA 3HULA 4JI3I 5FLXC 4DPTA 4DV7E 1B63A 1FJGI 2UUBI 4B3TI 4LFCI 4LF7E 1XNQI 3CWVA 5IWAE 4DV2E 5LMNE 4LF6E 1N36I 1XMOI 4ED4A 2J7KA 4LF4E 4USMA 1MX0A 2R3VA 5BR8E 3JAMC 4HY1A 4LF9I 2NPFA 4JI7E 1FI4A 4M1KA 5BR8I 4B3ME 2UXBI 1KKHA 4JV5I 4GKKI 2ZM6E 3B82A 4PU9A 4DR2I 4FWHA 4FN5A 1DARA 4LF7I 4NXNE 1KTVA 4DPUA 2UXDI 4DR6E 4UTGA 3QT6A 4DPXA 2GS8A 3T1YI 1EI1A
chains in the Genus database with same CATH superfamily
4PRVA 1UDNA 4MDTA 4OZEA 4X65E 4IFDA 1IBKI 3GCMA 2C38A 3HKMA 1UDQA 4DXLA 4DUYI 4KHPE 1IBME 1BKNA 3NZKA 4DR5E 1N33I 3B8HA 1ZXMA 4GKJI 2F4VE 2F4VI 4ISAA 1B62A 4IZJA 4P52A 2JE6A 2C39B 2C38B 4LCGA 4JI0E 1Y4UA 3K85A 1H73A 2IOPA 2AE8A 1J5EI 3KRNA 4DR4E 2LJPA 1FKAE 2UXCE 4HXZA 4U3DA 1ELOA 3CDJA 2V2VA 4BA1A 4X65I 2UXBE 4WUCA 1N0VC 3WU4A 2Z5BB 2HHHE 4LFAE 4K0KI 1HR0I 2VQFE 2JEBB 4HACB 1E3HA 1MG7A 4XTJA 1H74A 4DR2E 4B3RI 4NXMI 4LFBE 4B3SE 4JI6I 1K47A 2NN6E 1YHCA 1MU5A 4LF5I 4MU0A 1Z0GA 1FNMA 2JEAA 2JT2A 4DV0E 1KVKA 2BM0A 1RREA 5GMDA 4LF5E 3QT8A 2PNZB 5LMUI 1FJGE 3J81C 5DRRA 4LFAI 4X62E 1N32I 3J80C 4DUZI 4HACA 1RHYA 4DPWA 3ZZ0A 1HR0E 3GMEA 1D6TA 2O1UA 4B3SI 2HK2A 3WU6A 4OO1E 1EA6A 2CGEA 5DRQA 4BA1B 4LF4I 1XNRE 4I3HA 4BA2B 4NBQA 1Z0TA 2CVEA 4DR4I 3OTOI 2WP8B 1HNXE 2WP8A 2Z5CA 5K36C 4JI1E 4OKGA 2Q2EB 2NN6D 4LFCE 2UUBE 4B3TE 4DU8A 4LPFA 3P3EA 1USUA 2VQFI 1Y4SA 1Z0BA 1VI7A 4DUYE 3H4LA 4LCHA 1N34I 2BA1D 4FW4A 4DV5I 4JI5I 4FWGA 5IT9Q 1OYRA 1IBLI 4MQYA 2F1DA 5DNXA 2V34A 5DRPA 3T1HI 5JEAE 2UXDE 3LPSA 1KIJA 2E1RA 1A6FA 3T1YE 5JEAD 1IBLE 4DR1E 4OX9E 3J7AM 4FW5A 2J65A 2UUCI 2UU9I 4OO1D 1HNXI 2CG9A 5C0XD 4OO1B 4MU3A 1ZM9A 4JV5E 4DPYA 3PYEA 4RPFA 3ZKDA 1ZM3A 1WUUA 1NHIA 2WW4A 3ZZUA 4DV6E 1UDOA 1Z0CA 4X62I 1XHKA 1Z5AA 5C0XB 4AIMA 4DV4I 3PRYA 2ZITA 1XMQE 1Z0VA 3Q6MA 5C0XC 5IT9C 2C37B 2A2DA 3F0NA 4NXNI 2PNMA 4X64E 4LOMA 4JI7I 4LF9E 1YH8A 3B78A 3P06A 4DR3I 3JAMQ 4URLA 2O1TA 1N0UA 2CZ9A 1S16A 5C0XF 4DV0I 3GONA 5A2QQ 3QT5A 2PO2B 2VQEI 5A2QC 4DUZE 4IFDE 2ZM6I 1N32E 1Z0EA 3ZM7A 2OI2A 1UEKA 1OJ4A 4DV7I 1XMOE 1VISA 2WNRB 4B3RE 1XNQE 4IZJB 3DD6A 1P42A 4U3BA 4DV6I 4DR7I 4DR7E 4WUBA 4DV4E 4FWDA 4BA2A 1FWKA 2NN6A 2VESA 2HK3A 4Z7CA 1NZ0A 2BV3A 4DR3E 2EFGA 1J5EE 2IOQA 4YHHE 2BA0D 2PO0A 4JI0I 2UUCE 5EL9A 4JI4I 3J80Q 2NN6B 2XEXA 3WU5A 1Z0WA 4LF6I 4JI8E 4DV2I 2VF3A 1HNZI 3GLLA 2HHHI 4QNJA 4AM3A 4PRXA 2HFUA 4JG4A 5EKWA 1IBKE 1N34E 1OYPA 1NHHA 4DV1I 1Y6ZA 4JYAE 4GKJE 5JEAA 4DV5E 2DEIA 4Z7YA 4JI2I 5JEAF 3LNUA 4OX9I 1S4EA 4JI1I 2HFSA 3PYFA 4DR6I 3M85D 4OO1F 3V2UC 1Z59A 2UU9E 3PS2A 4FW9A 4P7AA 1H7SA 4ZVIA 3D4JA 4DV3I 2GO3A 1IBMI 2V8PA 1N33E 3U1YA 2C39A 5L3JA 4MYTA 2Z5CB 4MU4A 5DROA 5GMEA 3CDIA 4OO1A 3M6AA 1PKPA 1NHJA 1I94I 4X66I 2BR2A 3J7AG 4B3MI 1UDSA 4EMDA 1U2RA 4USKA 5LL6R 4JI4E 1HNZE 1HK7A 2IERA 2X7IA 1RR9A 2X36A 3OTOE 3ZZTA 2V2ZA 3Q6NA 1H72C 2DEJA 4HYMA 4N3OA 4IS9A 4IZKB 2PNZA 4GKKE 1XMQI 5C0XA 2BR2B 4JI6E 4NXME 2PO1A 4LFBI 1I94E 4X64I 2BA0G 2GO4A 3Q1QA 1ZXNA 2UUAI 2ZBKB 1E3PA 3LTOA 2HKJA 4R1FA 4AQYI 1XXEA 4UT4A 1ZM2A 4QNKA 4X66E 4KQVA 2HKEA 1R6MA 2PO1B 5LMUE 4K0KE 2UXCI 2JE6B 4IFDB 3V5RA 2E5LE 1HNWE 1PIEA 5LMNI 2VQEE 5IWAI 2R42A 2PNLA 1Y60A 4YY3E 1Z5CA 2Z5BA 3L7ZB 4FW3A 5K36A 3K1JA 1N36E 4FW6A 3M7NG 3T1HE 2IESA 1PVGA 1H7UA 4LCFA 3ZKBA 4JI5E 2C37A 4FW7A 4DR1I 1FWLA 2AJ4A 3L7ZA 3UHMA 5FLXQ 4JI3E 5K36D 4MYUA 4LF8I 5JEAB 4WUDA 3PYGA 3QT7A 1QZRA 4DU7A 3WU3A 4JI2E 2PO2A 3H1CA 4AIDA 2GQ0A 4JI8I 2BM1A 4DV1E 4JYAI 3J81Q 4DV3E 4DR5I 4GQUA 4KHPI 2JEBA 4YY3I 4IZJD 4IFDD 5JEAC 3K17A 1ZM4A 1XNRI 4IZKA 5FWKA 4LF8E 2O3ZA 1USVA 2A2CA 3U1KA 5K36F 2V2QA 2PO0B 4YHHI 4AQYE 1Z5BA 2E5LI 2UUAE 1HNWI 4J3DA 3PYDA 5ELWA 3HULA 4JI3I 5FLXC 4MU1A 4DPTA 5K36E 4DV7E 1B63A 1FJGI 3HJCA 2UUBI 4B3TI 4LFCI 2JEAB 4LF7E 3PS3A 5DNLA 3CWVA 5IWAE 4DV2E 1XNQI 3P76A 5LMNE 2BA1G 4IFDC 4LF6E 1Y5YA 1XMOI 1N36I 4ED4A 4OO1C 2J7KA 4LF4E 4USMA 1MX0A 2R3VA 5BR8E 3JAMC 3B4TA 4HY1A 4LF9I 5C0XE 2NPFA 4JI7E 2O1VA 1FI4A 4M1KA 5BR8I 4B3ME 4IFDF 2UXBI 3M85G 5K36B 2Z5EA 1KKHA 2WNRA 4JV5I 4GKKI 1OYSA 2ZM6E 3B82A 4PU9A 1R6LA 4DR2I 2NN6C 2O1WA 4FWHA 4FN5A 1DARA 4LF7I 4NXNE 1KTVA 3PS1A 3M7ND 4DPUA 2UXDI 4DR6E 4UTGA 3QT6A 4DPXA 2GS8A 3P3CA 3T1YI 1EI1A 3P3GA 2NN6F
chains in the Genus database with same CATH topology
4PRVA 4X65E 1IBKI 4DXLA 4DUYI 4KHPE 1IBME 1BKNA 4DR5E 1N33I 3B8HA 1ZXMA 4GKJI 2F4VE 2F4VI 1B62A 4IZJA 4P52A 4JI0E 1Y4UA 3K85A 1H73A 2IOPA 1J5EI 4DR4E 2LJPA 1FKAE 2UXCE 4HXZA 1ELOA 2V2VA 4X65I 2UXBE 4WUCA 1N0VC 3WU4A 2Z5BB 2HHHE 4LFAE 4K0KI 1HR0I 2VQFE 4HACB 1MG7A 4XTJA 1H74A 4DR2E 4B3RI 4NXMI 4LFBE 4B3SE 4JI6I 1K47A 1MU5A 4LF5I 1Z0GA 1FNMA 4DV0E 1KVKA 2BM0A 1RREA 5GMDA 4LF5E 3QT8A 1FJGE 5LMUI 3J81C 4LFAI 4X62E 1N32I 3J80C 4DUZI 4HACA 4DPWA 3ZZ0A 1HR0E 1D6TA 2O1UA 4B3SI 2HK2A 3WU6A 1EA6A 2CGEA 4LF4I 1XNRE 4I3HA 1Z0TA 4DR4I 3OTOI 1HNXE 2Z5CA 4JI1E 2Q2EB 4LFCE 2UUBE 4B3TE 4DU8A 1USUA 2VQFI 1Y4SA 1Z0BA 4DUYE 3H4LA 1N34I 4DV5I 4JI5I 4FWGA 5IT9Q 1IBLI 2V34A 3T1HI 2UXDE 3LPSA 1KIJA 2E1RA 1A6FA 3T1YE 1IBLE 4DR1E 4OX9E 3J7AM 2UUCI 2UU9I 1HNXI 2CG9A 1ZM9A 4JV5E 4DPYA 3PYEA 4RPFA 3ZKDA 1ZM3A 1WUUA 1NHIA 2WW4A 3ZZUA 4DV6E 1Z0CA 4X62I 1XHKA 1Z5AA 4DV4I 3PRYA 2ZITA 1XMQE 1Z0VA 3Q6MA 5IT9C 2A2DA 3F0NA 4NXNI 2PNMA 4X64E 4JI7I 4LF9E 3B78A 3P06A 4DR3I 3JAMQ 4URLA 2O1TA 1N0UA 2CZ9A 1S16A 4DV0I 3GONA 5A2QQ 3QT5A 2VQEI 5A2QC 4DUZE 2ZM6I 1N32E 1Z0EA 3ZM7A 2OI2A 1UEKA 1OJ4A 4DV7I 1XMOE 1VISA 4B3RE 1XNQE 4IZJB 4DR7I 4DV6I 4DR7E 4WUBA 4DV4E 4FWDA 1FWKA 2HK3A 4Z7CA 1NZ0A 2BV3A 4DR3E 2EFGA 1J5EE 2IOQA 4YHHE 4JI0I 2UUCE 4JI4I 3J80Q 2XEXA 3WU5A 1Z0WA 4LF6I 4JI8E 4DV2I 2VF3A 1HNZI 2HHHI 4PRXA 2HFUA 4JG4A 1IBKE 1N34E 1NHHA 4DV1I 1Y6ZA 4JYAE 4GKJE 4DV5E 2DEIA 4Z7YA 4JI2I 3LNUA 4OX9I 1S4EA 4JI1I 2HFSA 3PYFA 4DR6I 3V2UC 1Z59A 2UU9E 4FW9A 4P7AA 1H7SA 4ZVIA 3D4JA 4DV3I 1IBMI 2V8PA 1N33E 5L3JA 4MYTA 2Z5CB 5GMEA 3M6AA 1PKPA 1NHJA 1I94I 4X66I 3J7AG 4B3MI 4EMDA 1U2RA 4USKA 5LL6R 4JI4E 1HNZE 1HK7A 2X7IA 1RR9A 2X36A 3OTOE 3ZZTA 2V2ZA 3Q6NA 1H72C 2DEJA 4HYMA 4N3OA 4IZKB 4GKKE 1XMQI 4JI6E 4NXME 4LFBI 1I94E 4X64I 3Q1QA 1ZXNA 2UUAI 2ZBKB 3LTOA 2HKJA 4R1FA 4AQYI 4UT4A 1ZM2A 4X66E 4KQVA 2HKEA 4K0KE 2UXCI 5LMUE 3V5RA 2E5LE 1HNWE 1PIEA 5LMNI 2VQEE 5IWAI 2R42A 2PNLA 4YY3E 1Z5CA 2Z5BA 3K1JA 1N36E 3T1HE 1PVGA 1H7UA 3ZKBA 4JI5E 4DR1I 1FWLA 2AJ4A 5FLXQ 4JI3E 4MYUA 4LF8I 4WUDA 3PYGA 3QT7A 1QZRA 4DU7A 3WU3A 4JI2E 2GQ0A 4JI8I 2BM1A 4DV1E 4JYAI 3J81Q 4DV3E 4DR5I 4KHPI 4YY3I 4IZJD 3K17A 1ZM4A 1XNRI 4IZKA 5FWKA 4LF8E 1USVA 2A2CA 2V2QA 4YHHI 4AQYE 1Z5BA 2E5LI 2UUAE 1HNWI 3PYDA 3HULA 4JI3I 5FLXC 4DPTA 4DV7E 1B63A 1FJGI 3HJCA 2UUBI 4B3TI 4LFCI 4LF7E 1XNQI 3CWVA 5IWAE 4DV2E 5LMNE 4LF6E 1N36I 1XMOI 4ED4A 2J7KA 4LF4E 4USMA 1MX0A 2R3VA 5BR8E 3JAMC 4HY1A 4LF9I 2NPFA 4JI7E 2O1VA 1FI4A 4M1KA 5BR8I 4B3ME 2UXBI 2Z5EA 1KKHA 4JV5I 4GKKI 2ZM6E 3B82A 4PU9A 4DR2I 2O1WA 4FWHA 4FN5A 1DARA 4LF7I 4NXNE 1KTVA 4DPUA 2UXDI 4DR6E 4UTGA 3QT6A 4DPXA 2GS8A 3T1YI 1EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PRV A;  4X65 E;  1IBK I;  4DXL A;  4DUY I;  4KHP E;  1IBM E;  1BKN A;  4DR5 E;  1N33 I;  3B8H A;  1ZXM A;  4GKJ I;  2F4V E;  2F4V I;  1B62 A;  4P52 A;  4JI0 E;  1H73 A;  1J5E I;  4DR4 E;  2LJP A;  1FKA E;  2UXC E;  4HXZ A;  1ELO A;  2V2V A;  4X65 I;  2UXB E;  4WUC A;  1N0V C;  3WU4 A;  2HHH E;  4LFA E;  4K0K I;  1HR0 I;  2VQF E;  4HAC B;  1MG7 A;  4XTJ A;  1H74 A;  4DR2 E;  4B3R I;  4NXM I;  4LFB E;  4B3S E;  4JI6 I;  1K47 A;  1MU5 A;  4LF5 I;  1Z0G A;  1FNM A;  4DV0 E;  1KVK A;  2BM0 A;  1RRE A;  5GMD A;  4LF5 E;  3QT8 A;  1FJG E;  5LMU I;  3J81 C;  4LFA I;  4X62 E;  1N32 I;  3J80 C;  4DUZ I;  4HAC A;  4DPW A;  3ZZ0 A;  1HR0 E;  1D6T A;  4B3S I;  2HK2 A;  3WU6 A;  1EA6 A;  4LF4 I;  1XNR E;  4I3H A;  1Z0T A;  4DR4 I;  3OTO I;  1HNX E;  4JI1 E;  2Q2E B;  4LFC E;  2UUB E;  4B3T E;  4DU8 A;  2VQF I;  1Z0B A;  4DUY E;  3H4L A;  1N34 I;  4DV5 I;  4JI5 I;  4FWG A;  5IT9 Q;  1IBL I;  2V34 A;  3T1H I;  2UXD E;  3LPS A;  1KIJ A;  2E1R A;  1A6F A;  3T1Y E;  1IBL E;  4DR1 E;  4OX9 E;  3J7A M;  2UUC I;  2UU9 I;  1HNX I;  1ZM9 A;  4JV5 E;  4DPY A;  3PYE A;  4RPF A;  3ZKD A;  1ZM3 A;  1WUU A;  1NHI A;  2WW4 A;  3ZZU A;  4DV6 E;  1Z0C A;  4X62 I;  1XHK A;  1Z5A A;  4DV4 I;  2ZIT A;  1XMQ E;  1Z0V A;  5IT9 C;  2A2D A;  3F0N A;  4NXN I;  4X64 E;  4JI7 I;  4LF9 E;  3B78 A;  4DR3 I;  3JAM Q;  4URL A;  1N0U A;  2CZ9 A;  1S16 A;  4DV0 I;  3GON A;  5A2Q Q;  3QT5 A;  2VQE I;  5A2Q C;  4DUZ E;  2ZM6 I;  1N32 E;  1Z0E A;  3ZM7 A;  2OI2 A;  1UEK A;  1OJ4 A;  4DV7 I;  1XMO E;  1VIS A;  4B3R E;  1XNQ E;  4DR7 I;  4DV6 I;  4DR7 E;  4WUB A;  4DV4 E;  4FWD A;  1FWK A;  2HK3 A;  4Z7C A;  1NZ0 A;  2BV3 A;  4DR3 E;  2EFG A;  1J5E E;  4YHH E;  4JI0 I;  2UUC E;  4JI4 I;  3J80 Q;  2XEX A;  3WU5 A;  1Z0W A;  4LF6 I;  4JI8 E;  4DV2 I;  2VF3 A;  1HNZ I;  2HHH I;  4PRX A;  2HFU A;  4JG4 A;  1IBK E;  1N34 E;  1NHH A;  4DV1 I;  4JYA E;  4GKJ E;  4DV5 E;  2DEI A;  4Z7Y A;  4JI2 I;  3LNU A;  4OX9 I;  1S4E A;  4JI1 I;  2HFS A;  3PYF A;  4DR6 I;  3V2U C;  1Z59 A;  2UU9 E;  4FW9 A;  4P7A A;  1H7S A;  4ZVI A;  3D4J A;  4DV3 I;  1IBM I;  2V8P A;  1N33 E;  5L3J A;  4MYT A;  5GME A;  3M6A A;  1PKP A;  1NHJ A;  1I94 I;  4X66 I;  3J7A G;  4B3M I;  4EMD A;  1U2R A;  4USK A;  5LL6 R;  4JI4 E;  1HNZ E;  2X7I A;  1RR9 A;  2X36 A;  3OTO E;  3ZZT A;  2V2Z A;  1H72 C;  2DEJ A;  4HYM A;  4GKK E;  1XMQ I;  4JI6 E;  4NXM E;  4LFB I;  1I94 E;  4X64 I;  3Q1Q A;  1ZXN A;  2UUA I;  2ZBK B;  3LTO A;  2HKJ A;  4R1F A;  4AQY I;  4UT4 A;  1ZM2 A;  4X66 E;  4KQV A;  2HKE A;  4K0K E;  2UXC I;  5LMU E;  3V5R A;  2E5L E;  1HNW E;  1PIE A;  5LMN I;  2VQE E;  5IWA I;  2R42 A;  4YY3 E;  1Z5C A;  3K1J A;  1N36 E;  3T1H E;  1PVG A;  1H7U A;  3ZKB A;  4JI5 E;  4DR1 I;  1FWL A;  2AJ4 A;  5FLX Q;  4JI3 E;  4MYU A;  4LF8 I;  4WUD A;  3PYG A;  3QT7 A;  1QZR A;  4DU7 A;  3WU3 A;  4JI2 E;  4JI8 I;  2BM1 A;  4DV1 E;  4JYA I;  3J81 Q;  4DV3 E;  4DR5 I;  4KHP I;  4YY3 I;  3K17 A;  1ZM4 A;  1XNR I;  4LF8 E;  2A2C A;  2V2Q A;  4YHH I;  4AQY E;  1Z5B A;  2E5L I;  2UUA E;  1HNW I;  3PYD A;  3HUL A;  4JI3 I;  5FLX C;  4DPT A;  4DV7 E;  1B63 A;  1FJG I;  2UUB I;  4B3T I;  4LFC I;  4LF7 E;  1XNQ I;  3CWV A;  5IWA E;  4DV2 E;  5LMN E;  4LF6 E;  1N36 I;  1XMO I;  4ED4 A;  2J7K A;  4LF4 E;  4USM A;  1MX0 A;  2R3V A;  5BR8 E;  3JAM C;  4HY1 A;  4LF9 I;  2NPF A;  4JI7 E;  1FI4 A;  4M1K A;  5BR8 I;  4B3M E;  2UXB I;  1KKH A;  4JV5 I;  4GKK I;  2ZM6 E;  3B82 A;  4PU9 A;  4DR2 I;  4FWH A;  4FN5 A;  1DAR A;  4LF7 I;  4NXN E;  1KTV A;  4DPU A;  2UXD I;  4DR6 E;  4UTG A;  3QT6 A;  4DPX A;  2GS8 A;  3T1Y I;  1EI1 A; 
#chains in the Genus database with same CATH topology
 4PRV A;  1UDN A;  4MDT A;  4OZE A;  4X65 E;  4IFD A;  1IBK I;  3GCM A;  2C38 A;  3HKM A;  1UDQ A;  4DXL A;  4DUY I;  4KHP E;  1IBM E;  1BKN A;  3NZK A;  4DR5 E;  1N33 I;  3B8H A;  1ZXM A;  4GKJ I;  2F4V E;  2F4V I;  4ISA A;  1B62 A;  4IZJ A;  4P52 A;  2JE6 A;  2C39 B;  2C38 B;  4LCG A;  4JI0 E;  1Y4U A;  3K85 A;  1H73 A;  2IOP A;  2AE8 A;  1J5E I;  3KRN A;  4DR4 E;  2LJP A;  1FKA E;  2UXC E;  4HXZ A;  4U3D A;  1ELO A;  3CDJ A;  2V2V A;  4BA1 A;  4X65 I;  2UXB E;  4WUC A;  1N0V C;  3WU4 A;  2Z5B B;  2HHH E;  4LFA E;  4K0K I;  1HR0 I;  2VQF E;  2JEB B;  4HAC B;  1E3H A;  1MG7 A;  4XTJ A;  1H74 A;  4DR2 E;  4B3R I;  4NXM I;  4LFB E;  4B3S E;  4JI6 I;  1K47 A;  2NN6 E;  1YHC A;  1MU5 A;  4LF5 I;  4MU0 A;  1Z0G A;  1FNM A;  2JEA A;  2JT2 A;  4DV0 E;  1KVK A;  2BM0 A;  1RRE A;  5GMD A;  4LF5 E;  3QT8 A;  2PNZ B;  5LMU I;  1FJG E;  3J81 C;  5DRR A;  4LFA I;  4X62 E;  1N32 I;  3J80 C;  4DUZ I;  4HAC A;  1RHY A;  4DPW A;  3ZZ0 A;  1HR0 E;  3GME A;  1D6T A;  2O1U A;  4B3S I;  2HK2 A;  3WU6 A;  4OO1 E;  1EA6 A;  2CGE A;  5DRQ A;  4BA1 B;  4LF4 I;  1XNR E;  4I3H A;  4BA2 B;  4NBQ A;  1Z0T A;  2CVE A;  4DR4 I;  3OTO I;  2WP8 B;  1HNX E;  2WP8 A;  2Z5C A;  5K36 C;  4JI1 E;  4OKG A;  2Q2E B;  2NN6 D;  4LFC E;  2UUB E;  4B3T E;  4DU8 A;  4LPF A;  3P3E A;  1USU A;  2VQF I;  1Y4S A;  1Z0B A;  1VI7 A;  4DUY E;  3H4L A;  4LCH A;  1N34 I;  2BA1 D;  4FW4 A;  4DV5 I;  4JI5 I;  4FWG A;  5IT9 Q;  1OYR A;  1IBL I;  4MQY A;  2F1D A;  5DNX A;  2V34 A;  5DRP A;  3T1H I;  5JEA E;  2UXD E;  3LPS A;  1KIJ A;  2E1R A;  1A6F A;  3T1Y E;  5JEA D;  1IBL E;  4DR1 E;  4OX9 E;  3J7A M;  4FW5 A;  2J65 A;  2UUC I;  2UU9 I;  4OO1 D;  1HNX I;  2CG9 A;  5C0X D;  4OO1 B;  4MU3 A;  1ZM9 A;  4JV5 E;  4DPY A;  3PYE A;  4RPF A;  3ZKD A;  1ZM3 A;  1WUU A;  1NHI A;  2WW4 A;  3ZZU A;  4DV6 E;  1UDO A;  1Z0C A;  4X62 I;  1XHK A;  1Z5A A;  5C0X B;  4AIM A;  4DV4 I;  3PRY A;  2ZIT A;  1XMQ E;  1Z0V A;  3Q6M A;  5C0X C;  5IT9 C;  2C37 B;  2A2D A;  3F0N A;  4NXN I;  2PNM A;  4X64 E;  4LOM A;  4JI7 I;  4LF9 E;  1YH8 A;  3B78 A;  3P06 A;  4DR3 I;  3JAM Q;  4URL A;  2O1T A;  1N0U A;  2CZ9 A;  1S16 A;  5C0X F;  4DV0 I;  3GON A;  5A2Q Q;  3QT5 A;  2PO2 B;  2VQE I;  5A2Q C;  4DUZ E;  4IFD E;  2ZM6 I;  1N32 E;  1Z0E A;  3ZM7 A;  2OI2 A;  1UEK A;  1OJ4 A;  4DV7 I;  1XMO E;  1VIS A;  2WNR B;  4B3R E;  1XNQ E;  4IZJ B;  3DD6 A;  1P42 A;  4U3B A;  4DV6 I;  4DR7 I;  4DR7 E;  4WUB A;  4DV4 E;  4FWD A;  4BA2 A;  1FWK A;  2NN6 A;  2VES A;  2HK3 A;  4Z7C A;  1NZ0 A;  2BV3 A;  4DR3 E;  2EFG A;  1J5E E;  2IOQ A;  4YHH E;  2BA0 D;  2PO0 A;  4JI0 I;  2UUC E;  5EL9 A;  4JI4 I;  3J80 Q;  2NN6 B;  2XEX A;  3WU5 A;  1Z0W A;  4LF6 I;  4JI8 E;  4DV2 I;  2VF3 A;  1HNZ I;  3GLL A;  2HHH I;  4QNJ A;  4AM3 A;  4PRX A;  2HFU A;  4JG4 A;  5EKW A;  1IBK E;  1N34 E;  1OYP A;  1NHH A;  4DV1 I;  1Y6Z A;  4JYA E;  4GKJ E;  5JEA A;  4DV5 E;  2DEI A;  4Z7Y A;  4JI2 I;  5JEA F;  3LNU A;  4OX9 I;  1S4E A;  4JI1 I;  2HFS A;  3PYF A;  4DR6 I;  3M85 D;  4OO1 F;  3V2U C;  1Z59 A;  2UU9 E;  3PS2 A;  4FW9 A;  4P7A A;  1H7S A;  4ZVI A;  3D4J A;  4DV3 I;  2GO3 A;  1IBM I;  2V8P A;  1N33 E;  3U1Y A;  2C39 A;  5L3J A;  4MYT A;  2Z5C B;  4MU4 A;  5DRO A;  5GME A;  3CDI A;  4OO1 A;  3M6A A;  1PKP A;  1NHJ A;  1I94 I;  4X66 I;  2BR2 A;  3J7A G;  4B3M I;  1UDS A;  4EMD A;  1U2R A;  4USK A;  5LL6 R;  4JI4 E;  1HNZ E;  1HK7 A;  2IER A;  2X7I A;  1RR9 A;  2X36 A;  3OTO E;  3ZZT A;  2V2Z A;  3Q6N A;  1H72 C;  2DEJ A;  4HYM A;  4N3O A;  4IS9 A;  4IZK B;  2PNZ A;  4GKK E;  1XMQ I;  5C0X A;  2BR2 B;  4JI6 E;  4NXM E;  2PO1 A;  4LFB I;  1I94 E;  4X64 I;  2BA0 G;  2GO4 A;  3Q1Q A;  1ZXN A;  2UUA I;  2ZBK B;  1E3P A;  3LTO A;  2HKJ A;  4R1F A;  4AQY I;  1XXE A;  4UT4 A;  1ZM2 A;  4QNK A;  4X66 E;  4KQV A;  2HKE A;  1R6M A;  2PO1 B;  5LMU E;  4K0K E;  2UXC I;  2JE6 B;  4IFD B;  3V5R A;  2E5L E;  1HNW E;  1PIE A;  5LMN I;  2VQE E;  5IWA I;  2R42 A;  2PNL A;  1Y60 A;  4YY3 E;  1Z5C A;  2Z5B A;  3L7Z B;  4FW3 A;  5K36 A;  3K1J A;  1N36 E;  4FW6 A;  3M7N G;  3T1H E;  2IES A;  1PVG A;  1H7U A;  4LCF A;  3ZKB A;  4JI5 E;  2C37 A;  4FW7 A;  4DR1 I;  1FWL A;  2AJ4 A;  3L7Z A;  3UHM A;  5FLX Q;  4JI3 E;  5K36 D;  4MYU A;  4LF8 I;  5JEA B;  4WUD A;  3PYG A;  3QT7 A;  1QZR A;  4DU7 A;  3WU3 A;  4JI2 E;  2PO2 A;  3H1C A;  4AID A;  2GQ0 A;  4JI8 I;  2BM1 A;  4DV1 E;  4JYA I;  3J81 Q;  4DV3 E;  4DR5 I;  4GQU A;  4KHP I;  2JEB A;  4YY3 I;  4IZJ D;  4IFD D;  5JEA C;  3K17 A;  1ZM4 A;  1XNR I;  4IZK A;  5FWK A;  4LF8 E;  2O3Z A;  1USV A;  2A2C A;  3U1K A;  5K36 F;  2V2Q A;  2PO0 B;  4YHH I;  4AQY E;  1Z5B A;  2E5L I;  2UUA E;  1HNW I;  4J3D A;  3PYD A;  5ELW A;  3HUL A;  4JI3 I;  5FLX C;  4MU1 A;  4DPT A;  5K36 E;  4DV7 E;  1B63 A;  1FJG I;  3HJC A;  2UUB I;  4B3T I;  4LFC I;  2JEA B;  4LF7 E;  3PS3 A;  5DNL A;  3CWV A;  5IWA E;  4DV2 E;  1XNQ I;  3P76 A;  5LMN E;  2BA1 G;  4IFD C;  4LF6 E;  1Y5Y A;  1XMO I;  1N36 I;  4ED4 A;  4OO1 C;  2J7K A;  4LF4 E;  4USM A;  1MX0 A;  2R3V A;  5BR8 E;  3JAM C;  3B4T A;  4HY1 A;  4LF9 I;  5C0X E;  2NPF A;  4JI7 E;  2O1V A;  1FI4 A;  4M1K A;  5BR8 I;  4B3M E;  4IFD F;  2UXB I;  3M85 G;  5K36 B;  2Z5E A;  1KKH A;  2WNR A;  4JV5 I;  4GKK I;  1OYS A;  2ZM6 E;  3B82 A;  4PU9 A;  1R6L A;  4DR2 I;  2NN6 C;  2O1W A;  4FWH A;  4FN5 A;  1DAR A;  4LF7 I;  4NXN E;  1KTV A;  3PS1 A;  3M7N D;  4DPU A;  2UXD I;  4DR6 E;  4UTG A;  3QT6 A;  4DPX A;  2GS8 A;  3P3C A;  3T1Y I;  1EI1 A;  3P3G A;  2NN6 F; 
#chains in the Genus database with same CATH homology
 4PRV A;  4X65 E;  1IBK I;  4DXL A;  4DUY I;  4KHP E;  1IBM E;  1BKN A;  4DR5 E;  1N33 I;  3B8H A;  1ZXM A;  4GKJ I;  2F4V E;  2F4V I;  1B62 A;  4IZJ A;  4P52 A;  4JI0 E;  1Y4U A;  3K85 A;  1H73 A;  2IOP A;  1J5E I;  4DR4 E;  2LJP A;  1FKA E;  2UXC E;  4HXZ A;  1ELO A;  2V2V A;  4X65 I;  2UXB E;  4WUC A;  1N0V C;  3WU4 A;  2Z5B B;  2HHH E;  4LFA E;  4K0K I;  1HR0 I;  2VQF E;  4HAC B;  1MG7 A;  4XTJ A;  1H74 A;  4DR2 E;  4B3R I;  4NXM I;  4LFB E;  4B3S E;  4JI6 I;  1K47 A;  1MU5 A;  4LF5 I;  1Z0G A;  1FNM A;  4DV0 E;  1KVK A;  2BM0 A;  1RRE A;  5GMD A;  4LF5 E;  3QT8 A;  1FJG E;  5LMU I;  3J81 C;  4LFA I;  4X62 E;  1N32 I;  3J80 C;  4DUZ I;  4HAC A;  4DPW A;  3ZZ0 A;  1HR0 E;  1D6T A;  2O1U A;  4B3S I;  2HK2 A;  3WU6 A;  1EA6 A;  2CGE A;  4LF4 I;  1XNR E;  4I3H A;  1Z0T A;  4DR4 I;  3OTO I;  1HNX E;  2Z5C A;  4JI1 E;  2Q2E B;  4LFC E;  2UUB E;  4B3T E;  4DU8 A;  1USU A;  2VQF I;  1Y4S A;  1Z0B A;  4DUY E;  3H4L A;  1N34 I;  4DV5 I;  4JI5 I;  4FWG A;  5IT9 Q;  1IBL I;  2V34 A;  3T1H I;  2UXD E;  3LPS A;  1KIJ A;  2E1R A;  1A6F A;  3T1Y E;  1IBL E;  4DR1 E;  4OX9 E;  3J7A M;  2UUC I;  2UU9 I;  1HNX I;  2CG9 A;  1ZM9 A;  4JV5 E;  4DPY A;  3PYE A;  4RPF A;  3ZKD A;  1ZM3 A;  1WUU A;  1NHI A;  2WW4 A;  3ZZU A;  4DV6 E;  1Z0C A;  4X62 I;  1XHK A;  1Z5A A;  4DV4 I;  3PRY A;  2ZIT A;  1XMQ E;  1Z0V A;  3Q6M A;  5IT9 C;  2A2D A;  3F0N A;  4NXN I;  2PNM A;  4X64 E;  4JI7 I;  4LF9 E;  3B78 A;  3P06 A;  4DR3 I;  3JAM Q;  4URL A;  2O1T A;  1N0U A;  2CZ9 A;  1S16 A;  4DV0 I;  3GON A;  5A2Q Q;  3QT5 A;  2VQE I;  5A2Q C;  4DUZ E;  2ZM6 I;  1N32 E;  1Z0E A;  3ZM7 A;  2OI2 A;  1UEK A;  1OJ4 A;  4DV7 I;  1XMO E;  1VIS A;  4B3R E;  1XNQ E;  4IZJ B;  4DR7 I;  4DV6 I;  4DR7 E;  4WUB A;  4DV4 E;  4FWD A;  1FWK A;  2HK3 A;  4Z7C A;  1NZ0 A;  2BV3 A;  4DR3 E;  2EFG A;  1J5E E;  2IOQ A;  4YHH E;  4JI0 I;  2UUC E;  4JI4 I;  3J80 Q;  2XEX A;  3WU5 A;  1Z0W A;  4LF6 I;  4JI8 E;  4DV2 I;  2VF3 A;  1HNZ I;  2HHH I;  4PRX A;  2HFU A;  4JG4 A;  1IBK E;  1N34 E;  1NHH A;  4DV1 I;  1Y6Z A;  4JYA E;  4GKJ E;  4DV5 E;  2DEI A;  4Z7Y A;  4JI2 I;  3LNU A;  4OX9 I;  1S4E A;  4JI1 I;  2HFS A;  3PYF A;  4DR6 I;  3V2U C;  1Z59 A;  2UU9 E;  4FW9 A;  4P7A A;  1H7S A;  4ZVI A;  3D4J A;  4DV3 I;  1IBM I;  2V8P A;  1N33 E;  5L3J A;  4MYT A;  2Z5C B;  5GME A;  3M6A A;  1PKP A;  1NHJ A;  1I94 I;  4X66 I;  3J7A G;  4B3M I;  4EMD A;  1U2R A;  4USK A;  5LL6 R;  4JI4 E;  1HNZ E;  1HK7 A;  2X7I A;  1RR9 A;  2X36 A;  3OTO E;  3ZZT A;  2V2Z A;  3Q6N A;  1H72 C;  2DEJ A;  4HYM A;  4N3O A;  4IZK B;  4GKK E;  1XMQ I;  4JI6 E;  4NXM E;  4LFB I;  1I94 E;  4X64 I;  3Q1Q A;  1ZXN A;  2UUA I;  2ZBK B;  3LTO A;  2HKJ A;  4R1F A;  4AQY I;  4UT4 A;  1ZM2 A;  4X66 E;  4KQV A;  2HKE A;  4K0K E;  2UXC I;  5LMU E;  3V5R A;  2E5L E;  1HNW E;  1PIE A;  5LMN I;  2VQE E;  5IWA I;  2R42 A;  2PNL A;  4YY3 E;  1Z5C A;  2Z5B A;  3K1J A;  1N36 E;  3T1H E;  1PVG A;  1H7U A;  3ZKB A;  4JI5 E;  4DR1 I;  1FWL A;  2AJ4 A;  5FLX Q;  4JI3 E;  4MYU A;  4LF8 I;  4WUD A;  3PYG A;  3QT7 A;  1QZR A;  4DU7 A;  3WU3 A;  4JI2 E;  2GQ0 A;  4JI8 I;  2BM1 A;  4DV1 E;  4JYA I;  3J81 Q;  4DV3 E;  4DR5 I;  4KHP I;  4YY3 I;  4IZJ D;  3K17 A;  1ZM4 A;  1XNR I;  4IZK A;  5FWK A;  4LF8 E;  1USV A;  2A2C A;  2V2Q A;  4YHH I;  4AQY E;  1Z5B A;  2E5L I;  2UUA E;  1HNW I;  3PYD A;  3HUL A;  4JI3 I;  5FLX C;  4DPT A;  4DV7 E;  1B63 A;  1FJG I;  3HJC A;  2UUB I;  4B3T I;  4LFC I;  4LF7 E;  1XNQ I;  3CWV A;  5IWA E;  4DV2 E;  5LMN E;  4LF6 E;  1N36 I;  1XMO I;  4ED4 A;  2J7K A;  4LF4 E;  4USM A;  1MX0 A;  2R3V A;  5BR8 E;  3JAM C;  4HY1 A;  4LF9 I;  2NPF A;  4JI7 E;  2O1V A;  1FI4 A;  4M1K A;  5BR8 I;  4B3M E;  2UXB I;  2Z5E A;  1KKH A;  4JV5 I;  4GKK I;  2ZM6 E;  3B82 A;  4PU9 A;  4DR2 I;  2O1W A;  4FWH A;  4FN5 A;  1DAR A;  4LF7 I;  4NXN E;  1KTV A;  4DPU A;  2UXD I;  4DR6 E;  4UTG A;  3QT6 A;  4DPX A;  2GS8 A;  3T1Y I;  1EI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...