1HNZI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzI00
4DUZE 3K17A 4LF4I 2V34A 4DV7E 2HKJA 3QT6A 2V2QA 2V8PA 4GKJI 5LMNE 3T1HI 1FKAE 2UUAE 4ZVIA 4YY3I 1XNRI 3ZKBA 4JI2E 4DR6I 2DEJA 4B3TE 1S4EA 1XMOI 2E1RA 2AJ4A 3ZZUA 1N32E 4LF7I 1ZM4A 2UXDE 4DR5I 4JI0E 2UUBE 4WUDA 1Z0GA 1XMQE 1N0UA 4PU9A 4DPYA 4LFCE 2BM0A 1XNQE 4JI5E 4JYAI 3QT5A 5IT9C 2VQEE 1N33E 2VF3A 4LFBE 3B8HA 4K0KI 2HK3A 3ZKDA 1J5EE 4JI3E 1B63A 4HACB 4P52A 4DR2E 4DV3E 4DV6I 2BM1A 2ZM6E 4YHHE 4LF6I 4B3RE 5BR8I 4LF9E 3T1YE 1HNWE 1ZM9A 1N36E 1HNZI 4DU7A 4DV1E 3J81Q 4UT4A 1IBKE 1IBMI 2HKEA 4KHPI 4P7AA 2HFSA 4URLA 2GS8A 4JI1I 4DUYI 3H4LA 4DR4I 4JI6E 4XTJA 3JAMC 5A2QC 4USKA 1Z5AA 3J80C 4JI7E 1N34I 4X65E 3B78A 1MU5A 4RPFA 2LJPA 1HR0I 2UUCI 4GKKE 4X62E 1Z0VA 3K1JA 4DV0I 4B3MI 1NZ0A 2BV3A 1Z0WA 4DPTA 4LFAI 3PYGA 4NXNE 4DR7I 4DV4E 1OJ4A 2X36A 1FI4A 4LF8I 2UXCE 1ZXNA 2DEIA 4JI8I 1FWKA 2UXBE 3WU3A 1B62A 1KVKA 4GKJE 1I94I 4HXZA 3T1HE 3WU6A 4OX9I 2OI2A 1H72C 1Z0CA 4DR3I 1XNRE 4FWHA 4FN5A 4HY1A 4DUZI 3LNUA 2F4VE 4LF5E 4DV7I 1KTVA 4FW9A 2E5LE 3LTOA 2V2ZA 5LMNI 5L3JA 1S16A 2UUAI 4I3HA 4JI2I 4JI4I 3D4JA 4B3TI 1XHKA 2HHHE 1N32I 2XEXA 2UXDI 4JI0I 2UUBI 1HNXE 3PYEA 1XMQI 4Z7CA 3J80Q 2UU9I 4LF6E 2VQEI 1KIJA 1ZM2A 3PYFA 5IWAE 1NHIA 4LFBI 1ZXMA 3J7AG 1HNZE 4Z7YA 4DV5E 4DU8A 1J5EI 4M1KA 3J7AM 4DV3I 4KHPE 4FWDA 1FJGE 3OTOE 3M6AA 4NXME 1Z59A 2ZM6I 4B3RI 4AQYI 4LF9I 4PRVA 5LL6R 4DUYE 2J7KA 1HNWI 4DR1E 1N36I 4X66E 4DR4E 5FLXC 4X64E 4DV2I 3CWVA 4B3SE 4EMDA 4JV5I 1A6FA 1PKPA 1H73A 3QT7A 4MYUA 2VQFE 1PVGA 4JI6I 1WUUA 4MYTA 4DV0E 5LMUE 5GMDA 1MX0A 4DPXA 4X65I 1H74A 1ZM3A 4DR7E 1Z5CA 4LF4E 1UEKA 4GKKI 4X62I 1IBLI 5IT9Q 3ZM7A 4R1FA 3GONA 2HK2A 3ZZTA 1K47A 3HULA 4YY3E 1U2RA 1PIEA 5GMEA 2HFUA 4NXNI 4DV4I 3V5RA 4DR6E 2UXCI 2UXBI 1XMOE 1Z0TA 4WUCA 2Q2EB 4LF7E 4DR5E 3F0NA 2X7IA 2CZ9A 2F4VI 4LF5I 4JYAE 2ZBKB 4JI4E 1NHJA 1NHHA 3ZZ0A 1EA6A 1Z0BA 2E5LI 4K0KE 1RREA 1D6TA 3LPSA 5FLXQ 3JAMQ 3Q1QA 5A2QQ 4LFCI 4DV6E 1XNQI 2UU9E 4JI5I 5BR8E 1N33I 4JG4A 1MG7A 4HYMA 4HACA 2R3VA 2HHHI 2A2DA 1RR9A 4JI3I 1HNXI 3V2UC 4DPWA 2ZITA 1IBME 4DR2I 3WU5A 2V2VA 4YHHI 1FWLA 4AQYE 4ED4A 5IWAI 3T1YI 4JI1E 1DARA 1N0VC 2EFGA 1KKHA 4DV1I 4DV5I 1EI1A 4DV2E 2NPFA 4PRXA 1IBKI 4USMA 1N34E 1FJGI 3OTOI 4NXMI 4JV5E 1BKNA 3WU4A 1ELOA 1HR0E 2UUCE 1H7SA 3PYDA 4DR1I 4X66I 4X64I 4DPUA 4B3ME 4WUBA 3B82A 4LFAE 1Z0EA 1QZRA 4B3SI 4JI7I 1Z5BA 1VISA 1H7UA 4KQVA 2R42A 4UTGA 3QT8A 4FWGA 4LF8E 4DXLA 3J81C 2VQFI 1IBLE 4JI8E 1FNMA 2WW4A 5LMUI 1I94E 2A2CA 4OX9E 4DR3E
chains in the Genus database with same CATH superfamily
4DUZE 3K17A 4LF4I 2V34A 4DV7E 2HKJA 3QT6A 2V2QA 4IFDB 3U1KA 2V8PA 4GKJI 1VI7A 5LMNE 2J65A 3T1HI 5C0XD 1FKAE 3CDIA 2UUAE 4ZVIA 2PO2B 4YY3I 1XNRI 2GO3A 2PO1B 3ZKBA 4JI2E 4DR6I 2PO0B 3NZKA 1OYSA 2DEJA 4B3TE 1S4EA 1UDQA 1XMOI 2E1RA 2CGEA 4J3DA 2AJ4A 4NBQA 3PS2A 2NN6C 3ZZUA 1N32E 4LF7I 1ZM4A 2UXDE 5K36D 4DR5I 4JI0E 4OO1E 2NN6A 2UUBE 2JEBB 2BA1G 2C38B 4WUDA 5JEAF 1Z0GA 5DROA 1XMQE 1N0UA 4PU9A 4DPYA 4LFCE 2BM0A 1XNQE 2VESA 4JI5E 4IZJD 4JYAI 3QT5A 5IT9C 2VQEE 1N33E 2VF3A 4LFBE 5DRRA 3B8HA 4K0KI 2HK3A 4QNKA 5DNLA 3ZKDA 1J5EE 4JI3E 1B63A 4HACB 4P52A 4DR2E 3CDJA 4DV3E 4DV6I 2BM1A 2ZM6E 4YHHE 4LF6I 4B3RE 4OKGA 5BR8I 4LF9E 3T1YE 4IFDE 1HNWE 1ZM9A 2Z5EA 1N36E 1HNZI 4DU7A 4DV1E 3J81Q 4UT4A 3Q6NA 2O1UA 5EKWA 1IBKE 1IBMI 2HKEA 4N3OA 5C0XF 4KHPI 2JEAA 3U1YA 4P7AA 3B4TA 2C37A 2HFSA 4URLA 5ELWA 2GS8A 4JI1I 4DUYI 3H4LA 4DR4I 4JI6E 3L7ZA 2JT2A 4XTJA 2PNZB 3JAMC 4OO1D 5A2QC 4USKA 1Y4SA 1Z5AA 2JE6B 3J80C 2Z5BB 5K36F 4FW5A 2Z5CA 4JI7E 1N34I 4X65E 3B78A 1MU5A 4RPFA 2LJPA 1P42A 1HR0I 2UUCI 4GKKE 4X62E 4IZKA 1Z0VA 2WNRB 3K1JA 4DV0I 2C39A 4B3MI 1NZ0A 5JEAC 4BA1A 2BV3A 2WP8B 1Z0WA 4DPTA 5JEAA 4LFAI 3PYGA 2IERA 4NXNE 4DR7I 4IFDD 1RHYA 4DV4E 1OJ4A 4FW6A 2X36A 1FI4A 4LF8I 2UXCE 1ZXNA 2DEIA 4JI8I 1FWKA 2UXBE 1XXEA 1UDOA 3WU3A 1B62A 1KVKA 4GKJE 1I94I 4HXZA 4GQUA 3T1HE 3WU6A 4OX9I 2IOQA 2OI2A 1H72C 1Z0CA 1E3PA 4DR3I 1XNRE 4FWHA 4FN5A 2IOPA 4HY1A 4DUZI 3LNUA 2F4VE 4LF5E 4DV7I 3HJCA 1KTVA 4FW9A 2E5LE 3LTOA 2V2ZA 5LMNI 2NN6D 5C0XC 4OO1F 4FW3A 3H1CA 5C0XA 5L3JA 1S16A 2UUAI 3KRNA 1UDSA 2NN6B 4I3HA 3M85G 4JI2I 2BA0D 2PNLA 4JI4I 3D4JA 4B3TI 1XHKA 3P3EA 2HHHE 5K36C 1N32I 2XEXA 2UXDI 4JI0I 5K36A 2UUBI 1HNXE 3PYEA 1YH8A 1XMQI 4Z7CA 3J80Q 1E3HA 2UU9I 2BR2A 4LF6E 4IZJA 2VQEI 1KIJA 1ZM2A 3PYFA 1Y6ZA 5IWAE 1NHIA 4AM3A 4IFDF 4LFBI 1ZXMA 3J7AG 1HNZE 4Z7YA 2O1VA 4DV5E 4DU8A 1J5EI 3M85D 4M1KA 3J7AM 4DV3I 1Y60A 4KHPE 2GQ0A 1USUA 4FWDA 1FJGE 3OTOE 3M6AA 4NXME 4QNJA 1Z59A 2ZM6I 4B3RI 4AQYI 4LF9I 4PRVA 1HK7A 2JEAB 2O1TA 5LL6R 4LPFA 4DUYE 2J7KA 1HNWI 4DR1E 2C37B 1N36I 1YHCA 5DRQA 3PS3A 4U3DA 4X66E 5FLXC 4DR4E 4X64E 4DV2I 3L7ZB 4MDTA 2NN6E 2PNMA 3M7ND 3CWVA 2CVEA 4MQYA 4B3SE 4AIMA 4EMDA 4JV5I 2Z5CB 3P3CA 1A6FA 1PKPA 4IS9A 1H73A 3QT7A 4MYUA 2VQFE 1PVGA 4MU0A 4JI6I 4OO1C 1WUUA 4MYTA 4DV0E 5LMUE 4OO1A 3Q6MA 4IZKB 5GMDA 2O1WA 1USVA 2F1DA 2IESA 4MU3A 1MX0A 2C39B 4DPXA 4BA1B 4X65I 1H74A 1ZM3A 4BA2A 5JEAB 4LCFA 1Z5CA 4LF4E 4DR7E 1UEKA 1Y4UA 4GKKI 4AIDA 4X62I 4LCGA 1IBLI 5IT9Q 3ZM7A 2BA0G 4R1FA 3GONA 1UDNA 2HK2A 3ZZTA 1K47A 3HULA 5EL9A 4YY3E 1U2RA 1PIEA 5GMEA 2HFUA 4IFDC 4NXNI 2O3ZA 4DV4I 3V5RA 4DR6E 4IFDA 5DRPA 2UXCI 4ISAA 1XMOE 2UXBI 4MU4A 1Z0TA 4WUCA 2Q2EB 2AE8A 4LOMA 4LF7E 2PO2A 4DR5E 2PO1A 3F0NA 2X7IA 1R6MA 2PO0A 5C0XB 2CZ9A 2F4VI 4LF5I 4JYAE 2ZBKB 4JI4E 4LCHA 1NHJA 1NHHA 3ZZ0A 4FW4A 1EA6A 1Z0BA 2E5LI 4K0KE 2CG9A 1RREA 2JEBA 2C38A 3LPSA 1D6TA 5FLXQ 3PRYA 3JAMQ 3Q1QA 5A2QQ 5JEAE 5K36B 4LFCI 4DV6E 1XNQI 2UU9E 2GO4A 4JI5I 3M7NG 5BR8E 1N33I 4JG4A 1MG7A 2BR2B 4HYMA 4IZJB 4HACA 2R3VA 2HHHI 2A2DA 1RR9A 3P76A 3GMEA 4JI3I 1HNXI 3V2UC 4DPWA 2ZITA 1IBME 4DR2I 3WU5A 5DNXA 2V2VA 4YHHI 1FWLA 4AQYE 5FWKA 4ED4A 5IWAI 3T1YI 4JI1E 1DARA 3K85A 1N0VC 2EFGA 3PS1A 1KKHA 4DV1I 2BA1D 4DV5I 4FW7A 1EI1A 4DV2E 3GLLA 2NPFA 2NN6F 4PRXA 1IBKI 4MU1A 5C0XE 4USMA 1OYPA 1N34E 1FJGI 3HKMA 3OTOI 4NXMI 3P06A 4JV5E 1BKNA 3WU4A 1ELOA 1HR0E 2UUCE 2PNZA 1H7SA 3PYDA 4DR1I 4X66I 2JE6A 2Z5BA 4X64I 4DPUA 1R6LA 4B3ME 4WUBA 3B82A 3UHMA 5JEAD 5K36E 4LFAE 4OZEA 1Y5YA 1Z0EA 1QZRA 4OO1B 4B3SI 4JI7I 1Z5BA 1VISA 1H7UA 4KQVA 4U3BA 2WNRA 2R42A 4UTGA 4BA2B 3QT8A 4FWGA 4LF8E 3P3GA 4DXLA 3J81C 2VQFI 1IBLE 4JI8E 2WP8A 1FNMA 2WW4A 5LMUI 1I94E 2A2CA 3DD6A 3GCMA 4OX9E 1OYRA 4DR3E
chains in the Genus database with same CATH topology
4DUZE 3K17A 4LF4I 2V34A 4DV7E 2HKJA 3QT6A 2V2QA 2V8PA 4GKJI 5LMNE 3T1HI 1FKAE 2UUAE 4ZVIA 4YY3I 1XNRI 3ZKBA 4JI2E 4DR6I 2DEJA 4B3TE 1S4EA 1XMOI 2E1RA 2CGEA 2AJ4A 3ZZUA 1N32E 4LF7I 1ZM4A 2UXDE 4DR5I 4JI0E 2UUBE 4WUDA 1Z0GA 1XMQE 1N0UA 4PU9A 4DPYA 4LFCE 2BM0A 1XNQE 4JI5E 4IZJD 4JYAI 3QT5A 5IT9C 2VQEE 1N33E 2VF3A 4LFBE 3B8HA 4K0KI 2HK3A 3ZKDA 1J5EE 4JI3E 1B63A 4HACB 4P52A 4DR2E 4DV3E 4DV6I 2BM1A 2ZM6E 4YHHE 4LF6I 4B3RE 5BR8I 4LF9E 3T1YE 1HNWE 1ZM9A 2Z5EA 1N36E 1HNZI 4DU7A 4DV1E 3J81Q 4UT4A 3Q6NA 2O1UA 1IBKE 1IBMI 2HKEA 4N3OA 4KHPI 4P7AA 2HFSA 4URLA 2GS8A 4JI1I 4DUYI 3H4LA 4DR4I 4JI6E 4XTJA 3JAMC 5A2QC 4USKA 1Y4SA 1Z5AA 3J80C 2Z5BB 2Z5CA 4JI7E 1N34I 4X65E 3B78A 1MU5A 4RPFA 2LJPA 1HR0I 2UUCI 4GKKE 4X62E 4IZKA 1Z0VA 3K1JA 4DV0I 4B3MI 1NZ0A 2BV3A 1Z0WA 4DPTA 4LFAI 3PYGA 4NXNE 4DR7I 4DV4E 1OJ4A 2X36A 1FI4A 4LF8I 2UXCE 1ZXNA 2DEIA 4JI8I 1FWKA 2UXBE 3WU3A 1B62A 1KVKA 4GKJE 1I94I 4HXZA 3T1HE 3WU6A 4OX9I 2IOQA 2OI2A 1H72C 1Z0CA 4DR3I 1XNRE 4FWHA 4FN5A 2IOPA 4HY1A 4DUZI 3LNUA 2F4VE 4LF5E 4DV7I 3HJCA 1KTVA 4FW9A 2E5LE 3LTOA 2V2ZA 5LMNI 5L3JA 1S16A 2UUAI 4I3HA 4JI2I 2PNLA 4JI4I 3D4JA 4B3TI 1XHKA 2HHHE 1N32I 2XEXA 2UXDI 4JI0I 2UUBI 1HNXE 3PYEA 1XMQI 4Z7CA 3J80Q 2UU9I 4LF6E 4IZJA 2VQEI 1KIJA 1ZM2A 3PYFA 1Y6ZA 5IWAE 1NHIA 4LFBI 1ZXMA 3J7AG 1HNZE 4Z7YA 2O1VA 4DV5E 4DU8A 1J5EI 4M1KA 3J7AM 4DV3I 4KHPE 2GQ0A 1USUA 4FWDA 1FJGE 3OTOE 3M6AA 4NXME 1Z59A 2ZM6I 4B3RI 4AQYI 4LF9I 4PRVA 1HK7A 2O1TA 5LL6R 4DUYE 2J7KA 1HNWI 4DR1E 1N36I 4X66E 4DR4E 5FLXC 4X64E 4DV2I 2PNMA 3CWVA 4B3SE 4EMDA 4JV5I 2Z5CB 1A6FA 1PKPA 1H73A 3QT7A 4MYUA 2VQFE 1PVGA 4JI6I 1WUUA 4MYTA 4DV0E 5LMUE 3Q6MA 4IZKB 5GMDA 2O1WA 1USVA 1MX0A 4DPXA 4X65I 1H74A 1ZM3A 4DR7E 1Z5CA 4LF4E 1UEKA 1Y4UA 4GKKI 4X62I 1IBLI 5IT9Q 3ZM7A 4R1FA 3GONA 2HK2A 3ZZTA 1K47A 3HULA 4YY3E 1U2RA 1PIEA 5GMEA 2HFUA 4NXNI 4DV4I 3V5RA 4DR6E 2UXCI 2UXBI 1XMOE 1Z0TA 4WUCA 2Q2EB 4LF7E 4DR5E 3F0NA 2X7IA 2CZ9A 2F4VI 4LF5I 4JYAE 2ZBKB 4JI4E 1NHJA 1NHHA 3ZZ0A 1EA6A 1Z0BA 2E5LI 4K0KE 2CG9A 1RREA 1D6TA 3LPSA 5FLXQ 3PRYA 3JAMQ 3Q1QA 5A2QQ 4LFCI 4DV6E 1XNQI 2UU9E 4JI5I 5BR8E 1N33I 4JG4A 1MG7A 4HYMA 4IZJB 4HACA 2R3VA 2HHHI 2A2DA 1RR9A 4JI3I 1HNXI 3V2UC 4DPWA 2ZITA 1IBME 4DR2I 3WU5A 2V2VA 4YHHI 1FWLA 4AQYE 5FWKA 4ED4A 5IWAI 3T1YI 4JI1E 1DARA 3K85A 1N0VC 2EFGA 1KKHA 4DV1I 4DV5I 1EI1A 4DV2E 2NPFA 4PRXA 1IBKI 4USMA 1N34E 1FJGI 3OTOI 4NXMI 3P06A 4JV5E 1BKNA 3WU4A 1ELOA 1HR0E 2UUCE 1H7SA 3PYDA 4DR1I 4X66I 2Z5BA 4X64I 4DPUA 4B3ME 4WUBA 3B82A 4LFAE 1Z0EA 1QZRA 4B3SI 4JI7I 1Z5BA 1VISA 1H7UA 4KQVA 2R42A 4UTGA 3QT8A 4FWGA 4LF8E 4DXLA 3J81C 2VQFI 1IBLE 4JI8E 1FNMA 2WW4A 5LMUI 1I94E 2A2CA 4OX9E 4DR3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ E;  3K17 A;  4LF4 I;  2V34 A;  4DV7 E;  2HKJ A;  3QT6 A;  2V2Q A;  2V8P A;  4GKJ I;  5LMN E;  3T1H I;  1FKA E;  2UUA E;  4ZVI A;  4YY3 I;  1XNR I;  3ZKB A;  4JI2 E;  4DR6 I;  2DEJ A;  4B3T E;  1S4E A;  1XMO I;  2E1R A;  2AJ4 A;  3ZZU A;  1N32 E;  4LF7 I;  1ZM4 A;  2UXD E;  4DR5 I;  4JI0 E;  2UUB E;  4WUD A;  1Z0G A;  1XMQ E;  1N0U A;  4PU9 A;  4DPY A;  4LFC E;  2BM0 A;  1XNQ E;  4JI5 E;  4JYA I;  3QT5 A;  5IT9 C;  2VQE E;  1N33 E;  2VF3 A;  4LFB E;  3B8H A;  4K0K I;  2HK3 A;  3ZKD A;  1J5E E;  4JI3 E;  1B63 A;  4HAC B;  4P52 A;  4DR2 E;  4DV3 E;  4DV6 I;  2BM1 A;  2ZM6 E;  4YHH E;  4LF6 I;  4B3R E;  5BR8 I;  4LF9 E;  3T1Y E;  1HNW E;  1ZM9 A;  1N36 E;  1HNZ I;  4DU7 A;  4DV1 E;  3J81 Q;  4UT4 A;  1IBK E;  1IBM I;  2HKE A;  4KHP I;  4P7A A;  2HFS A;  4URL A;  2GS8 A;  4JI1 I;  4DUY I;  3H4L A;  4DR4 I;  4JI6 E;  4XTJ A;  3JAM C;  5A2Q C;  4USK A;  1Z5A A;  3J80 C;  4JI7 E;  1N34 I;  4X65 E;  3B78 A;  1MU5 A;  4RPF A;  2LJP A;  1HR0 I;  2UUC I;  4GKK E;  4X62 E;  1Z0V A;  3K1J A;  4DV0 I;  4B3M I;  1NZ0 A;  2BV3 A;  1Z0W A;  4DPT A;  4LFA I;  3PYG A;  4NXN E;  4DR7 I;  4DV4 E;  1OJ4 A;  2X36 A;  1FI4 A;  4LF8 I;  2UXC E;  1ZXN A;  2DEI A;  4JI8 I;  1FWK A;  2UXB E;  3WU3 A;  1B62 A;  1KVK A;  4GKJ E;  1I94 I;  4HXZ A;  3T1H E;  3WU6 A;  4OX9 I;  2OI2 A;  1H72 C;  1Z0C A;  4DR3 I;  1XNR E;  4FWH A;  4FN5 A;  4HY1 A;  4DUZ I;  3LNU A;  2F4V E;  4LF5 E;  4DV7 I;  1KTV A;  4FW9 A;  2E5L E;  3LTO A;  2V2Z A;  5LMN I;  5L3J A;  1S16 A;  2UUA I;  4I3H A;  4JI2 I;  4JI4 I;  3D4J A;  4B3T I;  1XHK A;  2HHH E;  1N32 I;  2XEX A;  2UXD I;  4JI0 I;  2UUB I;  1HNX E;  3PYE A;  1XMQ I;  4Z7C A;  3J80 Q;  2UU9 I;  4LF6 E;  2VQE I;  1KIJ A;  1ZM2 A;  3PYF A;  5IWA E;  1NHI A;  4LFB I;  1ZXM A;  3J7A G;  1HNZ E;  4Z7Y A;  4DV5 E;  4DU8 A;  1J5E I;  4M1K A;  3J7A M;  4DV3 I;  4KHP E;  4FWD A;  1FJG E;  3OTO E;  3M6A A;  4NXM E;  1Z59 A;  2ZM6 I;  4B3R I;  4AQY I;  4LF9 I;  4PRV A;  5LL6 R;  4DUY E;  2J7K A;  1HNW I;  4DR1 E;  1N36 I;  4X66 E;  4DR4 E;  5FLX C;  4X64 E;  4DV2 I;  3CWV A;  4B3S E;  4EMD A;  4JV5 I;  1A6F A;  1PKP A;  1H73 A;  3QT7 A;  4MYU A;  2VQF E;  1PVG A;  4JI6 I;  1WUU A;  4MYT A;  4DV0 E;  5LMU E;  5GMD A;  1MX0 A;  4DPX A;  4X65 I;  1H74 A;  1ZM3 A;  4DR7 E;  1Z5C A;  4LF4 E;  1UEK A;  4GKK I;  4X62 I;  1IBL I;  5IT9 Q;  3ZM7 A;  4R1F A;  3GON A;  2HK2 A;  3ZZT A;  1K47 A;  3HUL A;  4YY3 E;  1U2R A;  1PIE A;  5GME A;  2HFU A;  4NXN I;  4DV4 I;  3V5R A;  4DR6 E;  2UXC I;  2UXB I;  1XMO E;  1Z0T A;  4WUC A;  2Q2E B;  4LF7 E;  4DR5 E;  3F0N A;  2X7I A;  2CZ9 A;  2F4V I;  4LF5 I;  4JYA E;  2ZBK B;  4JI4 E;  1NHJ A;  1NHH A;  3ZZ0 A;  1EA6 A;  1Z0B A;  2E5L I;  4K0K E;  1RRE A;  1D6T A;  3LPS A;  5FLX Q;  3JAM Q;  3Q1Q A;  5A2Q Q;  4LFC I;  4DV6 E;  1XNQ I;  2UU9 E;  4JI5 I;  5BR8 E;  1N33 I;  4JG4 A;  1MG7 A;  4HYM A;  4HAC A;  2R3V A;  2HHH I;  2A2D A;  1RR9 A;  4JI3 I;  1HNX I;  3V2U C;  4DPW A;  2ZIT A;  1IBM E;  4DR2 I;  3WU5 A;  2V2V A;  4YHH I;  1FWL A;  4AQY E;  4ED4 A;  5IWA I;  3T1Y I;  4JI1 E;  1DAR A;  1N0V C;  2EFG A;  1KKH A;  4DV1 I;  4DV5 I;  1EI1 A;  4DV2 E;  2NPF A;  4PRX A;  1IBK I;  4USM A;  1N34 E;  1FJG I;  3OTO I;  4NXM I;  4JV5 E;  1BKN A;  3WU4 A;  1ELO A;  1HR0 E;  2UUC E;  1H7S A;  3PYD A;  4DR1 I;  4X66 I;  4X64 I;  4DPU A;  4B3M E;  4WUB A;  3B82 A;  4LFA E;  1Z0E A;  1QZR A;  4B3S I;  4JI7 I;  1Z5B A;  1VIS A;  1H7U A;  4KQV A;  2R42 A;  4UTG A;  3QT8 A;  4FWG A;  4LF8 E;  4DXL A;  3J81 C;  2VQF I;  1IBL E;  4JI8 E;  1FNM A;  2WW4 A;  5LMU I;  1I94 E;  2A2C A;  4OX9 E;  4DR3 E; 
#chains in the Genus database with same CATH topology
 4DUZ E;  3K17 A;  4LF4 I;  2V34 A;  4DV7 E;  2HKJ A;  3QT6 A;  2V2Q A;  4IFD B;  3U1K A;  2V8P A;  4GKJ I;  1VI7 A;  5LMN E;  2J65 A;  3T1H I;  5C0X D;  1FKA E;  3CDI A;  2UUA E;  4ZVI A;  2PO2 B;  4YY3 I;  1XNR I;  2GO3 A;  2PO1 B;  3ZKB A;  4JI2 E;  4DR6 I;  2PO0 B;  3NZK A;  1OYS A;  2DEJ A;  4B3T E;  1S4E A;  1UDQ A;  1XMO I;  2E1R A;  2CGE A;  4J3D A;  2AJ4 A;  4NBQ A;  3PS2 A;  2NN6 C;  3ZZU A;  1N32 E;  4LF7 I;  1ZM4 A;  2UXD E;  5K36 D;  4DR5 I;  4JI0 E;  4OO1 E;  2NN6 A;  2UUB E;  2JEB B;  2BA1 G;  2C38 B;  4WUD A;  5JEA F;  1Z0G A;  5DRO A;  1XMQ E;  1N0U A;  4PU9 A;  4DPY A;  4LFC E;  2BM0 A;  1XNQ E;  2VES A;  4JI5 E;  4IZJ D;  4JYA I;  3QT5 A;  5IT9 C;  2VQE E;  1N33 E;  2VF3 A;  4LFB E;  5DRR A;  3B8H A;  4K0K I;  2HK3 A;  4QNK A;  5DNL A;  3ZKD A;  1J5E E;  4JI3 E;  1B63 A;  4HAC B;  4P52 A;  4DR2 E;  3CDJ A;  4DV3 E;  4DV6 I;  2BM1 A;  2ZM6 E;  4YHH E;  4LF6 I;  4B3R E;  4OKG A;  5BR8 I;  4LF9 E;  3T1Y E;  4IFD E;  1HNW E;  1ZM9 A;  2Z5E A;  1N36 E;  1HNZ I;  4DU7 A;  4DV1 E;  3J81 Q;  4UT4 A;  3Q6N A;  2O1U A;  5EKW A;  1IBK E;  1IBM I;  2HKE A;  4N3O A;  5C0X F;  4KHP I;  2JEA A;  3U1Y A;  4P7A A;  3B4T A;  2C37 A;  2HFS A;  4URL A;  5ELW A;  2GS8 A;  4JI1 I;  4DUY I;  3H4L A;  4DR4 I;  4JI6 E;  3L7Z A;  2JT2 A;  4XTJ A;  2PNZ B;  3JAM C;  4OO1 D;  5A2Q C;  4USK A;  1Y4S A;  1Z5A A;  2JE6 B;  3J80 C;  2Z5B B;  5K36 F;  4FW5 A;  2Z5C A;  4JI7 E;  1N34 I;  4X65 E;  3B78 A;  1MU5 A;  4RPF A;  2LJP A;  1P42 A;  1HR0 I;  2UUC I;  4GKK E;  4X62 E;  4IZK A;  1Z0V A;  2WNR B;  3K1J A;  4DV0 I;  2C39 A;  4B3M I;  1NZ0 A;  5JEA C;  4BA1 A;  2BV3 A;  2WP8 B;  1Z0W A;  4DPT A;  5JEA A;  4LFA I;  3PYG A;  2IER A;  4NXN E;  4DR7 I;  4IFD D;  1RHY A;  4DV4 E;  1OJ4 A;  4FW6 A;  2X36 A;  1FI4 A;  4LF8 I;  2UXC E;  1ZXN A;  2DEI A;  4JI8 I;  1FWK A;  2UXB E;  1XXE A;  1UDO A;  3WU3 A;  1B62 A;  1KVK A;  4GKJ E;  1I94 I;  4HXZ A;  4GQU A;  3T1H E;  3WU6 A;  4OX9 I;  2IOQ A;  2OI2 A;  1H72 C;  1Z0C A;  1E3P A;  4DR3 I;  1XNR E;  4FWH A;  4FN5 A;  2IOP A;  4HY1 A;  4DUZ I;  3LNU A;  2F4V E;  4LF5 E;  4DV7 I;  3HJC A;  1KTV A;  4FW9 A;  2E5L E;  3LTO A;  2V2Z A;  5LMN I;  2NN6 D;  5C0X C;  4OO1 F;  4FW3 A;  3H1C A;  5C0X A;  5L3J A;  1S16 A;  2UUA I;  3KRN A;  1UDS A;  2NN6 B;  4I3H A;  3M85 G;  4JI2 I;  2BA0 D;  2PNL A;  4JI4 I;  3D4J A;  4B3T I;  1XHK A;  3P3E A;  2HHH E;  5K36 C;  1N32 I;  2XEX A;  2UXD I;  4JI0 I;  5K36 A;  2UUB I;  1HNX E;  3PYE A;  1YH8 A;  1XMQ I;  4Z7C A;  3J80 Q;  1E3H A;  2UU9 I;  2BR2 A;  4LF6 E;  4IZJ A;  2VQE I;  1KIJ A;  1ZM2 A;  3PYF A;  1Y6Z A;  5IWA E;  1NHI A;  4AM3 A;  4IFD F;  4LFB I;  1ZXM A;  3J7A G;  1HNZ E;  4Z7Y A;  2O1V A;  4DV5 E;  4DU8 A;  1J5E I;  3M85 D;  4M1K A;  3J7A M;  4DV3 I;  1Y60 A;  4KHP E;  2GQ0 A;  1USU A;  4FWD A;  1FJG E;  3OTO E;  3M6A A;  4NXM E;  4QNJ A;  1Z59 A;  2ZM6 I;  4B3R I;  4AQY I;  4LF9 I;  4PRV A;  1HK7 A;  2JEA B;  2O1T A;  5LL6 R;  4LPF A;  4DUY E;  2J7K A;  1HNW I;  4DR1 E;  2C37 B;  1N36 I;  1YHC A;  5DRQ A;  3PS3 A;  4U3D A;  4X66 E;  5FLX C;  4DR4 E;  4X64 E;  4DV2 I;  3L7Z B;  4MDT A;  2NN6 E;  2PNM A;  3M7N D;  3CWV A;  2CVE A;  4MQY A;  4B3S E;  4AIM A;  4EMD A;  4JV5 I;  2Z5C B;  3P3C A;  1A6F A;  1PKP A;  4IS9 A;  1H73 A;  3QT7 A;  4MYU A;  2VQF E;  1PVG A;  4MU0 A;  4JI6 I;  4OO1 C;  1WUU A;  4MYT A;  4DV0 E;  5LMU E;  4OO1 A;  3Q6M A;  4IZK B;  5GMD A;  2O1W A;  1USV A;  2F1D A;  2IES A;  4MU3 A;  1MX0 A;  2C39 B;  4DPX A;  4BA1 B;  4X65 I;  1H74 A;  1ZM3 A;  4BA2 A;  5JEA B;  4LCF A;  1Z5C A;  4LF4 E;  4DR7 E;  1UEK A;  1Y4U A;  4GKK I;  4AID A;  4X62 I;  4LCG A;  1IBL I;  5IT9 Q;  3ZM7 A;  2BA0 G;  4R1F A;  3GON A;  1UDN A;  2HK2 A;  3ZZT A;  1K47 A;  3HUL A;  5EL9 A;  4YY3 E;  1U2R A;  1PIE A;  5GME A;  2HFU A;  4IFD C;  4NXN I;  2O3Z A;  4DV4 I;  3V5R A;  4DR6 E;  4IFD A;  5DRP A;  2UXC I;  4ISA A;  1XMO E;  2UXB I;  4MU4 A;  1Z0T A;  4WUC A;  2Q2E B;  2AE8 A;  4LOM A;  4LF7 E;  2PO2 A;  4DR5 E;  2PO1 A;  3F0N A;  2X7I A;  1R6M A;  2PO0 A;  5C0X B;  2CZ9 A;  2F4V I;  4LF5 I;  4JYA E;  2ZBK B;  4JI4 E;  4LCH A;  1NHJ A;  1NHH A;  3ZZ0 A;  4FW4 A;  1EA6 A;  1Z0B A;  2E5L I;  4K0K E;  2CG9 A;  1RRE A;  2JEB A;  2C38 A;  3LPS A;  1D6T A;  5FLX Q;  3PRY A;  3JAM Q;  3Q1Q A;  5A2Q Q;  5JEA E;  5K36 B;  4LFC I;  4DV6 E;  1XNQ I;  2UU9 E;  2GO4 A;  4JI5 I;  3M7N G;  5BR8 E;  1N33 I;  4JG4 A;  1MG7 A;  2BR2 B;  4HYM A;  4IZJ B;  4HAC A;  2R3V A;  2HHH I;  2A2D A;  1RR9 A;  3P76 A;  3GME A;  4JI3 I;  1HNX I;  3V2U C;  4DPW A;  2ZIT A;  1IBM E;  4DR2 I;  3WU5 A;  5DNX A;  2V2V A;  4YHH I;  1FWL A;  4AQY E;  5FWK A;  4ED4 A;  5IWA I;  3T1Y I;  4JI1 E;  1DAR A;  3K85 A;  1N0V C;  2EFG A;  3PS1 A;  1KKH A;  4DV1 I;  2BA1 D;  4DV5 I;  4FW7 A;  1EI1 A;  4DV2 E;  3GLL A;  2NPF A;  2NN6 F;  4PRX A;  1IBK I;  4MU1 A;  5C0X E;  4USM A;  1OYP A;  1N34 E;  1FJG I;  3HKM A;  3OTO I;  4NXM I;  3P06 A;  4JV5 E;  1BKN A;  3WU4 A;  1ELO A;  1HR0 E;  2UUC E;  2PNZ A;  1H7S A;  3PYD A;  4DR1 I;  4X66 I;  2JE6 A;  2Z5B A;  4X64 I;  4DPU A;  1R6L A;  4B3M E;  4WUB A;  3B82 A;  3UHM A;  5JEA D;  5K36 E;  4LFA E;  4OZE A;  1Y5Y A;  1Z0E A;  1QZR A;  4OO1 B;  4B3S I;  4JI7 I;  1Z5B A;  1VIS A;  1H7U A;  4KQV A;  4U3B A;  2WNR A;  2R42 A;  4UTG A;  4BA2 B;  3QT8 A;  4FWG A;  4LF8 E;  3P3G A;  4DXL A;  3J81 C;  2VQF I;  1IBL E;  4JI8 E;  2WP8 A;  1FNM A;  2WW4 A;  5LMU I;  1I94 E;  2A2C A;  3DD6 A;  3GCM A;  4OX9 E;  1OYR A;  4DR3 E; 
#chains in the Genus database with same CATH homology
 4DUZ E;  3K17 A;  4LF4 I;  2V34 A;  4DV7 E;  2HKJ A;  3QT6 A;  2V2Q A;  2V8P A;  4GKJ I;  5LMN E;  3T1H I;  1FKA E;  2UUA E;  4ZVI A;  4YY3 I;  1XNR I;  3ZKB A;  4JI2 E;  4DR6 I;  2DEJ A;  4B3T E;  1S4E A;  1XMO I;  2E1R A;  2CGE A;  2AJ4 A;  3ZZU A;  1N32 E;  4LF7 I;  1ZM4 A;  2UXD E;  4DR5 I;  4JI0 E;  2UUB E;  4WUD A;  1Z0G A;  1XMQ E;  1N0U A;  4PU9 A;  4DPY A;  4LFC E;  2BM0 A;  1XNQ E;  4JI5 E;  4IZJ D;  4JYA I;  3QT5 A;  5IT9 C;  2VQE E;  1N33 E;  2VF3 A;  4LFB E;  3B8H A;  4K0K I;  2HK3 A;  3ZKD A;  1J5E E;  4JI3 E;  1B63 A;  4HAC B;  4P52 A;  4DR2 E;  4DV3 E;  4DV6 I;  2BM1 A;  2ZM6 E;  4YHH E;  4LF6 I;  4B3R E;  5BR8 I;  4LF9 E;  3T1Y E;  1HNW E;  1ZM9 A;  2Z5E A;  1N36 E;  1HNZ I;  4DU7 A;  4DV1 E;  3J81 Q;  4UT4 A;  3Q6N A;  2O1U A;  1IBK E;  1IBM I;  2HKE A;  4N3O A;  4KHP I;  4P7A A;  2HFS A;  4URL A;  2GS8 A;  4JI1 I;  4DUY I;  3H4L A;  4DR4 I;  4JI6 E;  4XTJ A;  3JAM C;  5A2Q C;  4USK A;  1Y4S A;  1Z5A A;  3J80 C;  2Z5B B;  2Z5C A;  4JI7 E;  1N34 I;  4X65 E;  3B78 A;  1MU5 A;  4RPF A;  2LJP A;  1HR0 I;  2UUC I;  4GKK E;  4X62 E;  4IZK A;  1Z0V A;  3K1J A;  4DV0 I;  4B3M I;  1NZ0 A;  2BV3 A;  1Z0W A;  4DPT A;  4LFA I;  3PYG A;  4NXN E;  4DR7 I;  4DV4 E;  1OJ4 A;  2X36 A;  1FI4 A;  4LF8 I;  2UXC E;  1ZXN A;  2DEI A;  4JI8 I;  1FWK A;  2UXB E;  3WU3 A;  1B62 A;  1KVK A;  4GKJ E;  1I94 I;  4HXZ A;  3T1H E;  3WU6 A;  4OX9 I;  2IOQ A;  2OI2 A;  1H72 C;  1Z0C A;  4DR3 I;  1XNR E;  4FWH A;  4FN5 A;  2IOP A;  4HY1 A;  4DUZ I;  3LNU A;  2F4V E;  4LF5 E;  4DV7 I;  3HJC A;  1KTV A;  4FW9 A;  2E5L E;  3LTO A;  2V2Z A;  5LMN I;  5L3J A;  1S16 A;  2UUA I;  4I3H A;  4JI2 I;  2PNL A;  4JI4 I;  3D4J A;  4B3T I;  1XHK A;  2HHH E;  1N32 I;  2XEX A;  2UXD I;  4JI0 I;  2UUB I;  1HNX E;  3PYE A;  1XMQ I;  4Z7C A;  3J80 Q;  2UU9 I;  4LF6 E;  4IZJ A;  2VQE I;  1KIJ A;  1ZM2 A;  3PYF A;  1Y6Z A;  5IWA E;  1NHI A;  4LFB I;  1ZXM A;  3J7A G;  1HNZ E;  4Z7Y A;  2O1V A;  4DV5 E;  4DU8 A;  1J5E I;  4M1K A;  3J7A M;  4DV3 I;  4KHP E;  2GQ0 A;  1USU A;  4FWD A;  1FJG E;  3OTO E;  3M6A A;  4NXM E;  1Z59 A;  2ZM6 I;  4B3R I;  4AQY I;  4LF9 I;  4PRV A;  1HK7 A;  2O1T A;  5LL6 R;  4DUY E;  2J7K A;  1HNW I;  4DR1 E;  1N36 I;  4X66 E;  4DR4 E;  5FLX C;  4X64 E;  4DV2 I;  2PNM A;  3CWV A;  4B3S E;  4EMD A;  4JV5 I;  2Z5C B;  1A6F A;  1PKP A;  1H73 A;  3QT7 A;  4MYU A;  2VQF E;  1PVG A;  4JI6 I;  1WUU A;  4MYT A;  4DV0 E;  5LMU E;  3Q6M A;  4IZK B;  5GMD A;  2O1W A;  1USV A;  1MX0 A;  4DPX A;  4X65 I;  1H74 A;  1ZM3 A;  4DR7 E;  1Z5C A;  4LF4 E;  1UEK A;  1Y4U A;  4GKK I;  4X62 I;  1IBL I;  5IT9 Q;  3ZM7 A;  4R1F A;  3GON A;  2HK2 A;  3ZZT A;  1K47 A;  3HUL A;  4YY3 E;  1U2R A;  1PIE A;  5GME A;  2HFU A;  4NXN I;  4DV4 I;  3V5R A;  4DR6 E;  2UXC I;  2UXB I;  1XMO E;  1Z0T A;  4WUC A;  2Q2E B;  4LF7 E;  4DR5 E;  3F0N A;  2X7I A;  2CZ9 A;  2F4V I;  4LF5 I;  4JYA E;  2ZBK B;  4JI4 E;  1NHJ A;  1NHH A;  3ZZ0 A;  1EA6 A;  1Z0B A;  2E5L I;  4K0K E;  2CG9 A;  1RRE A;  1D6T A;  3LPS A;  5FLX Q;  3PRY A;  3JAM Q;  3Q1Q A;  5A2Q Q;  4LFC I;  4DV6 E;  1XNQ I;  2UU9 E;  4JI5 I;  5BR8 E;  1N33 I;  4JG4 A;  1MG7 A;  4HYM A;  4IZJ B;  4HAC A;  2R3V A;  2HHH I;  2A2D A;  1RR9 A;  4JI3 I;  1HNX I;  3V2U C;  4DPW A;  2ZIT A;  1IBM E;  4DR2 I;  3WU5 A;  2V2V A;  4YHH I;  1FWL A;  4AQY E;  5FWK A;  4ED4 A;  5IWA I;  3T1Y I;  4JI1 E;  1DAR A;  3K85 A;  1N0V C;  2EFG A;  1KKH A;  4DV1 I;  4DV5 I;  1EI1 A;  4DV2 E;  2NPF A;  4PRX A;  1IBK I;  4USM A;  1N34 E;  1FJG I;  3OTO I;  4NXM I;  3P06 A;  4JV5 E;  1BKN A;  3WU4 A;  1ELO A;  1HR0 E;  2UUC E;  1H7S A;  3PYD A;  4DR1 I;  4X66 I;  2Z5B A;  4X64 I;  4DPU A;  4B3M E;  4WUB A;  3B82 A;  4LFA E;  1Z0E A;  1QZR A;  4B3S I;  4JI7 I;  1Z5B A;  1VIS A;  1H7U A;  4KQV A;  2R42 A;  4UTG A;  3QT8 A;  4FWG A;  4LF8 E;  4DXL A;  3J81 C;  2VQF I;  1IBL E;  4JI8 E;  1FNM A;  2WW4 A;  5LMU I;  1I94 E;  2A2C A;  4OX9 E;  4DR3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...