1HNZI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzI00
4DU7A 3J81C 5IT9Q 1IBKI 4LFAE 4LFCI 3T1HE 2WW4A 2UU9E 3T1YI 4AQYI 2X7IA 4LFCE 3V5RA 4HY1A 1RREA 4DR6I 2R3VA 4DPYA 1D6TA 4DR3E 2V2QA 3PYEA 4DV0E 4K0KE 4B3TI 1MX0A 1J5EI 3PYGA 5IWAI 4DR7E 3OTOE 2DEJA 4DV3I 2UXCE 4X64E 1Z0EA 4UTGA 2HHHE 4LFBE 2F4VE 4JI6I 4DR1I 1IBME 2Q2EB 3J80Q 2XEXA 1ELOA 1Z0BA 1PKPA 4JI4I 4NXME 3K1JA 3JAMQ 1IBLE 4USKA 1N32E 1HNWE 5GMDA 3LNUA 1K47A 2V8PA 1UEKA 4LF4E 4Z7YA 1NHIA 5IT9C 1H7SA 2CZ9A 4HACB 4JI3I 4LF8E 3V2UC 3J7AG 4OX9E 4DV4E 1XNRI 5GMEA 4LF8I 3ZZTA 2UUBI 4WUCA 1ZXNA 3J7AM 4PRXA 2HK2A 4KQVA 3GONA 2EFGA 4LF4I 4JI5E 2J7KA 1FKAE 2BM1A 4YHHI 4DV6I 1KTVA 1IBKE 3HULA 3OTOI 4B3SE 4DR2E 3QT8A 4FWHA 1H74A 1Z5BA 4B3MI 4DPUA 4DR2I 1QZRA 1U2RA 4JI4E 4NXMI 4UT4A 1H73A 2HFUA 4YHHE 5LMUI 4DXLA 4JI8I 1HNXI 1I94I 1Z5AA 4EMDA 4R1FA 1PIEA 4DV2E 1Z0CA 1B62A 4X64I 2UXCI 4MYTA 2V2VA 3F0NA 1XMQE 4URLA 1XNQE 1N34I 4JV5I 1N0UA 3WU3A 5LMNE 2X36A 4JI3E 4DV2I 5LL6R 2UXDE 4JI7E 4LF7E 1MG7A 2UUAI 4X65E 1H7UA 1I94E 1MU5A 1HR0E 4DUZE 1NHHA 4B3RE 5FLXQ 3B78A 2GS8A 4DV1I 3B82A 4DV7I 2R42A 1FI4A 2UXBI 4YY3I 4JI1I 4DUYE 4XTJA 1Z0TA 4X62E 4DV6E 1Z0VA 3D4JA 1ZM9A 2UUCI 1OJ4A 4JI0E 4FN5A 4LF6E 4P52A 1FNMA 3ZM7A 1BKNA 4KHPI 2VQEI 2BV3A 1DARA 1FWKA 4X62I 1HNZE 4ZVIA 4HACA 4DV4I 4DR7I 5BR8I 5IWAE 2E1RA 1FJGE 4M1KA 1HNZI 1NHJA 3H4LA 4DR6E 2HKJA 1N0VC 3B8HA 1HR0I 4NXNE 3QT6A 3WU6A 4JI0I 1Z0WA 1ZXMA 2UU9I 2A2DA 4DR5I 1ZM4A 3M6AA 2ZM6E 4LF7I 3ZKBA 2ZITA 5A2QC 1N33I 4B3ME 3J81Q 4DV7E 4JYAI 4DV1E 2VF3A 1PVGA 3WU4A 2AJ4A 4X66I 4DUZI 2LJPA 1XHKA 3K17A 4USMA 4DU8A 4X65I 4DV5E 2UUAE 3PYDA 4DR1E 4DV5I 4LF9E 4FW9A 4GKJI 1XMOI 1J5EE 2ZBKB 2VQFI 4B3TE 2OI2A 4ED4A 1XMOE 4GKJE 4Z7CA 4DR3I 2DEIA 4LF9I 1S4EA 3WU5A 3J80C 1NZ0A 3ZZUA 4DR5E 3CWVA 1EA6A 3T1YE 4JI5I 4PU9A 4MYUA 5L3JA 4X66E 2NPFA 4JYAE 1Z59A 2VQFE 1XNRE 4OX9I 4B3SI 1A6FA 1N32I 1IBLI 4WUDA 2A2CA 2ZM6I 4FWGA 2HK3A 2VQEE 1KKHA 4LF5E 4NXNI 1FWLA 3Q1QA 4KHPE 1WUUA 4HXZA 4PRVA 1IBMI 1N36E 2E5LI 4LF5I 2UUCE 2UUBE 4DPWA 1H72C 4DV3E 4DPXA 1FJGI 5FLXC 3LPSA 1N33E 3LTOA 2UXBE 4HYMA 1HNWI 1KIJA 2V34A 4P7AA 1Z0GA 4B3RI 4DR4I 3QT5A 4RPFA 1S16A 4LF6I 2HKEA 1B63A 1ZM2A 4DR4E 1KVKA 4JI7I 2UXDI 4JI6E 2HHHI 4LFBI 1EI1A 2HFSA 4DUYI 4JI1E 5LMNI 4YY3E 5BR8E 4GKKI 4JV5E 1N34E 1Z5CA 4K0KI 4JG4A 1ZM3A 2V2ZA 1N36I 2E5LE 4FWDA 4JI2I 2BM0A 3JAMC 4AQYE 2F4VI 4JI2E 1RR9A 4JI8E 1HNXE 5LMUE 3T1HI 4I3HA 4LFAI 3PYFA 3ZKDA 1VISA 4WUBA 1XNQI 4DPTA 1XMQI 4DV0I 3ZZ0A 5A2QQ 4GKKE 3QT7A
chains in the Genus database with same CATH superfamily
4DU7A 2NN6C 3J81C 4AM3A 5IT9Q 1IBKI 4LFAE 4LFCI 3T1HE 2WW4A 2JEBB 2UU9E 3T1YI 1E3PA 5C0XC 4AQYI 2X7IA 4LFCE 3V5RA 4HY1A 3M85D 1RREA 4DR6I 2R3VA 3K85A 2NN6D 4DPYA 1XXEA 1D6TA 3HJCA 5JEAD 4DR3E 2V2QA 3PYEA 4DV0E 4FW6A 4K0KE 4B3TI 1MX0A 1Y4UA 2PNLA 4IFDA 1J5EI 3PYGA 4OKGA 3U1KA 2PO2A 5IWAI 4DR7E 3OTOE 2DEJA 4DV3I 2UXCE 4X64E 4LOMA 2Z5CA 4IFDE 1Z0EA 4UTGA 2HHHE 4LFBE 2F4VE 4JI6I 4DR1I 5FWKA 1UDSA 1IBME 2Q2EB 3J80Q 2XEXA 1ELOA 4OO1F 1Z0BA 1PKPA 2BA1G 4JI4I 4NXME 4FW7A 3K1JA 3JAMQ 1IBLE 4USKA 1N32E 4FW3A 1HNWE 3UHMA 2PO0B 5GMDA 3LNUA 3KRNA 4QNJA 1K47A 2V8PA 4LCFA 1UEKA 4LF4E 5ELWA 4Z7YA 1NHIA 5DNLA 4IZJD 5IT9C 5JEAA 1H7SA 2Z5BA 2CZ9A 4HACB 4JI3I 5DNXA 4LF8E 3V2UC 3J7AG 4OX9E 4DV4E 1YHCA 1XNRI 3Q6NA 5GMEA 4LF8I 5DRRA 5EKWA 3ZZTA 2UUBI 4WUCA 1ZXNA 3J7AM 2NN6B 4MU0A 2AE8A 4PRXA 2HK2A 4MDTA 1OYRA 4MU4A 4KQVA 3GONA 3P3EA 2EFGA 4LF4I 2C39A 2O1TA 4JI5E 3U1YA 2J7KA 1FKAE 2BM1A 4YHHI 4DV6I 1KTVA 1IBKE 3HULA 3OTOI 4B3SE 4DR2E 3QT8A 4FWHA 2O1WA 1YH8A 5DROA 1H74A 3H1CA 4OO1D 4AIDA 1Z5BA 1R6MA 4B3MI 2VESA 4DPUA 4DR2I 2PNZA 1QZRA 4NBQA 1U2RA 2PO0A 4JI4E 4NXMI 4FW4A 2JT2A 4UT4A 1H73A 2HFUA 4YHHE 5LMUI 5K36D 4DXLA 4JI8I 1HNXI 2PNMA 1I94I 3L7ZB 1Z5AA 2NN6F 4EMDA 4R1FA 5EL9A 1PIEA 4DV2E 1Z0CA 2JEBA 1B62A 5K36E 4X64I 2UXCI 4MYTA 5JEAB 2V2VA 1OYPA 3F0NA 4IFDF 1XMQE 4URLA 4LCHA 1N34I 1XNQE 4JV5I 5JEAC 1N0UA 3WU3A 5LMNE 4LPFA 2X36A 4IFDB 4JI3E 4DV2I 5LL6R 2UXDE 4JI7E 3PS1A 1MG7A 4LF7E 2UUAI 4X65E 3CDJA 1H7UA 1I94E 1MU5A 2Z5CB 3P3GA 2JE6A 1HR0E 4DUZE 1NHHA 2Z5EA 5FLXQ 3B78A 4B3RE 2GS8A 4DV1I 3B82A 4DV7I 2R42A 1FI4A 2UXBI 4YY3I 4JI1I 2O3ZA 4DUYE 4OO1B 2PO1A 4LCGA 4XTJA 2WP8B 1Z0TA 4X62E 4DV6E 1Z0VA 3D4JA 1ZM9A 2UUCI 1OJ4A 4FN5A 4P52A 2PNZB 1FNMA 4JI0E 4LF6E 3ZM7A 3NZKA 3CDIA 1BKNA 2BA1D 1RHYA 4KHPI 2VQEI 1USVA 2BV3A 3L7ZA 1DARA 1FWKA 4X62I 1HNZE 4ZVIA 4HACA 4DV4I 4DR7I 5BR8I 5IWAE 2E1RA 1FJGE 4M1KA 4MU3A 2C37A 1HNZI 2WNRA 4FW5A 1NHJA 4IZKB 3H4LA 3HKMA 4U3BA 4DR6E 2HKJA 1N0VC 3B8HA 1HR0I 4BA2B 4NXNE 4OZEA 5DRQA 3QT6A 3WU6A 4JI0I 1Z0WA 2NN6A 2GO3A 1ZXMA 2A2DA 2UU9I 4DR5I 1ZM4A 3M6AA 2ZM6E 4LF7I 2IERA 3ZKBA 1Y5YA 2CG9A 3DD6A 2ZITA 4MU1A 1R6LA 2JE6B 5A2QC 4OO1C 1Y4SA 1N33I 4B3ME 2C38B 3J81Q 4DV7E 5JEAE 4JYAI 4DV1E 2VF3A 1PVGA 2NN6E 5DRPA 3P76A 3WU4A 2AJ4A 4X66I 1OYSA 4DUZI 2LJPA 1XHKA 3K17A 5K36F 5K36B 4USMA 3M7ND 4DU8A 4X65I 4DV5E 4ISAA 2UUAE 4BA1B 5C0XD 5C0XB 3PYDA 4DR1E 4IZJB 3PRYA 4DV5I 2F1DA 1HK7A 3PS3A 4LF9E 2BR2B 4FW9A 4GKJI 1XMOI 1E3HA 1J5EE 2ZBKB 2VQFI 4B3TE 2OI2A 4MQYA 4GQUA 4ED4A 1XMOE 4GKJE 4Z7CA 4DR3I 3PS2A 4QNKA 2DEIA 3GMEA 1P42A 5C0XF 4IFDC 4LF9I 1S4EA 3WU5A 3J80C 2GO4A 5JEAF 2C37B 1NZ0A 3ZZUA 3P06A 2IOQA 4DR5E 3CWVA 1USUA 4IZKA 1EA6A 3T1YE 4JI5I 4PU9A 4MYUA 5L3JA 3P3CA 4X66E 4BA2A 4J3DA 2NPFA 3B4TA 4JYAE 1Z59A 2VQFE 2CVEA 1XNRE 2JEAA 4OX9I 4B3SI 1A6FA 2GQ0A 1N32I 1IBLI 2O1VA 4WUDA 4N3OA 2A2CA 2ZM6I 4FWGA 4OO1A 1Y60A 2PO1B 4U3DA 2WP8A 2HK3A 2VQEE 1KKHA 5C0XE 4LF5E 4NXNI 1FWLA 3Q1QA 4KHPE 1WUUA 4HXZA 4PRVA 1IBMI 1N36E 2E5LI 4IS9A 4LF5I 5K36A 2UUCE 1VI7A 2O1UA 4IFDD 4BA1A 5C0XA 2UUBE 4DPWA 1H72C 3GCMA 4DV3E 3Q6MA 4IZJA 4DPXA 1FJGI 4OO1E 2BR2A 3GLLA 5FLXC 3LPSA 1N33E 3LTOA 2UXBE 4HYMA 1HNWI 1KIJA 2V34A 4P7AA 1Z0GA 4B3RI 1UDOA 2Z5BB 2WNRB 1UDNA 3QT5A 4DR4I 1UDQA 4RPFA 1S16A 4LF6I 2HKEA 1B63A 1ZM2A 4DR4E 1KVKA 1Y6ZA 4JI7I 2UXDI 4JI6E 2HHHI 4LFBI 1EI1A 2PO2B 2HFSA 4DUYI 2CGEA 4JI1E 5LMNI 4YY3E 5BR8E 4GKKI 2J65A 4JV5E 1N34E 1Z5CA 4K0KI 2IOPA 4JG4A 1ZM3A 2C38A 2C39B 2V2ZA 2JEAB 1N36I 2E5LE 4FWDA 4JI2I 2BM0A 3M85G 3JAMC 4AQYE 2IESA 2F4VI 4JI2E 1RR9A 5K36C 4JI8E 1HNXE 5LMUE 3T1HI 4I3HA 4LFAI 2BA0D 3PYFA 3ZKDA 3M7NG 1VISA 4WUBA 1XNQI 4DPTA 1XMQI 4DV0I 3ZZ0A 5A2QQ 4GKKE 3QT7A 4AIMA 2BA0G
chains in the Genus database with same CATH topology
4DU7A 3J81C 5IT9Q 1IBKI 4LFAE 4LFCI 3T1HE 2WW4A 2UU9E 3T1YI 4AQYI 2X7IA 4LFCE 3V5RA 4HY1A 1RREA 4DR6I 2R3VA 3K85A 4DPYA 1D6TA 3HJCA 4DR3E 2V2QA 3PYEA 4DV0E 4K0KE 4B3TI 1MX0A 1Y4UA 2PNLA 1J5EI 3PYGA 5IWAI 4DR7E 3OTOE 2DEJA 4DV3I 2UXCE 4X64E 2Z5CA 1Z0EA 4UTGA 2HHHE 4LFBE 2F4VE 4JI6I 4DR1I 5FWKA 1IBME 2Q2EB 3J80Q 2XEXA 1ELOA 1Z0BA 1PKPA 4JI4I 4NXME 3K1JA 3JAMQ 1IBLE 4USKA 1N32E 1HNWE 5GMDA 3LNUA 1K47A 2V8PA 1UEKA 4LF4E 4Z7YA 1NHIA 4IZJD 5IT9C 1H7SA 2Z5BA 2CZ9A 4HACB 4JI3I 4LF8E 3V2UC 3J7AG 4OX9E 4DV4E 1XNRI 3Q6NA 5GMEA 4LF8I 3ZZTA 2UUBI 4WUCA 1ZXNA 3J7AM 4PRXA 2HK2A 4KQVA 3GONA 2EFGA 4LF4I 2O1TA 4JI5E 2J7KA 1FKAE 2BM1A 4YHHI 4DV6I 1KTVA 1IBKE 3HULA 3OTOI 4B3SE 4DR2E 3QT8A 4FWHA 2O1WA 1H74A 1Z5BA 4B3MI 4DPUA 4DR2I 1QZRA 1U2RA 4JI4E 4NXMI 4UT4A 1H73A 2HFUA 4YHHE 5LMUI 4DXLA 4JI8I 1HNXI 2PNMA 1I94I 1Z5AA 4EMDA 4R1FA 1PIEA 4DV2E 1Z0CA 1B62A 4X64I 2UXCI 4MYTA 2V2VA 3F0NA 1XMQE 4URLA 1XNQE 1N34I 4JV5I 1N0UA 3WU3A 5LMNE 2X36A 4JI3E 4DV2I 5LL6R 2UXDE 4JI7E 4LF7E 1MG7A 2UUAI 4X65E 1H7UA 1I94E 1MU5A 2Z5CB 1HR0E 4DUZE 1NHHA 2Z5EA 5FLXQ 3B78A 4B3RE 2GS8A 4DV1I 3B82A 4DV7I 2R42A 1FI4A 2UXBI 4YY3I 4JI1I 4DUYE 4XTJA 1Z0TA 4X62E 4DV6E 1Z0VA 3D4JA 1ZM9A 2UUCI 1OJ4A 4FN5A 4P52A 4JI0E 1FNMA 4LF6E 3ZM7A 1BKNA 4KHPI 2VQEI 1USVA 2BV3A 1DARA 1FWKA 4X62I 1HNZE 4ZVIA 4HACA 4DV4I 4DR7I 5BR8I 5IWAE 2E1RA 1FJGE 4M1KA 1HNZI 1NHJA 4IZKB 3H4LA 4DR6E 2HKJA 1N0VC 3B8HA 1HR0I 4NXNE 3QT6A 3WU6A 4JI0I 1Z0WA 1ZXMA 2UU9I 2A2DA 4DR5I 1ZM4A 3M6AA 2ZM6E 4LF7I 3ZKBA 2CG9A 2ZITA 5A2QC 1Y4SA 1N33I 4B3ME 3J81Q 4DV7E 4JYAI 4DV1E 2VF3A 1PVGA 3WU4A 2AJ4A 4X66I 4DUZI 2LJPA 1XHKA 3K17A 4USMA 4DU8A 4X65I 4DV5E 2UUAE 3PYDA 4DR1E 4IZJB 3PRYA 4DV5I 1HK7A 4LF9E 4FW9A 4GKJI 1XMOI 1J5EE 2ZBKB 2VQFI 4B3TE 2OI2A 4ED4A 1XMOE 4GKJE 4Z7CA 4DR3I 2DEIA 4LF9I 1S4EA 3WU5A 3J80C 1NZ0A 3ZZUA 3P06A 2IOQA 4DR5E 3CWVA 1USUA 4IZKA 1EA6A 3T1YE 4JI5I 4PU9A 4MYUA 5L3JA 4X66E 2NPFA 4JYAE 1Z59A 2VQFE 1XNRE 4OX9I 4B3SI 1A6FA 2GQ0A 1N32I 1IBLI 2O1VA 4WUDA 4N3OA 2A2CA 2ZM6I 4FWGA 2HK3A 2VQEE 1KKHA 4LF5E 4NXNI 1FWLA 3Q1QA 4KHPE 1WUUA 4HXZA 4PRVA 1IBMI 1N36E 2E5LI 4LF5I 2UUCE 2O1UA 2UUBE 4DPWA 1H72C 4DV3E 3Q6MA 4IZJA 4DPXA 1FJGI 5FLXC 3LPSA 1N33E 3LTOA 2UXBE 4HYMA 1HNWI 1KIJA 2V34A 4P7AA 1Z0GA 4B3RI 2Z5BB 3QT5A 4DR4I 4RPFA 1S16A 4LF6I 2HKEA 1B63A 1ZM2A 4DR4E 1KVKA 1Y6ZA 4JI7I 2UXDI 4JI6E 2HHHI 4LFBI 1EI1A 2HFSA 4DUYI 2CGEA 4JI1E 5LMNI 4YY3E 5BR8E 4GKKI 4JV5E 1N34E 1Z5CA 4K0KI 2IOPA 4JG4A 1ZM3A 2V2ZA 1N36I 2E5LE 4FWDA 4JI2I 2BM0A 3JAMC 4AQYE 2F4VI 4JI2E 1RR9A 4JI8E 1HNXE 5LMUE 3T1HI 4I3HA 4LFAI 3PYFA 3ZKDA 1VISA 4WUBA 1XNQI 4DPTA 1XMQI 4DV0I 3ZZ0A 5A2QQ 4GKKE 3QT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DU7 A;  3J81 C;  5IT9 Q;  1IBK I;  4LFA E;  4LFC I;  3T1H E;  2WW4 A;  2UU9 E;  3T1Y I;  4AQY I;  2X7I A;  4LFC E;  3V5R A;  4HY1 A;  1RRE A;  4DR6 I;  2R3V A;  4DPY A;  1D6T A;  4DR3 E;  2V2Q A;  3PYE A;  4DV0 E;  4K0K E;  4B3T I;  1MX0 A;  1J5E I;  3PYG A;  5IWA I;  4DR7 E;  3OTO E;  2DEJ A;  4DV3 I;  2UXC E;  4X64 E;  1Z0E A;  4UTG A;  2HHH E;  4LFB E;  2F4V E;  4JI6 I;  4DR1 I;  1IBM E;  2Q2E B;  3J80 Q;  2XEX A;  1ELO A;  1Z0B A;  1PKP A;  4JI4 I;  4NXM E;  3K1J A;  3JAM Q;  1IBL E;  4USK A;  1N32 E;  1HNW E;  5GMD A;  3LNU A;  1K47 A;  2V8P A;  1UEK A;  4LF4 E;  4Z7Y A;  1NHI A;  5IT9 C;  1H7S A;  2CZ9 A;  4HAC B;  4JI3 I;  4LF8 E;  3V2U C;  3J7A G;  4OX9 E;  4DV4 E;  1XNR I;  5GME A;  4LF8 I;  3ZZT A;  2UUB I;  4WUC A;  1ZXN A;  3J7A M;  4PRX A;  2HK2 A;  4KQV A;  3GON A;  2EFG A;  4LF4 I;  4JI5 E;  2J7K A;  1FKA E;  2BM1 A;  4YHH I;  4DV6 I;  1KTV A;  1IBK E;  3HUL A;  3OTO I;  4B3S E;  4DR2 E;  3QT8 A;  4FWH A;  1H74 A;  1Z5B A;  4B3M I;  4DPU A;  4DR2 I;  1QZR A;  1U2R A;  4JI4 E;  4NXM I;  4UT4 A;  1H73 A;  2HFU A;  4YHH E;  5LMU I;  4DXL A;  4JI8 I;  1HNX I;  1I94 I;  1Z5A A;  4EMD A;  4R1F A;  1PIE A;  4DV2 E;  1Z0C A;  1B62 A;  4X64 I;  2UXC I;  4MYT A;  2V2V A;  3F0N A;  1XMQ E;  4URL A;  1XNQ E;  1N34 I;  4JV5 I;  1N0U A;  3WU3 A;  5LMN E;  2X36 A;  4JI3 E;  4DV2 I;  5LL6 R;  2UXD E;  4JI7 E;  4LF7 E;  1MG7 A;  2UUA I;  4X65 E;  1H7U A;  1I94 E;  1MU5 A;  1HR0 E;  4DUZ E;  1NHH A;  4B3R E;  5FLX Q;  3B78 A;  2GS8 A;  4DV1 I;  3B82 A;  4DV7 I;  2R42 A;  1FI4 A;  2UXB I;  4YY3 I;  4JI1 I;  4DUY E;  4XTJ A;  1Z0T A;  4X62 E;  4DV6 E;  1Z0V A;  3D4J A;  1ZM9 A;  2UUC I;  1OJ4 A;  4JI0 E;  4FN5 A;  4LF6 E;  4P52 A;  1FNM A;  3ZM7 A;  1BKN A;  4KHP I;  2VQE I;  2BV3 A;  1DAR A;  1FWK A;  4X62 I;  1HNZ E;  4ZVI A;  4HAC A;  4DV4 I;  4DR7 I;  5BR8 I;  5IWA E;  2E1R A;  1FJG E;  4M1K A;  1HNZ I;  1NHJ A;  3H4L A;  4DR6 E;  2HKJ A;  1N0V C;  3B8H A;  1HR0 I;  4NXN E;  3QT6 A;  3WU6 A;  4JI0 I;  1Z0W A;  1ZXM A;  2UU9 I;  2A2D A;  4DR5 I;  1ZM4 A;  3M6A A;  2ZM6 E;  4LF7 I;  3ZKB A;  2ZIT A;  5A2Q C;  1N33 I;  4B3M E;  3J81 Q;  4DV7 E;  4JYA I;  4DV1 E;  2VF3 A;  1PVG A;  3WU4 A;  2AJ4 A;  4X66 I;  4DUZ I;  2LJP A;  1XHK A;  3K17 A;  4USM A;  4DU8 A;  4X65 I;  4DV5 E;  2UUA E;  3PYD A;  4DR1 E;  4DV5 I;  4LF9 E;  4FW9 A;  4GKJ I;  1XMO I;  1J5E E;  2ZBK B;  2VQF I;  4B3T E;  2OI2 A;  4ED4 A;  1XMO E;  4GKJ E;  4Z7C A;  4DR3 I;  2DEI A;  4LF9 I;  1S4E A;  3WU5 A;  3J80 C;  1NZ0 A;  3ZZU A;  4DR5 E;  3CWV A;  1EA6 A;  3T1Y E;  4JI5 I;  4PU9 A;  4MYU A;  5L3J A;  4X66 E;  2NPF A;  4JYA E;  1Z59 A;  2VQF E;  1XNR E;  4OX9 I;  4B3S I;  1A6F A;  1N32 I;  1IBL I;  4WUD A;  2A2C A;  2ZM6 I;  4FWG A;  2HK3 A;  2VQE E;  1KKH A;  4LF5 E;  4NXN I;  1FWL A;  3Q1Q A;  4KHP E;  1WUU A;  4HXZ A;  4PRV A;  1IBM I;  1N36 E;  2E5L I;  4LF5 I;  2UUC E;  2UUB E;  4DPW A;  1H72 C;  4DV3 E;  4DPX A;  1FJG I;  5FLX C;  3LPS A;  1N33 E;  3LTO A;  2UXB E;  4HYM A;  1HNW I;  1KIJ A;  2V34 A;  4P7A A;  1Z0G A;  4B3R I;  4DR4 I;  3QT5 A;  4RPF A;  1S16 A;  4LF6 I;  2HKE A;  1B63 A;  1ZM2 A;  4DR4 E;  1KVK A;  4JI7 I;  2UXD I;  4JI6 E;  2HHH I;  4LFB I;  1EI1 A;  2HFS A;  4DUY I;  4JI1 E;  5LMN I;  4YY3 E;  5BR8 E;  4GKK I;  4JV5 E;  1N34 E;  1Z5C A;  4K0K I;  4JG4 A;  1ZM3 A;  2V2Z A;  1N36 I;  2E5L E;  4FWD A;  4JI2 I;  2BM0 A;  3JAM C;  4AQY E;  2F4V I;  4JI2 E;  1RR9 A;  4JI8 E;  1HNX E;  5LMU E;  3T1H I;  4I3H A;  4LFA I;  3PYF A;  3ZKD A;  1VIS A;  4WUB A;  1XNQ I;  4DPT A;  1XMQ I;  4DV0 I;  3ZZ0 A;  5A2Q Q;  4GKK E;  3QT7 A; 
#chains in the Genus database with same CATH topology
 4DU7 A;  2NN6 C;  3J81 C;  4AM3 A;  5IT9 Q;  1IBK I;  4LFA E;  4LFC I;  3T1H E;  2WW4 A;  2JEB B;  2UU9 E;  3T1Y I;  1E3P A;  5C0X C;  4AQY I;  2X7I A;  4LFC E;  3V5R A;  4HY1 A;  3M85 D;  1RRE A;  4DR6 I;  2R3V A;  3K85 A;  2NN6 D;  4DPY A;  1XXE A;  1D6T A;  3HJC A;  5JEA D;  4DR3 E;  2V2Q A;  3PYE A;  4DV0 E;  4FW6 A;  4K0K E;  4B3T I;  1MX0 A;  1Y4U A;  2PNL A;  4IFD A;  1J5E I;  3PYG A;  4OKG A;  3U1K A;  2PO2 A;  5IWA I;  4DR7 E;  3OTO E;  2DEJ A;  4DV3 I;  2UXC E;  4X64 E;  4LOM A;  2Z5C A;  4IFD E;  1Z0E A;  4UTG A;  2HHH E;  4LFB E;  2F4V E;  4JI6 I;  4DR1 I;  5FWK A;  1UDS A;  1IBM E;  2Q2E B;  3J80 Q;  2XEX A;  1ELO A;  4OO1 F;  1Z0B A;  1PKP A;  2BA1 G;  4JI4 I;  4NXM E;  4FW7 A;  3K1J A;  3JAM Q;  1IBL E;  4USK A;  1N32 E;  4FW3 A;  1HNW E;  3UHM A;  2PO0 B;  5GMD A;  3LNU A;  3KRN A;  4QNJ A;  1K47 A;  2V8P A;  4LCF A;  1UEK A;  4LF4 E;  5ELW A;  4Z7Y A;  1NHI A;  5DNL A;  4IZJ D;  5IT9 C;  5JEA A;  1H7S A;  2Z5B A;  2CZ9 A;  4HAC B;  4JI3 I;  5DNX A;  4LF8 E;  3V2U C;  3J7A G;  4OX9 E;  4DV4 E;  1YHC A;  1XNR I;  3Q6N A;  5GME A;  4LF8 I;  5DRR A;  5EKW A;  3ZZT A;  2UUB I;  4WUC A;  1ZXN A;  3J7A M;  2NN6 B;  4MU0 A;  2AE8 A;  4PRX A;  2HK2 A;  4MDT A;  1OYR A;  4MU4 A;  4KQV A;  3GON A;  3P3E A;  2EFG A;  4LF4 I;  2C39 A;  2O1T A;  4JI5 E;  3U1Y A;  2J7K A;  1FKA E;  2BM1 A;  4YHH I;  4DV6 I;  1KTV A;  1IBK E;  3HUL A;  3OTO I;  4B3S E;  4DR2 E;  3QT8 A;  4FWH A;  2O1W A;  1YH8 A;  5DRO A;  1H74 A;  3H1C A;  4OO1 D;  4AID A;  1Z5B A;  1R6M A;  4B3M I;  2VES A;  4DPU A;  4DR2 I;  2PNZ A;  1QZR A;  4NBQ A;  1U2R A;  2PO0 A;  4JI4 E;  4NXM I;  4FW4 A;  2JT2 A;  4UT4 A;  1H73 A;  2HFU A;  4YHH E;  5LMU I;  5K36 D;  4DXL A;  4JI8 I;  1HNX I;  2PNM A;  1I94 I;  3L7Z B;  1Z5A A;  2NN6 F;  4EMD A;  4R1F A;  5EL9 A;  1PIE A;  4DV2 E;  1Z0C A;  2JEB A;  1B62 A;  5K36 E;  4X64 I;  2UXC I;  4MYT A;  5JEA B;  2V2V A;  1OYP A;  3F0N A;  4IFD F;  1XMQ E;  4URL A;  4LCH A;  1N34 I;  1XNQ E;  4JV5 I;  5JEA C;  1N0U A;  3WU3 A;  5LMN E;  4LPF A;  2X36 A;  4IFD B;  4JI3 E;  4DV2 I;  5LL6 R;  2UXD E;  4JI7 E;  3PS1 A;  1MG7 A;  4LF7 E;  2UUA I;  4X65 E;  3CDJ A;  1H7U A;  1I94 E;  1MU5 A;  2Z5C B;  3P3G A;  2JE6 A;  1HR0 E;  4DUZ E;  1NHH A;  2Z5E A;  5FLX Q;  3B78 A;  4B3R E;  2GS8 A;  4DV1 I;  3B82 A;  4DV7 I;  2R42 A;  1FI4 A;  2UXB I;  4YY3 I;  4JI1 I;  2O3Z A;  4DUY E;  4OO1 B;  2PO1 A;  4LCG A;  4XTJ A;  2WP8 B;  1Z0T A;  4X62 E;  4DV6 E;  1Z0V A;  3D4J A;  1ZM9 A;  2UUC I;  1OJ4 A;  4FN5 A;  4P52 A;  2PNZ B;  1FNM A;  4JI0 E;  4LF6 E;  3ZM7 A;  3NZK A;  3CDI A;  1BKN A;  2BA1 D;  1RHY A;  4KHP I;  2VQE I;  1USV A;  2BV3 A;  3L7Z A;  1DAR A;  1FWK A;  4X62 I;  1HNZ E;  4ZVI A;  4HAC A;  4DV4 I;  4DR7 I;  5BR8 I;  5IWA E;  2E1R A;  1FJG E;  4M1K A;  4MU3 A;  2C37 A;  1HNZ I;  2WNR A;  4FW5 A;  1NHJ A;  4IZK B;  3H4L A;  3HKM A;  4U3B A;  4DR6 E;  2HKJ A;  1N0V C;  3B8H A;  1HR0 I;  4BA2 B;  4NXN E;  4OZE A;  5DRQ A;  3QT6 A;  3WU6 A;  4JI0 I;  1Z0W A;  2NN6 A;  2GO3 A;  1ZXM A;  2A2D A;  2UU9 I;  4DR5 I;  1ZM4 A;  3M6A A;  2ZM6 E;  4LF7 I;  2IER A;  3ZKB A;  1Y5Y A;  2CG9 A;  3DD6 A;  2ZIT A;  4MU1 A;  1R6L A;  2JE6 B;  5A2Q C;  4OO1 C;  1Y4S A;  1N33 I;  4B3M E;  2C38 B;  3J81 Q;  4DV7 E;  5JEA E;  4JYA I;  4DV1 E;  2VF3 A;  1PVG A;  2NN6 E;  5DRP A;  3P76 A;  3WU4 A;  2AJ4 A;  4X66 I;  1OYS A;  4DUZ I;  2LJP A;  1XHK A;  3K17 A;  5K36 F;  5K36 B;  4USM A;  3M7N D;  4DU8 A;  4X65 I;  4DV5 E;  4ISA A;  2UUA E;  4BA1 B;  5C0X D;  5C0X B;  3PYD A;  4DR1 E;  4IZJ B;  3PRY A;  4DV5 I;  2F1D A;  1HK7 A;  3PS3 A;  4LF9 E;  2BR2 B;  4FW9 A;  4GKJ I;  1XMO I;  1E3H A;  1J5E E;  2ZBK B;  2VQF I;  4B3T E;  2OI2 A;  4MQY A;  4GQU A;  4ED4 A;  1XMO E;  4GKJ E;  4Z7C A;  4DR3 I;  3PS2 A;  4QNK A;  2DEI A;  3GME A;  1P42 A;  5C0X F;  4IFD C;  4LF9 I;  1S4E A;  3WU5 A;  3J80 C;  2GO4 A;  5JEA F;  2C37 B;  1NZ0 A;  3ZZU A;  3P06 A;  2IOQ A;  4DR5 E;  3CWV A;  1USU A;  4IZK A;  1EA6 A;  3T1Y E;  4JI5 I;  4PU9 A;  4MYU A;  5L3J A;  3P3C A;  4X66 E;  4BA2 A;  4J3D A;  2NPF A;  3B4T A;  4JYA E;  1Z59 A;  2VQF E;  2CVE A;  1XNR E;  2JEA A;  4OX9 I;  4B3S I;  1A6F A;  2GQ0 A;  1N32 I;  1IBL I;  2O1V A;  4WUD A;  4N3O A;  2A2C A;  2ZM6 I;  4FWG A;  4OO1 A;  1Y60 A;  2PO1 B;  4U3D A;  2WP8 A;  2HK3 A;  2VQE E;  1KKH A;  5C0X E;  4LF5 E;  4NXN I;  1FWL A;  3Q1Q A;  4KHP E;  1WUU A;  4HXZ A;  4PRV A;  1IBM I;  1N36 E;  2E5L I;  4IS9 A;  4LF5 I;  5K36 A;  2UUC E;  1VI7 A;  2O1U A;  4IFD D;  4BA1 A;  5C0X A;  2UUB E;  4DPW A;  1H72 C;  3GCM A;  4DV3 E;  3Q6M A;  4IZJ A;  4DPX A;  1FJG I;  4OO1 E;  2BR2 A;  3GLL A;  5FLX C;  3LPS A;  1N33 E;  3LTO A;  2UXB E;  4HYM A;  1HNW I;  1KIJ A;  2V34 A;  4P7A A;  1Z0G A;  4B3R I;  1UDO A;  2Z5B B;  2WNR B;  1UDN A;  3QT5 A;  4DR4 I;  1UDQ A;  4RPF A;  1S16 A;  4LF6 I;  2HKE A;  1B63 A;  1ZM2 A;  4DR4 E;  1KVK A;  1Y6Z A;  4JI7 I;  2UXD I;  4JI6 E;  2HHH I;  4LFB I;  1EI1 A;  2PO2 B;  2HFS A;  4DUY I;  2CGE A;  4JI1 E;  5LMN I;  4YY3 E;  5BR8 E;  4GKK I;  2J65 A;  4JV5 E;  1N34 E;  1Z5C A;  4K0K I;  2IOP A;  4JG4 A;  1ZM3 A;  2C38 A;  2C39 B;  2V2Z A;  2JEA B;  1N36 I;  2E5L E;  4FWD A;  4JI2 I;  2BM0 A;  3M85 G;  3JAM C;  4AQY E;  2IES A;  2F4V I;  4JI2 E;  1RR9 A;  5K36 C;  4JI8 E;  1HNX E;  5LMU E;  3T1H I;  4I3H A;  4LFA I;  2BA0 D;  3PYF A;  3ZKD A;  3M7N G;  1VIS A;  4WUB A;  1XNQ I;  4DPT A;  1XMQ I;  4DV0 I;  3ZZ0 A;  5A2Q Q;  4GKK E;  3QT7 A;  4AIM A;  2BA0 G; 
#chains in the Genus database with same CATH homology
 4DU7 A;  3J81 C;  5IT9 Q;  1IBK I;  4LFA E;  4LFC I;  3T1H E;  2WW4 A;  2UU9 E;  3T1Y I;  4AQY I;  2X7I A;  4LFC E;  3V5R A;  4HY1 A;  1RRE A;  4DR6 I;  2R3V A;  3K85 A;  4DPY A;  1D6T A;  3HJC A;  4DR3 E;  2V2Q A;  3PYE A;  4DV0 E;  4K0K E;  4B3T I;  1MX0 A;  1Y4U A;  2PNL A;  1J5E I;  3PYG A;  5IWA I;  4DR7 E;  3OTO E;  2DEJ A;  4DV3 I;  2UXC E;  4X64 E;  2Z5C A;  1Z0E A;  4UTG A;  2HHH E;  4LFB E;  2F4V E;  4JI6 I;  4DR1 I;  5FWK A;  1IBM E;  2Q2E B;  3J80 Q;  2XEX A;  1ELO A;  1Z0B A;  1PKP A;  4JI4 I;  4NXM E;  3K1J A;  3JAM Q;  1IBL E;  4USK A;  1N32 E;  1HNW E;  5GMD A;  3LNU A;  1K47 A;  2V8P A;  1UEK A;  4LF4 E;  4Z7Y A;  1NHI A;  4IZJ D;  5IT9 C;  1H7S A;  2Z5B A;  2CZ9 A;  4HAC B;  4JI3 I;  4LF8 E;  3V2U C;  3J7A G;  4OX9 E;  4DV4 E;  1XNR I;  3Q6N A;  5GME A;  4LF8 I;  3ZZT A;  2UUB I;  4WUC A;  1ZXN A;  3J7A M;  4PRX A;  2HK2 A;  4KQV A;  3GON A;  2EFG A;  4LF4 I;  2O1T A;  4JI5 E;  2J7K A;  1FKA E;  2BM1 A;  4YHH I;  4DV6 I;  1KTV A;  1IBK E;  3HUL A;  3OTO I;  4B3S E;  4DR2 E;  3QT8 A;  4FWH A;  2O1W A;  1H74 A;  1Z5B A;  4B3M I;  4DPU A;  4DR2 I;  1QZR A;  1U2R A;  4JI4 E;  4NXM I;  4UT4 A;  1H73 A;  2HFU A;  4YHH E;  5LMU I;  4DXL A;  4JI8 I;  1HNX I;  2PNM A;  1I94 I;  1Z5A A;  4EMD A;  4R1F A;  1PIE A;  4DV2 E;  1Z0C A;  1B62 A;  4X64 I;  2UXC I;  4MYT A;  2V2V A;  3F0N A;  1XMQ E;  4URL A;  1XNQ E;  1N34 I;  4JV5 I;  1N0U A;  3WU3 A;  5LMN E;  2X36 A;  4JI3 E;  4DV2 I;  5LL6 R;  2UXD E;  4JI7 E;  4LF7 E;  1MG7 A;  2UUA I;  4X65 E;  1H7U A;  1I94 E;  1MU5 A;  2Z5C B;  1HR0 E;  4DUZ E;  1NHH A;  2Z5E A;  5FLX Q;  3B78 A;  4B3R E;  2GS8 A;  4DV1 I;  3B82 A;  4DV7 I;  2R42 A;  1FI4 A;  2UXB I;  4YY3 I;  4JI1 I;  4DUY E;  4XTJ A;  1Z0T A;  4X62 E;  4DV6 E;  1Z0V A;  3D4J A;  1ZM9 A;  2UUC I;  1OJ4 A;  4FN5 A;  4P52 A;  4JI0 E;  1FNM A;  4LF6 E;  3ZM7 A;  1BKN A;  4KHP I;  2VQE I;  1USV A;  2BV3 A;  1DAR A;  1FWK A;  4X62 I;  1HNZ E;  4ZVI A;  4HAC A;  4DV4 I;  4DR7 I;  5BR8 I;  5IWA E;  2E1R A;  1FJG E;  4M1K A;  1HNZ I;  1NHJ A;  4IZK B;  3H4L A;  4DR6 E;  2HKJ A;  1N0V C;  3B8H A;  1HR0 I;  4NXN E;  3QT6 A;  3WU6 A;  4JI0 I;  1Z0W A;  1ZXM A;  2UU9 I;  2A2D A;  4DR5 I;  1ZM4 A;  3M6A A;  2ZM6 E;  4LF7 I;  3ZKB A;  2CG9 A;  2ZIT A;  5A2Q C;  1Y4S A;  1N33 I;  4B3M E;  3J81 Q;  4DV7 E;  4JYA I;  4DV1 E;  2VF3 A;  1PVG A;  3WU4 A;  2AJ4 A;  4X66 I;  4DUZ I;  2LJP A;  1XHK A;  3K17 A;  4USM A;  4DU8 A;  4X65 I;  4DV5 E;  2UUA E;  3PYD A;  4DR1 E;  4IZJ B;  3PRY A;  4DV5 I;  1HK7 A;  4LF9 E;  4FW9 A;  4GKJ I;  1XMO I;  1J5E E;  2ZBK B;  2VQF I;  4B3T E;  2OI2 A;  4ED4 A;  1XMO E;  4GKJ E;  4Z7C A;  4DR3 I;  2DEI A;  4LF9 I;  1S4E A;  3WU5 A;  3J80 C;  1NZ0 A;  3ZZU A;  3P06 A;  2IOQ A;  4DR5 E;  3CWV A;  1USU A;  4IZK A;  1EA6 A;  3T1Y E;  4JI5 I;  4PU9 A;  4MYU A;  5L3J A;  4X66 E;  2NPF A;  4JYA E;  1Z59 A;  2VQF E;  1XNR E;  4OX9 I;  4B3S I;  1A6F A;  2GQ0 A;  1N32 I;  1IBL I;  2O1V A;  4WUD A;  4N3O A;  2A2C A;  2ZM6 I;  4FWG A;  2HK3 A;  2VQE E;  1KKH A;  4LF5 E;  4NXN I;  1FWL A;  3Q1Q A;  4KHP E;  1WUU A;  4HXZ A;  4PRV A;  1IBM I;  1N36 E;  2E5L I;  4LF5 I;  2UUC E;  2O1U A;  2UUB E;  4DPW A;  1H72 C;  4DV3 E;  3Q6M A;  4IZJ A;  4DPX A;  1FJG I;  5FLX C;  3LPS A;  1N33 E;  3LTO A;  2UXB E;  4HYM A;  1HNW I;  1KIJ A;  2V34 A;  4P7A A;  1Z0G A;  4B3R I;  2Z5B B;  3QT5 A;  4DR4 I;  4RPF A;  1S16 A;  4LF6 I;  2HKE A;  1B63 A;  1ZM2 A;  4DR4 E;  1KVK A;  1Y6Z A;  4JI7 I;  2UXD I;  4JI6 E;  2HHH I;  4LFB I;  1EI1 A;  2HFS A;  4DUY I;  2CGE A;  4JI1 E;  5LMN I;  4YY3 E;  5BR8 E;  4GKK I;  4JV5 E;  1N34 E;  1Z5C A;  4K0K I;  2IOP A;  4JG4 A;  1ZM3 A;  2V2Z A;  1N36 I;  2E5L E;  4FWD A;  4JI2 I;  2BM0 A;  3JAM C;  4AQY E;  2F4V I;  4JI2 E;  1RR9 A;  4JI8 E;  1HNX E;  5LMU E;  3T1H I;  4I3H A;  4LFA I;  3PYF A;  3ZKD A;  1VIS A;  4WUB A;  1XNQ I;  4DPT A;  1XMQ I;  4DV0 I;  3ZZ0 A;  5A2Q Q;  4GKK E;  3QT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...