1HNZI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzI00
4LF7E 1N34E 5IWAE 1ZM3A 4DV5E 4LF5E 1H7UA 3OTOE 1Z0EA 4B3SE 2VQEE 2HHHI 3B82A 4GKKE 4AQYE 4LFBE 4DR5I 4LF9E 3WU4A 4R1FA 1N36I 1QZRA 4DU8A 3LPSA 4JI7E 4DR4I 3ZZUA 1XMQE 4DU7A 2LJPA 4HY1A 4NXNI 1S4EA 2WW4A 1IBME 1OJ4A 1Z0TA 4DR1E 2UXBI 1HNZE 4JI6E 2UXDI 4LF4E 4NXMI 1Z0VA 4LF7I 3ZKDA 1H72C 3WU5A 4DUYI 2X7IA 4B3SI 1RREA 1KIJA 4GKKI 4AQYI 4DV4I 2V8PA 3WU6A 4I3HA 4X62E 4DPTA 1IBKE 4DR2E 1J5EE 4JI7I 1HNXI 5GMDA 2F4VI 4X64I 2HFUA 4DR1I 2V2QA 3ZM7A 4JI1E 1Z5AA 3F0NA 4JG4A 1B63A 3CWVA 4B3MI 1D6TA 3J7AM 2R42A 4YHHE 2HK3A 4DR3E 1U2RA 3J80C 4PRXA 4JI2E 2V2VA 4FWGA 2AJ4A 3JAMQ 3Q1QA 4GKJE 4LFAI 4X65I 5A2QC 2VF3A 3H4LA 4K0KE 3J7AG 1H73A 2UU9E 1J5EI 4WUCA 1Z0CA 4DPYA 4B3TE 1ZM2A 4DV3E 1HNWE 4DV0E 4MYUA 3GONA 1FKAE 4XTJA 4JI1I 4OX9E 2A2DA 1PIEA 1N33E 1EI1A 2UUCE 1H74A 2HKEA 1FWKA 1Z59A 4WUDA 4HYMA 4PU9A 2ZBKB 4DR3I 3QT6A 4DV2I 4JI2I 1FJGE 3ZZTA 5LMUI 1N0VC 4DV6E 3T1YI 4GKJI 4LFCE 2BM1A 4JYAI 1WUUA 2J7KA 1XMOE 3PYFA 1MU5A 4JI0E 2VQFI 4DV3I 1HNWI 1EA6A 1NZ0A 4DV1E 5LL6R 1FWLA 4DUZE 4KHPE 4OX9I 3M6AA 1N34I 4Z7YA 2UUCI 5IWAI 1N32E 2E1RA 4DV5I 3J81Q 1Z5BA 4LF5I 1MX0A 4JI3E 4DPUA 4RPFA 3OTOI 2VQEI 5IT9Q 1ZXMA 4LFBI 2UUAE 4LF6E 2NPFA 4LF9I 1MG7A 4DR6E 2HKJA 5GMEA 4FWHA 5FLXQ 1XMQI 1ZM9A 5LMNE 4JI8E 1IBMI 2BV3A 3PYEA 4JV5E 1UEKA 3ZKBA 1HNZI 4JI6I 1XNQE 4FWDA 4DV7E 4LF4I 4KHPI 1ZXNA 1VISA 2E5LE 1N32I 1IBLE 3T1HE 4P7AA 1Z5CA 4JI3I 1I94E 4FN5A 1XHKA 1BKNA 3K1JA 4JI4E 1K47A 2UUAI 4X62I 2UUBE 1B62A 3B8HA 1IBKI 4DR2I 4M1KA 4DR6I 4EMDA 1ELOA 1NHJA 1HR0E 1RR9A 2HHHE 2DEIA 4LF8E 2ZITA 5LMNI 4JI8I 2EFGA 4JI5E 4HACB 4DR5E 2BM0A 1N36E 2V2ZA 4DR4E 1NHIA 3J80Q 3LTOA 4YHHI 3T1HI 4HXZA 2UXDE 2A2CA 5L3JA 4ZVIA 5A2QQ 4NXME 4JI4I 3WU3A 3PYGA 3K17A 4DXLA 2UUBI 4URLA 4K0KI 1KTVA 2UU9I 4DUYE 2OI2A 1HR0I 3J81C 4B3TI 4DV4E 4LF8I 3HULA 1PKPA 4MYTA 4DV0I 4JI5I 2DEJA 4UTGA 5IT9C 3B78A 3QT7A 1N33I 4P52A 1HNXE 4YY3E 1A6FA 4HACA 4X66E 1H7SA 2X36A 4WUBA 5FLXC 2F4VE 4X64E 1PVGA 4USMA 1S16A 4B3ME 2V34A 1FJGI 3V2UC 4DV6I 4DR7E 4LFCI 3PYDA 1KKHA 4ED4A 1FI4A 2CZ9A 2GS8A 4KQVA 1XMOI 2R3VA 4JI0I 3D4JA 1Z0WA 4LFAE 4X65E 4DPXA 4DV1I 3JAMC 1XNRE 4USKA 4DUZI 2XEXA 3QT5A 4UT4A 1KVKA 4YY3I 5BR8E 4X66I 1FNMA 4B3RE 2ZM6E 2UXCE 1Z0BA 1N0UA 3V5RA 4LF6I 4DR7I 2HK2A 1ZM4A 4PRVA 4FW9A 1NHHA 4DV2E 1Z0GA 5LMUE 4JV5I 2Q2EB 4Z7CA 3T1YE 3LNUA 4JYAE 1XNQI 4DV7I 1XNRI 4NXNE 2E5LI 1IBLI 2UXBE 3ZZ0A 2VQFE 5BR8I 4DPWA 4B3RI 1DARA 1I94I 2ZM6I 2UXCI 2HFSA 3QT8A
chains in the Genus database with same CATH superfamily
1P42A 4LF7E 1N34E 4AIDA 5IWAE 1ZM3A 2NN6D 4DV5E 4LF5E 1H7UA 3OTOE 1Z0EA 4B3SE 2VQEE 5C0XA 2HHHI 3B82A 5EL9A 4AQYE 4GKKE 2CVEA 2JT2A 5DNLA 2GQ0A 3NZKA 4LFBE 2WP8B 4IFDA 2C38A 4DR5I 5EKWA 4LF9E 1USUA 3WU4A 3CDJA 4R1FA 1N36I 1QZRA 3UHMA 3LPSA 4JI7E 4DU8A 2O1VA 3M7ND 1R6LA 2NN6F 3ZZUA 5C0XD 4DR4I 4FW7A 5K36B 1XMQE 3GLLA 4DU7A 2LJPA 4HY1A 4NXNI 1S4EA 2WW4A 1IBME 1Y6ZA 1OJ4A 4IFDD 1Z0TA 1USVA 4DR1E 2UXBI 1HNZE 2JEAA 4JI6E 2JEBA 2UXDI 4OZEA 3HKMA 3KRNA 4FW4A 3U1YA 4LF4E 4NXMI 2C39B 1Z0VA 4LF7I 3U1KA 5DNXA 4MU0A 5C0XF 2Z5BA 3ZKDA 2PNZA 5DRPA 1H72C 3WU5A 2O1TA 4DUYI 4IFDF 2X7IA 4B3SI 3M7NG 1RREA 1KIJA 2BA1G 4GKKI 4AQYI 2PO1B 2CG9A 4DV4I 3L7ZB 2V8PA 2NN6B 3WU6A 4I3HA 4X62E 1Y5YA 4DPTA 4IS9A 1IBKE 4DR2E 1J5EE 2IESA 4JI7I 1HNXI 2WP8A 5GMDA 3PS1A 2F4VI 4X64I 2HFUA 3P3GA 4DR1I 2V2QA 1UDQA 1UDOA 3ZM7A 4JI1E 1Z5AA 3F0NA 4JG4A 5JEAB 1B63A 4OO1B 5K36A 3CWVA 1UDNA 4B3MI 1D6TA 4FW5A 3J7AM 2C38B 1OYRA 2R42A 4YHHE 2HK3A 4DR3E 1U2RA 2J65A 2C39A 3J80C 5K36D 4PRXA 4FW3A 2BA0D 4JI2E 2V2VA 4FWGA 2AJ4A 3JAMQ 4IZJA 4IZKA 3Q1QA 4LFAI 4X65I 5A2QC 4GKJE 2VF3A 3DD6A 3H4LA 4K0KE 4MU1A 3J7AG 1H73A 2UU9E 1J5EI 4WUCA 2PNMA 4MU3A 1R6MA 2PO1A 3L7ZA 2O1UA 1Z0CA 4DPYA 4OO1E 4B3TE 1ZM2A 4DV3E 4IZJD 1HNWE 5K36F 4DV0E 4MYUA 2GO4A 3GONA 1FKAE 4XTJA 4JI1I 4OX9E 2A2DA 1PIEA 2BA0G 1N33E 1EI1A 2UUCE 3H1CA 1H74A 2HKEA 2O1WA 1FWKA 1Z59A 4OO1A 4WUDA 5JEAA 4HYMA 4PU9A 2ZBKB 4DR3I 4J3DA 3QT6A 4DV2I 4JI2I 1FJGE 3ZZTA 5LMUI 1N0VC 4DV6E 2IOQA 3T1YI 4GKJI 4LFCE 2BM1A 4JYAI 3M85D 1WUUA 4N3OA 1XXEA 5JEAD 4OO1D 2BA1D 2J7KA 1XMOE 3PYFA 2PO0B 1RHYA 1MU5A 3K85A 4JI0E 2VQFI 4DV3I 1HNWI 1EA6A 1NZ0A 4DV1E 1HK7A 5LL6R 1FWLA 4DUZE 4KHPE 4OX9I 3M6AA 1N34I 4U3BA 3B4TA 4Z7YA 2UUCI 5JEAF 5IWAI 1N32E 2E1RA 4OO1F 4IZJB 4IZKB 4DV5I 3J81Q 1Z5BA 4LF5I 1MX0A 4JI3E 3M85G 4DPUA 4RPFA 3OTOI 2VQEI 3GMEA 5DRRA 5IT9Q 1ZXMA 4LFBI 1E3HA 1YH8A 2UUAE 1YHCA 4LF6E 5DRQA 2NPFA 4LF9I 1MG7A 4DR6E 2HKJA 5GMEA 2GO3A 2WNRB 4MQYA 4FWHA 5FLXQ 1XMQI 1ZM9A 5LMNE 4JI8E 1IBMI 2BV3A 3PYEA 4JV5E 1UEKA 3ZKBA 1HNZI 4JI6I 1XNQE 4FWDA 4DV7E 4LF4I 1VI7A 2F1DA 2PO0A 4LCHA 4KHPI 1ZXNA 5FWKA 1VISA 3HJCA 2E5LE 1N32I 1IBLE 3T1HE 4P7AA 1Z5CA 4JI3I 3Q6NA 1I94E 2AE8A 4MU4A 4FN5A 3PRYA 1XHKA 1BKNA 3K1JA 4JI4E 1K47A 2PNLA 2UUAI 4X62I 2UUBE 1B62A 3B8HA 1IBKI 4DR2I 4M1KA 4DR6I 1OYSA 4EMDA 1ELOA 1NHJA 1HR0E 5ELWA 1RR9A 3P76A 2HHHE 2DEIA 4LF8E 2ZITA 5LMNI 4JI8I 2EFGA 3CDIA 4HACB 2NN6C 4DR5E 4JI5E 2BM0A 1OYPA 1N36E 2WNRA 4LCFA 2V2ZA 4DR4E 2Z5EA 2O3ZA 1NHIA 3J80Q 3LTOA 4YHHI 3T1HI 4BA2B 4HXZA 2UXDE 2A2CA 5L3JA 4ZVIA 5A2QQ 5C0XC 4NXME 4AIMA 4LOMA 4NBQA 4JI4I 3WU3A 3PYGA 3K17A 4IFDC 4DXLA 2UUBI 4URLA 4K0KI 1KTVA 2UU9I 4DUYE 2IERA 1E3PA 2OI2A 1HR0I 4BA1B 3J81C 4B3TI 4DV4E 4LF8I 3HULA 5DROA 1PKPA 4MYTA 4DV0I 4QNJA 4GQUA 4JI5I 2DEJA 2C37B 4UTGA 5IT9C 2Z5CB 3B78A 3QT7A 3Q6MA 1N33I 4P52A 4ISAA 1HNXE 4YY3E 1A6FA 4HACA 4X66E 1H7SA 4LPFA 2X36A 4WUBA 5FLXC 2F4VE 4U3DA 4X64E 1PVGA 4USMA 2PO2B 4LCGA 1S16A 4B3ME 2JE6B 2VESA 2V34A 3P3EA 1FJGI 3V2UC 4DV6I 4DR7E 2BR2B 2CGEA 4BA2A 4LFCI 3PYDA 1KKHA 4ED4A 1Y4UA 1FI4A 2CZ9A 1Y4SA 2GS8A 4KQVA 1XMOI 4AM3A 2R3VA 4JI0I 3D4JA 1Z0WA 3P06A 4X65E 4LFAE 5K36E 4DPXA 4DV1I 3JAMC 1XNRE 4USKA 4DUZI 4BA1A 2XEXA 5K36C 3QT5A 4UT4A 1KVKA 4YY3I 5BR8E 2C37A 4X66I 1FNMA 2Z5CA 4B3RE 2ZM6E 4MDTA 2UXCE 1Z0BA 1Y60A 1N0UA 5C0XB 3V5RA 1UDSA 4LF6I 4DR7I 3PS2A 2HK2A 1ZM4A 4OKGA 4IFDB 2PO2A 2NN6E 4PRVA 3P3CA 2JE6A 4FW9A 1NHHA 2BR2A 4DV2E 1Z0GA 5LMUE 4JV5I 2Q2EB 4Z7CA 4QNKA 3T1YE 3LNUA 3PS3A 4JYAE 1XNQI 2JEAB 2JEBB 4FW6A 4DV7I 1XNRI 4NXNE 3GCMA 2E5LI 5JEAE 2NN6A 1IBLI 5C0XE 2UXBE 3ZZ0A 2VQFE 5BR8I 4DPWA 4B3RI 1DARA 2Z5BB 1I94I 2ZM6I 2PNZB 4IFDE 2UXCI 5JEAC 4OO1C 2HFSA 2IOPA 3QT8A
chains in the Genus database with same CATH topology
4LF7E 1N34E 5IWAE 1ZM3A 4DV5E 4LF5E 1H7UA 3OTOE 1Z0EA 4B3SE 2VQEE 2HHHI 3B82A 4GKKE 4AQYE 2GQ0A 4LFBE 4DR5I 4LF9E 1USUA 3WU4A 4R1FA 1N36I 1QZRA 4DU8A 3LPSA 4JI7E 2O1VA 4DR4I 3ZZUA 1XMQE 4DU7A 2LJPA 4HY1A 4NXNI 1S4EA 2WW4A 1IBME 1Y6ZA 1OJ4A 1Z0TA 1USVA 4DR1E 2UXBI 1HNZE 4JI6E 2UXDI 4LF4E 4NXMI 1Z0VA 4LF7I 2Z5BA 3ZKDA 1H72C 3WU5A 2O1TA 4DUYI 2X7IA 4B3SI 1RREA 1KIJA 4GKKI 4AQYI 2CG9A 4DV4I 2V8PA 3WU6A 4I3HA 4X62E 4DPTA 1IBKE 4DR2E 1J5EE 4JI7I 1HNXI 5GMDA 2F4VI 4X64I 2HFUA 4DR1I 2V2QA 3ZM7A 4JI1E 1Z5AA 3F0NA 4JG4A 1B63A 3CWVA 4B3MI 1D6TA 3J7AM 2R42A 4YHHE 2HK3A 4DR3E 1U2RA 3J80C 4PRXA 4JI2E 2V2VA 4FWGA 2AJ4A 3JAMQ 4IZJA 4IZKA 3Q1QA 4LFAI 4X65I 5A2QC 4GKJE 2VF3A 3H4LA 4K0KE 3J7AG 1H73A 2UU9E 1J5EI 4WUCA 2PNMA 2O1UA 1Z0CA 4DPYA 4B3TE 1ZM2A 4DV3E 4IZJD 1HNWE 4DV0E 4MYUA 3GONA 1FKAE 4XTJA 4JI1I 4OX9E 2A2DA 1PIEA 1N33E 1EI1A 2UUCE 1H74A 2HKEA 2O1WA 1FWKA 1Z59A 4WUDA 4HYMA 4PU9A 2ZBKB 4DR3I 3QT6A 4DV2I 4JI2I 1FJGE 3ZZTA 5LMUI 1N0VC 4DV6E 2IOQA 3T1YI 4GKJI 4LFCE 2BM1A 4JYAI 1WUUA 4N3OA 2J7KA 1XMOE 3PYFA 1MU5A 3K85A 4JI0E 2VQFI 4DV3I 1HNWI 1EA6A 1NZ0A 4DV1E 1HK7A 5LL6R 1FWLA 4DUZE 4KHPE 4OX9I 3M6AA 1N34I 4Z7YA 2UUCI 5IWAI 1N32E 2E1RA 4IZJB 4IZKB 4DV5I 3J81Q 1Z5BA 4LF5I 1MX0A 4JI3E 4DPUA 4RPFA 3OTOI 2VQEI 5IT9Q 1ZXMA 4LFBI 2UUAE 4LF6E 2NPFA 4LF9I 1MG7A 4DR6E 2HKJA 5GMEA 4FWHA 5FLXQ 1XMQI 1ZM9A 5LMNE 4JI8E 1IBMI 2BV3A 3PYEA 4JV5E 1UEKA 3ZKBA 1HNZI 4JI6I 1XNQE 4FWDA 4DV7E 4LF4I 4KHPI 1ZXNA 5FWKA 1VISA 3HJCA 2E5LE 1N32I 1IBLE 3T1HE 4P7AA 1Z5CA 4JI3I 3Q6NA 1I94E 4FN5A 3PRYA 1XHKA 1BKNA 3K1JA 4JI4E 1K47A 2PNLA 2UUAI 4X62I 2UUBE 1B62A 3B8HA 1IBKI 4DR2I 4M1KA 4DR6I 4EMDA 1ELOA 1NHJA 1HR0E 1RR9A 2HHHE 2DEIA 4LF8E 2ZITA 5LMNI 4JI8I 2EFGA 4JI5E 4HACB 4DR5E 2BM0A 1N36E 2V2ZA 4DR4E 2Z5EA 1NHIA 3J80Q 3LTOA 4YHHI 3T1HI 4HXZA 2UXDE 2A2CA 5L3JA 4ZVIA 5A2QQ 4NXME 4JI4I 3WU3A 3PYGA 3K17A 4DXLA 2UUBI 4URLA 4K0KI 1KTVA 2UU9I 4DUYE 2OI2A 1HR0I 3J81C 4B3TI 4DV4E 4LF8I 3HULA 1PKPA 4MYTA 4DV0I 4JI5I 2DEJA 4UTGA 5IT9C 2Z5CB 3B78A 3QT7A 3Q6MA 1N33I 4P52A 1HNXE 4YY3E 1A6FA 4HACA 4X66E 1H7SA 2X36A 4WUBA 5FLXC 2F4VE 4X64E 1PVGA 4USMA 1S16A 4B3ME 2V34A 1FJGI 3V2UC 4DV6I 4DR7E 2CGEA 4LFCI 3PYDA 1KKHA 4ED4A 1Y4UA 1FI4A 2CZ9A 1Y4SA 2GS8A 4KQVA 1XMOI 2R3VA 4JI0I 3D4JA 1Z0WA 3P06A 4X65E 4LFAE 4DPXA 4DV1I 3JAMC 1XNRE 4USKA 4DUZI 2XEXA 3QT5A 4UT4A 1KVKA 4YY3I 5BR8E 4X66I 1FNMA 2Z5CA 4B3RE 2ZM6E 2UXCE 1Z0BA 1N0UA 3V5RA 4LF6I 4DR7I 2HK2A 1ZM4A 4PRVA 4FW9A 1NHHA 4DV2E 1Z0GA 5LMUE 4JV5I 2Q2EB 4Z7CA 3T1YE 3LNUA 4JYAE 1XNQI 4DV7I 1XNRI 4NXNE 2E5LI 1IBLI 2UXBE 3ZZ0A 2VQFE 5BR8I 4DPWA 4B3RI 1DARA 2Z5BB 1I94I 2ZM6I 2UXCI 2HFSA 2IOPA 3QT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 E;  1N34 E;  5IWA E;  1ZM3 A;  4DV5 E;  4LF5 E;  1H7U A;  3OTO E;  1Z0E A;  4B3S E;  2VQE E;  2HHH I;  3B82 A;  4GKK E;  4AQY E;  4LFB E;  4DR5 I;  4LF9 E;  3WU4 A;  4R1F A;  1N36 I;  1QZR A;  4DU8 A;  3LPS A;  4JI7 E;  4DR4 I;  3ZZU A;  1XMQ E;  4DU7 A;  2LJP A;  4HY1 A;  4NXN I;  1S4E A;  2WW4 A;  1IBM E;  1OJ4 A;  1Z0T A;  4DR1 E;  2UXB I;  1HNZ E;  4JI6 E;  2UXD I;  4LF4 E;  4NXM I;  1Z0V A;  4LF7 I;  3ZKD A;  1H72 C;  3WU5 A;  4DUY I;  2X7I A;  4B3S I;  1RRE A;  1KIJ A;  4GKK I;  4AQY I;  4DV4 I;  2V8P A;  3WU6 A;  4I3H A;  4X62 E;  4DPT A;  1IBK E;  4DR2 E;  1J5E E;  4JI7 I;  1HNX I;  5GMD A;  2F4V I;  4X64 I;  2HFU A;  4DR1 I;  2V2Q A;  3ZM7 A;  4JI1 E;  1Z5A A;  3F0N A;  4JG4 A;  1B63 A;  3CWV A;  4B3M I;  1D6T A;  3J7A M;  2R42 A;  4YHH E;  2HK3 A;  4DR3 E;  1U2R A;  3J80 C;  4PRX A;  4JI2 E;  2V2V A;  4FWG A;  2AJ4 A;  3JAM Q;  3Q1Q A;  4GKJ E;  4LFA I;  4X65 I;  5A2Q C;  2VF3 A;  3H4L A;  4K0K E;  3J7A G;  1H73 A;  2UU9 E;  1J5E I;  4WUC A;  1Z0C A;  4DPY A;  4B3T E;  1ZM2 A;  4DV3 E;  1HNW E;  4DV0 E;  4MYU A;  3GON A;  1FKA E;  4XTJ A;  4JI1 I;  4OX9 E;  2A2D A;  1PIE A;  1N33 E;  1EI1 A;  2UUC E;  1H74 A;  2HKE A;  1FWK A;  1Z59 A;  4WUD A;  4HYM A;  4PU9 A;  2ZBK B;  4DR3 I;  3QT6 A;  4DV2 I;  4JI2 I;  1FJG E;  3ZZT A;  5LMU I;  1N0V C;  4DV6 E;  3T1Y I;  4GKJ I;  4LFC E;  2BM1 A;  4JYA I;  1WUU A;  2J7K A;  1XMO E;  3PYF A;  1MU5 A;  4JI0 E;  2VQF I;  4DV3 I;  1HNW I;  1EA6 A;  1NZ0 A;  4DV1 E;  5LL6 R;  1FWL A;  4DUZ E;  4KHP E;  4OX9 I;  3M6A A;  1N34 I;  4Z7Y A;  2UUC I;  5IWA I;  1N32 E;  2E1R A;  4DV5 I;  3J81 Q;  1Z5B A;  4LF5 I;  1MX0 A;  4JI3 E;  4DPU A;  4RPF A;  3OTO I;  2VQE I;  5IT9 Q;  1ZXM A;  4LFB I;  2UUA E;  4LF6 E;  2NPF A;  4LF9 I;  1MG7 A;  4DR6 E;  2HKJ A;  5GME A;  4FWH A;  5FLX Q;  1XMQ I;  1ZM9 A;  5LMN E;  4JI8 E;  1IBM I;  2BV3 A;  3PYE A;  4JV5 E;  1UEK A;  3ZKB A;  1HNZ I;  4JI6 I;  1XNQ E;  4FWD A;  4DV7 E;  4LF4 I;  4KHP I;  1ZXN A;  1VIS A;  2E5L E;  1N32 I;  1IBL E;  3T1H E;  4P7A A;  1Z5C A;  4JI3 I;  1I94 E;  4FN5 A;  1XHK A;  1BKN A;  3K1J A;  4JI4 E;  1K47 A;  2UUA I;  4X62 I;  2UUB E;  1B62 A;  3B8H A;  1IBK I;  4DR2 I;  4M1K A;  4DR6 I;  4EMD A;  1ELO A;  1NHJ A;  1HR0 E;  1RR9 A;  2HHH E;  2DEI A;  4LF8 E;  2ZIT A;  5LMN I;  4JI8 I;  2EFG A;  4JI5 E;  4HAC B;  4DR5 E;  2BM0 A;  1N36 E;  2V2Z A;  4DR4 E;  1NHI A;  3J80 Q;  3LTO A;  4YHH I;  3T1H I;  4HXZ A;  2UXD E;  2A2C A;  5L3J A;  4ZVI A;  5A2Q Q;  4NXM E;  4JI4 I;  3WU3 A;  3PYG A;  3K17 A;  4DXL A;  2UUB I;  4URL A;  4K0K I;  1KTV A;  2UU9 I;  4DUY E;  2OI2 A;  1HR0 I;  3J81 C;  4B3T I;  4DV4 E;  4LF8 I;  3HUL A;  1PKP A;  4MYT A;  4DV0 I;  4JI5 I;  2DEJ A;  4UTG A;  5IT9 C;  3B78 A;  3QT7 A;  1N33 I;  4P52 A;  1HNX E;  4YY3 E;  1A6F A;  4HAC A;  4X66 E;  1H7S A;  2X36 A;  4WUB A;  5FLX C;  2F4V E;  4X64 E;  1PVG A;  4USM A;  1S16 A;  4B3M E;  2V34 A;  1FJG I;  3V2U C;  4DV6 I;  4DR7 E;  4LFC I;  3PYD A;  1KKH A;  4ED4 A;  1FI4 A;  2CZ9 A;  2GS8 A;  4KQV A;  1XMO I;  2R3V A;  4JI0 I;  3D4J A;  1Z0W A;  4LFA E;  4X65 E;  4DPX A;  4DV1 I;  3JAM C;  1XNR E;  4USK A;  4DUZ I;  2XEX A;  3QT5 A;  4UT4 A;  1KVK A;  4YY3 I;  5BR8 E;  4X66 I;  1FNM A;  4B3R E;  2ZM6 E;  2UXC E;  1Z0B A;  1N0U A;  3V5R A;  4LF6 I;  4DR7 I;  2HK2 A;  1ZM4 A;  4PRV A;  4FW9 A;  1NHH A;  4DV2 E;  1Z0G A;  5LMU E;  4JV5 I;  2Q2E B;  4Z7C A;  3T1Y E;  3LNU A;  4JYA E;  1XNQ I;  4DV7 I;  1XNR I;  4NXN E;  2E5L I;  1IBL I;  2UXB E;  3ZZ0 A;  2VQF E;  5BR8 I;  4DPW A;  4B3R I;  1DAR A;  1I94 I;  2ZM6 I;  2UXC I;  2HFS A;  3QT8 A; 
#chains in the Genus database with same CATH topology
 1P42 A;  4LF7 E;  1N34 E;  4AID A;  5IWA E;  1ZM3 A;  2NN6 D;  4DV5 E;  4LF5 E;  1H7U A;  3OTO E;  1Z0E A;  4B3S E;  2VQE E;  5C0X A;  2HHH I;  3B82 A;  5EL9 A;  4AQY E;  4GKK E;  2CVE A;  2JT2 A;  5DNL A;  2GQ0 A;  3NZK A;  4LFB E;  2WP8 B;  4IFD A;  2C38 A;  4DR5 I;  5EKW A;  4LF9 E;  1USU A;  3WU4 A;  3CDJ A;  4R1F A;  1N36 I;  1QZR A;  3UHM A;  3LPS A;  4JI7 E;  4DU8 A;  2O1V A;  3M7N D;  1R6L A;  2NN6 F;  3ZZU A;  5C0X D;  4DR4 I;  4FW7 A;  5K36 B;  1XMQ E;  3GLL A;  4DU7 A;  2LJP A;  4HY1 A;  4NXN I;  1S4E A;  2WW4 A;  1IBM E;  1Y6Z A;  1OJ4 A;  4IFD D;  1Z0T A;  1USV A;  4DR1 E;  2UXB I;  1HNZ E;  2JEA A;  4JI6 E;  2JEB A;  2UXD I;  4OZE A;  3HKM A;  3KRN A;  4FW4 A;  3U1Y A;  4LF4 E;  4NXM I;  2C39 B;  1Z0V A;  4LF7 I;  3U1K A;  5DNX A;  4MU0 A;  5C0X F;  2Z5B A;  3ZKD A;  2PNZ A;  5DRP A;  1H72 C;  3WU5 A;  2O1T A;  4DUY I;  4IFD F;  2X7I A;  4B3S I;  3M7N G;  1RRE A;  1KIJ A;  2BA1 G;  4GKK I;  4AQY I;  2PO1 B;  2CG9 A;  4DV4 I;  3L7Z B;  2V8P A;  2NN6 B;  3WU6 A;  4I3H A;  4X62 E;  1Y5Y A;  4DPT A;  4IS9 A;  1IBK E;  4DR2 E;  1J5E E;  2IES A;  4JI7 I;  1HNX I;  2WP8 A;  5GMD A;  3PS1 A;  2F4V I;  4X64 I;  2HFU A;  3P3G A;  4DR1 I;  2V2Q A;  1UDQ A;  1UDO A;  3ZM7 A;  4JI1 E;  1Z5A A;  3F0N A;  4JG4 A;  5JEA B;  1B63 A;  4OO1 B;  5K36 A;  3CWV A;  1UDN A;  4B3M I;  1D6T A;  4FW5 A;  3J7A M;  2C38 B;  1OYR A;  2R42 A;  4YHH E;  2HK3 A;  4DR3 E;  1U2R A;  2J65 A;  2C39 A;  3J80 C;  5K36 D;  4PRX A;  4FW3 A;  2BA0 D;  4JI2 E;  2V2V A;  4FWG A;  2AJ4 A;  3JAM Q;  4IZJ A;  4IZK A;  3Q1Q A;  4LFA I;  4X65 I;  5A2Q C;  4GKJ E;  2VF3 A;  3DD6 A;  3H4L A;  4K0K E;  4MU1 A;  3J7A G;  1H73 A;  2UU9 E;  1J5E I;  4WUC A;  2PNM A;  4MU3 A;  1R6M A;  2PO1 A;  3L7Z A;  2O1U A;  1Z0C A;  4DPY A;  4OO1 E;  4B3T E;  1ZM2 A;  4DV3 E;  4IZJ D;  1HNW E;  5K36 F;  4DV0 E;  4MYU A;  2GO4 A;  3GON A;  1FKA E;  4XTJ A;  4JI1 I;  4OX9 E;  2A2D A;  1PIE A;  2BA0 G;  1N33 E;  1EI1 A;  2UUC E;  3H1C A;  1H74 A;  2HKE A;  2O1W A;  1FWK A;  1Z59 A;  4OO1 A;  4WUD A;  5JEA A;  4HYM A;  4PU9 A;  2ZBK B;  4DR3 I;  4J3D A;  3QT6 A;  4DV2 I;  4JI2 I;  1FJG E;  3ZZT A;  5LMU I;  1N0V C;  4DV6 E;  2IOQ A;  3T1Y I;  4GKJ I;  4LFC E;  2BM1 A;  4JYA I;  3M85 D;  1WUU A;  4N3O A;  1XXE A;  5JEA D;  4OO1 D;  2BA1 D;  2J7K A;  1XMO E;  3PYF A;  2PO0 B;  1RHY A;  1MU5 A;  3K85 A;  4JI0 E;  2VQF I;  4DV3 I;  1HNW I;  1EA6 A;  1NZ0 A;  4DV1 E;  1HK7 A;  5LL6 R;  1FWL A;  4DUZ E;  4KHP E;  4OX9 I;  3M6A A;  1N34 I;  4U3B A;  3B4T A;  4Z7Y A;  2UUC I;  5JEA F;  5IWA I;  1N32 E;  2E1R A;  4OO1 F;  4IZJ B;  4IZK B;  4DV5 I;  3J81 Q;  1Z5B A;  4LF5 I;  1MX0 A;  4JI3 E;  3M85 G;  4DPU A;  4RPF A;  3OTO I;  2VQE I;  3GME A;  5DRR A;  5IT9 Q;  1ZXM A;  4LFB I;  1E3H A;  1YH8 A;  2UUA E;  1YHC A;  4LF6 E;  5DRQ A;  2NPF A;  4LF9 I;  1MG7 A;  4DR6 E;  2HKJ A;  5GME A;  2GO3 A;  2WNR B;  4MQY A;  4FWH A;  5FLX Q;  1XMQ I;  1ZM9 A;  5LMN E;  4JI8 E;  1IBM I;  2BV3 A;  3PYE A;  4JV5 E;  1UEK A;  3ZKB A;  1HNZ I;  4JI6 I;  1XNQ E;  4FWD A;  4DV7 E;  4LF4 I;  1VI7 A;  2F1D A;  2PO0 A;  4LCH A;  4KHP I;  1ZXN A;  5FWK A;  1VIS A;  3HJC A;  2E5L E;  1N32 I;  1IBL E;  3T1H E;  4P7A A;  1Z5C A;  4JI3 I;  3Q6N A;  1I94 E;  2AE8 A;  4MU4 A;  4FN5 A;  3PRY A;  1XHK A;  1BKN A;  3K1J A;  4JI4 E;  1K47 A;  2PNL A;  2UUA I;  4X62 I;  2UUB E;  1B62 A;  3B8H A;  1IBK I;  4DR2 I;  4M1K A;  4DR6 I;  1OYS A;  4EMD A;  1ELO A;  1NHJ A;  1HR0 E;  5ELW A;  1RR9 A;  3P76 A;  2HHH E;  2DEI A;  4LF8 E;  2ZIT A;  5LMN I;  4JI8 I;  2EFG A;  3CDI A;  4HAC B;  2NN6 C;  4DR5 E;  4JI5 E;  2BM0 A;  1OYP A;  1N36 E;  2WNR A;  4LCF A;  2V2Z A;  4DR4 E;  2Z5E A;  2O3Z A;  1NHI A;  3J80 Q;  3LTO A;  4YHH I;  3T1H I;  4BA2 B;  4HXZ A;  2UXD E;  2A2C A;  5L3J A;  4ZVI A;  5A2Q Q;  5C0X C;  4NXM E;  4AIM A;  4LOM A;  4NBQ A;  4JI4 I;  3WU3 A;  3PYG A;  3K17 A;  4IFD C;  4DXL A;  2UUB I;  4URL A;  4K0K I;  1KTV A;  2UU9 I;  4DUY E;  2IER A;  1E3P A;  2OI2 A;  1HR0 I;  4BA1 B;  3J81 C;  4B3T I;  4DV4 E;  4LF8 I;  3HUL A;  5DRO A;  1PKP A;  4MYT A;  4DV0 I;  4QNJ A;  4GQU A;  4JI5 I;  2DEJ A;  2C37 B;  4UTG A;  5IT9 C;  2Z5C B;  3B78 A;  3QT7 A;  3Q6M A;  1N33 I;  4P52 A;  4ISA A;  1HNX E;  4YY3 E;  1A6F A;  4HAC A;  4X66 E;  1H7S A;  4LPF A;  2X36 A;  4WUB A;  5FLX C;  2F4V E;  4U3D A;  4X64 E;  1PVG A;  4USM A;  2PO2 B;  4LCG A;  1S16 A;  4B3M E;  2JE6 B;  2VES A;  2V34 A;  3P3E A;  1FJG I;  3V2U C;  4DV6 I;  4DR7 E;  2BR2 B;  2CGE A;  4BA2 A;  4LFC I;  3PYD A;  1KKH A;  4ED4 A;  1Y4U A;  1FI4 A;  2CZ9 A;  1Y4S A;  2GS8 A;  4KQV A;  1XMO I;  4AM3 A;  2R3V A;  4JI0 I;  3D4J A;  1Z0W A;  3P06 A;  4X65 E;  4LFA E;  5K36 E;  4DPX A;  4DV1 I;  3JAM C;  1XNR E;  4USK A;  4DUZ I;  4BA1 A;  2XEX A;  5K36 C;  3QT5 A;  4UT4 A;  1KVK A;  4YY3 I;  5BR8 E;  2C37 A;  4X66 I;  1FNM A;  2Z5C A;  4B3R E;  2ZM6 E;  4MDT A;  2UXC E;  1Z0B A;  1Y60 A;  1N0U A;  5C0X B;  3V5R A;  1UDS A;  4LF6 I;  4DR7 I;  3PS2 A;  2HK2 A;  1ZM4 A;  4OKG A;  4IFD B;  2PO2 A;  2NN6 E;  4PRV A;  3P3C A;  2JE6 A;  4FW9 A;  1NHH A;  2BR2 A;  4DV2 E;  1Z0G A;  5LMU E;  4JV5 I;  2Q2E B;  4Z7C A;  4QNK A;  3T1Y E;  3LNU A;  3PS3 A;  4JYA E;  1XNQ I;  2JEA B;  2JEB B;  4FW6 A;  4DV7 I;  1XNR I;  4NXN E;  3GCM A;  2E5L I;  5JEA E;  2NN6 A;  1IBL I;  5C0X E;  2UXB E;  3ZZ0 A;  2VQF E;  5BR8 I;  4DPW A;  4B3R I;  1DAR A;  2Z5B B;  1I94 I;  2ZM6 I;  2PNZ B;  4IFD E;  2UXC I;  5JEA C;  4OO1 C;  2HFS A;  2IOP A;  3QT8 A; 
#chains in the Genus database with same CATH homology
 4LF7 E;  1N34 E;  5IWA E;  1ZM3 A;  4DV5 E;  4LF5 E;  1H7U A;  3OTO E;  1Z0E A;  4B3S E;  2VQE E;  2HHH I;  3B82 A;  4GKK E;  4AQY E;  2GQ0 A;  4LFB E;  4DR5 I;  4LF9 E;  1USU A;  3WU4 A;  4R1F A;  1N36 I;  1QZR A;  4DU8 A;  3LPS A;  4JI7 E;  2O1V A;  4DR4 I;  3ZZU A;  1XMQ E;  4DU7 A;  2LJP A;  4HY1 A;  4NXN I;  1S4E A;  2WW4 A;  1IBM E;  1Y6Z A;  1OJ4 A;  1Z0T A;  1USV A;  4DR1 E;  2UXB I;  1HNZ E;  4JI6 E;  2UXD I;  4LF4 E;  4NXM I;  1Z0V A;  4LF7 I;  2Z5B A;  3ZKD A;  1H72 C;  3WU5 A;  2O1T A;  4DUY I;  2X7I A;  4B3S I;  1RRE A;  1KIJ A;  4GKK I;  4AQY I;  2CG9 A;  4DV4 I;  2V8P A;  3WU6 A;  4I3H A;  4X62 E;  4DPT A;  1IBK E;  4DR2 E;  1J5E E;  4JI7 I;  1HNX I;  5GMD A;  2F4V I;  4X64 I;  2HFU A;  4DR1 I;  2V2Q A;  3ZM7 A;  4JI1 E;  1Z5A A;  3F0N A;  4JG4 A;  1B63 A;  3CWV A;  4B3M I;  1D6T A;  3J7A M;  2R42 A;  4YHH E;  2HK3 A;  4DR3 E;  1U2R A;  3J80 C;  4PRX A;  4JI2 E;  2V2V A;  4FWG A;  2AJ4 A;  3JAM Q;  4IZJ A;  4IZK A;  3Q1Q A;  4LFA I;  4X65 I;  5A2Q C;  4GKJ E;  2VF3 A;  3H4L A;  4K0K E;  3J7A G;  1H73 A;  2UU9 E;  1J5E I;  4WUC A;  2PNM A;  2O1U A;  1Z0C A;  4DPY A;  4B3T E;  1ZM2 A;  4DV3 E;  4IZJ D;  1HNW E;  4DV0 E;  4MYU A;  3GON A;  1FKA E;  4XTJ A;  4JI1 I;  4OX9 E;  2A2D A;  1PIE A;  1N33 E;  1EI1 A;  2UUC E;  1H74 A;  2HKE A;  2O1W A;  1FWK A;  1Z59 A;  4WUD A;  4HYM A;  4PU9 A;  2ZBK B;  4DR3 I;  3QT6 A;  4DV2 I;  4JI2 I;  1FJG E;  3ZZT A;  5LMU I;  1N0V C;  4DV6 E;  2IOQ A;  3T1Y I;  4GKJ I;  4LFC E;  2BM1 A;  4JYA I;  1WUU A;  4N3O A;  2J7K A;  1XMO E;  3PYF A;  1MU5 A;  3K85 A;  4JI0 E;  2VQF I;  4DV3 I;  1HNW I;  1EA6 A;  1NZ0 A;  4DV1 E;  1HK7 A;  5LL6 R;  1FWL A;  4DUZ E;  4KHP E;  4OX9 I;  3M6A A;  1N34 I;  4Z7Y A;  2UUC I;  5IWA I;  1N32 E;  2E1R A;  4IZJ B;  4IZK B;  4DV5 I;  3J81 Q;  1Z5B A;  4LF5 I;  1MX0 A;  4JI3 E;  4DPU A;  4RPF A;  3OTO I;  2VQE I;  5IT9 Q;  1ZXM A;  4LFB I;  2UUA E;  4LF6 E;  2NPF A;  4LF9 I;  1MG7 A;  4DR6 E;  2HKJ A;  5GME A;  4FWH A;  5FLX Q;  1XMQ I;  1ZM9 A;  5LMN E;  4JI8 E;  1IBM I;  2BV3 A;  3PYE A;  4JV5 E;  1UEK A;  3ZKB A;  1HNZ I;  4JI6 I;  1XNQ E;  4FWD A;  4DV7 E;  4LF4 I;  4KHP I;  1ZXN A;  5FWK A;  1VIS A;  3HJC A;  2E5L E;  1N32 I;  1IBL E;  3T1H E;  4P7A A;  1Z5C A;  4JI3 I;  3Q6N A;  1I94 E;  4FN5 A;  3PRY A;  1XHK A;  1BKN A;  3K1J A;  4JI4 E;  1K47 A;  2PNL A;  2UUA I;  4X62 I;  2UUB E;  1B62 A;  3B8H A;  1IBK I;  4DR2 I;  4M1K A;  4DR6 I;  4EMD A;  1ELO A;  1NHJ A;  1HR0 E;  1RR9 A;  2HHH E;  2DEI A;  4LF8 E;  2ZIT A;  5LMN I;  4JI8 I;  2EFG A;  4JI5 E;  4HAC B;  4DR5 E;  2BM0 A;  1N36 E;  2V2Z A;  4DR4 E;  2Z5E A;  1NHI A;  3J80 Q;  3LTO A;  4YHH I;  3T1H I;  4HXZ A;  2UXD E;  2A2C A;  5L3J A;  4ZVI A;  5A2Q Q;  4NXM E;  4JI4 I;  3WU3 A;  3PYG A;  3K17 A;  4DXL A;  2UUB I;  4URL A;  4K0K I;  1KTV A;  2UU9 I;  4DUY E;  2OI2 A;  1HR0 I;  3J81 C;  4B3T I;  4DV4 E;  4LF8 I;  3HUL A;  1PKP A;  4MYT A;  4DV0 I;  4JI5 I;  2DEJ A;  4UTG A;  5IT9 C;  2Z5C B;  3B78 A;  3QT7 A;  3Q6M A;  1N33 I;  4P52 A;  1HNX E;  4YY3 E;  1A6F A;  4HAC A;  4X66 E;  1H7S A;  2X36 A;  4WUB A;  5FLX C;  2F4V E;  4X64 E;  1PVG A;  4USM A;  1S16 A;  4B3M E;  2V34 A;  1FJG I;  3V2U C;  4DV6 I;  4DR7 E;  2CGE A;  4LFC I;  3PYD A;  1KKH A;  4ED4 A;  1Y4U A;  1FI4 A;  2CZ9 A;  1Y4S A;  2GS8 A;  4KQV A;  1XMO I;  2R3V A;  4JI0 I;  3D4J A;  1Z0W A;  3P06 A;  4X65 E;  4LFA E;  4DPX A;  4DV1 I;  3JAM C;  1XNR E;  4USK A;  4DUZ I;  2XEX A;  3QT5 A;  4UT4 A;  1KVK A;  4YY3 I;  5BR8 E;  4X66 I;  1FNM A;  2Z5C A;  4B3R E;  2ZM6 E;  2UXC E;  1Z0B A;  1N0U A;  3V5R A;  4LF6 I;  4DR7 I;  2HK2 A;  1ZM4 A;  4PRV A;  4FW9 A;  1NHH A;  4DV2 E;  1Z0G A;  5LMU E;  4JV5 I;  2Q2E B;  4Z7C A;  3T1Y E;  3LNU A;  4JYA E;  1XNQ I;  4DV7 I;  1XNR I;  4NXN E;  2E5L I;  1IBL I;  2UXB E;  3ZZ0 A;  2VQF E;  5BR8 I;  4DPW A;  4B3R I;  1DAR A;  2Z5B B;  1I94 I;  2ZM6 I;  2UXC I;  2HFS A;  2IOP A;  3QT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...