1HNZI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzI00
2Q2EB 4LFBI 1KVKA 3JAMC 4YY3I 1NHHA 1J5EI 4P7AA 3QT7A 5LMUE 2LJPA 4KHPE 4DR1E 1HNZE 3B78A 3WU3A 5GMDA 4GKKI 1EI1A 1H72C 4JI8I 4LF5E 4JYAI 1PIEA 4B3SE 3PYEA 4JI7E 4JI2E 2HKEA 2J7KA 1XMOI 1IBLI 4JV5I 4JI3E 4DPWA 1FI4A 5LMNI 3PYDA 4FWHA 3GONA 4P52A 4MYUA 4LF8I 4M1KA 4B3MI 4DUZE 4DR5E 3B8HA 4JI0E 1N36E 5FLXC 4JI6I 4HACB 2UXCE 4YHHE 4LF4E 2UUCI 4DV1E 5BR8I 4NXMI 2BM0A 3J81Q 1IBMI 2UXBI 4LFBE 4YY3E 1HNZI 5A2QC 1J5EE 3D4JA 4ED4A 1QZRA 1VISA 1HR0I 2NPFA 1XNRI 4JI4I 4DR7I 4DPTA 1FJGI 4GKKE 2E5LI 4GKJI 1MX0A 3J80Q 1NHJA 1KTVA 1UEKA 3LTOA 1Z0WA 2HKJA 4DV5I 4JI5I 4JYAE 2GS8A 2HK2A 2V2ZA 1N34I 4KQVA 1ZM4A 1XMOE 3K17A 1DARA 2UUBI 1XNQI 3V5RA 1IBLE 5LMNE 4DR3I 4DPXA 4YHHI 4LF8E 4B3ME 4DV1I 1S16A 2X36A 4K0KI 1RR9A 3Q1QA 4JI6E 1FNMA 2ZM6I 4USMA 3H4LA 4FN5A 2UUCE 4DR4I 1H7UA 3K1JA 4I3HA 4LF7I 5BR8E 4NXME 1IBME 2UXBE 4LF6I 1ZM3A 3ZKDA 1Z5AA 5IT9Q 3J81C 1HR0E 1XNRE 4DV3I 4JI4E 4DR7E 2CZ9A 1PVGA 3QT5A 1FJGE 2E5LE 3LNUA 4GKJE 1NHIA 4FWGA 4X62I 1FKAE 4DV5E 4JI5E 2UUAE 1D6TA 1N34E 1Z0BA 1H73A 2UXDI 3J80C 2R3VA 4DV6I 4HXZA 2VQEI 2UUBE 1XNQE 1N0VC 1Z59A 4EMDA 2V2VA 4DR3E 2A2CA 2DEJA 4K0KE 4DV4E 1Z0TA 2R42A 2UU9I 1Z0VA 2ZBKB 2ZM6E 1B62A 4WUBA 3QT6A 2OI2A 1MU5A 2V34A 4JI1I 4X65I 4DR4E 3ZKBA 4DV2I 3ZZTA 4DR2I 4LF7E 1OJ4A 1B63A 1N33I 4Z7YA 3V2UC 2XEXA 1N32E 1XHKA 3J7AG 4LF6E 4XTJA 3F0NA 1XMQI 2HHHI 1IBKE 4LF9I 4X64E 1H7SA 4Z7CA 4DV3E 1FWKA 5IT9C 2UUAI 2X7IA 4DUYE 3CWVA 4WUDA 3WU6A 1I94I 1K47A 4WUCA 4X62E 4DXLA 1WUUA 4X66I 2WW4A 1U2RA 4NXNI 5IWAI 2UXDE 4DV6E 2F4VI 2VQEE 4DV7I 1ZM9A 4HACA 4DV4I 4LFCE 2A2DA 1ELOA 4DU7A 5L3JA 4PU9A 5GMEA 2UU9E 3OTOI 3ZM7A 1H74A 4PRXA 4X65E 4JI1E 1N32I 4FW9A 4DV2E 4DR2E 1IBKI 4LFAI 3QT8A 1Z0CA 1N33E 4X64I 1NZ0A 4DUYI 3T1YI 3T1HI 1XMQE 2HHHE 1ZXNA 4B3TI 4LF9E 2HFUA 1Z0EA 4MYTA 1S4EA 3PYFA 1KIJA 3WU4A 4FWDA 2V8PA 3B82A 1I94E 1N0UA 3M6AA 3HULA 4USKA 3LPSA 1FWLA 4X66E 4LFCI 1BKNA 4NXNE 5IWAE 1MG7A 4DV0I 4B3RI 2F4VE 2VQFI 4HYMA 1KKHA 4DV7E 4DU8A 2AJ4A 1HNXI 2VF3A 4OX9I 1EA6A 2ZITA 3JAMQ 4AQYI 3OTOE 4DR6I 4URLA 1RREA 4DPUA 3ZZUA 5LL6R 3J7AM 1Z5BA 2HK3A 1HNWE 2DEIA 5LMUI 4LFAE 4KHPI 4RPFA 4R1FA 4DR1I 3PYGA 1Z5CA 4DPYA 4JG4A 3T1YE 3T1HE 4ZVIA 4B3TE 4LF5I 1ZXMA 4B3SI 4JI7I 4JI2I 4UT4A 4HY1A 4JI8E 3ZZ0A 4JI3I 1Z0GA 2HFSA 5FLXQ 2E1RA 4UTGA 4DUZI 1ZM2A 4DV0E 1PKPA 4B3RE 4DR5I 2VQFE 1A6FA 4JI0I 4JV5E 1N36I 4PRVA 2BM1A 2UXCI 1HNXE 4LF4I 4OX9E 2V2QA 5A2QQ 3WU5A 4AQYE 1HNWI 2EFGA 2BV3A 4DR6E
chains in the Genus database with same CATH superfamily
2Q2EB 4LFBI 1KVKA 3JAMC 4YY3I 1NHHA 4OO1E 1J5EI 5JEAD 4P7AA 1OYPA 3QT7A 5LMUE 2LJPA 4KHPE 3P3EA 4DR6E 4DR1E 3B4TA 1Y5YA 1HNZE 3B78A 3WU3A 5GMDA 2AE8A 3CDIA 2NN6D 4GKKI 1EI1A 1H72C 4U3BA 4JI8I 2Z5BB 4LF5E 4JYAI 4IS9A 1PIEA 4B3SE 1R6MA 3PYEA 4JI7E 4JI2E 4AM3A 2HKEA 2Z5CB 2IESA 1UDNA 4FW5A 2J7KA 1XMOI 4LCGA 2C37B 1IBLI 4JV5I 4JI3E 4DPWA 1FI4A 2PO1B 2Z5EA 3PYDA 4FWHA 3HJCA 5LMNI 5K36D 5EKWA 3PS1A 3GONA 4FW4A 4P52A 4MYUA 3P3CA 4LF8I 2PNMA 4M1KA 4B3MI 2WNRB 4DUZE 4DR5E 3B8HA 4JI0E 3GLLA 1N36E 5FLXC 4JI6I 4HACB 2UXCE 2C38B 5K36B 4YHHE 4LF4E 4LCFA 2UUCI 2C39B 2BA1G 1HK7A 4DV1E 5K36C 1USVA 3U1YA 4BA2B 5BR8I 1YHCA 4NXMI 2BM0A 3J81Q 2JT2A 1IBMI 2UXBI 4LFBE 4YY3E 1HNZI 3GCMA 5A2QC 1J5EE 3D4JA 2PO2B 2PNZA 1Y6ZA 1QZRA 4ED4A 1VISA 1HR0I 2NPFA 1OYRA 1XNRI 4IFDA 4JI4I 4GQUA 4DR7I 2BR2A 3PRYA 4DPTA 1FJGI 5ELWA 4IZKB 4GKKE 2E5LI 4GKJI 1MX0A 1Y60A 3J80Q 1NHJA 1KTVA 1UEKA 3LTOA 1Z0WA 2HKJA 4U3DA 4DV5I 3GMEA 4JI5I 4JYAE 2GS8A 2HK2A 2F1DA 2V2ZA 1N34I 1P42A 2VESA 1Y4UA 1UDSA 4KQVA 1ZM4A 1XMOE 3K17A 1DARA 2UUBI 1XNQI 4MU3A 3V5RA 1IBLE 2WP8A 3DD6A 5LMNE 4DR3I 4DPXA 4YHHI 4MQYA 4LF8E 4B3ME 4DV1I 1S16A 2X36A 4K0KI 1RR9A 4LCHA 4FW7A 3Q1QA 4JI6E 1FNMA 2ZM6I 4USMA 3H4LA 4FN5A 2UUCE 4DR4I 1H7UA 3K1JA 4MU4A 2CG9A 4I3HA 4LF7I 5BR8E 4NXME 4IFDE 2O1WA 1IBME 2UXBE 4LF6I 3KRNA 4OO1F 1ZM3A 3ZKDA 1Z5AA 5IT9Q 4OO1D 3J81C 3UHMA 2NN6E 2JEBB 4IFDF 1HR0E 1XNRE 4DV3I 4JI4E 4DR7E 2CZ9A 1PVGA 2JEAB 2PO0B 3QT5A 5C0XA 1FJGE 4FW6A 4OO1B 2E5LE 3LNUA 4GKJE 1NHIA 4FWGA 4X62I 1FKAE 4MDTA 4OO1C 4DV5E 4JI5E 2BA1D 2UUAE 1D6TA 1N34E 1Z0BA 1H73A 2UXDI 3J80C 1Y4SA 2R3VA 4DV6I 4HXZA 2VQEI 2UUBE 1XNQE 2GQ0A 1N0VC 1Z59A 4EMDA 4IZJD 3U1KA 2BA0G 2V2VA 4DR3E 1E3PA 5EL9A 2JE6A 2A2CA 2DEJA 4K0KE 4DV4E 1Z0TA 4IZJB 2R42A 3M85G 2UU9I 1Z0VA 2ZBKB 4WUBA 1B62A 1USUA 2WP8B 3QT6A 2ZM6E 2OI2A 4N3OA 1MU5A 4BA1B 3CDJA 2V34A 4JI1I 5DROA 3NZKA 4X65I 4DR4E 3ZKBA 4DV2I 2O1TA 3ZZTA 4DR2I 4LF7E 1OJ4A 1B63A 1N33I 4Z7YA 4ISAA 5JEAA 5DNXA 3V2UC 2XEXA 1N32E 1XHKA 3J7AG 5C0XE 4LF6E 4XTJA 3F0NA 1XMQI 2HHHI 1IBKE 4LF9I 3H1CA 3L7ZA 4NBQA 4X64E 2NN6A 1H7SA 4Z7CA 4DV3E 4OZEA 1FWKA 5IT9C 2UUAI 5C0XF 2X7IA 4DUYE 3CWVA 4WUDA 3WU6A 2C37A 1I94I 1K47A 4WUCA 4X62E 2PO1A 4DXLA 1WUUA 4AIMA 4X66I 2WW4A 3HKMA 1U2RA 4NXNI 5IWAI 5C0XB 2UXDE 4DV6E 2F4VI 2VQEE 4DV7I 1ZM9A 4HACA 5C0XC 5K36A 4DV4I 4LFCE 5DRQA 2C39A 2A2DA 1XXEA 1ELOA 4DU7A 2J65A 5L3JA 5DRRA 4PU9A 5GMEA 1R6LA 2UU9E 5DNLA 3OTOI 5JEAE 2IOQA 3ZM7A 1H74A 4PRXA 4X65E 4JI1E 1N32I 4FW9A 2PO2A 4DV2E 3P3GA 1E3HA 3P76A 4LOMA 4FW3A 4DR2E 1IBKI 4LFAI 1OYSA 1Z0CA 3QT8A 1N33E 3M7NG 5JEAF 4X64I 1NZ0A 4LPFA 4IZKA 4IFDD 4DUYI 2CGEA 3T1YI 3T1HI 1XMQE 2HHHE 1ZXNA 4B3TI 4LF9E 2PNZB 2HFUA 1Z0EA 2NN6F 4MYTA 2BA0D 1S4EA 3PYFA 5JEAB 1KIJA 3WU4A 4FWDA 4IFDB 2V8PA 2BR2B 3B82A 5JEAC 1I94E 3M85D 4IFDC 1VI7A 1N0UA 5K36E 3L7ZB 3M6AA 3HULA 4USKA 2NN6B 3LPSA 2GO4A 1FWLA 4X66E 4LFCI 2IERA 1BKNA 4NXNE 5IWAE 1MG7A 4AIDA 2NN6C 4DV0I 4B3RI 2F4VE 2VQFI 4HYMA 1KKHA 5K36F 4DV7E 2O1VA 4DU8A 2AJ4A 1HNXI 2VF3A 4OX9I 1EA6A 2ZITA 3JAMQ 5DRPA 4AQYI 3Q6MA 3P06A 4MU0A 3Q6NA 3OTOE 4DR6I 4URLA 1RREA 2O3ZA 4DPUA 3ZZUA 2IOPA 5LL6R 3J7AM 1Z5BA 2HK3A 1HNWE 2DEIA 2Z5BA 5LMUI 2JEBA 4LFAE 4KHPI 4RPFA 4R1FA 4DR1I 3PYGA 2JEAA 2PO0A 1Z5CA 4OO1A 4DPYA 4QNKA 2Z5CA 4JG4A 3T1YE 3T1HE 4QNJA 4ZVIA 5C0XD 4B3TE 4LF5I 1ZXMA 4B3SI 4JI7I 4JI2I 4UT4A 4HY1A 2WNRA 4JI8E 3PS2A 3ZZ0A 4JI3I 1Z0GA 2C38A 2GO3A 2HFSA 3PS3A 4MU1A 5FWKA 5FLXQ 2E1RA 4UTGA 4DUZI 1ZM2A 4DV0E 1PKPA 4B3RE 4IZJA 4DR5I 2VQFE 1A6FA 3M7ND 4JI0I 4JV5E 1N36I 4BA2A 4PRVA 2BM1A 1UDOA 2UXCI 4BA1A 1HNXE 4LF4I 2CVEA 2O1UA 4OX9E 2V2QA 2PNLA 4OKGA 3K85A 1YH8A 5A2QQ 3WU5A 2JE6B 4AQYE 1HNWI 2EFGA 1RHYA 2BV3A 4J3DA 1UDQA
chains in the Genus database with same CATH topology
2Q2EB 4LFBI 1KVKA 3JAMC 4YY3I 1NHHA 1J5EI 4P7AA 3QT7A 5LMUE 2LJPA 4KHPE 4DR1E 1HNZE 3B78A 3WU3A 5GMDA 4GKKI 1EI1A 1H72C 4JI8I 2Z5BB 4LF5E 4JYAI 1PIEA 4B3SE 3PYEA 4JI7E 4JI2E 2HKEA 2Z5CB 2J7KA 1XMOI 1IBLI 4JV5I 4JI3E 4DPWA 1FI4A 2Z5EA 3PYDA 4FWHA 3HJCA 5LMNI 3GONA 4P52A 4MYUA 4LF8I 2PNMA 4M1KA 4B3MI 4DUZE 4DR5E 3B8HA 4JI0E 1N36E 5FLXC 4JI6I 4HACB 2UXCE 4YHHE 4LF4E 2UUCI 1HK7A 4DV1E 1USVA 5BR8I 4NXMI 2BM0A 3J81Q 1IBMI 2UXBI 4LFBE 4YY3E 1HNZI 5A2QC 1J5EE 3D4JA 1Y6ZA 1QZRA 4ED4A 1VISA 1HR0I 2NPFA 1XNRI 4JI4I 4DR7I 3PRYA 4DPTA 1FJGI 4IZKB 4GKKE 2E5LI 4GKJI 1MX0A 3J80Q 1NHJA 1KTVA 1UEKA 3LTOA 1Z0WA 2HKJA 4DV5I 4JI5I 4JYAE 2GS8A 2HK2A 2V2ZA 1N34I 1Y4UA 4KQVA 1ZM4A 1XMOE 3K17A 1DARA 2UUBI 1XNQI 3V5RA 1IBLE 5LMNE 4DR3I 4DPXA 4YHHI 4LF8E 4B3ME 4DV1I 1S16A 2X36A 4K0KI 1RR9A 3Q1QA 4JI6E 1FNMA 2ZM6I 4USMA 3H4LA 4FN5A 2UUCE 4DR4I 1H7UA 3K1JA 2CG9A 4I3HA 4LF7I 5BR8E 4NXME 2O1WA 1IBME 2UXBE 4LF6I 1ZM3A 3ZKDA 1Z5AA 5IT9Q 3J81C 1HR0E 1XNRE 4DV3I 4JI4E 4DR7E 2CZ9A 1PVGA 3QT5A 1FJGE 2E5LE 3LNUA 4GKJE 1NHIA 4FWGA 4X62I 1FKAE 4DV5E 4JI5E 2UUAE 1D6TA 1N34E 1Z0BA 1H73A 2UXDI 3J80C 1Y4SA 2R3VA 4DV6I 4HXZA 2VQEI 2UUBE 1XNQE 2GQ0A 1N0VC 1Z59A 4EMDA 4IZJD 2V2VA 4DR3E 2A2CA 2DEJA 4K0KE 4DV4E 1Z0TA 4IZJB 2R42A 2UU9I 1Z0VA 2ZBKB 2ZM6E 1B62A 1USUA 3QT6A 4WUBA 2OI2A 4N3OA 1MU5A 2V34A 4JI1I 4X65I 4DR4E 3ZKBA 4DV2I 2O1TA 3ZZTA 4DR2I 4LF7E 1OJ4A 1B63A 1N33I 4Z7YA 3V2UC 2XEXA 1N32E 1XHKA 3J7AG 4LF6E 4XTJA 3F0NA 1XMQI 2HHHI 1IBKE 4LF9I 4X64E 1H7SA 4Z7CA 4DV3E 1FWKA 5IT9C 2UUAI 2X7IA 4DUYE 3CWVA 4WUDA 3WU6A 1I94I 1K47A 4WUCA 4X62E 4DXLA 1WUUA 4X66I 2WW4A 1U2RA 4NXNI 5IWAI 2UXDE 4DV6E 2F4VI 2VQEE 4DV7I 1ZM9A 4HACA 4DV4I 4LFCE 2A2DA 1ELOA 4DU7A 5L3JA 4PU9A 5GMEA 2UU9E 3OTOI 2IOQA 3ZM7A 1H74A 4PRXA 4X65E 4JI1E 1N32I 4FW9A 4DV2E 4DR2E 1IBKI 4LFAI 3QT8A 1Z0CA 1N33E 4X64I 1NZ0A 4IZKA 4DUYI 2CGEA 3T1YI 3T1HI 1XMQE 2HHHE 1ZXNA 4B3TI 4LF9E 2HFUA 1Z0EA 4MYTA 1S4EA 3PYFA 1KIJA 3WU4A 4FWDA 2V8PA 3B82A 1I94E 1N0UA 3M6AA 3HULA 4USKA 3LPSA 1FWLA 4X66E 4LFCI 1BKNA 4NXNE 5IWAE 1MG7A 4DV0I 4B3RI 2F4VE 2VQFI 4HYMA 1KKHA 4DV7E 2O1VA 4DU8A 2AJ4A 1HNXI 2VF3A 4OX9I 1EA6A 2ZITA 3JAMQ 4AQYI 3Q6MA 3P06A 3Q6NA 3OTOE 4DR6I 4URLA 1RREA 4DPUA 3ZZUA 2IOPA 5LL6R 3J7AM 1Z5BA 2HK3A 1HNWE 2DEIA 2Z5BA 5LMUI 4LFAE 4KHPI 4RPFA 4R1FA 4DR1I 3PYGA 1Z5CA 4DPYA 2Z5CA 4JG4A 3T1YE 3T1HE 4ZVIA 4B3TE 4LF5I 1ZXMA 4B3SI 4JI7I 4JI2I 4UT4A 4HY1A 4JI8E 3ZZ0A 4JI3I 1Z0GA 2HFSA 5FWKA 5FLXQ 2E1RA 4UTGA 4DUZI 1ZM2A 4DV0E 1PKPA 4B3RE 4IZJA 4DR5I 2VQFE 1A6FA 4JI0I 4JV5E 1N36I 4PRVA 2BM1A 2UXCI 1HNXE 4LF4I 2O1UA 4OX9E 2V2QA 2PNLA 3K85A 5A2QQ 3WU5A 4AQYE 1HNWI 2EFGA 2BV3A 4DR6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E B;  4LFB I;  1KVK A;  3JAM C;  4YY3 I;  1NHH A;  1J5E I;  4P7A A;  3QT7 A;  5LMU E;  2LJP A;  4KHP E;  4DR1 E;  1HNZ E;  3B78 A;  3WU3 A;  5GMD A;  4GKK I;  1EI1 A;  1H72 C;  4JI8 I;  4LF5 E;  4JYA I;  1PIE A;  4B3S E;  3PYE A;  4JI7 E;  4JI2 E;  2HKE A;  2J7K A;  1XMO I;  1IBL I;  4JV5 I;  4JI3 E;  4DPW A;  1FI4 A;  5LMN I;  3PYD A;  4FWH A;  3GON A;  4P52 A;  4MYU A;  4LF8 I;  4M1K A;  4B3M I;  4DUZ E;  4DR5 E;  3B8H A;  4JI0 E;  1N36 E;  5FLX C;  4JI6 I;  4HAC B;  2UXC E;  4YHH E;  4LF4 E;  2UUC I;  4DV1 E;  5BR8 I;  4NXM I;  2BM0 A;  3J81 Q;  1IBM I;  2UXB I;  4LFB E;  4YY3 E;  1HNZ I;  5A2Q C;  1J5E E;  3D4J A;  4ED4 A;  1QZR A;  1VIS A;  1HR0 I;  2NPF A;  1XNR I;  4JI4 I;  4DR7 I;  4DPT A;  1FJG I;  4GKK E;  2E5L I;  4GKJ I;  1MX0 A;  3J80 Q;  1NHJ A;  1KTV A;  1UEK A;  3LTO A;  1Z0W A;  2HKJ A;  4DV5 I;  4JI5 I;  4JYA E;  2GS8 A;  2HK2 A;  2V2Z A;  1N34 I;  4KQV A;  1ZM4 A;  1XMO E;  3K17 A;  1DAR A;  2UUB I;  1XNQ I;  3V5R A;  1IBL E;  5LMN E;  4DR3 I;  4DPX A;  4YHH I;  4LF8 E;  4B3M E;  4DV1 I;  1S16 A;  2X36 A;  4K0K I;  1RR9 A;  3Q1Q A;  4JI6 E;  1FNM A;  2ZM6 I;  4USM A;  3H4L A;  4FN5 A;  2UUC E;  4DR4 I;  1H7U A;  3K1J A;  4I3H A;  4LF7 I;  5BR8 E;  4NXM E;  1IBM E;  2UXB E;  4LF6 I;  1ZM3 A;  3ZKD A;  1Z5A A;  5IT9 Q;  3J81 C;  1HR0 E;  1XNR E;  4DV3 I;  4JI4 E;  4DR7 E;  2CZ9 A;  1PVG A;  3QT5 A;  1FJG E;  2E5L E;  3LNU A;  4GKJ E;  1NHI A;  4FWG A;  4X62 I;  1FKA E;  4DV5 E;  4JI5 E;  2UUA E;  1D6T A;  1N34 E;  1Z0B A;  1H73 A;  2UXD I;  3J80 C;  2R3V A;  4DV6 I;  4HXZ A;  2VQE I;  2UUB E;  1XNQ E;  1N0V C;  1Z59 A;  4EMD A;  2V2V A;  4DR3 E;  2A2C A;  2DEJ A;  4K0K E;  4DV4 E;  1Z0T A;  2R42 A;  2UU9 I;  1Z0V A;  2ZBK B;  2ZM6 E;  1B62 A;  4WUB A;  3QT6 A;  2OI2 A;  1MU5 A;  2V34 A;  4JI1 I;  4X65 I;  4DR4 E;  3ZKB A;  4DV2 I;  3ZZT A;  4DR2 I;  4LF7 E;  1OJ4 A;  1B63 A;  1N33 I;  4Z7Y A;  3V2U C;  2XEX A;  1N32 E;  1XHK A;  3J7A G;  4LF6 E;  4XTJ A;  3F0N A;  1XMQ I;  2HHH I;  1IBK E;  4LF9 I;  4X64 E;  1H7S A;  4Z7C A;  4DV3 E;  1FWK A;  5IT9 C;  2UUA I;  2X7I A;  4DUY E;  3CWV A;  4WUD A;  3WU6 A;  1I94 I;  1K47 A;  4WUC A;  4X62 E;  4DXL A;  1WUU A;  4X66 I;  2WW4 A;  1U2R A;  4NXN I;  5IWA I;  2UXD E;  4DV6 E;  2F4V I;  2VQE E;  4DV7 I;  1ZM9 A;  4HAC A;  4DV4 I;  4LFC E;  2A2D A;  1ELO A;  4DU7 A;  5L3J A;  4PU9 A;  5GME A;  2UU9 E;  3OTO I;  3ZM7 A;  1H74 A;  4PRX A;  4X65 E;  4JI1 E;  1N32 I;  4FW9 A;  4DV2 E;  4DR2 E;  1IBK I;  4LFA I;  3QT8 A;  1Z0C A;  1N33 E;  4X64 I;  1NZ0 A;  4DUY I;  3T1Y I;  3T1H I;  1XMQ E;  2HHH E;  1ZXN A;  4B3T I;  4LF9 E;  2HFU A;  1Z0E A;  4MYT A;  1S4E A;  3PYF A;  1KIJ A;  3WU4 A;  4FWD A;  2V8P A;  3B82 A;  1I94 E;  1N0U A;  3M6A A;  3HUL A;  4USK A;  3LPS A;  1FWL A;  4X66 E;  4LFC I;  1BKN A;  4NXN E;  5IWA E;  1MG7 A;  4DV0 I;  4B3R I;  2F4V E;  2VQF I;  4HYM A;  1KKH A;  4DV7 E;  4DU8 A;  2AJ4 A;  1HNX I;  2VF3 A;  4OX9 I;  1EA6 A;  2ZIT A;  3JAM Q;  4AQY I;  3OTO E;  4DR6 I;  4URL A;  1RRE A;  4DPU A;  3ZZU A;  5LL6 R;  3J7A M;  1Z5B A;  2HK3 A;  1HNW E;  2DEI A;  5LMU I;  4LFA E;  4KHP I;  4RPF A;  4R1F A;  4DR1 I;  3PYG A;  1Z5C A;  4DPY A;  4JG4 A;  3T1Y E;  3T1H E;  4ZVI A;  4B3T E;  4LF5 I;  1ZXM A;  4B3S I;  4JI7 I;  4JI2 I;  4UT4 A;  4HY1 A;  4JI8 E;  3ZZ0 A;  4JI3 I;  1Z0G A;  2HFS A;  5FLX Q;  2E1R A;  4UTG A;  4DUZ I;  1ZM2 A;  4DV0 E;  1PKP A;  4B3R E;  4DR5 I;  2VQF E;  1A6F A;  4JI0 I;  4JV5 E;  1N36 I;  4PRV A;  2BM1 A;  2UXC I;  1HNX E;  4LF4 I;  4OX9 E;  2V2Q A;  5A2Q Q;  3WU5 A;  4AQY E;  1HNW I;  2EFG A;  2BV3 A;  4DR6 E; 
#chains in the Genus database with same CATH topology
 2Q2E B;  4LFB I;  1KVK A;  3JAM C;  4YY3 I;  1NHH A;  4OO1 E;  1J5E I;  5JEA D;  4P7A A;  1OYP A;  3QT7 A;  5LMU E;  2LJP A;  4KHP E;  3P3E A;  4DR6 E;  4DR1 E;  3B4T A;  1Y5Y A;  1HNZ E;  3B78 A;  3WU3 A;  5GMD A;  2AE8 A;  3CDI A;  2NN6 D;  4GKK I;  1EI1 A;  1H72 C;  4U3B A;  4JI8 I;  2Z5B B;  4LF5 E;  4JYA I;  4IS9 A;  1PIE A;  4B3S E;  1R6M A;  3PYE A;  4JI7 E;  4JI2 E;  4AM3 A;  2HKE A;  2Z5C B;  2IES A;  1UDN A;  4FW5 A;  2J7K A;  1XMO I;  4LCG A;  2C37 B;  1IBL I;  4JV5 I;  4JI3 E;  4DPW A;  1FI4 A;  2PO1 B;  2Z5E A;  3PYD A;  4FWH A;  3HJC A;  5LMN I;  5K36 D;  5EKW A;  3PS1 A;  3GON A;  4FW4 A;  4P52 A;  4MYU A;  3P3C A;  4LF8 I;  2PNM A;  4M1K A;  4B3M I;  2WNR B;  4DUZ E;  4DR5 E;  3B8H A;  4JI0 E;  3GLL A;  1N36 E;  5FLX C;  4JI6 I;  4HAC B;  2UXC E;  2C38 B;  5K36 B;  4YHH E;  4LF4 E;  4LCF A;  2UUC I;  2C39 B;  2BA1 G;  1HK7 A;  4DV1 E;  5K36 C;  1USV A;  3U1Y A;  4BA2 B;  5BR8 I;  1YHC A;  4NXM I;  2BM0 A;  3J81 Q;  2JT2 A;  1IBM I;  2UXB I;  4LFB E;  4YY3 E;  1HNZ I;  3GCM A;  5A2Q C;  1J5E E;  3D4J A;  2PO2 B;  2PNZ A;  1Y6Z A;  1QZR A;  4ED4 A;  1VIS A;  1HR0 I;  2NPF A;  1OYR A;  1XNR I;  4IFD A;  4JI4 I;  4GQU A;  4DR7 I;  2BR2 A;  3PRY A;  4DPT A;  1FJG I;  5ELW A;  4IZK B;  4GKK E;  2E5L I;  4GKJ I;  1MX0 A;  1Y60 A;  3J80 Q;  1NHJ A;  1KTV A;  1UEK A;  3LTO A;  1Z0W A;  2HKJ A;  4U3D A;  4DV5 I;  3GME A;  4JI5 I;  4JYA E;  2GS8 A;  2HK2 A;  2F1D A;  2V2Z A;  1N34 I;  1P42 A;  2VES A;  1Y4U A;  1UDS A;  4KQV A;  1ZM4 A;  1XMO E;  3K17 A;  1DAR A;  2UUB I;  1XNQ I;  4MU3 A;  3V5R A;  1IBL E;  2WP8 A;  3DD6 A;  5LMN E;  4DR3 I;  4DPX A;  4YHH I;  4MQY A;  4LF8 E;  4B3M E;  4DV1 I;  1S16 A;  2X36 A;  4K0K I;  1RR9 A;  4LCH A;  4FW7 A;  3Q1Q A;  4JI6 E;  1FNM A;  2ZM6 I;  4USM A;  3H4L A;  4FN5 A;  2UUC E;  4DR4 I;  1H7U A;  3K1J A;  4MU4 A;  2CG9 A;  4I3H A;  4LF7 I;  5BR8 E;  4NXM E;  4IFD E;  2O1W A;  1IBM E;  2UXB E;  4LF6 I;  3KRN A;  4OO1 F;  1ZM3 A;  3ZKD A;  1Z5A A;  5IT9 Q;  4OO1 D;  3J81 C;  3UHM A;  2NN6 E;  2JEB B;  4IFD F;  1HR0 E;  1XNR E;  4DV3 I;  4JI4 E;  4DR7 E;  2CZ9 A;  1PVG A;  2JEA B;  2PO0 B;  3QT5 A;  5C0X A;  1FJG E;  4FW6 A;  4OO1 B;  2E5L E;  3LNU A;  4GKJ E;  1NHI A;  4FWG A;  4X62 I;  1FKA E;  4MDT A;  4OO1 C;  4DV5 E;  4JI5 E;  2BA1 D;  2UUA E;  1D6T A;  1N34 E;  1Z0B A;  1H73 A;  2UXD I;  3J80 C;  1Y4S A;  2R3V A;  4DV6 I;  4HXZ A;  2VQE I;  2UUB E;  1XNQ E;  2GQ0 A;  1N0V C;  1Z59 A;  4EMD A;  4IZJ D;  3U1K A;  2BA0 G;  2V2V A;  4DR3 E;  1E3P A;  5EL9 A;  2JE6 A;  2A2C A;  2DEJ A;  4K0K E;  4DV4 E;  1Z0T A;  4IZJ B;  2R42 A;  3M85 G;  2UU9 I;  1Z0V A;  2ZBK B;  4WUB A;  1B62 A;  1USU A;  2WP8 B;  3QT6 A;  2ZM6 E;  2OI2 A;  4N3O A;  1MU5 A;  4BA1 B;  3CDJ A;  2V34 A;  4JI1 I;  5DRO A;  3NZK A;  4X65 I;  4DR4 E;  3ZKB A;  4DV2 I;  2O1T A;  3ZZT A;  4DR2 I;  4LF7 E;  1OJ4 A;  1B63 A;  1N33 I;  4Z7Y A;  4ISA A;  5JEA A;  5DNX A;  3V2U C;  2XEX A;  1N32 E;  1XHK A;  3J7A G;  5C0X E;  4LF6 E;  4XTJ A;  3F0N A;  1XMQ I;  2HHH I;  1IBK E;  4LF9 I;  3H1C A;  3L7Z A;  4NBQ A;  4X64 E;  2NN6 A;  1H7S A;  4Z7C A;  4DV3 E;  4OZE A;  1FWK A;  5IT9 C;  2UUA I;  5C0X F;  2X7I A;  4DUY E;  3CWV A;  4WUD A;  3WU6 A;  2C37 A;  1I94 I;  1K47 A;  4WUC A;  4X62 E;  2PO1 A;  4DXL A;  1WUU A;  4AIM A;  4X66 I;  2WW4 A;  3HKM A;  1U2R A;  4NXN I;  5IWA I;  5C0X B;  2UXD E;  4DV6 E;  2F4V I;  2VQE E;  4DV7 I;  1ZM9 A;  4HAC A;  5C0X C;  5K36 A;  4DV4 I;  4LFC E;  5DRQ A;  2C39 A;  2A2D A;  1XXE A;  1ELO A;  4DU7 A;  2J65 A;  5L3J A;  5DRR A;  4PU9 A;  5GME A;  1R6L A;  2UU9 E;  5DNL A;  3OTO I;  5JEA E;  2IOQ A;  3ZM7 A;  1H74 A;  4PRX A;  4X65 E;  4JI1 E;  1N32 I;  4FW9 A;  2PO2 A;  4DV2 E;  3P3G A;  1E3H A;  3P76 A;  4LOM A;  4FW3 A;  4DR2 E;  1IBK I;  4LFA I;  1OYS A;  1Z0C A;  3QT8 A;  1N33 E;  3M7N G;  5JEA F;  4X64 I;  1NZ0 A;  4LPF A;  4IZK A;  4IFD D;  4DUY I;  2CGE A;  3T1Y I;  3T1H I;  1XMQ E;  2HHH E;  1ZXN A;  4B3T I;  4LF9 E;  2PNZ B;  2HFU A;  1Z0E A;  2NN6 F;  4MYT A;  2BA0 D;  1S4E A;  3PYF A;  5JEA B;  1KIJ A;  3WU4 A;  4FWD A;  4IFD B;  2V8P A;  2BR2 B;  3B82 A;  5JEA C;  1I94 E;  3M85 D;  4IFD C;  1VI7 A;  1N0U A;  5K36 E;  3L7Z B;  3M6A A;  3HUL A;  4USK A;  2NN6 B;  3LPS A;  2GO4 A;  1FWL A;  4X66 E;  4LFC I;  2IER A;  1BKN A;  4NXN E;  5IWA E;  1MG7 A;  4AID A;  2NN6 C;  4DV0 I;  4B3R I;  2F4V E;  2VQF I;  4HYM A;  1KKH A;  5K36 F;  4DV7 E;  2O1V A;  4DU8 A;  2AJ4 A;  1HNX I;  2VF3 A;  4OX9 I;  1EA6 A;  2ZIT A;  3JAM Q;  5DRP A;  4AQY I;  3Q6M A;  3P06 A;  4MU0 A;  3Q6N A;  3OTO E;  4DR6 I;  4URL A;  1RRE A;  2O3Z A;  4DPU A;  3ZZU A;  2IOP A;  5LL6 R;  3J7A M;  1Z5B A;  2HK3 A;  1HNW E;  2DEI A;  2Z5B A;  5LMU I;  2JEB A;  4LFA E;  4KHP I;  4RPF A;  4R1F A;  4DR1 I;  3PYG A;  2JEA A;  2PO0 A;  1Z5C A;  4OO1 A;  4DPY A;  4QNK A;  2Z5C A;  4JG4 A;  3T1Y E;  3T1H E;  4QNJ A;  4ZVI A;  5C0X D;  4B3T E;  4LF5 I;  1ZXM A;  4B3S I;  4JI7 I;  4JI2 I;  4UT4 A;  4HY1 A;  2WNR A;  4JI8 E;  3PS2 A;  3ZZ0 A;  4JI3 I;  1Z0G A;  2C38 A;  2GO3 A;  2HFS A;  3PS3 A;  4MU1 A;  5FWK A;  5FLX Q;  2E1R A;  4UTG A;  4DUZ I;  1ZM2 A;  4DV0 E;  1PKP A;  4B3R E;  4IZJ A;  4DR5 I;  2VQF E;  1A6F A;  3M7N D;  4JI0 I;  4JV5 E;  1N36 I;  4BA2 A;  4PRV A;  2BM1 A;  1UDO A;  2UXC I;  4BA1 A;  1HNX E;  4LF4 I;  2CVE A;  2O1U A;  4OX9 E;  2V2Q A;  2PNL A;  4OKG A;  3K85 A;  1YH8 A;  5A2Q Q;  3WU5 A;  2JE6 B;  4AQY E;  1HNW I;  2EFG A;  1RHY A;  2BV3 A;  4J3D A;  1UDQ A; 
#chains in the Genus database with same CATH homology
 2Q2E B;  4LFB I;  1KVK A;  3JAM C;  4YY3 I;  1NHH A;  1J5E I;  4P7A A;  3QT7 A;  5LMU E;  2LJP A;  4KHP E;  4DR1 E;  1HNZ E;  3B78 A;  3WU3 A;  5GMD A;  4GKK I;  1EI1 A;  1H72 C;  4JI8 I;  2Z5B B;  4LF5 E;  4JYA I;  1PIE A;  4B3S E;  3PYE A;  4JI7 E;  4JI2 E;  2HKE A;  2Z5C B;  2J7K A;  1XMO I;  1IBL I;  4JV5 I;  4JI3 E;  4DPW A;  1FI4 A;  2Z5E A;  3PYD A;  4FWH A;  3HJC A;  5LMN I;  3GON A;  4P52 A;  4MYU A;  4LF8 I;  2PNM A;  4M1K A;  4B3M I;  4DUZ E;  4DR5 E;  3B8H A;  4JI0 E;  1N36 E;  5FLX C;  4JI6 I;  4HAC B;  2UXC E;  4YHH E;  4LF4 E;  2UUC I;  1HK7 A;  4DV1 E;  1USV A;  5BR8 I;  4NXM I;  2BM0 A;  3J81 Q;  1IBM I;  2UXB I;  4LFB E;  4YY3 E;  1HNZ I;  5A2Q C;  1J5E E;  3D4J A;  1Y6Z A;  1QZR A;  4ED4 A;  1VIS A;  1HR0 I;  2NPF A;  1XNR I;  4JI4 I;  4DR7 I;  3PRY A;  4DPT A;  1FJG I;  4IZK B;  4GKK E;  2E5L I;  4GKJ I;  1MX0 A;  3J80 Q;  1NHJ A;  1KTV A;  1UEK A;  3LTO A;  1Z0W A;  2HKJ A;  4DV5 I;  4JI5 I;  4JYA E;  2GS8 A;  2HK2 A;  2V2Z A;  1N34 I;  1Y4U A;  4KQV A;  1ZM4 A;  1XMO E;  3K17 A;  1DAR A;  2UUB I;  1XNQ I;  3V5R A;  1IBL E;  5LMN E;  4DR3 I;  4DPX A;  4YHH I;  4LF8 E;  4B3M E;  4DV1 I;  1S16 A;  2X36 A;  4K0K I;  1RR9 A;  3Q1Q A;  4JI6 E;  1FNM A;  2ZM6 I;  4USM A;  3H4L A;  4FN5 A;  2UUC E;  4DR4 I;  1H7U A;  3K1J A;  2CG9 A;  4I3H A;  4LF7 I;  5BR8 E;  4NXM E;  2O1W A;  1IBM E;  2UXB E;  4LF6 I;  1ZM3 A;  3ZKD A;  1Z5A A;  5IT9 Q;  3J81 C;  1HR0 E;  1XNR E;  4DV3 I;  4JI4 E;  4DR7 E;  2CZ9 A;  1PVG A;  3QT5 A;  1FJG E;  2E5L E;  3LNU A;  4GKJ E;  1NHI A;  4FWG A;  4X62 I;  1FKA E;  4DV5 E;  4JI5 E;  2UUA E;  1D6T A;  1N34 E;  1Z0B A;  1H73 A;  2UXD I;  3J80 C;  1Y4S A;  2R3V A;  4DV6 I;  4HXZ A;  2VQE I;  2UUB E;  1XNQ E;  2GQ0 A;  1N0V C;  1Z59 A;  4EMD A;  4IZJ D;  2V2V A;  4DR3 E;  2A2C A;  2DEJ A;  4K0K E;  4DV4 E;  1Z0T A;  4IZJ B;  2R42 A;  2UU9 I;  1Z0V A;  2ZBK B;  2ZM6 E;  1B62 A;  1USU A;  3QT6 A;  4WUB A;  2OI2 A;  4N3O A;  1MU5 A;  2V34 A;  4JI1 I;  4X65 I;  4DR4 E;  3ZKB A;  4DV2 I;  2O1T A;  3ZZT A;  4DR2 I;  4LF7 E;  1OJ4 A;  1B63 A;  1N33 I;  4Z7Y A;  3V2U C;  2XEX A;  1N32 E;  1XHK A;  3J7A G;  4LF6 E;  4XTJ A;  3F0N A;  1XMQ I;  2HHH I;  1IBK E;  4LF9 I;  4X64 E;  1H7S A;  4Z7C A;  4DV3 E;  1FWK A;  5IT9 C;  2UUA I;  2X7I A;  4DUY E;  3CWV A;  4WUD A;  3WU6 A;  1I94 I;  1K47 A;  4WUC A;  4X62 E;  4DXL A;  1WUU A;  4X66 I;  2WW4 A;  1U2R A;  4NXN I;  5IWA I;  2UXD E;  4DV6 E;  2F4V I;  2VQE E;  4DV7 I;  1ZM9 A;  4HAC A;  4DV4 I;  4LFC E;  2A2D A;  1ELO A;  4DU7 A;  5L3J A;  4PU9 A;  5GME A;  2UU9 E;  3OTO I;  2IOQ A;  3ZM7 A;  1H74 A;  4PRX A;  4X65 E;  4JI1 E;  1N32 I;  4FW9 A;  4DV2 E;  4DR2 E;  1IBK I;  4LFA I;  3QT8 A;  1Z0C A;  1N33 E;  4X64 I;  1NZ0 A;  4IZK A;  4DUY I;  2CGE A;  3T1Y I;  3T1H I;  1XMQ E;  2HHH E;  1ZXN A;  4B3T I;  4LF9 E;  2HFU A;  1Z0E A;  4MYT A;  1S4E A;  3PYF A;  1KIJ A;  3WU4 A;  4FWD A;  2V8P A;  3B82 A;  1I94 E;  1N0U A;  3M6A A;  3HUL A;  4USK A;  3LPS A;  1FWL A;  4X66 E;  4LFC I;  1BKN A;  4NXN E;  5IWA E;  1MG7 A;  4DV0 I;  4B3R I;  2F4V E;  2VQF I;  4HYM A;  1KKH A;  4DV7 E;  2O1V A;  4DU8 A;  2AJ4 A;  1HNX I;  2VF3 A;  4OX9 I;  1EA6 A;  2ZIT A;  3JAM Q;  4AQY I;  3Q6M A;  3P06 A;  3Q6N A;  3OTO E;  4DR6 I;  4URL A;  1RRE A;  4DPU A;  3ZZU A;  2IOP A;  5LL6 R;  3J7A M;  1Z5B A;  2HK3 A;  1HNW E;  2DEI A;  2Z5B A;  5LMU I;  4LFA E;  4KHP I;  4RPF A;  4R1F A;  4DR1 I;  3PYG A;  1Z5C A;  4DPY A;  2Z5C A;  4JG4 A;  3T1Y E;  3T1H E;  4ZVI A;  4B3T E;  4LF5 I;  1ZXM A;  4B3S I;  4JI7 I;  4JI2 I;  4UT4 A;  4HY1 A;  4JI8 E;  3ZZ0 A;  4JI3 I;  1Z0G A;  2HFS A;  5FWK A;  5FLX Q;  2E1R A;  4UTG A;  4DUZ I;  1ZM2 A;  4DV0 E;  1PKP A;  4B3R E;  4IZJ A;  4DR5 I;  2VQF E;  1A6F A;  4JI0 I;  4JV5 E;  1N36 I;  4PRV A;  2BM1 A;  2UXC I;  1HNX E;  4LF4 I;  2O1U A;  4OX9 E;  2V2Q A;  2PNL A;  3K85 A;  5A2Q Q;  3WU5 A;  4AQY E;  1HNW I;  2EFG A;  2BV3 A;  4DR6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...