1HNZI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzI00
1H72C 2F4VE 4DUZE 1U2RA 3J81Q 2R42A 4JI6E 4X66E 4DU7A 4DPYA 4LF5I 4DR4I 1A6FA 4ZVIA 1Z0TA 2UUCE 4YHHE 4ED4A 4DV2I 4DR4E 2BM0A 4B3TI 4DV7E 2VQFI 5L3JA 5IT9Q 3H4LA 4DV2E 2E5LI 1PKPA 1HNWE 3B82A 1FKAE 5A2QC 4LF8E 1J5EI 1MU5A 2E5LE 1RREA 4DR1I 4JI7E 4DV1I 3QT6A 1J5EE 4X64E 4EMDA 3T1HI 4JI8E 1I94I 3OTOI 4Z7YA 3T1HE 4YY3I 4DXLA 1N0UA 4KHPI 3QT8A 4XTJA 1N32I 4USKA 2V2VA 4JI1E 4FWDA 5FLXQ 2EFGA 4OX9I 5IWAE 4B3SI 1N34E 3JAMC 2AJ4A 1WUUA 4DV0I 1ZXNA 1IBMI 1FJGI 4HYMA 3GONA 4DV5I 4DUYI 2VQEE 1XMOI 1FJGE 3CWVA 4DPXA 1KIJA 3QT5A 2Q2EB 4DV5E 1FWKA 4JG4A 4K0KE 2DEJA 1XHKA 2ZM6E 1Z59A 4LF4E 4HACB 1N33I 4DPTA 1EA6A 1RR9A 2HHHI 2UU9I 4DPWA 1HNZE 4DV6I 4DV3I 2HKEA 2F4VI 4DUZI 4P7AA 1Z0GA 3B78A 2ZITA 1KVKA 4JI6I 4DV6E 4DV3E 3ZZ0A 5LMUE 2UXCI 5GMEA 5BR8I 2UUCI 4HXZA 4YHHI 2UXCE 3WU5A 4DR7E 2DEIA 4DV7I 5BR8E 1XNRE 1HNWI 2E1RA 4PRVA 4LF8I 4JI4E 3V5RA 1Z0CA 3J7AG 4LF9E 1PIEA 3ZZTA 2WW4A 4JI7I 4NXME 2NPFA 4X64I 4JI8I 4DR6I 1N36I 4KQVA 4B3RE 5IT9C 2BV3A 1HNXE 2HFUA 4DR6E 1N36E 1D6TA 4LF7E 4R1FA 4JI1I 4NXNE 5IWAI 1N34I 1NHIA 4X62I 3J80C 3Q1QA 2HK2A 1Z0VA 1FWLA 2BM1A 4X62E 1BKNA 1ZM2A 1Z0EA 2VQEI 1DARA 4JI3E 5FLXC 4GKKI 4M1KA 1HR0E 3LTOA 4DU8A 4X65E 1K47A 4GKKE 4K0KI 2UXDE 1KTVA 4LF6E 3PYEA 2ZM6I 4LF4I 2UUAE 4DR5E 4MYTA 2LJPA 4MYUA 2HFSA 1QZRA 2X7IA 4LFCE 4GKJE 1NHHA 4JV5I 2HK3A 4PRXA 1N0VC 2A2DA 4LFBE 1NHJA 2V34A 1HNZI 4HY1A 1Z5BA 4JYAE 1MG7A 2OI2A 3WU4A 1NZ0A 2A2CA 4I3HA 4JV5E 4RPFA 2V2QA 4DPUA 4DR3I 1ZM9A 5LMUI 4FN5A 4DR3E 5GMDA 1EI1A 1VISA 1XMQE 4DR7I 1UEKA 1XNRI 3PYFA 4JI2E 4DR2I 1MX0A 4JI5E 1B62A 2UXBI 3J81C 4JI4I 1OJ4A 1Z0BA 1ZM4A 4DR2E 4AQYE 4LFAE 4LF9I 2UXBE 4Z7CA 4NXMI 1FI4A 1IBKI 4UTGA 4B3RI 1Z0WA 3HULA 1IBKE 1HNXI 3J7AM 4LF7I 5A2QQ 3T1YI 4LF5E 4HACA 3ZKBA 4NXNI 1IBLI 4PU9A 3T1YE 4B3TE 1FNMA 2HKJA 4FWHA 2VQFE 1KKHA 1IBLE 3ZM7A 4FWGA 2J7KA 1S16A 3B8HA 3LNUA 3ZKDA 5LMNI 4WUCA 4JI3I 3J80Q 1HR0I 3D4JA 1S4EA 4DR1E 5LMNE 2CZ9A 4DV1E 4X65I 2X36A 3JAMQ 1I94E 2UXDI 3WU6A 1ZXMA 4WUBA 3WU3A 3OTOE 4LF6I 3M6AA 4B3MI 2VF3A 4YY3E 2UUAI 4KHPE 4DR5I 1Z5AA 3V2UC 1N32E 4UT4A 4B3ME 4LFCI 4P52A 4GKJI 4OX9E 2ZBKB 1H74A 4B3SE 2V8PA 2XEXA 1Z5CA 4LFBI 4DV0E 4JYAI 1IBME 3PYDA 3LPSA 4DV4I 1H73A 4DUYE 1XMOE 4DV4E 4JI0I 1PVGA 1H7UA 1B63A 4JI0E 1ZM3A 3F0NA 3PYGA 1XMQI 3K17A 2UUBI 1XNQI 4JI2I 5LL6R 1N33E 2V2ZA 4FW9A 4WUDA 2UUBE 4JI5I 2GS8A 1XNQE 3ZZUA 4URLA 2R3VA 3K1JA 3QT7A 1ELOA 4AQYI 2HHHE 4LFAI 2UU9E 4USMA 1H7SA 4X66I
chains in the Genus database with same CATH superfamily
1H72C 3PS1A 2F4VE 4DUZE 1U2RA 3J81Q 1HK7A 2NN6B 2R42A 4JI6E 2C39B 4X66E 4DU7A 3GMEA 2Z5BB 4IZJD 4IFDD 2BA1D 5DRPA 4DPYA 4LF5I 4MU0A 2O1UA 4DR4I 1A6FA 4ZVIA 1Z0TA 2UUCE 4YHHE 4ED4A 4DV2I 3UHMA 4DR4E 2BM0A 4B3TI 4DV7E 2CGEA 2VQFI 5C0XD 5L3JA 4IZJB 5IT9Q 3H4LA 4DV2E 2E5LI 1PKPA 2VESA 1HNWE 3B82A 2GQ0A 1FKAE 5A2QC 4OO1A 3CDJA 4LF8E 1J5EI 1MU5A 2E5LE 1RREA 2IERA 4NBQA 4DR1I 4JI7E 4DV1I 3QT6A 1J5EE 4BA1B 4AIMA 4X64E 4EMDA 3T1HI 4JI8E 1I94I 2C38A 3GLLA 3KRNA 3OTOI 4Z7YA 4N3OA 3T1HE 2PO1B 4YY3I 4DXLA 1N0UA 4OO1E 4KHPI 3QT8A 4XTJA 5K36A 2PNZA 1N32I 4USKA 2V2VA 4JI1E 4FWDA 5FLXQ 2EFGA 4OX9I 2CVEA 5IWAE 4B3SI 1N34E 4MU1A 3JAMC 4LCHA 2AJ4A 1WUUA 2PO2B 4IFDC 4DV0I 1ZXNA 1IBMI 1FJGI 1OYPA 3M85G 4IFDF 4HYMA 4QNJA 3GONA 4DV5I 1Y4UA 1P42A 4DUYI 2VQEE 1XMOI 1FJGE 5K36E 3CWVA 4MQYA 4DPXA 5C0XC 2BA0G 1KIJA 3QT5A 2Q2EB 4DV5E 2WP8B 2BR2A 1E3PA 2Z5CB 4LPFA 1FWKA 3M85D 3NZKA 4JG4A 3P3EA 4K0KE 2DEJA 2NN6E 4AM3A 4MDTA 1XHKA 3HJCA 2ZM6E 1Z59A 4LF4E 4HACB 1N33I 4DPTA 1EA6A 2JEAA 4IS9A 1RR9A 4BA2B 2HHHI 2UU9I 1E3HA 4DPWA 1HNZE 2PO0A 2O1VA 4DV6I 4DV3I 2HKEA 2WNRA 4DUZI 2F4VI 4P7AA 1Z0GA 1Y60A 3B78A 2O1WA 2ZITA 1KVKA 4JI6I 4DV6E 4DV3E 3ZZ0A 1USUA 5LMUE 2JEBB 2UXCI 5GMEA 4ISAA 5BR8I 2C37A 2UUCI 4HXZA 4YHHI 2UXCE 1YH8A 3PS3A 3WU5A 4DR7E 2DEIA 5DRQA 4DV7I 5BR8E 1XNRE 1HNWI 3B4TA 2E1RA 4MU4A 5EKWA 5JEAA 4IFDB 4PRVA 4LF8I 4JI4E 4LCGA 3V5RA 1Z0CA 3J7AG 2PNMA 4LF9E 1PIEA 3ZZTA 2WW4A 4OO1F 1UDOA 4JI7I 4NXME 2NPFA 3P76A 4X64I 4JI8I 4DR6I 5C0XB 1N36I 4KQVA 4B3RE 5IT9C 4IZKB 2JT2A 2BV3A 1HNXE 2HFUA 5JEAE 4DR6E 1N36E 1D6TA 4LF7E 3L7ZA 1R6MA 4R1FA 3Q6NA 4JI1I 4NXNE 5IWAI 1N34I 1NHIA 4X62I 5K36F 5FWKA 3J80C 3Q1QA 2HK2A 1Z0VA 3CDIA 1XXEA 2Z5EA 3PRYA 1FWLA 2BM1A 4X62E 1BKNA 1ZM2A 1Z0EA 2VQEI 1DARA 2IOQA 2O3ZA 2NN6A 4JI3E 4FW3A 5FLXC 2C39A 4GKKI 3P3GA 4M1KA 1HR0E 3LTOA 4DU8A 4X65E 1K47A 4GKKE 4K0KI 2UXDE 1KTVA 4LCFA 4LF6E 3PYEA 2ZM6I 4LF4I 2UUAE 4IZJA 2O1TA 4DR5E 4MYTA 2LJPA 4MYUA 2HFSA 1QZRA 2X7IA 4OO1D 2GO3A 4LFCE 4GKJE 1NHHA 4FW4A 5EL9A 4JV5I 2HK3A 4PRXA 1N0VC 2A2DA 4J3DA 4LFBE 1NHJA 2V34A 1HNZI 4HY1A 2PNLA 1Z5BA 1VI7A 2JE6A 1MG7A 2OI2A 4JYAE 3WU4A 1NZ0A 2A2CA 4I3HA 4JV5E 4RPFA 2V2QA 4OO1B 5DROA 4BA1A 4DPUA 1YHCA 4IFDE 4DR3I 1ZM9A 3P3CA 5LMUI 2PO1A 5K36D 3HKMA 4FN5A 4DR3E 3H1CA 5GMDA 2C38B 3K85A 1EI1A 5C0XE 3M7NG 1VISA 1XMQE 4DR7I 3PS2A 1UEKA 1XNRI 3PYFA 5K36B 2PNZB 4JI2E 2GO4A 4DR2I 2NN6D 3U1KA 1MX0A 4JI5E 1B62A 2UXBI 3J81C 3M7ND 2AE8A 1RHYA 4JI4I 1OJ4A 1Z0BA 1ZM4A 4DR2E 4AQYE 4LFAE 4LF9I 5JEAF 2UXBE 4Z7CA 4NXMI 1FI4A 2WP8A 1IBKI 4UTGA 5DNLA 2Z5CA 4OO1C 4B3RI 1Z0WA 4FW5A 3HULA 4QNKA 5ELWA 1IBKE 1HNXI 2BR2B 4OZEA 3J7AM 4LF7I 5DNXA 5A2QQ 3T1YI 4LF5E 4HACA 3ZKBA 4NXNI 1Y4SA 1IBLI 4PU9A 3T1YE 4B3TE 1FNMA 4BA2A 2HKJA 5K36C 4FWHA 2VQFE 1KKHA 1IBLE 3ZM7A 2JEAB 4FWGA 2J7KA 4OKGA 1S16A 2JE6B 3B8HA 3LNUA 3ZKDA 5LMNI 4WUCA 4JI3I 3J80Q 1Y6ZA 2PO0B 2NN6C 3D4JA 1HR0I 1UDNA 1S4EA 4DR1E 2WNRB 2JEBA 5LMNE 2CZ9A 4AIDA 4DV1E 4X65I 2X36A 2NN6F 3JAMQ 1I94E 2J65A 2UXDI 3WU6A 1ZXMA 4WUBA 3WU3A 3OTOE 2Z5BA 1OYRA 3P06A 4LF6I 3M6AA 2VF3A 4B3MI 4YY3E 2UUAI 3GCMA 4KHPE 4DR5I 2C37B 1OYSA 1Z5AA 4U3BA 3V2UC 1N32E 5JEAD 4UT4A 4B3ME 4LFCI 4P52A 4GKJI 4OX9E 2ZBKB 1H74A 4FW7A 5DRRA 4B3SE 2V8PA 2XEXA 1Z5CA 4IFDA 4LFBI 3DD6A 4DV0E 4JYAI 3U1YA 3PYDA 1IBME 3LPSA 4U3DA 4DV4I 1USVA 5JEAB 1H73A 1UDQA 2CG9A 5C0XF 5C0XA 4DUYE 1XMOE 4DV4E 4JI0I 4IZKA 1PVGA 1H7UA 4MU3A 1B63A 2BA0D 4JI0E 1ZM3A 1R6LA 3F0NA 1UDSA 3PYGA 1XMQI 3K17A 2UUBI 1Y5YA 1XNQI 3L7ZB 4JI2I 4LOMA 5LL6R 1N33E 4GQUA 2V2ZA 4FW9A 4WUDA 2UUBE 4JI5I 2F1DA 2GS8A 4FW6A 3ZZUA 4URLA 1XNQE 2PO2A 2R3VA 3Q6MA 3K1JA 2IESA 3QT7A 1ELOA 2IOPA 4AQYI 2HHHE 4LFAI 2UU9E 4USMA 1H7SA 2BA1G 5JEAC 4X66I
chains in the Genus database with same CATH topology
1H72C 2F4VE 4DUZE 1U2RA 3J81Q 1HK7A 2R42A 4JI6E 4X66E 4DU7A 2Z5BB 4IZJD 4DPYA 4LF5I 2O1UA 4DR4I 1A6FA 4ZVIA 1Z0TA 2UUCE 4YHHE 4ED4A 4DV2I 4DR4E 2BM0A 4B3TI 4DV7E 2CGEA 2VQFI 5L3JA 4IZJB 5IT9Q 3H4LA 4DV2E 2E5LI 1PKPA 1HNWE 3B82A 2GQ0A 1FKAE 5A2QC 4LF8E 1J5EI 1MU5A 2E5LE 1RREA 4DR1I 4JI7E 4DV1I 3QT6A 1J5EE 4X64E 4EMDA 3T1HI 4JI8E 1I94I 3OTOI 4Z7YA 4N3OA 3T1HE 4YY3I 4DXLA 1N0UA 4KHPI 3QT8A 4XTJA 1N32I 4USKA 2V2VA 4JI1E 4FWDA 5FLXQ 2EFGA 4OX9I 5IWAE 4B3SI 1N34E 3JAMC 2AJ4A 1WUUA 4DV0I 1ZXNA 1IBMI 1FJGI 4HYMA 3GONA 4DV5I 1Y4UA 4DUYI 2VQEE 1XMOI 1FJGE 3CWVA 4DPXA 1KIJA 3QT5A 2Q2EB 4DV5E 2Z5CB 1FWKA 4JG4A 4K0KE 2DEJA 1XHKA 3HJCA 2ZM6E 1Z59A 4LF4E 4HACB 1N33I 4DPTA 1EA6A 1RR9A 2HHHI 2UU9I 4DPWA 1HNZE 2O1VA 4DV6I 4DV3I 2HKEA 2F4VI 4DUZI 4P7AA 1Z0GA 3B78A 2O1WA 2ZITA 1KVKA 4JI6I 4DV6E 4DV3E 3ZZ0A 1USUA 5LMUE 2UXCI 5GMEA 5BR8I 2UUCI 4HXZA 4YHHI 2UXCE 3WU5A 4DR7E 2DEIA 4DV7I 5BR8E 1XNRE 1HNWI 2E1RA 4PRVA 4LF8I 4JI4E 3V5RA 1Z0CA 3J7AG 2PNMA 4LF9E 1PIEA 3ZZTA 2WW4A 4JI7I 4NXME 2NPFA 4X64I 4JI8I 4DR6I 1N36I 4KQVA 4B3RE 5IT9C 4IZKB 2BV3A 1HNXE 2HFUA 4DR6E 1N36E 1D6TA 4LF7E 4R1FA 3Q6NA 4JI1I 4NXNE 5IWAI 1N34I 1NHIA 4X62I 5FWKA 3J80C 3Q1QA 2HK2A 1Z0VA 2Z5EA 3PRYA 1FWLA 2BM1A 4X62E 1BKNA 1ZM2A 1Z0EA 2VQEI 1DARA 2IOQA 4JI3E 5FLXC 4GKKI 4M1KA 1HR0E 3LTOA 4DU8A 4X65E 1K47A 4GKKE 4K0KI 2UXDE 1KTVA 4LF6E 3PYEA 2ZM6I 4LF4I 2UUAE 4IZJA 2O1TA 4DR5E 4MYTA 2LJPA 4MYUA 2HFSA 1QZRA 2X7IA 4LFCE 4GKJE 1NHHA 4JV5I 2HK3A 4PRXA 1N0VC 2A2DA 4LFBE 1NHJA 2V34A 1HNZI 4HY1A 2PNLA 1Z5BA 4JYAE 1MG7A 2OI2A 3WU4A 1NZ0A 2A2CA 4I3HA 4JV5E 4RPFA 2V2QA 4DPUA 4DR3I 1ZM9A 5LMUI 4FN5A 4DR3E 5GMDA 3K85A 1EI1A 1VISA 1XMQE 4DR7I 1UEKA 1XNRI 3PYFA 4JI2E 4DR2I 1MX0A 4JI5E 1B62A 2UXBI 3J81C 4JI4I 1OJ4A 1Z0BA 1ZM4A 4DR2E 4AQYE 4LFAE 4LF9I 2UXBE 4Z7CA 4NXMI 1FI4A 1IBKI 4UTGA 2Z5CA 4B3RI 1Z0WA 3HULA 1IBKE 1HNXI 3J7AM 4LF7I 5A2QQ 3T1YI 4LF5E 4HACA 3ZKBA 4NXNI 1Y4SA 1IBLI 4PU9A 3T1YE 4B3TE 1FNMA 2HKJA 4FWHA 2VQFE 1KKHA 1IBLE 3ZM7A 4FWGA 2J7KA 1S16A 3B8HA 3LNUA 3ZKDA 5LMNI 4WUCA 4JI3I 3J80Q 1Y6ZA 1HR0I 3D4JA 1S4EA 4DR1E 5LMNE 2CZ9A 4DV1E 4X65I 2X36A 3JAMQ 1I94E 2UXDI 3WU6A 1ZXMA 4WUBA 3WU3A 3OTOE 2Z5BA 3P06A 4LF6I 3M6AA 2VF3A 4B3MI 4YY3E 2UUAI 4KHPE 4DR5I 1Z5AA 3V2UC 1N32E 4UT4A 4B3ME 4LFCI 4P52A 4GKJI 4OX9E 2ZBKB 1H74A 4B3SE 2V8PA 2XEXA 1Z5CA 4LFBI 4DV0E 4JYAI 1IBME 3PYDA 3LPSA 4DV4I 1USVA 1H73A 2CG9A 4DUYE 1XMOE 4DV4E 4JI0I 4IZKA 1PVGA 1H7UA 1B63A 4JI0E 1ZM3A 3F0NA 3PYGA 1XMQI 3K17A 2UUBI 1XNQI 4JI2I 5LL6R 1N33E 2V2ZA 4FW9A 4WUDA 2UUBE 4JI5I 2GS8A 1XNQE 3ZZUA 4URLA 2R3VA 3Q6MA 3K1JA 3QT7A 1ELOA 2IOPA 4AQYI 2HHHE 4LFAI 2UU9E 4USMA 1H7SA 4X66I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H72 C;  2F4V E;  4DUZ E;  1U2R A;  3J81 Q;  2R42 A;  4JI6 E;  4X66 E;  4DU7 A;  4DPY A;  4LF5 I;  4DR4 I;  1A6F A;  4ZVI A;  1Z0T A;  2UUC E;  4YHH E;  4ED4 A;  4DV2 I;  4DR4 E;  2BM0 A;  4B3T I;  4DV7 E;  2VQF I;  5L3J A;  5IT9 Q;  3H4L A;  4DV2 E;  2E5L I;  1PKP A;  1HNW E;  3B82 A;  1FKA E;  5A2Q C;  4LF8 E;  1J5E I;  1MU5 A;  2E5L E;  1RRE A;  4DR1 I;  4JI7 E;  4DV1 I;  3QT6 A;  1J5E E;  4X64 E;  4EMD A;  3T1H I;  4JI8 E;  1I94 I;  3OTO I;  4Z7Y A;  3T1H E;  4YY3 I;  4DXL A;  1N0U A;  4KHP I;  3QT8 A;  4XTJ A;  1N32 I;  4USK A;  2V2V A;  4JI1 E;  4FWD A;  5FLX Q;  2EFG A;  4OX9 I;  5IWA E;  4B3S I;  1N34 E;  3JAM C;  2AJ4 A;  1WUU A;  4DV0 I;  1ZXN A;  1IBM I;  1FJG I;  4HYM A;  3GON A;  4DV5 I;  4DUY I;  2VQE E;  1XMO I;  1FJG E;  3CWV A;  4DPX A;  1KIJ A;  3QT5 A;  2Q2E B;  4DV5 E;  1FWK A;  4JG4 A;  4K0K E;  2DEJ A;  1XHK A;  2ZM6 E;  1Z59 A;  4LF4 E;  4HAC B;  1N33 I;  4DPT A;  1EA6 A;  1RR9 A;  2HHH I;  2UU9 I;  4DPW A;  1HNZ E;  4DV6 I;  4DV3 I;  2HKE A;  2F4V I;  4DUZ I;  4P7A A;  1Z0G A;  3B78 A;  2ZIT A;  1KVK A;  4JI6 I;  4DV6 E;  4DV3 E;  3ZZ0 A;  5LMU E;  2UXC I;  5GME A;  5BR8 I;  2UUC I;  4HXZ A;  4YHH I;  2UXC E;  3WU5 A;  4DR7 E;  2DEI A;  4DV7 I;  5BR8 E;  1XNR E;  1HNW I;  2E1R A;  4PRV A;  4LF8 I;  4JI4 E;  3V5R A;  1Z0C A;  3J7A G;  4LF9 E;  1PIE A;  3ZZT A;  2WW4 A;  4JI7 I;  4NXM E;  2NPF A;  4X64 I;  4JI8 I;  4DR6 I;  1N36 I;  4KQV A;  4B3R E;  5IT9 C;  2BV3 A;  1HNX E;  2HFU A;  4DR6 E;  1N36 E;  1D6T A;  4LF7 E;  4R1F A;  4JI1 I;  4NXN E;  5IWA I;  1N34 I;  1NHI A;  4X62 I;  3J80 C;  3Q1Q A;  2HK2 A;  1Z0V A;  1FWL A;  2BM1 A;  4X62 E;  1BKN A;  1ZM2 A;  1Z0E A;  2VQE I;  1DAR A;  4JI3 E;  5FLX C;  4GKK I;  4M1K A;  1HR0 E;  3LTO A;  4DU8 A;  4X65 E;  1K47 A;  4GKK E;  4K0K I;  2UXD E;  1KTV A;  4LF6 E;  3PYE A;  2ZM6 I;  4LF4 I;  2UUA E;  4DR5 E;  4MYT A;  2LJP A;  4MYU A;  2HFS A;  1QZR A;  2X7I A;  4LFC E;  4GKJ E;  1NHH A;  4JV5 I;  2HK3 A;  4PRX A;  1N0V C;  2A2D A;  4LFB E;  1NHJ A;  2V34 A;  1HNZ I;  4HY1 A;  1Z5B A;  4JYA E;  1MG7 A;  2OI2 A;  3WU4 A;  1NZ0 A;  2A2C A;  4I3H A;  4JV5 E;  4RPF A;  2V2Q A;  4DPU A;  4DR3 I;  1ZM9 A;  5LMU I;  4FN5 A;  4DR3 E;  5GMD A;  1EI1 A;  1VIS A;  1XMQ E;  4DR7 I;  1UEK A;  1XNR I;  3PYF A;  4JI2 E;  4DR2 I;  1MX0 A;  4JI5 E;  1B62 A;  2UXB I;  3J81 C;  4JI4 I;  1OJ4 A;  1Z0B A;  1ZM4 A;  4DR2 E;  4AQY E;  4LFA E;  4LF9 I;  2UXB E;  4Z7C A;  4NXM I;  1FI4 A;  1IBK I;  4UTG A;  4B3R I;  1Z0W A;  3HUL A;  1IBK E;  1HNX I;  3J7A M;  4LF7 I;  5A2Q Q;  3T1Y I;  4LF5 E;  4HAC A;  3ZKB A;  4NXN I;  1IBL I;  4PU9 A;  3T1Y E;  4B3T E;  1FNM A;  2HKJ A;  4FWH A;  2VQF E;  1KKH A;  1IBL E;  3ZM7 A;  4FWG A;  2J7K A;  1S16 A;  3B8H A;  3LNU A;  3ZKD A;  5LMN I;  4WUC A;  4JI3 I;  3J80 Q;  1HR0 I;  3D4J A;  1S4E A;  4DR1 E;  5LMN E;  2CZ9 A;  4DV1 E;  4X65 I;  2X36 A;  3JAM Q;  1I94 E;  2UXD I;  3WU6 A;  1ZXM A;  4WUB A;  3WU3 A;  3OTO E;  4LF6 I;  3M6A A;  4B3M I;  2VF3 A;  4YY3 E;  2UUA I;  4KHP E;  4DR5 I;  1Z5A A;  3V2U C;  1N32 E;  4UT4 A;  4B3M E;  4LFC I;  4P52 A;  4GKJ I;  4OX9 E;  2ZBK B;  1H74 A;  4B3S E;  2V8P A;  2XEX A;  1Z5C A;  4LFB I;  4DV0 E;  4JYA I;  1IBM E;  3PYD A;  3LPS A;  4DV4 I;  1H73 A;  4DUY E;  1XMO E;  4DV4 E;  4JI0 I;  1PVG A;  1H7U A;  1B63 A;  4JI0 E;  1ZM3 A;  3F0N A;  3PYG A;  1XMQ I;  3K17 A;  2UUB I;  1XNQ I;  4JI2 I;  5LL6 R;  1N33 E;  2V2Z A;  4FW9 A;  4WUD A;  2UUB E;  4JI5 I;  2GS8 A;  1XNQ E;  3ZZU A;  4URL A;  2R3V A;  3K1J A;  3QT7 A;  1ELO A;  4AQY I;  2HHH E;  4LFA I;  2UU9 E;  4USM A;  1H7S A;  4X66 I; 
#chains in the Genus database with same CATH topology
 1H72 C;  3PS1 A;  2F4V E;  4DUZ E;  1U2R A;  3J81 Q;  1HK7 A;  2NN6 B;  2R42 A;  4JI6 E;  2C39 B;  4X66 E;  4DU7 A;  3GME A;  2Z5B B;  4IZJ D;  4IFD D;  2BA1 D;  5DRP A;  4DPY A;  4LF5 I;  4MU0 A;  2O1U A;  4DR4 I;  1A6F A;  4ZVI A;  1Z0T A;  2UUC E;  4YHH E;  4ED4 A;  4DV2 I;  3UHM A;  4DR4 E;  2BM0 A;  4B3T I;  4DV7 E;  2CGE A;  2VQF I;  5C0X D;  5L3J A;  4IZJ B;  5IT9 Q;  3H4L A;  4DV2 E;  2E5L I;  1PKP A;  2VES A;  1HNW E;  3B82 A;  2GQ0 A;  1FKA E;  5A2Q C;  4OO1 A;  3CDJ A;  4LF8 E;  1J5E I;  1MU5 A;  2E5L E;  1RRE A;  2IER A;  4NBQ A;  4DR1 I;  4JI7 E;  4DV1 I;  3QT6 A;  1J5E E;  4BA1 B;  4AIM A;  4X64 E;  4EMD A;  3T1H I;  4JI8 E;  1I94 I;  2C38 A;  3GLL A;  3KRN A;  3OTO I;  4Z7Y A;  4N3O A;  3T1H E;  2PO1 B;  4YY3 I;  4DXL A;  1N0U A;  4OO1 E;  4KHP I;  3QT8 A;  4XTJ A;  5K36 A;  2PNZ A;  1N32 I;  4USK A;  2V2V A;  4JI1 E;  4FWD A;  5FLX Q;  2EFG A;  4OX9 I;  2CVE A;  5IWA E;  4B3S I;  1N34 E;  4MU1 A;  3JAM C;  4LCH A;  2AJ4 A;  1WUU A;  2PO2 B;  4IFD C;  4DV0 I;  1ZXN A;  1IBM I;  1FJG I;  1OYP A;  3M85 G;  4IFD F;  4HYM A;  4QNJ A;  3GON A;  4DV5 I;  1Y4U A;  1P42 A;  4DUY I;  2VQE E;  1XMO I;  1FJG E;  5K36 E;  3CWV A;  4MQY A;  4DPX A;  5C0X C;  2BA0 G;  1KIJ A;  3QT5 A;  2Q2E B;  4DV5 E;  2WP8 B;  2BR2 A;  1E3P A;  2Z5C B;  4LPF A;  1FWK A;  3M85 D;  3NZK A;  4JG4 A;  3P3E A;  4K0K E;  2DEJ A;  2NN6 E;  4AM3 A;  4MDT A;  1XHK A;  3HJC A;  2ZM6 E;  1Z59 A;  4LF4 E;  4HAC B;  1N33 I;  4DPT A;  1EA6 A;  2JEA A;  4IS9 A;  1RR9 A;  4BA2 B;  2HHH I;  2UU9 I;  1E3H A;  4DPW A;  1HNZ E;  2PO0 A;  2O1V A;  4DV6 I;  4DV3 I;  2HKE A;  2WNR A;  4DUZ I;  2F4V I;  4P7A A;  1Z0G A;  1Y60 A;  3B78 A;  2O1W A;  2ZIT A;  1KVK A;  4JI6 I;  4DV6 E;  4DV3 E;  3ZZ0 A;  1USU A;  5LMU E;  2JEB B;  2UXC I;  5GME A;  4ISA A;  5BR8 I;  2C37 A;  2UUC I;  4HXZ A;  4YHH I;  2UXC E;  1YH8 A;  3PS3 A;  3WU5 A;  4DR7 E;  2DEI A;  5DRQ A;  4DV7 I;  5BR8 E;  1XNR E;  1HNW I;  3B4T A;  2E1R A;  4MU4 A;  5EKW A;  5JEA A;  4IFD B;  4PRV A;  4LF8 I;  4JI4 E;  4LCG A;  3V5R A;  1Z0C A;  3J7A G;  2PNM A;  4LF9 E;  1PIE A;  3ZZT A;  2WW4 A;  4OO1 F;  1UDO A;  4JI7 I;  4NXM E;  2NPF A;  3P76 A;  4X64 I;  4JI8 I;  4DR6 I;  5C0X B;  1N36 I;  4KQV A;  4B3R E;  5IT9 C;  4IZK B;  2JT2 A;  2BV3 A;  1HNX E;  2HFU A;  5JEA E;  4DR6 E;  1N36 E;  1D6T A;  4LF7 E;  3L7Z A;  1R6M A;  4R1F A;  3Q6N A;  4JI1 I;  4NXN E;  5IWA I;  1N34 I;  1NHI A;  4X62 I;  5K36 F;  5FWK A;  3J80 C;  3Q1Q A;  2HK2 A;  1Z0V A;  3CDI A;  1XXE A;  2Z5E A;  3PRY A;  1FWL A;  2BM1 A;  4X62 E;  1BKN A;  1ZM2 A;  1Z0E A;  2VQE I;  1DAR A;  2IOQ A;  2O3Z A;  2NN6 A;  4JI3 E;  4FW3 A;  5FLX C;  2C39 A;  4GKK I;  3P3G A;  4M1K A;  1HR0 E;  3LTO A;  4DU8 A;  4X65 E;  1K47 A;  4GKK E;  4K0K I;  2UXD E;  1KTV A;  4LCF A;  4LF6 E;  3PYE A;  2ZM6 I;  4LF4 I;  2UUA E;  4IZJ A;  2O1T A;  4DR5 E;  4MYT A;  2LJP A;  4MYU A;  2HFS A;  1QZR A;  2X7I A;  4OO1 D;  2GO3 A;  4LFC E;  4GKJ E;  1NHH A;  4FW4 A;  5EL9 A;  4JV5 I;  2HK3 A;  4PRX A;  1N0V C;  2A2D A;  4J3D A;  4LFB E;  1NHJ A;  2V34 A;  1HNZ I;  4HY1 A;  2PNL A;  1Z5B A;  1VI7 A;  2JE6 A;  1MG7 A;  2OI2 A;  4JYA E;  3WU4 A;  1NZ0 A;  2A2C A;  4I3H A;  4JV5 E;  4RPF A;  2V2Q A;  4OO1 B;  5DRO A;  4BA1 A;  4DPU A;  1YHC A;  4IFD E;  4DR3 I;  1ZM9 A;  3P3C A;  5LMU I;  2PO1 A;  5K36 D;  3HKM A;  4FN5 A;  4DR3 E;  3H1C A;  5GMD A;  2C38 B;  3K85 A;  1EI1 A;  5C0X E;  3M7N G;  1VIS A;  1XMQ E;  4DR7 I;  3PS2 A;  1UEK A;  1XNR I;  3PYF A;  5K36 B;  2PNZ B;  4JI2 E;  2GO4 A;  4DR2 I;  2NN6 D;  3U1K A;  1MX0 A;  4JI5 E;  1B62 A;  2UXB I;  3J81 C;  3M7N D;  2AE8 A;  1RHY A;  4JI4 I;  1OJ4 A;  1Z0B A;  1ZM4 A;  4DR2 E;  4AQY E;  4LFA E;  4LF9 I;  5JEA F;  2UXB E;  4Z7C A;  4NXM I;  1FI4 A;  2WP8 A;  1IBK I;  4UTG A;  5DNL A;  2Z5C A;  4OO1 C;  4B3R I;  1Z0W A;  4FW5 A;  3HUL A;  4QNK A;  5ELW A;  1IBK E;  1HNX I;  2BR2 B;  4OZE A;  3J7A M;  4LF7 I;  5DNX A;  5A2Q Q;  3T1Y I;  4LF5 E;  4HAC A;  3ZKB A;  4NXN I;  1Y4S A;  1IBL I;  4PU9 A;  3T1Y E;  4B3T E;  1FNM A;  4BA2 A;  2HKJ A;  5K36 C;  4FWH A;  2VQF E;  1KKH A;  1IBL E;  3ZM7 A;  2JEA B;  4FWG A;  2J7K A;  4OKG A;  1S16 A;  2JE6 B;  3B8H A;  3LNU A;  3ZKD A;  5LMN I;  4WUC A;  4JI3 I;  3J80 Q;  1Y6Z A;  2PO0 B;  2NN6 C;  3D4J A;  1HR0 I;  1UDN A;  1S4E A;  4DR1 E;  2WNR B;  2JEB A;  5LMN E;  2CZ9 A;  4AID A;  4DV1 E;  4X65 I;  2X36 A;  2NN6 F;  3JAM Q;  1I94 E;  2J65 A;  2UXD I;  3WU6 A;  1ZXM A;  4WUB A;  3WU3 A;  3OTO E;  2Z5B A;  1OYR A;  3P06 A;  4LF6 I;  3M6A A;  2VF3 A;  4B3M I;  4YY3 E;  2UUA I;  3GCM A;  4KHP E;  4DR5 I;  2C37 B;  1OYS A;  1Z5A A;  4U3B A;  3V2U C;  1N32 E;  5JEA D;  4UT4 A;  4B3M E;  4LFC I;  4P52 A;  4GKJ I;  4OX9 E;  2ZBK B;  1H74 A;  4FW7 A;  5DRR A;  4B3S E;  2V8P A;  2XEX A;  1Z5C A;  4IFD A;  4LFB I;  3DD6 A;  4DV0 E;  4JYA I;  3U1Y A;  3PYD A;  1IBM E;  3LPS A;  4U3D A;  4DV4 I;  1USV A;  5JEA B;  1H73 A;  1UDQ A;  2CG9 A;  5C0X F;  5C0X A;  4DUY E;  1XMO E;  4DV4 E;  4JI0 I;  4IZK A;  1PVG A;  1H7U A;  4MU3 A;  1B63 A;  2BA0 D;  4JI0 E;  1ZM3 A;  1R6L A;  3F0N A;  1UDS A;  3PYG A;  1XMQ I;  3K17 A;  2UUB I;  1Y5Y A;  1XNQ I;  3L7Z B;  4JI2 I;  4LOM A;  5LL6 R;  1N33 E;  4GQU A;  2V2Z A;  4FW9 A;  4WUD A;  2UUB E;  4JI5 I;  2F1D A;  2GS8 A;  4FW6 A;  3ZZU A;  4URL A;  1XNQ E;  2PO2 A;  2R3V A;  3Q6M A;  3K1J A;  2IES A;  3QT7 A;  1ELO A;  2IOP A;  4AQY I;  2HHH E;  4LFA I;  2UU9 E;  4USM A;  1H7S A;  2BA1 G;  5JEA C;  4X66 I; 
#chains in the Genus database with same CATH homology
 1H72 C;  2F4V E;  4DUZ E;  1U2R A;  3J81 Q;  1HK7 A;  2R42 A;  4JI6 E;  4X66 E;  4DU7 A;  2Z5B B;  4IZJ D;  4DPY A;  4LF5 I;  2O1U A;  4DR4 I;  1A6F A;  4ZVI A;  1Z0T A;  2UUC E;  4YHH E;  4ED4 A;  4DV2 I;  4DR4 E;  2BM0 A;  4B3T I;  4DV7 E;  2CGE A;  2VQF I;  5L3J A;  4IZJ B;  5IT9 Q;  3H4L A;  4DV2 E;  2E5L I;  1PKP A;  1HNW E;  3B82 A;  2GQ0 A;  1FKA E;  5A2Q C;  4LF8 E;  1J5E I;  1MU5 A;  2E5L E;  1RRE A;  4DR1 I;  4JI7 E;  4DV1 I;  3QT6 A;  1J5E E;  4X64 E;  4EMD A;  3T1H I;  4JI8 E;  1I94 I;  3OTO I;  4Z7Y A;  4N3O A;  3T1H E;  4YY3 I;  4DXL A;  1N0U A;  4KHP I;  3QT8 A;  4XTJ A;  1N32 I;  4USK A;  2V2V A;  4JI1 E;  4FWD A;  5FLX Q;  2EFG A;  4OX9 I;  5IWA E;  4B3S I;  1N34 E;  3JAM C;  2AJ4 A;  1WUU A;  4DV0 I;  1ZXN A;  1IBM I;  1FJG I;  4HYM A;  3GON A;  4DV5 I;  1Y4U A;  4DUY I;  2VQE E;  1XMO I;  1FJG E;  3CWV A;  4DPX A;  1KIJ A;  3QT5 A;  2Q2E B;  4DV5 E;  2Z5C B;  1FWK A;  4JG4 A;  4K0K E;  2DEJ A;  1XHK A;  3HJC A;  2ZM6 E;  1Z59 A;  4LF4 E;  4HAC B;  1N33 I;  4DPT A;  1EA6 A;  1RR9 A;  2HHH I;  2UU9 I;  4DPW A;  1HNZ E;  2O1V A;  4DV6 I;  4DV3 I;  2HKE A;  2F4V I;  4DUZ I;  4P7A A;  1Z0G A;  3B78 A;  2O1W A;  2ZIT A;  1KVK A;  4JI6 I;  4DV6 E;  4DV3 E;  3ZZ0 A;  1USU A;  5LMU E;  2UXC I;  5GME A;  5BR8 I;  2UUC I;  4HXZ A;  4YHH I;  2UXC E;  3WU5 A;  4DR7 E;  2DEI A;  4DV7 I;  5BR8 E;  1XNR E;  1HNW I;  2E1R A;  4PRV A;  4LF8 I;  4JI4 E;  3V5R A;  1Z0C A;  3J7A G;  2PNM A;  4LF9 E;  1PIE A;  3ZZT A;  2WW4 A;  4JI7 I;  4NXM E;  2NPF A;  4X64 I;  4JI8 I;  4DR6 I;  1N36 I;  4KQV A;  4B3R E;  5IT9 C;  4IZK B;  2BV3 A;  1HNX E;  2HFU A;  4DR6 E;  1N36 E;  1D6T A;  4LF7 E;  4R1F A;  3Q6N A;  4JI1 I;  4NXN E;  5IWA I;  1N34 I;  1NHI A;  4X62 I;  5FWK A;  3J80 C;  3Q1Q A;  2HK2 A;  1Z0V A;  2Z5E A;  3PRY A;  1FWL A;  2BM1 A;  4X62 E;  1BKN A;  1ZM2 A;  1Z0E A;  2VQE I;  1DAR A;  2IOQ A;  4JI3 E;  5FLX C;  4GKK I;  4M1K A;  1HR0 E;  3LTO A;  4DU8 A;  4X65 E;  1K47 A;  4GKK E;  4K0K I;  2UXD E;  1KTV A;  4LF6 E;  3PYE A;  2ZM6 I;  4LF4 I;  2UUA E;  4IZJ A;  2O1T A;  4DR5 E;  4MYT A;  2LJP A;  4MYU A;  2HFS A;  1QZR A;  2X7I A;  4LFC E;  4GKJ E;  1NHH A;  4JV5 I;  2HK3 A;  4PRX A;  1N0V C;  2A2D A;  4LFB E;  1NHJ A;  2V34 A;  1HNZ I;  4HY1 A;  2PNL A;  1Z5B A;  4JYA E;  1MG7 A;  2OI2 A;  3WU4 A;  1NZ0 A;  2A2C A;  4I3H A;  4JV5 E;  4RPF A;  2V2Q A;  4DPU A;  4DR3 I;  1ZM9 A;  5LMU I;  4FN5 A;  4DR3 E;  5GMD A;  3K85 A;  1EI1 A;  1VIS A;  1XMQ E;  4DR7 I;  1UEK A;  1XNR I;  3PYF A;  4JI2 E;  4DR2 I;  1MX0 A;  4JI5 E;  1B62 A;  2UXB I;  3J81 C;  4JI4 I;  1OJ4 A;  1Z0B A;  1ZM4 A;  4DR2 E;  4AQY E;  4LFA E;  4LF9 I;  2UXB E;  4Z7C A;  4NXM I;  1FI4 A;  1IBK I;  4UTG A;  2Z5C A;  4B3R I;  1Z0W A;  3HUL A;  1IBK E;  1HNX I;  3J7A M;  4LF7 I;  5A2Q Q;  3T1Y I;  4LF5 E;  4HAC A;  3ZKB A;  4NXN I;  1Y4S A;  1IBL I;  4PU9 A;  3T1Y E;  4B3T E;  1FNM A;  2HKJ A;  4FWH A;  2VQF E;  1KKH A;  1IBL E;  3ZM7 A;  4FWG A;  2J7K A;  1S16 A;  3B8H A;  3LNU A;  3ZKD A;  5LMN I;  4WUC A;  4JI3 I;  3J80 Q;  1Y6Z A;  1HR0 I;  3D4J A;  1S4E A;  4DR1 E;  5LMN E;  2CZ9 A;  4DV1 E;  4X65 I;  2X36 A;  3JAM Q;  1I94 E;  2UXD I;  3WU6 A;  1ZXM A;  4WUB A;  3WU3 A;  3OTO E;  2Z5B A;  3P06 A;  4LF6 I;  3M6A A;  2VF3 A;  4B3M I;  4YY3 E;  2UUA I;  4KHP E;  4DR5 I;  1Z5A A;  3V2U C;  1N32 E;  4UT4 A;  4B3M E;  4LFC I;  4P52 A;  4GKJ I;  4OX9 E;  2ZBK B;  1H74 A;  4B3S E;  2V8P A;  2XEX A;  1Z5C A;  4LFB I;  4DV0 E;  4JYA I;  1IBM E;  3PYD A;  3LPS A;  4DV4 I;  1USV A;  1H73 A;  2CG9 A;  4DUY E;  1XMO E;  4DV4 E;  4JI0 I;  4IZK A;  1PVG A;  1H7U A;  1B63 A;  4JI0 E;  1ZM3 A;  3F0N A;  3PYG A;  1XMQ I;  3K17 A;  2UUB I;  1XNQ I;  4JI2 I;  5LL6 R;  1N33 E;  2V2Z A;  4FW9 A;  4WUD A;  2UUB E;  4JI5 I;  2GS8 A;  1XNQ E;  3ZZU A;  4URL A;  2R3V A;  3Q6M A;  3K1J A;  3QT7 A;  1ELO A;  2IOP A;  4AQY I;  2HHH E;  4LFA I;  2UU9 E;  4USM A;  1H7S A;  4X66 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...