5IT9C

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5it9C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9C02
1EA6A 1H7SA 4JG4A 4HY1A 1KVKA 4DV6I 4USKA 4XTJA 5LMNE 1XHKA 3B8HA 4RPFA 1EI1A 1ZM2A 1NZ0A 5LMNI 3D4JA 4FWHA 2BM1A 2V34A 4PRVA 4NXNI 2HKJA 4DR7E 1HNWE 4DV5E 2UUBE 4DR7I 2LJPA 4JI0E 1N34E 4JI6E 3WU3A 4WUCA 4DV5I 2UUBI 4JI0I 1N34I 1J5EE 4DR3E 4JI6I 1J5EI 4DR3I 4P7AA 4DPUA 1PVGA 3QT6A 4JI7E 3ZZTA 1K47A 4B3ME 1H7UA 4JI7I 4DR4E 1N33E 4B3MI 4B3SE 3ZZ0A 4PRXA 1A6FA 4DR4I 1N33I 4B3SI 3M6AA 1FI4A 2HFUA 3ZKDA 5FLXQ 4DXLA 3J81C 4AQYE 3HULA 4AQYI 2R42A 4DPXA 4PU9A 1FWKA 4K0KE 4FWDA 3T1HE 3PYDA 2ZITA 1MX0A 3J80Q 2UXBE 3V2UC 4NXME 4K0KI 3T1HI 2HKEA 2OI2A 2UXBI 4NXMI 1DARA 1HR0E 2A2DA 3LPSA 5IWAE 4ZVIA 1HR0I 5IWAI 4X66E 4X62E 4FW9A 4DV4E 4X66I 3B82A 4X62I 5BR8E 1S16A 1Z0VA 4DV4I 4KHPE 4LFAE 4DPWA 4GKJE 1BKNA 1IBKE 4KHPI 4LFAI 5A2QQ 4GKJI 1IBKI 4DV1E 4P52A 1FJGE 2ZM6E 1XNQE 4DV1I 1FJGI 2ZM6I 1XNQI 1RREA 1Z0EA 4JI3E 1NHIA 4B3RE 1D6TA 4JI3I 4B3RI 4R1FA 1ZXNA 2HFSA 1HNWI 4HYMA 5FLXC 1H74A 2VQEE 1RR9A 5LL6R 2VQEI 3PYFA 2E1RA 3QT8A 4LF7E 3ZKBA 3J80C 4LF7I 2X36A 3F0NA 1I94E 1FNMA 4JYAE 4YHHE 1I94I 5GMDA 4EMDA 3OTOE 1MG7A 4JYAI 4YHHI 4DV2E 1HNXE 3OTOI 3ZM7A 2BV3A 4DV2I 1HNXI 2VQFE 4X64E 2VQFI 2Q2EB 1N0UA 4X64I 4USMA 2UXDE 2A2CA 4B3TE 3B78A 2UXDI 5A2QC 4LF8E 4B3TI 3JAMC 1NHJA 5GMEA 4YY3E 4LF8I 3WU5A 4JI1E 4FN5A 1N32E 1ZM3A 4HACB 4YY3I 2UU9E 4JI5E 4JI1I 1B63A 1N32I 4JI5I 2UU9I 4LF5E 2ZBKB 3QT5A 4DV3E 1Z5BA 4LF5I 4JI4E 4DUZE 1VISA 4DV3I 5BR8I 4DR6E 1Z5CA 4LF9E 1ZM4A 4JI4I 1S4EA 4DR2E 4DUZI 5IT9Q 4DR6I 4LF9I 4DPTA 2V8PA 1XMOE 4DR2I 1KTVA 2VF3A 4HACA 4HXZA 2J7KA 3H4LA 3K17A 4OX9E 1XMOI 1Z0CA 1PKPA 3J7AM 4KQVA 4OX9I 2UXCE 1Z0BA 2XEXA 4X65E 2AJ4A 2EFGA 2UUCE 2UXCI 1H73A 4X65I 3PYEA 2UUCI 1N36E 1ELOA 2V2VA 4ED4A 2BM0A 1UEKA 1XMQE 1N36I 4NXNE 3WU6A 1KKHA 2WW4A 1XMQI 1PIEA 1NHHA 1MU5A 1Z0GA 4LFBE 4LF4E 4DU8A 5LMUE 3LTOA 4DPYA 1Z59A 4DUYE 1FKAE 2R3VA 4JI2E 4LFBI 4LF4I 4LF6E 2DEJA 5LMUI 2HK2A 4DUYI 4JI2I 3V5RA 1XNRE 2HK3A 4LF6I 4GKKE 4DV0E 1XNRI 4GKKI 2E5LE 1Z5AA 3QT7A 1IBME 3K1JA 4MYUA 4DV0I 1IBLE 1WUUA 1ZXMA 2E5LI 1IBMI 4MYTA 2GS8A 1IBLI 1Z0WA 2CZ9A 4LFCE 4URLA 1KIJA 3LNUA 4DV7E 4FWGA 2V2QA 4LFCI 5IT9C 4DV7I 1FWLA 5L3JA 4JV5E 2X7IA 1U2RA 4JV5I 2V2ZA 1ZM9A 4JI8E 4WUDA 4DR1E 1B62A 4M1KA 1HNZE 4JI8I 2DEIA 4WUBA 4DR1I 4Z7YA 1Z0TA 1HNZI 1N0VC 4UT4A 1QZRA 2UUAE 3WU4A 2F4VE 3GONA 3ZZUA 2UUAI 1OJ4A 3J81Q 2F4VI 4DR5E 4I3HA 2NPFA 4DU7A 3PYGA 4DR5I 3J7AG 3CWVA 2HHHE 4Z7CA 3Q1QA 3T1YE 1H72C 2HHHI 3T1YI 3JAMQ 4DV6E 4UTGA
chains in the Genus database with same CATH superfamily
3QG5C 1EA6A 1H7SA 4FW5A 4JG4A 4HY1A 5KL3A 1KVKA 4DV6I 4USKA 4ZYDA 5LMNE 1VI7A 4XTJA 3F6HA 1XHKA 2EPMX 2JY9A 3B8HA 1OYRA 4RPFA 2DGCA 2JEAA 1EI1A 5KL5A 1NZ0A 5LMNI 1EH8A 3D4JA 4TUGA 3PS2A 4FWHA 2HGHA 1OYSA 3AUZA 2V86A 2BM1A 4BMJA 2V34A 2IHR1 3P3GA 1ZBTA 2M7QA 1YYOA 4QNKA 4PRVA 1HK7A 4NXNI 3KWRA 2HKJA 2EOXA 4DR7E 3BBGA 1HNWE 3K85A 5FWKA 4DV5E 3J7Yp 2UUBE 3MHSC 4O43A 5AC4A 4DR7I 2LJPA 4JI0E 1N34E 1P47A 2WP8A 1EKZA 4JI6E 3WU3A 4WUCA 4DV5I 2DMIA 2UUBI 3F6GA 4Q35B 2E1MA 4WSGA 1G2DC 3HTXA 2EQ0A 4JI0I 1N34I 1J5EE 4DR3E 4QNJA 4FW6A 2PO1B 4JI6I 4KWYA 2YU8A 1GZ6A 2BA1G 2PNLA 3GLLA 2E72A 1R6MA 2IERA 5ADZA 1J5EI 2CT1A 4P7AA 4DR3I 3HKMA 4LCFA 2V89A 1RC7A 2EOSA 4DPUA 2L2KB 4ZYGA 2EPPA 2EJ4A 1PVGA 1DQ3A 3QT6A 4JI7E 3ZZTA 1K47A 4B3ME 2LT7A 4BC9A 3EPLA 4J3DA 3THNA 1H7UA 4F2JC 5A6BA 4DR4E 4JI7I 2KONA 1N33E 4B3MI 1G2FC 2JR1A 3LLHA 4B3SE 1DI2A 4PRXA 3ZZ0A 2B9DA 1A6FA 2EM3A 4Q28A 3EPJA 2EM2A 4DR4I 1N33I 4R2CA 4B3SI 1ZAAC 1UHZA 3M6AA 3THOB 3ECRA 5JEAC 1FI4A 4ZYHA 1LLMC 2HFUA 4F9BB 2EPRA 1T4OA 2L2MA 3ZKDA 5FLXQ 4DXLA 3J81C 5C0XE 2IESA 4AQYE 4N4RB 2LUQA 4MU1A 5LLQA 2EMFA 4AM3A 3HULA 1ZU1A 3UK3C 3ADJA 2O1WA 2ADRA 2LVHA 5TSEA 4OO1C 4AQYI 2MC6A 2EMBA 2R42A 4DPXA 1QNTA 2LTSA 4DV6E 4PU9A 2CGEA 4GEQB 4K0KE 2YTPA 4X9JA 1FWKA 2C37B 2JEBB 2O3ZA 3T1HE 3Q6MA 3PYDA 4FWDA 4IS1C 2ZITA 1MX0A 5A6AA 2UXBE 1KYQA 2DRPA 3J80Q 1A1KA 3V2UC 2EPZA 4NXME 4K0KI 3FIGA 3GMEA 3T1HI 2YTNA 2HKEA 1AAYA 2OI2A 1O0WA 3OMLA 3U1KA 4RHBB 2UXBI 5C0XF 2ELZA 2YTDA 2NA2A 1F2IG 2BB8A 4M2ZA 1DARA 4NXMI 4IFDC 1HR0E 3ADIA 4F9AB 2A2DA 3LPSA 5IWAE 5EKWA 4BC7A 2J7JA 3U1YA 3C6MA 4ZVIA 2CVEA 2LJUA 2EOZA 3JTZA 3KZYA 1E3PA 2EMIA 4IZKB 5C0XA 1HR0I 1GTKA 4MU3A 5IWAI 4X66E 1YUIA 4X62E 4M30A 4FW9A 4IJDA 2JXPA 2L3CA 4DV4E 1PJTA 3DJWA 1A1GA 2NUGA 2NN6B 4X66I 1UDSA 4MLVA 3B82A 4X62I 2GQ0A 5BR8E 2H36X 1S16A 5AASA 5A6BD 5DNYA 1Z0VA 4DV4I 2ODRC 4O4KA 4MU4A 4KHPE 3LMLA 5JEAE 4LFAE 4DPWA 1PJQA 1USUA 5K36B 2EMZA 2PRTA 2GLIA 4GKJE 1BKNA 1IBKE 4HEIA 2C38B 2ENCA 2YTFA 4KHPI 4LFAI 2MDRA 2WBSA 5A2QQ 2BR2B 2EN6A 2EM8A 4WSPA 4GKJI 1IBKI 3PS3A 4DV1E 4P52A 1FJGE 2PO2A 2EMGA 4IZKA 5AE3A 3KZZA 2ZM6E 1XNQE 4BHBA 1E3HA 2EOQA 2NN6F 2EOYA 2B7TA 1WHNA 1YYWA 1STUA 2YT4A 4DV1I 1FJGI 4WX9A 2EPAA 2GPIA 2KHXA 1WJPA 4R03A 2ZM6I 2RTXA 1XNQI 1RREA 1YHCA 1Z0EA 4JI3E 1X3CA 4I8OA 1NHIA 2NN6A 4FW4A 5DNLA 2EPLX 2GO3A 1Y4UA 3MHHC 2YZTA 1EH7A 4B3RE 5K36F 1PJSA 1D6TA 3IWDA 4IFDE 4JI3I 2LTRA 2MDGA 3DD6A 4B3RI 2WCC3 2EP3A 3EPHA 5K36A 4R1FA 2C38A 1ZXNA 3P76A 4R2AA 2BR2A 2HFSA 3L00A 1HNWI 2N3HA 2EOJA 2JYAA 4OZEA 2YTOA 2EMXA 4HYMA 5C0XD 5AE2A 1BBGA 2IOQA 5FLXC 2DSYA 2YTQA 4BA1B 1H74A 2VQEE 3HPZA 1RR9A 2JT2A 2V88A 3GCMA 4IFDF 2EPXA 1ZR9A 2FTXB 2CG9A 2F1DA 4DMIA 5LL6R 4BS9A 5IXMB 2VQEI 2R76A 4R2SA 3PYFA 1IMUA 3BF2A 3JU0A 4R2PA 2E1RA 1QU6A 2GHFA 5DRQA 3QT8A 2A25A 2YRKA 4BA2A 4LF7E 4IFDA 4LPFA 3ZKBA 1PDAA 1IQOA 3J80C 1YUJA 4LF7I 2EQ3A 1L4SA 2L6MA 2X36A 2O1UA 1T39A 3F0NA 1I94E 2ELYA 1FNMA 1NCSA 1X6HA 2DIXA 2EE8A 4JYAE 5AE1A 4GZNC 4YHHE 4IS9A 4P78A 4BBYA 2V83A 5KL2A 4M9VC 2PNMA 1I94I 2EN2A 5GMDA 3OTOE 4GQUA 4EMDA 2EM0A 2RPCA 1MG7A 3ADGA 3EQ1A 4JYAI 2L2NA 1RQ0A 4R8OA 4YHHI 4BA1A 4DV2E 1HNXE 3OTOI 5C0XB 3ZM7A 2BV3A 2NN6D 2EN3A 3M85D 2K4VA 2VQFE 4DV2I 1HNXI 1N3GA 3K6QA 4X64E 2PNZB 1BB8A 2EOIA 2EMLA 3H09A 3KRNA 2R1FA 2ENHA 1UDNA 2VQFI 2Q2EB 1N0UA 2EOHA 2RSIA 4X64I 4USMA 2G7HA 3B4TA 2UXDE 2WZOA 5K36D 4LTYA 3VYXA 1Y6ZA 1TN9A 2JWOA 2A2CA 4B3TE 3M7ND 2FGGA 1Z1BA 2DMYA 4KZSA 2IOPA 2BA0D 1A1IA 3B78A 1X6EA 2NABA 2FV4B 2UXDI 5A2QC 2EMWA 4LF8E 2RSMA 1RHYA 4B3TI 2LBSB 3JAMC 1A1JA 1NHJA 5GMEA 4FW7A 5T6JA 4YY3E 2F8BA 3RMPA 4LF8I 4TUIA 2D9HA 2WBUA 4JI1E 3WU5A 1Y4SA 5EL9A 2PO2B 1N32E 1YPNA 1MEYC 4FN5A 3EPKA 1ZM3A 4JI5E 2UU9E 4WXDA 2EOMA 2EPKX 4HACB 4NZVA 3L7ZB 4YY3I 2EPNA 4JI1I 2WBTA 1X47A 2DB2A 1BBOA 1B63A 2PNZA 1N32I 2EM4A 4JI5I 3BIDA 2EN1A 2Z5EA 2UU9I 2JOXA 4DKKA 2EL5A 2LJHA 4LF5E 2ZBKB 3QT5A 2EN7A 2Z5BA 4DV3E 4UTGA 3BGHA 2MKDA 2DLKA 1Z5BA 2V85A 3H1CA 4X8WA 5JEAB 4LF5I 4JI4E 1IQSA 4F54A 4DUZE 1A1HA 1VISA 1WRJA 2B7VA 4DV3I 5BR8I 2LV2A 3ZOQB 4DR6E 2I9IA 1Z5CA 4LF9E 1ZM4A 2BBGA 2RS6A 4JI4I 1T4NA 1S4EA 2EL6A 4DR2E 4DUZI 5IT9Q 4OO1B 4DR6I 4OO1E 3P3CA 1J26A 3PS1A 4LF9I 4DPTA 2V8PA 1XMOE 4DR2I 2MKNA 4WYQB 1ZBQA 2YTJA 1KTVA 2VF3A 4HACA 4HXZA 2NUFA 2J7KA 3H4LA 3K17A 3L7ZA 4IZJB 1DGCA 1KJKA 4OX9E 2YTEA 1XMOI 4J8ZA 5KL4A 1Z0CA 2HC5A 3HJCA 2O1TA 4FW3A 4OKGA 5JEAF 2GO4A 1PKPA 3J7AM 1X5WA 4KQVA 4OX9I 2JPAA 2K7IA 2EMHA 4P7DA 2UXCE 1EH6A 2EQ1A 2KOUA 1X49A 4IFDB 1Z0BA 5DRPA 5JEAA 2XEXA 2DLQA 4X65E 2AJ4A 2EFGA 4LCHA 2VRDA 1UDOA 3P1XA 1WHQA 4O5GA 2UUCE 5ELWA 4OO1F 1GQEA 4WFTA 5IV8B 1H73A 2UXCI 2M9AA 2O1VA 4X65I 2EMYA 3PYEA 2UUCI 4OO1A 1JK1A 2EM5A 4WPYA 4R2QA 2WNRA 4AIDA 1N36E 1ELOA 2EMAA 1UILA 2EMKA 2JVAA 3IWBA 4BA2B 4LCGA 4AIMA 2V2VA 4ED4A 4RH8A 2BM0A 1UEKA 2LCEA 5KL7A 1XMQE 1N36I 4NXNE 4IZJA 2EN4A 1X6FA 3WU6A 1KKHA 2L92A 2WW4A 1XMQI 4M0VA 5C0XC 1AH5A 2EM6A 4NHRA 3P3EA 1TF6A 5AC5A 1PIEA 4R2EA 1NHHA 1MU5A 1Z0GA 4LFBE 4OOGC 4LF4E 1R6LA 1YZ9A 2L8TA 4MQYA 4DU8A 5LMUE 4F6NA 1YH8A 3LTOA 5A6KA 1Z59A 4DPYA 4DUYE 1FKAE 2R3VA 4JI2E 4LFBI 4LF4I 2B3TB 2JP9A 4LF6E 2DEJA 5LMUI 2HK2A 2NUEA 2BA1D 1YSAC 4DUYI 4JI2I 3V5RA 1XNRE 2PO0B 2EZ6A 2HK3A 3HXLA 4GKKE 4LF6I 4LOMA 2L33A 2EPCA 5F3WA 1Y60A 2EOFA 4DV0E 3UHMA 1XNRI 2CPNA 2YWQA 4GKKI 2E5LE 2N3GA 2LUPB 1IBME 1Z5AA 3K1JA 3QT7A 4MYUA 1IBLE 4DV0I 4MLQA 1WUUA 3AV0A 1ZXMA 4O24A 2E5LI 4BCAA 1IBMI 4MYTA 3Q6NA 2AE8A 3C6KA 2GS8A 3M85G 2Q8UA 1IBLI 2EPOA 1SR9A 2YSOA 1A1LA 2RS7A 1Z0WA 5JEAD 2N8XA 1WXRA 2CZ9A 2ENAA 4LFCE 3PRYA 2Z5BB 1KIJA 4BHCA 4URLA 3LNUA 2NN6C 4MU0A 4DV7E 1UN6B 4N3OA 4LU9A 1NEIA 3HQ1A 4F9CB 5CFFE 4FWGA 2M1SA 2V2QA 1TF3A 3P06A 2VESA 4LFCI 2LE2A 2PO1A 4OO1D 2J65A 3M7NG 2EOOA 4R2RA 5IT9C 2PO0A 4DV7I 1FWLA 3CDJA 5L3JA 2BA0G 5K36C 2EM7A 3NZKA 4JV5E 3MSWA 2X7IA 4ZYEA 2YU5A 2LMZA 1UBDC 2V87A 1MGTA 4MDTA 4IZJD 1U2RA 1YFHA 2EWLA 2Z5CB 2I13A 4JV5I 3TQMA 2V2ZA 4U3BA 5DROA 1ZM9A 3VHTB 1X48A 4JI8E 2JE6B 4WUDA 1Y5YA 2YPNA 4DR1E 4IFDD 1B62A 2CTDA 4L8NA 4FK5C 3ADLA 4M1KA 1HNZE 4JI8I 2DEIA 4WUBA 4DR1I 4Z7YA 1Z0TA 1SFEA 2EOEA 1HNZI 1N0VC 2C39B 2V8QB 4U3DA 4UT4A 1QZRA 2VE7C 2UUAE 5A69A 1OYPA 4L5NC 1XXEA 3WU4A 2EM9A 2EORA 1RMDA 2M4IA 2F4VE 4WXCA 1P42A 3GONA 4ISAA 3C4BA 5A6JA 5DNXA 1T38A 5DRRA 3ZZUA 2UUAI 2YSPA 2EPUA 2RQLA 3HPSA 2CSHA 1A1FA 2JOBA 1OJ4A 2MC5A 2WNRB 3J81Q 2YRMA 2F4VI 2ODRD 1B69A 4DR5E 2Z5CA 2JEAB 4I3HA 2EN8A 3CDIA 2NPFA 2EL4A 3C4TA 2NN6E 4HTGA 2JEBA 3PYGA 4DU7A 2C37A 2JE6A 3IWCA 4DR5I 2VF1A 3M99B 3VK6A 2HHHE 4F6MA 3J7AG 3CWVA 3VYYA 4Z7CA 5KL6A 3Q1QA 3T1YE 1T4LB 4R2DA 1H72C 2LRSA 2YTGA 2YRHA 2L3JA 1YYKA 4NBQA 5K36E 2HHHI 1JK2A 2HJJA 2EMCA 1USVA 2C39A 3T1YI 2YTIA 2LO3A 2WP8B 3JAMQ 3DF6A 1UDQA 1ZM2A
chains in the Genus database with same CATH topology
1EA6A 1H7SA 4JG4A 4HY1A 1KVKA 4DV6I 4USKA 5LMNE 4XTJA 3F6HA 1XHKA 2JY9A 3B8HA 4RPFA 1EI1A 1NZ0A 5LMNI 3D4JA 4TUGA 4FWHA 2BM1A 3AUZA 2V86A 2V34A 4BMJA 2IHR1 1ZBTA 2M7QA 1YYOA 4PRVA 1HK7A 4NXNI 3KWRA 2HKJA 4DR7E 1HNWE 3K85A 5FWKA 4DV5E 3J7Yp 2UUBE 4DR7I 2LJPA 4JI0E 1N34E 1EKZA 4JI6E 3WU3A 4WUCA 4DV5I 2UUBI 3F6GA 2E1MA 3HTXA 4JI0I 1N34I 1J5EE 4DR3E 4JI6I 1GZ6A 2PNLA 5ADZA 1J5EI 4DR3I 4P7AA 2V89A 1RC7A 4DPUA 2L2KB 1PVGA 1DQ3A 3QT6A 4JI7E 3ZZTA 1K47A 4B3ME 4BC9A 1H7UA 4JI7I 4DR4E 2KONA 1N33E 4B3MI 2JR1A 3LLHA 4B3SE 1DI2A 4PRXA 3ZZ0A 2B9DA 1A6FA 4Q28A 4DR4I 1N33I 4B3SI 1UHZA 3M6AA 1FI4A 2HFUA 4F9BB 1T4OA 2L2MA 3ZKDA 5FLXQ 4DXLA 3J81C 4AQYE 2LUQA 3HULA 3ADJA 2O1WA 4AQYI 2MC6A 2R42A 4DPXA 2LTSA 4PU9A 2CGEA 1FWKA 4GEQB 4K0KE 4FWDA 3T1HE 3Q6MA 3PYDA 2ZITA 1MX0A 2UXBE 3J80Q 3V2UC 4NXME 4K0KI 3FIGA 3T1HI 2HKEA 2OI2A 1O0WA 3OMLA 2UXBI 2NA2A 4M2ZA 4NXMI 1DARA 1HR0E 3ADIA 4F9AB 2A2DA 3LPSA 5IWAE 4BC7A 4ZVIA 4IZKB 3JTZA 1HR0I 5IWAI 4X66E 4X62E 4M30A 4FW9A 2L3CA 4DV4E 3DJWA 2NUGA 4X66I 3B82A 4X62I 2GQ0A 5BR8E 2H36X 1S16A 5AASA 5DNYA 1Z0VA 4DV4I 2ODRC 4KHPE 3LMLA 4LFAE 4DPWA 1USUA 4GKJE 1BKNA 1IBKE 4KHPI 4LFAI 2MDRA 5A2QQ 4WSPA 4GKJI 1IBKI 4DV1E 4P52A 1FJGE 4IZKA 5AE3A 2ZM6E 1XNQE 2B7TA 1WHNA 1YYWA 1STUA 2YT4A 4DV1I 1FJGI 4R03A 2KHXA 2ZM6I 1XNQI 2RTXA 1RREA 1Z0EA 4JI3E 4I8OA 1NHIA 1Y4UA 4B3RE 2YZTA 1D6TA 3IWDA 4JI3I 2LTRA 4B3RI 4R1FA 1ZXNA 2HFSA 1HNWI 2N3HA 4HYMA 5AE2A 2IOQA 5FLXC 2DSYA 1H74A 2VQEE 3HPZA 1RR9A 2V88A 2FTXB 2CG9A 4DMIA 5LL6R 4BS9A 2VQEI 3PYFA 2E1RA 3JU0A 1QU6A 3QT8A 4LF7E 3ZKBA 3J80C 4LF7I 2L6MA 2X36A 2O1UA 3F0NA 1I94E 1FNMA 4JYAE 2DIXA 5AE1A 4YHHE 4P78A 4BBYA 2V83A 1I94I 2PNMA 5GMDA 3OTOE 4EMDA 1MG7A 3ADGA 4JYAI 2L2NA 1RQ0A 4R8OA 4YHHI 4DV2E 1HNXE 3OTOI 3ZM7A 2BV3A 4DV2I 2K4VA 2VQFE 1HNXI 3K6QA 4X64E 3H09A 2VQFI 2Q2EB 1N0UA 4X64I 4USMA 2G7HA 2UXDE 2WZOA 4LTYA 3VYXA 1Y6ZA 2JWOA 2A2CA 4B3TE 2FGGA 2DMYA 4KZSA 2IOPA 3B78A 2UXDI 2FV4B 5A2QC 4LF8E 2RSMA 4B3TI 2LBSB 3JAMC 1NHJA 5GMEA 5T6JA 4YY3E 2F8BA 3RMPA 4LF8I 4TUIA 3WU5A 4JI1E 1Y4SA 4FN5A 1N32E 1ZM3A 4JI5E 2UU9E 4HACB 4YY3I 4JI1I 1X47A 2DB2A 1B63A 1N32I 4JI5I 2UU9I 2Z5EA 2JOXA 4DKKA 2LJHA 4LF5E 2ZBKB 3QT5A 2Z5BA 4DV3E 4UTGA 1Z5BA 2V85A 4X8WA 4LF5I 4JI4E 4F54A 4DUZE 1VISA 2B7VA 4DV3I 5BR8I 3ZOQB 4DR6E 1Z5CA 4LF9E 1ZM4A 2RS6A 4JI4I 1T4NA 1S4EA 4DR2E 4DUZI 5IT9Q 4DR6I 1J26A 4LF9I 4DPTA 2V8PA 1XMOE 4DR2I 4WYQB 1ZBQA 3DF6A 1KTVA 2VF3A 4HACA 4HXZA 2NUFA 2J7KA 3H4LA 3K17A 4IZJB 4OX9E 1XMOI 4J8ZA 1Z0CA 3HJCA 2O1TA 1PKPA 3J7AM 4KQVA 4OX9I 4P7DA 2UXCE 2KOUA 1X49A 1Z0BA 2XEXA 4X65E 2AJ4A 2EFGA 3P1XA 1WHQA 2UUCE 2UXCI 1GQEA 4WFTA 1H73A 2O1VA 4X65I 3PYEA 2UUCI 4WPYA 1N36E 1ELOA 1UILA 3IWBA 2JVAA 2V2VA 4ED4A 2BM0A 1UEKA 1XMQE 1N36I 4NXNE 4IZJA 3WU6A 1KKHA 2L92A 2WW4A 1XMQI 4M0VA 1PIEA 1NHHA 1MU5A 1Z0GA 4LFBE 4OOGC 4LF4E 1YZ9A 2L8TA 4DU8A 5LMUE 3LTOA 4DPYA 1Z59A 4DUYE 1FKAE 2R3VA 4JI2E 4LFBI 4LF4I 2B3TB 4LF6E 2DEJA 5LMUI 2HK2A 2NUEA 4DUYI 4JI2I 3V5RA 1XNRE 2EZ6A 2HK3A 3HXLA 4GKKE 4LF6I 2L33A 5F3WA 4DV0E 1XNRI 2CPNA 4GKKI 2E5LE 2N3GA 2LUPB 1IBME 1Z5AA 3K1JA 3QT7A 4MYUA 1IBLE 4DV0I 1WUUA 3AV0A 1ZXMA 2E5LI 4BCAA 1IBMI 4MYTA 3Q6NA 2GS8A 1IBLI 1SR9A 2RS7A 1Z0WA 1WXRA 2CZ9A 4LFCE 3PRYA 2Z5BB 1KIJA 4URLA 3LNUA 4DV7E 4N3OA 4LU9A 3HQ1A 4F9CB 5CFFE 4FWGA 2M1SA 2V2QA 3P06A 4LFCI 2LE2A 5IT9C 4DV7I 1FWLA 5L3JA 4JV5E 3MSWA 2X7IA 2LMZA 2V87A 4IZJD 1U2RA 2EWLA 2Z5CB 4JV5I 2V2ZA 1ZM9A 1X48A 4JI8E 4WUDA 4DR1E 1B62A 4L8NA 3ADLA 4M1KA 1HNZE 4JI8I 2DEIA 4WUBA 4DR1I 4Z7YA 1Z0TA 1HNZI 1N0VC 2V8QB 4UT4A 1QZRA 2VE7C 2UUAE 4L5NC 3WU4A 2M4IA 2F4VE 3GONA 3C4BA 3ZZUA 2UUAI 3HPSA 1OJ4A 2JOBA 2MC5A 3J81Q 2F4VI 2ODRD 4DR5E 2Z5CA 4I3HA 2NPFA 3C4TA 4DU7A 3PYGA 3IWCA 4DR5I 2VF1A 3VK6A 3J7AG 2HHHE 3CWVA 3VYYA 4Z7CA 3Q1QA 3T1YE 1T4LB 1H72C 2LRSA 2L3JA 1YYKA 2HHHI 1USVA 3T1YI 3JAMQ 4DV6E 1ZM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA6 A;  1H7S A;  4JG4 A;  4HY1 A;  1KVK A;  4DV6 I;  4USK A;  4XTJ A;  5LMN E;  1XHK A;  3B8H A;  4RPF A;  1EI1 A;  1ZM2 A;  1NZ0 A;  5LMN I;  3D4J A;  4FWH A;  2BM1 A;  2V34 A;  4PRV A;  4NXN I;  2HKJ A;  4DR7 E;  1HNW E;  4DV5 E;  2UUB E;  4DR7 I;  2LJP A;  4JI0 E;  1N34 E;  4JI6 E;  3WU3 A;  4WUC A;  4DV5 I;  2UUB I;  4JI0 I;  1N34 I;  1J5E E;  4DR3 E;  4JI6 I;  1J5E I;  4DR3 I;  4P7A A;  4DPU A;  1PVG A;  3QT6 A;  4JI7 E;  3ZZT A;  1K47 A;  4B3M E;  1H7U A;  4JI7 I;  4DR4 E;  1N33 E;  4B3M I;  4B3S E;  3ZZ0 A;  4PRX A;  1A6F A;  4DR4 I;  1N33 I;  4B3S I;  3M6A A;  1FI4 A;  2HFU A;  3ZKD A;  5FLX Q;  4DXL A;  3J81 C;  4AQY E;  3HUL A;  4AQY I;  2R42 A;  4DPX A;  4PU9 A;  1FWK A;  4K0K E;  4FWD A;  3T1H E;  3PYD A;  2ZIT A;  1MX0 A;  3J80 Q;  2UXB E;  3V2U C;  4NXM E;  4K0K I;  3T1H I;  2HKE A;  2OI2 A;  2UXB I;  4NXM I;  1DAR A;  1HR0 E;  2A2D A;  3LPS A;  5IWA E;  4ZVI A;  1HR0 I;  5IWA I;  4X66 E;  4X62 E;  4FW9 A;  4DV4 E;  4X66 I;  3B82 A;  4X62 I;  5BR8 E;  1S16 A;  1Z0V A;  4DV4 I;  4KHP E;  4LFA E;  4DPW A;  4GKJ E;  1BKN A;  1IBK E;  4KHP I;  4LFA I;  5A2Q Q;  4GKJ I;  1IBK I;  4DV1 E;  4P52 A;  1FJG E;  2ZM6 E;  1XNQ E;  4DV1 I;  1FJG I;  2ZM6 I;  1XNQ I;  1RRE A;  1Z0E A;  4JI3 E;  1NHI A;  4B3R E;  1D6T A;  4JI3 I;  4B3R I;  4R1F A;  1ZXN A;  2HFS A;  1HNW I;  4HYM A;  5FLX C;  1H74 A;  2VQE E;  1RR9 A;  5LL6 R;  2VQE I;  3PYF A;  2E1R A;  3QT8 A;  4LF7 E;  3ZKB A;  3J80 C;  4LF7 I;  2X36 A;  3F0N A;  1I94 E;  1FNM A;  4JYA E;  4YHH E;  1I94 I;  5GMD A;  4EMD A;  3OTO E;  1MG7 A;  4JYA I;  4YHH I;  4DV2 E;  1HNX E;  3OTO I;  3ZM7 A;  2BV3 A;  4DV2 I;  1HNX I;  2VQF E;  4X64 E;  2VQF I;  2Q2E B;  1N0U A;  4X64 I;  4USM A;  2UXD E;  2A2C A;  4B3T E;  3B78 A;  2UXD I;  5A2Q C;  4LF8 E;  4B3T I;  3JAM C;  1NHJ A;  5GME A;  4YY3 E;  4LF8 I;  3WU5 A;  4JI1 E;  4FN5 A;  1N32 E;  1ZM3 A;  4HAC B;  4YY3 I;  2UU9 E;  4JI5 E;  4JI1 I;  1B63 A;  1N32 I;  4JI5 I;  2UU9 I;  4LF5 E;  2ZBK B;  3QT5 A;  4DV3 E;  1Z5B A;  4LF5 I;  4JI4 E;  4DUZ E;  1VIS A;  4DV3 I;  5BR8 I;  4DR6 E;  1Z5C A;  4LF9 E;  1ZM4 A;  4JI4 I;  1S4E A;  4DR2 E;  4DUZ I;  5IT9 Q;  4DR6 I;  4LF9 I;  4DPT A;  2V8P A;  1XMO E;  4DR2 I;  1KTV A;  2VF3 A;  4HAC A;  4HXZ A;  2J7K A;  3H4L A;  3K17 A;  4OX9 E;  1XMO I;  1Z0C A;  1PKP A;  3J7A M;  4KQV A;  4OX9 I;  2UXC E;  1Z0B A;  2XEX A;  4X65 E;  2AJ4 A;  2EFG A;  2UUC E;  2UXC I;  1H73 A;  4X65 I;  3PYE A;  2UUC I;  1N36 E;  1ELO A;  2V2V A;  4ED4 A;  2BM0 A;  1UEK A;  1XMQ E;  1N36 I;  4NXN E;  3WU6 A;  1KKH A;  2WW4 A;  1XMQ I;  1PIE A;  1NHH A;  1MU5 A;  1Z0G A;  4LFB E;  4LF4 E;  4DU8 A;  5LMU E;  3LTO A;  4DPY A;  1Z59 A;  4DUY E;  1FKA E;  2R3V A;  4JI2 E;  4LFB I;  4LF4 I;  4LF6 E;  2DEJ A;  5LMU I;  2HK2 A;  4DUY I;  4JI2 I;  3V5R A;  1XNR E;  2HK3 A;  4LF6 I;  4GKK E;  4DV0 E;  1XNR I;  4GKK I;  2E5L E;  1Z5A A;  3QT7 A;  1IBM E;  3K1J A;  4MYU A;  4DV0 I;  1IBL E;  1WUU A;  1ZXM A;  2E5L I;  1IBM I;  4MYT A;  2GS8 A;  1IBL I;  1Z0W A;  2CZ9 A;  4LFC E;  4URL A;  1KIJ A;  3LNU A;  4DV7 E;  4FWG A;  2V2Q A;  4LFC I;  5IT9 C;  4DV7 I;  1FWL A;  5L3J A;  4JV5 E;  2X7I A;  1U2R A;  4JV5 I;  2V2Z A;  1ZM9 A;  4JI8 E;  4WUD A;  4DR1 E;  1B62 A;  4M1K A;  1HNZ E;  4JI8 I;  2DEI A;  4WUB A;  4DR1 I;  4Z7Y A;  1Z0T A;  1HNZ I;  1N0V C;  4UT4 A;  1QZR A;  2UUA E;  3WU4 A;  2F4V E;  3GON A;  3ZZU A;  2UUA I;  1OJ4 A;  3J81 Q;  2F4V I;  4DR5 E;  4I3H A;  2NPF A;  4DU7 A;  3PYG A;  4DR5 I;  3J7A G;  3CWV A;  2HHH E;  4Z7C A;  3Q1Q A;  3T1Y E;  1H72 C;  2HHH I;  3T1Y I;  3JAM Q;  4DV6 E;  4UTG A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  1EA6 A;  1H7S A;  4FW5 A;  4JG4 A;  4HY1 A;  5KL3 A;  1KVK A;  4DV6 I;  4USK A;  4ZYD A;  5LMN E;  1VI7 A;  4XTJ A;  3F6H A;  1XHK A;  2EPM X;  2JY9 A;  3B8H A;  1OYR A;  4RPF A;  2DGC A;  2JEA A;  1EI1 A;  5KL5 A;  1NZ0 A;  5LMN I;  1EH8 A;  3D4J A;  4TUG A;  3PS2 A;  4FWH A;  2HGH A;  1OYS A;  3AUZ A;  2V86 A;  2BM1 A;  4BMJ A;  2V34 A;  2IHR 1;  3P3G A;  1ZBT A;  2M7Q A;  1YYO A;  4QNK A;  4PRV A;  1HK7 A;  4NXN I;  3KWR A;  2HKJ A;  2EOX A;  4DR7 E;  3BBG A;  1HNW E;  3K85 A;  5FWK A;  4DV5 E;  3J7Y p;  2UUB E;  3MHS C;  4O43 A;  5AC4 A;  4DR7 I;  2LJP A;  4JI0 E;  1N34 E;  1P47 A;  2WP8 A;  1EKZ A;  4JI6 E;  3WU3 A;  4WUC A;  4DV5 I;  2DMI A;  2UUB I;  3F6G A;  4Q35 B;  2E1M A;  4WSG A;  1G2D C;  3HTX A;  2EQ0 A;  4JI0 I;  1N34 I;  1J5E E;  4DR3 E;  4QNJ A;  4FW6 A;  2PO1 B;  4JI6 I;  4KWY A;  2YU8 A;  1GZ6 A;  2BA1 G;  2PNL A;  3GLL A;  2E72 A;  1R6M A;  2IER A;  5ADZ A;  1J5E I;  2CT1 A;  4P7A A;  4DR3 I;  3HKM A;  4LCF A;  2V89 A;  1RC7 A;  2EOS A;  4DPU A;  2L2K B;  4ZYG A;  2EPP A;  2EJ4 A;  1PVG A;  1DQ3 A;  3QT6 A;  4JI7 E;  3ZZT A;  1K47 A;  4B3M E;  2LT7 A;  4BC9 A;  3EPL A;  4J3D A;  3THN A;  1H7U A;  4F2J C;  5A6B A;  4DR4 E;  4JI7 I;  2KON A;  1N33 E;  4B3M I;  1G2F C;  2JR1 A;  3LLH A;  4B3S E;  1DI2 A;  4PRX A;  3ZZ0 A;  2B9D A;  1A6F A;  2EM3 A;  4Q28 A;  3EPJ A;  2EM2 A;  4DR4 I;  1N33 I;  4R2C A;  4B3S I;  1ZAA C;  1UHZ A;  3M6A A;  3THO B;  3ECR A;  5JEA C;  1FI4 A;  4ZYH A;  1LLM C;  2HFU A;  4F9B B;  2EPR A;  1T4O A;  2L2M A;  3ZKD A;  5FLX Q;  4DXL A;  3J81 C;  5C0X E;  2IES A;  4AQY E;  4N4R B;  2LUQ A;  4MU1 A;  5LLQ A;  2EMF A;  4AM3 A;  3HUL A;  1ZU1 A;  3UK3 C;  3ADJ A;  2O1W A;  2ADR A;  2LVH A;  5TSE A;  4OO1 C;  4AQY I;  2MC6 A;  2EMB A;  2R42 A;  4DPX A;  1QNT A;  2LTS A;  4DV6 E;  4PU9 A;  2CGE A;  4GEQ B;  4K0K E;  2YTP A;  4X9J A;  1FWK A;  2C37 B;  2JEB B;  2O3Z A;  3T1H E;  3Q6M A;  3PYD A;  4FWD A;  4IS1 C;  2ZIT A;  1MX0 A;  5A6A A;  2UXB E;  1KYQ A;  2DRP A;  3J80 Q;  1A1K A;  3V2U C;  2EPZ A;  4NXM E;  4K0K I;  3FIG A;  3GME A;  3T1H I;  2YTN A;  2HKE A;  1AAY A;  2OI2 A;  1O0W A;  3OML A;  3U1K A;  4RHB B;  2UXB I;  5C0X F;  2ELZ A;  2YTD A;  2NA2 A;  1F2I G;  2BB8 A;  4M2Z A;  1DAR A;  4NXM I;  4IFD C;  1HR0 E;  3ADI A;  4F9A B;  2A2D A;  3LPS A;  5IWA E;  5EKW A;  4BC7 A;  2J7J A;  3U1Y A;  3C6M A;  4ZVI A;  2CVE A;  2LJU A;  2EOZ A;  3JTZ A;  3KZY A;  1E3P A;  2EMI A;  4IZK B;  5C0X A;  1HR0 I;  1GTK A;  4MU3 A;  5IWA I;  4X66 E;  1YUI A;  4X62 E;  4M30 A;  4FW9 A;  4IJD A;  2JXP A;  2L3C A;  4DV4 E;  1PJT A;  3DJW A;  1A1G A;  2NUG A;  2NN6 B;  4X66 I;  1UDS A;  4MLV A;  3B82 A;  4X62 I;  2GQ0 A;  5BR8 E;  2H36 X;  1S16 A;  5AAS A;  5A6B D;  5DNY A;  1Z0V A;  4DV4 I;  2ODR C;  4O4K A;  4MU4 A;  4KHP E;  3LML A;  5JEA E;  4LFA E;  4DPW A;  1PJQ A;  1USU A;  5K36 B;  2EMZ A;  2PRT A;  2GLI A;  4GKJ E;  1BKN A;  1IBK E;  4HEI A;  2C38 B;  2ENC A;  2YTF A;  4KHP I;  4LFA I;  2MDR A;  2WBS A;  5A2Q Q;  2BR2 B;  2EN6 A;  2EM8 A;  4WSP A;  4GKJ I;  1IBK I;  3PS3 A;  4DV1 E;  4P52 A;  1FJG E;  2PO2 A;  2EMG A;  4IZK A;  5AE3 A;  3KZZ A;  2ZM6 E;  1XNQ E;  4BHB A;  1E3H A;  2EOQ A;  2NN6 F;  2EOY A;  2B7T A;  1WHN A;  1YYW A;  1STU A;  2YT4 A;  4DV1 I;  1FJG I;  4WX9 A;  2EPA A;  2GPI A;  2KHX A;  1WJP A;  4R03 A;  2ZM6 I;  2RTX A;  1XNQ I;  1RRE A;  1YHC A;  1Z0E A;  4JI3 E;  1X3C A;  4I8O A;  1NHI A;  2NN6 A;  4FW4 A;  5DNL A;  2EPL X;  2GO3 A;  1Y4U A;  3MHH C;  2YZT A;  1EH7 A;  4B3R E;  5K36 F;  1PJS A;  1D6T A;  3IWD A;  4IFD E;  4JI3 I;  2LTR A;  2MDG A;  3DD6 A;  4B3R I;  2WCC 3;  2EP3 A;  3EPH A;  5K36 A;  4R1F A;  2C38 A;  1ZXN A;  3P76 A;  4R2A A;  2BR2 A;  2HFS A;  3L00 A;  1HNW I;  2N3H A;  2EOJ A;  2JYA A;  4OZE A;  2YTO A;  2EMX A;  4HYM A;  5C0X D;  5AE2 A;  1BBG A;  2IOQ A;  5FLX C;  2DSY A;  2YTQ A;  4BA1 B;  1H74 A;  2VQE E;  3HPZ A;  1RR9 A;  2JT2 A;  2V88 A;  3GCM A;  4IFD F;  2EPX A;  1ZR9 A;  2FTX B;  2CG9 A;  2F1D A;  4DMI A;  5LL6 R;  4BS9 A;  5IXM B;  2VQE I;  2R76 A;  4R2S A;  3PYF A;  1IMU A;  3BF2 A;  3JU0 A;  4R2P A;  2E1R A;  1QU6 A;  2GHF A;  5DRQ A;  3QT8 A;  2A25 A;  2YRK A;  4BA2 A;  4LF7 E;  4IFD A;  4LPF A;  3ZKB A;  1PDA A;  1IQO A;  3J80 C;  1YUJ A;  4LF7 I;  2EQ3 A;  1L4S A;  2L6M A;  2X36 A;  2O1U A;  1T39 A;  3F0N A;  1I94 E;  2ELY A;  1FNM A;  1NCS A;  1X6H A;  2DIX A;  2EE8 A;  4JYA E;  5AE1 A;  4GZN C;  4YHH E;  4IS9 A;  4P78 A;  4BBY A;  2V83 A;  5KL2 A;  4M9V C;  2PNM A;  1I94 I;  2EN2 A;  5GMD A;  3OTO E;  4GQU A;  4EMD A;  2EM0 A;  2RPC A;  1MG7 A;  3ADG A;  3EQ1 A;  4JYA I;  2L2N A;  1RQ0 A;  4R8O A;  4YHH I;  4BA1 A;  4DV2 E;  1HNX E;  3OTO I;  5C0X B;  3ZM7 A;  2BV3 A;  2NN6 D;  2EN3 A;  3M85 D;  2K4V A;  2VQF E;  4DV2 I;  1HNX I;  1N3G A;  3K6Q A;  4X64 E;  2PNZ B;  1BB8 A;  2EOI A;  2EML A;  3H09 A;  3KRN A;  2R1F A;  2ENH A;  1UDN A;  2VQF I;  2Q2E B;  1N0U A;  2EOH A;  2RSI A;  4X64 I;  4USM A;  2G7H A;  3B4T A;  2UXD E;  2WZO A;  5K36 D;  4LTY A;  3VYX A;  1Y6Z A;  1TN9 A;  2JWO A;  2A2C A;  4B3T E;  3M7N D;  2FGG A;  1Z1B A;  2DMY A;  4KZS A;  2IOP A;  2BA0 D;  1A1I A;  3B78 A;  1X6E A;  2NAB A;  2FV4 B;  2UXD I;  5A2Q C;  2EMW A;  4LF8 E;  2RSM A;  1RHY A;  4B3T I;  2LBS B;  3JAM C;  1A1J A;  1NHJ A;  5GME A;  4FW7 A;  5T6J A;  4YY3 E;  2F8B A;  3RMP A;  4LF8 I;  4TUI A;  2D9H A;  2WBU A;  4JI1 E;  3WU5 A;  1Y4S A;  5EL9 A;  2PO2 B;  1N32 E;  1YPN A;  1MEY C;  4FN5 A;  3EPK A;  1ZM3 A;  4JI5 E;  2UU9 E;  4WXD A;  2EOM A;  2EPK X;  4HAC B;  4NZV A;  3L7Z B;  4YY3 I;  2EPN A;  4JI1 I;  2WBT A;  1X47 A;  2DB2 A;  1BBO A;  1B63 A;  2PNZ A;  1N32 I;  2EM4 A;  4JI5 I;  3BID A;  2EN1 A;  2Z5E A;  2UU9 I;  2JOX A;  4DKK A;  2EL5 A;  2LJH A;  4LF5 E;  2ZBK B;  3QT5 A;  2EN7 A;  2Z5B A;  4DV3 E;  4UTG A;  3BGH A;  2MKD A;  2DLK A;  1Z5B A;  2V85 A;  3H1C A;  4X8W A;  5JEA B;  4LF5 I;  4JI4 E;  1IQS A;  4F54 A;  4DUZ E;  1A1H A;  1VIS A;  1WRJ A;  2B7V A;  4DV3 I;  5BR8 I;  2LV2 A;  3ZOQ B;  4DR6 E;  2I9I A;  1Z5C A;  4LF9 E;  1ZM4 A;  2BBG A;  2RS6 A;  4JI4 I;  1T4N A;  1S4E A;  2EL6 A;  4DR2 E;  4DUZ I;  5IT9 Q;  4OO1 B;  4DR6 I;  4OO1 E;  3P3C A;  1J26 A;  3PS1 A;  4LF9 I;  4DPT A;  2V8P A;  1XMO E;  4DR2 I;  2MKN A;  4WYQ B;  1ZBQ A;  2YTJ A;  1KTV A;  2VF3 A;  4HAC A;  4HXZ A;  2NUF A;  2J7K A;  3H4L A;  3K17 A;  3L7Z A;  4IZJ B;  1DGC A;  1KJK A;  4OX9 E;  2YTE A;  1XMO I;  4J8Z A;  5KL4 A;  1Z0C A;  2HC5 A;  3HJC A;  2O1T A;  4FW3 A;  4OKG A;  5JEA F;  2GO4 A;  1PKP A;  3J7A M;  1X5W A;  4KQV A;  4OX9 I;  2JPA A;  2K7I A;  2EMH A;  4P7D A;  2UXC E;  1EH6 A;  2EQ1 A;  2KOU A;  1X49 A;  4IFD B;  1Z0B A;  5DRP A;  5JEA A;  2XEX A;  2DLQ A;  4X65 E;  2AJ4 A;  2EFG A;  4LCH A;  2VRD A;  1UDO A;  3P1X A;  1WHQ A;  4O5G A;  2UUC E;  5ELW A;  4OO1 F;  1GQE A;  4WFT A;  5IV8 B;  1H73 A;  2UXC I;  2M9A A;  2O1V A;  4X65 I;  2EMY A;  3PYE A;  2UUC I;  4OO1 A;  1JK1 A;  2EM5 A;  4WPY A;  4R2Q A;  2WNR A;  4AID A;  1N36 E;  1ELO A;  2EMA A;  1UIL A;  2EMK A;  2JVA A;  3IWB A;  4BA2 B;  4LCG A;  4AIM A;  2V2V A;  4ED4 A;  4RH8 A;  2BM0 A;  1UEK A;  2LCE A;  5KL7 A;  1XMQ E;  1N36 I;  4NXN E;  4IZJ A;  2EN4 A;  1X6F A;  3WU6 A;  1KKH A;  2L92 A;  2WW4 A;  1XMQ I;  4M0V A;  5C0X C;  1AH5 A;  2EM6 A;  4NHR A;  3P3E A;  1TF6 A;  5AC5 A;  1PIE A;  4R2E A;  1NHH A;  1MU5 A;  1Z0G A;  4LFB E;  4OOG C;  4LF4 E;  1R6L A;  1YZ9 A;  2L8T A;  4MQY A;  4DU8 A;  5LMU E;  4F6N A;  1YH8 A;  3LTO A;  5A6K A;  1Z59 A;  4DPY A;  4DUY E;  1FKA E;  2R3V A;  4JI2 E;  4LFB I;  4LF4 I;  2B3T B;  2JP9 A;  4LF6 E;  2DEJ A;  5LMU I;  2HK2 A;  2NUE A;  2BA1 D;  1YSA C;  4DUY I;  4JI2 I;  3V5R A;  1XNR E;  2PO0 B;  2EZ6 A;  2HK3 A;  3HXL A;  4GKK E;  4LF6 I;  4LOM A;  2L33 A;  2EPC A;  5F3W A;  1Y60 A;  2EOF A;  4DV0 E;  3UHM A;  1XNR I;  2CPN A;  2YWQ A;  4GKK I;  2E5L E;  2N3G A;  2LUP B;  1IBM E;  1Z5A A;  3K1J A;  3QT7 A;  4MYU A;  1IBL E;  4DV0 I;  4MLQ A;  1WUU A;  3AV0 A;  1ZXM A;  4O24 A;  2E5L I;  4BCA A;  1IBM I;  4MYT A;  3Q6N A;  2AE8 A;  3C6K A;  2GS8 A;  3M85 G;  2Q8U A;  1IBL I;  2EPO A;  1SR9 A;  2YSO A;  1A1L A;  2RS7 A;  1Z0W A;  5JEA D;  2N8X A;  1WXR A;  2CZ9 A;  2ENA A;  4LFC E;  3PRY A;  2Z5B B;  1KIJ A;  4BHC A;  4URL A;  3LNU A;  2NN6 C;  4MU0 A;  4DV7 E;  1UN6 B;  4N3O A;  4LU9 A;  1NEI A;  3HQ1 A;  4F9C B;  5CFF E;  4FWG A;  2M1S A;  2V2Q A;  1TF3 A;  3P06 A;  2VES A;  4LFC I;  2LE2 A;  2PO1 A;  4OO1 D;  2J65 A;  3M7N G;  2EOO A;  4R2R A;  5IT9 C;  2PO0 A;  4DV7 I;  1FWL A;  3CDJ A;  5L3J A;  2BA0 G;  5K36 C;  2EM7 A;  3NZK A;  4JV5 E;  3MSW A;  2X7I A;  4ZYE A;  2YU5 A;  2LMZ A;  1UBD C;  2V87 A;  1MGT A;  4MDT A;  4IZJ D;  1U2R A;  1YFH A;  2EWL A;  2Z5C B;  2I13 A;  4JV5 I;  3TQM A;  2V2Z A;  4U3B A;  5DRO A;  1ZM9 A;  3VHT B;  1X48 A;  4JI8 E;  2JE6 B;  4WUD A;  1Y5Y A;  2YPN A;  4DR1 E;  4IFD D;  1B62 A;  2CTD A;  4L8N A;  4FK5 C;  3ADL A;  4M1K A;  1HNZ E;  4JI8 I;  2DEI A;  4WUB A;  4DR1 I;  4Z7Y A;  1Z0T A;  1SFE A;  2EOE A;  1HNZ I;  1N0V C;  2C39 B;  2V8Q B;  4U3D A;  4UT4 A;  1QZR A;  2VE7 C;  2UUA E;  5A69 A;  1OYP A;  4L5N C;  1XXE A;  3WU4 A;  2EM9 A;  2EOR A;  1RMD A;  2M4I A;  2F4V E;  4WXC A;  1P42 A;  3GON A;  4ISA A;  3C4B A;  5A6J A;  5DNX A;  1T38 A;  5DRR A;  3ZZU A;  2UUA I;  2YSP A;  2EPU A;  2RQL A;  3HPS A;  2CSH A;  1A1F A;  2JOB A;  1OJ4 A;  2MC5 A;  2WNR B;  3J81 Q;  2YRM A;  2F4V I;  2ODR D;  1B69 A;  4DR5 E;  2Z5C A;  2JEA B;  4I3H A;  2EN8 A;  3CDI A;  2NPF A;  2EL4 A;  3C4T A;  2NN6 E;  4HTG A;  2JEB A;  3PYG A;  4DU7 A;  2C37 A;  2JE6 A;  3IWC A;  4DR5 I;  2VF1 A;  3M99 B;  3VK6 A;  2HHH E;  4F6M A;  3J7A G;  3CWV A;  3VYY A;  4Z7C A;  5KL6 A;  3Q1Q A;  3T1Y E;  1T4L B;  4R2D A;  1H72 C;  2LRS A;  2YTG A;  2YRH A;  2L3J A;  1YYK A;  4NBQ A;  5K36 E;  2HHH I;  1JK2 A;  2HJJ A;  2EMC A;  1USV A;  2C39 A;  3T1Y I;  2YTI A;  2LO3 A;  2WP8 B;  3JAM Q;  3DF6 A;  1UDQ A;  1ZM2 A; 
#chains in the Genus database with same CATH homology
 1EA6 A;  1H7S A;  4JG4 A;  4HY1 A;  1KVK A;  4DV6 I;  4USK A;  5LMN E;  4XTJ A;  3F6H A;  1XHK A;  2JY9 A;  3B8H A;  4RPF A;  1EI1 A;  1NZ0 A;  5LMN I;  3D4J A;  4TUG A;  4FWH A;  2BM1 A;  3AUZ A;  2V86 A;  2V34 A;  4BMJ A;  2IHR 1;  1ZBT A;  2M7Q A;  1YYO A;  4PRV A;  1HK7 A;  4NXN I;  3KWR A;  2HKJ A;  4DR7 E;  1HNW E;  3K85 A;  5FWK A;  4DV5 E;  3J7Y p;  2UUB E;  4DR7 I;  2LJP A;  4JI0 E;  1N34 E;  1EKZ A;  4JI6 E;  3WU3 A;  4WUC A;  4DV5 I;  2UUB I;  3F6G A;  2E1M A;  3HTX A;  4JI0 I;  1N34 I;  1J5E E;  4DR3 E;  4JI6 I;  1GZ6 A;  2PNL A;  5ADZ A;  1J5E I;  4DR3 I;  4P7A A;  2V89 A;  1RC7 A;  4DPU A;  2L2K B;  1PVG A;  1DQ3 A;  3QT6 A;  4JI7 E;  3ZZT A;  1K47 A;  4B3M E;  4BC9 A;  1H7U A;  4JI7 I;  4DR4 E;  2KON A;  1N33 E;  4B3M I;  2JR1 A;  3LLH A;  4B3S E;  1DI2 A;  4PRX A;  3ZZ0 A;  2B9D A;  1A6F A;  4Q28 A;  4DR4 I;  1N33 I;  4B3S I;  1UHZ A;  3M6A A;  1FI4 A;  2HFU A;  4F9B B;  1T4O A;  2L2M A;  3ZKD A;  5FLX Q;  4DXL A;  3J81 C;  4AQY E;  2LUQ A;  3HUL A;  3ADJ A;  2O1W A;  4AQY I;  2MC6 A;  2R42 A;  4DPX A;  2LTS A;  4PU9 A;  2CGE A;  1FWK A;  4GEQ B;  4K0K E;  4FWD A;  3T1H E;  3Q6M A;  3PYD A;  2ZIT A;  1MX0 A;  2UXB E;  3J80 Q;  3V2U C;  4NXM E;  4K0K I;  3FIG A;  3T1H I;  2HKE A;  2OI2 A;  1O0W A;  3OML A;  2UXB I;  2NA2 A;  4M2Z A;  4NXM I;  1DAR A;  1HR0 E;  3ADI A;  4F9A B;  2A2D A;  3LPS A;  5IWA E;  4BC7 A;  4ZVI A;  4IZK B;  3JTZ A;  1HR0 I;  5IWA I;  4X66 E;  4X62 E;  4M30 A;  4FW9 A;  2L3C A;  4DV4 E;  3DJW A;  2NUG A;  4X66 I;  3B82 A;  4X62 I;  2GQ0 A;  5BR8 E;  2H36 X;  1S16 A;  5AAS A;  5DNY A;  1Z0V A;  4DV4 I;  2ODR C;  4KHP E;  3LML A;  4LFA E;  4DPW A;  1USU A;  4GKJ E;  1BKN A;  1IBK E;  4KHP I;  4LFA I;  2MDR A;  5A2Q Q;  4WSP A;  4GKJ I;  1IBK I;  4DV1 E;  4P52 A;  1FJG E;  4IZK A;  5AE3 A;  2ZM6 E;  1XNQ E;  2B7T A;  1WHN A;  1YYW A;  1STU A;  2YT4 A;  4DV1 I;  1FJG I;  4R03 A;  2KHX A;  2ZM6 I;  1XNQ I;  2RTX A;  1RRE A;  1Z0E A;  4JI3 E;  4I8O A;  1NHI A;  1Y4U A;  4B3R E;  2YZT A;  1D6T A;  3IWD A;  4JI3 I;  2LTR A;  4B3R I;  4R1F A;  1ZXN A;  2HFS A;  1HNW I;  2N3H A;  4HYM A;  5AE2 A;  2IOQ A;  5FLX C;  2DSY A;  1H74 A;  2VQE E;  3HPZ A;  1RR9 A;  2V88 A;  2FTX B;  2CG9 A;  4DMI A;  5LL6 R;  4BS9 A;  2VQE I;  3PYF A;  2E1R A;  3JU0 A;  1QU6 A;  3QT8 A;  4LF7 E;  3ZKB A;  3J80 C;  4LF7 I;  2L6M A;  2X36 A;  2O1U A;  3F0N A;  1I94 E;  1FNM A;  4JYA E;  2DIX A;  5AE1 A;  4YHH E;  4P78 A;  4BBY A;  2V83 A;  1I94 I;  2PNM A;  5GMD A;  3OTO E;  4EMD A;  1MG7 A;  3ADG A;  4JYA I;  2L2N A;  1RQ0 A;  4R8O A;  4YHH I;  4DV2 E;  1HNX E;  3OTO I;  3ZM7 A;  2BV3 A;  4DV2 I;  2K4V A;  2VQF E;  1HNX I;  3K6Q A;  4X64 E;  3H09 A;  2VQF I;  2Q2E B;  1N0U A;  4X64 I;  4USM A;  2G7H A;  2UXD E;  2WZO A;  4LTY A;  3VYX A;  1Y6Z A;  2JWO A;  2A2C A;  4B3T E;  2FGG A;  2DMY A;  4KZS A;  2IOP A;  3B78 A;  2UXD I;  2FV4 B;  5A2Q C;  4LF8 E;  2RSM A;  4B3T I;  2LBS B;  3JAM C;  1NHJ A;  5GME A;  5T6J A;  4YY3 E;  2F8B A;  3RMP A;  4LF8 I;  4TUI A;  3WU5 A;  4JI1 E;  1Y4S A;  4FN5 A;  1N32 E;  1ZM3 A;  4JI5 E;  2UU9 E;  4HAC B;  4YY3 I;  4JI1 I;  1X47 A;  2DB2 A;  1B63 A;  1N32 I;  4JI5 I;  2UU9 I;  2Z5E A;  2JOX A;  4DKK A;  2LJH A;  4LF5 E;  2ZBK B;  3QT5 A;  2Z5B A;  4DV3 E;  4UTG A;  1Z5B A;  2V85 A;  4X8W A;  4LF5 I;  4JI4 E;  4F54 A;  4DUZ E;  1VIS A;  2B7V A;  4DV3 I;  5BR8 I;  3ZOQ B;  4DR6 E;  1Z5C A;  4LF9 E;  1ZM4 A;  2RS6 A;  4JI4 I;  1T4N A;  1S4E A;  4DR2 E;  4DUZ I;  5IT9 Q;  4DR6 I;  1J26 A;  4LF9 I;  4DPT A;  2V8P A;  1XMO E;  4DR2 I;  4WYQ B;  1ZBQ A;  3DF6 A;  1KTV A;  2VF3 A;  4HAC A;  4HXZ A;  2NUF A;  2J7K A;  3H4L A;  3K17 A;  4IZJ B;  4OX9 E;  1XMO I;  4J8Z A;  1Z0C A;  3HJC A;  2O1T A;  1PKP A;  3J7A M;  4KQV A;  4OX9 I;  4P7D A;  2UXC E;  2KOU A;  1X49 A;  1Z0B A;  2XEX A;  4X65 E;  2AJ4 A;  2EFG A;  3P1X A;  1WHQ A;  2UUC E;  2UXC I;  1GQE A;  4WFT A;  1H73 A;  2O1V A;  4X65 I;  3PYE A;  2UUC I;  4WPY A;  1N36 E;  1ELO A;  1UIL A;  3IWB A;  2JVA A;  2V2V A;  4ED4 A;  2BM0 A;  1UEK A;  1XMQ E;  1N36 I;  4NXN E;  4IZJ A;  3WU6 A;  1KKH A;  2L92 A;  2WW4 A;  1XMQ I;  4M0V A;  1PIE A;  1NHH A;  1MU5 A;  1Z0G A;  4LFB E;  4OOG C;  4LF4 E;  1YZ9 A;  2L8T A;  4DU8 A;  5LMU E;  3LTO A;  4DPY A;  1Z59 A;  4DUY E;  1FKA E;  2R3V A;  4JI2 E;  4LFB I;  4LF4 I;  2B3T B;  4LF6 E;  2DEJ A;  5LMU I;  2HK2 A;  2NUE A;  4DUY I;  4JI2 I;  3V5R A;  1XNR E;  2EZ6 A;  2HK3 A;  3HXL A;  4GKK E;  4LF6 I;  2L33 A;  5F3W A;  4DV0 E;  1XNR I;  2CPN A;  4GKK I;  2E5L E;  2N3G A;  2LUP B;  1IBM E;  1Z5A A;  3K1J A;  3QT7 A;  4MYU A;  1IBL E;  4DV0 I;  1WUU A;  3AV0 A;  1ZXM A;  2E5L I;  4BCA A;  1IBM I;  4MYT A;  3Q6N A;  2GS8 A;  1IBL I;  1SR9 A;  2RS7 A;  1Z0W A;  1WXR A;  2CZ9 A;  4LFC E;  3PRY A;  2Z5B B;  1KIJ A;  4URL A;  3LNU A;  4DV7 E;  4N3O A;  4LU9 A;  3HQ1 A;  4F9C B;  5CFF E;  4FWG A;  2M1S A;  2V2Q A;  3P06 A;  4LFC I;  2LE2 A;  5IT9 C;  4DV7 I;  1FWL A;  5L3J A;  4JV5 E;  3MSW A;  2X7I A;  2LMZ A;  2V87 A;  4IZJ D;  1U2R A;  2EWL A;  2Z5C B;  4JV5 I;  2V2Z A;  1ZM9 A;  1X48 A;  4JI8 E;  4WUD A;  4DR1 E;  1B62 A;  4L8N A;  3ADL A;  4M1K A;  1HNZ E;  4JI8 I;  2DEI A;  4WUB A;  4DR1 I;  4Z7Y A;  1Z0T A;  1HNZ I;  1N0V C;  2V8Q B;  4UT4 A;  1QZR A;  2VE7 C;  2UUA E;  4L5N C;  3WU4 A;  2M4I A;  2F4V E;  3GON A;  3C4B A;  3ZZU A;  2UUA I;  3HPS A;  1OJ4 A;  2JOB A;  2MC5 A;  3J81 Q;  2F4V I;  2ODR D;  4DR5 E;  2Z5C A;  4I3H A;  2NPF A;  3C4T A;  4DU7 A;  3PYG A;  3IWC A;  4DR5 I;  2VF1 A;  3VK6 A;  3J7A G;  2HHH E;  3CWV A;  3VYY A;  4Z7C A;  3Q1Q A;  3T1Y E;  1T4L B;  1H72 C;  2LRS A;  2L3J A;  1YYK A;  2HHH I;  1USV A;  3T1Y I;  3JAM Q;  4DV6 E;  1ZM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...