5IT9C

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5it9C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9C02
4LF4E 1N32E 4DR5I 4LFCE 2V8PA 1FJGE 3J7AM 3Q1QA 5IT9Q 4GKKE 2VQEE 2UXDI 4GKJI 3B8HA 4I3HA 4LFAI 4ZVIA 1N34E 1BKNA 1XMQI 1ZXMA 4PRXA 4DV6I 4URLA 3WU3A 3D4JA 4B3MI 5FLXQ 1N36E 1Z5AA 1FWLA 2UU9I 4LF6E 4X62I 4Z7CA 4HACB 2NPFA 4DPUA 4DR1I 2UUAI 2AJ4A 4X65E 2VQFE 4YHHI 4DR4I 2DEJA 4DV2E 1NZ0A 4AQYI 4JI4E 2XEXA 4DV3I 5IT9C 4HYMA 4DR3I 1ZM3A 2UXCI 4DR7E 4B3RI 2BV3A 3V2UC 4RPFA 4KQVA 4JI2I 3T1YI 5LMNI 2CZ9A 5LL6R 1N33E 4JYAI 2V2QA 3OTOI 4UT4A 2LJPA 1PVGA 2E1RA 4YY3I 4PU9A 4HY1A 1IBMI 1MX0A 1VISA 4DPYA 4PRVA 4DV4I 3ZZTA 1PKPA 1XMOE 1HNXE 2VF3A 1OJ4A 3F0NA 2HKJA 1A6FA 4JI3I 2F4VI 1U2RA 1QZRA 4HXZA 4JI1I 1J5EI 2HHHE 4B3SI 4M1KA 3HULA 4JI7I 4LF7I 1D6TA 4P7AA 1B62A 4JI6E 4DV1E 5IWAE 3B82A 5A2QQ 3ZKDA 4DV0I 4DR6I 5GMEA 2ZM6I 4B3TI 1EA6A 3QT7A 1N32I 1XNRE 3ZM7A 2DEIA 1N0VC 1HNWE 4JV5E 3LPSA 4LFCI 4DU8A 4LF9E 4JI0E 4FN5A 2UUBI 3PYFA 2V2ZA 1MU5A 4DV5E 4DUZE 4WUBA 1N34I 2ZBKB 1H7SA 3T1HE 3K1JA 1Z0CA 1ZXNA 4DPWA 1Z0TA 1I94E 4P52A 1H72C 5A2QC 4DR5E 1HR0E 4WUCA 1IBKI 2A2CA 1NHHA 4LF6I 3JAMQ 4USMA 2X7IA 2V34A 2BM1A 2J7KA 4K0KE 1WUUA 1Z0GA 4LF8I 4X65I 4FWHA 4DV2I 1XMQE 1H7UA 4NXNI 4JI4I 1ZM9A 4WUDA 1Z0EA 2UU9E 3H4LA 1N33I 5GMDA 1B63A 1Z0BA 2UUCI 4DV7E 3B78A 4DUYE 1IBLE 4LFBI 2UXBE 5BR8E 2UUAE 1HNZE 3WU5A 4DR4E 3JAMC 4AQYE 4DV3E 3WU4A 4FWDA 2E5LE 4NXMI 1XNQI 1FWKA 4MYTA 4B3RE 1ELOA 1Z5BA 2HK2A 3T1YE 5LMNE 2HHHI 1S16A 4YY3E 1ZM2A 4USKA 4JI8I 2R3VA 4DXLA 1N0UA 3J81Q 4JI6I 1KIJA 4DV4E 4JI5E 4X64I 4DR2I 1H74A 5LMUI 1KVKA 4UTGA 1Z0WA 1HNWI 1Z0VA 4LF4I 4X66E 4JI1E 3PYDA 4LF9I 4KHPE 2A2DA 1FJGI 2HFUA 5L3JA 2OI2A 4DV5I 4DUZI 4GKKI 2VQEI 4EMDA 4DR6E 4LF5E 3T1HI 4ED4A 1UEKA 4DPTA 4OX9E 2WW4A 3J81C 1I94I 3J7AG 3PYEA 2ZITA 3CWVA 1N36I 1HR0I 3LTOA 1FKAE 1KTVA 2UUBE 4K0KI 1XHKA 1FI4A 1S4EA 2UXDE 2VQFI 4GKJE 2R42A 4LFAE 4DV6E 2GS8A 3K17A 4DR7I 4B3ME 4FW9A 1IBKE 3ZZUA 4DV7I 3WU6A 3M6AA 2X36A 4DUYI 1IBLI 2UXBI 5BR8I 3ZZ0A 4X62E 4LF8E 1HNZI 4JG4A 3J80Q 2HFSA 4DR1E 1ZM4A 2HKEA 4NXNE 2V2VA 4YHHE 1XMOI 1HNXI 1RREA 2E5LI 4DPXA 4DR3E 2HK3A 2UXCE 3QT8A 4Z7YA 4JI2E 2UUCE 1NHJA 5FLXC 1RR9A 4JYAE 3OTOE 4HACA 4LFBE 1KKHA 3LNUA 4JI5I 1IBME 1K47A 1PIEA 4DV1I 1DARA 5IWAI 1H73A 4R1FA 4NXME 1EI1A 1XNQE 3J80C 4FWGA 3GONA 2BM0A 4X66I 1NHIA 1XNRI 4MYUA 4JI3E 2F4VE 4JV5I 4KHPI 1J5EE 1FNMA 1MG7A 3PYGA 4B3SE 4JI0I 2Q2EB 4JI8E 4JI7E 4LF7E 1Z5CA 3QT6A 4LF5I 3QT5A 3ZKBA 4X64E 4XTJA 4DR2E 4OX9I 4DV0E 5LMUE 2ZM6E 4DU7A 1Z59A 4B3TE 3V5RA 2EFGA
chains in the Genus database with same CATH superfamily
1IBMI 4LF4E 2YRKA 1N32E 3P76A 4BHCA 4OKGA 2JOXA 1LLMC 2BA1G 1EH7A 4MDTA 2LV2A 1P42A 4LFCE 4DR5I 3ADGA 2MC5A 2V8PA 1FJGE 2LMZA 3PRYA 2O1WA 3J7AM 3JTZA 5CFFE 2JEAA 4AM3A 3TQMA 2WNRB 2EN7A 2MKDA 4IFDE 3Q1QA 5IT9Q 3LLHA 4U3DA 4GKKE 2VQEE 2GO4A 2UXDI 2EORA 4ISAA 4GKJI 3B8HA 4I3HA 5A6BA 4ZVIA 4LFAI 1N34E 3L7ZA 1BKNA 2JVAA 4O24A 3H1CA 5JEAE 1XMQI 1ZXMA 2EWLA 2GHFA 4PRXA 4DV6I 5AE1A 5JEAD 3HKMA 2ODRD 4WSGA 1YPNA 2GPIA 2RQLA 2EP3A 4URLA 3BBGA 3WU3A 3THOB 3D4JA 1ZR9A 1X3CA 1XXEA 4B3MI 5FLXQ 3KRNA 1N36E 1Z5AA 2YTOA 3GCMA 1FWLA 1X6HA 2EPAA 2V86A 4BA1A 2UU9I 5A6JA 4F6MA 2PNLA 5AASA 1A1HA 2C37A 2EN6A 2IESA 3M85D 4LF6E 5C0XA 4IFDB 4OO1C 2RPCA 2WBTA 1ZU1A 2EN1A 4I8OA 4R2RA 2BR2A 2O3ZA 4X62I 2G7HA 2EMGA 2EM5A 1IQOA 1T4OA 1PDAA 4Z7CA 5A69A 4HACB 2NPFA 4DPUA 4DR1I 2UUAI 5JEAB 3EPKA 2AJ4A 2L92A 5LLQA 4X65E 2VQFE 2Z5CA 1X6EA 4YHHI 4DR4I 3EQ1A 5KL4A 2RSMA 3KZZA 1AAYA 2DEJA 1USVA 4DV2E 1NZ0A 3ECRA 2EMKA 2J65A 4AQYI 1TF3A 4JI4E 2XEXA 4DV3I 5IT9C 2N3HA 2RS7A 1E3PA 1DQ3A 3C4TA 4HYMA 4DR3I 1ZM3A 2YRMA 5T6JA 2UXCI 2EPRA 4DR7E 2MKNA 2YSPA 1KYQA 4B3RI 2BV3A 2YTJA 3V2UC 2EPOA 2LJHA 4RPFA 3AUZA 1G2FC 4KQVA 4JI2I 2FGGA 3T1YI 5LMNI 1USUA 2CZ9A 3GLLA 5LL6R 1RC7A 2KHXA 1N33E 1R6LA 4JYAI 2V2QA 3OTOI 2RS6A 1A1IA 2YPNA 2EMBA 3JU0A 2HGHA 1Y4UA 4UT4A 2LJPA 4BA2A 1UILA 2EM2A 1PVGA 4FW5A 4LTYA 2EMIA 4OO1E 2E1RA 4LCFA 2Z5BA 4YY3I 1EKZA 5C0XC 2M4IA 4PU9A 2DMYA 2LUQA 2EM3A 1MX0A 1VISA 4HY1A 2IOQA 2ENHA 1RQ0A 4PRVA 2EE8A 4DPYA 3ZZTA 1PKPA 4DV4I 4IS1C 1XMOE 3NZKA 4MU1A 2AE8A 2YSOA 1HNXE 2VF3A 1WXRA 3VK6A 2EFGA 3QG5C 1ZAAC 1OJ4A 4O43A 2EPNA 3ADLA 1TF6A 3F0NA 1Y4SA 4BS9A 2HKJA 2YT4A 2MDGA 1A6FA 2JEBA 5A6BD 4JI3I 2F4VI 5DNLA 1U2RA 1QZRA 2NABA 2NUFA 2B9DA 4HXZA 2LTRA 4J8ZA 2HHHE 4J3DA 4JI1I 1J5EI 3HQ1A 2DMIA 4F9CB 4OO1B 4B3SI 5ADZA 4P7DA 3P3GA 1UN6B 4MLVA 1ZBTA 5IV8B 4O4KA 4M1KA 3HULA 2EN4A 4JI7I 5K36A 4LF7I 1D6TA 4P7AA 3MHHC 2JEAB 3AV0A 2WBUA 4LCGA 3VYYA 3IWCA 4JI6E 1B62A 2PO0A 5C0XE 2M9AA 4R2PA 4DV1E 5IWAE 4DMIA 5C0XD 3B82A 5A2QQ 3ZKDA 4DV0I 2K7IA 4DR6I 5GMEA 3U1KA 2EJ4A 2I13A 2ZM6I 2BA0D 3L7ZB 4B3TI 1UDQA 1WRJA 1EA6A 2RTXA 3QT7A 1JK2A 4MU0A 2EMWA 1N32I 2R76A 2L8TA 1XNRE 3ZM7A 2YTEA 4BMJA 2DEIA 5A6AA 1N0VC 1HNWE 3F6HA 2F8BA 4JV5E 2JT2A 3LPSA 4LFCI 4DU8A 2EMCA 5C0XF 4OO1A 3HJCA 4LF9E 2EPMX 4JI0E 1T4LB 2EZ6A 4LPFA 1UHZA 4FN5A 3CDIA 4BA1B 2L3JA 2UUBI 2EOZA 3RMPA 1T38A 2C37B 5C0XB 2DLKA 4BCAA 3PYFA 2JY9A 2YTPA 4DV5E 1MU5A 4R8OA 2BA1D 2L2KB 4DUZE 2V2ZA 2BR2B 3ADIA 2KONA 2EMZA 2BBGA 2EOHA 3DD6A 4WUBA 1N34I 1YYOA 2ZBKB 4P78A 4IFDD 2EM9A 5ELWA 5K36C 3B4TA 2CT1A 2VESA 1H7SA 1OYSA 4BBYA 3T1HE 2Z5CB 2EMYA 3K1JA 1Z0CA 4WSPA 2VRDA 1ZXNA 4GZNC 2EMFA 4R2QA 4U3BA 2EPKX 4DPWA 1Z0TA 1X48A 1I94E 1Z1BA 1Y5YA 4P52A 4IFDF 2EQ1A 1H72C 3HXLA 5A2QC 4TUGA 2PNZA 4DR5E 3M99B 1HR0E 4WUCA 2I9IA 1IBKI 2A2CA 1NHHA 4LF6I 3P3EA 3JAMQ 2IHR1 5TSEA 1YSAC 2CG9A 2N8XA 3EPHA 1E3HA 4USMA 2IOPA 4M2ZA 2X7IA 2V34A 2B7TA 4X8WA 1A1GA 5JEAF 2PRTA 2BM1A 2J7KA 2EM8A 3KWRA 4WFTA 3C6KA 4BA2B 2V8QB 4K0KE 1WUUA 1Z0GA 1PJTA 4BC9A 4TUIA 2LTSA 3OMLA 4X65I 4Q35B 1JK1A 4LF8I 4QNKA 3ZOQB 2Z5BB 3C6MA 5A6KA 4FWHA 1N3GA 4DV2I 2YTDA 2V85A 1XMQE 1H7UA 4NXNI 4WPYA 4JI4I 5K36E 3M85G 3F6GA 1J26A 3P1XA 1ZM9A 5K36D 4WUDA 2JE6A 1F2IG 1STUA 3H09A 3MSWA 3KZYA 4FW6A 3BGHA 2NUGA 2O1TA 2HC5A 2YTFA 2L6MA 1Z0EA 2EQ3A 4WXDA 2UU9E 3H4LA 4FW3A 2NN6C 3P3CA 1N33I 5GMDA 2L2NA 1QU6A 1B63A 2JEBB 2EM4A 1Y6ZA 2FV4B 1IQSA 4ZYGA 2CVEA 5K36F 4F54A 1A1LA 1Z0BA 2WP8A 4AIDA 2UUCI 5DNXA 5EKWA 4DV7E 2EOYA 2BB8A 4DUYE 1IBLE 4RHBB 2UXBE 3B78A 5BR8E 4LFBI 3C4BA 2UUAE 4F9AB 3M7ND 2L3CA 1HNZE 3K6QA 3WU5A 2L33A 4DR4E 5K36B 3JAMC 4M30A 2LCEA 4OO1D 4IZJA 1RMDA 4R2AA 4AQYE 4LOMA 3EPLA 2V88A 4DV3E 2PO0B 5DROA 2E72A 3WU4A 4FK5C 2E5LE 4M9VC 4FWDA 4NXMI 2HJJA 1XNQI 1FWKA 3VHTB 4B3RE 4MYTA 4GQUA 2ADRA 4FW7A 1ELOA 4OZEA 1EH8A 2GO3A 1TN9A 1Z5BA 2HK2A 3T1YE 4R2CA 2PO1A 5LMNE 4IJDA 4OO1F 5FWKA 2DIXA 4IS9A 2HHHI 3L00A 2EOEA 4IZKA 2NN6E 1DI2A 5EL9A 1DGCA 2JP9A 4LF5I 2WBSA 2EOOA 1S16A 4YY3E 1X5WA 1ZM2A 4USKA 3DF6A 2R3VA 2LT7A 4JI8I 4DXLA 4ZYDA 1N0UA 3J81Q 4JI6I 2EOSA 4DV4E 1KIJA 4MU4A 3J7Yp 4JI5E 1VI7A 2JPAA 4F6NA 1MEYC 2LRSA 3CDJA 2NUEA 1SR9A 1GQEA 3IWDA 4X64I 4DR2I 4OOGC 1MGTA 1H74A 4L8NA 2LO3A 5DRRA 1YH8A 3EPJA 1BBOA 5LMUI 1KVKA 4UTGA 5AC5A 4GEQB 2DSYA 1Z0WA 1HNWI 2EPPA 4O5GA 2EN8A 1T4NA 4RH8A 1Z0VA 2NN6B 4X66E 4LF4I 4JI1E 4WYQB 1OYPA 1L4SA 3PYDA 4NZVA 1AH5A 4LF9I 1Y60A 2EMXA 1YYKA 1T39A 4KHPE 4LCHA 2PNZB 1NEIA 2A2DA 1FJGI 2HFUA 5L3JA 3HPSA 2BA0G 2J7JA 2C39A 2OI2A 4DV5I 4R2DA 4NBQA 4DUZI 1PJSA 4GKKI 2VQEI 2PO2A 2N3GA 2EMHA 3Q6NA 2WCC3 4FW4A 4EMDA 2EOJA 4DR6E 4LF5E 2YRHA 3U1YA 3T1HI 4ED4A 1UEKA 3HTXA 3K85A 1WHQA 4KWYA 4DPTA 4OX9E 5KL6A 2WW4A 3J81C 2Z5EA 1UBDC 2YU8A 1I94I 1EH6A 2NN6A 3J7AG 1IMUA 2MC6A 3PYEA 4IZJD 2ZITA 2JE6B 3CWVA 1N36I 1HR0I 2H36X 2YU5A 2C38A 1GZ6A 3LTOA 3PS3A 2EMAA 5KL2A 2JWOA 2LBSB 2DLQA 4LU9A 1FKAE 2M1SA 1KTVA 4NHRA 2UUBE 1GTKA 1WHNA 2R1FA 1YYWA 2CSHA 1YFHA 1O0WA 4F9BB 2EOMA 1XHKA 3HPZA 4K0KI 2CGEA 2WP8B 2GQ0A 1FI4A 2EPXA 4HEIA 4BC7A 1YUJA 2FTXB 2ENAA 1S4EA 3Q6MA 1A1KA 1UDSA 2UXDE 4GKJE 2VQFI 4MQYA 2R42A 1X47A 2LUPB 4LFAE 2JOBA 4DKKA 2LJUA 2EOXA 4IZJB 2ENCA 2EPCA 4DV6E 1YZ9A 4N4RB 2GS8A 3K17A 2LVHA 3FIGA 2ELZA 1B69A 2V87A 1NCSA 4DR7I 4B3ME 4FW9A 3GMEA 1IBKE 2YTIA 3ZZUA 1YUIA 2WZOA 2PO1B 4R2EA 5KL5A 2WNRA 2IERA 2EL5A 4DV7I 3WU6A 3M6AA 2X36A 4DUYI 1IBLI 2UXBI 5BR8I 2M7QA 4IZKB 2A25A 4R2SA 4X62E 3ZZ0A 1X49A 5AE3A 2EOFA 4LF8E 1HNZI 4JG4A 2DRPA 3J80Q 2YTGA 1ZBQA 4DR1E 2HFSA 1ZM4A 2HKEA 4M0VA 4NXNE 2V2VA 2VF1A 4YHHE 2K4VA 5DRQA 3ADJA 1XMOI 5F3WA 2EM7A 1HNXI 1RREA 2E5LI 2EOIA 2F1DA 2V83A 4DPXA 3P06A 2EPZA 1UDOA 4DR3E 1RHYA 2CTDA 2UXCE 1P47A 2HK3A 1G2DC 2MDRA 5AC4A 3M7NG 3QT8A 4IFDA 4ZYHA 4JI2E 4Z7YA 2B7VA 4Q28A 1YHCA 2YTNA 2UUCE 4WXCA 5FLXC 2EM6A 4HTGA 1NHJA 4JYAE 1RR9A 3OTOE 1QNTA 4HACA 4LFBE 4BHBA 5JEAA 3DJWA 2NN6D 1KJKA 1KKHA 3LNUA 2D9HA 2LE2A 4MU3A 2ELYA 4JI5I 2C39B 2Q8UA 4X9JA 1IBME 2EMLA 1K47A 2JXPA 5KL3A 1PIEA 4ZYEA 1OYRA 4DV1I 1UDNA 2DGCA 1DARA 1H73A 5IWAI 2PO2B 2EPLX 4KZSA 4R1FA 1R6MA 2JR1A 4NXME 2RSIA 5AE2A 1A1FA 2NN6F 1XNQE 1EI1A 3J80C 3PS1A 4N3OA 4FWGA 3BF2A 3GONA 4AIMA 2NA2A 2BM0A 4X66I 2EM0A 3BIDA 1NHIA 2L2MA 1XNRI 3MHSC 4MYUA 1BBGA 4JI3E 1HK7A 2F4VE 3UHMA 2E1MA 3VYXA 4JV5I 4KHPI 2KOUA 5DRPA 2B3TB 2EOQA 1J5EE 2EN2A 1SFEA 1FNMA 1MG7A 3PYGA 4B3SE 4WX9A 2C38B 4JI0I 4IFDC 1BB8A 1X6FA 5IXMB 2PNMA 2VE7C 3THNA 2Q2EB 4QNJA 2EL4A 2DB2A 3IWBA 4L5NC 2EQ0A 4R03A 4JI8E 4JI7E 2V89A 2YTQA 4LF7E 2JYAA 2EL6A 1Z5CA 2EPUA 2O1UA 3UK3C 3LMLA 2GLIA 3QT6A 5JEAC 2YZTA 5DNYA 2ODRC 2CPNA 2YWQA 1WJPA 5KL7A 4X64E 4DR2E 3PS2A 3QT5A 4XTJA 3ZKBA 4F2JC 1PJQA 4OX9I 2O1VA 1A1JA 4DV0E 5LMUE 2ZM6E 4DU7A 1Z59A 4B3TE 4MLQA 3V5RA 2EN3A
chains in the Genus database with same CATH topology
4LF4E 1N32E 2JOXA 4LFCE 4DR5I 3ADGA 2MC5A 2V8PA 1FJGE 2LMZA 3PRYA 2O1WA 3J7AM 3JTZA 5CFFE 3Q1QA 5IT9Q 3LLHA 4GKKE 2VQEE 2UXDI 4GKJI 3B8HA 4I3HA 4LFAI 4ZVIA 1N34E 1BKNA 2JVAA 1XMQI 1ZXMA 2EWLA 4PRXA 4DV6I 5AE1A 2ODRD 4URLA 3WU3A 3D4JA 4B3MI 5FLXQ 1N36E 1Z5AA 1FWLA 2V86A 2UU9I 2PNLA 5AASA 4LF6E 4X62I 4I8OA 2G7HA 1T4OA 4Z7CA 4HACB 2NPFA 4DPUA 4DR1I 2UUAI 2AJ4A 2L92A 4X65E 2VQFE 2Z5CA 4YHHI 4DR4I 2RSMA 2DEJA 1USVA 4DV2E 1NZ0A 4AQYI 4JI4E 2XEXA 4DV3I 5IT9C 2N3HA 2RS7A 1DQ3A 3C4TA 4HYMA 4DR3I 1ZM3A 5T6JA 2UXCI 4DR7E 4B3RI 2BV3A 3V2UC 2LJHA 4RPFA 3AUZA 4KQVA 4JI2I 2FGGA 3T1YI 5LMNI 1USUA 2CZ9A 5LL6R 1RC7A 2KHXA 1N33E 4JYAI 2V2QA 3OTOI 2RS6A 3JU0A 1Y4UA 4UT4A 2LJPA 1UILA 1PVGA 4LTYA 2E1RA 2Z5BA 4YY3I 1EKZA 2M4IA 4PU9A 2DMYA 2LUQA 4HY1A 1MX0A 1VISA 4DPYA 2IOQA 1IBMI 1RQ0A 4PRVA 4DV4I 3ZZTA 1PKPA 1XMOE 1HNXE 2VF3A 1WXRA 3VK6A 1OJ4A 3ADLA 3F0NA 1Y4SA 4BS9A 2HKJA 2YT4A 1A6FA 4JI3I 2F4VI 1U2RA 1QZRA 2NUFA 2B9DA 4HXZA 2LTRA 4J8ZA 2HHHE 4JI1I 1J5EI 3HQ1A 4F9CB 4B3SI 5ADZA 4P7DA 1ZBTA 4M1KA 3HULA 4JI7I 4LF7I 1D6TA 4P7AA 3AV0A 3VYYA 3IWCA 4JI6E 1B62A 4DV1E 5IWAE 4DMIA 3B82A 5A2QQ 3ZKDA 4DV0I 4DR6I 5GMEA 2ZM6I 4B3TI 1EA6A 2RTXA 3QT7A 1N32I 1XNRE 2L8TA 3ZM7A 2DEIA 4BMJA 1N0VC 1HNWE 3F6HA 2F8BA 4JV5E 3LPSA 4LFCI 4DU8A 3HJCA 4LF9E 4JI0E 1T4LB 2EZ6A 1UHZA 4FN5A 2L3JA 2UUBI 3RMPA 4BCAA 3PYFA 2JY9A 4DV5E 1MU5A 2V2ZA 4R8OA 2L2KB 4DUZE 3ADIA 2KONA 4WUBA 1N34I 1YYOA 2ZBKB 4P78A 1H7SA 4BBYA 3T1HE 2Z5CB 3K1JA 1Z0CA 4WSPA 1ZXNA 4DPWA 1Z0TA 1X48A 1I94E 4P52A 1H72C 3HXLA 5A2QC 4TUGA 4DR5E 1HR0E 4WUCA 1IBKI 2A2CA 1NHHA 4LF6I 3JAMQ 2IHR1 2CG9A 4USMA 2IOPA 4M2ZA 2X7IA 2V34A 2B7TA 4X8WA 2BM1A 2J7KA 3KWRA 4WFTA 2V8QB 4K0KE 1WUUA 1Z0GA 4TUIA 4BC9A 2LTSA 3OMLA 4X65I 4LF8I 3ZOQB 2Z5BB 4FWHA 4DV2I 1XMQE 2V85A 1H7UA 4NXNI 4WPYA 4JI4I 3F6GA 1J26A 3P1XA 1ZM9A 4WUDA 1STUA 3H09A 3MSWA 2NUGA 2O1TA 2L6MA 1Z0EA 2UU9E 3H4LA 1N33I 5GMDA 2L2NA 1QU6A 1B63A 1Y6ZA 2FV4B 4F54A 1Z0BA 2UUCI 4DV7E 4DUYE 1IBLE 3B78A 4LFBI 2UXBE 5BR8E 3C4BA 2UUAE 4F9AB 2L3CA 1HNZE 3K6QA 3WU5A 2L33A 4DR4E 3JAMC 4M30A 4IZJA 4AQYE 2V88A 4DV3E 3WU4A 4FWDA 2E5LE 4NXMI 1XNQI 1FWKA 4B3RE 4MYTA 1ELOA 1Z5BA 2HK2A 3T1YE 5LMNE 5FWKA 2DIXA 2HHHI 4IZKA 1DI2A 1S16A 4YY3E 1ZM2A 4USKA 3DF6A 2R3VA 4JI8I 4DXLA 1N0UA 3J81Q 4JI6I 4DV4E 1KIJA 3J7Yp 4JI5E 2LRSA 2NUEA 1SR9A 1GQEA 3IWDA 4X64I 4DR2I 4OOGC 1H74A 4L8NA 5LMUI 1KVKA 4UTGA 4GEQB 2DSYA 1Z0WA 1HNWI 1Z0VA 1T4NA 4LF4I 4X66E 4JI1E 4WYQB 3PYDA 4LF9I 1YYKA 4KHPE 2A2DA 1FJGI 2HFUA 5L3JA 3HPSA 2OI2A 4DV5I 4DUZI 4GKKI 2VQEI 2N3GA 3Q6NA 4EMDA 4DR6E 4LF5E 3T1HI 4ED4A 1UEKA 3HTXA 3K85A 1WHQA 4DPTA 4OX9E 2WW4A 3J81C 2Z5EA 1I94I 3J7AG 2MC6A 3PYEA 4IZJD 2ZITA 3CWVA 1N36I 1HR0I 2H36X 1GZ6A 3LTOA 2JWOA 2LBSB 4LU9A 1FKAE 2M1SA 1KTVA 2UUBE 1WHNA 1YYWA 1O0WA 4F9BB 4K0KI 1XHKA 3HPZA 2CGEA 2GQ0A 1FI4A 4BC7A 1S4EA 2FTXB 3Q6MA 2UXDE 4GKJE 2VQFI 2R42A 4LFAE 2LUPB 1X47A 2JOBA 4DKKA 4IZJB 4DV6E 1YZ9A 2GS8A 3K17A 3FIGA 2V87A 4DR7I 4B3ME 4FW9A 1IBKE 3ZZUA 2WZOA 4DV7I 3WU6A 3M6AA 2X36A 4DUYI 1IBLI 2UXBI 5BR8I 2M7QA 4IZKB 4X62E 3ZZ0A 1X49A 5AE3A 4LF8E 1HNZI 4JG4A 3J80Q 1ZBQA 4DR1E 2HFSA 1ZM4A 2HKEA 4M0VA 4NXNE 2V2VA 2VF1A 4YHHE 2K4VA 3ADJA 1XMOI 5F3WA 1HNXI 1RREA 2E5LI 2V83A 4DPXA 3P06A 4DR3E 2UXCE 2HK3A 2MDRA 3QT8A 4JI2E 4Z7YA 2B7VA 4Q28A 2UUCE 5FLXC 1NHJA 4JYAE 1RR9A 3OTOE 4HACA 4LFBE 3DJWA 1KKHA 3LNUA 2LE2A 4JI5I 1IBME 1K47A 1PIEA 4DV1I 1DARA 5IWAI 1H73A 4KZSA 4R1FA 2JR1A 4NXME 5AE2A 1XNQE 1EI1A 3J80C 4N3OA 4FWGA 3GONA 2NA2A 2BM0A 4X66I 1NHIA 1XNRI 2L2MA 4MYUA 4JI3E 1HK7A 2F4VE 2E1MA 3VYXA 4JV5I 4KHPI 2KOUA 2B3TB 1J5EE 1FNMA 1MG7A 3PYGA 4B3SE 4JI0I 2PNMA 2VE7C 2Q2EB 3IWBA 2DB2A 4R03A 4L5NC 4JI8E 4JI7E 2V89A 4LF7E 1Z5CA 2O1UA 3LMLA 3QT6A 2YZTA 5DNYA 2ODRC 2CPNA 4X64E 3QT5A 4DR2E 4XTJA 3ZKBA 4LF5I 4OX9I 2O1VA 4DV0E 5LMUE 2ZM6E 4DU7A 1Z59A 4B3TE 3V5RA 2EFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 E;  1N32 E;  4DR5 I;  4LFC E;  2V8P A;  1FJG E;  3J7A M;  3Q1Q A;  5IT9 Q;  4GKK E;  2VQE E;  2UXD I;  4GKJ I;  3B8H A;  4I3H A;  4LFA I;  4ZVI A;  1N34 E;  1BKN A;  1XMQ I;  1ZXM A;  4PRX A;  4DV6 I;  4URL A;  3WU3 A;  3D4J A;  4B3M I;  5FLX Q;  1N36 E;  1Z5A A;  1FWL A;  2UU9 I;  4LF6 E;  4X62 I;  4Z7C A;  4HAC B;  2NPF A;  4DPU A;  4DR1 I;  2UUA I;  2AJ4 A;  4X65 E;  2VQF E;  4YHH I;  4DR4 I;  2DEJ A;  4DV2 E;  1NZ0 A;  4AQY I;  4JI4 E;  2XEX A;  4DV3 I;  5IT9 C;  4HYM A;  4DR3 I;  1ZM3 A;  2UXC I;  4DR7 E;  4B3R I;  2BV3 A;  3V2U C;  4RPF A;  4KQV A;  4JI2 I;  3T1Y I;  5LMN I;  2CZ9 A;  5LL6 R;  1N33 E;  4JYA I;  2V2Q A;  3OTO I;  4UT4 A;  2LJP A;  1PVG A;  2E1R A;  4YY3 I;  4PU9 A;  4HY1 A;  1IBM I;  1MX0 A;  1VIS A;  4DPY A;  4PRV A;  4DV4 I;  3ZZT A;  1PKP A;  1XMO E;  1HNX E;  2VF3 A;  1OJ4 A;  3F0N A;  2HKJ A;  1A6F A;  4JI3 I;  2F4V I;  1U2R A;  1QZR A;  4HXZ A;  4JI1 I;  1J5E I;  2HHH E;  4B3S I;  4M1K A;  3HUL A;  4JI7 I;  4LF7 I;  1D6T A;  4P7A A;  1B62 A;  4JI6 E;  4DV1 E;  5IWA E;  3B82 A;  5A2Q Q;  3ZKD A;  4DV0 I;  4DR6 I;  5GME A;  2ZM6 I;  4B3T I;  1EA6 A;  3QT7 A;  1N32 I;  1XNR E;  3ZM7 A;  2DEI A;  1N0V C;  1HNW E;  4JV5 E;  3LPS A;  4LFC I;  4DU8 A;  4LF9 E;  4JI0 E;  4FN5 A;  2UUB I;  3PYF A;  2V2Z A;  1MU5 A;  4DV5 E;  4DUZ E;  4WUB A;  1N34 I;  2ZBK B;  1H7S A;  3T1H E;  3K1J A;  1Z0C A;  1ZXN A;  4DPW A;  1Z0T A;  1I94 E;  4P52 A;  1H72 C;  5A2Q C;  4DR5 E;  1HR0 E;  4WUC A;  1IBK I;  2A2C A;  1NHH A;  4LF6 I;  3JAM Q;  4USM A;  2X7I A;  2V34 A;  2BM1 A;  2J7K A;  4K0K E;  1WUU A;  1Z0G A;  4LF8 I;  4X65 I;  4FWH A;  4DV2 I;  1XMQ E;  1H7U A;  4NXN I;  4JI4 I;  1ZM9 A;  4WUD A;  1Z0E A;  2UU9 E;  3H4L A;  1N33 I;  5GMD A;  1B63 A;  1Z0B A;  2UUC I;  4DV7 E;  3B78 A;  4DUY E;  1IBL E;  4LFB I;  2UXB E;  5BR8 E;  2UUA E;  1HNZ E;  3WU5 A;  4DR4 E;  3JAM C;  4AQY E;  4DV3 E;  3WU4 A;  4FWD A;  2E5L E;  4NXM I;  1XNQ I;  1FWK A;  4MYT A;  4B3R E;  1ELO A;  1Z5B A;  2HK2 A;  3T1Y E;  5LMN E;  2HHH I;  1S16 A;  4YY3 E;  1ZM2 A;  4USK A;  4JI8 I;  2R3V A;  4DXL A;  1N0U A;  3J81 Q;  4JI6 I;  1KIJ A;  4DV4 E;  4JI5 E;  4X64 I;  4DR2 I;  1H74 A;  5LMU I;  1KVK A;  4UTG A;  1Z0W A;  1HNW I;  1Z0V A;  4LF4 I;  4X66 E;  4JI1 E;  3PYD A;  4LF9 I;  4KHP E;  2A2D A;  1FJG I;  2HFU A;  5L3J A;  2OI2 A;  4DV5 I;  4DUZ I;  4GKK I;  2VQE I;  4EMD A;  4DR6 E;  4LF5 E;  3T1H I;  4ED4 A;  1UEK A;  4DPT A;  4OX9 E;  2WW4 A;  3J81 C;  1I94 I;  3J7A G;  3PYE A;  2ZIT A;  3CWV A;  1N36 I;  1HR0 I;  3LTO A;  1FKA E;  1KTV A;  2UUB E;  4K0K I;  1XHK A;  1FI4 A;  1S4E A;  2UXD E;  2VQF I;  4GKJ E;  2R42 A;  4LFA E;  4DV6 E;  2GS8 A;  3K17 A;  4DR7 I;  4B3M E;  4FW9 A;  1IBK E;  3ZZU A;  4DV7 I;  3WU6 A;  3M6A A;  2X36 A;  4DUY I;  1IBL I;  2UXB I;  5BR8 I;  3ZZ0 A;  4X62 E;  4LF8 E;  1HNZ I;  4JG4 A;  3J80 Q;  2HFS A;  4DR1 E;  1ZM4 A;  2HKE A;  4NXN E;  2V2V A;  4YHH E;  1XMO I;  1HNX I;  1RRE A;  2E5L I;  4DPX A;  4DR3 E;  2HK3 A;  2UXC E;  3QT8 A;  4Z7Y A;  4JI2 E;  2UUC E;  1NHJ A;  5FLX C;  1RR9 A;  4JYA E;  3OTO E;  4HAC A;  4LFB E;  1KKH A;  3LNU A;  4JI5 I;  1IBM E;  1K47 A;  1PIE A;  4DV1 I;  1DAR A;  5IWA I;  1H73 A;  4R1F A;  4NXM E;  1EI1 A;  1XNQ E;  3J80 C;  4FWG A;  3GON A;  2BM0 A;  4X66 I;  1NHI A;  1XNR I;  4MYU A;  4JI3 E;  2F4V E;  4JV5 I;  4KHP I;  1J5E E;  1FNM A;  1MG7 A;  3PYG A;  4B3S E;  4JI0 I;  2Q2E B;  4JI8 E;  4JI7 E;  4LF7 E;  1Z5C A;  3QT6 A;  4LF5 I;  3QT5 A;  3ZKB A;  4X64 E;  4XTJ A;  4DR2 E;  4OX9 I;  4DV0 E;  5LMU E;  2ZM6 E;  4DU7 A;  1Z59 A;  4B3T E;  3V5R A;  2EFG A; 
#chains in the Genus database with same CATH topology
 1IBM I;  4LF4 E;  2YRK A;  1N32 E;  3P76 A;  4BHC A;  4OKG A;  2JOX A;  1LLM C;  2BA1 G;  1EH7 A;  4MDT A;  2LV2 A;  1P42 A;  4LFC E;  4DR5 I;  3ADG A;  2MC5 A;  2V8P A;  1FJG E;  2LMZ A;  3PRY A;  2O1W A;  3J7A M;  3JTZ A;  5CFF E;  2JEA A;  4AM3 A;  3TQM A;  2WNR B;  2EN7 A;  2MKD A;  4IFD E;  3Q1Q A;  5IT9 Q;  3LLH A;  4U3D A;  4GKK E;  2VQE E;  2GO4 A;  2UXD I;  2EOR A;  4ISA A;  4GKJ I;  3B8H A;  4I3H A;  5A6B A;  4ZVI A;  4LFA I;  1N34 E;  3L7Z A;  1BKN A;  2JVA A;  4O24 A;  3H1C A;  5JEA E;  1XMQ I;  1ZXM A;  2EWL A;  2GHF A;  4PRX A;  4DV6 I;  5AE1 A;  5JEA D;  3HKM A;  2ODR D;  4WSG A;  1YPN A;  2GPI A;  2RQL A;  2EP3 A;  4URL A;  3BBG A;  3WU3 A;  3THO B;  3D4J A;  1ZR9 A;  1X3C A;  1XXE A;  4B3M I;  5FLX Q;  3KRN A;  1N36 E;  1Z5A A;  2YTO A;  3GCM A;  1FWL A;  1X6H A;  2EPA A;  2V86 A;  4BA1 A;  2UU9 I;  5A6J A;  4F6M A;  2PNL A;  5AAS A;  1A1H A;  2C37 A;  2EN6 A;  2IES A;  3M85 D;  4LF6 E;  5C0X A;  4IFD B;  4OO1 C;  2RPC A;  2WBT A;  1ZU1 A;  2EN1 A;  4I8O A;  4R2R A;  2BR2 A;  2O3Z A;  4X62 I;  2G7H A;  2EMG A;  2EM5 A;  1IQO A;  1T4O A;  1PDA A;  4Z7C A;  5A69 A;  4HAC B;  2NPF A;  4DPU A;  4DR1 I;  2UUA I;  5JEA B;  3EPK A;  2AJ4 A;  2L92 A;  5LLQ A;  4X65 E;  2VQF E;  2Z5C A;  1X6E A;  4YHH I;  4DR4 I;  3EQ1 A;  5KL4 A;  2RSM A;  3KZZ A;  1AAY A;  2DEJ A;  1USV A;  4DV2 E;  1NZ0 A;  3ECR A;  2EMK A;  2J65 A;  4AQY I;  1TF3 A;  4JI4 E;  2XEX A;  4DV3 I;  5IT9 C;  2N3H A;  2RS7 A;  1E3P A;  1DQ3 A;  3C4T A;  4HYM A;  4DR3 I;  1ZM3 A;  2YRM A;  5T6J A;  2UXC I;  2EPR A;  4DR7 E;  2MKN A;  2YSP A;  1KYQ A;  4B3R I;  2BV3 A;  2YTJ A;  3V2U C;  2EPO A;  2LJH A;  4RPF A;  3AUZ A;  1G2F C;  4KQV A;  4JI2 I;  2FGG A;  3T1Y I;  5LMN I;  1USU A;  2CZ9 A;  3GLL A;  5LL6 R;  1RC7 A;  2KHX A;  1N33 E;  1R6L A;  4JYA I;  2V2Q A;  3OTO I;  2RS6 A;  1A1I A;  2YPN A;  2EMB A;  3JU0 A;  2HGH A;  1Y4U A;  4UT4 A;  2LJP A;  4BA2 A;  1UIL A;  2EM2 A;  1PVG A;  4FW5 A;  4LTY A;  2EMI A;  4OO1 E;  2E1R A;  4LCF A;  2Z5B A;  4YY3 I;  1EKZ A;  5C0X C;  2M4I A;  4PU9 A;  2DMY A;  2LUQ A;  2EM3 A;  1MX0 A;  1VIS A;  4HY1 A;  2IOQ A;  2ENH A;  1RQ0 A;  4PRV A;  2EE8 A;  4DPY A;  3ZZT A;  1PKP A;  4DV4 I;  4IS1 C;  1XMO E;  3NZK A;  4MU1 A;  2AE8 A;  2YSO A;  1HNX E;  2VF3 A;  1WXR A;  3VK6 A;  2EFG A;  3QG5 C;  1ZAA C;  1OJ4 A;  4O43 A;  2EPN A;  3ADL A;  1TF6 A;  3F0N A;  1Y4S A;  4BS9 A;  2HKJ A;  2YT4 A;  2MDG A;  1A6F A;  2JEB A;  5A6B D;  4JI3 I;  2F4V I;  5DNL A;  1U2R A;  1QZR A;  2NAB A;  2NUF A;  2B9D A;  4HXZ A;  2LTR A;  4J8Z A;  2HHH E;  4J3D A;  4JI1 I;  1J5E I;  3HQ1 A;  2DMI A;  4F9C B;  4OO1 B;  4B3S I;  5ADZ A;  4P7D A;  3P3G A;  1UN6 B;  4MLV A;  1ZBT A;  5IV8 B;  4O4K A;  4M1K A;  3HUL A;  2EN4 A;  4JI7 I;  5K36 A;  4LF7 I;  1D6T A;  4P7A A;  3MHH C;  2JEA B;  3AV0 A;  2WBU A;  4LCG A;  3VYY A;  3IWC A;  4JI6 E;  1B62 A;  2PO0 A;  5C0X E;  2M9A A;  4R2P A;  4DV1 E;  5IWA E;  4DMI A;  5C0X D;  3B82 A;  5A2Q Q;  3ZKD A;  4DV0 I;  2K7I A;  4DR6 I;  5GME A;  3U1K A;  2EJ4 A;  2I13 A;  2ZM6 I;  2BA0 D;  3L7Z B;  4B3T I;  1UDQ A;  1WRJ A;  1EA6 A;  2RTX A;  3QT7 A;  1JK2 A;  4MU0 A;  2EMW A;  1N32 I;  2R76 A;  2L8T A;  1XNR E;  3ZM7 A;  2YTE A;  4BMJ A;  2DEI A;  5A6A A;  1N0V C;  1HNW E;  3F6H A;  2F8B A;  4JV5 E;  2JT2 A;  3LPS A;  4LFC I;  4DU8 A;  2EMC A;  5C0X F;  4OO1 A;  3HJC A;  4LF9 E;  2EPM X;  4JI0 E;  1T4L B;  2EZ6 A;  4LPF A;  1UHZ A;  4FN5 A;  3CDI A;  4BA1 B;  2L3J A;  2UUB I;  2EOZ A;  3RMP A;  1T38 A;  2C37 B;  5C0X B;  2DLK A;  4BCA A;  3PYF A;  2JY9 A;  2YTP A;  4DV5 E;  1MU5 A;  4R8O A;  2BA1 D;  2L2K B;  4DUZ E;  2V2Z A;  2BR2 B;  3ADI A;  2KON A;  2EMZ A;  2BBG A;  2EOH A;  3DD6 A;  4WUB A;  1N34 I;  1YYO A;  2ZBK B;  4P78 A;  4IFD D;  2EM9 A;  5ELW A;  5K36 C;  3B4T A;  2CT1 A;  2VES A;  1H7S A;  1OYS A;  4BBY A;  3T1H E;  2Z5C B;  2EMY A;  3K1J A;  1Z0C A;  4WSP A;  2VRD A;  1ZXN A;  4GZN C;  2EMF A;  4R2Q A;  4U3B A;  2EPK X;  4DPW A;  1Z0T A;  1X48 A;  1I94 E;  1Z1B A;  1Y5Y A;  4P52 A;  4IFD F;  2EQ1 A;  1H72 C;  3HXL A;  5A2Q C;  4TUG A;  2PNZ A;  4DR5 E;  3M99 B;  1HR0 E;  4WUC A;  2I9I A;  1IBK I;  2A2C A;  1NHH A;  4LF6 I;  3P3E A;  3JAM Q;  2IHR 1;  5TSE A;  1YSA C;  2CG9 A;  2N8X A;  3EPH A;  1E3H A;  4USM A;  2IOP A;  4M2Z A;  2X7I A;  2V34 A;  2B7T A;  4X8W A;  1A1G A;  5JEA F;  2PRT A;  2BM1 A;  2J7K A;  2EM8 A;  3KWR A;  4WFT A;  3C6K A;  4BA2 B;  2V8Q B;  4K0K E;  1WUU A;  1Z0G A;  1PJT A;  4BC9 A;  4TUI A;  2LTS A;  3OML A;  4X65 I;  4Q35 B;  1JK1 A;  4LF8 I;  4QNK A;  3ZOQ B;  2Z5B B;  3C6M A;  5A6K A;  4FWH A;  1N3G A;  4DV2 I;  2YTD A;  2V85 A;  1XMQ E;  1H7U A;  4NXN I;  4WPY A;  4JI4 I;  5K36 E;  3M85 G;  3F6G A;  1J26 A;  3P1X A;  1ZM9 A;  5K36 D;  4WUD A;  2JE6 A;  1F2I G;  1STU A;  3H09 A;  3MSW A;  3KZY A;  4FW6 A;  3BGH A;  2NUG A;  2O1T A;  2HC5 A;  2YTF A;  2L6M A;  1Z0E A;  2EQ3 A;  4WXD A;  2UU9 E;  3H4L A;  4FW3 A;  2NN6 C;  3P3C A;  1N33 I;  5GMD A;  2L2N A;  1QU6 A;  1B63 A;  2JEB B;  2EM4 A;  1Y6Z A;  2FV4 B;  1IQS A;  4ZYG A;  2CVE A;  5K36 F;  4F54 A;  1A1L A;  1Z0B A;  2WP8 A;  4AID A;  2UUC I;  5DNX A;  5EKW A;  4DV7 E;  2EOY A;  2BB8 A;  4DUY E;  1IBL E;  4RHB B;  2UXB E;  3B78 A;  5BR8 E;  4LFB I;  3C4B A;  2UUA E;  4F9A B;  3M7N D;  2L3C A;  1HNZ E;  3K6Q A;  3WU5 A;  2L33 A;  4DR4 E;  5K36 B;  3JAM C;  4M30 A;  2LCE A;  4OO1 D;  4IZJ A;  1RMD A;  4R2A A;  4AQY E;  4LOM A;  3EPL A;  2V88 A;  4DV3 E;  2PO0 B;  5DRO A;  2E72 A;  3WU4 A;  4FK5 C;  2E5L E;  4M9V C;  4FWD A;  4NXM I;  2HJJ A;  1XNQ I;  1FWK A;  3VHT B;  4B3R E;  4MYT A;  4GQU A;  2ADR A;  4FW7 A;  1ELO A;  4OZE A;  1EH8 A;  2GO3 A;  1TN9 A;  1Z5B A;  2HK2 A;  3T1Y E;  4R2C A;  2PO1 A;  5LMN E;  4IJD A;  4OO1 F;  5FWK A;  2DIX A;  4IS9 A;  2HHH I;  3L00 A;  2EOE A;  4IZK A;  2NN6 E;  1DI2 A;  5EL9 A;  1DGC A;  2JP9 A;  4LF5 I;  2WBS A;  2EOO A;  1S16 A;  4YY3 E;  1X5W A;  1ZM2 A;  4USK A;  3DF6 A;  2R3V A;  2LT7 A;  4JI8 I;  4DXL A;  4ZYD A;  1N0U A;  3J81 Q;  4JI6 I;  2EOS A;  4DV4 E;  1KIJ A;  4MU4 A;  3J7Y p;  4JI5 E;  1VI7 A;  2JPA A;  4F6N A;  1MEY C;  2LRS A;  3CDJ A;  2NUE A;  1SR9 A;  1GQE A;  3IWD A;  4X64 I;  4DR2 I;  4OOG C;  1MGT A;  1H74 A;  4L8N A;  2LO3 A;  5DRR A;  1YH8 A;  3EPJ A;  1BBO A;  5LMU I;  1KVK A;  4UTG A;  5AC5 A;  4GEQ B;  2DSY A;  1Z0W A;  1HNW I;  2EPP A;  4O5G A;  2EN8 A;  1T4N A;  4RH8 A;  1Z0V A;  2NN6 B;  4X66 E;  4LF4 I;  4JI1 E;  4WYQ B;  1OYP A;  1L4S A;  3PYD A;  4NZV A;  1AH5 A;  4LF9 I;  1Y60 A;  2EMX A;  1YYK A;  1T39 A;  4KHP E;  4LCH A;  2PNZ B;  1NEI A;  2A2D A;  1FJG I;  2HFU A;  5L3J A;  3HPS A;  2BA0 G;  2J7J A;  2C39 A;  2OI2 A;  4DV5 I;  4R2D A;  4NBQ A;  4DUZ I;  1PJS A;  4GKK I;  2VQE I;  2PO2 A;  2N3G A;  2EMH A;  3Q6N A;  2WCC 3;  4FW4 A;  4EMD A;  2EOJ A;  4DR6 E;  4LF5 E;  2YRH A;  3U1Y A;  3T1H I;  4ED4 A;  1UEK A;  3HTX A;  3K85 A;  1WHQ A;  4KWY A;  4DPT A;  4OX9 E;  5KL6 A;  2WW4 A;  3J81 C;  2Z5E A;  1UBD C;  2YU8 A;  1I94 I;  1EH6 A;  2NN6 A;  3J7A G;  1IMU A;  2MC6 A;  3PYE A;  4IZJ D;  2ZIT A;  2JE6 B;  3CWV A;  1N36 I;  1HR0 I;  2H36 X;  2YU5 A;  2C38 A;  1GZ6 A;  3LTO A;  3PS3 A;  2EMA A;  5KL2 A;  2JWO A;  2LBS B;  2DLQ A;  4LU9 A;  1FKA E;  2M1S A;  1KTV A;  4NHR A;  2UUB E;  1GTK A;  1WHN A;  2R1F A;  1YYW A;  2CSH A;  1YFH A;  1O0W A;  4F9B B;  2EOM A;  1XHK A;  3HPZ A;  4K0K I;  2CGE A;  2WP8 B;  2GQ0 A;  1FI4 A;  2EPX A;  4HEI A;  4BC7 A;  1YUJ A;  2FTX B;  2ENA A;  1S4E A;  3Q6M A;  1A1K A;  1UDS A;  2UXD E;  4GKJ E;  2VQF I;  4MQY A;  2R42 A;  1X47 A;  2LUP B;  4LFA E;  2JOB A;  4DKK A;  2LJU A;  2EOX A;  4IZJ B;  2ENC A;  2EPC A;  4DV6 E;  1YZ9 A;  4N4R B;  2GS8 A;  3K17 A;  2LVH A;  3FIG A;  2ELZ A;  1B69 A;  2V87 A;  1NCS A;  4DR7 I;  4B3M E;  4FW9 A;  3GME A;  1IBK E;  2YTI A;  3ZZU A;  1YUI A;  2WZO A;  2PO1 B;  4R2E A;  5KL5 A;  2WNR A;  2IER A;  2EL5 A;  4DV7 I;  3WU6 A;  3M6A A;  2X36 A;  4DUY I;  1IBL I;  2UXB I;  5BR8 I;  2M7Q A;  4IZK B;  2A25 A;  4R2S A;  4X62 E;  3ZZ0 A;  1X49 A;  5AE3 A;  2EOF A;  4LF8 E;  1HNZ I;  4JG4 A;  2DRP A;  3J80 Q;  2YTG A;  1ZBQ A;  4DR1 E;  2HFS A;  1ZM4 A;  2HKE A;  4M0V A;  4NXN E;  2V2V A;  2VF1 A;  4YHH E;  2K4V A;  5DRQ A;  3ADJ A;  1XMO I;  5F3W A;  2EM7 A;  1HNX I;  1RRE A;  2E5L I;  2EOI A;  2F1D A;  2V83 A;  4DPX A;  3P06 A;  2EPZ A;  1UDO A;  4DR3 E;  1RHY A;  2CTD A;  2UXC E;  1P47 A;  2HK3 A;  1G2D C;  2MDR A;  5AC4 A;  3M7N G;  3QT8 A;  4IFD A;  4ZYH A;  4JI2 E;  4Z7Y A;  2B7V A;  4Q28 A;  1YHC A;  2YTN A;  2UUC E;  4WXC A;  5FLX C;  2EM6 A;  4HTG A;  1NHJ A;  4JYA E;  1RR9 A;  3OTO E;  1QNT A;  4HAC A;  4LFB E;  4BHB A;  5JEA A;  3DJW A;  2NN6 D;  1KJK A;  1KKH A;  3LNU A;  2D9H A;  2LE2 A;  4MU3 A;  2ELY A;  4JI5 I;  2C39 B;  2Q8U A;  4X9J A;  1IBM E;  2EML A;  1K47 A;  2JXP A;  5KL3 A;  1PIE A;  4ZYE A;  1OYR A;  4DV1 I;  1UDN A;  2DGC A;  1DAR A;  1H73 A;  5IWA I;  2PO2 B;  2EPL X;  4KZS A;  4R1F A;  1R6M A;  2JR1 A;  4NXM E;  2RSI A;  5AE2 A;  1A1F A;  2NN6 F;  1XNQ E;  1EI1 A;  3J80 C;  3PS1 A;  4N3O A;  4FWG A;  3BF2 A;  3GON A;  4AIM A;  2NA2 A;  2BM0 A;  4X66 I;  2EM0 A;  3BID A;  1NHI A;  2L2M A;  1XNR I;  3MHS C;  4MYU A;  1BBG A;  4JI3 E;  1HK7 A;  2F4V E;  3UHM A;  2E1M A;  3VYX A;  4JV5 I;  4KHP I;  2KOU A;  5DRP A;  2B3T B;  2EOQ A;  1J5E E;  2EN2 A;  1SFE A;  1FNM A;  1MG7 A;  3PYG A;  4B3S E;  4WX9 A;  2C38 B;  4JI0 I;  4IFD C;  1BB8 A;  1X6F A;  5IXM B;  2PNM A;  2VE7 C;  3THN A;  2Q2E B;  4QNJ A;  2EL4 A;  2DB2 A;  3IWB A;  4L5N C;  2EQ0 A;  4R03 A;  4JI8 E;  4JI7 E;  2V89 A;  2YTQ A;  4LF7 E;  2JYA A;  2EL6 A;  1Z5C A;  2EPU A;  2O1U A;  3UK3 C;  3LML A;  2GLI A;  3QT6 A;  5JEA C;  2YZT A;  5DNY A;  2ODR C;  2CPN A;  2YWQ A;  1WJP A;  5KL7 A;  4X64 E;  4DR2 E;  3PS2 A;  3QT5 A;  4XTJ A;  3ZKB A;  4F2J C;  1PJQ A;  4OX9 I;  2O1V A;  1A1J A;  4DV0 E;  5LMU E;  2ZM6 E;  4DU7 A;  1Z59 A;  4B3T E;  4MLQ A;  3V5R A;  2EN3 A; 
#chains in the Genus database with same CATH homology
 4LF4 E;  1N32 E;  2JOX A;  4LFC E;  4DR5 I;  3ADG A;  2MC5 A;  2V8P A;  1FJG E;  2LMZ A;  3PRY A;  2O1W A;  3J7A M;  3JTZ A;  5CFF E;  3Q1Q A;  5IT9 Q;  3LLH A;  4GKK E;  2VQE E;  2UXD I;  4GKJ I;  3B8H A;  4I3H A;  4LFA I;  4ZVI A;  1N34 E;  1BKN A;  2JVA A;  1XMQ I;  1ZXM A;  2EWL A;  4PRX A;  4DV6 I;  5AE1 A;  2ODR D;  4URL A;  3WU3 A;  3D4J A;  4B3M I;  5FLX Q;  1N36 E;  1Z5A A;  1FWL A;  2V86 A;  2UU9 I;  2PNL A;  5AAS A;  4LF6 E;  4X62 I;  4I8O A;  2G7H A;  1T4O A;  4Z7C A;  4HAC B;  2NPF A;  4DPU A;  4DR1 I;  2UUA I;  2AJ4 A;  2L92 A;  4X65 E;  2VQF E;  2Z5C A;  4YHH I;  4DR4 I;  2RSM A;  2DEJ A;  1USV A;  4DV2 E;  1NZ0 A;  4AQY I;  4JI4 E;  2XEX A;  4DV3 I;  5IT9 C;  2N3H A;  2RS7 A;  1DQ3 A;  3C4T A;  4HYM A;  4DR3 I;  1ZM3 A;  5T6J A;  2UXC I;  4DR7 E;  4B3R I;  2BV3 A;  3V2U C;  2LJH A;  4RPF A;  3AUZ A;  4KQV A;  4JI2 I;  2FGG A;  3T1Y I;  5LMN I;  1USU A;  2CZ9 A;  5LL6 R;  1RC7 A;  2KHX A;  1N33 E;  4JYA I;  2V2Q A;  3OTO I;  2RS6 A;  3JU0 A;  1Y4U A;  4UT4 A;  2LJP A;  1UIL A;  1PVG A;  4LTY A;  2E1R A;  2Z5B A;  4YY3 I;  1EKZ A;  2M4I A;  4PU9 A;  2DMY A;  2LUQ A;  4HY1 A;  1MX0 A;  1VIS A;  4DPY A;  2IOQ A;  1IBM I;  1RQ0 A;  4PRV A;  4DV4 I;  3ZZT A;  1PKP A;  1XMO E;  1HNX E;  2VF3 A;  1WXR A;  3VK6 A;  1OJ4 A;  3ADL A;  3F0N A;  1Y4S A;  4BS9 A;  2HKJ A;  2YT4 A;  1A6F A;  4JI3 I;  2F4V I;  1U2R A;  1QZR A;  2NUF A;  2B9D A;  4HXZ A;  2LTR A;  4J8Z A;  2HHH E;  4JI1 I;  1J5E I;  3HQ1 A;  4F9C B;  4B3S I;  5ADZ A;  4P7D A;  1ZBT A;  4M1K A;  3HUL A;  4JI7 I;  4LF7 I;  1D6T A;  4P7A A;  3AV0 A;  3VYY A;  3IWC A;  4JI6 E;  1B62 A;  4DV1 E;  5IWA E;  4DMI A;  3B82 A;  5A2Q Q;  3ZKD A;  4DV0 I;  4DR6 I;  5GME A;  2ZM6 I;  4B3T I;  1EA6 A;  2RTX A;  3QT7 A;  1N32 I;  1XNR E;  2L8T A;  3ZM7 A;  2DEI A;  4BMJ A;  1N0V C;  1HNW E;  3F6H A;  2F8B A;  4JV5 E;  3LPS A;  4LFC I;  4DU8 A;  3HJC A;  4LF9 E;  4JI0 E;  1T4L B;  2EZ6 A;  1UHZ A;  4FN5 A;  2L3J A;  2UUB I;  3RMP A;  4BCA A;  3PYF A;  2JY9 A;  4DV5 E;  1MU5 A;  2V2Z A;  4R8O A;  2L2K B;  4DUZ E;  3ADI A;  2KON A;  4WUB A;  1N34 I;  1YYO A;  2ZBK B;  4P78 A;  1H7S A;  4BBY A;  3T1H E;  2Z5C B;  3K1J A;  1Z0C A;  4WSP A;  1ZXN A;  4DPW A;  1Z0T A;  1X48 A;  1I94 E;  4P52 A;  1H72 C;  3HXL A;  5A2Q C;  4TUG A;  4DR5 E;  1HR0 E;  4WUC A;  1IBK I;  2A2C A;  1NHH A;  4LF6 I;  3JAM Q;  2IHR 1;  2CG9 A;  4USM A;  2IOP A;  4M2Z A;  2X7I A;  2V34 A;  2B7T A;  4X8W A;  2BM1 A;  2J7K A;  3KWR A;  4WFT A;  2V8Q B;  4K0K E;  1WUU A;  1Z0G A;  4TUI A;  4BC9 A;  2LTS A;  3OML A;  4X65 I;  4LF8 I;  3ZOQ B;  2Z5B B;  4FWH A;  4DV2 I;  1XMQ E;  2V85 A;  1H7U A;  4NXN I;  4WPY A;  4JI4 I;  3F6G A;  1J26 A;  3P1X A;  1ZM9 A;  4WUD A;  1STU A;  3H09 A;  3MSW A;  2NUG A;  2O1T A;  2L6M A;  1Z0E A;  2UU9 E;  3H4L A;  1N33 I;  5GMD A;  2L2N A;  1QU6 A;  1B63 A;  1Y6Z A;  2FV4 B;  4F54 A;  1Z0B A;  2UUC I;  4DV7 E;  4DUY E;  1IBL E;  3B78 A;  4LFB I;  2UXB E;  5BR8 E;  3C4B A;  2UUA E;  4F9A B;  2L3C A;  1HNZ E;  3K6Q A;  3WU5 A;  2L33 A;  4DR4 E;  3JAM C;  4M30 A;  4IZJ A;  4AQY E;  2V88 A;  4DV3 E;  3WU4 A;  4FWD A;  2E5L E;  4NXM I;  1XNQ I;  1FWK A;  4B3R E;  4MYT A;  1ELO A;  1Z5B A;  2HK2 A;  3T1Y E;  5LMN E;  5FWK A;  2DIX A;  2HHH I;  4IZK A;  1DI2 A;  1S16 A;  4YY3 E;  1ZM2 A;  4USK A;  3DF6 A;  2R3V A;  4JI8 I;  4DXL A;  1N0U A;  3J81 Q;  4JI6 I;  4DV4 E;  1KIJ A;  3J7Y p;  4JI5 E;  2LRS A;  2NUE A;  1SR9 A;  1GQE A;  3IWD A;  4X64 I;  4DR2 I;  4OOG C;  1H74 A;  4L8N A;  5LMU I;  1KVK A;  4UTG A;  4GEQ B;  2DSY A;  1Z0W A;  1HNW I;  1Z0V A;  1T4N A;  4LF4 I;  4X66 E;  4JI1 E;  4WYQ B;  3PYD A;  4LF9 I;  1YYK A;  4KHP E;  2A2D A;  1FJG I;  2HFU A;  5L3J A;  3HPS A;  2OI2 A;  4DV5 I;  4DUZ I;  4GKK I;  2VQE I;  2N3G A;  3Q6N A;  4EMD A;  4DR6 E;  4LF5 E;  3T1H I;  4ED4 A;  1UEK A;  3HTX A;  3K85 A;  1WHQ A;  4DPT A;  4OX9 E;  2WW4 A;  3J81 C;  2Z5E A;  1I94 I;  3J7A G;  2MC6 A;  3PYE A;  4IZJ D;  2ZIT A;  3CWV A;  1N36 I;  1HR0 I;  2H36 X;  1GZ6 A;  3LTO A;  2JWO A;  2LBS B;  4LU9 A;  1FKA E;  2M1S A;  1KTV A;  2UUB E;  1WHN A;  1YYW A;  1O0W A;  4F9B B;  4K0K I;  1XHK A;  3HPZ A;  2CGE A;  2GQ0 A;  1FI4 A;  4BC7 A;  1S4E A;  2FTX B;  3Q6M A;  2UXD E;  4GKJ E;  2VQF I;  2R42 A;  4LFA E;  2LUP B;  1X47 A;  2JOB A;  4DKK A;  4IZJ B;  4DV6 E;  1YZ9 A;  2GS8 A;  3K17 A;  3FIG A;  2V87 A;  4DR7 I;  4B3M E;  4FW9 A;  1IBK E;  3ZZU A;  2WZO A;  4DV7 I;  3WU6 A;  3M6A A;  2X36 A;  4DUY I;  1IBL I;  2UXB I;  5BR8 I;  2M7Q A;  4IZK B;  4X62 E;  3ZZ0 A;  1X49 A;  5AE3 A;  4LF8 E;  1HNZ I;  4JG4 A;  3J80 Q;  1ZBQ A;  4DR1 E;  2HFS A;  1ZM4 A;  2HKE A;  4M0V A;  4NXN E;  2V2V A;  2VF1 A;  4YHH E;  2K4V A;  3ADJ A;  1XMO I;  5F3W A;  1HNX I;  1RRE A;  2E5L I;  2V83 A;  4DPX A;  3P06 A;  4DR3 E;  2UXC E;  2HK3 A;  2MDR A;  3QT8 A;  4JI2 E;  4Z7Y A;  2B7V A;  4Q28 A;  2UUC E;  5FLX C;  1NHJ A;  4JYA E;  1RR9 A;  3OTO E;  4HAC A;  4LFB E;  3DJW A;  1KKH A;  3LNU A;  2LE2 A;  4JI5 I;  1IBM E;  1K47 A;  1PIE A;  4DV1 I;  1DAR A;  5IWA I;  1H73 A;  4KZS A;  4R1F A;  2JR1 A;  4NXM E;  5AE2 A;  1XNQ E;  1EI1 A;  3J80 C;  4N3O A;  4FWG A;  3GON A;  2NA2 A;  2BM0 A;  4X66 I;  1NHI A;  1XNR I;  2L2M A;  4MYU A;  4JI3 E;  1HK7 A;  2F4V E;  2E1M A;  3VYX A;  4JV5 I;  4KHP I;  2KOU A;  2B3T B;  1J5E E;  1FNM A;  1MG7 A;  3PYG A;  4B3S E;  4JI0 I;  2PNM A;  2VE7 C;  2Q2E B;  3IWB A;  2DB2 A;  4R03 A;  4L5N C;  4JI8 E;  4JI7 E;  2V89 A;  4LF7 E;  1Z5C A;  2O1U A;  3LML A;  3QT6 A;  2YZT A;  5DNY A;  2ODR C;  2CPN A;  4X64 E;  3QT5 A;  4DR2 E;  4XTJ A;  3ZKB A;  4LF5 I;  4OX9 I;  2O1V A;  4DV0 E;  5LMU E;  2ZM6 E;  4DU7 A;  1Z59 A;  4B3T E;  3V5R A;  2EFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...