5IT9C

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
b'GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5it9C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9C02
1XMQE 3QT8A 4LFAI 3J80Q 3CWVA 2UXCE 4JI0E 4DR6I 1HR0E 1Z0WA 4DV5E 5LMNE 1N33E 4B3SI 1UEKA 3OTOE 3J80C 1MG7A 2HFSA 1QZRA 1J5EI 4NXNE 2UXDI 3LPSA 2J7KA 4FWHA 4LF7E 3PYGA 5LL6R 1XHKA 3Q1QA 3K1JA 4GKKI 3B82A 1Z5AA 4B3TE 2EFGA 1PIEA 4DPYA 1Z0TA 4LF5I 1IBMI 3B78A 5BR8E 4MYUA 2X36A 2UXCI 4M1KA 1H72C 1HR0I 2BV3A 5LMNI 1K47A 4YHHE 1IBLE 1HNXE 4NXMI 1MX0A 1NHJA 2V2QA 4AQYE 2HKJA 1ZM3A 4P7AA 4HACB 3M6AA 4DUZE 4NXNI 2UUAE 2E5LI 2HKEA 2DEJA 3J7AG 2AJ4A 2F4VE 1ZM4A 4LFBI 4JI2E 1EI1A 1S4EA 3J81Q 2VQEE 1Z5BA 1HNWI 1PVGA 4UTGA 4DR6E 4DR5E 3J81C 3D4JA 2HK3A 1XNQI 1HNZI 1Z0EA 1RREA 1N0UA 1J5EE 4JI6E 4JYAE 3LNUA 4HXZA 4JI4I 1KVKA 4GKJI 1EA6A 4JI5I 2BM0A 1FKAE 4B3MI 2A2CA 3ZKBA 4JI1E 1KTVA 4WUCA 2GS8A 4YY3I 1BKNA 5GMEA 4DV6I 4JG4A 4LF5E 1H7UA 4DPXA 3LTOA 1RR9A 4X62I 4EMDA 1PKPA 4UT4A 4DR5I 1WUUA 4HYMA 4K0KI 4NXME 4DV3E 4JI7I 1Z0BA 4LF4I 4DPWA 2Q2EB 3QT7A 4JI6I 4XTJA 4JYAI 2E5LE 1FWKA 4JI1I 4JI8I 4LFBE 2V2VA 1I94E 1N32I 2V8PA 3J7AM 3V2UC 4DV2E 4DR2E 1HNWE 4X66I 4Z7YA 4JI3E 4B3RI 4DV1I 1XNQE 1ZM2A 1N34E 1HNZE 2NPFA 3QT6A 1Z59A 4DV3I 4DV0E 4JI4E 4JI5E 4LF6I 4B3ME 5A2QQ 4DPTA 2UXBE 4MYTA 4RPFA 3HULA 4KHPI 4YY3E 1Z0GA 4DV6E 5A2QC 1I94I 1NZ0A 4DV2I 3ZZTA 2UUCI 4PRVA 2UUBE 4DR2I 4X62E 1IBKI 2V2ZA 4JI3I 1H7SA 4K0KE 1N34I 4JI7E 4DPUA 5FLXQ 4LF4E 2CZ9A 4DV0I 2UU9E 4X64I 5FLXC 2UXBI 3T1YE 4JI8E 1Z0CA 3WU3A 4FW9A 1N32E 5LMUI 2VF3A 1XNRE 1H74A 4OX9E 1N36I 4X65I 4X66E 4LF8I 4HY1A 4FWDA 2V34A 2UUBI 2VQFI 1FJGI 1ZXMA 4B3RE 4DR4I 4DV1E 1NHIA 4DR1E 2HHHI 3B8HA 1B63A 3F0NA 5GMDA 4FN5A 3T1HI 4LF6E 5IWAI 1Z0VA 2UU9I 2WW4A 4KHPE 1ELOA 4KQVA 1H73A 3T1YI 4DU7A 1N0VC 1XMOI 2HK2A 1XNRI 4USMA 2UUCE 4OX9I 1MU5A 1A6FA 4ZVIA 3WU5A 4P52A 3ZM7A 1IBKE 3ZZUA 2R3VA 4DR7E 4DR1I 1FNMA 2E1RA 4DU8A 2A2DA 1ZM9A 1KIJA 1NHHA 4USKA 1DARA 4DR3I 4PU9A 2ZM6I 4X64E 4Z7CA 4JV5I 2R42A 2LJPA 1XMQI 2BM1A 5IT9Q 3ZKDA 4DV4E 4DV7E 4LF9E 4HACA 4JI0I 5LMUE 1U2RA 4DV5I 4LFCE 2DEIA 1N33I 2HFUA 5IT9C 1N36E 4X65E 3OTOI 4LF8E 2VQFE 1FJGE 4DR4E 2X7IA 5L3JA 4ED4A 2HHHE 1FWLA 4DUYE 2OI2A 4LF7I 3WU6A 3QT5A 4DR7I 3PYDA 3PYFA 3PYEA 4FWGA 3T1HE 3H4LA 4B3TI 4GKJE 5IWAE 3WU4A 4LFAE 1OJ4A 5BR8I 4URLA 4I3HA 4DV4I 4B3SE 4DV7I 4LF9I 3JAMQ 1XMOE 4DXLA 3GONA 1VISA 4LFCI 4WUBA 4YHHI 1IBLI 1HNXI 4AQYI 1B62A 3V5RA 2UXDE 3JAMC 4WUDA 2XEXA 2ZBKB 4DUZI 4R1FA 2UUAI 1KKHA 1FI4A 1ZXNA 4GKKE 1Z5CA 3K17A 1D6TA 4DUYI 4DR3E 2ZITA 3ZZ0A 2ZM6E 4PRXA 2F4VI 1S16A 4JI2I 4JV5E 1IBME 2VQEI
chains in the Genus database with same CATH superfamily
1XMQE 2YRKA 2GLIA 3MHSC 3QT8A 5AC5A 1HK7A 4LFAI 2YZTA 4R2QA 3J80Q 3CWVA 2WCC3 4GZNC 3IWDA 4JI0E 2UXCE 4DR6I 2EP3A 1HR0E 1Z0WA 4DV5E 3HQ1A 5K36E 5LMNE 2EOSA 1N33E 4B3SI 2YTQA 1UEKA 2EM7A 2LTRA 2IOQA 4R2EA 2NUEA 3L7ZA 3OTOE 3J80C 1MG7A 2HFSA 4R03A 1QZRA 4LPFA 5AASA 2EOHA 2V87A 2FV4B 1J5EI 4NXNE 2KHXA 1GTKA 4IJDA 1SFEA 2CVEA 2LUQA 2PNZA 2UXDI 5AE1A 2BR2B 3LPSA 2J7KA 4FWHA 2C37B 4LF7E 3PYGA 3IWCA 2EL5A 5LL6R 4R2RA 5KL2A 1XHKA 3Q1QA 4IS9A 2RPCA 3K1JA 2JPAA 2YTDA 1T38A 3B82A 4GKKI 4ZYGA 1Z5AA 1R6LA 4IS1C 4B3TE 4OO1F 2EFGA 4FW4A 1WXRA 5A69A 2YRMA 1X6HA 3KZYA 1YZ9A 1PIEA 4IZJD 5C0XF 4O5GA 2I9IA 1Z0TA 4DPYA 4LF5I 2YTGA 5DNXA 1IBMI 3B78A 2L2NA 3M85G 2EOIA 5BR8E 4MLVA 1YFHA 4IZKA 4MYUA 4BHBA 3F6HA 4IZJB 4DKKA 1ZAAC 4QNJA 2L3CA 2VE7C 2X36A 2YSPA 4NHRA 2EJ4A 2UXCI 4M1KA 3HPSA 2L3JA 2PO0A 2VRDA 4L8NA 1H72C 1HR0I 4O4KA 2BV3A 2LT7A 5LMNI 1K47A 4YHHE 1IBLE 5DNYA 1HNXE 4NXMI 1YUJA 2EN1A 1MX0A 1NHJA 5K36F 4I8OA 4AQYE 2V2QA 2CPNA 2HKJA 2MC6A 1ZM3A 4P7AA 2EMZA 2EOXA 2DB2A 5KL5A 4HACB 3M6AA 4DUZE 4LCFA 4NXNI 4OO1B 2UUAE 4X62I 2E5LI 4BMJA 1YPNA 2K7IA 2EM0A 2L2KB 2F8BA 2J7JA 1A1JA 4M2ZA 5C0XB 2HKEA 3GLLA 1IQOA 4MDTA 3HXLA 3H09A 2DMYA 2DEJA 2NABA 3J7AG 5KL3A 2EPXA 4F2JC 2AJ4A 3P3GA 2F4VE 2NN6A 1ZM4A 4LFBI 4JI2E 5IV8B 1EI1A 1A1FA 1S4EA 3J81Q 2VQEE 3QG5C 3ECRA 1NCSA 1A1HA 3M85D 2LMZA 2BA1D 2NN6D 2DSYA 3HTXA 1Z5BA 4AIMA 2Z5EA 4OOGC 4BC7A 1HNWI 2EPCA 3HPZA 2B7VA 4DR6E 1PVGA 4UTGA 3U1KA 3B4TA 1UILA 5K36B 2RTXA 4WSGA 2EN8A 2EMGA 4DR5E 3J81C 1B69A 2LJUA 1UDQA 4OO1C 2N8XA 1JK2A 2ENCA 2EMLA 4FW6A 3D4JA 4GQUA 2HK3A 1XNQI 5C0XC 3KZZA 1HNZI 1NEIA 2PNLA 1Z0EA 1WRJA 1J5EE 1N0UA 1RREA 4JI6E 2Z5BB 4JYAE 3LNUA 2V8QB 4HXZA 2B7TA 4MQYA 4JI4I 2RS6A 1KVKA 4GKJI 3MSWA 5KL7A 2G7HA 1EA6A 4JI5I 5IXMB 2BM0A 1FKAE 5A6BD 4B3MI 2NUGA 2BB8A 3AUZA 2EOFA 3VK6A 1YSAC 2JT2A 1USVA 1L4SA 5F3WA 2MKNA 2A2CA 4JI1E 3ZKBA 1KTVA 4WUCA 5KL6A 3JTZA 3RMPA 1EKZA 3LMLA 2C38B 1WHNA 3C4TA 1E3HA 2GS8A 2JY9A 3P3CA 4YY3I 2YU8A 1J26A 2EOEA 1BKNA 2Z5CB 3P76A 2CSHA 2EM8A 2RSIA 2C39B 5GMEA 5CFFE 1LLMC 4DV6I 2EPZA 4JG4A 4F6NA 1AH5A 4LF5E 4BA2B 2KOUA 3CDIA 3PRYA 1H7UA 4ISAA 4DPXA 3LTOA 3VYXA 5DRQA 2L2MA 2LO3A 1RR9A 3PS1A 1JK1A 2EOZA 4F9CB 2EMAA 4EMDA 1PKPA 2JEBA 1ZBQA 2M1SA 5JEAA 3BBGA 4AIDA 4UT4A 4DR5I 1A1GA 2EQ3A 4LTYA 1WHQA 2HC5A 2L6MA 2EOYA 1WUUA 4HYMA 4LOMA 4K0KI 2EMYA 2LCEA 4F54A 2EN4A 4NXME 2EM9A 4DV3E 4F9BB 2NN6E 2CTDA 5JEAD 2WZOA 4JI7I 2M7QA 4F9AB 1Z0BA 3OMLA 2LV2A 4LF4I 2WBTA 4DPWA 3U1YA 4N4RB 1STUA 2Q2EB 3QT7A 1X47A 1EH6A 4JI6I 4XTJA 4JYAI 1SR9A 3C6KA 2E5LE 2ENHA 2WBSA 2JE6B 1FWKA 1ZBTA 2LE2A 2EORA 2E72A 1N3GA 2GO3A 2EPRA 3L7ZB 4NBQA 4WXCA 1Y4UA 4JI1I 4FW3A 4JI8I 4LFBE 2V2VA 4MU1A 4BS9A 1I94E 1N32I 4WPYA 2DLQA 2V8PA 4ZYHA 4O24A 2ODRD 3J7AM 4DV2E 3V2UC 2FGGA 1YYWA 3BIDA 2PNZB 2GQ0A 5DROA 4DR2E 2LRSA 1F2IG 1G2DC 1HNWE 1USUA 4AM3A 2EM3A 4DMIA 4WFTA 1O0WA 4X66I 2BA1G 2I13A 2YT4A 4Z7YA 1EH8A 4JI3E 3EPLA 1X5WA 3H1CA 4FK5C 4B3RI 4FW5A 2O1WA 1QNTA 4DV1I 2LBSB 1XNQE 1ZM2A 3FIGA 1N34E 1A1KA 1BB8A 2JOBA 2YTEA 2A25A 4GEQB 2MDGA 1HNZE 3PS3A 2NPFA 2ELZA 5A6AA 1A1LA 3QT6A 2R1FA 1Z59A 4DV3I 4J8ZA 4DV0E 4R8OA 4IZKB 4JI4E 2NN6F 3DD6A 3THNA 2KONA 4JI5E 2IOPA 4LF6I 4BCAA 4B3ME 5A2QQ 2PO0B 2UXBE 4DPTA 1YHCA 1VI7A 3IWBA 4MYTA 4RPFA 3HULA 3Q6MA 4KHPI 2MDRA 2EMKA 1Y6ZA 2L92A 1X3CA 2L8TA 2EQ1A 2EPNA 2HJJA 4YY3E 3P1XA 1Z0GA 2O3ZA 2PO2A 4DV6E 5A2QC 1I94I 1NZ0A 1XXEA 4WXDA 5T6JA 2PO1A 5ELWA 2EM2A 3ZZTA 4DV2I 2UUCI 4PRVA 2ELYA 2UUBE 5DRRA 4DR2I 2DLKA 2NUFA 1DI2A 3AV0A 4N3OA 4X62E 4U3BA 1TF3A 2IHR1 4BA1A 2O1TA 2NN6B 1IBKI 2V2ZA 3PS2A 2RSMA 4JI3I 1H7SA 4O43A 4K0KE 2LUPB 4IFDA 3EPKA 4U3DA 2V85A 3GMEA 2DGCA 1G2FC 2EMHA 4JI7E 5KL4A 3EPJA 1T39A 4DPUA 1N34I 1PDAA 5FLXQ 2WP8A 1ZU1A 1RMDA 2EPLX 4LF4E 4IFDD 2GO4A 1P47A 2CZ9A 5AC4A 4FW7A 4DV0I 2UU9E 4X64I 1RHYA 2MC5A 4P7DA 2YTIA 3HKMA 2ADRA 2CT1A 1KJKA 2EZ6A 4OZEA 2Z5BA 5FLXC 2BBGA 3ADLA 2ENAA 2O1UA 2UXBI 2DIXA 2EQ0A 2EOOA 3T1YE 2O1VA 2EM5A 4JI8E 1Z0CA 5EL9A 3BF2A 1N32E 2YWQA 2NN6C 4FW9A 3WU3A 5LMUI 2VF3A 1XNRE 4HEIA 4LCGA 1H74A 2BA0G 3DF6A 4OKGA 1WJPA 4OX9E 4ZYDA 2WNRA 1X6EA 1PJSA 1N36I 4X65I 3L00A 2MKDA 4KZSA 3Q6NA 4X66E 3UK3C 4LF8I 3KWRA 4HY1A 4FWDA 2V34A 2JOXA 2UUBI 2EMWA 4MU4A 2VQFI 2JEAB 1FJGI 4B3RE 1ZXMA 4TUIA 2YTNA 4R2DA 4DR4I 4DV1E 2K4VA 5ADZA 4DR1E 1NHIA 2IERA 4RHBB 4Q28A 2RQLA 2N3HA 2HHHI 2LJHA 1MGTA 2JYAA 1TF6A 2EL4A 2EN3A 1B63A 3B8HA 3F0NA 1YYOA 2YSOA 5GMDA 1OYSA 4FN5A 3DJWA 4LF6E 3T1HI 5DRPA 3M7ND 2R76A 2YTJA 1ZR9A 5IWAI 5JEAB 2JEBB 4BBYA 1Z0VA 2N3GA 2HGHA 1UDOA 2WW4A 5FWKA 2UU9I 2FTXB 2WBUA 2E1MA 1OYRA 4MU3A 3HJCA 4M9VC 3JU0A 4KHPE 3M99B 2RS7A 4IFDE 2D9HA 1ELOA 3ADJA 4Q35B 4KQVA 1H73A 3T1YI 2VESA 2BR2A 2JE6A 2BA0D 2EMCA 3LLHA 1Y60A 2C37A 2PNMA 4DU7A 1N0VC 1XMOI 2YTOA 2EOQA 2HK2A 1XNRI 4USMA 2JWOA 2DMIA 2YU5A 2UUCE 1Y4SA 2EPMX 3CDJA 3K6QA 4OX9I 2M9AA 2V89A 2EPAA 2PRTA 3VYYA 1MU5A 1A6FA 4KWYA 4ZVIA 2EL6A 2EE8A 2YTFA 4P52A 3WU5A 2YTPA 3ZM7A 4BHCA 2EPPA 1P42A 1IBKE 3ZZUA 4X9JA 5JEAC 3TQMA 2R3VA 4DR7E 2V86A 1FNMA 3EPHA 2E1RA 4DU8A 4DR1I 2A2DA 1DQ3A 1ZM9A 1KIJA 1NHHA 4IZJA 3ADIA 4USKA 2F1DA 1PJTA 3MHHC 1DARA 1E3PA 5EKWA 1QU6A 1X49A 1TN9A 4DR3I 2EN2A 4PU9A 2ZM6I 2EOMA 4X64E 4Z7CA 2LVHA 5A6JA 2EM4A 2B9DA 1IQSA 1GQEA 3C6MA 3ADGA 4JV5I 2R42A 2LJPA 2EOJA 3GCMA 1XMQI 5TSEA 1YYKA 2BM1A 5IT9Q 3P06A 3ZKDA 4DV4E 5JEAE 3J7Yp 4DV7E 4LF9E 2ODRC 2YRHA 4LCHA 4HACA 4JI0I 1R6MA 3VHTB 2B3TB 5LMUE 1YH8A 4OO1A 1U2RA 2JVAA 4DV5I 4WX9A 4LFCE 2DEIA 4M0VA 4J3DA 5C0XA 1N33I 1BBOA 4IFDF 4R2CA 2JXPA 2HFUA 5AE2A 5IT9C 4WYQB 4MLQA 4X65E 1N36E 4OO1D 1UBDC 2EMIA 1MEYC 1IMUA 3OTOI 4LF8E 2GPIA 5C0XD 4ZYEA 1PJQA 1GZ6A 2VQFE 1FJGE 1DGCA 4QNKA 4DR4E 2X7IA 1RQ0A 5L3JA 1BBGA 2JR1A 2EN7A 2EMBA 4WSPA 5LLQA 3KRNA 4ED4A 2PO2B 2HHHE 3P3EA 1FWLA 1KYQA 4DUYE 2OI2A 4LF7I 3WU6A 2EPOA 3QT5A 2PO1B 2CGEA 4DR7I 3ZOQB 3PYDA 4LU9A 5K36A 1UDNA 1AAYA 4HTGA 1T4NA 2EMXA 1UN6B 3PYFA 1OYPA 3PYEA 4FWGA 3T1HE 3H4LA 4GKJE 4B3TI 5A6KA 2EM6A 2EN6A 2M4IA 5IWAE 5K36D 2L33A 4BA1B 4P78A 3WU4A 4LFAE 4X8WA 3EQ1A 1X6FA 4IFDB 2EPUA 3M7NG 1OJ4A 2VF1A 2LTSA 3UHMA 5BR8I 3F6GA 2H36X 2CG9A 3BGHA 1T4OA 2GHFA 3NZKA 2WP8B 4R2SA 4I3HA 4URLA 4DV4I 2JP9A 4B3SE 4DV7I 2EWLA 4LF9I 1EH7A 4L5NC 3JAMQ 1YUIA 1Z1BA 1XMOE 3C4BA 2AE8A 4DXLA 3GONA 5DNLA 2V88A 1VISA 5JEAF 2DRPA 3K85A 4LFCI 2EPKX 2J65A 4WUBA 1UDSA 4YHHI 5A6BA 1HNXI 1IBLI 1Y5YA 4M30A 2V83A 4MU0A 4NZVA 2C38A 2YPNA 4AQYI 2EMFA 1B62A 3V5RA 2UXDE 3JAMC 2Z5CA 4WUDA 2C39A 5AE3A 2IESA 1RC7A 2XEXA 2ZBKB 4R1FA 4DUZI 2UUAI 4BA2A 1KKHA 4IFDC 1A1IA 4OO1E 1FI4A 4RH8A 1ZXNA 4GKKE 2NA2A 5K36C 2WNRB 1Z5CA 3THOB 3K17A 1UHZA 4TUGA 1X48A 4DUYI 2JEAA 1D6TA 5C0XE 4DR3E 2ZITA 2ZM6E 3ZZ0A 4PRXA 2F4VI 4F6MA 4R2PA 1S16A 4R2AA 4JI2I 1T4LB 4BC9A 2Q8UA 4JV5E 1IBME 2VQEI
chains in the Genus database with same CATH topology
1XMQE 3QT8A 1HK7A 4LFAI 2YZTA 3J80Q 3CWVA 2UXCE 3IWDA 4JI0E 4DR6I 1HR0E 1Z0WA 4DV5E 3HQ1A 5LMNE 1N33E 4B3SI 1UEKA 2LTRA 2IOQA 2NUEA 3OTOE 3J80C 1MG7A 2HFSA 4R03A 1QZRA 5AASA 2V87A 2FV4B 1J5EI 4NXNE 2KHXA 2LUQA 2UXDI 5AE1A 3LPSA 2J7KA 4FWHA 4LF7E 3PYGA 3IWCA 5LL6R 1XHKA 3Q1QA 3K1JA 4GKKI 3B82A 1Z5AA 4B3TE 2EFGA 1WXRA 1PIEA 1YZ9A 4IZJD 4DPYA 1Z0TA 4LF5I 1IBMI 3B78A 2L2NA 5BR8E 4MYUA 4IZKA 3F6HA 4IZJB 4DKKA 2L3CA 2VE7C 2X36A 2UXCI 4M1KA 3HPSA 2L3JA 4L8NA 1H72C 1HR0I 2BV3A 5LMNI 1K47A 4YHHE 1IBLE 5DNYA 1HNXE 4NXMI 1MX0A 1NHJA 4I8OA 4AQYE 2V2QA 2CPNA 2HKJA 2MC6A 1ZM3A 4P7AA 2DB2A 4HACB 3M6AA 4DUZE 4NXNI 2UUAE 2E5LI 4BMJA 2L2KB 4M2ZA 2F8BA 2HKEA 3HXLA 3H09A 2DMYA 2DEJA 3J7AG 2AJ4A 2F4VE 1ZM4A 4LFBI 4JI2E 1EI1A 1S4EA 3J81Q 2VQEE 2LMZA 2DSYA 3HTXA 1Z5BA 2Z5EA 4OOGC 4BC7A 1HNWI 3HPZA 2B7VA 4DR6E 1PVGA 4UTGA 1UILA 2RTXA 4DR5E 3J81C 3D4JA 2HK3A 1XNQI 1HNZI 2PNLA 1Z0EA 1RREA 1J5EE 1N0UA 2Z5BB 4JI6E 4JYAE 3LNUA 2V8QB 4HXZA 2B7TA 4JI4I 2RS6A 1KVKA 4GKJI 3MSWA 2G7HA 1EA6A 4JI5I 2BM0A 1FKAE 4B3MI 2NUGA 3AUZA 3VK6A 1USVA 5F3WA 2A2CA 3ZKBA 4JI1E 1KTVA 4WUCA 3JTZA 3RMPA 1EKZA 3LMLA 1WHNA 3C4TA 2GS8A 2JY9A 4YY3I 1J26A 1BKNA 5GMEA 2Z5CB 4DV6I 5CFFE 4JG4A 4LF5E 2KOUA 3PRYA 1H7UA 4DPXA 3LTOA 3VYXA 2L2MA 1RR9A 4X62I 4F9CB 4EMDA 1PKPA 1ZBQA 2M1SA 4UT4A 4DR5I 1WUUA 4LTYA 1WHQA 2L6MA 4HYMA 4K0KI 4F54A 4NXME 4DV3E 4F9BB 2WZOA 4JI7I 2M7QA 4F9AB 1Z0BA 3OMLA 4LF4I 4DPWA 1STUA 2Q2EB 3QT7A 1X47A 4JI6I 4XTJA 4JYAI 1SR9A 2E5LE 1FWKA 1ZBTA 2LE2A 1Y4UA 4JI1I 4JI8I 4LFBE 2V2VA 4BS9A 1I94E 1N32I 4WPYA 2V8PA 2ODRD 3J7AM 4DV2E 3V2UC 2FGGA 1YYWA 2GQ0A 4DR2E 2LRSA 1HNWE 1USUA 4DMIA 4WFTA 1O0WA 4X66I 2YT4A 4Z7YA 4JI3E 4B3RI 2O1WA 4DV1I 2LBSB 1XNQE 1ZM2A 3FIGA 1N34E 2JOBA 4GEQB 1HNZE 2NPFA 3QT6A 1Z59A 4DV3I 4J8ZA 4DV0E 4R8OA 4IZKB 4JI4E 2KONA 4JI5E 2IOPA 4LF6I 4BCAA 4B3ME 5A2QQ 2UXBE 4DPTA 4MYTA 3IWBA 4RPFA 3HULA 3Q6MA 4KHPI 2MDRA 1Y6ZA 2L92A 2L8TA 4YY3E 3P1XA 1Z0GA 4DV6E 5A2QC 1I94I 1NZ0A 5T6JA 4DV2I 3ZZTA 2UUCI 4PRVA 2UUBE 4DR2I 2NUFA 1DI2A 3AV0A 4N3OA 4X62E 2IHR1 2O1TA 1IBKI 2V2ZA 4JI3I 2RSMA 1H7SA 4K0KE 2LUPB 2V85A 1N34I 4JI7E 4DPUA 5FLXQ 4LF4E 2CZ9A 4DV0I 2UU9E 4X64I 2MC5A 4P7DA 2EZ6A 2Z5BA 5FLXC 3ADLA 2UXBI 2O1UA 2DIXA 3T1YE 2O1VA 4JI8E 1Z0CA 3WU3A 1N32E 4FW9A 5LMUI 2VF3A 1XNRE 1H74A 3DF6A 4OX9E 1N36I 4X65I 4KZSA 3Q6NA 4X66E 4LF8I 3KWRA 4HY1A 4FWDA 2V34A 2JOXA 2UUBI 2VQFI 1FJGI 4B3RE 1ZXMA 4TUIA 4DR4I 4DV1E 2K4VA 5ADZA 4DR1E 1NHIA 4Q28A 2N3HA 2HHHI 2LJHA 3B8HA 1B63A 3F0NA 1YYOA 5GMDA 4FN5A 3DJWA 4LF6E 3T1HI 5IWAI 4BBYA 1Z0VA 2N3GA 5FWKA 2WW4A 2UU9I 2FTXB 2E1MA 3HJCA 3JU0A 4KHPE 2RS7A 1ELOA 3ADJA 4KQVA 1H73A 3T1YI 3LLHA 2PNMA 4DU7A 1N0VC 1XMOI 2HK2A 1XNRI 4USMA 2JWOA 2UUCE 1Y4SA 3K6QA 4OX9I 2V89A 3VYYA 1MU5A 1A6FA 4ZVIA 3WU5A 4P52A 3ZM7A 1IBKE 3ZZUA 2R3VA 4DR7E 2V86A 1FNMA 2E1RA 4DU8A 4DR1I 2A2DA 1DQ3A 1ZM9A 1KIJA 1NHHA 4IZJA 3ADIA 4USKA 1DARA 1QU6A 1X49A 4DR3I 4PU9A 2ZM6I 4X64E 4Z7CA 2B9DA 1GQEA 3ADGA 4JV5I 2R42A 2LJPA 1XMQI 1YYKA 2BM1A 5IT9Q 3P06A 3ZKDA 4DV4E 3J7Yp 4DV7E 4LF9E 2ODRC 4HACA 4JI0I 2B3TB 5LMUE 1U2RA 2JVAA 4DV5I 4LFCE 2DEIA 4M0VA 1N33I 2HFUA 5AE2A 5IT9C 4WYQB 4X65E 1N36E 3OTOI 4LF8E 1GZ6A 2VQFE 1FJGE 4DR4E 2X7IA 1RQ0A 5L3JA 4WSPA 2JR1A 4ED4A 2HHHE 1FWLA 4DUYE 2OI2A 4LF7I 3WU6A 3QT5A 4DR7I 2CGEA 3ZOQB 3PYDA 4LU9A 1T4NA 3PYFA 3PYEA 4FWGA 3T1HE 3H4LA 4GKJE 4B3TI 5IWAE 2M4IA 2L33A 4P78A 3WU4A 4LFAE 4X8WA 1OJ4A 2VF1A 2LTSA 5BR8I 3F6GA 2H36X 2CG9A 1T4OA 4URLA 4I3HA 4DV4I 4B3SE 4DV7I 2EWLA 4LF9I 4L5NC 3JAMQ 1XMOE 3C4BA 4DXLA 3GONA 2V88A 1VISA 3K85A 4LFCI 4WUBA 4YHHI 1IBLI 1HNXI 4M30A 2V83A 4AQYI 1B62A 3V5RA 2UXDE 3JAMC 2Z5CA 4WUDA 5AE3A 2XEXA 1RC7A 2ZBKB 4R1FA 4DUZI 2UUAI 1KKHA 1FI4A 1ZXNA 4GKKE 2NA2A 1Z5CA 3K17A 1D6TA 1UHZA 4TUGA 1X48A 4DUYI 4DR3E 2ZITA 2ZM6E 3ZZ0A 4PRXA 2F4VI 1S16A 4JI2I 1T4LB 4BC9A 4JV5E 1IBME 2VQEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ E;  3QT8 A;  4LFA I;  3J80 Q;  3CWV A;  2UXC E;  4JI0 E;  4DR6 I;  1HR0 E;  1Z0W A;  4DV5 E;  5LMN E;  1N33 E;  4B3S I;  1UEK A;  3OTO E;  3J80 C;  1MG7 A;  2HFS A;  1QZR A;  1J5E I;  4NXN E;  2UXD I;  3LPS A;  2J7K A;  4FWH A;  4LF7 E;  3PYG A;  5LL6 R;  1XHK A;  3Q1Q A;  3K1J A;  4GKK I;  3B82 A;  1Z5A A;  4B3T E;  2EFG A;  1PIE A;  4DPY A;  1Z0T A;  4LF5 I;  1IBM I;  3B78 A;  5BR8 E;  4MYU A;  2X36 A;  2UXC I;  4M1K A;  1H72 C;  1HR0 I;  2BV3 A;  5LMN I;  1K47 A;  4YHH E;  1IBL E;  1HNX E;  4NXM I;  1MX0 A;  1NHJ A;  2V2Q A;  4AQY E;  2HKJ A;  1ZM3 A;  4P7A A;  4HAC B;  3M6A A;  4DUZ E;  4NXN I;  2UUA E;  2E5L I;  2HKE A;  2DEJ A;  3J7A G;  2AJ4 A;  2F4V E;  1ZM4 A;  4LFB I;  4JI2 E;  1EI1 A;  1S4E A;  3J81 Q;  2VQE E;  1Z5B A;  1HNW I;  1PVG A;  4UTG A;  4DR6 E;  4DR5 E;  3J81 C;  3D4J A;  2HK3 A;  1XNQ I;  1HNZ I;  1Z0E A;  1RRE A;  1N0U A;  1J5E E;  4JI6 E;  4JYA E;  3LNU A;  4HXZ A;  4JI4 I;  1KVK A;  4GKJ I;  1EA6 A;  4JI5 I;  2BM0 A;  1FKA E;  4B3M I;  2A2C A;  3ZKB A;  4JI1 E;  1KTV A;  4WUC A;  2GS8 A;  4YY3 I;  1BKN A;  5GME A;  4DV6 I;  4JG4 A;  4LF5 E;  1H7U A;  4DPX A;  3LTO A;  1RR9 A;  4X62 I;  4EMD A;  1PKP A;  4UT4 A;  4DR5 I;  1WUU A;  4HYM A;  4K0K I;  4NXM E;  4DV3 E;  4JI7 I;  1Z0B A;  4LF4 I;  4DPW A;  2Q2E B;  3QT7 A;  4JI6 I;  4XTJ A;  4JYA I;  2E5L E;  1FWK A;  4JI1 I;  4JI8 I;  4LFB E;  2V2V A;  1I94 E;  1N32 I;  2V8P A;  3J7A M;  3V2U C;  4DV2 E;  4DR2 E;  1HNW E;  4X66 I;  4Z7Y A;  4JI3 E;  4B3R I;  4DV1 I;  1XNQ E;  1ZM2 A;  1N34 E;  1HNZ E;  2NPF A;  3QT6 A;  1Z59 A;  4DV3 I;  4DV0 E;  4JI4 E;  4JI5 E;  4LF6 I;  4B3M E;  5A2Q Q;  4DPT A;  2UXB E;  4MYT A;  4RPF A;  3HUL A;  4KHP I;  4YY3 E;  1Z0G A;  4DV6 E;  5A2Q C;  1I94 I;  1NZ0 A;  4DV2 I;  3ZZT A;  2UUC I;  4PRV A;  2UUB E;  4DR2 I;  4X62 E;  1IBK I;  2V2Z A;  4JI3 I;  1H7S A;  4K0K E;  1N34 I;  4JI7 E;  4DPU A;  5FLX Q;  4LF4 E;  2CZ9 A;  4DV0 I;  2UU9 E;  4X64 I;  5FLX C;  2UXB I;  3T1Y E;  4JI8 E;  1Z0C A;  3WU3 A;  4FW9 A;  1N32 E;  5LMU I;  2VF3 A;  1XNR E;  1H74 A;  4OX9 E;  1N36 I;  4X65 I;  4X66 E;  4LF8 I;  4HY1 A;  4FWD A;  2V34 A;  2UUB I;  2VQF I;  1FJG I;  1ZXM A;  4B3R E;  4DR4 I;  4DV1 E;  1NHI A;  4DR1 E;  2HHH I;  3B8H A;  1B63 A;  3F0N A;  5GMD A;  4FN5 A;  3T1H I;  4LF6 E;  5IWA I;  1Z0V A;  2UU9 I;  2WW4 A;  4KHP E;  1ELO A;  4KQV A;  1H73 A;  3T1Y I;  4DU7 A;  1N0V C;  1XMO I;  2HK2 A;  1XNR I;  4USM A;  2UUC E;  4OX9 I;  1MU5 A;  1A6F A;  4ZVI A;  3WU5 A;  4P52 A;  3ZM7 A;  1IBK E;  3ZZU A;  2R3V A;  4DR7 E;  4DR1 I;  1FNM A;  2E1R A;  4DU8 A;  2A2D A;  1ZM9 A;  1KIJ A;  1NHH A;  4USK A;  1DAR A;  4DR3 I;  4PU9 A;  2ZM6 I;  4X64 E;  4Z7C A;  4JV5 I;  2R42 A;  2LJP A;  1XMQ I;  2BM1 A;  5IT9 Q;  3ZKD A;  4DV4 E;  4DV7 E;  4LF9 E;  4HAC A;  4JI0 I;  5LMU E;  1U2R A;  4DV5 I;  4LFC E;  2DEI A;  1N33 I;  2HFU A;  5IT9 C;  1N36 E;  4X65 E;  3OTO I;  4LF8 E;  2VQF E;  1FJG E;  4DR4 E;  2X7I A;  5L3J A;  4ED4 A;  2HHH E;  1FWL A;  4DUY E;  2OI2 A;  4LF7 I;  3WU6 A;  3QT5 A;  4DR7 I;  3PYD A;  3PYF A;  3PYE A;  4FWG A;  3T1H E;  3H4L A;  4B3T I;  4GKJ E;  5IWA E;  3WU4 A;  4LFA E;  1OJ4 A;  5BR8 I;  4URL A;  4I3H A;  4DV4 I;  4B3S E;  4DV7 I;  4LF9 I;  3JAM Q;  1XMO E;  4DXL A;  3GON A;  1VIS A;  4LFC I;  4WUB A;  4YHH I;  1IBL I;  1HNX I;  4AQY I;  1B62 A;  3V5R A;  2UXD E;  3JAM C;  4WUD A;  2XEX A;  2ZBK B;  4DUZ I;  4R1F A;  2UUA I;  1KKH A;  1FI4 A;  1ZXN A;  4GKK E;  1Z5C A;  3K17 A;  1D6T A;  4DUY I;  4DR3 E;  2ZIT A;  3ZZ0 A;  2ZM6 E;  4PRX A;  2F4V I;  1S16 A;  4JI2 I;  4JV5 E;  1IBM E;  2VQE I; 
#chains in the Genus database with same CATH topology
 1XMQ E;  2YRK A;  2GLI A;  3MHS C;  3QT8 A;  5AC5 A;  1HK7 A;  4LFA I;  2YZT A;  4R2Q A;  3J80 Q;  3CWV A;  2WCC 3;  4GZN C;  3IWD A;  4JI0 E;  2UXC E;  4DR6 I;  2EP3 A;  1HR0 E;  1Z0W A;  4DV5 E;  3HQ1 A;  5K36 E;  5LMN E;  2EOS A;  1N33 E;  4B3S I;  2YTQ A;  1UEK A;  2EM7 A;  2LTR A;  2IOQ A;  4R2E A;  2NUE A;  3L7Z A;  3OTO E;  3J80 C;  1MG7 A;  2HFS A;  4R03 A;  1QZR A;  4LPF A;  5AAS A;  2EOH A;  2V87 A;  2FV4 B;  1J5E I;  4NXN E;  2KHX A;  1GTK A;  4IJD A;  1SFE A;  2CVE A;  2LUQ A;  2PNZ A;  2UXD I;  5AE1 A;  2BR2 B;  3LPS A;  2J7K A;  4FWH A;  2C37 B;  4LF7 E;  3PYG A;  3IWC A;  2EL5 A;  5LL6 R;  4R2R A;  5KL2 A;  1XHK A;  3Q1Q A;  4IS9 A;  2RPC A;  3K1J A;  2JPA A;  2YTD A;  1T38 A;  3B82 A;  4GKK I;  4ZYG A;  1Z5A A;  1R6L A;  4IS1 C;  4B3T E;  4OO1 F;  2EFG A;  4FW4 A;  1WXR A;  5A69 A;  2YRM A;  1X6H A;  3KZY A;  1YZ9 A;  1PIE A;  4IZJ D;  5C0X F;  4O5G A;  2I9I A;  1Z0T A;  4DPY A;  4LF5 I;  2YTG A;  5DNX A;  1IBM I;  3B78 A;  2L2N A;  3M85 G;  2EOI A;  5BR8 E;  4MLV A;  1YFH A;  4IZK A;  4MYU A;  4BHB A;  3F6H A;  4IZJ B;  4DKK A;  1ZAA C;  4QNJ A;  2L3C A;  2VE7 C;  2X36 A;  2YSP A;  4NHR A;  2EJ4 A;  2UXC I;  4M1K A;  3HPS A;  2L3J A;  2PO0 A;  2VRD A;  4L8N A;  1H72 C;  1HR0 I;  4O4K A;  2BV3 A;  2LT7 A;  5LMN I;  1K47 A;  4YHH E;  1IBL E;  5DNY A;  1HNX E;  4NXM I;  1YUJ A;  2EN1 A;  1MX0 A;  1NHJ A;  5K36 F;  4I8O A;  4AQY E;  2V2Q A;  2CPN A;  2HKJ A;  2MC6 A;  1ZM3 A;  4P7A A;  2EMZ A;  2EOX A;  2DB2 A;  5KL5 A;  4HAC B;  3M6A A;  4DUZ E;  4LCF A;  4NXN I;  4OO1 B;  2UUA E;  4X62 I;  2E5L I;  4BMJ A;  1YPN A;  2K7I A;  2EM0 A;  2L2K B;  2F8B A;  2J7J A;  1A1J A;  4M2Z A;  5C0X B;  2HKE A;  3GLL A;  1IQO A;  4MDT A;  3HXL A;  3H09 A;  2DMY A;  2DEJ A;  2NAB A;  3J7A G;  5KL3 A;  2EPX A;  4F2J C;  2AJ4 A;  3P3G A;  2F4V E;  2NN6 A;  1ZM4 A;  4LFB I;  4JI2 E;  5IV8 B;  1EI1 A;  1A1F A;  1S4E A;  3J81 Q;  2VQE E;  3QG5 C;  3ECR A;  1NCS A;  1A1H A;  3M85 D;  2LMZ A;  2BA1 D;  2NN6 D;  2DSY A;  3HTX A;  1Z5B A;  4AIM A;  2Z5E A;  4OOG C;  4BC7 A;  1HNW I;  2EPC A;  3HPZ A;  2B7V A;  4DR6 E;  1PVG A;  4UTG A;  3U1K A;  3B4T A;  1UIL A;  5K36 B;  2RTX A;  4WSG A;  2EN8 A;  2EMG A;  4DR5 E;  3J81 C;  1B69 A;  2LJU A;  1UDQ A;  4OO1 C;  2N8X A;  1JK2 A;  2ENC A;  2EML A;  4FW6 A;  3D4J A;  4GQU A;  2HK3 A;  1XNQ I;  5C0X C;  3KZZ A;  1HNZ I;  1NEI A;  2PNL A;  1Z0E A;  1WRJ A;  1J5E E;  1N0U A;  1RRE A;  4JI6 E;  2Z5B B;  4JYA E;  3LNU A;  2V8Q B;  4HXZ A;  2B7T A;  4MQY A;  4JI4 I;  2RS6 A;  1KVK A;  4GKJ I;  3MSW A;  5KL7 A;  2G7H A;  1EA6 A;  4JI5 I;  5IXM B;  2BM0 A;  1FKA E;  5A6B D;  4B3M I;  2NUG A;  2BB8 A;  3AUZ A;  2EOF A;  3VK6 A;  1YSA C;  2JT2 A;  1USV A;  1L4S A;  5F3W A;  2MKN A;  2A2C A;  4JI1 E;  3ZKB A;  1KTV A;  4WUC A;  5KL6 A;  3JTZ A;  3RMP A;  1EKZ A;  3LML A;  2C38 B;  1WHN A;  3C4T A;  1E3H A;  2GS8 A;  2JY9 A;  3P3C A;  4YY3 I;  2YU8 A;  1J26 A;  2EOE A;  1BKN A;  2Z5C B;  3P76 A;  2CSH A;  2EM8 A;  2RSI A;  2C39 B;  5GME A;  5CFF E;  1LLM C;  4DV6 I;  2EPZ A;  4JG4 A;  4F6N A;  1AH5 A;  4LF5 E;  4BA2 B;  2KOU A;  3CDI A;  3PRY A;  1H7U A;  4ISA A;  4DPX A;  3LTO A;  3VYX A;  5DRQ A;  2L2M A;  2LO3 A;  1RR9 A;  3PS1 A;  1JK1 A;  2EOZ A;  4F9C B;  2EMA A;  4EMD A;  1PKP A;  2JEB A;  1ZBQ A;  2M1S A;  5JEA A;  3BBG A;  4AID A;  4UT4 A;  4DR5 I;  1A1G A;  2EQ3 A;  4LTY A;  1WHQ A;  2HC5 A;  2L6M A;  2EOY A;  1WUU A;  4HYM A;  4LOM A;  4K0K I;  2EMY A;  2LCE A;  4F54 A;  2EN4 A;  4NXM E;  2EM9 A;  4DV3 E;  4F9B B;  2NN6 E;  2CTD A;  5JEA D;  2WZO A;  4JI7 I;  2M7Q A;  4F9A B;  1Z0B A;  3OML A;  2LV2 A;  4LF4 I;  2WBT A;  4DPW A;  3U1Y A;  4N4R B;  1STU A;  2Q2E B;  3QT7 A;  1X47 A;  1EH6 A;  4JI6 I;  4XTJ A;  4JYA I;  1SR9 A;  3C6K A;  2E5L E;  2ENH A;  2WBS A;  2JE6 B;  1FWK A;  1ZBT A;  2LE2 A;  2EOR A;  2E72 A;  1N3G A;  2GO3 A;  2EPR A;  3L7Z B;  4NBQ A;  4WXC A;  1Y4U A;  4JI1 I;  4FW3 A;  4JI8 I;  4LFB E;  2V2V A;  4MU1 A;  4BS9 A;  1I94 E;  1N32 I;  4WPY A;  2DLQ A;  2V8P A;  4ZYH A;  4O24 A;  2ODR D;  3J7A M;  4DV2 E;  3V2U C;  2FGG A;  1YYW A;  3BID A;  2PNZ B;  2GQ0 A;  5DRO A;  4DR2 E;  2LRS A;  1F2I G;  1G2D C;  1HNW E;  1USU A;  4AM3 A;  2EM3 A;  4DMI A;  4WFT A;  1O0W A;  4X66 I;  2BA1 G;  2I13 A;  2YT4 A;  4Z7Y A;  1EH8 A;  4JI3 E;  3EPL A;  1X5W A;  3H1C A;  4FK5 C;  4B3R I;  4FW5 A;  2O1W A;  1QNT A;  4DV1 I;  2LBS B;  1XNQ E;  1ZM2 A;  3FIG A;  1N34 E;  1A1K A;  1BB8 A;  2JOB A;  2YTE A;  2A25 A;  4GEQ B;  2MDG A;  1HNZ E;  3PS3 A;  2NPF A;  2ELZ A;  5A6A A;  1A1L A;  3QT6 A;  2R1F A;  1Z59 A;  4DV3 I;  4J8Z A;  4DV0 E;  4R8O A;  4IZK B;  4JI4 E;  2NN6 F;  3DD6 A;  3THN A;  2KON A;  4JI5 E;  2IOP A;  4LF6 I;  4BCA A;  4B3M E;  5A2Q Q;  2PO0 B;  2UXB E;  4DPT A;  1YHC A;  1VI7 A;  3IWB A;  4MYT A;  4RPF A;  3HUL A;  3Q6M A;  4KHP I;  2MDR A;  2EMK A;  1Y6Z A;  2L92 A;  1X3C A;  2L8T A;  2EQ1 A;  2EPN A;  2HJJ A;  4YY3 E;  3P1X A;  1Z0G A;  2O3Z A;  2PO2 A;  4DV6 E;  5A2Q C;  1I94 I;  1NZ0 A;  1XXE A;  4WXD A;  5T6J A;  2PO1 A;  5ELW A;  2EM2 A;  3ZZT A;  4DV2 I;  2UUC I;  4PRV A;  2ELY A;  2UUB E;  5DRR A;  4DR2 I;  2DLK A;  2NUF A;  1DI2 A;  3AV0 A;  4N3O A;  4X62 E;  4U3B A;  1TF3 A;  2IHR 1;  4BA1 A;  2O1T A;  2NN6 B;  1IBK I;  2V2Z A;  3PS2 A;  2RSM A;  4JI3 I;  1H7S A;  4O43 A;  4K0K E;  2LUP B;  4IFD A;  3EPK A;  4U3D A;  2V85 A;  3GME A;  2DGC A;  1G2F C;  2EMH A;  4JI7 E;  5KL4 A;  3EPJ A;  1T39 A;  4DPU A;  1N34 I;  1PDA A;  5FLX Q;  2WP8 A;  1ZU1 A;  1RMD A;  2EPL X;  4LF4 E;  4IFD D;  2GO4 A;  1P47 A;  2CZ9 A;  5AC4 A;  4FW7 A;  4DV0 I;  2UU9 E;  4X64 I;  1RHY A;  2MC5 A;  4P7D A;  2YTI A;  3HKM A;  2ADR A;  2CT1 A;  1KJK A;  2EZ6 A;  4OZE A;  2Z5B A;  5FLX C;  2BBG A;  3ADL A;  2ENA A;  2O1U A;  2UXB I;  2DIX A;  2EQ0 A;  2EOO A;  3T1Y E;  2O1V A;  2EM5 A;  4JI8 E;  1Z0C A;  5EL9 A;  3BF2 A;  1N32 E;  2YWQ A;  2NN6 C;  4FW9 A;  3WU3 A;  5LMU I;  2VF3 A;  1XNR E;  4HEI A;  4LCG A;  1H74 A;  2BA0 G;  3DF6 A;  4OKG A;  1WJP A;  4OX9 E;  4ZYD A;  2WNR A;  1X6E A;  1PJS A;  1N36 I;  4X65 I;  3L00 A;  2MKD A;  4KZS A;  3Q6N A;  4X66 E;  3UK3 C;  4LF8 I;  3KWR A;  4HY1 A;  4FWD A;  2V34 A;  2JOX A;  2UUB I;  2EMW A;  4MU4 A;  2VQF I;  2JEA B;  1FJG I;  4B3R E;  1ZXM A;  4TUI A;  2YTN A;  4R2D A;  4DR4 I;  4DV1 E;  2K4V A;  5ADZ A;  4DR1 E;  1NHI A;  2IER A;  4RHB B;  4Q28 A;  2RQL A;  2N3H A;  2HHH I;  2LJH A;  1MGT A;  2JYA A;  1TF6 A;  2EL4 A;  2EN3 A;  1B63 A;  3B8H A;  3F0N A;  1YYO A;  2YSO A;  5GMD A;  1OYS A;  4FN5 A;  3DJW A;  4LF6 E;  3T1H I;  5DRP A;  3M7N D;  2R76 A;  2YTJ A;  1ZR9 A;  5IWA I;  5JEA B;  2JEB B;  4BBY A;  1Z0V A;  2N3G A;  2HGH A;  1UDO A;  2WW4 A;  5FWK A;  2UU9 I;  2FTX B;  2WBU A;  2E1M A;  1OYR A;  4MU3 A;  3HJC A;  4M9V C;  3JU0 A;  4KHP E;  3M99 B;  2RS7 A;  4IFD E;  2D9H A;  1ELO A;  3ADJ A;  4Q35 B;  4KQV A;  1H73 A;  3T1Y I;  2VES A;  2BR2 A;  2JE6 A;  2BA0 D;  2EMC A;  3LLH A;  1Y60 A;  2C37 A;  2PNM A;  4DU7 A;  1N0V C;  1XMO I;  2YTO A;  2EOQ A;  2HK2 A;  1XNR I;  4USM A;  2JWO A;  2DMI A;  2YU5 A;  2UUC E;  1Y4S A;  2EPM X;  3CDJ A;  3K6Q A;  4OX9 I;  2M9A A;  2V89 A;  2EPA A;  2PRT A;  3VYY A;  1MU5 A;  1A6F A;  4KWY A;  4ZVI A;  2EL6 A;  2EE8 A;  2YTF A;  4P52 A;  3WU5 A;  2YTP A;  3ZM7 A;  4BHC A;  2EPP A;  1P42 A;  1IBK E;  3ZZU A;  4X9J A;  5JEA C;  3TQM A;  2R3V A;  4DR7 E;  2V86 A;  1FNM A;  3EPH A;  2E1R A;  4DU8 A;  4DR1 I;  2A2D A;  1DQ3 A;  1ZM9 A;  1KIJ A;  1NHH A;  4IZJ A;  3ADI A;  4USK A;  2F1D A;  1PJT A;  3MHH C;  1DAR A;  1E3P A;  5EKW A;  1QU6 A;  1X49 A;  1TN9 A;  4DR3 I;  2EN2 A;  4PU9 A;  2ZM6 I;  2EOM A;  4X64 E;  4Z7C A;  2LVH A;  5A6J A;  2EM4 A;  2B9D A;  1IQS A;  1GQE A;  3C6M A;  3ADG A;  4JV5 I;  2R42 A;  2LJP A;  2EOJ A;  3GCM A;  1XMQ I;  5TSE A;  1YYK A;  2BM1 A;  5IT9 Q;  3P06 A;  3ZKD A;  4DV4 E;  5JEA E;  3J7Y p;  4DV7 E;  4LF9 E;  2ODR C;  2YRH A;  4LCH A;  4HAC A;  4JI0 I;  1R6M A;  3VHT B;  2B3T B;  5LMU E;  1YH8 A;  4OO1 A;  1U2R A;  2JVA A;  4DV5 I;  4WX9 A;  4LFC E;  2DEI A;  4M0V A;  4J3D A;  5C0X A;  1N33 I;  1BBO A;  4IFD F;  4R2C A;  2JXP A;  2HFU A;  5AE2 A;  5IT9 C;  4WYQ B;  4MLQ A;  4X65 E;  1N36 E;  4OO1 D;  1UBD C;  2EMI A;  1MEY C;  1IMU A;  3OTO I;  4LF8 E;  2GPI A;  5C0X D;  4ZYE A;  1PJQ A;  1GZ6 A;  2VQF E;  1FJG E;  1DGC A;  4QNK A;  4DR4 E;  2X7I A;  1RQ0 A;  5L3J A;  1BBG A;  2JR1 A;  2EN7 A;  2EMB A;  4WSP A;  5LLQ A;  3KRN A;  4ED4 A;  2PO2 B;  2HHH E;  3P3E A;  1FWL A;  1KYQ A;  4DUY E;  2OI2 A;  4LF7 I;  3WU6 A;  2EPO A;  3QT5 A;  2PO1 B;  2CGE A;  4DR7 I;  3ZOQ B;  3PYD A;  4LU9 A;  5K36 A;  1UDN A;  1AAY A;  4HTG A;  1T4N A;  2EMX A;  1UN6 B;  3PYF A;  1OYP A;  3PYE A;  4FWG A;  3T1H E;  3H4L A;  4GKJ E;  4B3T I;  5A6K A;  2EM6 A;  2EN6 A;  2M4I A;  5IWA E;  5K36 D;  2L33 A;  4BA1 B;  4P78 A;  3WU4 A;  4LFA E;  4X8W A;  3EQ1 A;  1X6F A;  4IFD B;  2EPU A;  3M7N G;  1OJ4 A;  2VF1 A;  2LTS A;  3UHM A;  5BR8 I;  3F6G A;  2H36 X;  2CG9 A;  3BGH A;  1T4O A;  2GHF A;  3NZK A;  2WP8 B;  4R2S A;  4I3H A;  4URL A;  4DV4 I;  2JP9 A;  4B3S E;  4DV7 I;  2EWL A;  4LF9 I;  1EH7 A;  4L5N C;  3JAM Q;  1YUI A;  1Z1B A;  1XMO E;  3C4B A;  2AE8 A;  4DXL A;  3GON A;  5DNL A;  2V88 A;  1VIS A;  5JEA F;  2DRP A;  3K85 A;  4LFC I;  2EPK X;  2J65 A;  4WUB A;  1UDS A;  4YHH I;  5A6B A;  1HNX I;  1IBL I;  1Y5Y A;  4M30 A;  2V83 A;  4MU0 A;  4NZV A;  2C38 A;  2YPN A;  4AQY I;  2EMF A;  1B62 A;  3V5R A;  2UXD E;  3JAM C;  2Z5C A;  4WUD A;  2C39 A;  5AE3 A;  2IES A;  1RC7 A;  2XEX A;  2ZBK B;  4R1F A;  4DUZ I;  2UUA I;  4BA2 A;  1KKH A;  4IFD C;  1A1I A;  4OO1 E;  1FI4 A;  4RH8 A;  1ZXN A;  4GKK E;  2NA2 A;  5K36 C;  2WNR B;  1Z5C A;  3THO B;  3K17 A;  1UHZ A;  4TUG A;  1X48 A;  4DUY I;  2JEA A;  1D6T A;  5C0X E;  4DR3 E;  2ZIT A;  2ZM6 E;  3ZZ0 A;  4PRX A;  2F4V I;  4F6M A;  4R2P A;  1S16 A;  4R2A A;  4JI2 I;  1T4L B;  4BC9 A;  2Q8U A;  4JV5 E;  1IBM E;  2VQE I; 
#chains in the Genus database with same CATH homology
 1XMQ E;  3QT8 A;  1HK7 A;  4LFA I;  2YZT A;  3J80 Q;  3CWV A;  2UXC E;  3IWD A;  4JI0 E;  4DR6 I;  1HR0 E;  1Z0W A;  4DV5 E;  3HQ1 A;  5LMN E;  1N33 E;  4B3S I;  1UEK A;  2LTR A;  2IOQ A;  2NUE A;  3OTO E;  3J80 C;  1MG7 A;  2HFS A;  4R03 A;  1QZR A;  5AAS A;  2V87 A;  2FV4 B;  1J5E I;  4NXN E;  2KHX A;  2LUQ A;  2UXD I;  5AE1 A;  3LPS A;  2J7K A;  4FWH A;  4LF7 E;  3PYG A;  3IWC A;  5LL6 R;  1XHK A;  3Q1Q A;  3K1J A;  4GKK I;  3B82 A;  1Z5A A;  4B3T E;  2EFG A;  1WXR A;  1PIE A;  1YZ9 A;  4IZJ D;  4DPY A;  1Z0T A;  4LF5 I;  1IBM I;  3B78 A;  2L2N A;  5BR8 E;  4MYU A;  4IZK A;  3F6H A;  4IZJ B;  4DKK A;  2L3C A;  2VE7 C;  2X36 A;  2UXC I;  4M1K A;  3HPS A;  2L3J A;  4L8N A;  1H72 C;  1HR0 I;  2BV3 A;  5LMN I;  1K47 A;  4YHH E;  1IBL E;  5DNY A;  1HNX E;  4NXM I;  1MX0 A;  1NHJ A;  4I8O A;  4AQY E;  2V2Q A;  2CPN A;  2HKJ A;  2MC6 A;  1ZM3 A;  4P7A A;  2DB2 A;  4HAC B;  3M6A A;  4DUZ E;  4NXN I;  2UUA E;  2E5L I;  4BMJ A;  2L2K B;  4M2Z A;  2F8B A;  2HKE A;  3HXL A;  3H09 A;  2DMY A;  2DEJ A;  3J7A G;  2AJ4 A;  2F4V E;  1ZM4 A;  4LFB I;  4JI2 E;  1EI1 A;  1S4E A;  3J81 Q;  2VQE E;  2LMZ A;  2DSY A;  3HTX A;  1Z5B A;  2Z5E A;  4OOG C;  4BC7 A;  1HNW I;  3HPZ A;  2B7V A;  4DR6 E;  1PVG A;  4UTG A;  1UIL A;  2RTX A;  4DR5 E;  3J81 C;  3D4J A;  2HK3 A;  1XNQ I;  1HNZ I;  2PNL A;  1Z0E A;  1RRE A;  1J5E E;  1N0U A;  2Z5B B;  4JI6 E;  4JYA E;  3LNU A;  2V8Q B;  4HXZ A;  2B7T A;  4JI4 I;  2RS6 A;  1KVK A;  4GKJ I;  3MSW A;  2G7H A;  1EA6 A;  4JI5 I;  2BM0 A;  1FKA E;  4B3M I;  2NUG A;  3AUZ A;  3VK6 A;  1USV A;  5F3W A;  2A2C A;  3ZKB A;  4JI1 E;  1KTV A;  4WUC A;  3JTZ A;  3RMP A;  1EKZ A;  3LML A;  1WHN A;  3C4T A;  2GS8 A;  2JY9 A;  4YY3 I;  1J26 A;  1BKN A;  5GME A;  2Z5C B;  4DV6 I;  5CFF E;  4JG4 A;  4LF5 E;  2KOU A;  3PRY A;  1H7U A;  4DPX A;  3LTO A;  3VYX A;  2L2M A;  1RR9 A;  4X62 I;  4F9C B;  4EMD A;  1PKP A;  1ZBQ A;  2M1S A;  4UT4 A;  4DR5 I;  1WUU A;  4LTY A;  1WHQ A;  2L6M A;  4HYM A;  4K0K I;  4F54 A;  4NXM E;  4DV3 E;  4F9B B;  2WZO A;  4JI7 I;  2M7Q A;  4F9A B;  1Z0B A;  3OML A;  4LF4 I;  4DPW A;  1STU A;  2Q2E B;  3QT7 A;  1X47 A;  4JI6 I;  4XTJ A;  4JYA I;  1SR9 A;  2E5L E;  1FWK A;  1ZBT A;  2LE2 A;  1Y4U A;  4JI1 I;  4JI8 I;  4LFB E;  2V2V A;  4BS9 A;  1I94 E;  1N32 I;  4WPY A;  2V8P A;  2ODR D;  3J7A M;  4DV2 E;  3V2U C;  2FGG A;  1YYW A;  2GQ0 A;  4DR2 E;  2LRS A;  1HNW E;  1USU A;  4DMI A;  4WFT A;  1O0W A;  4X66 I;  2YT4 A;  4Z7Y A;  4JI3 E;  4B3R I;  2O1W A;  4DV1 I;  2LBS B;  1XNQ E;  1ZM2 A;  3FIG A;  1N34 E;  2JOB A;  4GEQ B;  1HNZ E;  2NPF A;  3QT6 A;  1Z59 A;  4DV3 I;  4J8Z A;  4DV0 E;  4R8O A;  4IZK B;  4JI4 E;  2KON A;  4JI5 E;  2IOP A;  4LF6 I;  4BCA A;  4B3M E;  5A2Q Q;  2UXB E;  4DPT A;  4MYT A;  3IWB A;  4RPF A;  3HUL A;  3Q6M A;  4KHP I;  2MDR A;  1Y6Z A;  2L92 A;  2L8T A;  4YY3 E;  3P1X A;  1Z0G A;  4DV6 E;  5A2Q C;  1I94 I;  1NZ0 A;  5T6J A;  4DV2 I;  3ZZT A;  2UUC I;  4PRV A;  2UUB E;  4DR2 I;  2NUF A;  1DI2 A;  3AV0 A;  4N3O A;  4X62 E;  2IHR 1;  2O1T A;  1IBK I;  2V2Z A;  4JI3 I;  2RSM A;  1H7S A;  4K0K E;  2LUP B;  2V85 A;  1N34 I;  4JI7 E;  4DPU A;  5FLX Q;  4LF4 E;  2CZ9 A;  4DV0 I;  2UU9 E;  4X64 I;  2MC5 A;  4P7D A;  2EZ6 A;  2Z5B A;  5FLX C;  3ADL A;  2UXB I;  2O1U A;  2DIX A;  3T1Y E;  2O1V A;  4JI8 E;  1Z0C A;  3WU3 A;  1N32 E;  4FW9 A;  5LMU I;  2VF3 A;  1XNR E;  1H74 A;  3DF6 A;  4OX9 E;  1N36 I;  4X65 I;  4KZS A;  3Q6N A;  4X66 E;  4LF8 I;  3KWR A;  4HY1 A;  4FWD A;  2V34 A;  2JOX A;  2UUB I;  2VQF I;  1FJG I;  4B3R E;  1ZXM A;  4TUI A;  4DR4 I;  4DV1 E;  2K4V A;  5ADZ A;  4DR1 E;  1NHI A;  4Q28 A;  2N3H A;  2HHH I;  2LJH A;  3B8H A;  1B63 A;  3F0N A;  1YYO A;  5GMD A;  4FN5 A;  3DJW A;  4LF6 E;  3T1H I;  5IWA I;  4BBY A;  1Z0V A;  2N3G A;  5FWK A;  2WW4 A;  2UU9 I;  2FTX B;  2E1M A;  3HJC A;  3JU0 A;  4KHP E;  2RS7 A;  1ELO A;  3ADJ A;  4KQV A;  1H73 A;  3T1Y I;  3LLH A;  2PNM A;  4DU7 A;  1N0V C;  1XMO I;  2HK2 A;  1XNR I;  4USM A;  2JWO A;  2UUC E;  1Y4S A;  3K6Q A;  4OX9 I;  2V89 A;  3VYY A;  1MU5 A;  1A6F A;  4ZVI A;  3WU5 A;  4P52 A;  3ZM7 A;  1IBK E;  3ZZU A;  2R3V A;  4DR7 E;  2V86 A;  1FNM A;  2E1R A;  4DU8 A;  4DR1 I;  2A2D A;  1DQ3 A;  1ZM9 A;  1KIJ A;  1NHH A;  4IZJ A;  3ADI A;  4USK A;  1DAR A;  1QU6 A;  1X49 A;  4DR3 I;  4PU9 A;  2ZM6 I;  4X64 E;  4Z7C A;  2B9D A;  1GQE A;  3ADG A;  4JV5 I;  2R42 A;  2LJP A;  1XMQ I;  1YYK A;  2BM1 A;  5IT9 Q;  3P06 A;  3ZKD A;  4DV4 E;  3J7Y p;  4DV7 E;  4LF9 E;  2ODR C;  4HAC A;  4JI0 I;  2B3T B;  5LMU E;  1U2R A;  2JVA A;  4DV5 I;  4LFC E;  2DEI A;  4M0V A;  1N33 I;  2HFU A;  5AE2 A;  5IT9 C;  4WYQ B;  4X65 E;  1N36 E;  3OTO I;  4LF8 E;  1GZ6 A;  2VQF E;  1FJG E;  4DR4 E;  2X7I A;  1RQ0 A;  5L3J A;  4WSP A;  2JR1 A;  4ED4 A;  2HHH E;  1FWL A;  4DUY E;  2OI2 A;  4LF7 I;  3WU6 A;  3QT5 A;  4DR7 I;  2CGE A;  3ZOQ B;  3PYD A;  4LU9 A;  1T4N A;  3PYF A;  3PYE A;  4FWG A;  3T1H E;  3H4L A;  4GKJ E;  4B3T I;  5IWA E;  2M4I A;  2L33 A;  4P78 A;  3WU4 A;  4LFA E;  4X8W A;  1OJ4 A;  2VF1 A;  2LTS A;  5BR8 I;  3F6G A;  2H36 X;  2CG9 A;  1T4O A;  4URL A;  4I3H A;  4DV4 I;  4B3S E;  4DV7 I;  2EWL A;  4LF9 I;  4L5N C;  3JAM Q;  1XMO E;  3C4B A;  4DXL A;  3GON A;  2V88 A;  1VIS A;  3K85 A;  4LFC I;  4WUB A;  4YHH I;  1IBL I;  1HNX I;  4M30 A;  2V83 A;  4AQY I;  1B62 A;  3V5R A;  2UXD E;  3JAM C;  2Z5C A;  4WUD A;  5AE3 A;  2XEX A;  1RC7 A;  2ZBK B;  4R1F A;  4DUZ I;  2UUA I;  1KKH A;  1FI4 A;  1ZXN A;  4GKK E;  2NA2 A;  1Z5C A;  3K17 A;  1D6T A;  1UHZ A;  4TUG A;  1X48 A;  4DUY I;  4DR3 E;  2ZIT A;  2ZM6 E;  3ZZ0 A;  4PRX A;  2F4V I;  1S16 A;  4JI2 I;  1T4L B;  4BC9 A;  4JV5 E;  1IBM E;  2VQE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...