5IT9C

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5it9C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9C02
1ZM9A 4DV3I 4LF9I 3WU4A 4JI0I 3QT8A 5IWAI 1RREA 1BKNA 1DARA 4ZVIA 4JI7E 3CWVA 4JI3I 1XNRE 1WUUA 4DR3I 3H4LA 1ZM4A 3J7AM 4DPTA 4X62E 4HXZA 4JV5I 4DV7E 4DUYI 4YY3I 2NPFA 1Z0GA 5L3JA 4DPXA 4DV3E 1HNXI 4WUBA 3ZZUA 4HY1A 3T1YI 4DR6I 1ZXNA 4URLA 4FN5A 4DPWA 4K0KE 4OX9I 4DR7E 2A2DA 4X62I 1FJGE 4GKJE 4NXNE 4DR1I 4R1FA 1EI1A 4DR4I 4I3HA 2BV3A 1KKHA 2UXCE 4PU9A 4YY3E 2HFSA 5IWAE 4ED4A 2EFGA 4DV2E 3T1HI 4DU8A 1N36I 1Z0BA 3HULA 2WW4A 1N34E 4DR2E 4MYUA 4USMA 4USKA 4JI4I 1HR0E 4JV5E 2OI2A 4KQVA 4DR6E 1FI4A 1FNMA 4KHPI 1N32E 2V2ZA 2HKJA 4JI2E 4EMDA 4LF6E 4WUCA 3J81Q 4JI1E 4AQYI 1N0UA 2UUAE 1XNQI 4GKKI 4PRXA 1HNZE 4X65I 4JI3E 5LMUE 5BR8E 1Z5CA 3OTOI 2HK3A 2E5LE 4DU7A 4DV1I 2UUCE 1ZM2A 3QT5A 4PRVA 3WU6A 3WU3A 1EA6A 4DV5E 4LF7I 1B62A 4HACB 1IBKI 4LF4E 2UXBE 4DV0E 1N32I 1H72C 2HHHI 4YHHI 2LJPA 1IBLE 4AQYE 4FW9A 2HFUA 2F4VE 2A2CA 4JYAE 1H74A 4P7AA 3D4JA 4X64I 3J81C 1FWKA 3PYEA 4JI4E 1S4EA 1XMQE 2AJ4A 2X7IA 2V8PA 1QZRA 4JI2I 1I94E 4X66I 1ZXMA 4LFCI 3QT7A 1NHIA 4UTGA 4XTJA 1IBKE 1OJ4A 4B3TE 1NZ0A 1HNZI 4DV0I 5IT9Q 1Z0TA 2E5LI 3WU5A 2VQEE 1N36E 3M6AA 2HHHE 3V5RA 1PVGA 2F4VI 5IT9C 4UT4A 1S16A 4B3MI 2UU9I 4B3SE 3ZZ0A 5A2QC 4LF8E 2ZM6I 1XNQE 3JAMC 4JI8E 3PYFA 1H7UA 4X66E 1J5EE 4DV1E 1XHKA 1RR9A 5A2QQ 4P52A 3OTOE 5LMNE 2UUCI 3LPSA 3LTOA 1H73A 1H7SA 2E1RA 4JI7I 1UEKA 4Z7CA 4LF7E 4HYMA 2X36A 2UU9E 4B3SI 4LF9E 4B3TI 1Z59A 4JI0E 2ZITA 2GS8A 4RPFA 4DR3E 1Z0EA 4X64E 1XMQI 4DV2I 4LFBE 1N0VC 1HNWE 4LF5E 1NHHA 4B3ME 1I94I 3Q1QA 3K1JA 4DUYE 4LFAE 2VF3A 4NXNI 1KIJA 2BM1A 3B8HA 4DPUA 4JI1I 5LL6R 3K17A 3QT6A 4JG4A 1D6TA 4GKKE 1MU5A 1N34I 2V2VA 3J80Q 4DPYA 4K0KI 3T1HE 1Z0WA 2BM0A 4FWHA 1FJGI 1HR0I 4LF8I 4FWGA 4DR2I 4LF5I 1Z5AA 2R42A 4HACA 4DV5I 1N33I 1MG7A 4LF6I 3V2UC 3F0NA 5LMNI 1VISA 4YHHE 5GMDA 4X65E 5LMUI 4B3RE 2DEIA 1ELOA 1Z5BA 2V34A 3ZZTA 1IBMI 4M1KA 4DV4I 3PYGA 3PYDA 3B82A 2DEJA 2UUAI 4DUZI 1B63A 4LF4I 4FWDA 3J80C 5BR8I 4LFCE 2CZ9A 4DR5E 1PIEA 2UXDE 3LNUA 1KTVA 4LFBI 2Q2EB 4JI5E 3JAMQ 1HNWI 4JYAI 1Z0VA 3J7AG 2UUBE 2HK2A 1MX0A 4JI6I 2UXBI 5FLXC 2VQFE 4NXMI 3ZM7A 1Z0CA 3B78A 3GONA 3ZKBA 4JI8I 1PKPA 1KVKA 2XEXA 4DR5I 2J7KA 1HNXE 4B3RI 1FWLA 5GMEA 4DV6E 1XMOE 1IBME 4DXLA 3ZKDA 4MYTA 4DR1E 1N33E 1IBLI 2VQEI 2ZM6E 2VQFI 2V2QA 4DR4E 1ZM3A 1J5EI 4Z7YA 1FKAE 1XNRI 4JI5I 4WUDA 5FLXQ 3T1YE 1U2RA 4DV7I 2HKEA 2ZBKB 2R3VA 2UUBI 4DV4E 4OX9E 4DR7I 1NHJA 4DUZE 1K47A 4DV6I 1XMOI 1A6FA 4JI6E 4NXME 4LFAI 4KHPE 4GKJI 2UXDI 2UXCI
chains in the Genus database with same CATH superfamily
2EZ6A 1ZM9A 2RQLA 2EM9A 4DV3I 4LF9I 2NN6A 4OO1D 1ZAAC 2YPNA 4JI0I 3WU4A 3QT8A 4USMA 2L92A 5IWAI 3KWRA 4MU3A 1UHZA 2NABA 4ZYEA 1P47A 1RREA 2JE6A 1BKNA 1DARA 1OYPA 4BHBA 2EN1A 1YYKA 2JOBA 4ZVIA 4N3OA 4JI7E 3CWVA 5EL9A 4JI3I 2PRTA 3M7ND 1XNRE 1GQEA 2JE6B 2NN6C 1WUUA 4DR3I 3H4LA 2CTDA 3THNA 5K36F 1ZM4A 4GQUA 3J7AM 2ADRA 4DPTA 4X62E 4WYQB 4L5NC 3VK6A 5JEAE 4HXZA 3ADIA 1EH7A 4JV5I 4DV7E 5A6JA 4DUYI 1B69A 2FV4B 1WHNA 3KZZA 1WXRA 3KZYA 4R2SA 4YY3I 2NPFA 2V88A 2HGHA 2EPPA 1Z0GA 2DLKA 2MC5A 2EPRA 5L3JA 4IFDB 2RTXA 4O43A 3H1CA 4DV3E 3M99B 4DPXA 2EMXA 2J7JA 1UDOA 5DNXA 4BBYA 4WUBA 1HNXI 3ZZUA 1X47A 4M0VA 3F6GA 4MDTA 4HY1A 5JEAA 1DI2A 3T1YI 2V85A 2YTFA 4WXCA 3P06A 4DR6I 1IMUA 1ZXNA 2JEAB 3F6HA 2EPUA 2AE8A 4URLA 3THOB 4IFDF 4FN5A 2G7HA 4DPWA 4WPYA 5KL2A 4K0KE 4DR7E 4OX9I 2A2DA 2NA2A 3CDIA 3P76A 5KL6A 4X62I 1FJGE 4Q28A 4IFDD 3MSWA 4O5GA 1X6EA 4NXNE 2L2MA 4GKJE 2M1SA 4DR1I 2YRMA 2BR2A 2L3JA 2EMYA 4R1FA 1EI1A 2LT7A 4DR4I 4I3HA 2B9DA 2BV3A 3EPKA 1A1GA 1L4SA 1KKHA 2UXCE 4PU9A 3AV0A 4YY3E 2JT2A 2EMIA 2L2KB 5K36B 2LVHA 2HFSA 4IZKB 4P78A 2WCC3 2H36X 1NEIA 2A25A 5IWAE 1E3HA 4ED4A 4FW6A 2EFGA 4DV2E 4M2ZA 1NCSA 2ENCA 5DNYA 4DU8A 3T1HI 1Z0BA 1N36I 2IOPA 2WW4A 2EMCA 2VRDA 2EMHA 5A6AA 1N34E 3HULA 2EM5A 4AIDA 4DR2E 4MYUA 1F2IG 1WRJA 1IQOA 1Y5YA 2WP8B 4USKA 1RMDA 1HR0E 4JV5E 1YYWA 4IZJA 4ZYHA 2V87A 2OI2A 4KQVA 1PDAA 1ZR9A 5CFFE 1YYOA 3OMLA 1A1LA 4DR6E 1FI4A 1GZ6A 1YPNA 1FNMA 4KHPI 1N32E 2V2ZA 2PO2B 1UILA 2JY9A 4IJDA 2EWLA 4DKKA 1G2FC 2HKJA 4JI2E 3C6MA 2JXPA 4EMDA 1A1IA 2EN8A 4LF6E 4WUCA 3J81Q 2RPCA 4JI1E 5AC5A 1VI7A 4AQYI 2EN6A 4HTGA 5DRPA 1N0UA 2UUAE 4F9CB 1XNQI 2EM8A 2ODRC 4GKKI 4F6NA 3VYYA 1HNZE 4PRXA 5LMUE 4JI3E 5BR8E 4FW3A 4X65I 5K36C 2B7VA 1Z5CA 4F6MA 3OTOI 3ADGA 2HK3A 2E1MA 3DF6A 2E5LE 2C38A 2GO3A 1EH6A 2UUCE 4OKGA 4DU7A 2V86A 3L7ZB 3M85G 4DV1I 3PS1A 2YTEA 4BS9A 1PJQA 5DRQA 1Y4UA 1ZM2A 2ENHA 3ADJA 4ZYDA 4BHCA 2EMKA 2GLIA 3QT5A 3P3CA 2EOQA 1OYSA 4PRVA 3WU6A 3WU3A 1QU6A 2WBTA 1EA6A 2YTJA 4DV5E 2EMBA 4BA1A 1B62A 4LF7I 2I9IA 2M4IA 4HACB 2EORA 1IBKI 3HJCA 2LV2A 4LF4E 2UXBE 4DV0E 2IOQA 1N32I 4U3BA 2MC6A 5IV8B 4OO1B 4MU0A 1X49A 1H72C 4QNKA 2HHHI 2CGEA 4YHHI 2LJPA 1IBLE 4MQYA 4AQYE 2NN6D 2PO1A 4FW9A 2HFUA 2F4VE 2A2CA 1Y60A 4JYAE 3VYXA 1H74A 2PO0A 1T4NA 4P7AA 1N3GA 4IZJB 5DROA 2BA1G 3D4JA 4X64I 2NUGA 1HK7A 4KWYA 1WJPA 3J81C 3P3EA 1FWKA 3M85D 4AIMA 3PYEA 4JI4E 1S4EA 3C4TA 1XMQE 2AJ4A 1GTKA 2X7IA 2V8PA 4P7DA 1QZRA 2V89A 4JI2I 1I94E 2EOFA 4X66I 1ZXMA 4LFCI 2FTXB 3QT7A 2EPNA 2EMAA 2YU5A 1NHIA 2DSYA 2EQ1A 4UTGA 2YRHA 4XTJA 5JEAC 3U1YA 1X6FA 5C0XD 1IBKE 1OJ4A 2R1FA 4IZKA 3IWBA 2RSMA 2KONA 4B3TE 1NZ0A 1OYRA 1HNZI 1UBDC 2BA1D 4DV0I 5IT9Q 1Z0TA 3VHTB 2E5LI 1X6HA 2EM0A 2C39B 3WU5A 1A1FA 1UDSA 3MHSC 2VQEE 4NBQA 1SR9A 2YTOA 4R2DA 1N36E 2HHHE 3M6AA 5K36A 4J8ZA 2E72A 2JR1A 2EM7A 3V5RA 2Z5BB 2YTDA 1T39A 2I13A 1PVGA 4ISAA 4OZEA 2F4VI 2KOUA 5ELWA 2EPZA 2F1DA 3HPZA 3P1XA 4R2EA 3QG5C 5IT9C 4UT4A 1T4OA 1S16A 4B3MI 4B3SE 2UU9I 3ZZ0A 2N8XA 5A2QC 4GZNC 2L8TA 4LF8E 1E3PA 2JEBB 3UK3C 2ZM6I 2EPCA 3ECRA 2C39A 1XNQE 2YTNA 4DMIA 2K7IA 4JI8E 3JAMC 1T4LB 4LPFA 4LU9A 3Q6MA 2EN2A 3PYFA 4X66E 2NUFA 2CPNA 1H7UA 1XXEA 4OO1F 2L6MA 2MDGA 1J5EE 4DV1E 4BC7A 1XHKA 2O1TA 2PNMA 2BBGA 2EQ0A 4R2QA 1RR9A 2C38B 4P52A 5A2QQ 3OTOE 2HJJA 3K6QA 4N4RB 1RHYA 4R2AA 5LMNE 1AH5A 2UUCI 4BA2A 2MKDA 2D9HA 5KL5A 2Z5EA 3LPSA 3C4BA 2YSPA 3LTOA 1H73A 1H7SA 2E1RA 2EOYA 4JI7I 2DMIA 2WNRB 1UEKA 2V83A 3IWCA 1T38A 3HTXA 2V8QB 2EOZA 4LF7E 4Z7CA 3GCMA 4BA1B 2DGCA 4QNJA 4F2JC 3J7Yp 1QNTA 1R6MA 4HYMA 2N3HA 2X36A 1O0WA 3BGHA 2LCEA 5DNLA 2EJ4A 2UU9E 4B3SI 4WSPA 2EOSA 4O24A 2CSHA 4LF9E 3JTZA 4B3TI 2VE7C 1Z59A 2VESA 2EPLX 4JI0E 2Z5CA 2C37B 4OO1A 2GO4A 2YT4A 5AE3A 2O1VA 3GLLA 2ZITA 4R2PA 4TUGA 1BBOA 2GS8A 1MGTA 4RPFA 3FIGA 4NZVA 2BB8A 5KL4A 4BCAA 4F9AB 4DR3E 1YH8A 1Z0EA 2O3ZA 3B4TA 4LCGA 1Y4SA 3P3GA 2ENAA 1DGCA 3AUZA 3IWDA 4X64E 3EPHA 1XMQI 4DV2I 2LBSB 1TF3A 3M7NG 4LFBE 1HNWE 1N0VC 1X3CA 4LF5E 2EM2A 1NHHA 1RC7A 4B3ME 4F54A 1A1KA 5ADZA 1I94I 3Q1QA 2M9AA 4DUYE 1X5WA 3K1JA 2Z5CB 3KRNA 4FW4A 4MLQA 4LFAE 4LCFA 2JP9A 2VF3A 4WXDA 2NN6B 3PS3A 4LCHA 4OO1E 4F9BB 1MEYC 1BBGA 4NXNI 2RS6A 1STUA 2YTIA 2WBSA 1KIJA 3HPSA 5AC4A 2BM1A 3B8HA 4DPUA 2DMYA 1BB8A 4IFDC 1YZ9A 2GHFA 4RH8A 4HEIA 3UHMA 2YTPA 2LE2A 3C6KA 3K85A 4BA2B 4FW7A 2DRPA 2KHXA 4JI1I 5LL6R 3K17A 3QT6A 2EN4A 2Z5BA 4JG4A 1D6TA 1KJKA 4GKKE 4BC9A 2EPKX 1ZBQA 2EL4A 3NZKA 1MU5A 4IFDA 2IHR1 4TUIA 1N34I 2V2VA 3J80Q 1IQSA 2R76A 2PO1B 2JPAA 4DPYA 4K0KI 3T1HE 4FW5A 4IS1C 1Z0WA 2BM0A 4FWHA 1FJGI 1SFEA 2EMFA 1HR0I 2WBUA 2GPIA 4R2RA 4FWGA 4DR2I 4LF5I 1Z5AA 4LF8I 2Q8UA 2YTGA 1ZU1A 1YSAC 2NN6E 1YUIA 5AASA 1DQ3A 2R42A 2EOJA 2EPAA 4M30A 4M9VC 4HACA 4DV5I 1UDQA 3EPJA 4R8OA 1N33I 2LUQA 1PJSA 2N3GA 2EMZA 1X48A 2EM4A 2LJUA 3HKMA 1MG7A 4X9JA 4LF6I 2JOXA 5AE2A 3V2UC 1USUA 3U1KA 3F0NA 5LMNI 2JEAA 4MLVA 1EH8A 1UDNA 3DD6A 1AAYA 2YSOA 4OO1C 2DIXA 4ZYGA 2C37A 2EOIA 1VISA 2EM6A 4YHHE 2EL6A 1LLMC 5GMDA 4X65E 5LMUI 2EE8A 4B3RE 2BA0G 2YWQA 3EPLA 4O4KA 5IXMB 2DEIA 5C0XE 1ELOA 2IERA 1Z5BA 2BR2B 2WNRA 2V34A 3PRYA 4R03A 4LOMA 2EMGA 2PO0B 2JYAA 3ZZTA 2LRSA 1IBMI 5LLQA 3PS2A 3LLHA 2O1UA 1A1HA 1JK2A 4M1KA 2B3TB 4DV4I 3PYGA 3PYDA 2LUPB 3B82A 2J65A 1P42A 2ODRD 1KYQA 4WX9A 2DEJA 1B63A 2ELYA 4DUZI 2UUAI 4FWDA 4LF4I 5K36D 3GMEA 3J80C 5BR8I 2YU8A 4LFCE 2CT1A 2EPMX 4WSGA 3Q6NA 4RHBB 4MU4A 2CZ9A 4DR5E 2LTRA 1G2DC 2UXDE 1PIEA 3LNUA 2JVAA 1JK1A 1A1JA 1YUJA 2EN3A 2RS7A 3DJWA 2WP8A 3CDJA 1KTVA 3BBGA 4BMJA 4LFBI 5T6JA 1EKZA 4KZSA 2DB2A 2Q2EB 4JI5E 3JAMQ 2M7QA 1HNWI 2DLQA 2O1WA 5K36E 4JYAI 3BIDA 1Z0VA 5JEAF 2F8BA 2FGGA 2MDRA 4LTYA 5FWKA 2PO2A 3J7AG 2UUBE 1TN9A 2YRKA 2HK2A 1MX0A 4JI6I 4FK5C 2UXBI 3HXLA 2EOXA 5FLXC 2NUEA 5A6BD 5A69A 2VQFE 3L00A 2EN7A 2K4VA 4NXMI 4L8NA 5EKWA 3ZM7A 1Y6ZA 3L7ZA 2EOHA 1Z0CA 1R6LA 2JEBA 3B78A 4IS9A 3GONA 2L2NA 3ZKBA 5F3WA 4JI8I 2B7TA 4OOGC 1PKPA 1KVKA 2CG9A 2ELZA 5C0XC 1WHQA 2MKNA 2XEXA 2LMZA 2EM3A 2EL5A 2J7KA 4DR5I 2YZTA 1HNXE 4B3RI 2LO3A 1Z1BA 1FWLA 2JWOA 5TSEA 5GMEA 1RQ0A 2BA0D 4IZJD 3TQMA 2PNZA 3RMPA 4U3DA 4I8OA 2EMLA 3ZOQB 4DV6E 1XMOE 1IBME 2PNZB 5JEAD 2EPOA 4WFTA 3LMLA 4DXLA 2NN6F 3ZKDA 2EMWA 2IESA 1J26A 4MYTA 2YTQA 5KL3A 1ZBTA 4DR1E 2VF1A 1N33E 2GQ0A 2EQ3A 1UN6B 5AE1A 1YHCA 1IBLI 2VQEI 2ZM6E 5DRRA 3EQ1A 2EP3A 2PNLA 5C0XB 5JEAB 3H09A 4NHRA 2V2QA 2VQFI 4DR4E 2HC5A 1ZM3A 4Z7YA 1J5EI 2RSIA 1YFHA 1FKAE 2EOEA 3MHHC 1XNRI 2LTSA 5A6BA 4X8WA 5C0XA 4JI5I 2LJHA 1TF6A 4WUDA 5FLXQ 3T1YE 5A6KA 1U2RA 1USVA 4DV7I 4Q35B 5C0XF 2HKEA 2EOMA 3BF2A 2WZOA 2R3VA 2ZBKB 2EPXA 2UUBI 4DV4E 2L3CA 4OX9E 3ADLA 4AM3A 4DR7I 1NHJA 4IFDE 4DUZE 4JI4I 1PJTA 4GEQB 2CVEA 2L33A 1K47A 4DV6I 1XMOI 4R2CA 1A6FA 4MU1A 3JU0A 4JI6E 3HQ1A 4NXME 4LFAI 4KHPE 4GKJI 4J3DA 2UXDI 2UXCI 2EOOA 5KL7A
chains in the Genus database with same CATH topology
2EZ6A 1ZM9A 4DV3I 4LF9I 3WU4A 4JI0I 3QT8A 2L92A 5IWAI 3KWRA 1UHZA 1RREA 1BKNA 1DARA 1YYKA 2JOBA 4ZVIA 4N3OA 4JI7E 3CWVA 4JI3I 1XNRE 1GQEA 1WUUA 4DR3I 3H4LA 1ZM4A 3J7AM 4DPTA 4X62E 4WYQB 4L5NC 3VK6A 4HXZA 3ADIA 4JV5I 4DV7E 4DUYI 2FV4B 1WHNA 1WXRA 4YY3I 2NPFA 2V88A 1Z0GA 2MC5A 5L3JA 2RTXA 4DV3E 4DPXA 4BBYA 4WUBA 1HNXI 3ZZUA 1X47A 4M0VA 3F6GA 4HY1A 3T1YI 1DI2A 2V85A 3P06A 4DR6I 1ZXNA 3F6HA 4URLA 4FN5A 2G7HA 4DPWA 4WPYA 4K0KE 4DR7E 4OX9I 2A2DA 2NA2A 4X62I 1FJGE 4Q28A 3MSWA 4GKJE 4NXNE 2L2MA 2M1SA 4DR1I 2L3JA 4R1FA 1EI1A 4DR4I 4I3HA 2B9DA 2BV3A 1KKHA 2UXCE 4PU9A 3AV0A 4YY3E 2L2KB 2HFSA 4IZKB 4P78A 2H36X 5IWAE 4ED4A 2EFGA 4DV2E 4M2ZA 3T1HI 5DNYA 4DU8A 1N36I 1Z0BA 2IOPA 2WW4A 3HULA 1N34E 4DR2E 4MYUA 4USMA 4USKA 4JI4I 1HR0E 4JV5E 1YYWA 4IZJA 2OI2A 2V87A 4KQVA 4DR6E 5CFFE 1YYOA 3OMLA 1FI4A 1GZ6A 1FNMA 4KHPI 1N32E 2V2ZA 1UILA 2JY9A 2EWLA 4DKKA 2HKJA 4JI2E 4EMDA 4LF6E 4WUCA 3J81Q 4JI1E 4AQYI 1N0UA 2UUAE 4F9CB 1XNQI 2ODRC 4GKKI 4PRXA 3VYYA 1HNZE 5LMUE 4JI3E 5BR8E 4X65I 2B7VA 1Z5CA 3OTOI 3ADGA 2HK3A 2E1MA 3DF6A 2E5LE 4DU7A 2UUCE 4DV1I 2V86A 4BS9A 1Y4UA 1ZM2A 3ADJA 3QT5A 4PRVA 3WU6A 3WU3A 1QU6A 1EA6A 4DV5E 4LF7I 1B62A 2M4IA 4HACB 1IBKI 3HJCA 4LF4E 2UXBE 4DV0E 2IOQA 1N32I 2MC6A 1X49A 1H72C 2HHHI 2CGEA 4YHHI 2LJPA 1IBLE 4AQYE 4FW9A 2HFUA 2F4VE 2A2CA 4JYAE 3VYXA 1H74A 1T4NA 4P7AA 4IZJB 3D4JA 4X64I 2NUGA 1HK7A 3J81C 1FWKA 3PYEA 4JI4E 1S4EA 3C4TA 1XMQE 2AJ4A 2X7IA 2V8PA 4P7DA 1QZRA 2V89A 4JI2I 1I94E 4X66I 1ZXMA 4LFCI 2FTXB 3QT7A 1NHIA 2DSYA 4UTGA 4XTJA 1IBKE 1OJ4A 4IZKA 3IWBA 2RSMA 2KONA 4B3TE 1NZ0A 1HNZI 4DV0I 5IT9Q 1Z0TA 2E5LI 3WU5A 2VQEE 1SR9A 1N36E 3M6AA 2HHHE 4J8ZA 2JR1A 3V5RA 2Z5BB 1PVGA 2F4VI 2KOUA 3HPZA 3P1XA 5IT9C 4UT4A 1T4OA 1S16A 4B3MI 4B3SE 2UU9I 3ZZ0A 5A2QC 4LF8E 2L8TA 2ZM6I 1XNQE 4DMIA 4JI8E 3JAMC 1T4LB 4LU9A 3Q6MA 3PYFA 4X66E 2NUFA 2CPNA 1H7UA 2L6MA 1J5EE 4DV1E 4BC7A 1XHKA 2O1TA 2PNMA 1RR9A 5A2QQ 4P52A 3OTOE 3K6QA 5LMNE 2UUCI 2Z5EA 3LPSA 3C4BA 3LTOA 1H73A 1H7SA 2E1RA 4JI7I 1UEKA 2V83A 3IWCA 3HTXA 2V8QB 4Z7CA 4LF7E 3J7Yp 4HYMA 2N3HA 2X36A 1O0WA 2UU9E 4B3SI 4WSPA 4LF9E 3JTZA 4B3TI 2VE7C 1Z59A 2Z5CA 4JI0E 2YT4A 5AE3A 2O1VA 2ZITA 4TUGA 2GS8A 4RPFA 3FIGA 4DR3E 4BCAA 4F9AB 1Z0EA 1Y4SA 3AUZA 3IWDA 4X64E 1XMQI 4DV2I 2LBSB 4LFBE 1HNWE 1N0VC 4LF5E 1NHHA 1RC7A 4B3ME 4F54A 1I94I 5ADZA 3Q1QA 4DUYE 3K1JA 2Z5CB 4LFAE 2VF3A 4F9BB 4NXNI 2RS6A 1STUA 1KIJA 3HPSA 2BM1A 3B8HA 4DPUA 2DMYA 3K85A 2LE2A 2KHXA 4JI1I 5LL6R 3K17A 3QT6A 2Z5BA 4JG4A 1D6TA 4GKKE 4BC9A 1ZBQA 1MU5A 2IHR1 4TUIA 1N34I 2V2VA 3J80Q 4DPYA 4K0KI 3T1HE 1Z0WA 2BM0A 4FWHA 1FJGI 1HR0I 4LF8I 4FWGA 4DR2I 4LF5I 1Z5AA 5AASA 1DQ3A 2R42A 4M30A 4HACA 4DV5I 4R8OA 1N33I 2LUQA 2N3GA 1X48A 1MG7A 4LF6I 2JOXA 5AE2A 3V2UC 1USUA 3F0NA 5LMNI 2DIXA 1VISA 4YHHE 5GMDA 4X65E 5LMUI 4B3RE 2DEIA 1ELOA 3PRYA 1Z5BA 2V34A 3ZZTA 4R03A 2LRSA 1IBMI 3LLHA 2O1UA 4M1KA 2B3TB 4DV4I 3PYGA 3PYDA 2LUPB 3B82A 2ODRD 2DEJA 2UUAI 4DUZI 1B63A 4LF4I 4FWDA 3J80C 5BR8I 4LFCE 3Q6NA 2CZ9A 4DR5E 2LTRA 2UXDE 1PIEA 3LNUA 2JVAA 2RS7A 3DJWA 1KTVA 4BMJA 4LFBI 5T6JA 1EKZA 4KZSA 2DB2A 2Q2EB 4JI5E 3JAMQ 2M7QA 1HNWI 2O1WA 4JYAI 1Z0VA 2F8BA 2FGGA 2MDRA 4LTYA 5FWKA 3J7AG 2UUBE 2HK2A 1MX0A 4JI6I 2UXBI 3HXLA 5FLXC 2NUEA 2VQFE 2K4VA 4NXMI 4L8NA 3ZM7A 1Y6ZA 1Z0CA 3B78A 3GONA 2L2NA 3ZKBA 5F3WA 4JI8I 2B7TA 4OOGC 1PKPA 1KVKA 2CG9A 1WHQA 2XEXA 2LMZA 4DR5I 2J7KA 2YZTA 1HNXE 4B3RI 1FWLA 2JWOA 5GMEA 1RQ0A 4IZJD 3RMPA 4I8OA 3ZOQB 4DV6E 1XMOE 1IBME 4WFTA 3LMLA 4DXLA 3ZKDA 1J26A 4MYTA 1ZBTA 4DR1E 2VF1A 1N33E 2GQ0A 5AE1A 1IBLI 2VQEI 2ZM6E 2PNLA 3H09A 2V2QA 2VQFI 4DR4E 1ZM3A 1J5EI 4Z7YA 1FKAE 1XNRI 2LTSA 4X8WA 4JI5I 2LJHA 4WUDA 5FLXQ 3T1YE 1U2RA 1USVA 4DV7I 2HKEA 2ZBKB 2R3VA 2WZOA 2UUBI 4DV4E 2L3CA 4OX9E 3ADLA 4DR7I 1NHJA 4DUZE 4GEQB 2L33A 1K47A 4DV6I 1XMOI 1A6FA 3JU0A 4JI6E 3HQ1A 4NXME 4LFAI 4KHPE 4GKJI 2UXDI 2UXCI 1YZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM9 A;  4DV3 I;  4LF9 I;  3WU4 A;  4JI0 I;  3QT8 A;  5IWA I;  1RRE A;  1BKN A;  1DAR A;  4ZVI A;  4JI7 E;  3CWV A;  4JI3 I;  1XNR E;  1WUU A;  4DR3 I;  3H4L A;  1ZM4 A;  3J7A M;  4DPT A;  4X62 E;  4HXZ A;  4JV5 I;  4DV7 E;  4DUY I;  4YY3 I;  2NPF A;  1Z0G A;  5L3J A;  4DPX A;  4DV3 E;  1HNX I;  4WUB A;  3ZZU A;  4HY1 A;  3T1Y I;  4DR6 I;  1ZXN A;  4URL A;  4FN5 A;  4DPW A;  4K0K E;  4OX9 I;  4DR7 E;  2A2D A;  4X62 I;  1FJG E;  4GKJ E;  4NXN E;  4DR1 I;  4R1F A;  1EI1 A;  4DR4 I;  4I3H A;  2BV3 A;  1KKH A;  2UXC E;  4PU9 A;  4YY3 E;  2HFS A;  5IWA E;  4ED4 A;  2EFG A;  4DV2 E;  3T1H I;  4DU8 A;  1N36 I;  1Z0B A;  3HUL A;  2WW4 A;  1N34 E;  4DR2 E;  4MYU A;  4USM A;  4USK A;  4JI4 I;  1HR0 E;  4JV5 E;  2OI2 A;  4KQV A;  4DR6 E;  1FI4 A;  1FNM A;  4KHP I;  1N32 E;  2V2Z A;  2HKJ A;  4JI2 E;  4EMD A;  4LF6 E;  4WUC A;  3J81 Q;  4JI1 E;  4AQY I;  1N0U A;  2UUA E;  1XNQ I;  4GKK I;  4PRX A;  1HNZ E;  4X65 I;  4JI3 E;  5LMU E;  5BR8 E;  1Z5C A;  3OTO I;  2HK3 A;  2E5L E;  4DU7 A;  4DV1 I;  2UUC E;  1ZM2 A;  3QT5 A;  4PRV A;  3WU6 A;  3WU3 A;  1EA6 A;  4DV5 E;  4LF7 I;  1B62 A;  4HAC B;  1IBK I;  4LF4 E;  2UXB E;  4DV0 E;  1N32 I;  1H72 C;  2HHH I;  4YHH I;  2LJP A;  1IBL E;  4AQY E;  4FW9 A;  2HFU A;  2F4V E;  2A2C A;  4JYA E;  1H74 A;  4P7A A;  3D4J A;  4X64 I;  3J81 C;  1FWK A;  3PYE A;  4JI4 E;  1S4E A;  1XMQ E;  2AJ4 A;  2X7I A;  2V8P A;  1QZR A;  4JI2 I;  1I94 E;  4X66 I;  1ZXM A;  4LFC I;  3QT7 A;  1NHI A;  4UTG A;  4XTJ A;  1IBK E;  1OJ4 A;  4B3T E;  1NZ0 A;  1HNZ I;  4DV0 I;  5IT9 Q;  1Z0T A;  2E5L I;  3WU5 A;  2VQE E;  1N36 E;  3M6A A;  2HHH E;  3V5R A;  1PVG A;  2F4V I;  5IT9 C;  4UT4 A;  1S16 A;  4B3M I;  2UU9 I;  4B3S E;  3ZZ0 A;  5A2Q C;  4LF8 E;  2ZM6 I;  1XNQ E;  3JAM C;  4JI8 E;  3PYF A;  1H7U A;  4X66 E;  1J5E E;  4DV1 E;  1XHK A;  1RR9 A;  5A2Q Q;  4P52 A;  3OTO E;  5LMN E;  2UUC I;  3LPS A;  3LTO A;  1H73 A;  1H7S A;  2E1R A;  4JI7 I;  1UEK A;  4Z7C A;  4LF7 E;  4HYM A;  2X36 A;  2UU9 E;  4B3S I;  4LF9 E;  4B3T I;  1Z59 A;  4JI0 E;  2ZIT A;  2GS8 A;  4RPF A;  4DR3 E;  1Z0E A;  4X64 E;  1XMQ I;  4DV2 I;  4LFB E;  1N0V C;  1HNW E;  4LF5 E;  1NHH A;  4B3M E;  1I94 I;  3Q1Q A;  3K1J A;  4DUY E;  4LFA E;  2VF3 A;  4NXN I;  1KIJ A;  2BM1 A;  3B8H A;  4DPU A;  4JI1 I;  5LL6 R;  3K17 A;  3QT6 A;  4JG4 A;  1D6T A;  4GKK E;  1MU5 A;  1N34 I;  2V2V A;  3J80 Q;  4DPY A;  4K0K I;  3T1H E;  1Z0W A;  2BM0 A;  4FWH A;  1FJG I;  1HR0 I;  4LF8 I;  4FWG A;  4DR2 I;  4LF5 I;  1Z5A A;  2R42 A;  4HAC A;  4DV5 I;  1N33 I;  1MG7 A;  4LF6 I;  3V2U C;  3F0N A;  5LMN I;  1VIS A;  4YHH E;  5GMD A;  4X65 E;  5LMU I;  4B3R E;  2DEI A;  1ELO A;  1Z5B A;  2V34 A;  3ZZT A;  1IBM I;  4M1K A;  4DV4 I;  3PYG A;  3PYD A;  3B82 A;  2DEJ A;  2UUA I;  4DUZ I;  1B63 A;  4LF4 I;  4FWD A;  3J80 C;  5BR8 I;  4LFC E;  2CZ9 A;  4DR5 E;  1PIE A;  2UXD E;  3LNU A;  1KTV A;  4LFB I;  2Q2E B;  4JI5 E;  3JAM Q;  1HNW I;  4JYA I;  1Z0V A;  3J7A G;  2UUB E;  2HK2 A;  1MX0 A;  4JI6 I;  2UXB I;  5FLX C;  2VQF E;  4NXM I;  3ZM7 A;  1Z0C A;  3B78 A;  3GON A;  3ZKB A;  4JI8 I;  1PKP A;  1KVK A;  2XEX A;  4DR5 I;  2J7K A;  1HNX E;  4B3R I;  1FWL A;  5GME A;  4DV6 E;  1XMO E;  1IBM E;  4DXL A;  3ZKD A;  4MYT A;  4DR1 E;  1N33 E;  1IBL I;  2VQE I;  2ZM6 E;  2VQF I;  2V2Q A;  4DR4 E;  1ZM3 A;  1J5E I;  4Z7Y A;  1FKA E;  1XNR I;  4JI5 I;  4WUD A;  5FLX Q;  3T1Y E;  1U2R A;  4DV7 I;  2HKE A;  2ZBK B;  2R3V A;  2UUB I;  4DV4 E;  4OX9 E;  4DR7 I;  1NHJ A;  4DUZ E;  1K47 A;  4DV6 I;  1XMO I;  1A6F A;  4JI6 E;  4NXM E;  4LFA I;  4KHP E;  4GKJ I;  2UXD I;  2UXC I; 
#chains in the Genus database with same CATH topology
 2EZ6 A;  1ZM9 A;  2RQL A;  2EM9 A;  4DV3 I;  4LF9 I;  2NN6 A;  4OO1 D;  1ZAA C;  2YPN A;  4JI0 I;  3WU4 A;  3QT8 A;  4USM A;  2L92 A;  5IWA I;  3KWR A;  4MU3 A;  1UHZ A;  2NAB A;  4ZYE A;  1P47 A;  1RRE A;  2JE6 A;  1BKN A;  1DAR A;  1OYP A;  4BHB A;  2EN1 A;  1YYK A;  2JOB A;  4ZVI A;  4N3O A;  4JI7 E;  3CWV A;  5EL9 A;  4JI3 I;  2PRT A;  3M7N D;  1XNR E;  1GQE A;  2JE6 B;  2NN6 C;  1WUU A;  4DR3 I;  3H4L A;  2CTD A;  3THN A;  5K36 F;  1ZM4 A;  4GQU A;  3J7A M;  2ADR A;  4DPT A;  4X62 E;  4WYQ B;  4L5N C;  3VK6 A;  5JEA E;  4HXZ A;  3ADI A;  1EH7 A;  4JV5 I;  4DV7 E;  5A6J A;  4DUY I;  1B69 A;  2FV4 B;  1WHN A;  3KZZ A;  1WXR A;  3KZY A;  4R2S A;  4YY3 I;  2NPF A;  2V88 A;  2HGH A;  2EPP A;  1Z0G A;  2DLK A;  2MC5 A;  2EPR A;  5L3J A;  4IFD B;  2RTX A;  4O43 A;  3H1C A;  4DV3 E;  3M99 B;  4DPX A;  2EMX A;  2J7J A;  1UDO A;  5DNX A;  4BBY A;  4WUB A;  1HNX I;  3ZZU A;  1X47 A;  4M0V A;  3F6G A;  4MDT A;  4HY1 A;  5JEA A;  1DI2 A;  3T1Y I;  2V85 A;  2YTF A;  4WXC A;  3P06 A;  4DR6 I;  1IMU A;  1ZXN A;  2JEA B;  3F6H A;  2EPU A;  2AE8 A;  4URL A;  3THO B;  4IFD F;  4FN5 A;  2G7H A;  4DPW A;  4WPY A;  5KL2 A;  4K0K E;  4DR7 E;  4OX9 I;  2A2D A;  2NA2 A;  3CDI A;  3P76 A;  5KL6 A;  4X62 I;  1FJG E;  4Q28 A;  4IFD D;  3MSW A;  4O5G A;  1X6E A;  4NXN E;  2L2M A;  4GKJ E;  2M1S A;  4DR1 I;  2YRM A;  2BR2 A;  2L3J A;  2EMY A;  4R1F A;  1EI1 A;  2LT7 A;  4DR4 I;  4I3H A;  2B9D A;  2BV3 A;  3EPK A;  1A1G A;  1L4S A;  1KKH A;  2UXC E;  4PU9 A;  3AV0 A;  4YY3 E;  2JT2 A;  2EMI A;  2L2K B;  5K36 B;  2LVH A;  2HFS A;  4IZK B;  4P78 A;  2WCC 3;  2H36 X;  1NEI A;  2A25 A;  5IWA E;  1E3H A;  4ED4 A;  4FW6 A;  2EFG A;  4DV2 E;  4M2Z A;  1NCS A;  2ENC A;  5DNY A;  4DU8 A;  3T1H I;  1Z0B A;  1N36 I;  2IOP A;  2WW4 A;  2EMC A;  2VRD A;  2EMH A;  5A6A A;  1N34 E;  3HUL A;  2EM5 A;  4AID A;  4DR2 E;  4MYU A;  1F2I G;  1WRJ A;  1IQO A;  1Y5Y A;  2WP8 B;  4USK A;  1RMD A;  1HR0 E;  4JV5 E;  1YYW A;  4IZJ A;  4ZYH A;  2V87 A;  2OI2 A;  4KQV A;  1PDA A;  1ZR9 A;  5CFF E;  1YYO A;  3OML A;  1A1L A;  4DR6 E;  1FI4 A;  1GZ6 A;  1YPN A;  1FNM A;  4KHP I;  1N32 E;  2V2Z A;  2PO2 B;  1UIL A;  2JY9 A;  4IJD A;  2EWL A;  4DKK A;  1G2F C;  2HKJ A;  4JI2 E;  3C6M A;  2JXP A;  4EMD A;  1A1I A;  2EN8 A;  4LF6 E;  4WUC A;  3J81 Q;  2RPC A;  4JI1 E;  5AC5 A;  1VI7 A;  4AQY I;  2EN6 A;  4HTG A;  5DRP A;  1N0U A;  2UUA E;  4F9C B;  1XNQ I;  2EM8 A;  2ODR C;  4GKK I;  4F6N A;  3VYY A;  1HNZ E;  4PRX A;  5LMU E;  4JI3 E;  5BR8 E;  4FW3 A;  4X65 I;  5K36 C;  2B7V A;  1Z5C A;  4F6M A;  3OTO I;  3ADG A;  2HK3 A;  2E1M A;  3DF6 A;  2E5L E;  2C38 A;  2GO3 A;  1EH6 A;  2UUC E;  4OKG A;  4DU7 A;  2V86 A;  3L7Z B;  3M85 G;  4DV1 I;  3PS1 A;  2YTE A;  4BS9 A;  1PJQ A;  5DRQ A;  1Y4U A;  1ZM2 A;  2ENH A;  3ADJ A;  4ZYD A;  4BHC A;  2EMK A;  2GLI A;  3QT5 A;  3P3C A;  2EOQ A;  1OYS A;  4PRV A;  3WU6 A;  3WU3 A;  1QU6 A;  2WBT A;  1EA6 A;  2YTJ A;  4DV5 E;  2EMB A;  4BA1 A;  1B62 A;  4LF7 I;  2I9I A;  2M4I A;  4HAC B;  2EOR A;  1IBK I;  3HJC A;  2LV2 A;  4LF4 E;  2UXB E;  4DV0 E;  2IOQ A;  1N32 I;  4U3B A;  2MC6 A;  5IV8 B;  4OO1 B;  4MU0 A;  1X49 A;  1H72 C;  4QNK A;  2HHH I;  2CGE A;  4YHH I;  2LJP A;  1IBL E;  4MQY A;  4AQY E;  2NN6 D;  2PO1 A;  4FW9 A;  2HFU A;  2F4V E;  2A2C A;  1Y60 A;  4JYA E;  3VYX A;  1H74 A;  2PO0 A;  1T4N A;  4P7A A;  1N3G A;  4IZJ B;  5DRO A;  2BA1 G;  3D4J A;  4X64 I;  2NUG A;  1HK7 A;  4KWY A;  1WJP A;  3J81 C;  3P3E A;  1FWK A;  3M85 D;  4AIM A;  3PYE A;  4JI4 E;  1S4E A;  3C4T A;  1XMQ E;  2AJ4 A;  1GTK A;  2X7I A;  2V8P A;  4P7D A;  1QZR A;  2V89 A;  4JI2 I;  1I94 E;  2EOF A;  4X66 I;  1ZXM A;  4LFC I;  2FTX B;  3QT7 A;  2EPN A;  2EMA A;  2YU5 A;  1NHI A;  2DSY A;  2EQ1 A;  4UTG A;  2YRH A;  4XTJ A;  5JEA C;  3U1Y A;  1X6F A;  5C0X D;  1IBK E;  1OJ4 A;  2R1F A;  4IZK A;  3IWB A;  2RSM A;  2KON A;  4B3T E;  1NZ0 A;  1OYR A;  1HNZ I;  1UBD C;  2BA1 D;  4DV0 I;  5IT9 Q;  1Z0T A;  3VHT B;  2E5L I;  1X6H A;  2EM0 A;  2C39 B;  3WU5 A;  1A1F A;  1UDS A;  3MHS C;  2VQE E;  4NBQ A;  1SR9 A;  2YTO A;  4R2D A;  1N36 E;  2HHH E;  3M6A A;  5K36 A;  4J8Z A;  2E72 A;  2JR1 A;  2EM7 A;  3V5R A;  2Z5B B;  2YTD A;  1T39 A;  2I13 A;  1PVG A;  4ISA A;  4OZE A;  2F4V I;  2KOU A;  5ELW A;  2EPZ A;  2F1D A;  3HPZ A;  3P1X A;  4R2E A;  3QG5 C;  5IT9 C;  4UT4 A;  1T4O A;  1S16 A;  4B3M I;  4B3S E;  2UU9 I;  3ZZ0 A;  2N8X A;  5A2Q C;  4GZN C;  2L8T A;  4LF8 E;  1E3P A;  2JEB B;  3UK3 C;  2ZM6 I;  2EPC A;  3ECR A;  2C39 A;  1XNQ E;  2YTN A;  4DMI A;  2K7I A;  4JI8 E;  3JAM C;  1T4L B;  4LPF A;  4LU9 A;  3Q6M A;  2EN2 A;  3PYF A;  4X66 E;  2NUF A;  2CPN A;  1H7U A;  1XXE A;  4OO1 F;  2L6M A;  2MDG A;  1J5E E;  4DV1 E;  4BC7 A;  1XHK A;  2O1T A;  2PNM A;  2BBG A;  2EQ0 A;  4R2Q A;  1RR9 A;  2C38 B;  4P52 A;  5A2Q Q;  3OTO E;  2HJJ A;  3K6Q A;  4N4R B;  1RHY A;  4R2A A;  5LMN E;  1AH5 A;  2UUC I;  4BA2 A;  2MKD A;  2D9H A;  5KL5 A;  2Z5E A;  3LPS A;  3C4B A;  2YSP A;  3LTO A;  1H73 A;  1H7S A;  2E1R A;  2EOY A;  4JI7 I;  2DMI A;  2WNR B;  1UEK A;  2V83 A;  3IWC A;  1T38 A;  3HTX A;  2V8Q B;  2EOZ A;  4LF7 E;  4Z7C A;  3GCM A;  4BA1 B;  2DGC A;  4QNJ A;  4F2J C;  3J7Y p;  1QNT A;  1R6M A;  4HYM A;  2N3H A;  2X36 A;  1O0W A;  3BGH A;  2LCE A;  5DNL A;  2EJ4 A;  2UU9 E;  4B3S I;  4WSP A;  2EOS A;  4O24 A;  2CSH A;  4LF9 E;  3JTZ A;  4B3T I;  2VE7 C;  1Z59 A;  2VES A;  2EPL X;  4JI0 E;  2Z5C A;  2C37 B;  4OO1 A;  2GO4 A;  2YT4 A;  5AE3 A;  2O1V A;  3GLL A;  2ZIT A;  4R2P A;  4TUG A;  1BBO A;  2GS8 A;  1MGT A;  4RPF A;  3FIG A;  4NZV A;  2BB8 A;  5KL4 A;  4BCA A;  4F9A B;  4DR3 E;  1YH8 A;  1Z0E A;  2O3Z A;  3B4T A;  4LCG A;  1Y4S A;  3P3G A;  2ENA A;  1DGC A;  3AUZ A;  3IWD A;  4X64 E;  3EPH A;  1XMQ I;  4DV2 I;  2LBS B;  1TF3 A;  3M7N G;  4LFB E;  1HNW E;  1N0V C;  1X3C A;  4LF5 E;  2EM2 A;  1NHH A;  1RC7 A;  4B3M E;  4F54 A;  1A1K A;  5ADZ A;  1I94 I;  3Q1Q A;  2M9A A;  4DUY E;  1X5W A;  3K1J A;  2Z5C B;  3KRN A;  4FW4 A;  4MLQ A;  4LFA E;  4LCF A;  2JP9 A;  2VF3 A;  4WXD A;  2NN6 B;  3PS3 A;  4LCH A;  4OO1 E;  4F9B B;  1MEY C;  1BBG A;  4NXN I;  2RS6 A;  1STU A;  2YTI A;  2WBS A;  1KIJ A;  3HPS A;  5AC4 A;  2BM1 A;  3B8H A;  4DPU A;  2DMY A;  1BB8 A;  4IFD C;  1YZ9 A;  2GHF A;  4RH8 A;  4HEI A;  3UHM A;  2YTP A;  2LE2 A;  3C6K A;  3K85 A;  4BA2 B;  4FW7 A;  2DRP A;  2KHX A;  4JI1 I;  5LL6 R;  3K17 A;  3QT6 A;  2EN4 A;  2Z5B A;  4JG4 A;  1D6T A;  1KJK A;  4GKK E;  4BC9 A;  2EPK X;  1ZBQ A;  2EL4 A;  3NZK A;  1MU5 A;  4IFD A;  2IHR 1;  4TUI A;  1N34 I;  2V2V A;  3J80 Q;  1IQS A;  2R76 A;  2PO1 B;  2JPA A;  4DPY A;  4K0K I;  3T1H E;  4FW5 A;  4IS1 C;  1Z0W A;  2BM0 A;  4FWH A;  1FJG I;  1SFE A;  2EMF A;  1HR0 I;  2WBU A;  2GPI A;  4R2R A;  4FWG A;  4DR2 I;  4LF5 I;  1Z5A A;  4LF8 I;  2Q8U A;  2YTG A;  1ZU1 A;  1YSA C;  2NN6 E;  1YUI A;  5AAS A;  1DQ3 A;  2R42 A;  2EOJ A;  2EPA A;  4M30 A;  4M9V C;  4HAC A;  4DV5 I;  1UDQ A;  3EPJ A;  4R8O A;  1N33 I;  2LUQ A;  1PJS A;  2N3G A;  2EMZ A;  1X48 A;  2EM4 A;  2LJU A;  3HKM A;  1MG7 A;  4X9J A;  4LF6 I;  2JOX A;  5AE2 A;  3V2U C;  1USU A;  3U1K A;  3F0N A;  5LMN I;  2JEA A;  4MLV A;  1EH8 A;  1UDN A;  3DD6 A;  1AAY A;  2YSO A;  4OO1 C;  2DIX A;  4ZYG A;  2C37 A;  2EOI A;  1VIS A;  2EM6 A;  4YHH E;  2EL6 A;  1LLM C;  5GMD A;  4X65 E;  5LMU I;  2EE8 A;  4B3R E;  2BA0 G;  2YWQ A;  3EPL A;  4O4K A;  5IXM B;  2DEI A;  5C0X E;  1ELO A;  2IER A;  1Z5B A;  2BR2 B;  2WNR A;  2V34 A;  3PRY A;  4R03 A;  4LOM A;  2EMG A;  2PO0 B;  2JYA A;  3ZZT A;  2LRS A;  1IBM I;  5LLQ A;  3PS2 A;  3LLH A;  2O1U A;  1A1H A;  1JK2 A;  4M1K A;  2B3T B;  4DV4 I;  3PYG A;  3PYD A;  2LUP B;  3B82 A;  2J65 A;  1P42 A;  2ODR D;  1KYQ A;  4WX9 A;  2DEJ A;  1B63 A;  2ELY A;  4DUZ I;  2UUA I;  4FWD A;  4LF4 I;  5K36 D;  3GME A;  3J80 C;  5BR8 I;  2YU8 A;  4LFC E;  2CT1 A;  2EPM X;  4WSG A;  3Q6N A;  4RHB B;  4MU4 A;  2CZ9 A;  4DR5 E;  2LTR A;  1G2D C;  2UXD E;  1PIE A;  3LNU A;  2JVA A;  1JK1 A;  1A1J A;  1YUJ A;  2EN3 A;  2RS7 A;  3DJW A;  2WP8 A;  3CDJ A;  1KTV A;  3BBG A;  4BMJ A;  4LFB I;  5T6J A;  1EKZ A;  4KZS A;  2DB2 A;  2Q2E B;  4JI5 E;  3JAM Q;  2M7Q A;  1HNW I;  2DLQ A;  2O1W A;  5K36 E;  4JYA I;  3BID A;  1Z0V A;  5JEA F;  2F8B A;  2FGG A;  2MDR A;  4LTY A;  5FWK A;  2PO2 A;  3J7A G;  2UUB E;  1TN9 A;  2YRK A;  2HK2 A;  1MX0 A;  4JI6 I;  4FK5 C;  2UXB I;  3HXL A;  2EOX A;  5FLX C;  2NUE A;  5A6B D;  5A69 A;  2VQF E;  3L00 A;  2EN7 A;  2K4V A;  4NXM I;  4L8N A;  5EKW A;  3ZM7 A;  1Y6Z A;  3L7Z A;  2EOH A;  1Z0C A;  1R6L A;  2JEB A;  3B78 A;  4IS9 A;  3GON A;  2L2N A;  3ZKB A;  5F3W A;  4JI8 I;  2B7T A;  4OOG C;  1PKP A;  1KVK A;  2CG9 A;  2ELZ A;  5C0X C;  1WHQ A;  2MKN A;  2XEX A;  2LMZ A;  2EM3 A;  2EL5 A;  2J7K A;  4DR5 I;  2YZT A;  1HNX E;  4B3R I;  2LO3 A;  1Z1B A;  1FWL A;  2JWO A;  5TSE A;  5GME A;  1RQ0 A;  2BA0 D;  4IZJ D;  3TQM A;  2PNZ A;  3RMP A;  4U3D A;  4I8O A;  2EML A;  3ZOQ B;  4DV6 E;  1XMO E;  1IBM E;  2PNZ B;  5JEA D;  2EPO A;  4WFT A;  3LML A;  4DXL A;  2NN6 F;  3ZKD A;  2EMW A;  2IES A;  1J26 A;  4MYT A;  2YTQ A;  5KL3 A;  1ZBT A;  4DR1 E;  2VF1 A;  1N33 E;  2GQ0 A;  2EQ3 A;  1UN6 B;  5AE1 A;  1YHC A;  1IBL I;  2VQE I;  2ZM6 E;  5DRR A;  3EQ1 A;  2EP3 A;  2PNL A;  5C0X B;  5JEA B;  3H09 A;  4NHR A;  2V2Q A;  2VQF I;  4DR4 E;  2HC5 A;  1ZM3 A;  4Z7Y A;  1J5E I;  2RSI A;  1YFH A;  1FKA E;  2EOE A;  3MHH C;  1XNR I;  2LTS A;  5A6B A;  4X8W A;  5C0X A;  4JI5 I;  2LJH A;  1TF6 A;  4WUD A;  5FLX Q;  3T1Y E;  5A6K A;  1U2R A;  1USV A;  4DV7 I;  4Q35 B;  5C0X F;  2HKE A;  2EOM A;  3BF2 A;  2WZO A;  2R3V A;  2ZBK B;  2EPX A;  2UUB I;  4DV4 E;  2L3C A;  4OX9 E;  3ADL A;  4AM3 A;  4DR7 I;  1NHJ A;  4IFD E;  4DUZ E;  4JI4 I;  1PJT A;  4GEQ B;  2CVE A;  2L33 A;  1K47 A;  4DV6 I;  1XMO I;  4R2C A;  1A6F A;  4MU1 A;  3JU0 A;  4JI6 E;  3HQ1 A;  4NXM E;  4LFA I;  4KHP E;  4GKJ I;  4J3D A;  2UXD I;  2UXC I;  2EOO A;  5KL7 A; 
#chains in the Genus database with same CATH homology
 2EZ6 A;  1ZM9 A;  4DV3 I;  4LF9 I;  3WU4 A;  4JI0 I;  3QT8 A;  2L92 A;  5IWA I;  3KWR A;  1UHZ A;  1RRE A;  1BKN A;  1DAR A;  1YYK A;  2JOB A;  4ZVI A;  4N3O A;  4JI7 E;  3CWV A;  4JI3 I;  1XNR E;  1GQE A;  1WUU A;  4DR3 I;  3H4L A;  1ZM4 A;  3J7A M;  4DPT A;  4X62 E;  4WYQ B;  4L5N C;  3VK6 A;  4HXZ A;  3ADI A;  4JV5 I;  4DV7 E;  4DUY I;  2FV4 B;  1WHN A;  1WXR A;  4YY3 I;  2NPF A;  2V88 A;  1Z0G A;  2MC5 A;  5L3J A;  2RTX A;  4DV3 E;  4DPX A;  4BBY A;  4WUB A;  1HNX I;  3ZZU A;  1X47 A;  4M0V A;  3F6G A;  4HY1 A;  3T1Y I;  1DI2 A;  2V85 A;  3P06 A;  4DR6 I;  1ZXN A;  3F6H A;  4URL A;  4FN5 A;  2G7H A;  4DPW A;  4WPY A;  4K0K E;  4DR7 E;  4OX9 I;  2A2D A;  2NA2 A;  4X62 I;  1FJG E;  4Q28 A;  3MSW A;  4GKJ E;  4NXN E;  2L2M A;  2M1S A;  4DR1 I;  2L3J A;  4R1F A;  1EI1 A;  4DR4 I;  4I3H A;  2B9D A;  2BV3 A;  1KKH A;  2UXC E;  4PU9 A;  3AV0 A;  4YY3 E;  2L2K B;  2HFS A;  4IZK B;  4P78 A;  2H36 X;  5IWA E;  4ED4 A;  2EFG A;  4DV2 E;  4M2Z A;  3T1H I;  5DNY A;  4DU8 A;  1N36 I;  1Z0B A;  2IOP A;  2WW4 A;  3HUL A;  1N34 E;  4DR2 E;  4MYU A;  4USM A;  4USK A;  4JI4 I;  1HR0 E;  4JV5 E;  1YYW A;  4IZJ A;  2OI2 A;  2V87 A;  4KQV A;  4DR6 E;  5CFF E;  1YYO A;  3OML A;  1FI4 A;  1GZ6 A;  1FNM A;  4KHP I;  1N32 E;  2V2Z A;  1UIL A;  2JY9 A;  2EWL A;  4DKK A;  2HKJ A;  4JI2 E;  4EMD A;  4LF6 E;  4WUC A;  3J81 Q;  4JI1 E;  4AQY I;  1N0U A;  2UUA E;  4F9C B;  1XNQ I;  2ODR C;  4GKK I;  4PRX A;  3VYY A;  1HNZ E;  5LMU E;  4JI3 E;  5BR8 E;  4X65 I;  2B7V A;  1Z5C A;  3OTO I;  3ADG A;  2HK3 A;  2E1M A;  3DF6 A;  2E5L E;  4DU7 A;  2UUC E;  4DV1 I;  2V86 A;  4BS9 A;  1Y4U A;  1ZM2 A;  3ADJ A;  3QT5 A;  4PRV A;  3WU6 A;  3WU3 A;  1QU6 A;  1EA6 A;  4DV5 E;  4LF7 I;  1B62 A;  2M4I A;  4HAC B;  1IBK I;  3HJC A;  4LF4 E;  2UXB E;  4DV0 E;  2IOQ A;  1N32 I;  2MC6 A;  1X49 A;  1H72 C;  2HHH I;  2CGE A;  4YHH I;  2LJP A;  1IBL E;  4AQY E;  4FW9 A;  2HFU A;  2F4V E;  2A2C A;  4JYA E;  3VYX A;  1H74 A;  1T4N A;  4P7A A;  4IZJ B;  3D4J A;  4X64 I;  2NUG A;  1HK7 A;  3J81 C;  1FWK A;  3PYE A;  4JI4 E;  1S4E A;  3C4T A;  1XMQ E;  2AJ4 A;  2X7I A;  2V8P A;  4P7D A;  1QZR A;  2V89 A;  4JI2 I;  1I94 E;  4X66 I;  1ZXM A;  4LFC I;  2FTX B;  3QT7 A;  1NHI A;  2DSY A;  4UTG A;  4XTJ A;  1IBK E;  1OJ4 A;  4IZK A;  3IWB A;  2RSM A;  2KON A;  4B3T E;  1NZ0 A;  1HNZ I;  4DV0 I;  5IT9 Q;  1Z0T A;  2E5L I;  3WU5 A;  2VQE E;  1SR9 A;  1N36 E;  3M6A A;  2HHH E;  4J8Z A;  2JR1 A;  3V5R A;  2Z5B B;  1PVG A;  2F4V I;  2KOU A;  3HPZ A;  3P1X A;  5IT9 C;  4UT4 A;  1T4O A;  1S16 A;  4B3M I;  4B3S E;  2UU9 I;  3ZZ0 A;  5A2Q C;  4LF8 E;  2L8T A;  2ZM6 I;  1XNQ E;  4DMI A;  4JI8 E;  3JAM C;  1T4L B;  4LU9 A;  3Q6M A;  3PYF A;  4X66 E;  2NUF A;  2CPN A;  1H7U A;  2L6M A;  1J5E E;  4DV1 E;  4BC7 A;  1XHK A;  2O1T A;  2PNM A;  1RR9 A;  5A2Q Q;  4P52 A;  3OTO E;  3K6Q A;  5LMN E;  2UUC I;  2Z5E A;  3LPS A;  3C4B A;  3LTO A;  1H73 A;  1H7S A;  2E1R A;  4JI7 I;  1UEK A;  2V83 A;  3IWC A;  3HTX A;  2V8Q B;  4Z7C A;  4LF7 E;  3J7Y p;  4HYM A;  2N3H A;  2X36 A;  1O0W A;  2UU9 E;  4B3S I;  4WSP A;  4LF9 E;  3JTZ A;  4B3T I;  2VE7 C;  1Z59 A;  2Z5C A;  4JI0 E;  2YT4 A;  5AE3 A;  2O1V A;  2ZIT A;  4TUG A;  2GS8 A;  4RPF A;  3FIG A;  4DR3 E;  4BCA A;  4F9A B;  1Z0E A;  1Y4S A;  3AUZ A;  3IWD A;  4X64 E;  1XMQ I;  4DV2 I;  2LBS B;  4LFB E;  1HNW E;  1N0V C;  4LF5 E;  1NHH A;  1RC7 A;  4B3M E;  4F54 A;  1I94 I;  5ADZ A;  3Q1Q A;  4DUY E;  3K1J A;  2Z5C B;  4LFA E;  2VF3 A;  4F9B B;  4NXN I;  2RS6 A;  1STU A;  1KIJ A;  3HPS A;  2BM1 A;  3B8H A;  4DPU A;  2DMY A;  3K85 A;  2LE2 A;  2KHX A;  4JI1 I;  5LL6 R;  3K17 A;  3QT6 A;  2Z5B A;  4JG4 A;  1D6T A;  4GKK E;  4BC9 A;  1ZBQ A;  1MU5 A;  2IHR 1;  4TUI A;  1N34 I;  2V2V A;  3J80 Q;  4DPY A;  4K0K I;  3T1H E;  1Z0W A;  2BM0 A;  4FWH A;  1FJG I;  1HR0 I;  4LF8 I;  4FWG A;  4DR2 I;  4LF5 I;  1Z5A A;  5AAS A;  1DQ3 A;  2R42 A;  4M30 A;  4HAC A;  4DV5 I;  4R8O A;  1N33 I;  2LUQ A;  2N3G A;  1X48 A;  1MG7 A;  4LF6 I;  2JOX A;  5AE2 A;  3V2U C;  1USU A;  3F0N A;  5LMN I;  2DIX A;  1VIS A;  4YHH E;  5GMD A;  4X65 E;  5LMU I;  4B3R E;  2DEI A;  1ELO A;  3PRY A;  1Z5B A;  2V34 A;  3ZZT A;  4R03 A;  2LRS A;  1IBM I;  3LLH A;  2O1U A;  4M1K A;  2B3T B;  4DV4 I;  3PYG A;  3PYD A;  2LUP B;  3B82 A;  2ODR D;  2DEJ A;  2UUA I;  4DUZ I;  1B63 A;  4LF4 I;  4FWD A;  3J80 C;  5BR8 I;  4LFC E;  3Q6N A;  2CZ9 A;  4DR5 E;  2LTR A;  2UXD E;  1PIE A;  3LNU A;  2JVA A;  2RS7 A;  3DJW A;  1KTV A;  4BMJ A;  4LFB I;  5T6J A;  1EKZ A;  4KZS A;  2DB2 A;  2Q2E B;  4JI5 E;  3JAM Q;  2M7Q A;  1HNW I;  2O1W A;  4JYA I;  1Z0V A;  2F8B A;  2FGG A;  2MDR A;  4LTY A;  5FWK A;  3J7A G;  2UUB E;  2HK2 A;  1MX0 A;  4JI6 I;  2UXB I;  3HXL A;  5FLX C;  2NUE A;  2VQF E;  2K4V A;  4NXM I;  4L8N A;  3ZM7 A;  1Y6Z A;  1Z0C A;  3B78 A;  3GON A;  2L2N A;  3ZKB A;  5F3W A;  4JI8 I;  2B7T A;  4OOG C;  1PKP A;  1KVK A;  2CG9 A;  1WHQ A;  2XEX A;  2LMZ A;  4DR5 I;  2J7K A;  2YZT A;  1HNX E;  4B3R I;  1FWL A;  2JWO A;  5GME A;  1RQ0 A;  4IZJ D;  3RMP A;  4I8O A;  3ZOQ B;  4DV6 E;  1XMO E;  1IBM E;  4WFT A;  3LML A;  4DXL A;  3ZKD A;  1J26 A;  4MYT A;  1ZBT A;  4DR1 E;  2VF1 A;  1N33 E;  2GQ0 A;  5AE1 A;  1IBL I;  2VQE I;  2ZM6 E;  2PNL A;  3H09 A;  2V2Q A;  2VQF I;  4DR4 E;  1ZM3 A;  1J5E I;  4Z7Y A;  1FKA E;  1XNR I;  2LTS A;  4X8W A;  4JI5 I;  2LJH A;  4WUD A;  5FLX Q;  3T1Y E;  1U2R A;  1USV A;  4DV7 I;  2HKE A;  2ZBK B;  2R3V A;  2WZO A;  2UUB I;  4DV4 E;  2L3C A;  4OX9 E;  3ADL A;  4DR7 I;  1NHJ A;  4DUZ E;  4GEQ B;  2L33 A;  1K47 A;  4DV6 I;  1XMO I;  1A6F A;  3JU0 A;  4JI6 E;  3HQ1 A;  4NXM E;  4LFA I;  4KHP E;  4GKJ I;  2UXD I;  2UXC I;  1YZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...