5IT9C

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5it9C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9C02
1N32E 1S16A 4PU9A 4LF6I 3F0NA 2ZM6I 4DPUA 1I94E 2UUCI 4I3HA 1Z0GA 3H4LA 2X36A 4YY3I 4LF9I 4JV5E 4DV7E 5IWAI 1XMQE 2OI2A 4UTGA 4DV3E 1U2RA 3T1HE 1K47A 4B3MI 1H7UA 3LPSA 2GS8A 2HK3A 1PKPA 4JI0I 4DV7I 4NXNI 3PYDA 1XNQI 1H7SA 4JI6I 4LFCE 1HNWE 2HHHE 4X64E 4LF4E 4DR3E 4DUYE 4HXZA 3T1YE 4K0KE 1HNXI 2CZ9A 3J7AM 4JYAE 4X62E 1S4EA 3V2UC 1MG7A 1H72C 3B8HA 1NZ0A 4AQYI 4NXNE 4GKKE 3ZKBA 4ZVIA 2HHHI 4LF5I 1N34I 1QZRA 1PIEA 2VQFE 4GKKI 1FJGI 4DR2I 2VF3A 4DPXA 1EA6A 3QT6A 2BM1A 1N36E 2UU9E 1XMQI 4B3ME 1HNZE 4WUDA 3ZKDA 2ZBKB 4JI5E 4FWGA 3QT7A 4JI3I 4DUYI 1ZXMA 5FLXQ 1EI1A 1ZM4A 4JI8E 4LFBI 1I94I 3LTOA 1N32I 2UXBE 1RR9A 4FWHA 1OJ4A 2LJPA 2UXCI 3ZZUA 1Z5AA 4DR6E 4DV6E 2E1RA 4JI1I 4LFAE 3JAMQ 4DV3I 2J7KA 2VQEE 4B3SE 4JG4A 1KIJA 2X7IA 1FKAE 4DR2E 4DR5E 3JAMC 1MX0A 4YHHI 4DV5E 1XMOI 2Q2EB 5BR8E 2ZITA 3B82A 1BKNA 4DV4E 4FWDA 2NPFA 1Z0BA 4R1FA 2UU9I 4X65I 1IBLI 1ZM2A 3PYEA 1KKHA 3LNUA 5LMUI 1N0UA 4LF8I 5BR8I 4DV1E 2V2ZA 2V2VA 1HR0I 4X66I 4DU7A 4Z7CA 2BV3A 2EFGA 1IBME 1B62A 5LMNE 1N0VC 1H73A 2HFUA 4DR6I 4NXMI 4KQVA 1RREA 2UUCE 1Z59A 1VISA 1D6TA 5A2QC 4LFCI 4X66E 5GMDA 1MU5A 4LF6E 4DUZE 3WU6A 3HULA 3K17A 4DPTA 2UXDI 4HACB 4P52A 1FWLA 1N33E 4OX9E 2HKJA 4USMA 1IBLE 5FLXC 4LF7I 4HY1A 4WUBA 5IT9Q 1FWKA 4X64I 4DU8A 1FJGE 4GKJI 2VQFI 1KTVA 4DR5I 4HACA 4JI2I 2ZM6E 4JI3E 2E5LE 4M1KA 1J5EE 1Z0CA 3D4JA 3T1HI 2XEXA 3M6AA 4FN5A 4X62I 5A2QQ 5LMNI 4DV2E 1H74A 2A2CA 1IBKE 4JI8I 4HYMA 3B78A 1ELOA 2V34A 4WUCA 3OTOI 5IT9C 3GONA 3J80Q 4PRVA 5LL6R 1DARA 3QT8A 4JI5I 2UUBE 1XNRE 2DEIA 1HNZI 2A2DA 3Q1QA 4FW9A 3J7AG 1HNXE 1WUUA 2HFSA 1Z0EA 1XMOE 1Z0TA 4LF9E 3ZM7A 1IBMI 3OTOE 1NHHA 4LF5E 4EMDA 4GKJE 4AQYE 4DV0I 3WU3A 4B3SI 1N34E 4X65E 3QT5A 4DV1I 4DPYA 2UUAE 1Z0WA 4P7AA 4ED4A 4B3TE 1Z5CA 1FI4A 2R3VA 2HK2A 4UT4A 4DV2I 2VQEI 4LF7E 2AJ4A 4DR3I 4B3TI 4KHPE 4MYTA 4DV5I 4DR1E 4JI6E 2UUAI 4YHHE 2UXDE 3T1YI 4K0KI 4JI7E 4LF4I 2BM0A 2V8PA 4Z7YA 3J81Q 2R42A 4DV0E 2F4VE 4LFBE 3ZZTA 1PVGA 5GMEA 4DXLA 4DR1I 4JI0E 1ZM3A 2WW4A 1Z0VA 2UXCE 2HKEA 4DR4E 4USKA 4URLA 4DV6I 1N36I 4DUZI 1ZXNA 4B3RE 4MYUA 1UEKA 1Z5BA 3WU4A 1FNMA 4KHPI 1IBKI 4DR4I 4JYAI 4PRXA 3PYFA 4DV4I 4NXME 1XHKA 2V2QA 1KVKA 4JI2E 2UUBI 1XNRI 4DR7I 1HR0E 4JI4I 1B63A 3ZZ0A 3WU5A 2E5LI 2F4VI 4B3RI 3CWVA 3V5RA 5LMUE 1NHIA 4DR7E 4JI7I 4RPFA 1XNQE 3K1JA 3PYGA 4XTJA 4LF8E 4JI1E 4LFAI 4OX9I 4JI4E 4DPWA 3J80C 3J81C 2DEJA 5IWAE 1N33I 1HNWI 1NHJA 4JV5I 1ZM9A 4YY3E 5L3JA 1J5EI 1A6FA 2UXBI
chains in the Genus database with same CATH superfamily
1N32E 4IS1C 1S16A 4PU9A 4LF6I 2LUPB 3F0NA 2ZM6I 1I94E 1EH8A 1Y4SA 4I3HA 4DPUA 2UUCI 4O43A 1Z0GA 2JEAA 2EM8A 3H4LA 5AE1A 2X36A 3CDIA 1YYKA 4YY3I 4LF9I 2AE8A 4JV5E 4DV7E 4R2SA 5AE3A 3H1CA 5IWAI 4OO1D 4MU4A 2G7HA 1XMQE 2LV2A 2EMZA 2OI2A 3HJCA 3P3CA 4UTGA 4IJDA 3QG5C 2RSMA 3VK6A 4DV3E 1RC7A 2BBGA 1U2RA 4BC7A 3T1HE 4LU9A 5KL6A 1YFHA 1F2IG 2NN6A 1K47A 2KONA 2B7VA 1H7UA 4BC9A 3LPSA 4B3MI 3C6MA 2GS8A 1G2FC 2IHR1 2C39B 2DMIA 1B69A 2HK3A 2O1VA 1PKPA 5EL9A 2YTQA 4JI0I 5F3WA 3BIDA 1DI2A 2ELZA 4DV7I 2VESA 2EM2A 4NXNI 3GLLA 1OYPA 3PYDA 1XNQI 3IWDA 1H7SA 2BA0G 4JI6I 2EMXA 4LFCE 2JVAA 1GTKA 3ADLA 1HNWE 2HHHE 4X64E 4FW4A 3JU0A 4LF4E 4DR3E 1RMDA 4DUYE 4AIMA 2FTXB 5C0XE 4QNKA 2V8QB 4HXZA 2EMLA 1SFEA 4R2DA 3T1YE 4K0KE 1WHQA 3M85G 1HNXI 5T6JA 1N3GA 2VE7C 1L4SA 2CZ9A 4JYAE 2PNLA 3J7AM 1MEYC 1UBDC 2YU5A 4LCGA 2EPPA 4X62E 2EN1A 1IQSA 3MSWA 1GZ6A 3F6HA 2EPXA 5KL5A 4WX9A 1S4EA 3V2UC 2I9IA 2ODRD 1OYRA 4J3DA 2RS6A 3P3EA 1MG7A 5A69A 1H72C 2C37B 1STUA 2N8XA 3B8HA 4NXNE 1NZ0A 2ENHA 2RTXA 2JPAA 4GKKE 2JEBB 4ZVIA 3ZKBA 4AQYI 2HHHI 4LF5I 2MKNA 1N34I 2MDRA 4HTGA 3VHTB 2L8TA 3ADGA 1NEIA 2YTEA 1BB8A 4NHRA 1QZRA 1PIEA 5K36C 2VQFE 2L6MA 1Z1BA 3C6KA 4GKKI 4O4KA 2NN6E 1FJGI 4DR2I 2VF3A 4DPXA 4BA2A 1EA6A 1T4NA 4DKKA 3QT6A 3KZZA 1KJKA 5C0XD 4ZYHA 2BM1A 4BCAA 2J65A 3K85A 2RPCA 1N36E 2UU9E 2NUGA 2L33A 2EM6A 3JTZA 4B3ME 5C0XB 1XMQI 2EQ3A 2C37A 2UXBI 1HNZE 4WUDA 1EH6A 1X3CA 5FWKA 2JWOA 3ZKDA 2PRTA 1PJTA 2ZBKB 3ECRA 4JI5E 2IESA 2WP8B 4FWGA 1UHZA 3QT7A 1UDNA 2DIXA 4JI3I 4F54A 4M0VA 4DUYI 1ZXMA 5FLXQ 1EI1A 5JEAE 1ZM4A 2M7QA 5A6BD 2MC5A 5KL7A 1IMUA 2EMBA 4JI8E 4R8OA 4BHCA 4LFBI 1X6HA 1I94I 2YWQA 2EPCA 5A6BA 2WBUA 3LTOA 1N32I 2NN6F 2UXBE 2RSIA 1BBOA 1RR9A 4FWHA 1OJ4A 2LJPA 2UXCI 3ZZUA 2J7JA 2CTDA 2EN8A 2C38B 1ZAAC 1Z5AA 2EL4A 2O1WA 2ADRA 4DR6E 4DV6E 2E1RA 4GEQB 4LFAE 4JI1I 5DNLA 3JAMQ 4DV3I 2B7TA 2L2KB 2J7KA 2LE2A 2VQEE 4HEIA 4B3SE 4IZKB 2KOUA 2EOEA 4JG4A 4FW5A 3DF6A 2WBSA 1KIJA 2X7IA 1FKAE 4DR2E 4LCFA 2V87A 1QU6A 3EQ1A 2ENCA 1NCSA 2MKDA 4DR5E 4LCHA 4ZYDA 2FV4B 3C4BA 2PO1B 2LMZA 3JAMC 1MX0A 1OYSA 1WXRA 4YHHI 3HPSA 4P78A 4DV5E 4Q28A 2EOFA 2JEBA 1XMOI 5BR8E 2Q2EB 2R1FA 4F9BB 2ZITA 2KHXA 3VYYA 2EN2A 4OOGC 1E3HA 2N3HA 2ELYA 1BKNA 2JT2A 3B82A 3THOB 2DGCA 2EPRA 4DV4E 2I13A 4IZKA 4IFDF 4FWDA 3L00A 1UDSA 2NPFA 5AE2A 1Z0BA 4R1FA 5ELWA 2EMIA 2Q8UA 2EL5A 4BA1B 2UU9I 4X65I 2DLQA 4R2QA 4J8ZA 4OZEA 4M30A 3MHSC 4GQUA 1ZM2A 2VRDA 1IBLI 3PYEA 1KKHA 1PJSA 3LNUA 4KZSA 5C0XA 3M85D 5LMUI 2EOOA 2EM4A 2EZ6A 5A6JA 2JXPA 1N0UA 4LF8I 4F6NA 5BR8I 4DV1E 3M7ND 4O5GA 4M2ZA 4I8OA 2V2ZA 2WP8A 5DROA 4OO1F 2V2VA 1HR0I 4IFDC 2DRPA 4X66I 2FGGA 2PO2A 4F9CB 5EKWA 2C38A 2ODRC 2JOXA 4N4RB 4DU7A 4Z7CA 1O0WA 2O1TA 3EPHA 2BR2B 2BV3A 1QNTA 2EFGA 3L7ZA 2L2NA 1IBME 2EE8A 2YRHA 4ZYEA 1B62A 2YRKA 5LMNE 1YHCA 4IFDE 5K36A 5AC4A 2LVHA 1N0VC 1H73A 2HFUA 3P06A 3FIGA 2GLIA 4DR6I 4NXMI 4KQVA 1MGTA 1RREA 4IZJB 1BBGA 2EN3A 5AC5A 2CPNA 2LRSA 3TQMA 1E3PA 2EJ4A 4IS9A 1AAYA 2UUCE 1HK7A 3PRYA 1Z59A 1VISA 2V83A 1YPNA 5A2QC 3IWCA 2EMHA 4ZYGA 4LFCI 4BBYA 4X66E 1D6TA 1T4LB 2EMCA 2N3GA 2EMWA 3UHMA 5GMDA 5KL3A 5JEAA 4AM3A 3CDJA 1A1JA 2B9DA 4X8WA 4P7DA 2EPUA 3ZOQB 5K36B 2DMYA 4LF6E 1MU5A 4KWYA 1RHYA 3P76A 4DUZE 2GO3A 1YUIA 4FW6A 3WU6A 4NZVA 2YZTA 4TUIA 3HULA 3K17A 4DPTA 2UXDI 1SR9A 4HACB 1FWLA 4P52A 2HJJA 5K36F 1N33E 4OX9E 2HKJA 5DRRA 4USMA 1PJQA 2EMGA 2NN6D 1IBLE 2M1SA 5FLXC 4DMIA 2BA1G 4ISAA 1PDAA 4N3OA 1Y4UA 4LF7I 4HY1A 4MQYA 4WUBA 3EPLA 4F9AB 1FWKA 2EPMX 5IT9Q 4X64I 3KZYA 1X47A 1A1GA 2JE6A 4DU8A 2EL6A 2M4IA 2V86A 1FJGE 2NN6C 4GKJI 3Q6NA 2VQFI 1KTVA 2EPKX 3HPZA 2Z5EA 3GCMA 1UILA 4R2EA 1USVA 3RMPA 1J26A 4HACA 4DR5I 1X5WA 3P1XA 2ZM6E 4RHBB 4MDTA 4JI2I 2LTSA 1YZ9A 3U1KA 4JI3E 1TF3A 2E5LE 1A1LA 2PNZA 2HGHA 2CGEA 2YTJA 4M1KA 2YT4A 1J5EE 1GQEA 2PNMA 3ADIA 1Z0CA 3U1YA 2DB2A 1XXEA 5AASA 3D4JA 4IZJA 2HC5A 3T1HI 2XEXA 3M6AA 5C0XF 2LJHA 1KYQA 2O3ZA 4FN5A 1ZBTA 5A2QQ 4X62I 4R2AA 5K36E 5DRPA 5LMNI 2EMKA 2EPOA 4DV2E 1H74A 4AIDA 2A2CA 5DRQA 1P42A 3BGHA 2M9AA 2B3TB 2F1DA 4GZNC 2EOZA 4U3BA 5C0XC 5IV8B 2MDGA 4LOMA 2GHFA 1IBKE 2GO4A 4JI8I 4OO1B 4HYMA 3B78A 1ELOA 1WHNA 2V34A 4WUCA 3OTOI 5IT9C 3GONA 3J80Q 3VYXA 2L3JA 3UK3C 4PRVA 5LL6R 2JYAA 2YTIA 3DJWA 1DARA 4WXDA 5KL4A 2L92A 4FW7A 2EOSA 3QT8A 2EM7A 4JI5I 3H09A 5JEAB 1Y6ZA 2BA1D 2UUBE 1XNRE 2K4VA 2DEIA 4BMJA 2CSHA 1HNZI 1VI7A 3HXLA 2PO0A 2JEAB 2YRMA 2A2DA 3PS1A 3Q1QA 5A6AA 4FW9A 3AUZA 2JE6B 5TSEA 1HNXE 3J7AG 3C4TA 2CT1A 2EWLA 1UDOA 2YSPA 2YTNA 3M99B 1WJPA 2EOXA 1WUUA 2HFSA 2PO1A 1Z0EA 2CVEA 4QNJA 1XMOE 1TN9A 1Z0TA 4LF9E 3ZM7A 1IBMI 3OTOE 5KL2A 1ZU1A 1NHHA 1LLMC 5A6KA 2Z5CB 4BS9A 4MU1A 4LF5E 2LTRA 4EMDA 4FW3A 4GKJE 4AQYE 1ZR9A 4DV0I 2EOJA 2NUFA 3WU3A 2C39A 2IERA 3HKMA 2YTFA 4F6MA 2V89A 2EMFA 2WCC3 1X49A 1ZBQA 4MLVA 1N34E 2GQ0A 4X65E 4B3SI 2EQ1A 3QT5A 4DV1I 2EM3A 2UUAE 4DPYA 1Z0WA 4WSPA 4P7AA 4ED4A 5JEAD 4B3TE 1Z5CA 1FI4A 2R3VA 2HK2A 2PNZB 1T39A 4IFDA 4WPYA 4UT4A 4DV2I 2VQEI 5JEAC 3F6GA 1USUA 4LF7E 2EN7A 2RS7A 2AJ4A 2Z5CA 4M9VC 2WNRB 4DR3I 5DNXA 3B4TA 4B3TI 4KHPE 4MYTA 4WYQB 4DR1E 4DV5I 2EOIA 1EH7A 4JI6E 2PO2B 2UUAI 4YHHE 2UXDE 3T1YI 4K0KI 4R2CA 3DD6A 5JEAF 2YPNA 2EOHA 2BB8A 3BBGA 3KWRA 4FK5C 4L8NA 4JI7E 1UDQA 4LPFA 4LF4I 2BM0A 2BR2A 2V8PA 3L7ZB 4Z7YA 1AH5A 2EN6A 3J81Q 2R42A 4DV0E 4OO1A 1RQ0A 2F4VE 4LFBE 4R03A 2EOQA 3ZZTA 2CG9A 2NABA 1Y5YA 4IFDB 2LCEA 1PVGA 2LJUA 3K6QA 2EOMA 4L5NC 1X48A 1UN6B 5GMEA 4Q35B 4DXLA 3LLHA 4DR1I 2F8BA 3J7Yp 2Z5BA 4TUGA 5CFFE 4JI0E 2YTGA 2E1MA 1ZM3A 1T4OA 2L2MA 1A1FA 4WXCA 2WW4A 1Z0VA 2UXCE 2EM5A 3NZKA 1YYOA 2JR1A 4NBQA 2HKEA 2PO0B 4BA2B 4DR4E 4USKA 4URLA 4DV6I 2EPNA 4R2RA 1N36I 2YTDA 2WZOA 2BA0D 2H36X 2YU8A 4DUZI 1EKZA 2K7IA 1ZXNA 4IFDD 1TF6A 2D9HA 4B3RE 4MYUA 4LTYA 2V85A 4OO1E 4WFTA 1WRJA 1X6EA 1UEKA 1YH8A 3THNA 2E72A 3HQ1A 3EPKA 1JK2A 1Z5BA 3WU4A 2EMAA 1IQOA 1R6LA 1FNMA 4KHPI 2EMYA 4BHBA 1IBKI 2RQLA 4X9JA 1P47A 3HTXA 3M7NG 1A1HA 4F2JC 2NN6B 4DR4I 2DLKA 4JYAI 2V88A 4PRXA 2A25A 3PYFA 4RH8A 1DGCA 1DQ3A 4DV4I 2NA2A 3LMLA 4NXME 1XHKA 1A1IA 2IOQA 2DSYA 2JY9A 2YTOA 4O24A 2V2QA 2EN4A 1KVKA 2YSOA 2JOBA 2JP9A 4JI2E 2UUBI 1A1KA 1XNRI 3EPJA 4OKGA 4DR7I 1HR0E 5K36D 3P3GA 2EPZA 4JI4I 1B63A 2WNRA 3OMLA 3GMEA 3ZZ0A 3WU5A 2E5LI 3IWBA 2EP3A 2F4VI 4B3RI 1X6FA 3CWVA 2LO3A 2LUQA 5DNYA 3Q6MA 5LMUE 3KRNA 3V5RA 2GPIA 1NHIA 2VF1A 4MU3A 2EOYA 2IOPA 1YYWA 4DR7E 4RPFA 1XNQE 1R6MA 4JI7I 5ADZA 3K1JA 2WBTA 3PS2A 3PYGA 4LF8E 4XTJA 4IZJD 5IXMB 4JI1E 3BF2A 4LFAI 4OX9I 2MC6A 2O1UA 4JI4E 4U3DA 2EORA 2LBSB 3MHHC 1YSAC 3PS3A 4DPWA 4OO1C 3J80C 3J81C 1JK1A 2EPAA 2ENAA 3ADJA 2EM9A 2DEJA 4MU0A 1YUJA 2Z5BB 5IWAE 4MLQA 1N33I 1HNWI 2EM0A 4WSGA 1NHJA 4JV5I 1G2DC 1ZM9A 4YY3E 2NUEA 3AV0A 2R76A 5LLQA 2LT7A 1Y60A 5L3JA 2EPLX 1J5EI 2EQ0A 2L3CA 4R2PA 1T38A 1A6FA 2YTPA 4BA1A
chains in the Genus database with same CATH topology
1N32E 1S16A 4PU9A 4LF6I 2LUPB 3F0NA 2ZM6I 1I94E 1Y4SA 4DPUA 4I3HA 2UUCI 1Z0GA 3H4LA 5AE1A 2X36A 4YY3I 1YYKA 4LF9I 4JV5E 4DV7E 5AE3A 5IWAI 2G7HA 1XMQE 2OI2A 3HJCA 4UTGA 2RSMA 3VK6A 4DV3E 1RC7A 1U2RA 4BC7A 3T1HE 4LU9A 1K47A 2KONA 2B7VA 1H7UA 4BC9A 3LPSA 4B3MI 2GS8A 2IHR1 2HK3A 2O1VA 1PKPA 4JI0I 5F3WA 1DI2A 4DV7I 4NXNI 3PYDA 1XNQI 3IWDA 1H7SA 4JI6I 4LFCE 2JVAA 3ADLA 1HNWE 2HHHE 4X64E 3JU0A 4LF4E 4DR3E 4DUYE 2FTXB 2V8QB 4HXZA 3T1YE 4K0KE 1WHQA 1HNXI 5T6JA 2VE7C 2CZ9A 2PNLA 4JYAE 3J7AM 4X62E 3MSWA 1GZ6A 3F6HA 1S4EA 3V2UC 2ODRD 2RS6A 1MG7A 1H72C 1STUA 3B8HA 4NXNE 1NZ0A 4AQYI 2RTXA 4GKKE 3ZKBA 4ZVIA 2HHHI 4LF5I 1N34I 2MDRA 2L8TA 3ADGA 1QZRA 1PIEA 2VQFE 2L6MA 4GKKI 1FJGI 4DR2I 2VF3A 4DPXA 1EA6A 1T4NA 4DKKA 3QT6A 2BM1A 3K85A 4BCAA 1N36E 2UU9E 2NUGA 2L33A 1XMQI 3JTZA 4B3ME 1HNZE 4WUDA 5FWKA 2JWOA 3ZKDA 2ZBKB 4JI5E 4FWGA 1UHZA 3QT7A 2DIXA 4JI3I 4F54A 4M0VA 4DUYI 1ZXMA 5FLXQ 1EI1A 1ZM4A 2M7QA 2MC5A 4JI8E 4R8OA 4LFBI 1I94I 3LTOA 1N32I 2UXBE 1RR9A 4FWHA 1OJ4A 2LJPA 2UXCI 3ZZUA 1Z5AA 2O1WA 4DR6E 4DV6E 2E1RA 4GEQB 4LFAE 4JI1I 3JAMQ 4DV3I 2B7TA 2L2KB 2J7KA 2LE2A 2VQEE 4B3SE 4IZKB 2KOUA 4JG4A 3DF6A 1KIJA 2X7IA 1FKAE 4DR2E 2V87A 1QU6A 4DR5E 2FV4B 3C4BA 2LMZA 3JAMC 1MX0A 1WXRA 4YHHI 3HPSA 4P78A 4DV5E 4Q28A 1XMOI 5BR8E 2Q2EB 4F9BB 2ZITA 2KHXA 3VYYA 4OOGC 3B82A 2N3HA 1BKNA 4DV4E 4IZKA 4FWDA 2NPFA 5AE2A 1Z0BA 4R1FA 2UU9I 4X65I 4J8ZA 4M30A 1IBLI 1ZM2A 3PYEA 1KKHA 3LNUA 4KZSA 5LMUI 2EZ6A 1N0UA 4LF8I 5BR8I 4DV1E 4M2ZA 4I8OA 2V2ZA 2V2VA 1HR0I 4X66I 2FGGA 4F9CB 2ODRC 2JOXA 4DU7A 4Z7CA 1O0WA 2O1TA 2BV3A 2EFGA 2L2NA 1IBME 1B62A 5LMNE 1N0VC 1H73A 2HFUA 3P06A 3FIGA 4DR6I 4NXMI 4KQVA 1RREA 4IZJB 2CPNA 2LRSA 2UUCE 1HK7A 3PRYA 1Z59A 1VISA 2V83A 1D6TA 5A2QC 3IWCA 4LFCI 4BBYA 4X66E 1T4LB 2N3GA 5GMDA 2B9DA 4X8WA 4P7DA 3ZOQB 2DMYA 4LF6E 1MU5A 4DUZE 3WU6A 2YZTA 4TUIA 3HULA 3K17A 4DPTA 2UXDI 1SR9A 4HACB 1FWLA 4P52A 1N33E 4OX9E 2HKJA 4USMA 1IBLE 2M1SA 5FLXC 4DMIA 4N3OA 4LF7I 1Y4UA 4HY1A 4WUBA 4F9AB 1FWKA 5IT9Q 4X64I 1X47A 4DU8A 2M4IA 2V86A 1FJGE 4GKJI 3Q6NA 2VQFI 1KTVA 3HPZA 2Z5EA 1UILA 1USVA 3RMPA 1J26A 4HACA 4DR5I 3P1XA 2ZM6E 4JI2I 2LTSA 1YZ9A 4JI3E 2E5LE 2CGEA 4M1KA 2YT4A 1J5EE 1GQEA 2PNMA 3ADIA 1Z0CA 2DB2A 5AASA 3D4JA 4IZJA 3T1HI 2XEXA 3M6AA 2LJHA 4FN5A 4X62I 1ZBTA 5A2QQ 5LMNI 4DV2E 1H74A 2A2CA 2B3TB 1IBKE 4JI8I 4HYMA 3B78A 1ELOA 1WHNA 2V34A 4WUCA 3OTOI 5IT9C 3GONA 3J80Q 3VYXA 2L3JA 4PRVA 5LL6R 3DJWA 1DARA 2L92A 3QT8A 4JI5I 3H09A 1Y6ZA 2UUBE 1XNRE 2K4VA 2DEIA 4BMJA 1HNZI 3HXLA 2A2DA 3Q1QA 4FW9A 3AUZA 3J7AG 1HNXE 3C4TA 2EWLA 1WUUA 2HFSA 1Z0EA 1XMOE 1Z0TA 4LF9E 3ZM7A 1IBMI 3OTOE 1NHHA 2Z5CB 4BS9A 4LF5E 2LTRA 4EMDA 4GKJE 4AQYE 4DV0I 2NUFA 3WU3A 2V89A 2GQ0A 1X49A 1ZBQA 1N34E 4B3SI 4X65E 3QT5A 4DV1I 2UUAE 4DPYA 1Z0WA 4WSPA 4P7AA 4ED4A 4B3TE 1Z5CA 1FI4A 2R3VA 2HK2A 4WPYA 4UT4A 4DV2I 2VQEI 3F6GA 1USUA 4LF7E 2AJ4A 2RS7A 2Z5CA 4DR3I 4B3TI 4KHPE 4MYTA 4WYQB 4DR1E 4DV5I 4JI6E 2UUAI 4YHHE 2UXDE 3T1YI 4K0KI 3KWRA 4L8NA 4JI7E 4LF4I 2BM0A 2V8PA 4Z7YA 3J81Q 2R42A 4DV0E 1RQ0A 2F4VE 4LFBE 4R03A 3ZZTA 2CG9A 1PVGA 3K6QA 4L5NC 1X48A 5GMEA 4DXLA 3LLHA 4DR1I 2F8BA 3J7Yp 2Z5BA 4TUGA 5CFFE 4JI0E 2E1MA 1ZM3A 1T4OA 2L2MA 2WW4A 1Z0VA 2UXCE 1YYOA 2JR1A 2HKEA 4DR4E 4USKA 4URLA 4DV6I 1N36I 2WZOA 2H36X 4DUZI 1EKZA 1ZXNA 4B3RE 4MYUA 4LTYA 2V85A 4WFTA 1UEKA 3HQ1A 1Z5BA 3WU4A 1FNMA 4KHPI 1IBKI 3HTXA 4DR4I 4JYAI 2V88A 4PRXA 3PYFA 4DV4I 1DQ3A 2NA2A 3LMLA 4NXME 1XHKA 2IOQA 2DSYA 2JY9A 2V2QA 1KVKA 2JOBA 4JI2E 2UUBI 1XNRI 4DR7I 1HR0E 4JI4I 1B63A 3OMLA 3ZZ0A 3WU5A 2E5LI 3IWBA 2F4VI 4B3RI 3CWVA 3Q6MA 5DNYA 2LUQA 5LMUE 3V5RA 1NHIA 2VF1A 2IOPA 1YYWA 4DR7E 4RPFA 1XNQE 4JI7I 5ADZA 3K1JA 3PYGA 4LF8E 4XTJA 4IZJD 4JI1E 4LFAI 4OX9I 2MC6A 2O1UA 4JI4E 2LBSB 4DPWA 3J80C 3J81C 3ADJA 2DEJA 2Z5BB 5IWAE 1N33I 1HNWI 1NHJA 4JV5I 1ZM9A 4YY3E 2NUEA 3AV0A 5L3JA 1J5EI 2L3CA 1A6FA 2UXBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 E;  1S16 A;  4PU9 A;  4LF6 I;  3F0N A;  2ZM6 I;  4DPU A;  1I94 E;  2UUC I;  4I3H A;  1Z0G A;  3H4L A;  2X36 A;  4YY3 I;  4LF9 I;  4JV5 E;  4DV7 E;  5IWA I;  1XMQ E;  2OI2 A;  4UTG A;  4DV3 E;  1U2R A;  3T1H E;  1K47 A;  4B3M I;  1H7U A;  3LPS A;  2GS8 A;  2HK3 A;  1PKP A;  4JI0 I;  4DV7 I;  4NXN I;  3PYD A;  1XNQ I;  1H7S A;  4JI6 I;  4LFC E;  1HNW E;  2HHH E;  4X64 E;  4LF4 E;  4DR3 E;  4DUY E;  4HXZ A;  3T1Y E;  4K0K E;  1HNX I;  2CZ9 A;  3J7A M;  4JYA E;  4X62 E;  1S4E A;  3V2U C;  1MG7 A;  1H72 C;  3B8H A;  1NZ0 A;  4AQY I;  4NXN E;  4GKK E;  3ZKB A;  4ZVI A;  2HHH I;  4LF5 I;  1N34 I;  1QZR A;  1PIE A;  2VQF E;  4GKK I;  1FJG I;  4DR2 I;  2VF3 A;  4DPX A;  1EA6 A;  3QT6 A;  2BM1 A;  1N36 E;  2UU9 E;  1XMQ I;  4B3M E;  1HNZ E;  4WUD A;  3ZKD A;  2ZBK B;  4JI5 E;  4FWG A;  3QT7 A;  4JI3 I;  4DUY I;  1ZXM A;  5FLX Q;  1EI1 A;  1ZM4 A;  4JI8 E;  4LFB I;  1I94 I;  3LTO A;  1N32 I;  2UXB E;  1RR9 A;  4FWH A;  1OJ4 A;  2LJP A;  2UXC I;  3ZZU A;  1Z5A A;  4DR6 E;  4DV6 E;  2E1R A;  4JI1 I;  4LFA E;  3JAM Q;  4DV3 I;  2J7K A;  2VQE E;  4B3S E;  4JG4 A;  1KIJ A;  2X7I A;  1FKA E;  4DR2 E;  4DR5 E;  3JAM C;  1MX0 A;  4YHH I;  4DV5 E;  1XMO I;  2Q2E B;  5BR8 E;  2ZIT A;  3B82 A;  1BKN A;  4DV4 E;  4FWD A;  2NPF A;  1Z0B A;  4R1F A;  2UU9 I;  4X65 I;  1IBL I;  1ZM2 A;  3PYE A;  1KKH A;  3LNU A;  5LMU I;  1N0U A;  4LF8 I;  5BR8 I;  4DV1 E;  2V2Z A;  2V2V A;  1HR0 I;  4X66 I;  4DU7 A;  4Z7C A;  2BV3 A;  2EFG A;  1IBM E;  1B62 A;  5LMN E;  1N0V C;  1H73 A;  2HFU A;  4DR6 I;  4NXM I;  4KQV A;  1RRE A;  2UUC E;  1Z59 A;  1VIS A;  1D6T A;  5A2Q C;  4LFC I;  4X66 E;  5GMD A;  1MU5 A;  4LF6 E;  4DUZ E;  3WU6 A;  3HUL A;  3K17 A;  4DPT A;  2UXD I;  4HAC B;  4P52 A;  1FWL A;  1N33 E;  4OX9 E;  2HKJ A;  4USM A;  1IBL E;  5FLX C;  4LF7 I;  4HY1 A;  4WUB A;  5IT9 Q;  1FWK A;  4X64 I;  4DU8 A;  1FJG E;  4GKJ I;  2VQF I;  1KTV A;  4DR5 I;  4HAC A;  4JI2 I;  2ZM6 E;  4JI3 E;  2E5L E;  4M1K A;  1J5E E;  1Z0C A;  3D4J A;  3T1H I;  2XEX A;  3M6A A;  4FN5 A;  4X62 I;  5A2Q Q;  5LMN I;  4DV2 E;  1H74 A;  2A2C A;  1IBK E;  4JI8 I;  4HYM A;  3B78 A;  1ELO A;  2V34 A;  4WUC A;  3OTO I;  5IT9 C;  3GON A;  3J80 Q;  4PRV A;  5LL6 R;  1DAR A;  3QT8 A;  4JI5 I;  2UUB E;  1XNR E;  2DEI A;  1HNZ I;  2A2D A;  3Q1Q A;  4FW9 A;  3J7A G;  1HNX E;  1WUU A;  2HFS A;  1Z0E A;  1XMO E;  1Z0T A;  4LF9 E;  3ZM7 A;  1IBM I;  3OTO E;  1NHH A;  4LF5 E;  4EMD A;  4GKJ E;  4AQY E;  4DV0 I;  3WU3 A;  4B3S I;  1N34 E;  4X65 E;  3QT5 A;  4DV1 I;  4DPY A;  2UUA E;  1Z0W A;  4P7A A;  4ED4 A;  4B3T E;  1Z5C A;  1FI4 A;  2R3V A;  2HK2 A;  4UT4 A;  4DV2 I;  2VQE I;  4LF7 E;  2AJ4 A;  4DR3 I;  4B3T I;  4KHP E;  4MYT A;  4DV5 I;  4DR1 E;  4JI6 E;  2UUA I;  4YHH E;  2UXD E;  3T1Y I;  4K0K I;  4JI7 E;  4LF4 I;  2BM0 A;  2V8P A;  4Z7Y A;  3J81 Q;  2R42 A;  4DV0 E;  2F4V E;  4LFB E;  3ZZT A;  1PVG A;  5GME A;  4DXL A;  4DR1 I;  4JI0 E;  1ZM3 A;  2WW4 A;  1Z0V A;  2UXC E;  2HKE A;  4DR4 E;  4USK A;  4URL A;  4DV6 I;  1N36 I;  4DUZ I;  1ZXN A;  4B3R E;  4MYU A;  1UEK A;  1Z5B A;  3WU4 A;  1FNM A;  4KHP I;  1IBK I;  4DR4 I;  4JYA I;  4PRX A;  3PYF A;  4DV4 I;  4NXM E;  1XHK A;  2V2Q A;  1KVK A;  4JI2 E;  2UUB I;  1XNR I;  4DR7 I;  1HR0 E;  4JI4 I;  1B63 A;  3ZZ0 A;  3WU5 A;  2E5L I;  2F4V I;  4B3R I;  3CWV A;  3V5R A;  5LMU E;  1NHI A;  4DR7 E;  4JI7 I;  4RPF A;  1XNQ E;  3K1J A;  3PYG A;  4XTJ A;  4LF8 E;  4JI1 E;  4LFA I;  4OX9 I;  4JI4 E;  4DPW A;  3J80 C;  3J81 C;  2DEJ A;  5IWA E;  1N33 I;  1HNW I;  1NHJ A;  4JV5 I;  1ZM9 A;  4YY3 E;  5L3J A;  1J5E I;  1A6F A;  2UXB I; 
#chains in the Genus database with same CATH topology
 1N32 E;  4IS1 C;  1S16 A;  4PU9 A;  4LF6 I;  2LUP B;  3F0N A;  2ZM6 I;  1I94 E;  1EH8 A;  1Y4S A;  4I3H A;  4DPU A;  2UUC I;  4O43 A;  1Z0G A;  2JEA A;  2EM8 A;  3H4L A;  5AE1 A;  2X36 A;  3CDI A;  1YYK A;  4YY3 I;  4LF9 I;  2AE8 A;  4JV5 E;  4DV7 E;  4R2S A;  5AE3 A;  3H1C A;  5IWA I;  4OO1 D;  4MU4 A;  2G7H A;  1XMQ E;  2LV2 A;  2EMZ A;  2OI2 A;  3HJC A;  3P3C A;  4UTG A;  4IJD A;  3QG5 C;  2RSM A;  3VK6 A;  4DV3 E;  1RC7 A;  2BBG A;  1U2R A;  4BC7 A;  3T1H E;  4LU9 A;  5KL6 A;  1YFH A;  1F2I G;  2NN6 A;  1K47 A;  2KON A;  2B7V A;  1H7U A;  4BC9 A;  3LPS A;  4B3M I;  3C6M A;  2GS8 A;  1G2F C;  2IHR 1;  2C39 B;  2DMI A;  1B69 A;  2HK3 A;  2O1V A;  1PKP A;  5EL9 A;  2YTQ A;  4JI0 I;  5F3W A;  3BID A;  1DI2 A;  2ELZ A;  4DV7 I;  2VES A;  2EM2 A;  4NXN I;  3GLL A;  1OYP A;  3PYD A;  1XNQ I;  3IWD A;  1H7S A;  2BA0 G;  4JI6 I;  2EMX A;  4LFC E;  2JVA A;  1GTK A;  3ADL A;  1HNW E;  2HHH E;  4X64 E;  4FW4 A;  3JU0 A;  4LF4 E;  4DR3 E;  1RMD A;  4DUY E;  4AIM A;  2FTX B;  5C0X E;  4QNK A;  2V8Q B;  4HXZ A;  2EML A;  1SFE A;  4R2D A;  3T1Y E;  4K0K E;  1WHQ A;  3M85 G;  1HNX I;  5T6J A;  1N3G A;  2VE7 C;  1L4S A;  2CZ9 A;  4JYA E;  2PNL A;  3J7A M;  1MEY C;  1UBD C;  2YU5 A;  4LCG A;  2EPP A;  4X62 E;  2EN1 A;  1IQS A;  3MSW A;  1GZ6 A;  3F6H A;  2EPX A;  5KL5 A;  4WX9 A;  1S4E A;  3V2U C;  2I9I A;  2ODR D;  1OYR A;  4J3D A;  2RS6 A;  3P3E A;  1MG7 A;  5A69 A;  1H72 C;  2C37 B;  1STU A;  2N8X A;  3B8H A;  4NXN E;  1NZ0 A;  2ENH A;  2RTX A;  2JPA A;  4GKK E;  2JEB B;  4ZVI A;  3ZKB A;  4AQY I;  2HHH I;  4LF5 I;  2MKN A;  1N34 I;  2MDR A;  4HTG A;  3VHT B;  2L8T A;  3ADG A;  1NEI A;  2YTE A;  1BB8 A;  4NHR A;  1QZR A;  1PIE A;  5K36 C;  2VQF E;  2L6M A;  1Z1B A;  3C6K A;  4GKK I;  4O4K A;  2NN6 E;  1FJG I;  4DR2 I;  2VF3 A;  4DPX A;  4BA2 A;  1EA6 A;  1T4N A;  4DKK A;  3QT6 A;  3KZZ A;  1KJK A;  5C0X D;  4ZYH A;  2BM1 A;  4BCA A;  2J65 A;  3K85 A;  2RPC A;  1N36 E;  2UU9 E;  2NUG A;  2L33 A;  2EM6 A;  3JTZ A;  4B3M E;  5C0X B;  1XMQ I;  2EQ3 A;  2C37 A;  2UXB I;  1HNZ E;  4WUD A;  1EH6 A;  1X3C A;  5FWK A;  2JWO A;  3ZKD A;  2PRT A;  1PJT A;  2ZBK B;  3ECR A;  4JI5 E;  2IES A;  2WP8 B;  4FWG A;  1UHZ A;  3QT7 A;  1UDN A;  2DIX A;  4JI3 I;  4F54 A;  4M0V A;  4DUY I;  1ZXM A;  5FLX Q;  1EI1 A;  5JEA E;  1ZM4 A;  2M7Q A;  5A6B D;  2MC5 A;  5KL7 A;  1IMU A;  2EMB A;  4JI8 E;  4R8O A;  4BHC A;  4LFB I;  1X6H A;  1I94 I;  2YWQ A;  2EPC A;  5A6B A;  2WBU A;  3LTO A;  1N32 I;  2NN6 F;  2UXB E;  2RSI A;  1BBO A;  1RR9 A;  4FWH A;  1OJ4 A;  2LJP A;  2UXC I;  3ZZU A;  2J7J A;  2CTD A;  2EN8 A;  2C38 B;  1ZAA C;  1Z5A A;  2EL4 A;  2O1W A;  2ADR A;  4DR6 E;  4DV6 E;  2E1R A;  4GEQ B;  4LFA E;  4JI1 I;  5DNL A;  3JAM Q;  4DV3 I;  2B7T A;  2L2K B;  2J7K A;  2LE2 A;  2VQE E;  4HEI A;  4B3S E;  4IZK B;  2KOU A;  2EOE A;  4JG4 A;  4FW5 A;  3DF6 A;  2WBS A;  1KIJ A;  2X7I A;  1FKA E;  4DR2 E;  4LCF A;  2V87 A;  1QU6 A;  3EQ1 A;  2ENC A;  1NCS A;  2MKD A;  4DR5 E;  4LCH A;  4ZYD A;  2FV4 B;  3C4B A;  2PO1 B;  2LMZ A;  3JAM C;  1MX0 A;  1OYS A;  1WXR A;  4YHH I;  3HPS A;  4P78 A;  4DV5 E;  4Q28 A;  2EOF A;  2JEB A;  1XMO I;  5BR8 E;  2Q2E B;  2R1F A;  4F9B B;  2ZIT A;  2KHX A;  3VYY A;  2EN2 A;  4OOG C;  1E3H A;  2N3H A;  2ELY A;  1BKN A;  2JT2 A;  3B82 A;  3THO B;  2DGC A;  2EPR A;  4DV4 E;  2I13 A;  4IZK A;  4IFD F;  4FWD A;  3L00 A;  1UDS A;  2NPF A;  5AE2 A;  1Z0B A;  4R1F A;  5ELW A;  2EMI A;  2Q8U A;  2EL5 A;  4BA1 B;  2UU9 I;  4X65 I;  2DLQ A;  4R2Q A;  4J8Z A;  4OZE A;  4M30 A;  3MHS C;  4GQU A;  1ZM2 A;  2VRD A;  1IBL I;  3PYE A;  1KKH A;  1PJS A;  3LNU A;  4KZS A;  5C0X A;  3M85 D;  5LMU I;  2EOO A;  2EM4 A;  2EZ6 A;  5A6J A;  2JXP A;  1N0U A;  4LF8 I;  4F6N A;  5BR8 I;  4DV1 E;  3M7N D;  4O5G A;  4M2Z A;  4I8O A;  2V2Z A;  2WP8 A;  5DRO A;  4OO1 F;  2V2V A;  1HR0 I;  4IFD C;  2DRP A;  4X66 I;  2FGG A;  2PO2 A;  4F9C B;  5EKW A;  2C38 A;  2ODR C;  2JOX A;  4N4R B;  4DU7 A;  4Z7C A;  1O0W A;  2O1T A;  3EPH A;  2BR2 B;  2BV3 A;  1QNT A;  2EFG A;  3L7Z A;  2L2N A;  1IBM E;  2EE8 A;  2YRH A;  4ZYE A;  1B62 A;  2YRK A;  5LMN E;  1YHC A;  4IFD E;  5K36 A;  5AC4 A;  2LVH A;  1N0V C;  1H73 A;  2HFU A;  3P06 A;  3FIG A;  2GLI A;  4DR6 I;  4NXM I;  4KQV A;  1MGT A;  1RRE A;  4IZJ B;  1BBG A;  2EN3 A;  5AC5 A;  2CPN A;  2LRS A;  3TQM A;  1E3P A;  2EJ4 A;  4IS9 A;  1AAY A;  2UUC E;  1HK7 A;  3PRY A;  1Z59 A;  1VIS A;  2V83 A;  1YPN A;  5A2Q C;  3IWC A;  2EMH A;  4ZYG A;  4LFC I;  4BBY A;  4X66 E;  1D6T A;  1T4L B;  2EMC A;  2N3G A;  2EMW A;  3UHM A;  5GMD A;  5KL3 A;  5JEA A;  4AM3 A;  3CDJ A;  1A1J A;  2B9D A;  4X8W A;  4P7D A;  2EPU A;  3ZOQ B;  5K36 B;  2DMY A;  4LF6 E;  1MU5 A;  4KWY A;  1RHY A;  3P76 A;  4DUZ E;  2GO3 A;  1YUI A;  4FW6 A;  3WU6 A;  4NZV A;  2YZT A;  4TUI A;  3HUL A;  3K17 A;  4DPT A;  2UXD I;  1SR9 A;  4HAC B;  1FWL A;  4P52 A;  2HJJ A;  5K36 F;  1N33 E;  4OX9 E;  2HKJ A;  5DRR A;  4USM A;  1PJQ A;  2EMG A;  2NN6 D;  1IBL E;  2M1S A;  5FLX C;  4DMI A;  2BA1 G;  4ISA A;  1PDA A;  4N3O A;  1Y4U A;  4LF7 I;  4HY1 A;  4MQY A;  4WUB A;  3EPL A;  4F9A B;  1FWK A;  2EPM X;  5IT9 Q;  4X64 I;  3KZY A;  1X47 A;  1A1G A;  2JE6 A;  4DU8 A;  2EL6 A;  2M4I A;  2V86 A;  1FJG E;  2NN6 C;  4GKJ I;  3Q6N A;  2VQF I;  1KTV A;  2EPK X;  3HPZ A;  2Z5E A;  3GCM A;  1UIL A;  4R2E A;  1USV A;  3RMP A;  1J26 A;  4HAC A;  4DR5 I;  1X5W A;  3P1X A;  2ZM6 E;  4RHB B;  4MDT A;  4JI2 I;  2LTS A;  1YZ9 A;  3U1K A;  4JI3 E;  1TF3 A;  2E5L E;  1A1L A;  2PNZ A;  2HGH A;  2CGE A;  2YTJ A;  4M1K A;  2YT4 A;  1J5E E;  1GQE A;  2PNM A;  3ADI A;  1Z0C A;  3U1Y A;  2DB2 A;  1XXE A;  5AAS A;  3D4J A;  4IZJ A;  2HC5 A;  3T1H I;  2XEX A;  3M6A A;  5C0X F;  2LJH A;  1KYQ A;  2O3Z A;  4FN5 A;  1ZBT A;  5A2Q Q;  4X62 I;  4R2A A;  5K36 E;  5DRP A;  5LMN I;  2EMK A;  2EPO A;  4DV2 E;  1H74 A;  4AID A;  2A2C A;  5DRQ A;  1P42 A;  3BGH A;  2M9A A;  2B3T B;  2F1D A;  4GZN C;  2EOZ A;  4U3B A;  5C0X C;  5IV8 B;  2MDG A;  4LOM A;  2GHF A;  1IBK E;  2GO4 A;  4JI8 I;  4OO1 B;  4HYM A;  3B78 A;  1ELO A;  1WHN A;  2V34 A;  4WUC A;  3OTO I;  5IT9 C;  3GON A;  3J80 Q;  3VYX A;  2L3J A;  3UK3 C;  4PRV A;  5LL6 R;  2JYA A;  2YTI A;  3DJW A;  1DAR A;  4WXD A;  5KL4 A;  2L92 A;  4FW7 A;  2EOS A;  3QT8 A;  2EM7 A;  4JI5 I;  3H09 A;  5JEA B;  1Y6Z A;  2BA1 D;  2UUB E;  1XNR E;  2K4V A;  2DEI A;  4BMJ A;  2CSH A;  1HNZ I;  1VI7 A;  3HXL A;  2PO0 A;  2JEA B;  2YRM A;  2A2D A;  3PS1 A;  3Q1Q A;  5A6A A;  4FW9 A;  3AUZ A;  2JE6 B;  5TSE A;  1HNX E;  3J7A G;  3C4T A;  2CT1 A;  2EWL A;  1UDO A;  2YSP A;  2YTN A;  3M99 B;  1WJP A;  2EOX A;  1WUU A;  2HFS A;  2PO1 A;  1Z0E A;  2CVE A;  4QNJ A;  1XMO E;  1TN9 A;  1Z0T A;  4LF9 E;  3ZM7 A;  1IBM I;  3OTO E;  5KL2 A;  1ZU1 A;  1NHH A;  1LLM C;  5A6K A;  2Z5C B;  4BS9 A;  4MU1 A;  4LF5 E;  2LTR A;  4EMD A;  4FW3 A;  4GKJ E;  4AQY E;  1ZR9 A;  4DV0 I;  2EOJ A;  2NUF A;  3WU3 A;  2C39 A;  2IER A;  3HKM A;  2YTF A;  4F6M A;  2V89 A;  2EMF A;  2WCC 3;  1X49 A;  1ZBQ A;  4MLV A;  1N34 E;  2GQ0 A;  4X65 E;  4B3S I;  2EQ1 A;  3QT5 A;  4DV1 I;  2EM3 A;  2UUA E;  4DPY A;  1Z0W A;  4WSP A;  4P7A A;  4ED4 A;  5JEA D;  4B3T E;  1Z5C A;  1FI4 A;  2R3V A;  2HK2 A;  2PNZ B;  1T39 A;  4IFD A;  4WPY A;  4UT4 A;  4DV2 I;  2VQE I;  5JEA C;  3F6G A;  1USU A;  4LF7 E;  2EN7 A;  2RS7 A;  2AJ4 A;  2Z5C A;  4M9V C;  2WNR B;  4DR3 I;  5DNX A;  3B4T A;  4B3T I;  4KHP E;  4MYT A;  4WYQ B;  4DR1 E;  4DV5 I;  2EOI A;  1EH7 A;  4JI6 E;  2PO2 B;  2UUA I;  4YHH E;  2UXD E;  3T1Y I;  4K0K I;  4R2C A;  3DD6 A;  5JEA F;  2YPN A;  2EOH A;  2BB8 A;  3BBG A;  3KWR A;  4FK5 C;  4L8N A;  4JI7 E;  1UDQ A;  4LPF A;  4LF4 I;  2BM0 A;  2BR2 A;  2V8P A;  3L7Z B;  4Z7Y A;  1AH5 A;  2EN6 A;  3J81 Q;  2R42 A;  4DV0 E;  4OO1 A;  1RQ0 A;  2F4V E;  4LFB E;  4R03 A;  2EOQ A;  3ZZT A;  2CG9 A;  2NAB A;  1Y5Y A;  4IFD B;  2LCE A;  1PVG A;  2LJU A;  3K6Q A;  2EOM A;  4L5N C;  1X48 A;  1UN6 B;  5GME A;  4Q35 B;  4DXL A;  3LLH A;  4DR1 I;  2F8B A;  3J7Y p;  2Z5B A;  4TUG A;  5CFF E;  4JI0 E;  2YTG A;  2E1M A;  1ZM3 A;  1T4O A;  2L2M A;  1A1F A;  4WXC A;  2WW4 A;  1Z0V A;  2UXC E;  2EM5 A;  3NZK A;  1YYO A;  2JR1 A;  4NBQ A;  2HKE A;  2PO0 B;  4BA2 B;  4DR4 E;  4USK A;  4URL A;  4DV6 I;  2EPN A;  4R2R A;  1N36 I;  2YTD A;  2WZO A;  2BA0 D;  2H36 X;  2YU8 A;  4DUZ I;  1EKZ A;  2K7I A;  1ZXN A;  4IFD D;  1TF6 A;  2D9H A;  4B3R E;  4MYU A;  4LTY A;  2V85 A;  4OO1 E;  4WFT A;  1WRJ A;  1X6E A;  1UEK A;  1YH8 A;  3THN A;  2E72 A;  3HQ1 A;  3EPK A;  1JK2 A;  1Z5B A;  3WU4 A;  2EMA A;  1IQO A;  1R6L A;  1FNM A;  4KHP I;  2EMY A;  4BHB A;  1IBK I;  2RQL A;  4X9J A;  1P47 A;  3HTX A;  3M7N G;  1A1H A;  4F2J C;  2NN6 B;  4DR4 I;  2DLK A;  4JYA I;  2V88 A;  4PRX A;  2A25 A;  3PYF A;  4RH8 A;  1DGC A;  1DQ3 A;  4DV4 I;  2NA2 A;  3LML A;  4NXM E;  1XHK A;  1A1I A;  2IOQ A;  2DSY A;  2JY9 A;  2YTO A;  4O24 A;  2V2Q A;  2EN4 A;  1KVK A;  2YSO A;  2JOB A;  2JP9 A;  4JI2 E;  2UUB I;  1A1K A;  1XNR I;  3EPJ A;  4OKG A;  4DR7 I;  1HR0 E;  5K36 D;  3P3G A;  2EPZ A;  4JI4 I;  1B63 A;  2WNR A;  3OML A;  3GME A;  3ZZ0 A;  3WU5 A;  2E5L I;  3IWB A;  2EP3 A;  2F4V I;  4B3R I;  1X6F A;  3CWV A;  2LO3 A;  2LUQ A;  5DNY A;  3Q6M A;  5LMU E;  3KRN A;  3V5R A;  2GPI A;  1NHI A;  2VF1 A;  4MU3 A;  2EOY A;  2IOP A;  1YYW A;  4DR7 E;  4RPF A;  1XNQ E;  1R6M A;  4JI7 I;  5ADZ A;  3K1J A;  2WBT A;  3PS2 A;  3PYG A;  4LF8 E;  4XTJ A;  4IZJ D;  5IXM B;  4JI1 E;  3BF2 A;  4LFA I;  4OX9 I;  2MC6 A;  2O1U A;  4JI4 E;  4U3D A;  2EOR A;  2LBS B;  3MHH C;  1YSA C;  3PS3 A;  4DPW A;  4OO1 C;  3J80 C;  3J81 C;  1JK1 A;  2EPA A;  2ENA A;  3ADJ A;  2EM9 A;  2DEJ A;  4MU0 A;  1YUJ A;  2Z5B B;  5IWA E;  4MLQ A;  1N33 I;  1HNW I;  2EM0 A;  4WSG A;  1NHJ A;  4JV5 I;  1G2D C;  1ZM9 A;  4YY3 E;  2NUE A;  3AV0 A;  2R76 A;  5LLQ A;  2LT7 A;  1Y60 A;  5L3J A;  2EPL X;  1J5E I;  2EQ0 A;  2L3C A;  4R2P A;  1T38 A;  1A6F A;  2YTP A;  4BA1 A; 
#chains in the Genus database with same CATH homology
 1N32 E;  1S16 A;  4PU9 A;  4LF6 I;  2LUP B;  3F0N A;  2ZM6 I;  1I94 E;  1Y4S A;  4DPU A;  4I3H A;  2UUC I;  1Z0G A;  3H4L A;  5AE1 A;  2X36 A;  4YY3 I;  1YYK A;  4LF9 I;  4JV5 E;  4DV7 E;  5AE3 A;  5IWA I;  2G7H A;  1XMQ E;  2OI2 A;  3HJC A;  4UTG A;  2RSM A;  3VK6 A;  4DV3 E;  1RC7 A;  1U2R A;  4BC7 A;  3T1H E;  4LU9 A;  1K47 A;  2KON A;  2B7V A;  1H7U A;  4BC9 A;  3LPS A;  4B3M I;  2GS8 A;  2IHR 1;  2HK3 A;  2O1V A;  1PKP A;  4JI0 I;  5F3W A;  1DI2 A;  4DV7 I;  4NXN I;  3PYD A;  1XNQ I;  3IWD A;  1H7S A;  4JI6 I;  4LFC E;  2JVA A;  3ADL A;  1HNW E;  2HHH E;  4X64 E;  3JU0 A;  4LF4 E;  4DR3 E;  4DUY E;  2FTX B;  2V8Q B;  4HXZ A;  3T1Y E;  4K0K E;  1WHQ A;  1HNX I;  5T6J A;  2VE7 C;  2CZ9 A;  2PNL A;  4JYA E;  3J7A M;  4X62 E;  3MSW A;  1GZ6 A;  3F6H A;  1S4E A;  3V2U C;  2ODR D;  2RS6 A;  1MG7 A;  1H72 C;  1STU A;  3B8H A;  4NXN E;  1NZ0 A;  4AQY I;  2RTX A;  4GKK E;  3ZKB A;  4ZVI A;  2HHH I;  4LF5 I;  1N34 I;  2MDR A;  2L8T A;  3ADG A;  1QZR A;  1PIE A;  2VQF E;  2L6M A;  4GKK I;  1FJG I;  4DR2 I;  2VF3 A;  4DPX A;  1EA6 A;  1T4N A;  4DKK A;  3QT6 A;  2BM1 A;  3K85 A;  4BCA A;  1N36 E;  2UU9 E;  2NUG A;  2L33 A;  1XMQ I;  3JTZ A;  4B3M E;  1HNZ E;  4WUD A;  5FWK A;  2JWO A;  3ZKD A;  2ZBK B;  4JI5 E;  4FWG A;  1UHZ A;  3QT7 A;  2DIX A;  4JI3 I;  4F54 A;  4M0V A;  4DUY I;  1ZXM A;  5FLX Q;  1EI1 A;  1ZM4 A;  2M7Q A;  2MC5 A;  4JI8 E;  4R8O A;  4LFB I;  1I94 I;  3LTO A;  1N32 I;  2UXB E;  1RR9 A;  4FWH A;  1OJ4 A;  2LJP A;  2UXC I;  3ZZU A;  1Z5A A;  2O1W A;  4DR6 E;  4DV6 E;  2E1R A;  4GEQ B;  4LFA E;  4JI1 I;  3JAM Q;  4DV3 I;  2B7T A;  2L2K B;  2J7K A;  2LE2 A;  2VQE E;  4B3S E;  4IZK B;  2KOU A;  4JG4 A;  3DF6 A;  1KIJ A;  2X7I A;  1FKA E;  4DR2 E;  2V87 A;  1QU6 A;  4DR5 E;  2FV4 B;  3C4B A;  2LMZ A;  3JAM C;  1MX0 A;  1WXR A;  4YHH I;  3HPS A;  4P78 A;  4DV5 E;  4Q28 A;  1XMO I;  5BR8 E;  2Q2E B;  4F9B B;  2ZIT A;  2KHX A;  3VYY A;  4OOG C;  3B82 A;  2N3H A;  1BKN A;  4DV4 E;  4IZK A;  4FWD A;  2NPF A;  5AE2 A;  1Z0B A;  4R1F A;  2UU9 I;  4X65 I;  4J8Z A;  4M30 A;  1IBL I;  1ZM2 A;  3PYE A;  1KKH A;  3LNU A;  4KZS A;  5LMU I;  2EZ6 A;  1N0U A;  4LF8 I;  5BR8 I;  4DV1 E;  4M2Z A;  4I8O A;  2V2Z A;  2V2V A;  1HR0 I;  4X66 I;  2FGG A;  4F9C B;  2ODR C;  2JOX A;  4DU7 A;  4Z7C A;  1O0W A;  2O1T A;  2BV3 A;  2EFG A;  2L2N A;  1IBM E;  1B62 A;  5LMN E;  1N0V C;  1H73 A;  2HFU A;  3P06 A;  3FIG A;  4DR6 I;  4NXM I;  4KQV A;  1RRE A;  4IZJ B;  2CPN A;  2LRS A;  2UUC E;  1HK7 A;  3PRY A;  1Z59 A;  1VIS A;  2V83 A;  1D6T A;  5A2Q C;  3IWC A;  4LFC I;  4BBY A;  4X66 E;  1T4L B;  2N3G A;  5GMD A;  2B9D A;  4X8W A;  4P7D A;  3ZOQ B;  2DMY A;  4LF6 E;  1MU5 A;  4DUZ E;  3WU6 A;  2YZT A;  4TUI A;  3HUL A;  3K17 A;  4DPT A;  2UXD I;  1SR9 A;  4HAC B;  1FWL A;  4P52 A;  1N33 E;  4OX9 E;  2HKJ A;  4USM A;  1IBL E;  2M1S A;  5FLX C;  4DMI A;  4N3O A;  4LF7 I;  1Y4U A;  4HY1 A;  4WUB A;  4F9A B;  1FWK A;  5IT9 Q;  4X64 I;  1X47 A;  4DU8 A;  2M4I A;  2V86 A;  1FJG E;  4GKJ I;  3Q6N A;  2VQF I;  1KTV A;  3HPZ A;  2Z5E A;  1UIL A;  1USV A;  3RMP A;  1J26 A;  4HAC A;  4DR5 I;  3P1X A;  2ZM6 E;  4JI2 I;  2LTS A;  1YZ9 A;  4JI3 E;  2E5L E;  2CGE A;  4M1K A;  2YT4 A;  1J5E E;  1GQE A;  2PNM A;  3ADI A;  1Z0C A;  2DB2 A;  5AAS A;  3D4J A;  4IZJ A;  3T1H I;  2XEX A;  3M6A A;  2LJH A;  4FN5 A;  4X62 I;  1ZBT A;  5A2Q Q;  5LMN I;  4DV2 E;  1H74 A;  2A2C A;  2B3T B;  1IBK E;  4JI8 I;  4HYM A;  3B78 A;  1ELO A;  1WHN A;  2V34 A;  4WUC A;  3OTO I;  5IT9 C;  3GON A;  3J80 Q;  3VYX A;  2L3J A;  4PRV A;  5LL6 R;  3DJW A;  1DAR A;  2L92 A;  3QT8 A;  4JI5 I;  3H09 A;  1Y6Z A;  2UUB E;  1XNR E;  2K4V A;  2DEI A;  4BMJ A;  1HNZ I;  3HXL A;  2A2D A;  3Q1Q A;  4FW9 A;  3AUZ A;  3J7A G;  1HNX E;  3C4T A;  2EWL A;  1WUU A;  2HFS A;  1Z0E A;  1XMO E;  1Z0T A;  4LF9 E;  3ZM7 A;  1IBM I;  3OTO E;  1NHH A;  2Z5C B;  4BS9 A;  4LF5 E;  2LTR A;  4EMD A;  4GKJ E;  4AQY E;  4DV0 I;  2NUF A;  3WU3 A;  2V89 A;  2GQ0 A;  1X49 A;  1ZBQ A;  1N34 E;  4B3S I;  4X65 E;  3QT5 A;  4DV1 I;  2UUA E;  4DPY A;  1Z0W A;  4WSP A;  4P7A A;  4ED4 A;  4B3T E;  1Z5C A;  1FI4 A;  2R3V A;  2HK2 A;  4WPY A;  4UT4 A;  4DV2 I;  2VQE I;  3F6G A;  1USU A;  4LF7 E;  2AJ4 A;  2RS7 A;  2Z5C A;  4DR3 I;  4B3T I;  4KHP E;  4MYT A;  4WYQ B;  4DR1 E;  4DV5 I;  4JI6 E;  2UUA I;  4YHH E;  2UXD E;  3T1Y I;  4K0K I;  3KWR A;  4L8N A;  4JI7 E;  4LF4 I;  2BM0 A;  2V8P A;  4Z7Y A;  3J81 Q;  2R42 A;  4DV0 E;  1RQ0 A;  2F4V E;  4LFB E;  4R03 A;  3ZZT A;  2CG9 A;  1PVG A;  3K6Q A;  4L5N C;  1X48 A;  5GME A;  4DXL A;  3LLH A;  4DR1 I;  2F8B A;  3J7Y p;  2Z5B A;  4TUG A;  5CFF E;  4JI0 E;  2E1M A;  1ZM3 A;  1T4O A;  2L2M A;  2WW4 A;  1Z0V A;  2UXC E;  1YYO A;  2JR1 A;  2HKE A;  4DR4 E;  4USK A;  4URL A;  4DV6 I;  1N36 I;  2WZO A;  2H36 X;  4DUZ I;  1EKZ A;  1ZXN A;  4B3R E;  4MYU A;  4LTY A;  2V85 A;  4WFT A;  1UEK A;  3HQ1 A;  1Z5B A;  3WU4 A;  1FNM A;  4KHP I;  1IBK I;  3HTX A;  4DR4 I;  4JYA I;  2V88 A;  4PRX A;  3PYF A;  4DV4 I;  1DQ3 A;  2NA2 A;  3LML A;  4NXM E;  1XHK A;  2IOQ A;  2DSY A;  2JY9 A;  2V2Q A;  1KVK A;  2JOB A;  4JI2 E;  2UUB I;  1XNR I;  4DR7 I;  1HR0 E;  4JI4 I;  1B63 A;  3OML A;  3ZZ0 A;  3WU5 A;  2E5L I;  3IWB A;  2F4V I;  4B3R I;  3CWV A;  3Q6M A;  5DNY A;  2LUQ A;  5LMU E;  3V5R A;  1NHI A;  2VF1 A;  2IOP A;  1YYW A;  4DR7 E;  4RPF A;  1XNQ E;  4JI7 I;  5ADZ A;  3K1J A;  3PYG A;  4LF8 E;  4XTJ A;  4IZJ D;  4JI1 E;  4LFA I;  4OX9 I;  2MC6 A;  2O1U A;  4JI4 E;  2LBS B;  4DPW A;  3J80 C;  3J81 C;  3ADJ A;  2DEJ A;  2Z5B B;  5IWA E;  1N33 I;  1HNW I;  1NHJ A;  4JV5 I;  1ZM9 A;  4YY3 E;  2NUE A;  3AV0 A;  5L3J A;  1J5E I;  2L3C A;  1A6F A;  2UXB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...