5IT9C

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5it9C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9C02
4P7AA 2BV3A 4KQVA 3ZZ0A 5A2QQ 2VQEE 4DUYI 2HFSA 3V5RA 3J7AM 5BR8E 4RPFA 4DV7E 4KHPE 2F4VI 2R3VA 3CWVA 2HFUA 2NPFA 3LNUA 1D6TA 4MYTA 1U2RA 2VF3A 4FWDA 4DV4I 4JI8I 3JAMC 4LFCI 2HHHI 4DV5I 4HACA 2AJ4A 5LMNI 4JI5E 4NXNI 1HNXE 4DR4I 1XMQI 1UEKA 2UU9I 4GKJE 4DR3E 3JAMQ 4YY3I 4JV5I 5IWAE 4DR6I 3D4JA 3K1JA 4B3RE 1RR9A 4K0KE 1NZ0A 2UXDI 1Z0CA 1Z0WA 2DEJA 4JI4I 1NHIA 2CZ9A 1J5EE 2HK2A 4Z7CA 3J80C 2HKEA 4URLA 2GS8A 1H74A 4DR2E 3K17A 4JYAE 4PRVA 2UXBI 4DV1I 4WUBA 1I94I 3B78A 1N32I 4LF4I 1KIJA 1IBMI 1XNRE 4DV3E 3J80Q 2V2QA 4FWGA 3V2UC 1HNWE 4JI7I 4JI2I 2UUAI 1H72C 4DPWA 4YHHI 3ZZTA 4B3ME 1Z5AA 4B3SE 1EI1A 5IT9C 3T1YE 4X65I 3PYEA 1N36I 3LTOA 2R42A 4AQYI 4LF8E 4DV6I 4OX9I 3WU4A 4PU9A 5LMNE 4NXNE 4PRXA 4GKKE 4LFBI 2UUBI 1H7SA 2VQFE 4DR5I 4M1KA 5IT9Q 1K47A 3OTOE 4LFAI 4DUZI 1FWKA 4DV2I 2BM1A 1HR0E 4DR6E 1HNZE 3QT6A 1ZM3A 3QT5A 4NXMI 4DV0I 4JI3E 4JI1E 1FJGE 1ZM2A 4X64E 4I3HA 1N34E 1S16A 1PVGA 1ELOA 1QZRA 4R1FA 4DR7I 3T1HI 2ZM6E 4JI6I 4ED4A 4X66I 1XMOI 1MX0A 1Z59A 5L3JA 4LF7E 4XTJA 4USMA 3M6AA 3H4LA 1IBLI 4LF6E 2UXCI 4JG4A 4HACB 4X62E 4JI0E 3QT8A 2V8PA 1XNQE 1RREA 2E1RA 4B3TI 1H73A 1IBKE 2V34A 4LF9E 1FI4A 3PYGA 4DU7A 2VQEI 3B82A 3ZZUA 5LL6R 1N33E 3ZM7A 2BM0A 3ZKDA 2UUCE 5BR8I 4DR1E 4DV7I 4KHPI 1ZXMA 5LMUE 1A6FA 2E5LE 4ZVIA 1NHHA 4FW9A 5FLXC 1MG7A 2V2ZA 1KKHA 4DV6E 3J81C 1ZXNA 1Z0GA 1Z5CA 2HK3A 4DUYE 2F4VE 1OJ4A 4JI5I 5FLXQ 2LJPA 1HNXI 1MU5A 3J81Q 3WU5A 3HULA 4GKJI 1Z0BA 4DR3I 4DV4E 4JI8E 4LFCE 1B62A 4DR7E 1NHJA 1PKPA 1WUUA 2EFGA 5IWAI 2HHHE 4Z7YA 4DV5E 4B3RI 4K0KI 3PYDA 4DR4E 1XMQE 1J5EI 2UU9E 4DU8A 4HY1A 2OI2A 5GMEA 4YY3E 4JV5E 4WUDA 4DR2I 4JYAI 3B8HA 1FKAE 4LF5I 1Z0TA 1FNMA 2UXDE 3PYFA 4JI4E 1N0VC 1XNRI 1H7UA 4DV3I 1VISA 1HNWI 3GONA 3J7AG 2HKJA 2WW4A 2UXBE 4WUCA 4DV1E 4B3MI 4USKA 4DPYA 4FWHA 4B3SI 1I94E 2A2CA 4MYUA 1N32E 4LF4E 3T1YI 1S4EA 3QT7A 4DPXA 1IBME 2ZBKB 4LF8I 4JI7E 4JI2E 2UUAE 3WU6A 4GKKI 4YHHE 1EA6A 2VQFI 3F0NA 4UTGA 1FWLA 1Z0VA 3OTOI 4DPTA 1B63A 1HR0I 1DARA 3LPSA 4UT4A 1HNZI 1KTVA 4X65E 1ZM4A 1N36E 4JI3I 4AQYE 2X36A 4JI1I 4OX9E 1Z0EA 3Q1QA 1FJGI 4LFBE 4X64I 1N34I 2UUBE 1PIEA 4DR5E 2ZM6I 4LFAE 4DUZE 1XHKA 4DV2E 5GMDA 1ZM9A 1N0UA 2X7IA 4FN5A 4NXME 4DV0E 2XEXA 4LF5E 4LF7I 1Z5BA 1BKNA 4DXLA 4LF6I 4HXZA 4EMDA 3T1HE 4X62I 4JI0I 4JI6E 2A2DA 2J7KA 3WU3A 4X66E 1XNQI 4DPUA 1XMOE 1IBKI 4LF9I 1KVKA 4P52A 5A2QC 2DEIA 1N33I 1IBLE 2UUCI 2UXCE 2ZITA 4DR1I 5LMUI 2E5LI 2V2VA 3ZKBA 2Q2EB 4HYMA 4B3TE
chains in the Genus database with same CATH superfamily
5C0XA 1IQSA 4P7AA 1A1LA 2ELZA 3TQMA 2BA1D 2BV3A 4KQVA 2NN6B 2B3TB 1UDOA 3ZZ0A 5A2QQ 2E1MA 2VQEE 2DGCA 3Q6NA 4LCHA 4DUYI 5K36C 4IFDE 2HFSA 3V5RA 3J7AM 5BR8E 4ZYDA 1Z1BA 5LLQA 4RPFA 1PJQA 5KL5A 4DV7E 4KHPE 5EL9A 2LJHA 1OYPA 1YZ9A 1JK1A 3LLHA 2R3VA 1ZR9A 3CWVA 3PS3A 2F4VI 1PJSA 2K4VA 2ELYA 2HFUA 3GMEA 2NPFA 3GLLA 1BBOA 2IOQA 1Y60A 3LNUA 5DRRA 3U1KA 5KL4A 1D6TA 4MYTA 5C0XC 1X3CA 4DKKA 1U2RA 2V8QB 2IOPA 2VF3A 2DLKA 4FWDA 2C38B 4DV4I 4JI8I 3JAMC 1RQ0A 2YWQA 5AE1A 4LFCI 4BA2A 4WPYA 1YFHA 4Q28A 1RHYA 2JR1A 2YTIA 2JT2A 2EMLA 4OO1A 2HHHI 2RS6A 2MC6A 1PJTA 3L00A 3VYXA 4DV5I 1KYQA 2JOXA 4ZYHA 2PRTA 4FK5C 4HACA 2AJ4A 2CT1A 4JI5E 5LMNI 4NXNI 1HNXE 4GEQB 2NN6F 4DR4I 1XMQI 1UEKA 4R2QA 2UU9I 4GKJE 5EKWA 4DR3E 4IFDA 2HGHA 3JAMQ 3PS1A 2EL6A 3HTXA 2BR2A 2YU5A 4YY3I 4OO1C 4JV5I 5IWAE 2EORA 4DR6I 2N3GA 3D4JA 4R2AA 2EPZA 3K1JA 2EE8A 1X6FA 2ENAA 4R8OA 2DLQA 4B3RE 3M7ND 1GTKA 2JOBA 2N8XA 1RR9A 4IFDB 2JE6A 4K0KE 4DMIA 1NZ0A 1UDSA 4IZKA 3DD6A 1WHQA 3MSWA 2UXDI 1Z0CA 1X5WA 2H36X 1Z0WA 3L7ZA 2DEJA 4JI4I 2EOSA 3UK3C 2A25A 1J5EE 1NHIA 2CZ9A 2HK2A 4IFDC 5K36E 4Z7CA 2YSPA 3J80C 3DF6A 4IZKB 3ECRA 3P3CA 2HKEA 4OOGC 4URLA 2V85A 2GS8A 3CDIA 2ADRA 1H74A 4DR2E 3K17A 1Y4UA 1T39A 1A1IA 4JYAE 1E3HA 2EPCA 4BS9A 4PRVA 2UXBI 4DV1I 2EMHA 4IJDA 1YUIA 3P76A 4MLQA 2KHXA 4IZJB 5DNYA 2BB8A 2EPMX 4M2ZA 2PO2A 4WUBA 5AASA 3EPHA 1I94I 3B78A 1UDQA 1N32I 1RC7A 3EPJA 1A1KA 4RHBB 2L33A 2PNZA 4OKGA 4LF4I 1KIJA 2EPLX 4WYQB 4F9AB 3EPLA 4FW7A 4F6MA 4O5GA 4DV3E 1XNRE 4N4RB 3QG5C 2V86A 5FWKA 1KJKA 2V2QA 5ELWA 3J80Q 4FWGA 4KWYA 3OMLA 3V2UC 2YRKA 4R03A 1HNWE 4JI7I 3KRNA 4JI2I 1Y4SA 2EMXA 2UUAI 4ISAA 1XXEA 1H72C 2MC5A 2F8BA 4KZSA 5T6JA 4O4KA 2NN6D 2NABA 4DPWA 2LTRA 2EOYA 4BCAA 4B3ME 1GZ6A 1Z5AA 3ZZTA 1N3GA 1UN6B 4YHHI 4ZYGA 2HJJA 2YTPA 3F6GA 4B3SE 2CSHA 5IT9C 1EI1A 2WP8A 2YTFA 2Z5EA 3M99B 3ZOQB 2EOQA 5JEAE 1QU6A 2DSYA 3K85A 2MDRA 2O1VA 3T1YE 2PO0A 2EMYA 4FW6A 2LBSB 2C37B 4OO1E 4LTYA 3PYEA 4X65I 1BBGA 4MU3A 1N36I 2LT7A 3LTOA 3M85G 1HR0I 2O3ZA 2B7VA 3HPSA 2FTXB 4LF8E 2R42A 3VYYA 4AQYI 4TUGA 5A6BA 2JVAA 5K36B 4DV6I 2ENCA 3J7Yp 3WU4A 4OX9I 2G7HA 2JPAA 4PU9A 5LMNE 3BF2A 4NXNE 4GKKE 2GO4A 4PRXA 4LFBI 2UUBI 1H7SA 2VQFE 3LMLA 2EPOA 4O43A 4M1KA 4DR5I 3C6KA 5IT9Q 2NA2A 3JTZA 3ADIA 1K47A 2EOEA 2EZ6A 3OTOE 4LFAI 5AE2A 4DUZI 2PO1B 1FWKA 1DQ3A 5C0XB 4M0VA 5A6JA 1HR0E 2ODRD 1ZAAC 2BM1A 4DV2I 4DR6E 2O1UA 2L3JA 1HNZE 2L6MA 2EQ0A 4FW5A 3QT6A 2LV2A 1ZM3A 2GQ0A 2IERA 3QT5A 2C39A 4NXMI 2JP9A 1OYSA 1EKZA 2RSMA 4JI3E 3H1CA 5DRPA 4DV0I 3Q6MA 4JI1E 2O1TA 5KL7A 4BA1A 2YRHA 3ADJA 1FJGE 3IWCA 1ZM2A 4X64E 1YYWA 1N34E 4I3HA 1Y6ZA 1S16A 2YU8A 4MU1A 1PVGA 1ELOA 2IHR1 1QZRA 4N3OA 4R1FA 5JEAA 2CTDA 2ZM6E 3T1HI 4JI6I 4DR7I 4GQUA 3PRYA 4ED4A 2EM0A 3HPZA 2LJUA 4X66I 2NUGA 3M85D 2Z5CA 4IFDD 1XMOI 4WFTA 4NZVA 1MX0A 1Z59A 4BA2B 2RTXA 1ZBQA 5L3JA 4LF7E 2EJ4A 5A6AA 4XTJA 4OO1B 3NZKA 4USMA 3M6AA 2V87A 3H4LA 4LF6E 2GPIA 4M9VC 1IBLI 3KZZA 5JEAC 2UXCI 4R2PA 4JG4A 2DB2A 2VESA 2EM3A 2LTSA 1EH8A 4HACB 2PNMA 5C0XF 1YYOA 4X62E 4JI0E 1UBDC 2RS7A 3QT8A 2BA0G 2EOFA 2V8PA 1XNQE 1RREA 2JXPA 2E1RA 4IZJD 4B3TI 4LCFA 1H73A 1ZU1A 1IBKE 2EMFA 2KONA 4L8NA 4QNKA 1ZBTA 2BR2B 4LF9E 2V34A 4MU0A 2EMBA 2JEAA 1FI4A 2YRMA 3PYGA 3VK6A 4DU7A 2EMGA 4GZNC 2MKDA 4TUIA 3B82A 3ZZUA 2VQEI 5LL6R 3ADGA 2BBGA 1N33E 3ZM7A 2BM0A 2UUCE 3ZKDA 5BR8I 2JE6B 4DR1E 4DV7I 4KHPI 1QNTA 4WSPA 3JU0A 5LMUE 2EN3A 1A6FA 1ZXMA 2E5LE 2EPKX 2WNRA 3AV0A 2EPAA 1YUJA 3L7ZB 4ZVIA 3F6HA 1O0WA 2I9IA 1NHHA 4FW9A 4U3DA 1USVA 4OZEA 3DJWA 5AE3A 5FLXC 1MG7A 2GO3A 2V2ZA 1KKHA 4DV6E 2CPNA 4OO1F 3J81C 2LE2A 4WSGA 2F1DA 3MHHC 2JY9A 2NUEA 2EM2A 1ZXNA 4NBQA 1TN9A 1A1FA 1Z0GA 5KL3A 1Z5CA 2EMZA 4BMJA 2HK3A 3HQ1A 4DUYE 2JWOA 4RH8A 2WCC3 1UILA 1TF3A 2EN8A 2YT4A 1WRJA 2R76A 2VF1A 2EM5A 1X6HA 1NEIA 2F4VE 2PO2B 5K36D 3M7NG 2NN6E 2RQLA 3FIGA 4HTGA 2WBTA 1OJ4A 4IFDF 2EL4A 5KL6A 2PNZB 4F54A 2WBSA 4L5NC 4JI5I 5FLXQ 5AC5A 2LJPA 1HNXI 2EOOA 1MU5A 4U3BA 2EM7A 1YSAC 3WU5A 3J81Q 3GCMA 3HULA 4GKJI 1Z0BA 1R6MA 5IV8B 2EQ1A 2V83A 1IQOA 4DR3I 2M7QA 4DV4E 4JI8E 5C0XD 4LFCE 1B62A 2EOJA 5A69A 4DR7E 1NHJA 1PKPA 3AUZA 1EH7A 1WUUA 2YTDA 1T4OA 3H09A 2EFGA 5IWAI 1UHZA 3U1YA 1DI2A 2L2KB 2HHHE 4QNJA 2EMIA 2Z5BA 4Z7YA 4DV5E 4FW4A 2WP8B 5DNLA 1L4SA 4B3RI 2LVHA 5TSEA 3PYDA 4K0KI 4LOMA 2EMCA 1X47A 1SFEA 1OYRA 1YHCA 2PO0B 4AIDA 2B7TA 1XMQE 4DR4E 3HKMA 2UU9E 1J5EI 2DRPA 1AAYA 1USUA 1PDAA 4DU8A 2EOHA 1GQEA 4HY1A 4F9CB 2OI2A 5GMEA 2YTJA 3HXLA 2JEBA 4YY3E 2EM8A 2EN1A 3ADLA 4JV5E 4WUDA 2E72A 2L3CA 2NN6A 4DR2I 1JK2A 4JYAI 2I13A 2LUQA 3KZYA 1FKAE 3B8HA 1G2FC 4OO1D 1MGTA 2Q8UA 2D9HA 4F6NA 1Z0TA 4LF5I 2DMYA 1FNMA 2YPNA 2JEBB 2UXDE 1STUA 1A1HA 3PYFA 4JI4E 2M4IA 1N0VC 2C39B 4R2CA 3KWRA 3P3EA 1H7UA 3BGHA 4DV3I 2LRSA 1XNRI 1VISA 4BA1B 4LPFA 5CFFE 2EOZA 2C38A 2NN6C 2EN2A 4F2JC 4P7DA 1A1GA 1IBMI 1HNWI 1R6LA 2YTNA 3P06A 2AE8A 4MU4A 2BA0D 3GONA 3J7AG 2V88A 3IWBA 5K36F 5JEAB 2HKJA 2UXBE 2WW4A 4DV1E 4WUCA 2YTEA 1G2DC 2BA1G 4BBYA 4B3MI 4USKA 4DPYA 4FWHA 4B3SI 2CGEA 2IESA 2Z5CB 1I94E 1TF6A 2YTOA 2K7IA 1YYKA 2A2CA 2FGGA 4MQYA 1N32E 4MYUA 4J8ZA 4LF4E 3T1YI 2EOXA 4BC7A 1S4EA 3QT7A 4DPXA 1IBME 4NHRA 2EL5A 1LLMC 3VHTB 4J3DA 2ZBKB 4AIMA 4LF8I 3K6QA 1AH5A 4JI7E 2EP3A 2DMIA 1T38A 4JI2E 3HJCA 3EQ1A 1WXRA 2UUAE 3WU6A 4BHBA 2ENHA 2MKNA 4GKKI 2EMWA 1X6EA 4R2SA 4YHHE 1B69A 1EA6A 2VQFI 3F0NA 2ODRC 2GLIA 4UTGA 1FWLA 1Z0VA 2J65A 2PNLA 3OTOI 2CVEA 1P47A 5A6KA 4DPTA 3RMPA 3MHSC 1B63A 4FW3A 1DARA 2RSIA 2EN7A 1T4NA 4BHCA 1RMDA 2B9DA 2EN4A 2JEAB 3LPSA 3UHMA 3EPKA 4X65E 2NUFA 1E3PA 1KTVA 4UT4A 1ZM4A 1HNZI 1N36E 5JEAF 5ADZA 2L8TA 5IXMB 4AQYE 4JI3I 5DROA 2WZOA 3P3GA 2EM6A 2X36A 2GHFA 2JYAA 2EM4A 4JI1I 2YZTA 2EOIA 2EM9A 2EN6A 4OX9E 1Z0EA 3Q1QA 1FJGI 1WHNA 2EQ3A 2DIXA 1F2IG 4MDTA 1Y5YA 2MDGA 1SR9A 2YTGA 4MLVA 4LFBE 1T4LB 2WNRB 4LCGA 4X64I 5DRQA 2UUBE 4WX9A 2CG9A 2EMAA 1N34I 4O24A 2EWLA 4DR5E 4M30A 1PIEA 3B4TA 2ZM6I 1YH8A 4IZJA 1NCSA 4DUZE 4LFAE 4BC9A 1WJPA 2LO3A 1A1JA 1XHKA 3CDJA 4DV2E 4IS1C 2WBUA 5GMDA 1ZM9A 2VE7C 2VRDA 3BBGA 1N0UA 2RPCA 3THNA 5F3WA 2X7IA 5DNXA 1X48A 2FV4B 4X9JA 4NXME 4FN5A 4DV0E 2XEXA 2YTQA 1VI7A 2EPXA 4LF5E 4LF7I 1Z5BA 2HC5A 4IS9A 4I8OA 5C0XE 2L2MA 1BKNA 4DXLA 2L92A 1J26A 1UDNA 4LF6I 5A6BD 3PS2A 4R2EA 1YPNA 2O1WA 3P1XA 4HXZA 1HK7A 2M1SA 1X49A 4LU9A 5KL2A 4EMDA 3T1HE 4X62I 4JI6E 4JI0I 3THOB 2R1FA 2A2DA 4HEIA 3C6MA 2LUPB 1MEYC 4X66E 2J7KA 3WU3A 1DGCA 2J7JA 2EMKA 1XNQI 2YSOA 2EPUA 4DPUA 1XMOE 1IBKI 3C4TA 4WXDA 2KOUA 4F9BB 4R2RA 4LF9I 2LCEA 1KVKA 2LMZA 2C37A 4P52A 4WXCA 5A2QC 2DEIA 4X8WA 5AC4A 1N33I 2Z5BB 2EPNA 2V89A 1IBLE 4ZYEA 2UUCI 2EPPA 4AM3A 2UXCE 5K36A 2EOMA 2ZITA 4DR1I 2EPRA 2L2NA 4Q35B 1EH6A 1BB8A 5LMUI 1P42A 3BIDA 2E5LI 2V2VA 3ZKBA 5JEAD 2Q2EB 2N3HA 3C4BA 3IWDA 4P78A 4HYMA 4B3TE 2M9AA 1IMUA 4R2DA 2PO1A
chains in the Genus database with same CATH topology
4P7AA 2BV3A 4KQVA 2B3TB 3ZZ0A 5A2QQ 2E1MA 2VQEE 3Q6NA 4DUYI 2HFSA 3V5RA 3J7AM 5BR8E 4RPFA 4DV7E 4KHPE 2LJHA 2F4VI 1YZ9A 3LLHA 2R3VA 3CWVA 2K4VA 2HFUA 2NPFA 2IOQA 3LNUA 1D6TA 4MYTA 4DKKA 1U2RA 2V8QB 2IOPA 2VF3A 4FWDA 4DV4I 4JI8I 3JAMC 1RQ0A 5AE1A 4LFCI 4WPYA 4Q28A 2JR1A 2HHHI 2RS6A 2MC6A 3VYXA 4DV5I 2JOXA 4HACA 2AJ4A 4JI5E 5LMNI 4NXNI 1HNXE 4GEQB 4DR4I 1XMQI 1UEKA 2UU9I 4GKJE 4DR3E 3JAMQ 3HTXA 4YY3I 4JV5I 5IWAE 4DR6I 2N3GA 3D4JA 3K1JA 4R8OA 4B3RE 2JOBA 1RR9A 4K0KE 4DMIA 1NZ0A 4IZKA 1WHQA 3MSWA 2UXDI 1Z0CA 2H36X 1Z0WA 2DEJA 4JI4I 1NHIA 2CZ9A 1J5EE 2HK2A 4Z7CA 3J80C 3DF6A 4IZKB 2HKEA 4OOGC 4URLA 2V85A 2GS8A 1H74A 4DR2E 3K17A 1Y4UA 4JYAE 4PRVA 4BS9A 2UXBI 4DV1I 4IZJB 2KHXA 5DNYA 4M2ZA 4WUBA 5AASA 1I94I 3B78A 1N32I 1RC7A 2L33A 4LF4I 1KIJA 1IBMI 4WYQB 4F9AB 1XNRE 4DV3E 3J80Q 5FWKA 2V86A 2V2QA 4FWGA 3OMLA 3V2UC 4R03A 1HNWE 4JI7I 4JI2I 1Y4SA 2UUAI 1H72C 2MC5A 2F8BA 4KZSA 5T6JA 4DPWA 2LTRA 4BCAA 3ZZTA 4B3ME 1GZ6A 1Z5AA 4YHHI 3F6GA 4B3SE 1EI1A 5IT9C 2Z5EA 3ZOQB 1QU6A 2DSYA 3K85A 2MDRA 2O1VA 3T1YE 2LBSB 4LTYA 3PYEA 4X65I 1N36I 3LTOA 2B7VA 3HPSA 2FTXB 4LF8E 2R42A 3VYYA 4AQYI 4TUGA 2JVAA 4DV6I 4OX9I 3J7Yp 3WU4A 2G7HA 4PU9A 5LMNE 4NXNE 4GKKE 4PRXA 4LFBI 2UUBI 1H7SA 2VQFE 3LMLA 4M1KA 4DR5I 5IT9Q 2NA2A 3JTZA 3ADIA 1K47A 2EZ6A 3OTOE 4LFAI 5AE2A 4DUZI 1FWKA 1DQ3A 4M0VA 1HR0E 2BM1A 2ODRD 4DV2I 4DR6E 2O1UA 2L3JA 1HNZE 2L6MA 3QT6A 1ZM3A 2GQ0A 3QT5A 4NXMI 4DV0I 1EKZA 2RSMA 4JI3E 3Q6MA 4JI1E 2O1TA 3ADJA 1FJGE 3IWCA 1ZM2A 4X64E 1YYWA 1N34E 4I3HA 1Y6ZA 1S16A 1PVGA 1ELOA 2IHR1 1QZRA 4N3OA 4R1FA 4DR7I 3T1HI 2ZM6E 4JI6I 3PRYA 4ED4A 3HPZA 4X66I 2NUGA 2Z5CA 1XMOI 4WFTA 1MX0A 1Z59A 2RTXA 1ZBQA 5L3JA 4LF7E 4XTJA 4USMA 3M6AA 2V87A 3H4LA 4LF6E 1IBLI 2UXCI 4JG4A 2DB2A 2LTSA 4HACB 2PNMA 1YYOA 4X62E 4JI0E 2RS7A 3QT8A 2V8PA 1XNQE 1RREA 2E1RA 4IZJD 4B3TI 1H73A 1IBKE 2KONA 4L8NA 1ZBTA 2V34A 4LF9E 1FI4A 3PYGA 3VK6A 4DU7A 4TUIA 3B82A 3ZZUA 2VQEI 5LL6R 3ADGA 1N33E 3ZM7A 2BM0A 2UUCE 3ZKDA 5BR8I 4DR1E 4DV7I 4KHPI 4WSPA 1ZXMA 3JU0A 5LMUE 1A6FA 2E5LE 3AV0A 4ZVIA 3F6HA 1O0WA 1NHHA 4FW9A 1USVA 3DJWA 5AE3A 5FLXC 1MG7A 2V2ZA 1KKHA 4DV6E 2CPNA 3J81C 2LE2A 2JY9A 2NUEA 1ZXNA 1Z0GA 1Z5CA 4BMJA 2HK3A 3HQ1A 4DUYE 2JWOA 1UILA 2YT4A 2VF1A 2F4VE 3FIGA 1OJ4A 4F54A 4L5NC 4JI5I 5FLXQ 2LJPA 1HNXI 1MU5A 3J81Q 3WU5A 3HULA 4GKJI 1Z0BA 2V83A 4DR3I 2M7QA 4DV4E 4JI8E 4LFCE 1B62A 4DR7E 1NHJA 1PKPA 3AUZA 1WUUA 2EFGA 3H09A 1T4OA 5IWAI 1UHZA 1DI2A 2L2KB 2HHHE 2Z5BA 4Z7YA 4DV5E 4B3RI 4K0KI 3PYDA 1X47A 2B7TA 1XMQE 4DR4E 2UU9E 1J5EI 1USUA 4DU8A 1GQEA 4HY1A 4F9CB 2OI2A 5GMEA 3HXLA 4YY3E 3ADLA 4JV5E 4WUDA 2L3CA 4DR2I 4JYAI 2LUQA 1FKAE 3B8HA 4LF5I 1Z0TA 2DMYA 1FNMA 2UXDE 1STUA 3PYFA 4JI4E 2M4IA 1N0VC 3KWRA 1XNRI 1H7UA 4DV3I 2LRSA 1VISA 5CFFE 4P7DA 1HNWI 3P06A 3GONA 3J7AG 2V88A 3IWBA 2HKJA 2UXBE 2WW4A 4DV1E 4WUCA 4BBYA 4B3MI 4USKA 4DPYA 4FWHA 4B3SI 2CGEA 2Z5CB 1YYKA 1I94E 2A2CA 2FGGA 4MYUA 1N32E 4J8ZA 4LF4E 3T1YI 4BC7A 1S4EA 3QT7A 4DPXA 1IBME 2ZBKB 4LF8I 3K6QA 4JI7E 4JI2E 3HJCA 1WXRA 2UUAE 3WU6A 4GKKI 4YHHE 1EA6A 2VQFI 3F0NA 2ODRC 4UTGA 1FWLA 1Z0VA 2PNLA 3OTOI 4DPTA 3RMPA 1B63A 1HR0I 1DARA 1T4NA 2B9DA 3LPSA 4UT4A 1HNZI 4X65E 2NUFA 1KTVA 1ZM4A 1N36E 5ADZA 2L8TA 4JI3I 4AQYE 2WZOA 2X36A 4JI1I 2YZTA 4OX9E 1Z0EA 3Q1QA 1FJGI 1WHNA 2DIXA 1SR9A 4LFBE 1T4LB 4X64I 2UUBE 2CG9A 1N34I 2EWLA 4DR5E 4M30A 1PIEA 2ZM6I 4IZJA 4LFAE 4DUZE 4BC9A 1XHKA 4DV2E 5GMDA 1ZM9A 2VE7C 1N0UA 2X7IA 5F3WA 1X48A 2FV4B 4NXME 4FN5A 4DV0E 2XEXA 4LF5E 4LF7I 1Z5BA 4I8OA 2L2MA 1BKNA 4DXLA 2L92A 1J26A 4LF6I 4HXZA 2O1WA 3P1XA 1HK7A 2M1SA 1X49A 4LU9A 4EMDA 3T1HE 4X62I 4JI6E 4JI0I 2A2DA 2LUPB 2J7KA 4X66E 3WU3A 1XNQI 4DPUA 1XMOE 1IBKI 3C4TA 2KOUA 4F9BB 4LF9I 1KVKA 2LMZA 4P52A 5A2QC 2DEIA 4X8WA 1N33I 2Z5BB 2V89A 1IBLE 2UUCI 2UXCE 2ZITA 4DR1I 2L2NA 5LMUI 2E5LI 2V2VA 3ZKBA 2Q2EB 2N3HA 3C4BA 3IWDA 4P78A 4HYMA 4B3TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7A A;  2BV3 A;  4KQV A;  3ZZ0 A;  5A2Q Q;  2VQE E;  4DUY I;  2HFS A;  3V5R A;  3J7A M;  5BR8 E;  4RPF A;  4DV7 E;  4KHP E;  2F4V I;  2R3V A;  3CWV A;  2HFU A;  2NPF A;  3LNU A;  1D6T A;  4MYT A;  1U2R A;  2VF3 A;  4FWD A;  4DV4 I;  4JI8 I;  3JAM C;  4LFC I;  2HHH I;  4DV5 I;  4HAC A;  2AJ4 A;  5LMN I;  4JI5 E;  4NXN I;  1HNX E;  4DR4 I;  1XMQ I;  1UEK A;  2UU9 I;  4GKJ E;  4DR3 E;  3JAM Q;  4YY3 I;  4JV5 I;  5IWA E;  4DR6 I;  3D4J A;  3K1J A;  4B3R E;  1RR9 A;  4K0K E;  1NZ0 A;  2UXD I;  1Z0C A;  1Z0W A;  2DEJ A;  4JI4 I;  1NHI A;  2CZ9 A;  1J5E E;  2HK2 A;  4Z7C A;  3J80 C;  2HKE A;  4URL A;  2GS8 A;  1H74 A;  4DR2 E;  3K17 A;  4JYA E;  4PRV A;  2UXB I;  4DV1 I;  4WUB A;  1I94 I;  3B78 A;  1N32 I;  4LF4 I;  1KIJ A;  1IBM I;  1XNR E;  4DV3 E;  3J80 Q;  2V2Q A;  4FWG A;  3V2U C;  1HNW E;  4JI7 I;  4JI2 I;  2UUA I;  1H72 C;  4DPW A;  4YHH I;  3ZZT A;  4B3M E;  1Z5A A;  4B3S E;  1EI1 A;  5IT9 C;  3T1Y E;  4X65 I;  3PYE A;  1N36 I;  3LTO A;  2R42 A;  4AQY I;  4LF8 E;  4DV6 I;  4OX9 I;  3WU4 A;  4PU9 A;  5LMN E;  4NXN E;  4PRX A;  4GKK E;  4LFB I;  2UUB I;  1H7S A;  2VQF E;  4DR5 I;  4M1K A;  5IT9 Q;  1K47 A;  3OTO E;  4LFA I;  4DUZ I;  1FWK A;  4DV2 I;  2BM1 A;  1HR0 E;  4DR6 E;  1HNZ E;  3QT6 A;  1ZM3 A;  3QT5 A;  4NXM I;  4DV0 I;  4JI3 E;  4JI1 E;  1FJG E;  1ZM2 A;  4X64 E;  4I3H A;  1N34 E;  1S16 A;  1PVG A;  1ELO A;  1QZR A;  4R1F A;  4DR7 I;  3T1H I;  2ZM6 E;  4JI6 I;  4ED4 A;  4X66 I;  1XMO I;  1MX0 A;  1Z59 A;  5L3J A;  4LF7 E;  4XTJ A;  4USM A;  3M6A A;  3H4L A;  1IBL I;  4LF6 E;  2UXC I;  4JG4 A;  4HAC B;  4X62 E;  4JI0 E;  3QT8 A;  2V8P A;  1XNQ E;  1RRE A;  2E1R A;  4B3T I;  1H73 A;  1IBK E;  2V34 A;  4LF9 E;  1FI4 A;  3PYG A;  4DU7 A;  2VQE I;  3B82 A;  3ZZU A;  5LL6 R;  1N33 E;  3ZM7 A;  2BM0 A;  3ZKD A;  2UUC E;  5BR8 I;  4DR1 E;  4DV7 I;  4KHP I;  1ZXM A;  5LMU E;  1A6F A;  2E5L E;  4ZVI A;  1NHH A;  4FW9 A;  5FLX C;  1MG7 A;  2V2Z A;  1KKH A;  4DV6 E;  3J81 C;  1ZXN A;  1Z0G A;  1Z5C A;  2HK3 A;  4DUY E;  2F4V E;  1OJ4 A;  4JI5 I;  5FLX Q;  2LJP A;  1HNX I;  1MU5 A;  3J81 Q;  3WU5 A;  3HUL A;  4GKJ I;  1Z0B A;  4DR3 I;  4DV4 E;  4JI8 E;  4LFC E;  1B62 A;  4DR7 E;  1NHJ A;  1PKP A;  1WUU A;  2EFG A;  5IWA I;  2HHH E;  4Z7Y A;  4DV5 E;  4B3R I;  4K0K I;  3PYD A;  4DR4 E;  1XMQ E;  1J5E I;  2UU9 E;  4DU8 A;  4HY1 A;  2OI2 A;  5GME A;  4YY3 E;  4JV5 E;  4WUD A;  4DR2 I;  4JYA I;  3B8H A;  1FKA E;  4LF5 I;  1Z0T A;  1FNM A;  2UXD E;  3PYF A;  4JI4 E;  1N0V C;  1XNR I;  1H7U A;  4DV3 I;  1VIS A;  1HNW I;  3GON A;  3J7A G;  2HKJ A;  2WW4 A;  2UXB E;  4WUC A;  4DV1 E;  4B3M I;  4USK A;  4DPY A;  4FWH A;  4B3S I;  1I94 E;  2A2C A;  4MYU A;  1N32 E;  4LF4 E;  3T1Y I;  1S4E A;  3QT7 A;  4DPX A;  1IBM E;  2ZBK B;  4LF8 I;  4JI7 E;  4JI2 E;  2UUA E;  3WU6 A;  4GKK I;  4YHH E;  1EA6 A;  2VQF I;  3F0N A;  4UTG A;  1FWL A;  1Z0V A;  3OTO I;  4DPT A;  1B63 A;  1HR0 I;  1DAR A;  3LPS A;  4UT4 A;  1HNZ I;  1KTV A;  4X65 E;  1ZM4 A;  1N36 E;  4JI3 I;  4AQY E;  2X36 A;  4JI1 I;  4OX9 E;  1Z0E A;  3Q1Q A;  1FJG I;  4LFB E;  4X64 I;  1N34 I;  2UUB E;  1PIE A;  4DR5 E;  2ZM6 I;  4LFA E;  4DUZ E;  1XHK A;  4DV2 E;  5GMD A;  1ZM9 A;  1N0U A;  2X7I A;  4FN5 A;  4NXM E;  4DV0 E;  2XEX A;  4LF5 E;  4LF7 I;  1Z5B A;  1BKN A;  4DXL A;  4LF6 I;  4HXZ A;  4EMD A;  3T1H E;  4X62 I;  4JI0 I;  4JI6 E;  2A2D A;  2J7K A;  3WU3 A;  4X66 E;  1XNQ I;  4DPU A;  1XMO E;  1IBK I;  4LF9 I;  1KVK A;  4P52 A;  5A2Q C;  2DEI A;  1N33 I;  1IBL E;  2UUC I;  2UXC E;  2ZIT A;  4DR1 I;  5LMU I;  2E5L I;  2V2V A;  3ZKB A;  2Q2E B;  4HYM A;  4B3T E; 
#chains in the Genus database with same CATH topology
 5C0X A;  1IQS A;  4P7A A;  1A1L A;  2ELZ A;  3TQM A;  2BA1 D;  2BV3 A;  4KQV A;  2NN6 B;  2B3T B;  1UDO A;  3ZZ0 A;  5A2Q Q;  2E1M A;  2VQE E;  2DGC A;  3Q6N A;  4LCH A;  4DUY I;  5K36 C;  4IFD E;  2HFS A;  3V5R A;  3J7A M;  5BR8 E;  4ZYD A;  1Z1B A;  5LLQ A;  4RPF A;  1PJQ A;  5KL5 A;  4DV7 E;  4KHP E;  5EL9 A;  2LJH A;  1OYP A;  1YZ9 A;  1JK1 A;  3LLH A;  2R3V A;  1ZR9 A;  3CWV A;  3PS3 A;  2F4V I;  1PJS A;  2K4V A;  2ELY A;  2HFU A;  3GME A;  2NPF A;  3GLL A;  1BBO A;  2IOQ A;  1Y60 A;  3LNU A;  5DRR A;  3U1K A;  5KL4 A;  1D6T A;  4MYT A;  5C0X C;  1X3C A;  4DKK A;  1U2R A;  2V8Q B;  2IOP A;  2VF3 A;  2DLK A;  4FWD A;  2C38 B;  4DV4 I;  4JI8 I;  3JAM C;  1RQ0 A;  2YWQ A;  5AE1 A;  4LFC I;  4BA2 A;  4WPY A;  1YFH A;  4Q28 A;  1RHY A;  2JR1 A;  2YTI A;  2JT2 A;  2EML A;  4OO1 A;  2HHH I;  2RS6 A;  2MC6 A;  1PJT A;  3L00 A;  3VYX A;  4DV5 I;  1KYQ A;  2JOX A;  4ZYH A;  2PRT A;  4FK5 C;  4HAC A;  2AJ4 A;  2CT1 A;  4JI5 E;  5LMN I;  4NXN I;  1HNX E;  4GEQ B;  2NN6 F;  4DR4 I;  1XMQ I;  1UEK A;  4R2Q A;  2UU9 I;  4GKJ E;  5EKW A;  4DR3 E;  4IFD A;  2HGH A;  3JAM Q;  3PS1 A;  2EL6 A;  3HTX A;  2BR2 A;  2YU5 A;  4YY3 I;  4OO1 C;  4JV5 I;  5IWA E;  2EOR A;  4DR6 I;  2N3G A;  3D4J A;  4R2A A;  2EPZ A;  3K1J A;  2EE8 A;  1X6F A;  2ENA A;  4R8O A;  2DLQ A;  4B3R E;  3M7N D;  1GTK A;  2JOB A;  2N8X A;  1RR9 A;  4IFD B;  2JE6 A;  4K0K E;  4DMI A;  1NZ0 A;  1UDS A;  4IZK A;  3DD6 A;  1WHQ A;  3MSW A;  2UXD I;  1Z0C A;  1X5W A;  2H36 X;  1Z0W A;  3L7Z A;  2DEJ A;  4JI4 I;  2EOS A;  3UK3 C;  2A25 A;  1J5E E;  1NHI A;  2CZ9 A;  2HK2 A;  4IFD C;  5K36 E;  4Z7C A;  2YSP A;  3J80 C;  3DF6 A;  4IZK B;  3ECR A;  3P3C A;  2HKE A;  4OOG C;  4URL A;  2V85 A;  2GS8 A;  3CDI A;  2ADR A;  1H74 A;  4DR2 E;  3K17 A;  1Y4U A;  1T39 A;  1A1I A;  4JYA E;  1E3H A;  2EPC A;  4BS9 A;  4PRV A;  2UXB I;  4DV1 I;  2EMH A;  4IJD A;  1YUI A;  3P76 A;  4MLQ A;  2KHX A;  4IZJ B;  5DNY A;  2BB8 A;  2EPM X;  4M2Z A;  2PO2 A;  4WUB A;  5AAS A;  3EPH A;  1I94 I;  3B78 A;  1UDQ A;  1N32 I;  1RC7 A;  3EPJ A;  1A1K A;  4RHB B;  2L33 A;  2PNZ A;  4OKG A;  4LF4 I;  1KIJ A;  2EPL X;  4WYQ B;  4F9A B;  3EPL A;  4FW7 A;  4F6M A;  4O5G A;  4DV3 E;  1XNR E;  4N4R B;  3QG5 C;  2V86 A;  5FWK A;  1KJK A;  2V2Q A;  5ELW A;  3J80 Q;  4FWG A;  4KWY A;  3OML A;  3V2U C;  2YRK A;  4R03 A;  1HNW E;  4JI7 I;  3KRN A;  4JI2 I;  1Y4S A;  2EMX A;  2UUA I;  4ISA A;  1XXE A;  1H72 C;  2MC5 A;  2F8B A;  4KZS A;  5T6J A;  4O4K A;  2NN6 D;  2NAB A;  4DPW A;  2LTR A;  2EOY A;  4BCA A;  4B3M E;  1GZ6 A;  1Z5A A;  3ZZT A;  1N3G A;  1UN6 B;  4YHH I;  4ZYG A;  2HJJ A;  2YTP A;  3F6G A;  4B3S E;  2CSH A;  5IT9 C;  1EI1 A;  2WP8 A;  2YTF A;  2Z5E A;  3M99 B;  3ZOQ B;  2EOQ A;  5JEA E;  1QU6 A;  2DSY A;  3K85 A;  2MDR A;  2O1V A;  3T1Y E;  2PO0 A;  2EMY A;  4FW6 A;  2LBS B;  2C37 B;  4OO1 E;  4LTY A;  3PYE A;  4X65 I;  1BBG A;  4MU3 A;  1N36 I;  2LT7 A;  3LTO A;  3M85 G;  1HR0 I;  2O3Z A;  2B7V A;  3HPS A;  2FTX B;  4LF8 E;  2R42 A;  3VYY A;  4AQY I;  4TUG A;  5A6B A;  2JVA A;  5K36 B;  4DV6 I;  2ENC A;  3J7Y p;  3WU4 A;  4OX9 I;  2G7H A;  2JPA A;  4PU9 A;  5LMN E;  3BF2 A;  4NXN E;  4GKK E;  2GO4 A;  4PRX A;  4LFB I;  2UUB I;  1H7S A;  2VQF E;  3LML A;  2EPO A;  4O43 A;  4M1K A;  4DR5 I;  3C6K A;  5IT9 Q;  2NA2 A;  3JTZ A;  3ADI A;  1K47 A;  2EOE A;  2EZ6 A;  3OTO E;  4LFA I;  5AE2 A;  4DUZ I;  2PO1 B;  1FWK A;  1DQ3 A;  5C0X B;  4M0V A;  5A6J A;  1HR0 E;  2ODR D;  1ZAA C;  2BM1 A;  4DV2 I;  4DR6 E;  2O1U A;  2L3J A;  1HNZ E;  2L6M A;  2EQ0 A;  4FW5 A;  3QT6 A;  2LV2 A;  1ZM3 A;  2GQ0 A;  2IER A;  3QT5 A;  2C39 A;  4NXM I;  2JP9 A;  1OYS A;  1EKZ A;  2RSM A;  4JI3 E;  3H1C A;  5DRP A;  4DV0 I;  3Q6M A;  4JI1 E;  2O1T A;  5KL7 A;  4BA1 A;  2YRH A;  3ADJ A;  1FJG E;  3IWC A;  1ZM2 A;  4X64 E;  1YYW A;  1N34 E;  4I3H A;  1Y6Z A;  1S16 A;  2YU8 A;  4MU1 A;  1PVG A;  1ELO A;  2IHR 1;  1QZR A;  4N3O A;  4R1F A;  5JEA A;  2CTD A;  2ZM6 E;  3T1H I;  4JI6 I;  4DR7 I;  4GQU A;  3PRY A;  4ED4 A;  2EM0 A;  3HPZ A;  2LJU A;  4X66 I;  2NUG A;  3M85 D;  2Z5C A;  4IFD D;  1XMO I;  4WFT A;  4NZV A;  1MX0 A;  1Z59 A;  4BA2 B;  2RTX A;  1ZBQ A;  5L3J A;  4LF7 E;  2EJ4 A;  5A6A A;  4XTJ A;  4OO1 B;  3NZK A;  4USM A;  3M6A A;  2V87 A;  3H4L A;  4LF6 E;  2GPI A;  4M9V C;  1IBL I;  3KZZ A;  5JEA C;  2UXC I;  4R2P A;  4JG4 A;  2DB2 A;  2VES A;  2EM3 A;  2LTS A;  1EH8 A;  4HAC B;  2PNM A;  5C0X F;  1YYO A;  4X62 E;  4JI0 E;  1UBD C;  2RS7 A;  3QT8 A;  2BA0 G;  2EOF A;  2V8P A;  1XNQ E;  1RRE A;  2JXP A;  2E1R A;  4IZJ D;  4B3T I;  4LCF A;  1H73 A;  1ZU1 A;  1IBK E;  2EMF A;  2KON A;  4L8N A;  4QNK A;  1ZBT A;  2BR2 B;  4LF9 E;  2V34 A;  4MU0 A;  2EMB A;  2JEA A;  1FI4 A;  2YRM A;  3PYG A;  3VK6 A;  4DU7 A;  2EMG A;  4GZN C;  2MKD A;  4TUI A;  3B82 A;  3ZZU A;  2VQE I;  5LL6 R;  3ADG A;  2BBG A;  1N33 E;  3ZM7 A;  2BM0 A;  2UUC E;  3ZKD A;  5BR8 I;  2JE6 B;  4DR1 E;  4DV7 I;  4KHP I;  1QNT A;  4WSP A;  3JU0 A;  5LMU E;  2EN3 A;  1A6F A;  1ZXM A;  2E5L E;  2EPK X;  2WNR A;  3AV0 A;  2EPA A;  1YUJ A;  3L7Z B;  4ZVI A;  3F6H A;  1O0W A;  2I9I A;  1NHH A;  4FW9 A;  4U3D A;  1USV A;  4OZE A;  3DJW A;  5AE3 A;  5FLX C;  1MG7 A;  2GO3 A;  2V2Z A;  1KKH A;  4DV6 E;  2CPN A;  4OO1 F;  3J81 C;  2LE2 A;  4WSG A;  2F1D A;  3MHH C;  2JY9 A;  2NUE A;  2EM2 A;  1ZXN A;  4NBQ A;  1TN9 A;  1A1F A;  1Z0G A;  5KL3 A;  1Z5C A;  2EMZ A;  4BMJ A;  2HK3 A;  3HQ1 A;  4DUY E;  2JWO A;  4RH8 A;  2WCC 3;  1UIL A;  1TF3 A;  2EN8 A;  2YT4 A;  1WRJ A;  2R76 A;  2VF1 A;  2EM5 A;  1X6H A;  1NEI A;  2F4V E;  2PO2 B;  5K36 D;  3M7N G;  2NN6 E;  2RQL A;  3FIG A;  4HTG A;  2WBT A;  1OJ4 A;  4IFD F;  2EL4 A;  5KL6 A;  2PNZ B;  4F54 A;  2WBS A;  4L5N C;  4JI5 I;  5FLX Q;  5AC5 A;  2LJP A;  1HNX I;  2EOO A;  1MU5 A;  4U3B A;  2EM7 A;  1YSA C;  3WU5 A;  3J81 Q;  3GCM A;  3HUL A;  4GKJ I;  1Z0B A;  1R6M A;  5IV8 B;  2EQ1 A;  2V83 A;  1IQO A;  4DR3 I;  2M7Q A;  4DV4 E;  4JI8 E;  5C0X D;  4LFC E;  1B62 A;  2EOJ A;  5A69 A;  4DR7 E;  1NHJ A;  1PKP A;  3AUZ A;  1EH7 A;  1WUU A;  2YTD A;  1T4O A;  3H09 A;  2EFG A;  5IWA I;  1UHZ A;  3U1Y A;  1DI2 A;  2L2K B;  2HHH E;  4QNJ A;  2EMI A;  2Z5B A;  4Z7Y A;  4DV5 E;  4FW4 A;  2WP8 B;  5DNL A;  1L4S A;  4B3R I;  2LVH A;  5TSE A;  3PYD A;  4K0K I;  4LOM A;  2EMC A;  1X47 A;  1SFE A;  1OYR A;  1YHC A;  2PO0 B;  4AID A;  2B7T A;  1XMQ E;  4DR4 E;  3HKM A;  2UU9 E;  1J5E I;  2DRP A;  1AAY A;  1USU A;  1PDA A;  4DU8 A;  2EOH A;  1GQE A;  4HY1 A;  4F9C B;  2OI2 A;  5GME A;  2YTJ A;  3HXL A;  2JEB A;  4YY3 E;  2EM8 A;  2EN1 A;  3ADL A;  4JV5 E;  4WUD A;  2E72 A;  2L3C A;  2NN6 A;  4DR2 I;  1JK2 A;  4JYA I;  2I13 A;  2LUQ A;  3KZY A;  1FKA E;  3B8H A;  1G2F C;  4OO1 D;  1MGT A;  2Q8U A;  2D9H A;  4F6N A;  1Z0T A;  4LF5 I;  2DMY A;  1FNM A;  2YPN A;  2JEB B;  2UXD E;  1STU A;  1A1H A;  3PYF A;  4JI4 E;  2M4I A;  1N0V C;  2C39 B;  4R2C A;  3KWR A;  3P3E A;  1H7U A;  3BGH A;  4DV3 I;  2LRS A;  1XNR I;  1VIS A;  4BA1 B;  4LPF A;  5CFF E;  2EOZ A;  2C38 A;  2NN6 C;  2EN2 A;  4F2J C;  4P7D A;  1A1G A;  1IBM I;  1HNW I;  1R6L A;  2YTN A;  3P06 A;  2AE8 A;  4MU4 A;  2BA0 D;  3GON A;  3J7A G;  2V88 A;  3IWB A;  5K36 F;  5JEA B;  2HKJ A;  2UXB E;  2WW4 A;  4DV1 E;  4WUC A;  2YTE A;  1G2D C;  2BA1 G;  4BBY A;  4B3M I;  4USK A;  4DPY A;  4FWH A;  4B3S I;  2CGE A;  2IES A;  2Z5C B;  1I94 E;  1TF6 A;  2YTO A;  2K7I A;  1YYK A;  2A2C A;  2FGG A;  4MQY A;  1N32 E;  4MYU A;  4J8Z A;  4LF4 E;  3T1Y I;  2EOX A;  4BC7 A;  1S4E A;  3QT7 A;  4DPX A;  1IBM E;  4NHR A;  2EL5 A;  1LLM C;  3VHT B;  4J3D A;  2ZBK B;  4AIM A;  4LF8 I;  3K6Q A;  1AH5 A;  4JI7 E;  2EP3 A;  2DMI A;  1T38 A;  4JI2 E;  3HJC A;  3EQ1 A;  1WXR A;  2UUA E;  3WU6 A;  4BHB A;  2ENH A;  2MKN A;  4GKK I;  2EMW A;  1X6E A;  4R2S A;  4YHH E;  1B69 A;  1EA6 A;  2VQF I;  3F0N A;  2ODR C;  2GLI A;  4UTG A;  1FWL A;  1Z0V A;  2J65 A;  2PNL A;  3OTO I;  2CVE A;  1P47 A;  5A6K A;  4DPT A;  3RMP A;  3MHS C;  1B63 A;  4FW3 A;  1DAR A;  2RSI A;  2EN7 A;  1T4N A;  4BHC A;  1RMD A;  2B9D A;  2EN4 A;  2JEA B;  3LPS A;  3UHM A;  3EPK A;  4X65 E;  2NUF A;  1E3P A;  1KTV A;  4UT4 A;  1ZM4 A;  1HNZ I;  1N36 E;  5JEA F;  5ADZ A;  2L8T A;  5IXM B;  4AQY E;  4JI3 I;  5DRO A;  2WZO A;  3P3G A;  2EM6 A;  2X36 A;  2GHF A;  2JYA A;  2EM4 A;  4JI1 I;  2YZT A;  2EOI A;  2EM9 A;  2EN6 A;  4OX9 E;  1Z0E A;  3Q1Q A;  1FJG I;  1WHN A;  2EQ3 A;  2DIX A;  1F2I G;  4MDT A;  1Y5Y A;  2MDG A;  1SR9 A;  2YTG A;  4MLV A;  4LFB E;  1T4L B;  2WNR B;  4LCG A;  4X64 I;  5DRQ A;  2UUB E;  4WX9 A;  2CG9 A;  2EMA A;  1N34 I;  4O24 A;  2EWL A;  4DR5 E;  4M30 A;  1PIE A;  3B4T A;  2ZM6 I;  1YH8 A;  4IZJ A;  1NCS A;  4DUZ E;  4LFA E;  4BC9 A;  1WJP A;  2LO3 A;  1A1J A;  1XHK A;  3CDJ A;  4DV2 E;  4IS1 C;  2WBU A;  5GMD A;  1ZM9 A;  2VE7 C;  2VRD A;  3BBG A;  1N0U A;  2RPC A;  3THN A;  5F3W A;  2X7I A;  5DNX A;  1X48 A;  2FV4 B;  4X9J A;  4NXM E;  4FN5 A;  4DV0 E;  2XEX A;  2YTQ A;  1VI7 A;  2EPX A;  4LF5 E;  4LF7 I;  1Z5B A;  2HC5 A;  4IS9 A;  4I8O A;  5C0X E;  2L2M A;  1BKN A;  4DXL A;  2L92 A;  1J26 A;  1UDN A;  4LF6 I;  5A6B D;  3PS2 A;  4R2E A;  1YPN A;  2O1W A;  3P1X A;  4HXZ A;  1HK7 A;  2M1S A;  1X49 A;  4LU9 A;  5KL2 A;  4EMD A;  3T1H E;  4X62 I;  4JI6 E;  4JI0 I;  3THO B;  2R1F A;  2A2D A;  4HEI A;  3C6M A;  2LUP B;  1MEY C;  4X66 E;  2J7K A;  3WU3 A;  1DGC A;  2J7J A;  2EMK A;  1XNQ I;  2YSO A;  2EPU A;  4DPU A;  1XMO E;  1IBK I;  3C4T A;  4WXD A;  2KOU A;  4F9B B;  4R2R A;  4LF9 I;  2LCE A;  1KVK A;  2LMZ A;  2C37 A;  4P52 A;  4WXC A;  5A2Q C;  2DEI A;  4X8W A;  5AC4 A;  1N33 I;  2Z5B B;  2EPN A;  2V89 A;  1IBL E;  4ZYE A;  2UUC I;  2EPP A;  4AM3 A;  2UXC E;  5K36 A;  2EOM A;  2ZIT A;  4DR1 I;  2EPR A;  2L2N A;  4Q35 B;  1EH6 A;  1BB8 A;  5LMU I;  1P42 A;  3BID A;  2E5L I;  2V2V A;  3ZKB A;  5JEA D;  2Q2E B;  2N3H A;  3C4B A;  3IWD A;  4P78 A;  4HYM A;  4B3T E;  2M9A A;  1IMU A;  4R2D A;  2PO1 A; 
#chains in the Genus database with same CATH homology
 4P7A A;  2BV3 A;  4KQV A;  2B3T B;  3ZZ0 A;  5A2Q Q;  2E1M A;  2VQE E;  3Q6N A;  4DUY I;  2HFS A;  3V5R A;  3J7A M;  5BR8 E;  4RPF A;  4DV7 E;  4KHP E;  2LJH A;  2F4V I;  1YZ9 A;  3LLH A;  2R3V A;  3CWV A;  2K4V A;  2HFU A;  2NPF A;  2IOQ A;  3LNU A;  1D6T A;  4MYT A;  4DKK A;  1U2R A;  2V8Q B;  2IOP A;  2VF3 A;  4FWD A;  4DV4 I;  4JI8 I;  3JAM C;  1RQ0 A;  5AE1 A;  4LFC I;  4WPY A;  4Q28 A;  2JR1 A;  2HHH I;  2RS6 A;  2MC6 A;  3VYX A;  4DV5 I;  2JOX A;  4HAC A;  2AJ4 A;  4JI5 E;  5LMN I;  4NXN I;  1HNX E;  4GEQ B;  4DR4 I;  1XMQ I;  1UEK A;  2UU9 I;  4GKJ E;  4DR3 E;  3JAM Q;  3HTX A;  4YY3 I;  4JV5 I;  5IWA E;  4DR6 I;  2N3G A;  3D4J A;  3K1J A;  4R8O A;  4B3R E;  2JOB A;  1RR9 A;  4K0K E;  4DMI A;  1NZ0 A;  4IZK A;  1WHQ A;  3MSW A;  2UXD I;  1Z0C A;  2H36 X;  1Z0W A;  2DEJ A;  4JI4 I;  1NHI A;  2CZ9 A;  1J5E E;  2HK2 A;  4Z7C A;  3J80 C;  3DF6 A;  4IZK B;  2HKE A;  4OOG C;  4URL A;  2V85 A;  2GS8 A;  1H74 A;  4DR2 E;  3K17 A;  1Y4U A;  4JYA E;  4PRV A;  4BS9 A;  2UXB I;  4DV1 I;  4IZJ B;  2KHX A;  5DNY A;  4M2Z A;  4WUB A;  5AAS A;  1I94 I;  3B78 A;  1N32 I;  1RC7 A;  2L33 A;  4LF4 I;  1KIJ A;  1IBM I;  4WYQ B;  4F9A B;  1XNR E;  4DV3 E;  3J80 Q;  5FWK A;  2V86 A;  2V2Q A;  4FWG A;  3OML A;  3V2U C;  4R03 A;  1HNW E;  4JI7 I;  4JI2 I;  1Y4S A;  2UUA I;  1H72 C;  2MC5 A;  2F8B A;  4KZS A;  5T6J A;  4DPW A;  2LTR A;  4BCA A;  3ZZT A;  4B3M E;  1GZ6 A;  1Z5A A;  4YHH I;  3F6G A;  4B3S E;  1EI1 A;  5IT9 C;  2Z5E A;  3ZOQ B;  1QU6 A;  2DSY A;  3K85 A;  2MDR A;  2O1V A;  3T1Y E;  2LBS B;  4LTY A;  3PYE A;  4X65 I;  1N36 I;  3LTO A;  2B7V A;  3HPS A;  2FTX B;  4LF8 E;  2R42 A;  3VYY A;  4AQY I;  4TUG A;  2JVA A;  4DV6 I;  4OX9 I;  3J7Y p;  3WU4 A;  2G7H A;  4PU9 A;  5LMN E;  4NXN E;  4GKK E;  4PRX A;  4LFB I;  2UUB I;  1H7S A;  2VQF E;  3LML A;  4M1K A;  4DR5 I;  5IT9 Q;  2NA2 A;  3JTZ A;  3ADI A;  1K47 A;  2EZ6 A;  3OTO E;  4LFA I;  5AE2 A;  4DUZ I;  1FWK A;  1DQ3 A;  4M0V A;  1HR0 E;  2BM1 A;  2ODR D;  4DV2 I;  4DR6 E;  2O1U A;  2L3J A;  1HNZ E;  2L6M A;  3QT6 A;  1ZM3 A;  2GQ0 A;  3QT5 A;  4NXM I;  4DV0 I;  1EKZ A;  2RSM A;  4JI3 E;  3Q6M A;  4JI1 E;  2O1T A;  3ADJ A;  1FJG E;  3IWC A;  1ZM2 A;  4X64 E;  1YYW A;  1N34 E;  4I3H A;  1Y6Z A;  1S16 A;  1PVG A;  1ELO A;  2IHR 1;  1QZR A;  4N3O A;  4R1F A;  4DR7 I;  3T1H I;  2ZM6 E;  4JI6 I;  3PRY A;  4ED4 A;  3HPZ A;  4X66 I;  2NUG A;  2Z5C A;  1XMO I;  4WFT A;  1MX0 A;  1Z59 A;  2RTX A;  1ZBQ A;  5L3J A;  4LF7 E;  4XTJ A;  4USM A;  3M6A A;  2V87 A;  3H4L A;  4LF6 E;  1IBL I;  2UXC I;  4JG4 A;  2DB2 A;  2LTS A;  4HAC B;  2PNM A;  1YYO A;  4X62 E;  4JI0 E;  2RS7 A;  3QT8 A;  2V8P A;  1XNQ E;  1RRE A;  2E1R A;  4IZJ D;  4B3T I;  1H73 A;  1IBK E;  2KON A;  4L8N A;  1ZBT A;  2V34 A;  4LF9 E;  1FI4 A;  3PYG A;  3VK6 A;  4DU7 A;  4TUI A;  3B82 A;  3ZZU A;  2VQE I;  5LL6 R;  3ADG A;  1N33 E;  3ZM7 A;  2BM0 A;  2UUC E;  3ZKD A;  5BR8 I;  4DR1 E;  4DV7 I;  4KHP I;  4WSP A;  1ZXM A;  3JU0 A;  5LMU E;  1A6F A;  2E5L E;  3AV0 A;  4ZVI A;  3F6H A;  1O0W A;  1NHH A;  4FW9 A;  1USV A;  3DJW A;  5AE3 A;  5FLX C;  1MG7 A;  2V2Z A;  1KKH A;  4DV6 E;  2CPN A;  3J81 C;  2LE2 A;  2JY9 A;  2NUE A;  1ZXN A;  1Z0G A;  1Z5C A;  4BMJ A;  2HK3 A;  3HQ1 A;  4DUY E;  2JWO A;  1UIL A;  2YT4 A;  2VF1 A;  2F4V E;  3FIG A;  1OJ4 A;  4F54 A;  4L5N C;  4JI5 I;  5FLX Q;  2LJP A;  1HNX I;  1MU5 A;  3J81 Q;  3WU5 A;  3HUL A;  4GKJ I;  1Z0B A;  2V83 A;  4DR3 I;  2M7Q A;  4DV4 E;  4JI8 E;  4LFC E;  1B62 A;  4DR7 E;  1NHJ A;  1PKP A;  3AUZ A;  1WUU A;  2EFG A;  3H09 A;  1T4O A;  5IWA I;  1UHZ A;  1DI2 A;  2L2K B;  2HHH E;  2Z5B A;  4Z7Y A;  4DV5 E;  4B3R I;  4K0K I;  3PYD A;  1X47 A;  2B7T A;  1XMQ E;  4DR4 E;  2UU9 E;  1J5E I;  1USU A;  4DU8 A;  1GQE A;  4HY1 A;  4F9C B;  2OI2 A;  5GME A;  3HXL A;  4YY3 E;  3ADL A;  4JV5 E;  4WUD A;  2L3C A;  4DR2 I;  4JYA I;  2LUQ A;  1FKA E;  3B8H A;  4LF5 I;  1Z0T A;  2DMY A;  1FNM A;  2UXD E;  1STU A;  3PYF A;  4JI4 E;  2M4I A;  1N0V C;  3KWR A;  1XNR I;  1H7U A;  4DV3 I;  2LRS A;  1VIS A;  5CFF E;  4P7D A;  1HNW I;  3P06 A;  3GON A;  3J7A G;  2V88 A;  3IWB A;  2HKJ A;  2UXB E;  2WW4 A;  4DV1 E;  4WUC A;  4BBY A;  4B3M I;  4USK A;  4DPY A;  4FWH A;  4B3S I;  2CGE A;  2Z5C B;  1YYK A;  1I94 E;  2A2C A;  2FGG A;  4MYU A;  1N32 E;  4J8Z A;  4LF4 E;  3T1Y I;  4BC7 A;  1S4E A;  3QT7 A;  4DPX A;  1IBM E;  2ZBK B;  4LF8 I;  3K6Q A;  4JI7 E;  4JI2 E;  3HJC A;  1WXR A;  2UUA E;  3WU6 A;  4GKK I;  4YHH E;  1EA6 A;  2VQF I;  3F0N A;  2ODR C;  4UTG A;  1FWL A;  1Z0V A;  2PNL A;  3OTO I;  4DPT A;  3RMP A;  1B63 A;  1HR0 I;  1DAR A;  1T4N A;  2B9D A;  3LPS A;  4UT4 A;  1HNZ I;  4X65 E;  2NUF A;  1KTV A;  1ZM4 A;  1N36 E;  5ADZ A;  2L8T A;  4JI3 I;  4AQY E;  2WZO A;  2X36 A;  4JI1 I;  2YZT A;  4OX9 E;  1Z0E A;  3Q1Q A;  1FJG I;  1WHN A;  2DIX A;  1SR9 A;  4LFB E;  1T4L B;  4X64 I;  2UUB E;  2CG9 A;  1N34 I;  2EWL A;  4DR5 E;  4M30 A;  1PIE A;  2ZM6 I;  4IZJ A;  4LFA E;  4DUZ E;  4BC9 A;  1XHK A;  4DV2 E;  5GMD A;  1ZM9 A;  2VE7 C;  1N0U A;  2X7I A;  5F3W A;  1X48 A;  2FV4 B;  4NXM E;  4FN5 A;  4DV0 E;  2XEX A;  4LF5 E;  4LF7 I;  1Z5B A;  4I8O A;  2L2M A;  1BKN A;  4DXL A;  2L92 A;  1J26 A;  4LF6 I;  4HXZ A;  2O1W A;  3P1X A;  1HK7 A;  2M1S A;  1X49 A;  4LU9 A;  4EMD A;  3T1H E;  4X62 I;  4JI6 E;  4JI0 I;  2A2D A;  2LUP B;  2J7K A;  4X66 E;  3WU3 A;  1XNQ I;  4DPU A;  1XMO E;  1IBK I;  3C4T A;  2KOU A;  4F9B B;  4LF9 I;  1KVK A;  2LMZ A;  4P52 A;  5A2Q C;  2DEI A;  4X8W A;  1N33 I;  2Z5B B;  2V89 A;  1IBL E;  2UUC I;  2UXC E;  2ZIT A;  4DR1 I;  2L2N A;  5LMU I;  2E5L I;  2V2V A;  3ZKB A;  2Q2E B;  2N3H A;  3C4B A;  3IWD A;  4P78 A;  4HYM A;  4B3T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...