2UXBE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbE02
4X65I 4NXNI 1QU6A 2EFGA 2RS6A 2DB2A 2R42A 4PRVA 1YYWA 1RREA 1H7UA 4OX9E 4EMDA 3ADIA 1N0VC 1Z59A 4OOGC 3C4BA 2V2VA 4B3SI 1HNXI 3B82A 1FWKA 2MDRA 2RTXA 2B3TB 1Z0CA 1K47A 3WU3A 4DR2E 1KVKA 2UUBI 4JI4E 2JVAA 4LF9I 1N33E 3WU6A 4JYAI 1WUUA 2E1RA 4P7AA 1B63A 5LMUE 1WHNA 4YY3E 2L3CA 1ELOA 4JI0E 5GMEA 4M30A 4X64E 4Z7CA 1Z0WA 3VYXA 3ZZ0A 1X47A 1Z5BA 1MU5A 3V2UC 3J7AG 1RQ0A 2GS8A 4DV4E 4XTJA 4WYQB 4LF8E 4DR5I 4DV6I 4LFAE 3LLHA 2UUAI 4JI7E 1XNQI 4USKA 4FWDA 3ZZTA 5A2QC 2BM1A 1I94I 1S16A 1PIEA 3QT8A 4AQYE 4RPFA 1WHQA 2UUCE 4X62I 2UXDE 1BKNA 2UXBE 4DUYE 1H74A 1QZRA 2L2NA 3J80C 3OTOI 4GKJE 1HNWE 2BV3A 2VQFI 4FWHA 4X65E 4NXNE 4DR7I 1EA6A 2VQEI 1Z0EA 3J80Q 1ZXMA 2LJHA 4DU8A 2UU9I 2CPNA 3P1XA 4B3SE 1HNXE 4FW9A 4B3MI 2XEXA 4DPXA 2LUPB 1A6FA 2NA2A 5LMNI 3B78A 4GKKI 4ED4A 2ZBKB 2UUBE 4LF9E 3JAMC 1YYOA 4DPUA 2DEIA 4JYAE 4DR6I 2AJ4A 1T4NA 3PYDA 4DR3I 1N36I 2B7VA 5BR8I 3ADGA 2L33A 1ZM9A 2RSMA 4DV3I 1PVGA 2NPFA 3HTXA 2A2DA 2E5LI 1O0WA 1XMOI 1J26A 2NUEA 1HNZI 3T1HI 3D4JA 2LTSA 4X8WA 4JI8I 4DR5E 3GONA 4HXZA 4DV6E 4LF7I 2UUAE 3ADJA 1XNQE 2LUQA 3PYEA 1ZM3A 4NXMI 1IBMI 4UTGA 1I94E 4DR1I 4R1FA 4X62E 4JI6I 3B8HA 5GMDA 4JI1I 4UT4A 2HK3A 2V8PA 1XMQI 3J81C 2HHHI 4MYTA 4Z7YA 1UEKA 3OTOE 1DI2A 2VQFE 4DU7A 4KHPI 4YHHI 4DV1I 5FLXC 2UXCI 3WU4A 4DR7E 3Q1QA 2BM0A 1IBLI 2NUFA 4PRXA 4JV5I 3CWVA 2ZM6I 2KHXA 4JI3I 2Q2EB 1YZ9A 2JY9A 2DIXA 2YT4A 4FWGA 3VYYA 4I3HA 2R3VA 2EZ6A 2UU9E 1OJ4A 2LBSB 4LF5I 4JI2I 1UILA 4B3ME 5LMNE 4DUZI 3M6AA 1X48A 2DMYA 4PU9A 4X66I 4WUCA 5L3JA 4GKKE 1RC7A 1Z0VA 3LNUA 1YYKA 2V2ZA 3J7AM 2V2QA 4USMA 4JG4A 1STUA 4DR6E 1MG7A 1MX0A 4DR3E 1N36E 5IT9C 4DKKA 5BR8E 5A2QQ 4LFCI 2CZ9A 2NUGA 1Z5AA 1IBKI 4HY1A 4DV3E 4JI4I 1KIJA 3QT7A 2OI2A 5IT9Q 2E5LE 1XMOE 4DV7I 1EI1A 4DV2I 1HNZE 2J7KA 3T1HE 2LTRA 4JI8E 4URLA 4LF7E 3ZKBA 2L3JA 4K0KI 4NXME 1NHJA 1IBME 4DR1E 4JI6E 4JI1E 2A2CA 2HHHE 2B7TA 1XNRI 4DPTA 4DV5I 4LF6I 1ZXNA 4KHPE 4DPWA 4HACA 4YHHE 4DV1E 3QT5A 2UXCE 1IBLE 1H73A 3JAMQ 2L2KB 4P52A 4DV0I 4B3TI 4JV5E 2ZM6E 1J5EI 4M1KA 4JI3E 2WW4A 3ZKDA 3ZM7A 4DR4I 2VF3A 4LFBI 1FNMA 1U2RA 3HULA 1EKZA 1H72C 4B3RI 4LF5E 4JI2E 1ZM4A 4WFTA 4JI5I 3QT6A 1FJGI 1FI4A 4DUZE 5IWAI 3ZZUA 2V34A 4X66E 4LF4I 3C4TA 2F4VI 3F0NA 2HKEA 2LJPA 1X49A 1HR0I 4LFCE 1UHZA 5LL6R 1DARA 1T4LB 2VQEE 1IBKE 2HK2A 4ZVIA 2ZITA 1N34I 3J81Q 2DEJA 2L2MA 4DV7E 3T1YI 4DV2E 1N32I 5FLXQ 4M2ZA 3J7Yp 2N3GA 3LTOA 1Z0GA 4MYUA 3K1JA 3PYFA 2HFUA 1T4OA 4HYMA 4K0KE 4OX9I 1KTVA 1VISA 2N3HA 1KKHA 1XNRE 4DV5E 4LF6E 3ADLA 1S4EA 2X36A 2X7IA 2IHR1 4DV0E 4B3TE 4DXLA 1NZ0A 1ZBTA 1J5EE 1Z0TA 4DR2I 3V5RA 1FKAE 4WUDA 3WU5A 1N33I 4DR4E 4LFBE 1XHKA 1H7SA 4KQVA 5LMUI 4B3RE 4YY3I 1FWLA 1NHHA 4JI5E 1FJGE 4JI0I 1RR9A 4X64I 5IWAE 2HKJA 1ZM2A 2HFSA 4LF4E 2F4VE 2LRSA 1XMQE 1HR0E 4DV4I 4WUBA 4LF8I 4HACB 4LFAI 1D6TA 4FN5A 5CFFE 4JI7I 2RS7A 1Z5CA 4DPYA 1PKPA 1B62A 1Z0BA 1N0UA 1N34E 4AQYI 2UUCI 2UXDI 2UXBI 4DUYI 3H4LA 1GQEA 3T1YE 1N32E 3LPSA 1NHIA 4GKJI 3K17A 1HNWI 3PYGA
chains in the Genus database with same CATH superfamily
4X65I 2GQ0A 4NXNI 1QU6A 1GZ6A 2EFGA 3BF2A 4OO1B 1AAYA 2RS6A 2V83A 4F6MA 4R2PA 3JTZA 2DB2A 3EPLA 2MC5A 1YYWA 1RREA 2R42A 4WXCA 1ZR9A 4IS9A 4LOMA 1H7UA 4PRVA 4OX9E 2V85A 2M7QA 1UN6B 3ADIA 4DPYA 4EMDA 1N0VC 1Z59A 1PJTA 4OOGC 3C4BA 2EOEA 4N3OA 2V2VA 5K36E 2EM8A 4B3SI 1HNXI 3AV0A 4I8OA 1DGCA 2Z5CA 3B82A 1FWKA 5K36C 2MDRA 2I13A 4NZVA 3K85A 4MU3A 2EMGA 2EPZA 4AM3A 3JU0A 1UBDC 2RTXA 4N4RB 2B3TB 5A6KA 3H1CA 2DGCA 4R2CA 1Z0CA 2NN6F 1K47A 1RHYA 2EM6A 2BA0G 3WU3A 4DR2E 1KVKA 2UUBI 4R2QA 4JI4E 2JVAA 4LF9I 1N33E 2EM3A 3WU6A 2LVHA 2O1VA 2PNZB 3P76A 4JYAI 4M0VA 3C6MA 1WUUA 2E1RA 1WJPA 4P7AA 1B63A 5LMUE 2JT2A 1WHNA 4YY3E 2L3CA 1ELOA 2ODRC 4JI0E 2N8XA 4NBQA 5GMEA 4F9CB 1AH5A 2EL6A 4M30A 4X64E 4R2DA 3MHSC 2C39B 4Z7CA 1Z0WA 4LCFA 3VYXA 2EOFA 3ZZ0A 2WP8B 2EMLA 1X47A 1P42A 1Z5BA 1Z1BA 1USUA 4DV2I 1MU5A 2V87A 3J7AG 3V2UC 3DJWA 2YTOA 2YTGA 2EMAA 5AE2A 1RQ0A 2NN6D 5C0XE 5F3WA 2GS8A 4DV4E 3HPZA 4XTJA 4WYQB 2GLIA 4LF8E 2YTIA 4DR5I 4DV6I 4LFAE 3LLHA 5C0XC 2MDGA 4IJDA 4JI7E 2UUAI 1XNQI 4ISAA 4USKA 2YU5A 4L5NC 2IESA 4FWDA 2YTEA 5A2QC 2D9HA 2VE7C 4F54A 2BM1A 4FW3A 3ZZTA 4OZEA 3PS3A 3CDIA 4WSGA 5A6BD 1I94I 1S16A 1PIEA 3QT8A 4AQYE 1BBGA 1WHQA 2LJUA 5KL4A 2UUCE 2UXDE 4RPFA 4X62I 4BC9A 1YUJA 5JEAE 1BKNA 4FW4A 2UXBE 4DUYE 2BR2B 3M85D 2EN1A 1H74A 2C37A 1QZRA 2EMWA 2L2NA 5EL9A 5KL2A 5JEAC 3J80C 3OTOI 2EE8A 4GKJE 1HNWE 2BV3A 2VQFI 4FWHA 4X65E 5ELWA 5KL7A 4NXNE 5A69A 4BS9A 4DR7I 2EPMX 3HKMA 4OO1F 1EA6A 4HEIA 2VQEI 5KL3A 2M9AA 1Z0EA 3THOB 2EN7A 2Q8UA 4IZJB 3J80Q 1ZXMA 2EOIA 2WZOA 2V86A 2O1TA 1L4SA 2LJHA 3VHTB 3KRNA 2CT1A 2DLQA 4DU8A 2E1MA 2WNRB 2UU9I 2CPNA 3P1XA 4B3SE 1HNXE 5FWKA 2LO3A 2IOPA 5A6BA 3CDJA 3IWCA 4FW9A 2EL4A 4KZSA 2EPCA 4B3MI 5C0XA 4R2SA 2XEXA 4DPXA 2LUPB 1A6FA 2NA2A 5LMNI 2BA1G 2RSIA 1EH8A 4TUGA 2F1DA 4P78A 4R2RA 3B78A 1RMDA 4GKKI 4IFDD 2BB8A 4ED4A 2ZBKB 2UUBE 3GLLA 3JAMC 4LF9E 5DRPA 4OO1D 1YYOA 2PO1B 4DPUA 2DEIA 4JYAE 1TF6A 4BA1A 1F2IG 5JEAB 5DNLA 4DR6I 2YU8A 3C6KA 2YTNA 1T4NA 2EOJA 4FK5C 2AJ4A 3PYDA 4DR3I 1N36I 2B7VA 5BR8I 3ADGA 2H36X 2BBGA 2LMZA 2L33A 4GQUA 2JEAA 5AC5A 2PRTA 1A1GA 3IWBA 1ZM9A 2NABA 1HK7A 2RSMA 2JP9A 2FGGA 5AE1A 4DV3I 2EMYA 5EKWA 1PVGA 1A1JA 2NPFA 3HTXA 2A2DA 2E5LI 1A1KA 1O0WA 1XMOI 1J26A 2RQLA 2Z5CB 2NUEA 4RHBB 2HGHA 5DRQA 1OYPA 2EJ4A 1Y5YA 1HNZI 2DLKA 1JK1A 1R6MA 3T1HI 3D4JA 2LTSA 3MSWA 4X8WA 4JI8I 3U1YA 4DR5E 3GONA 4HXZA 4DV6E 4IFDA 3P3CA 5K36F 4LF7I 2UUAE 3ADJA 2EPPA 1XNQE 2EN2A 2LUQA 2O1WA 2EOHA 4GEQB 2ELZA 4J8ZA 3PYEA 1ZM3A 1PJQA 4NXMI 2EMCA 2EMXA 4P7DA 1YFHA 1IBMI 1USVA 4UTGA 1I94E 4DR1I 2DRPA 4R1FA 4X62E 2YTQA 3B8HA 5GMDA 2EM0A 3HXLA 3KZYA 2C38B 2CVEA 4JI1I 1X3CA 4UT4A 3EQ1A 3M7ND 2HK3A 2V8PA 1XMQI 2ENHA 3J81C 2HHHI 4JI6I 4MYTA 4Z7YA 2JXPA 1ZBQA 3OTOE 1DI2A 1UEKA 1UDOA 2VQFE 4DU7A 4KHPI 4O4KA 4YHHI 2LV2A 2R76A 5T6JA 4DV1I 2K4VA 5FLXC 2UXCI 3WU4A 1G2DC 4DR7E 3Q1QA 2BM0A 1IBLI 2NUFA 2YZTA 4PRXA 4JV5I 3CWVA 2ZM6I 2KHXA 5ADZA 3RMPA 2GO4A 4JI3I 4LPFA 4J3DA 1OYRA 2Q2EB 1YZ9A 2JY9A 2DIXA 2YT4A 4FWGA 3VYYA 4I3HA 2L6MA 1DQ3A 3KWRA 2CTDA 3EPKA 2UU9E 2EZ6A 2R3VA 3GCMA 4Q28A 1OJ4A 5K36B 2EM2A 2LBSB 1A1LA 3HJCA 1X6EA 2WBTA 4QNJA 4LF5I 4JI2I 1UILA 2EMBA 2YSPA 4B3ME 4IZKA 3IWDA 4RH8A 5LMNE 5C0XF 4DUZI 2Z5BA 2PNLA 1R6LA 3M6AA 4BA2A 4LCHA 1X48A 2DMYA 4PU9A 4X66I 3AUZA 4WUCA 5L3JA 2VF1A 4GKKE 4LTYA 1RC7A 1TF3A 1KYQA 4BCAA 1Z0VA 2HC5A 2ODRD 3FIGA 1YYKA 2C37B 2V2ZA 3LNUA 2DMIA 1ZU1A 2G7HA 2I9IA 2V2QA 4USMA 2EMKA 3J7AM 4JG4A 1STUA 2EOMA 4DR6E 1MG7A 1MX0A 1PDAA 4DR3E 2YPNA 1N36E 5AASA 5IT9C 4DKKA 5BR8E 2EQ1A 2EPOA 4MQYA 5A2QQ 5JEAF 3QG5C 4LFCI 4IZJD 2PO0B 1MGTA 2YRMA 1WRJA 1E3PA 2CZ9A 1XXEA 2NUGA 4ZYHA 1Z5AA 4AIMA 3DD6A 1KJKA 2NN6A 1IBKI 3F6HA 3B4TA 4HY1A 2JE6A 2RPCA 3MHHC 2CG9A 4DV3E 4BMJA 4OKGA 2M1SA 2LCEA 4JI4I 1KIJA 3QT7A 2OI2A 4F6NA 2E5LE 5IT9Q 1G2FC 1XMOE 4QNKA 4DV7I 4IFDE 1EI1A 2EL5A 2EMIA 2EOSA 3UK3C 2B9DA 2EM9A 4ZYDA 2WBUA 1HNZE 2J7KA 2JEBA 2EM7A 3OMLA 3T1HE 4WXDA 2LTRA 3HQ1A 5C0XB 4IFDC 4JI8E 4R2AA 4URLA 4LF7E 1X6FA 3ZKBA 3GMEA 2EPUA 2L3JA 4K0KI 3L7ZA 2EN6A 4NXME 1NHJA 4OO1C 2VRDA 1IBME 2EOQA 4MU0A 5JEAD 3KZZA 3P3GA 5AC4A 4Q35B 2PO2A 4DR1E 2Z5EA 5IV8B 1N3GA 2GO3A 1E3HA 4JI6E 2M4IA 4X9JA 4JI1E 1QNTA 2DSYA 2R1FA 2MKDA 2A2CA 5DNXA 2YWQA 1OYSA 2EORA 2FV4B 2HHHE 1X5WA 2B7TA 2EOXA 1XNRI 2YTDA 2BA0D 4DPTA 4DV5I 4LF6I 3F6GA 4TUIA 2J65A 2L92A 1ZXNA 2JEAB 4KHPE 4DPWA 4HACA 4BC7A 4YHHE 4DV1E 2VESA 3QT5A 2UXCE 3BGHA 1Y6ZA 1EH6A 1IBLE 2EPXA 1H73A 3JAMQ 2L2KB 4P52A 4DV0I 5DRRA 4B3TI 2YRHA 2YSOA 4JV5E 2V88A 2ZM6E 4F2JC 1J5EI 4M1KA 5A6AA 4JI3E 2WW4A 3ZKDA 5KL6A 1YHCA 1GTKA 3ZM7A 3PS2A 2O1UA 2EOOA 4DR4I 2VF3A 4LFBI 1FNMA 1U2RA 3HULA 1EKZA 1H72C 4B3RI 2O3ZA 1TN9A 4U3BA 4LF5E 4MU1A 4ZYEA 4JI2E 1ZM4A 4WFTA 4JI5I 3QT6A 2F8BA 3Q6NA 4OO1A 1FJGI 1FI4A 4DUZE 2CGEA 5IWAI 3ZZUA 3VK6A 2V34A 4HTGA 4X66E 1T39A 1SR9A 3EPJA 1MEYC 1IQOA 4LF4I 3C4TA 2LT7A 2F4VI 3F0NA 2EPKX 2HKEA 3HPSA 1IMUA 2LJPA 1X49A 1P47A 1HR0I 1JK2A 4M9VC 4U3DA 5TSEA 2NN6E 4LFCE 1NEIA 3BBGA 1UHZA 5LL6R 1DARA 4LCGA 3P06A 1T4LB 2NN6C 4FW6A 2VQEE 2MC6A 2KOUA 2YRKA 1IBKE 2HK2A 4ZVIA 2ZITA 1B69A 1N34I 3J81Q 2JOBA 5K36D 4AIDA 2DEJA 2L2MA 2C38A 3P3EA 4DV7E 4MDTA 3T1YI 4DV2E 2EN4A 1N32I 5FLXQ 2PNZA 4M2ZA 3J7Yp 2N3GA 3LTOA 1Z0GA 4IZKB 2EPLX 2JR1A 4MYUA 3K1JA 2Z5BB 3PYFA 2EOZA 1A1HA 2MKNA 2HFUA 1T4OA 4HYMA 4BA2B 4K0KE 2ADRA 4BBYA 2GPIA 4OX9I 2GHFA 2A25A 2L8TA 2AE8A 4F9AB 2ENAA 1KTVA 2C39A 5LLQA 1YUIA 4DMIA 2WP8A 2JWOA 1VISA 3PS1A 2BA1D 2N3HA 5KL5A 1ZAAC 2JYAA 2WBSA 1YPNA 4FW7A 1KKHA 1XNRE 2YTFA 2JPAA 5K36A 4DV5E 4LF6E 2PNMA 2LE2A 4MLQA 4MLVA 3THNA 3ADLA 1S4EA 3NZKA 2X36A 2CSHA 3PRYA 2NN6B 4FW5A 3H09A 2X7IA 4O24A 4BHCA 3M7NG 2EMZA 2JE6B 2IHR1 4DV0E 4BHBA 4B3TE 4GZNC 4DXLA 1NZ0A 1ZBTA 1BBOA 1UDNA 3Q6MA 3LMLA 1J5EE 1Z0TA 4DR2I 2WCC3 3V5RA 1FKAE 5C0XD 3EPHA 4WUDA 3WU5A 1N33I 4DR4E 2JEBB 2E72A 4LFBE 1XHKA 4LU9A 1UDSA 2BR2A 1H7SA 1X6HA 2EOYA 4R8OA 4B3RE 4KQVA 4YY3I 5LMUI 4OO1E 4MU4A 4O43A 4IFDF 2V89A 2KONA 5IXMB 4JI5E 1FWLA 1NHHA 1Y60A 3L7ZB 1FJGE 2EN3A 4JI0I 2PO0A 2EP3A 1RR9A 4X64I 5IWAE 2PO2B 4WPYA 4R2EA 2J7JA 2EMHA 1PJSA 1Y4UA 2HKJA 2IOQA 1ZM2A 4ZYGA 2HFSA 4LF4E 3M99B 1Y4SA 2F4VE 4IZJA 4BA1B 4IS1C 1A1FA 2JOXA 2LRSA 2FTXB 1XMQE 2EQ0A 4L8NA 2EN8A 1HR0E 1YSAC 2WNRA 4DV4I 2EPAA 4WUBA 4LF8I 2YTJA 4F9BB 4HACB 4LFAI 1D6TA 4WSPA 4FN5A 5CFFE 1WXRA 4JI7I 2RS7A 4KWYA 3ZOQB 1PKPA 2EPNA 1Z5CA 1BB8A 5DNYA 4O5GA 2EWLA 2EPRA 3DF6A 1B62A 3M85G 3BIDA 2HJJA 4NHRA 5A6JA 1EH7A 2EQ3A 4WX9A 1Z0BA 2K7IA 3U1KA 1N0UA 3ECRA 1N34E 1LLMC 2ENCA 2ELYA 3TQMA 2YTPA 1YH8A 4AQYI 2EM4A 1VI7A 3K6QA 5AE3A 2UUCI 2UXDI 1IQSA 3UHMA 1A1IA 4R03A 2V8QB 4DUYI 2UXBI 3H4LA 1GQEA 3T1YE 1T38A 3L00A 1UDQA 2IERA 2PO1A 5DROA 1N32E 2EM5A 3LPSA 1NHIA 5JEAA 3K17A 4GKJI 2EMFA 4IFDB 1HNWI 1SFEA 1NCSA 3PYGA
chains in the Genus database with same CATH topology
4X65I 2GQ0A 4NXNI 1QU6A 1GZ6A 2EFGA 2RS6A 2V83A 3JTZA 2DB2A 2R42A 2MC5A 1YYWA 1RREA 4PRVA 1H7UA 4OX9E 2V85A 2M7QA 3ADIA 4EMDA 1N0VC 1Z59A 4OOGC 3C4BA 4N3OA 2V2VA 4B3SI 1HNXI 3AV0A 4I8OA 2Z5CA 3B82A 1FWKA 2MDRA 3K85A 3JU0A 2RTXA 2B3TB 1Z0CA 1K47A 3WU3A 4DR2E 1KVKA 2UUBI 4JI4E 2JVAA 4LF9I 1N33E 3WU6A 2O1VA 4JYAI 4M0VA 1WUUA 2E1RA 4P7AA 1B63A 5LMUE 1WHNA 4YY3E 2L3CA 1ELOA 2ODRC 4JI0E 5GMEA 4F9CB 4M30A 4X64E 4Z7CA 1Z0WA 3VYXA 3ZZ0A 1X47A 1Z5BA 1USUA 1MU5A 2V87A 3J7AG 3V2UC 3DJWA 5AE2A 1RQ0A 5F3WA 2GS8A 4DV4E 3HPZA 4XTJA 4WYQB 4LF8E 4DR5I 4DV6I 4LFAE 3LLHA 2UUAI 4JI7E 1XNQI 4USKA 4L5NC 4FWDA 5A2QC 3ZZTA 2VE7C 4F54A 2BM1A 1I94I 1S16A 1PIEA 3QT8A 4AQYE 4RPFA 1WHQA 2UUCE 4X62I 2UXDE 4BC9A 1BKNA 2UXBE 4DUYE 1H74A 1QZRA 2L2NA 3J80C 3OTOI 4GKJE 1HNWE 2BV3A 2VQFI 4FWHA 4X65E 4NXNE 4BS9A 4DR7I 1EA6A 2VQEI 1Z0EA 4IZJB 3J80Q 1ZXMA 2WZOA 2V86A 2O1TA 2LJHA 4DU8A 2E1MA 2UU9I 2CPNA 3P1XA 4B3SE 1HNXE 5FWKA 2IOPA 4FW9A 3IWCA 4KZSA 4B3MI 2XEXA 4DPXA 2LUPB 1A6FA 2NA2A 5LMNI 4TUGA 4P78A 3B78A 4GKKI 4ED4A 2ZBKB 2UUBE 3JAMC 4LF9E 1YYOA 4DPUA 2DEIA 4JYAE 4DR6I 2AJ4A 1T4NA 3PYDA 4DR3I 1N36I 2B7VA 5BR8I 3ADGA 2H36X 2LMZA 2L33A 3IWBA 1ZM9A 1HK7A 2RSMA 2FGGA 5AE1A 4DV3I 1PVGA 2NPFA 3HTXA 2A2DA 2E5LI 1O0WA 1XMOI 1J26A 2Z5CB 2NUEA 1HNZI 3T1HI 3D4JA 2LTSA 3MSWA 4X8WA 4JI8I 4DR5E 3GONA 4HXZA 4DV6E 4LF7I 2UUAE 3ADJA 1XNQE 2LUQA 2O1WA 4J8ZA 4GEQB 3PYEA 1ZM3A 4NXMI 4P7DA 1IBMI 1USVA 4UTGA 1I94E 4DR1I 4R1FA 4X62E 4JI6I 3B8HA 5GMDA 3HXLA 4JI1I 4UT4A 2HK3A 2V8PA 1XMQI 3J81C 2HHHI 4MYTA 4Z7YA 1ZBQA 3OTOE 1DI2A 1UEKA 2VQFE 4DU7A 4KHPI 4YHHI 5T6JA 4DV1I 2K4VA 5FLXC 2UXCI 3WU4A 4DR7E 3Q1QA 2BM0A 1IBLI 2NUFA 2YZTA 4PRXA 4JV5I 3CWVA 2ZM6I 2KHXA 5ADZA 3RMPA 4JI3I 2Q2EB 1YZ9A 2JY9A 2DIXA 2YT4A 4FWGA 3VYYA 4I3HA 2L6MA 1DQ3A 3KWRA 2UU9E 2EZ6A 2R3VA 4Q28A 1OJ4A 2LBSB 3HJCA 4LF5I 4JI2I 1UILA 4B3ME 4IZKA 3IWDA 5LMNE 4DUZI 2Z5BA 2PNLA 3M6AA 1X48A 2DMYA 4PU9A 4X66I 3AUZA 4WUCA 5L3JA 2VF1A 4GKKE 1RC7A 4LTYA 4BCAA 1Z0VA 2ODRD 3FIGA 1YYKA 2V2ZA 3LNUA 3J7AM 2G7HA 2V2QA 4USMA 4JG4A 1STUA 4DR6E 1MG7A 1MX0A 4DR3E 1N36E 5AASA 5IT9C 4DKKA 5BR8E 5A2QQ 4LFCI 4IZJD 2CZ9A 2NUGA 1Z5AA 1IBKI 3F6HA 4HY1A 2CG9A 4DV3E 4BMJA 2M1SA 4JI4I 1KIJA 3QT7A 2OI2A 5IT9Q 2E5LE 1XMOE 4DV7I 1EI1A 4DV2I 1HNZE 2B9DA 2J7KA 3OMLA 3T1HE 2LTRA 3HQ1A 4JI8E 4URLA 4LF7E 3ZKBA 2L3JA 4K0KI 4NXME 1NHJA 1IBME 4DR1E 2Z5EA 4JI6E 2M4IA 4JI1E 2A2CA 2DSYA 2FV4B 2HHHE 2B7TA 1XNRI 4DPTA 4DV5I 4LF6I 3F6GA 4TUIA 2L92A 1ZXNA 4KHPE 4DPWA 4HACA 4BC7A 4YHHE 4DV1E 3QT5A 2UXCE 1Y6ZA 1IBLE 1H73A 3JAMQ 2L2KB 4P52A 4DV0I 4B3TI 4JV5E 2V88A 2ZM6E 1J5EI 4M1KA 4JI3E 2WW4A 3ZKDA 3ZM7A 2O1UA 4DR4I 2VF3A 4LFBI 1FNMA 1U2RA 3HULA 1EKZA 1H72C 4B3RI 4LF5E 4JI2E 1ZM4A 4WFTA 4JI5I 3QT6A 2F8BA 3Q6NA 1FJGI 1FI4A 4DUZE 2CGEA 5IWAI 3ZZUA 3VK6A 2V34A 4X66E 1SR9A 4LF4I 3C4TA 2F4VI 3F0NA 2HKEA 3HPSA 2LJPA 1X49A 1HR0I 4LFCE 1UHZA 5LL6R 1DARA 3P06A 1T4LB 2VQEE 2MC6A 2KOUA 1IBKE 2HK2A 4ZVIA 2ZITA 1N34I 3J81Q 2JOBA 2DEJA 2L2MA 4DV7E 3T1YI 4DV2E 1N32I 5FLXQ 4M2ZA 3J7Yp 2N3GA 3LTOA 1Z0GA 4IZKB 2JR1A 4MYUA 3K1JA 2Z5BB 3PYFA 2HFUA 1T4OA 4HYMA 4K0KE 4BBYA 4OX9I 2L8TA 4F9AB 1KTVA 4DMIA 2JWOA 1VISA 2N3HA 1KKHA 1XNRE 4DV5E 4LF6E 2PNMA 2LE2A 3ADLA 1S4EA 2X36A 3PRYA 3H09A 2X7IA 2IHR1 4DV0E 4B3TE 4DXLA 1NZ0A 1ZBTA 3Q6MA 3LMLA 1J5EE 1Z0TA 4DR2I 3V5RA 1FKAE 4WUDA 3WU5A 1N33I 4DR4E 4LFBE 1XHKA 4LU9A 1H7SA 4R8OA 4KQVA 5LMUI 4B3RE 4YY3I 2V89A 1FWLA 2KONA 4JI5E 1NHHA 1FJGE 4JI0I 1RR9A 4X64I 5IWAE 4WPYA 1Y4UA 2HKJA 2IOQA 1ZM2A 2HFSA 4LF4E 1Y4SA 2F4VE 4IZJA 2JOXA 2LRSA 2FTXB 1XMQE 4L8NA 1HR0E 4DV4I 4WUBA 4LF8I 4F9BB 4HACB 4LFAI 1D6TA 4WSPA 4FN5A 5CFFE 1WXRA 4JI7I 2RS7A 3ZOQB 1Z5CA 1PKPA 4DPYA 5DNYA 2EWLA 3DF6A 1B62A 1Z0BA 1N0UA 1N34E 4AQYI 2UUCI 3K6QA 5AE3A 2UXDI 4R03A 2V8QB 4DUYI 2UXBI 3H4LA 1GQEA 3T1YE 1N32E 3LPSA 1NHIA 4GKJI 3K17A 1HNWI 3PYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 I;  4NXN I;  1QU6 A;  2EFG A;  2RS6 A;  2DB2 A;  2R42 A;  4PRV A;  1YYW A;  1RRE A;  1H7U A;  4OX9 E;  4EMD A;  3ADI A;  1N0V C;  1Z59 A;  4OOG C;  3C4B A;  2V2V A;  4B3S I;  1HNX I;  3B82 A;  1FWK A;  2MDR A;  2RTX A;  2B3T B;  1Z0C A;  1K47 A;  3WU3 A;  4DR2 E;  1KVK A;  2UUB I;  4JI4 E;  2JVA A;  4LF9 I;  1N33 E;  3WU6 A;  4JYA I;  1WUU A;  2E1R A;  4P7A A;  1B63 A;  5LMU E;  1WHN A;  4YY3 E;  2L3C A;  1ELO A;  4JI0 E;  5GME A;  4M30 A;  4X64 E;  4Z7C A;  1Z0W A;  3VYX A;  3ZZ0 A;  1X47 A;  1Z5B A;  1MU5 A;  3V2U C;  3J7A G;  1RQ0 A;  2GS8 A;  4DV4 E;  4XTJ A;  4WYQ B;  4LF8 E;  4DR5 I;  4DV6 I;  4LFA E;  3LLH A;  2UUA I;  4JI7 E;  1XNQ I;  4USK A;  4FWD A;  3ZZT A;  5A2Q C;  2BM1 A;  1I94 I;  1S16 A;  1PIE A;  3QT8 A;  4AQY E;  4RPF A;  1WHQ A;  2UUC E;  4X62 I;  2UXD E;  1BKN A;  2UXB E;  4DUY E;  1H74 A;  1QZR A;  2L2N A;  3J80 C;  3OTO I;  4GKJ E;  1HNW E;  2BV3 A;  2VQF I;  4FWH A;  4X65 E;  4NXN E;  4DR7 I;  1EA6 A;  2VQE I;  1Z0E A;  3J80 Q;  1ZXM A;  2LJH A;  4DU8 A;  2UU9 I;  2CPN A;  3P1X A;  4B3S E;  1HNX E;  4FW9 A;  4B3M I;  2XEX A;  4DPX A;  2LUP B;  1A6F A;  2NA2 A;  5LMN I;  3B78 A;  4GKK I;  4ED4 A;  2ZBK B;  2UUB E;  4LF9 E;  3JAM C;  1YYO A;  4DPU A;  2DEI A;  4JYA E;  4DR6 I;  2AJ4 A;  1T4N A;  3PYD A;  4DR3 I;  1N36 I;  2B7V A;  5BR8 I;  3ADG A;  2L33 A;  1ZM9 A;  2RSM A;  4DV3 I;  1PVG A;  2NPF A;  3HTX A;  2A2D A;  2E5L I;  1O0W A;  1XMO I;  1J26 A;  2NUE A;  1HNZ I;  3T1H I;  3D4J A;  2LTS A;  4X8W A;  4JI8 I;  4DR5 E;  3GON A;  4HXZ A;  4DV6 E;  4LF7 I;  2UUA E;  3ADJ A;  1XNQ E;  2LUQ A;  3PYE A;  1ZM3 A;  4NXM I;  1IBM I;  4UTG A;  1I94 E;  4DR1 I;  4R1F A;  4X62 E;  4JI6 I;  3B8H A;  5GMD A;  4JI1 I;  4UT4 A;  2HK3 A;  2V8P A;  1XMQ I;  3J81 C;  2HHH I;  4MYT A;  4Z7Y A;  1UEK A;  3OTO E;  1DI2 A;  2VQF E;  4DU7 A;  4KHP I;  4YHH I;  4DV1 I;  5FLX C;  2UXC I;  3WU4 A;  4DR7 E;  3Q1Q A;  2BM0 A;  1IBL I;  2NUF A;  4PRX A;  4JV5 I;  3CWV A;  2ZM6 I;  2KHX A;  4JI3 I;  2Q2E B;  1YZ9 A;  2JY9 A;  2DIX A;  2YT4 A;  4FWG A;  3VYY A;  4I3H A;  2R3V A;  2EZ6 A;  2UU9 E;  1OJ4 A;  2LBS B;  4LF5 I;  4JI2 I;  1UIL A;  4B3M E;  5LMN E;  4DUZ I;  3M6A A;  1X48 A;  2DMY A;  4PU9 A;  4X66 I;  4WUC A;  5L3J A;  4GKK E;  1RC7 A;  1Z0V A;  3LNU A;  1YYK A;  2V2Z A;  3J7A M;  2V2Q A;  4USM A;  4JG4 A;  1STU A;  4DR6 E;  1MG7 A;  1MX0 A;  4DR3 E;  1N36 E;  5IT9 C;  4DKK A;  5BR8 E;  5A2Q Q;  4LFC I;  2CZ9 A;  2NUG A;  1Z5A A;  1IBK I;  4HY1 A;  4DV3 E;  4JI4 I;  1KIJ A;  3QT7 A;  2OI2 A;  5IT9 Q;  2E5L E;  1XMO E;  4DV7 I;  1EI1 A;  4DV2 I;  1HNZ E;  2J7K A;  3T1H E;  2LTR A;  4JI8 E;  4URL A;  4LF7 E;  3ZKB A;  2L3J A;  4K0K I;  4NXM E;  1NHJ A;  1IBM E;  4DR1 E;  4JI6 E;  4JI1 E;  2A2C A;  2HHH E;  2B7T A;  1XNR I;  4DPT A;  4DV5 I;  4LF6 I;  1ZXN A;  4KHP E;  4DPW A;  4HAC A;  4YHH E;  4DV1 E;  3QT5 A;  2UXC E;  1IBL E;  1H73 A;  3JAM Q;  2L2K B;  4P52 A;  4DV0 I;  4B3T I;  4JV5 E;  2ZM6 E;  1J5E I;  4M1K A;  4JI3 E;  2WW4 A;  3ZKD A;  3ZM7 A;  4DR4 I;  2VF3 A;  4LFB I;  1FNM A;  1U2R A;  3HUL A;  1EKZ A;  1H72 C;  4B3R I;  4LF5 E;  4JI2 E;  1ZM4 A;  4WFT A;  4JI5 I;  3QT6 A;  1FJG I;  1FI4 A;  4DUZ E;  5IWA I;  3ZZU A;  2V34 A;  4X66 E;  4LF4 I;  3C4T A;  2F4V I;  3F0N A;  2HKE A;  2LJP A;  1X49 A;  1HR0 I;  4LFC E;  1UHZ A;  5LL6 R;  1DAR A;  1T4L B;  2VQE E;  1IBK E;  2HK2 A;  4ZVI A;  2ZIT A;  1N34 I;  3J81 Q;  2DEJ A;  2L2M A;  4DV7 E;  3T1Y I;  4DV2 E;  1N32 I;  5FLX Q;  4M2Z A;  3J7Y p;  2N3G A;  3LTO A;  1Z0G A;  4MYU A;  3K1J A;  3PYF A;  2HFU A;  1T4O A;  4HYM A;  4K0K E;  4OX9 I;  1KTV A;  1VIS A;  2N3H A;  1KKH A;  1XNR E;  4DV5 E;  4LF6 E;  3ADL A;  1S4E A;  2X36 A;  2X7I A;  2IHR 1;  4DV0 E;  4B3T E;  4DXL A;  1NZ0 A;  1ZBT A;  1J5E E;  1Z0T A;  4DR2 I;  3V5R A;  1FKA E;  4WUD A;  3WU5 A;  1N33 I;  4DR4 E;  4LFB E;  1XHK A;  1H7S A;  4KQV A;  5LMU I;  4B3R E;  4YY3 I;  1FWL A;  1NHH A;  4JI5 E;  1FJG E;  4JI0 I;  1RR9 A;  4X64 I;  5IWA E;  2HKJ A;  1ZM2 A;  2HFS A;  4LF4 E;  2F4V E;  2LRS A;  1XMQ E;  1HR0 E;  4DV4 I;  4WUB A;  4LF8 I;  4HAC B;  4LFA I;  1D6T A;  4FN5 A;  5CFF E;  4JI7 I;  2RS7 A;  1Z5C A;  4DPY A;  1PKP A;  1B62 A;  1Z0B A;  1N0U A;  1N34 E;  4AQY I;  2UUC I;  2UXD I;  2UXB I;  4DUY I;  3H4L A;  1GQE A;  3T1Y E;  1N32 E;  3LPS A;  1NHI A;  4GKJ I;  3K17 A;  1HNW I;  3PYG A; 
#chains in the Genus database with same CATH topology
 4X65 I;  2GQ0 A;  4NXN I;  1QU6 A;  1GZ6 A;  2EFG A;  3BF2 A;  4OO1 B;  1AAY A;  2RS6 A;  2V83 A;  4F6M A;  4R2P A;  3JTZ A;  2DB2 A;  3EPL A;  2MC5 A;  1YYW A;  1RRE A;  2R42 A;  4WXC A;  1ZR9 A;  4IS9 A;  4LOM A;  1H7U A;  4PRV A;  4OX9 E;  2V85 A;  2M7Q A;  1UN6 B;  3ADI A;  4DPY A;  4EMD A;  1N0V C;  1Z59 A;  1PJT A;  4OOG C;  3C4B A;  2EOE A;  4N3O A;  2V2V A;  5K36 E;  2EM8 A;  4B3S I;  1HNX I;  3AV0 A;  4I8O A;  1DGC A;  2Z5C A;  3B82 A;  1FWK A;  5K36 C;  2MDR A;  2I13 A;  4NZV A;  3K85 A;  4MU3 A;  2EMG A;  2EPZ A;  4AM3 A;  3JU0 A;  1UBD C;  2RTX A;  4N4R B;  2B3T B;  5A6K A;  3H1C A;  2DGC A;  4R2C A;  1Z0C A;  2NN6 F;  1K47 A;  1RHY A;  2EM6 A;  2BA0 G;  3WU3 A;  4DR2 E;  1KVK A;  2UUB I;  4R2Q A;  4JI4 E;  2JVA A;  4LF9 I;  1N33 E;  2EM3 A;  3WU6 A;  2LVH A;  2O1V A;  2PNZ B;  3P76 A;  4JYA I;  4M0V A;  3C6M A;  1WUU A;  2E1R A;  1WJP A;  4P7A A;  1B63 A;  5LMU E;  2JT2 A;  1WHN A;  4YY3 E;  2L3C A;  1ELO A;  2ODR C;  4JI0 E;  2N8X A;  4NBQ A;  5GME A;  4F9C B;  1AH5 A;  2EL6 A;  4M30 A;  4X64 E;  4R2D A;  3MHS C;  2C39 B;  4Z7C A;  1Z0W A;  4LCF A;  3VYX A;  2EOF A;  3ZZ0 A;  2WP8 B;  2EML A;  1X47 A;  1P42 A;  1Z5B A;  1Z1B A;  1USU A;  4DV2 I;  1MU5 A;  2V87 A;  3J7A G;  3V2U C;  3DJW A;  2YTO A;  2YTG A;  2EMA A;  5AE2 A;  1RQ0 A;  2NN6 D;  5C0X E;  5F3W A;  2GS8 A;  4DV4 E;  3HPZ A;  4XTJ A;  4WYQ B;  2GLI A;  4LF8 E;  2YTI A;  4DR5 I;  4DV6 I;  4LFA E;  3LLH A;  5C0X C;  2MDG A;  4IJD A;  4JI7 E;  2UUA I;  1XNQ I;  4ISA A;  4USK A;  2YU5 A;  4L5N C;  2IES A;  4FWD A;  2YTE A;  5A2Q C;  2D9H A;  2VE7 C;  4F54 A;  2BM1 A;  4FW3 A;  3ZZT A;  4OZE A;  3PS3 A;  3CDI A;  4WSG A;  5A6B D;  1I94 I;  1S16 A;  1PIE A;  3QT8 A;  4AQY E;  1BBG A;  1WHQ A;  2LJU A;  5KL4 A;  2UUC E;  2UXD E;  4RPF A;  4X62 I;  4BC9 A;  1YUJ A;  5JEA E;  1BKN A;  4FW4 A;  2UXB E;  4DUY E;  2BR2 B;  3M85 D;  2EN1 A;  1H74 A;  2C37 A;  1QZR A;  2EMW A;  2L2N A;  5EL9 A;  5KL2 A;  5JEA C;  3J80 C;  3OTO I;  2EE8 A;  4GKJ E;  1HNW E;  2BV3 A;  2VQF I;  4FWH A;  4X65 E;  5ELW A;  5KL7 A;  4NXN E;  5A69 A;  4BS9 A;  4DR7 I;  2EPM X;  3HKM A;  4OO1 F;  1EA6 A;  4HEI A;  2VQE I;  5KL3 A;  2M9A A;  1Z0E A;  3THO B;  2EN7 A;  2Q8U A;  4IZJ B;  3J80 Q;  1ZXM A;  2EOI A;  2WZO A;  2V86 A;  2O1T A;  1L4S A;  2LJH A;  3VHT B;  3KRN A;  2CT1 A;  2DLQ A;  4DU8 A;  2E1M A;  2WNR B;  2UU9 I;  2CPN A;  3P1X A;  4B3S E;  1HNX E;  5FWK A;  2LO3 A;  2IOP A;  5A6B A;  3CDJ A;  3IWC A;  4FW9 A;  2EL4 A;  4KZS A;  2EPC A;  4B3M I;  5C0X A;  4R2S A;  2XEX A;  4DPX A;  2LUP B;  1A6F A;  2NA2 A;  5LMN I;  2BA1 G;  2RSI A;  1EH8 A;  4TUG A;  2F1D A;  4P78 A;  4R2R A;  3B78 A;  1RMD A;  4GKK I;  4IFD D;  2BB8 A;  4ED4 A;  2ZBK B;  2UUB E;  3GLL A;  3JAM C;  4LF9 E;  5DRP A;  4OO1 D;  1YYO A;  2PO1 B;  4DPU A;  2DEI A;  4JYA E;  1TF6 A;  4BA1 A;  1F2I G;  5JEA B;  5DNL A;  4DR6 I;  2YU8 A;  3C6K A;  2YTN A;  1T4N A;  2EOJ A;  4FK5 C;  2AJ4 A;  3PYD A;  4DR3 I;  1N36 I;  2B7V A;  5BR8 I;  3ADG A;  2H36 X;  2BBG A;  2LMZ A;  2L33 A;  4GQU A;  2JEA A;  5AC5 A;  2PRT A;  1A1G A;  3IWB A;  1ZM9 A;  2NAB A;  1HK7 A;  2RSM A;  2JP9 A;  2FGG A;  5AE1 A;  4DV3 I;  2EMY A;  5EKW A;  1PVG A;  1A1J A;  2NPF A;  3HTX A;  2A2D A;  2E5L I;  1A1K A;  1O0W A;  1XMO I;  1J26 A;  2RQL A;  2Z5C B;  2NUE A;  4RHB B;  2HGH A;  5DRQ A;  1OYP A;  2EJ4 A;  1Y5Y A;  1HNZ I;  2DLK A;  1JK1 A;  1R6M A;  3T1H I;  3D4J A;  2LTS A;  3MSW A;  4X8W A;  4JI8 I;  3U1Y A;  4DR5 E;  3GON A;  4HXZ A;  4DV6 E;  4IFD A;  3P3C A;  5K36 F;  4LF7 I;  2UUA E;  3ADJ A;  2EPP A;  1XNQ E;  2EN2 A;  2LUQ A;  2O1W A;  2EOH A;  4GEQ B;  2ELZ A;  4J8Z A;  3PYE A;  1ZM3 A;  1PJQ A;  4NXM I;  2EMC A;  2EMX A;  4P7D A;  1YFH A;  1IBM I;  1USV A;  4UTG A;  1I94 E;  4DR1 I;  2DRP A;  4R1F A;  4X62 E;  2YTQ A;  3B8H A;  5GMD A;  2EM0 A;  3HXL A;  3KZY A;  2C38 B;  2CVE A;  4JI1 I;  1X3C A;  4UT4 A;  3EQ1 A;  3M7N D;  2HK3 A;  2V8P A;  1XMQ I;  2ENH A;  3J81 C;  2HHH I;  4JI6 I;  4MYT A;  4Z7Y A;  2JXP A;  1ZBQ A;  3OTO E;  1DI2 A;  1UEK A;  1UDO A;  2VQF E;  4DU7 A;  4KHP I;  4O4K A;  4YHH I;  2LV2 A;  2R76 A;  5T6J A;  4DV1 I;  2K4V A;  5FLX C;  2UXC I;  3WU4 A;  1G2D C;  4DR7 E;  3Q1Q A;  2BM0 A;  1IBL I;  2NUF A;  2YZT A;  4PRX A;  4JV5 I;  3CWV A;  2ZM6 I;  2KHX A;  5ADZ A;  3RMP A;  2GO4 A;  4JI3 I;  4LPF A;  4J3D A;  1OYR A;  2Q2E B;  1YZ9 A;  2JY9 A;  2DIX A;  2YT4 A;  4FWG A;  3VYY A;  4I3H A;  2L6M A;  1DQ3 A;  3KWR A;  2CTD A;  3EPK A;  2UU9 E;  2EZ6 A;  2R3V A;  3GCM A;  4Q28 A;  1OJ4 A;  5K36 B;  2EM2 A;  2LBS B;  1A1L A;  3HJC A;  1X6E A;  2WBT A;  4QNJ A;  4LF5 I;  4JI2 I;  1UIL A;  2EMB A;  2YSP A;  4B3M E;  4IZK A;  3IWD A;  4RH8 A;  5LMN E;  5C0X F;  4DUZ I;  2Z5B A;  2PNL A;  1R6L A;  3M6A A;  4BA2 A;  4LCH A;  1X48 A;  2DMY A;  4PU9 A;  4X66 I;  3AUZ A;  4WUC A;  5L3J A;  2VF1 A;  4GKK E;  4LTY A;  1RC7 A;  1TF3 A;  1KYQ A;  4BCA A;  1Z0V A;  2HC5 A;  2ODR D;  3FIG A;  1YYK A;  2C37 B;  2V2Z A;  3LNU A;  2DMI A;  1ZU1 A;  2G7H A;  2I9I A;  2V2Q A;  4USM A;  2EMK A;  3J7A M;  4JG4 A;  1STU A;  2EOM A;  4DR6 E;  1MG7 A;  1MX0 A;  1PDA A;  4DR3 E;  2YPN A;  1N36 E;  5AAS A;  5IT9 C;  4DKK A;  5BR8 E;  2EQ1 A;  2EPO A;  4MQY A;  5A2Q Q;  5JEA F;  3QG5 C;  4LFC I;  4IZJ D;  2PO0 B;  1MGT A;  2YRM A;  1WRJ A;  1E3P A;  2CZ9 A;  1XXE A;  2NUG A;  4ZYH A;  1Z5A A;  4AIM A;  3DD6 A;  1KJK A;  2NN6 A;  1IBK I;  3F6H A;  3B4T A;  4HY1 A;  2JE6 A;  2RPC A;  3MHH C;  2CG9 A;  4DV3 E;  4BMJ A;  4OKG A;  2M1S A;  2LCE A;  4JI4 I;  1KIJ A;  3QT7 A;  2OI2 A;  4F6N A;  2E5L E;  5IT9 Q;  1G2F C;  1XMO E;  4QNK A;  4DV7 I;  4IFD E;  1EI1 A;  2EL5 A;  2EMI A;  2EOS A;  3UK3 C;  2B9D A;  2EM9 A;  4ZYD A;  2WBU A;  1HNZ E;  2J7K A;  2JEB A;  2EM7 A;  3OML A;  3T1H E;  4WXD A;  2LTR A;  3HQ1 A;  5C0X B;  4IFD C;  4JI8 E;  4R2A A;  4URL A;  4LF7 E;  1X6F A;  3ZKB A;  3GME A;  2EPU A;  2L3J A;  4K0K I;  3L7Z A;  2EN6 A;  4NXM E;  1NHJ A;  4OO1 C;  2VRD A;  1IBM E;  2EOQ A;  4MU0 A;  5JEA D;  3KZZ A;  3P3G A;  5AC4 A;  4Q35 B;  2PO2 A;  4DR1 E;  2Z5E A;  5IV8 B;  1N3G A;  2GO3 A;  1E3H A;  4JI6 E;  2M4I A;  4X9J A;  4JI1 E;  1QNT A;  2DSY A;  2R1F A;  2MKD A;  2A2C A;  5DNX A;  2YWQ A;  1OYS A;  2EOR A;  2FV4 B;  2HHH E;  1X5W A;  2B7T A;  2EOX A;  1XNR I;  2YTD A;  2BA0 D;  4DPT A;  4DV5 I;  4LF6 I;  3F6G A;  4TUI A;  2J65 A;  2L92 A;  1ZXN A;  2JEA B;  4KHP E;  4DPW A;  4HAC A;  4BC7 A;  4YHH E;  4DV1 E;  2VES A;  3QT5 A;  2UXC E;  3BGH A;  1Y6Z A;  1EH6 A;  1IBL E;  2EPX A;  1H73 A;  3JAM Q;  2L2K B;  4P52 A;  4DV0 I;  5DRR A;  4B3T I;  2YRH A;  2YSO A;  4JV5 E;  2V88 A;  2ZM6 E;  4F2J C;  1J5E I;  4M1K A;  5A6A A;  4JI3 E;  2WW4 A;  3ZKD A;  5KL6 A;  1YHC A;  1GTK A;  3ZM7 A;  3PS2 A;  2O1U A;  2EOO A;  4DR4 I;  2VF3 A;  4LFB I;  1FNM A;  1U2R A;  3HUL A;  1EKZ A;  1H72 C;  4B3R I;  2O3Z A;  1TN9 A;  4U3B A;  4LF5 E;  4MU1 A;  4ZYE A;  4JI2 E;  1ZM4 A;  4WFT A;  4JI5 I;  3QT6 A;  2F8B A;  3Q6N A;  4OO1 A;  1FJG I;  1FI4 A;  4DUZ E;  2CGE A;  5IWA I;  3ZZU A;  3VK6 A;  2V34 A;  4HTG A;  4X66 E;  1T39 A;  1SR9 A;  3EPJ A;  1MEY C;  1IQO A;  4LF4 I;  3C4T A;  2LT7 A;  2F4V I;  3F0N A;  2EPK X;  2HKE A;  3HPS A;  1IMU A;  2LJP A;  1X49 A;  1P47 A;  1HR0 I;  1JK2 A;  4M9V C;  4U3D A;  5TSE A;  2NN6 E;  4LFC E;  1NEI A;  3BBG A;  1UHZ A;  5LL6 R;  1DAR A;  4LCG A;  3P06 A;  1T4L B;  2NN6 C;  4FW6 A;  2VQE E;  2MC6 A;  2KOU A;  2YRK A;  1IBK E;  2HK2 A;  4ZVI A;  2ZIT A;  1B69 A;  1N34 I;  3J81 Q;  2JOB A;  5K36 D;  4AID A;  2DEJ A;  2L2M A;  2C38 A;  3P3E A;  4DV7 E;  4MDT A;  3T1Y I;  4DV2 E;  2EN4 A;  1N32 I;  5FLX Q;  2PNZ A;  4M2Z A;  3J7Y p;  2N3G A;  3LTO A;  1Z0G A;  4IZK B;  2EPL X;  2JR1 A;  4MYU A;  3K1J A;  2Z5B B;  3PYF A;  2EOZ A;  1A1H A;  2MKN A;  2HFU A;  1T4O A;  4HYM A;  4BA2 B;  4K0K E;  2ADR A;  4BBY A;  2GPI A;  4OX9 I;  2GHF A;  2A25 A;  2L8T A;  2AE8 A;  4F9A B;  2ENA A;  1KTV A;  2C39 A;  5LLQ A;  1YUI A;  4DMI A;  2WP8 A;  2JWO A;  1VIS A;  3PS1 A;  2BA1 D;  2N3H A;  5KL5 A;  1ZAA C;  2JYA A;  2WBS A;  1YPN A;  4FW7 A;  1KKH A;  1XNR E;  2YTF A;  2JPA A;  5K36 A;  4DV5 E;  4LF6 E;  2PNM A;  2LE2 A;  4MLQ A;  4MLV A;  3THN A;  3ADL A;  1S4E A;  3NZK A;  2X36 A;  2CSH A;  3PRY A;  2NN6 B;  4FW5 A;  3H09 A;  2X7I A;  4O24 A;  4BHC A;  3M7N G;  2EMZ A;  2JE6 B;  2IHR 1;  4DV0 E;  4BHB A;  4B3T E;  4GZN C;  4DXL A;  1NZ0 A;  1ZBT A;  1BBO A;  1UDN A;  3Q6M A;  3LML A;  1J5E E;  1Z0T A;  4DR2 I;  2WCC 3;  3V5R A;  1FKA E;  5C0X D;  3EPH A;  4WUD A;  3WU5 A;  1N33 I;  4DR4 E;  2JEB B;  2E72 A;  4LFB E;  1XHK A;  4LU9 A;  1UDS A;  2BR2 A;  1H7S A;  1X6H A;  2EOY A;  4R8O A;  4B3R E;  4KQV A;  4YY3 I;  5LMU I;  4OO1 E;  4MU4 A;  4O43 A;  4IFD F;  2V89 A;  2KON A;  5IXM B;  4JI5 E;  1FWL A;  1NHH A;  1Y60 A;  3L7Z B;  1FJG E;  2EN3 A;  4JI0 I;  2PO0 A;  2EP3 A;  1RR9 A;  4X64 I;  5IWA E;  2PO2 B;  4WPY A;  4R2E A;  2J7J A;  2EMH A;  1PJS A;  1Y4U A;  2HKJ A;  2IOQ A;  1ZM2 A;  4ZYG A;  2HFS A;  4LF4 E;  3M99 B;  1Y4S A;  2F4V E;  4IZJ A;  4BA1 B;  4IS1 C;  1A1F A;  2JOX A;  2LRS A;  2FTX B;  1XMQ E;  2EQ0 A;  4L8N A;  2EN8 A;  1HR0 E;  1YSA C;  2WNR A;  4DV4 I;  2EPA A;  4WUB A;  4LF8 I;  2YTJ A;  4F9B B;  4HAC B;  4LFA I;  1D6T A;  4WSP A;  4FN5 A;  5CFF E;  1WXR A;  4JI7 I;  2RS7 A;  4KWY A;  3ZOQ B;  1PKP A;  2EPN A;  1Z5C A;  1BB8 A;  5DNY A;  4O5G A;  2EWL A;  2EPR A;  3DF6 A;  1B62 A;  3M85 G;  3BID A;  2HJJ A;  4NHR A;  5A6J A;  1EH7 A;  2EQ3 A;  4WX9 A;  1Z0B A;  2K7I A;  3U1K A;  1N0U A;  3ECR A;  1N34 E;  1LLM C;  2ENC A;  2ELY A;  3TQM A;  2YTP A;  1YH8 A;  4AQY I;  2EM4 A;  1VI7 A;  3K6Q A;  5AE3 A;  2UUC I;  2UXD I;  1IQS A;  3UHM A;  1A1I A;  4R03 A;  2V8Q B;  4DUY I;  2UXB I;  3H4L A;  1GQE A;  3T1Y E;  1T38 A;  3L00 A;  1UDQ A;  2IER A;  2PO1 A;  5DRO A;  1N32 E;  2EM5 A;  3LPS A;  1NHI A;  5JEA A;  3K17 A;  4GKJ I;  2EMF A;  4IFD B;  1HNW I;  1SFE A;  1NCS A;  3PYG A; 
#chains in the Genus database with same CATH homology
 4X65 I;  2GQ0 A;  4NXN I;  1QU6 A;  1GZ6 A;  2EFG A;  2RS6 A;  2V83 A;  3JTZ A;  2DB2 A;  2R42 A;  2MC5 A;  1YYW A;  1RRE A;  4PRV A;  1H7U A;  4OX9 E;  2V85 A;  2M7Q A;  3ADI A;  4EMD A;  1N0V C;  1Z59 A;  4OOG C;  3C4B A;  4N3O A;  2V2V A;  4B3S I;  1HNX I;  3AV0 A;  4I8O A;  2Z5C A;  3B82 A;  1FWK A;  2MDR A;  3K85 A;  3JU0 A;  2RTX A;  2B3T B;  1Z0C A;  1K47 A;  3WU3 A;  4DR2 E;  1KVK A;  2UUB I;  4JI4 E;  2JVA A;  4LF9 I;  1N33 E;  3WU6 A;  2O1V A;  4JYA I;  4M0V A;  1WUU A;  2E1R A;  4P7A A;  1B63 A;  5LMU E;  1WHN A;  4YY3 E;  2L3C A;  1ELO A;  2ODR C;  4JI0 E;  5GME A;  4F9C B;  4M30 A;  4X64 E;  4Z7C A;  1Z0W A;  3VYX A;  3ZZ0 A;  1X47 A;  1Z5B A;  1USU A;  1MU5 A;  2V87 A;  3J7A G;  3V2U C;  3DJW A;  5AE2 A;  1RQ0 A;  5F3W A;  2GS8 A;  4DV4 E;  3HPZ A;  4XTJ A;  4WYQ B;  4LF8 E;  4DR5 I;  4DV6 I;  4LFA E;  3LLH A;  2UUA I;  4JI7 E;  1XNQ I;  4USK A;  4L5N C;  4FWD A;  5A2Q C;  3ZZT A;  2VE7 C;  4F54 A;  2BM1 A;  1I94 I;  1S16 A;  1PIE A;  3QT8 A;  4AQY E;  4RPF A;  1WHQ A;  2UUC E;  4X62 I;  2UXD E;  4BC9 A;  1BKN A;  2UXB E;  4DUY E;  1H74 A;  1QZR A;  2L2N A;  3J80 C;  3OTO I;  4GKJ E;  1HNW E;  2BV3 A;  2VQF I;  4FWH A;  4X65 E;  4NXN E;  4BS9 A;  4DR7 I;  1EA6 A;  2VQE I;  1Z0E A;  4IZJ B;  3J80 Q;  1ZXM A;  2WZO A;  2V86 A;  2O1T A;  2LJH A;  4DU8 A;  2E1M A;  2UU9 I;  2CPN A;  3P1X A;  4B3S E;  1HNX E;  5FWK A;  2IOP A;  4FW9 A;  3IWC A;  4KZS A;  4B3M I;  2XEX A;  4DPX A;  2LUP B;  1A6F A;  2NA2 A;  5LMN I;  4TUG A;  4P78 A;  3B78 A;  4GKK I;  4ED4 A;  2ZBK B;  2UUB E;  3JAM C;  4LF9 E;  1YYO A;  4DPU A;  2DEI A;  4JYA E;  4DR6 I;  2AJ4 A;  1T4N A;  3PYD A;  4DR3 I;  1N36 I;  2B7V A;  5BR8 I;  3ADG A;  2H36 X;  2LMZ A;  2L33 A;  3IWB A;  1ZM9 A;  1HK7 A;  2RSM A;  2FGG A;  5AE1 A;  4DV3 I;  1PVG A;  2NPF A;  3HTX A;  2A2D A;  2E5L I;  1O0W A;  1XMO I;  1J26 A;  2Z5C B;  2NUE A;  1HNZ I;  3T1H I;  3D4J A;  2LTS A;  3MSW A;  4X8W A;  4JI8 I;  4DR5 E;  3GON A;  4HXZ A;  4DV6 E;  4LF7 I;  2UUA E;  3ADJ A;  1XNQ E;  2LUQ A;  2O1W A;  4J8Z A;  4GEQ B;  3PYE A;  1ZM3 A;  4NXM I;  4P7D A;  1IBM I;  1USV A;  4UTG A;  1I94 E;  4DR1 I;  4R1F A;  4X62 E;  4JI6 I;  3B8H A;  5GMD A;  3HXL A;  4JI1 I;  4UT4 A;  2HK3 A;  2V8P A;  1XMQ I;  3J81 C;  2HHH I;  4MYT A;  4Z7Y A;  1ZBQ A;  3OTO E;  1DI2 A;  1UEK A;  2VQF E;  4DU7 A;  4KHP I;  4YHH I;  5T6J A;  4DV1 I;  2K4V A;  5FLX C;  2UXC I;  3WU4 A;  4DR7 E;  3Q1Q A;  2BM0 A;  1IBL I;  2NUF A;  2YZT A;  4PRX A;  4JV5 I;  3CWV A;  2ZM6 I;  2KHX A;  5ADZ A;  3RMP A;  4JI3 I;  2Q2E B;  1YZ9 A;  2JY9 A;  2DIX A;  2YT4 A;  4FWG A;  3VYY A;  4I3H A;  2L6M A;  1DQ3 A;  3KWR A;  2UU9 E;  2EZ6 A;  2R3V A;  4Q28 A;  1OJ4 A;  2LBS B;  3HJC A;  4LF5 I;  4JI2 I;  1UIL A;  4B3M E;  4IZK A;  3IWD A;  5LMN E;  4DUZ I;  2Z5B A;  2PNL A;  3M6A A;  1X48 A;  2DMY A;  4PU9 A;  4X66 I;  3AUZ A;  4WUC A;  5L3J A;  2VF1 A;  4GKK E;  1RC7 A;  4LTY A;  4BCA A;  1Z0V A;  2ODR D;  3FIG A;  1YYK A;  2V2Z A;  3LNU A;  3J7A M;  2G7H A;  2V2Q A;  4USM A;  4JG4 A;  1STU A;  4DR6 E;  1MG7 A;  1MX0 A;  4DR3 E;  1N36 E;  5AAS A;  5IT9 C;  4DKK A;  5BR8 E;  5A2Q Q;  4LFC I;  4IZJ D;  2CZ9 A;  2NUG A;  1Z5A A;  1IBK I;  3F6H A;  4HY1 A;  2CG9 A;  4DV3 E;  4BMJ A;  2M1S A;  4JI4 I;  1KIJ A;  3QT7 A;  2OI2 A;  5IT9 Q;  2E5L E;  1XMO E;  4DV7 I;  1EI1 A;  4DV2 I;  1HNZ E;  2B9D A;  2J7K A;  3OML A;  3T1H E;  2LTR A;  3HQ1 A;  4JI8 E;  4URL A;  4LF7 E;  3ZKB A;  2L3J A;  4K0K I;  4NXM E;  1NHJ A;  1IBM E;  4DR1 E;  2Z5E A;  4JI6 E;  2M4I A;  4JI1 E;  2A2C A;  2DSY A;  2FV4 B;  2HHH E;  2B7T A;  1XNR I;  4DPT A;  4DV5 I;  4LF6 I;  3F6G A;  4TUI A;  2L92 A;  1ZXN A;  4KHP E;  4DPW A;  4HAC A;  4BC7 A;  4YHH E;  4DV1 E;  3QT5 A;  2UXC E;  1Y6Z A;  1IBL E;  1H73 A;  3JAM Q;  2L2K B;  4P52 A;  4DV0 I;  4B3T I;  4JV5 E;  2V88 A;  2ZM6 E;  1J5E I;  4M1K A;  4JI3 E;  2WW4 A;  3ZKD A;  3ZM7 A;  2O1U A;  4DR4 I;  2VF3 A;  4LFB I;  1FNM A;  1U2R A;  3HUL A;  1EKZ A;  1H72 C;  4B3R I;  4LF5 E;  4JI2 E;  1ZM4 A;  4WFT A;  4JI5 I;  3QT6 A;  2F8B A;  3Q6N A;  1FJG I;  1FI4 A;  4DUZ E;  2CGE A;  5IWA I;  3ZZU A;  3VK6 A;  2V34 A;  4X66 E;  1SR9 A;  4LF4 I;  3C4T A;  2F4V I;  3F0N A;  2HKE A;  3HPS A;  2LJP A;  1X49 A;  1HR0 I;  4LFC E;  1UHZ A;  5LL6 R;  1DAR A;  3P06 A;  1T4L B;  2VQE E;  2MC6 A;  2KOU A;  1IBK E;  2HK2 A;  4ZVI A;  2ZIT A;  1N34 I;  3J81 Q;  2JOB A;  2DEJ A;  2L2M A;  4DV7 E;  3T1Y I;  4DV2 E;  1N32 I;  5FLX Q;  4M2Z A;  3J7Y p;  2N3G A;  3LTO A;  1Z0G A;  4IZK B;  2JR1 A;  4MYU A;  3K1J A;  2Z5B B;  3PYF A;  2HFU A;  1T4O A;  4HYM A;  4K0K E;  4BBY A;  4OX9 I;  2L8T A;  4F9A B;  1KTV A;  4DMI A;  2JWO A;  1VIS A;  2N3H A;  1KKH A;  1XNR E;  4DV5 E;  4LF6 E;  2PNM A;  2LE2 A;  3ADL A;  1S4E A;  2X36 A;  3PRY A;  3H09 A;  2X7I A;  2IHR 1;  4DV0 E;  4B3T E;  4DXL A;  1NZ0 A;  1ZBT A;  3Q6M A;  3LML A;  1J5E E;  1Z0T A;  4DR2 I;  3V5R A;  1FKA E;  4WUD A;  3WU5 A;  1N33 I;  4DR4 E;  4LFB E;  1XHK A;  4LU9 A;  1H7S A;  4R8O A;  4KQV A;  5LMU I;  4B3R E;  4YY3 I;  2V89 A;  1FWL A;  2KON A;  4JI5 E;  1NHH A;  1FJG E;  4JI0 I;  1RR9 A;  4X64 I;  5IWA E;  4WPY A;  1Y4U A;  2HKJ A;  2IOQ A;  1ZM2 A;  2HFS A;  4LF4 E;  1Y4S A;  2F4V E;  4IZJ A;  2JOX A;  2LRS A;  2FTX B;  1XMQ E;  4L8N A;  1HR0 E;  4DV4 I;  4WUB A;  4LF8 I;  4F9B B;  4HAC B;  4LFA I;  1D6T A;  4WSP A;  4FN5 A;  5CFF E;  1WXR A;  4JI7 I;  2RS7 A;  3ZOQ B;  1Z5C A;  1PKP A;  4DPY A;  5DNY A;  2EWL A;  3DF6 A;  1B62 A;  1Z0B A;  1N0U A;  1N34 E;  4AQY I;  2UUC I;  3K6Q A;  5AE3 A;  2UXD I;  4R03 A;  2V8Q B;  4DUY I;  2UXB I;  3H4L A;  1GQE A;  3T1Y E;  1N32 E;  3LPS A;  1NHI A;  4GKJ I;  3K17 A;  1HNW I;  3PYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...