2UXBE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbE02
4FWHA 1H73A 1I94E 1N34I 3Q1QA 1UEKA 1HNXI 2LRSA 1NHIA 1YYOA 4USKA 2F4VE 4FN5A 4PRVA 3ADJA 4JG4A 4DV1E 3OTOE 4OX9I 1T4LB 1Z0VA 4JI7I 1ZM9A 4DU7A 1RC7A 2CPNA 4LF8E 1STUA 4B3ME 1U2RA 4I3HA 1PKPA 1MG7A 2MDRA 4WUDA 2OI2A 4GKJE 4DV3E 1K47A 2NUGA 1Z0BA 1QZRA 4DPYA 5GMEA 4X64E 3WU5A 3K1JA 1X49A 4JI5E 2HHHE 1RR9A 1N36E 2L2KB 4DUZI 1HNWE 2ZITA 4X62E 4USMA 2UXDI 4X65E 4DR3E 4B3SE 3ZZ0A 1IBMI 1WHNA 1OJ4A 1DARA 2B7VA 1QU6A 2JY9A 1ZXMA 2ZBKB 1ZM3A 4DPTA 2NUFA 3C4BA 4LF9I 1Z5BA 2L2NA 2VF3A 5GMDA 2NPFA 4LF9E 4KHPE 1PIEA 3J81Q 1EA6A 2RTXA 1IBLE 1J5EI 4DR4E 2V2VA 4DV6E 2NA2A 2RS6A 3T1HE 1B63A 4LFCI 2IHR1 4DPXA 4OOGC 2UXDE 4X62I 4LFBI 4DPWA 4R1FA 5LMUE 2UUCE 4DR6I 1HNZE 4X64I 1YYWA 4M30A 2LUPB 4HXZA 1S4EA 4DV5I 4YY3E 3LTOA 1T4OA 2V2ZA 4JI1I 5LL6R 5FLXQ 1HR0E 3OTOI 4JI7E 3QT8A 2V8PA 1HNWI 2L3CA 2B3TB 4JI6E 2HK3A 1WHQA 3J80C 1KKHA 1VISA 4JI8I 4ED4A 4UTGA 4GKKI 2LUQA 1YZ9A 3J81C 1N34E 1I94I 1ZM2A 3P1XA 4DR2I 3GONA 1H72C 2RS7A 2UU9E 2DIXA 3JAMQ 3QT6A 5IT9C 1ZXNA 4LF8I 1KVKA 2L2MA 1YYKA 1GQEA 2X36A 2V2QA 2N3GA 2GS8A 1XMQI 2UXBE 2LTRA 2UUBE 3ZZTA 2X7IA 2DMYA 4LFAI 4LF5E 3PYDA 1HR0I 1A6FA 5FLXC 4M1KA 5BR8E 5IT9Q 2DEJA 5LMNI 1HNXE 4JV5E 3WU3A 1RREA 4DV5E 4DV2I 4LF4I 3J80Q 4DR5I 4KQVA 4FWGA 4GKKE 4UT4A 1N32E 1NZ0A 1FWLA 1FWKA 2WW4A 1X47A 3VYXA 4NXMI 1RQ0A 5LMUI 4WUBA 2UUCI 3QT5A 3HULA 4P52A 2UXCE 3ZZUA 3B78A 3C4TA 1H7SA 4EMDA 3PYEA 2ZM6I 2HFSA 4MYUA 4M2ZA 1FKAE 1IBLI 4WUCA 2V34A 2E5LE 3K17A 4KHPI 2XEXA 4DV4I 4LF7I 4FWDA 2HK2A 4X66I 4P7AA 3PYGA 5IWAI 4RPFA 1O0WA 1NHJA 4WYQB 1D6TA 3CWVA 3T1HI 4DV7I 4X65I 4DV7E 1FNMA 4DR3I 1J26A 1J5EE 3ADIA 1Z0TA 4X66E 5IWAE 4DV0I 4X8WA 3F0NA 4JI4I 3J7AG 2DB2A 4DV4E 4LF7E 3H4LA 2E5LI 1Z59A 4DV3I 1ELOA 4GKJI 2BM1A 2LTSA 2LBSB 1H7UA 4HACB 5BR8I 1XNQI 1IBME 4JYAI 2ZM6E 1NHHA 2UXCI 4OX9E 1Z5CA 3B82A 1IBKE 2DEIA 4JI5I 1N0UA 2VQFE 3D4JA 3VYYA 3ADGA 1UHZA 3HTXA 4DR5E 4JI0I 2NUEA 4DR2E 1KIJA 1FI4A 4DU8A 4LF4E 4B3MI 1Z0EA 4DV2E 4PRXA 3M6AA 4DPUA 1EI1A 4B3RI 2B7TA 1X48A 4JI6I 5CFFE 2VQEE 2UUBI 4DR1I 4DR1E 1N33E 4LF5I 2UXBI 3LNUA 4HACA 4B3RE 2VQEI 3ZM7A 4JI1E 4LF6I 2UU9I 2BM0A 1FJGI 4WFTA 4JI0E 2E1RA 1XNRI 3LLHA 1XNRE 4NXNE 1DI2A 3PYFA 1HNZI 3ZKBA 4LF6E 4JI8E 5L3JA 1IBKI 1ZBTA 1Z0GA 4K0KI 1N33I 1XMOE 4LFCE 2A2DA 3V5RA 4JYAE 1EKZA 4DV6I 1Z5AA 3ADLA 4DR4I 1BKNA 3WU4A 4B3TE 3T1YE 2J7KA 4YHHE 4YY3I 4DXLA 4DUYE 4JI2I 1MU5A 2HKJA 2L3JA 4DV0E 4JI4E 2VQFI 2HKEA 4DR6E 4LFBE 1MX0A 1Z0CA 4AQYE 2AJ4A 4HY1A 4JI3I 4JI3E 1XNQE 4DUZE 1H74A 4Z7CA 2R42A 2RSMA 2YT4A 1UILA 2HHHI 4HYMA 1WUUA 2LJHA 2JVAA 3WU6A 4URLA 5A2QC 2LJPA 3LPSA 4JI2E 4FW9A 2BV3A 2EFGA 4YHHI 3T1YI 2CZ9A 4ZVIA 4PU9A 2Q2EB 3JAMC 5A2QQ 2KHXA 4B3SI 1XMOI 4AQYI 1N36I 1N32I 2F4VI 2N3HA 3J7AM 1T4NA 4DUYI 2HFUA 4NXNI 2EZ6A 1B62A 4Z7YA 4B3TI 1FJGE 1XHKA 4JV5I 5LMNE 3B8HA 3J7Yp 3ZKDA 4DKKA 4DR7I 1S16A 2UUAI 1Z0WA 2R3VA 3QT7A 4K0KE 4XTJA 4LFAE 3V2UC 4DV1I 2L33A 1KTVA 2UUAE 1XMQE 4NXME 1N0VC 4DR7E 4MYTA 1PVGA 2A2CA 1ZM4A
chains in the Genus database with same CATH superfamily
4MU4A 2B9DA 2LVHA 1H73A 4FWHA 4J3DA 1I94E 3M85D 1N34I 2V88A 4IZJA 2PO1B 3Q1QA 4IFDD 1UEKA 2DMIA 1HNXI 2LRSA 5EL9A 1VI7A 2O1TA 2YWQA 4LFBI 1A1IA 2EMHA 1NHIA 1NEIA 1SR9A 1YYOA 4USKA 4IFDE 2F4VE 2MKNA 1NCSA 3THNA 2VESA 4FN5A 4PRVA 3M7NG 2EPZA 3ADJA 4JG4A 4FW7A 4DV1E 2BA1G 4WX9A 3OTOE 2EMAA 5ELWA 4OX9I 1T4LB 1Z0VA 2JE6B 4JI7I 1RHYA 1ZM9A 2YTFA 4BCAA 2BR2A 4DU7A 2KONA 1RC7A 2CPNA 4LF8E 5DNYA 1STUA 2MDGA 2BA1D 4B3ME 1P47A 2EN6A 1U2RA 2YTQA 3Q6NA 4I3HA 2EM4A 1PKPA 1DGCA 1MG7A 5JEAE 2PO1A 2EQ1A 2MDRA 4WUDA 2OI2A 2V85A 4GKJE 4LOMA 2NN6A 1LLMC 2GO3A 4DV3E 2EOFA 2IESA 2JR1A 1K47A 4QNJA 2H36X 2NUGA 1Z0BA 2YRKA 1QZRA 2RSIA 4I8OA 5GMEA 4DPYA 4X64E 3WU5A 1ZBQA 1X49A 3K1JA 4JI5E 1F2IG 4IZJB 2HHHE 1RR9A 2PO0A 4LTYA 2BA0D 1N36E 1X5WA 2O3ZA 1SFEA 2L2KB 4F6MA 1HNWE 2ZITA 4DUZI 4X62E 5A69A 4USMA 2EORA 2UXDI 4X65E 4DR3E 4ZYGA 4B3SE 3ZZ0A 1IBMI 1WHNA 2CTDA 1OJ4A 2L8TA 4WXCA 1DARA 2B7VA 2J65A 1QU6A 2JY9A 4F9AB 5AC4A 5JEAC 3AV0A 5K36E 2GHFA 2YTJA 4MDTA 1ZXMA 2ZBKB 3BGHA 4FW5A 1ZM3A 4DPTA 5IXMB 2NUFA 4WPYA 3C4BA 1TF3A 2EM0A 4LF9I 4AIDA 2EQ3A 1Z5BA 2ELZA 2C38B 2L2NA 2VF3A 4X9JA 1TF6A 5GMDA 1G2DC 2NPFA 2EPOA 4LF9E 2PNMA 3K6QA 4FK5C 4KHPE 1PIEA 3J81Q 1EA6A 4O24A 2EPLX 1BBGA 2YRMA 2RTXA 2YU8A 2V83A 2E1MA 1IBLE 4P7DA 4DR4E 1J5EI 5A6AA 2ENHA 4F9BB 2V2VA 2KOUA 4DV6E 5DRQA 2NA2A 2EJ4A 2RS6A 2YTNA 3T1HE 1B63A 2EMXA 2EOHA 4LFCI 2IHR1 2PO0B 4DPXA 2FGGA 2Z5EA 4OOGC 1T38A 4R2DA 2UXDE 1OYPA 2L92A 4X62I 3U1YA 4DPWA 4R1FA 2EOXA 4IFDA 2EM6A 5LMUE 4GZNC 2UUCE 1GZ6A 1PJQA 1WJPA 2EOSA 3DF6A 4LU9A 2I13A 2EL5A 2EOMA 3THOB 5K36A 1UBDC 4DR6I 1HNZE 4X64I 4BBYA 4AM3A 1DQ3A 1X3CA 2CSHA 1YYWA 2JE6A 4U3BA 2LMZA 4OO1C 4M30A 2LUPB 1ZAAC 2BR2B 3KZYA 2F1DA 1S4EA 4R2CA 4HXZA 4DV5I 4YY3E 4J8ZA 3LTOA 2K4VA 1T4OA 2V2ZA 1BBOA 5K36C 3PS2A 5FWKA 3BBGA 4IJDA 3CDIA 1MEYC 2EPPA 4N3OA 4P78A 1Y60A 4JI1I 2EE8A 5LL6R 3BF2A 3GLLA 5FLXQ 1HR0E 2DSYA 3OTOI 1A1HA 1A1FA 1Y4UA 4JI7E 2HJJA 3QT8A 2V8PA 1HNWI 3FIGA 2L3CA 1AAYA 2B3TB 2EMCA 2JT2A 4JI6E 2YSOA 2HK3A 2WBSA 1WHQA 3J80C 1KKHA 2EMLA 1ZR9A 1VISA 4JI8I 2EMIA 4ED4A 2EOQA 2WZOA 2RQLA 3P3CA 4UTGA 4GKKI 2LUQA 1YZ9A 3J81C 3PS1A 4TUIA 1N34E 2DRPA 1I94I 1ZM2A 3P1XA 4DR2I 4ZYHA 2GQ0A 3GONA 4OO1D 5KL3A 1H72C 5K36B 2YTGA 2YPNA 2RS7A 4IZKA 2BBGA 2UU9E 4IZKB 2BB8A 2DIXA 1YSAC 3JAMQ 3QT6A 3H09A 4RHBB 2LJUA 5IT9C 1ZXNA 4LF8I 1KVKA 2EMWA 3DD6A 2L2MA 1YYKA 1GQEA 2X36A 4OO1F 2V2QA 2EN2A 3ECRA 2N3GA 2ODRC 1N3GA 2C38A 2EPKX 2GS8A 2UXBE 1XMQI 2LTRA 4F54A 4F9CB 2R1FA 2UUBE 3ZZTA 2X7IA 4WSGA 2DMYA 3VHTB 4LFAI 4LF5E 2M1SA 2JEAA 3PYDA 2YTEA 1A6FA 5FLXC 1HR0I 4M1KA 5BR8E 4R2RA 2ENAA 2V86A 2EPXA 1USUA 5IT9Q 2DEJA 4BA2B 3GCMA 4R8OA 1HNXE 4JV5E 5LMNI 2AE8A 2EM5A 3WU3A 1RREA 4DV5E 4DV2I 2EP3A 5DNXA 4LF4I 2WCC3 4Q28A 3J80Q 4BC9A 4DR5I 2HC5A 2YTOA 4KQVA 4FWGA 1IQSA 2NN6E 4OO1B 4GKKE 1JK2A 3KWRA 1Y5YA 4OZEA 1N32E 1NZ0A 4UT4A 2DLKA 2D9HA 1FWLA 1FWKA 2WW4A 1HK7A 5DRRA 1X47A 3EQ1A 3JTZA 3VYXA 2MC5A 5C0XE 4NXMI 2EMZA 3EPHA 1RQ0A 2M7QA 5LMUI 4WUBA 5JEAD 2UUCI 3QT5A 3UK3C 3P06A 2ODRD 3MSWA 2JPAA 3HULA 4P52A 2UXCE 3ZZUA 3B78A 3C4TA 2JWOA 3AUZA 2FV4B 1H7SA 4EMDA 2V87A 3PYEA 2ZM6I 2EN7A 2MKDA 5C0XC 1YFHA 2O1UA 2HFSA 4MYUA 5DNLA 4M2ZA 4IS9A 1FKAE 2E72A 3EPLA 4WUCA 1IBLI 4MQYA 2V34A 5AC5A 2E5LE 3K17A 2Z5BB 2EPCA 2XEXA 4KHPI 1A1JA 4GEQB 4L5NC 4LPFA 4ZYDA 3EPJA 4JI6I 4DV4I 4MLVA 4LF7I 4FWDA 2EOIA 2HK2A 4X66I 4P7AA 2WBTA 5KL5A 2HGHA 2PNLA 2IOQA 3PYGA 4R2AA 4RPFA 5IWAI 1BB8A 5A6KA 1R6MA 1O0WA 1NHJA 4WYQB 1D6TA 3CWVA 4N4RB 3T1HI 4DV7I 4LCFA 4X65I 4DV7E 3IWBA 1FNMA 3HJCA 4DR3I 2GPIA 1J26A 2YTIA 4IZJD 1J5EE 1OYRA 2WNRB 2K7IA 2L6MA 2LCEA 5AE3A 3ADIA 1Z0TA 4X66E 5IWAE 3GMEA 4DV0I 4F6NA 4X8WA 2EMKA 1A1KA 1E3PA 4OKGA 3F0NA 4KZSA 4JI4I 5LLQA 4FW4A 3C6MA 3J7AG 1IMUA 3KZZA 2EOOA 1L4SA 2DB2A 4DV4E 4LF7E 2JEBB 3H4LA 4FW3A 2E5LI 1Z59A 4DV3I 4IFDC 2EQ0A 1ELOA 4GKJI 2BM1A 2JOXA 2WBUA 4O4KA 2EL4A 1USVA 2LTSA 1UDSA 2LBSB 2EM7A 2EM2A 2M9AA 1H7UA 3CDJA 4HACB 2EN8A 5BR8I 1AH5A 1UN6B 1IBME 1XNQI 4JYAI 2ZM6E 2EM9A 1NHHA 3U1KA 2UXCI 1Y4SA 4KWYA 2WNRA 3B4TA 2V89A 4OO1A 1UDQA 4OX9E 1Z5CA 2CVEA 3B82A 4GQUA 1IBKE 1IQOA 2DEIA 5A6BA 5C0XB 4JI5I 2YRHA 3P76A 2Z5CB 1N0UA 2JOBA 2VQFE 3D4JA 1G2FC 2JEBA 5A6BD 1A1LA 3VYYA 3KRNA 3PS3A 3ADGA 1UHZA 4MU0A 2O1VA 3HTXA 4DR5E 4JI0I 2EN3A 2EPMX 2NUEA 4O43A 3H1CA 1X6EA 2LE2A 4DR2E 1KIJA 1FI4A 4FW6A 4DU8A 4LF4E 4B3MI 1PDAA 1Z0EA 1YPNA 4DV2E 4PRXA 2DGCA 2EMYA 3M6AA 3HPZA 4DMIA 5DRPA 4DPUA 1EI1A 4B3RI 2B7TA 2Z5BA 3ZOQB 1X48A 1YUIA 3M99B 4M0VA 5ADZA 5CFFE 2VQEE 2CT1A 2EOEA 3P3EA 4DR1I 2UUBI 2EN1A 3IWCA 4R2QA 4DR1E 1ZU1A 1JK1A 1N33E 4LF5I 2EL6A 3PRYA 2UXBI 2EWLA 3LNUA 4HACA 2ENCA 2LO3A 4B3RE 2VQEI 2V8QB 4JI1E 3ZM7A 4LF6I 2DLQA 2F8BA 2UU9I 2EMGA 2BM0A 2GLIA 1FJGI 1EH6A 2EPNA 4WFTA 4BMJA 4JI0E 2E1RA 2WP8A 1XNRI 3LLHA 2ELYA 3MHHC 1XNRE 4NXNE 4TUGA 1XXEA 1B69A 1DI2A 2GO4A 2JEAB 3M7ND 4R2SA 2FTXB 4IFDB 3PYFA 1HNZI 5EKWA 3LMLA 3BIDA 3RMPA 1WRJA 2EPAA 4ISAA 1EH7A 2MC6A 3ZKBA 5KL6A 4LF6E 4BA2A 4MU3A 4JI8E 3HKMA 3M85G 3UHMA 5TSEA 3VK6A 5L3JA 1IBKI 5KL2A 1ZBTA 1Z0GA 2NN6C 4K0KI 1N33I 1XMOE 1YUJA 5KL7A 3NZKA 3L7ZA 4LFCE 2A2DA 3V5RA 4JYAE 1EKZA 2NN6F 4DV6I 1Z5AA 3ADLA 4DR4I 4NBQA 1BKNA 2IOPA 4B3TE 3WU4A 2YTPA 3T1YE 2J7KA 4IFDF 1R6LA 2O1WA 5C0XF 4YHHE 4BC7A 4MLQA 4YY3I 4BHBA 4DXLA 1X6FA 4DUYE 4JI2I 4RH8A 2C37B 1MU5A 2HKJA 5K36F 2L3JA 3P3GA 2J7JA 4DV0E 3QG5C 5C0XA 4O5GA 4JI4E 5JEAB 2VQFI 5JEAA 2HKEA 2WP8B 2EPUA 4BS9A 4DR6E 1YH8A 2ADRA 2A25A 4Q35B 4LFBE 1PJSA 1MX0A 1Z0CA 4AQYE 3MHSC 2AJ4A 1OYSA 1EH8A 4HY1A 5JEAF 3HQ1A 4JI3I 2PO2B 4JI3E 1PJTA 1XNQE 4DUZE 2EOZA 1YHCA 1H74A 4Z7CA 2R42A 2RSMA 2YT4A 5AE2A 1UILA 2N8XA 4L8NA 5A6JA 3L7ZB 1QNTA 1WUUA 1Y6ZA 4HYMA 2HHHI 2LJHA 2JVAA 2EMFA 3WU6A 2Q8UA 4URLA 4WSPA 2Z5CA 4BHCA 4ZYEA 5A2QC 2LJPA 3LPSA 4R03A 1WXRA 2EM8A 4JI2E 4FW9A 5IV8B 2BV3A 2C39A 2EN4A 2EFGA 2YZTA 4YHHI 5F3WA 2C37A 4LCGA 3T1YI 3TQMA 2CZ9A 5AE1A 5KL4A 2CG9A 4U3DA 1KYQA 2I9IA 1X6HA 4ZVIA 3F6GA 3JU0A 4PU9A 1A1GA 2Q2EB 3JAMC 5C0XD 4QNKA 3K85A 2G7HA 5A2QQ 2KHXA 4BA1A 4B3SI 1RMDA 4AQYI 1XMOI 2EOYA 1E3HA 1Z1BA 2NN6D 5K36D 2R76A 1N36I 2NABA 2JYAA 3HPSA 2PO2A 1N32I 2F4VI 2VF1A 5T6JA 2M4IA 3IWDA 3EPKA 2N3HA 3J7AM 1GTKA 1KJKA 5AASA 2C39B 4WXDA 3HXLA 2PNZB 1T4NA 4DUYI 2HFUA 4NHRA 4F2JC 2EZ6A 4NXNI 4MU1A 5DROA 2PRTA 2JP9A 1B62A 4Z7YA 4B3TI 4LCHA 1FJGE 1XHKA 4HTGA 4JV5I 5LMNE 3B8HA 3J7Yp 3C6KA 2LV2A 2YSPA 3F6HA 4DKKA 1UDOA 3ZKDA 2EMBA 4AIMA 4BA1B 4DR7I 4R2EA 2EPRA 1S16A 2UUAI 1Z0WA 2CGEA 2R3VA 4NZVA 2EM3A 1P42A 3QT7A 4K0KE 4R2PA 2VRDA 1TN9A 1UDNA 3L00A 3OMLA 4LFAE 4XTJA 3V2UC 4DV1I 2YU5A 2L33A 1MGTA 4HEIA 1KTVA 2LT7A 2UUAE 1XMQE 2JXPA 4NXME 1N0VC 2EOJA 4M9VC 4DR7E 4MYTA 2NN6B 4OO1E 2RPCA 2YTDA 4IS1C 1T39A 2PNZA 3DJWA 1PVGA 3Q6MA 2A2CA 2BA0G 2IERA 1ZM4A 2VE7C
chains in the Genus database with same CATH topology
2B9DA 4FWHA 1H73A 1I94E 1N34I 3Q1QA 2V88A 4IZJA 1UEKA 1HNXI 2LRSA 2O1TA 1NHIA 1YYOA 1SR9A 4USKA 2F4VE 4FN5A 4PRVA 3ADJA 4JG4A 4DV1E 3OTOE 4OX9I 1T4LB 1Z0VA 4JI7I 1ZM9A 4BCAA 4DU7A 2KONA 1RC7A 2CPNA 4LF8E 5DNYA 1STUA 4B3ME 1U2RA 3Q6NA 4I3HA 1PKPA 1MG7A 2MDRA 4WUDA 2OI2A 2V85A 4GKJE 4DV3E 2JR1A 1K47A 2H36X 2NUGA 1Z0BA 1QZRA 4DPYA 5GMEA 4I8OA 4X64E 3WU5A 1ZBQA 1X49A 3K1JA 4JI5E 4IZJB 2HHHE 1RR9A 4LTYA 1N36E 2L2KB 4DUZI 1HNWE 2ZITA 4X62E 4USMA 2UXDI 4X65E 4DR3E 4B3SE 3ZZ0A 1IBMI 1WHNA 1OJ4A 2L8TA 1DARA 2B7VA 1QU6A 2JY9A 4F9AB 3AV0A 1ZXMA 2ZBKB 1ZM3A 4DPTA 2NUFA 4WPYA 3C4BA 4LF9I 1Z5BA 2L2NA 2VF3A 5GMDA 2NPFA 4LF9E 2PNMA 3K6QA 4KHPE 1PIEA 3J81Q 1EA6A 2RTXA 2V83A 2E1MA 1IBLE 4P7DA 4DR4E 1J5EI 4F9BB 2V2VA 2KOUA 4DV6E 2NA2A 2RS6A 3T1HE 1B63A 4LFCI 2IHR1 4DPXA 2FGGA 2Z5EA 4OOGC 2UXDE 4X62I 4LFBI 2L92A 4DPWA 4R1FA 5LMUE 2UUCE 1GZ6A 3DF6A 4LU9A 4DR6I 1HNZE 4X64I 4BBYA 1DQ3A 1YYWA 2LMZA 4M30A 2LUPB 4HXZA 1S4EA 4DV5I 4YY3E 4J8ZA 3LTOA 2K4VA 1T4OA 2V2ZA 5FWKA 4N3OA 4P78A 4JI1I 5LL6R 5FLXQ 1HR0E 2DSYA 3OTOI 1Y4UA 4JI7E 3QT8A 2V8PA 1HNWI 3FIGA 2L3CA 2B3TB 4JI6E 2HK3A 1WHQA 3J80C 1KKHA 1VISA 4JI8I 4ED4A 2WZOA 4UTGA 4GKKI 2LUQA 1YZ9A 3J81C 4TUIA 1N34E 1I94I 1ZM2A 3P1XA 4DR2I 2GQ0A 3GONA 1H72C 2RS7A 4IZKA 2UU9E 4IZKB 2DIXA 3JAMQ 3QT6A 3H09A 5IT9C 1ZXNA 4LF8I 1KVKA 2L2MA 1YYKA 1GQEA 2X36A 2V2QA 2N3GA 2ODRC 2GS8A 1XMQI 2UXBE 2LTRA 4F54A 4F9CB 2UUBE 3ZZTA 2X7IA 2DMYA 4LFAI 4LF5E 2M1SA 3PYDA 1HR0I 1A6FA 5FLXC 4M1KA 5BR8E 2V86A 5IT9Q 1USUA 2DEJA 5LMNI 4R8OA 1HNXE 4JV5E 3WU3A 1RREA 4DV5E 4DV2I 4LF4I 3J80Q 4Q28A 4DR5I 4BC9A 4KQVA 4FWGA 4GKKE 3KWRA 4UT4A 1N32E 1NZ0A 1FWLA 1FWKA 2WW4A 1HK7A 1X47A 3JTZA 3VYXA 4NXMI 2MC5A 1RQ0A 2M7QA 5LMUI 4WUBA 2UUCI 3QT5A 3P06A 2ODRD 3MSWA 3HULA 4P52A 2UXCE 3ZZUA 3B78A 3C4TA 2JWOA 3AUZA 2FV4B 1H7SA 4EMDA 2V87A 3PYEA 2ZM6I 2O1UA 2HFSA 4MYUA 4M2ZA 1FKAE 1IBLI 4WUCA 2V34A 2E5LE 3K17A 2Z5BB 4KHPI 2XEXA 4GEQB 4L5NC 4DV4I 4LF7I 4FWDA 2HK2A 4X66I 4P7AA 2PNLA 2IOQA 3PYGA 5IWAI 4RPFA 1O0WA 1NHJA 4WYQB 1D6TA 3CWVA 3T1HI 4DV7I 4X65I 4DV7E 3IWBA 1FNMA 3HJCA 4DR3I 1J26A 4IZJD 1J5EE 2L6MA 3ADIA 5AE3A 1Z0TA 4X66E 5IWAE 4DV0I 4X8WA 3F0NA 4KZSA 4JI4I 3J7AG 2DB2A 4DV4E 4LF7E 3H4LA 2E5LI 1Z59A 4DV3I 1ELOA 4GKJI 2BM1A 2JOXA 1USVA 2LTSA 2LBSB 1H7UA 4HACB 5BR8I 1XNQI 1IBME 4JYAI 2ZM6E 1NHHA 2UXCI 1Y4SA 2V89A 4OX9E 1Z5CA 3B82A 1IBKE 2DEIA 4JI5I 2Z5CB 1N0UA 2JOBA 2VQFE 3D4JA 3VYYA 3ADGA 1UHZA 2O1VA 3HTXA 4DR5E 4JI0I 2NUEA 2LE2A 4DR2E 1KIJA 1FI4A 4DU8A 4LF4E 4B3MI 1Z0EA 4DV2E 4PRXA 3M6AA 3HPZA 4DMIA 4DPUA 1EI1A 4B3RI 2B7TA 2Z5BA 3ZOQB 1X48A 4JI6I 4M0VA 5ADZA 5CFFE 2VQEE 2UUBI 4DR1I 3IWCA 4DR1E 1N33E 4LF5I 2UXBI 3PRYA 2EWLA 3LNUA 4HACA 4B3RE 2VQEI 2V8QB 4JI1E 3ZM7A 4LF6I 2F8BA 2UU9I 2BM0A 1FJGI 4WFTA 4BMJA 4JI0E 2E1RA 1XNRI 3LLHA 1XNRE 4NXNE 4TUGA 1DI2A 2FTXB 3PYFA 1HNZI 3LMLA 3RMPA 3ZKBA 2MC6A 4LF6E 4JI8E 3VK6A 5L3JA 1IBKI 1ZBTA 1Z0GA 4K0KI 1N33I 1XMOE 4LFCE 2A2DA 3V5RA 4JYAE 1EKZA 4DV6I 1Z5AA 3ADLA 4DR4I 1BKNA 2IOPA 4B3TE 3WU4A 3T1YE 2J7KA 2O1WA 4YHHE 4BC7A 4YY3I 4DXLA 4DUYE 4JI2I 1MU5A 2HKJA 2L3JA 4DV0E 4JI4E 2VQFI 2HKEA 4BS9A 4DR6E 4LFBE 1MX0A 1Z0CA 4AQYE 2AJ4A 4HY1A 3HQ1A 4JI3I 4JI3E 1XNQE 4DUZE 1H74A 4Z7CA 2R42A 2RSMA 2YT4A 5AE2A 1UILA 4L8NA 2HHHI 4HYMA 1Y6ZA 1WUUA 2LJHA 2JVAA 3WU6A 4URLA 4WSPA 2Z5CA 5A2QC 2LJPA 3LPSA 4R03A 1WXRA 4JI2E 4FW9A 2BV3A 2EFGA 4YHHI 2YZTA 5F3WA 3T1YI 2CZ9A 5AE1A 2CG9A 4ZVIA 3F6GA 3JU0A 4PU9A 2Q2EB 3JAMC 3K85A 2G7HA 5A2QQ 2KHXA 4B3SI 1XMOI 4AQYI 1N36I 3HPSA 1N32I 2F4VI 2VF1A 5T6JA 2M4IA 3IWDA 2N3HA 3J7AM 5AASA 3HXLA 1T4NA 4DUYI 2HFUA 4NXNI 2EZ6A 1B62A 4Z7YA 4B3TI 1FJGE 1XHKA 4JV5I 5LMNE 3B8HA 3J7Yp 3ZKDA 3F6HA 4DKKA 4DR7I 1S16A 2UUAI 1Z0WA 2CGEA 2R3VA 3QT7A 4K0KE 4XTJA 3OMLA 4LFAE 3V2UC 4DV1I 2L33A 1KTVA 2UUAE 1XMQE 4NXME 1N0VC 4DR7E 4MYTA 3DJWA 1PVGA 3Q6MA 2A2CA 1ZM4A 2VE7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWH A;  1H73 A;  1I94 E;  1N34 I;  3Q1Q A;  1UEK A;  1HNX I;  2LRS A;  1NHI A;  1YYO A;  4USK A;  2F4V E;  4FN5 A;  4PRV A;  3ADJ A;  4JG4 A;  4DV1 E;  3OTO E;  4OX9 I;  1T4L B;  1Z0V A;  4JI7 I;  1ZM9 A;  4DU7 A;  1RC7 A;  2CPN A;  4LF8 E;  1STU A;  4B3M E;  1U2R A;  4I3H A;  1PKP A;  1MG7 A;  2MDR A;  4WUD A;  2OI2 A;  4GKJ E;  4DV3 E;  1K47 A;  2NUG A;  1Z0B A;  1QZR A;  4DPY A;  5GME A;  4X64 E;  3WU5 A;  3K1J A;  1X49 A;  4JI5 E;  2HHH E;  1RR9 A;  1N36 E;  2L2K B;  4DUZ I;  1HNW E;  2ZIT A;  4X62 E;  4USM A;  2UXD I;  4X65 E;  4DR3 E;  4B3S E;  3ZZ0 A;  1IBM I;  1WHN A;  1OJ4 A;  1DAR A;  2B7V A;  1QU6 A;  2JY9 A;  1ZXM A;  2ZBK B;  1ZM3 A;  4DPT A;  2NUF A;  3C4B A;  4LF9 I;  1Z5B A;  2L2N A;  2VF3 A;  5GMD A;  2NPF A;  4LF9 E;  4KHP E;  1PIE A;  3J81 Q;  1EA6 A;  2RTX A;  1IBL E;  1J5E I;  4DR4 E;  2V2V A;  4DV6 E;  2NA2 A;  2RS6 A;  3T1H E;  1B63 A;  4LFC I;  2IHR 1;  4DPX A;  4OOG C;  2UXD E;  4X62 I;  4LFB I;  4DPW A;  4R1F A;  5LMU E;  2UUC E;  4DR6 I;  1HNZ E;  4X64 I;  1YYW A;  4M30 A;  2LUP B;  4HXZ A;  1S4E A;  4DV5 I;  4YY3 E;  3LTO A;  1T4O A;  2V2Z A;  4JI1 I;  5LL6 R;  5FLX Q;  1HR0 E;  3OTO I;  4JI7 E;  3QT8 A;  2V8P A;  1HNW I;  2L3C A;  2B3T B;  4JI6 E;  2HK3 A;  1WHQ A;  3J80 C;  1KKH A;  1VIS A;  4JI8 I;  4ED4 A;  4UTG A;  4GKK I;  2LUQ A;  1YZ9 A;  3J81 C;  1N34 E;  1I94 I;  1ZM2 A;  3P1X A;  4DR2 I;  3GON A;  1H72 C;  2RS7 A;  2UU9 E;  2DIX A;  3JAM Q;  3QT6 A;  5IT9 C;  1ZXN A;  4LF8 I;  1KVK A;  2L2M A;  1YYK A;  1GQE A;  2X36 A;  2V2Q A;  2N3G A;  2GS8 A;  1XMQ I;  2UXB E;  2LTR A;  2UUB E;  3ZZT A;  2X7I A;  2DMY A;  4LFA I;  4LF5 E;  3PYD A;  1HR0 I;  1A6F A;  5FLX C;  4M1K A;  5BR8 E;  5IT9 Q;  2DEJ A;  5LMN I;  1HNX E;  4JV5 E;  3WU3 A;  1RRE A;  4DV5 E;  4DV2 I;  4LF4 I;  3J80 Q;  4DR5 I;  4KQV A;  4FWG A;  4GKK E;  4UT4 A;  1N32 E;  1NZ0 A;  1FWL A;  1FWK A;  2WW4 A;  1X47 A;  3VYX A;  4NXM I;  1RQ0 A;  5LMU I;  4WUB A;  2UUC I;  3QT5 A;  3HUL A;  4P52 A;  2UXC E;  3ZZU A;  3B78 A;  3C4T A;  1H7S A;  4EMD A;  3PYE A;  2ZM6 I;  2HFS A;  4MYU A;  4M2Z A;  1FKA E;  1IBL I;  4WUC A;  2V34 A;  2E5L E;  3K17 A;  4KHP I;  2XEX A;  4DV4 I;  4LF7 I;  4FWD A;  2HK2 A;  4X66 I;  4P7A A;  3PYG A;  5IWA I;  4RPF A;  1O0W A;  1NHJ A;  4WYQ B;  1D6T A;  3CWV A;  3T1H I;  4DV7 I;  4X65 I;  4DV7 E;  1FNM A;  4DR3 I;  1J26 A;  1J5E E;  3ADI A;  1Z0T A;  4X66 E;  5IWA E;  4DV0 I;  4X8W A;  3F0N A;  4JI4 I;  3J7A G;  2DB2 A;  4DV4 E;  4LF7 E;  3H4L A;  2E5L I;  1Z59 A;  4DV3 I;  1ELO A;  4GKJ I;  2BM1 A;  2LTS A;  2LBS B;  1H7U A;  4HAC B;  5BR8 I;  1XNQ I;  1IBM E;  4JYA I;  2ZM6 E;  1NHH A;  2UXC I;  4OX9 E;  1Z5C A;  3B82 A;  1IBK E;  2DEI A;  4JI5 I;  1N0U A;  2VQF E;  3D4J A;  3VYY A;  3ADG A;  1UHZ A;  3HTX A;  4DR5 E;  4JI0 I;  2NUE A;  4DR2 E;  1KIJ A;  1FI4 A;  4DU8 A;  4LF4 E;  4B3M I;  1Z0E A;  4DV2 E;  4PRX A;  3M6A A;  4DPU A;  1EI1 A;  4B3R I;  2B7T A;  1X48 A;  4JI6 I;  5CFF E;  2VQE E;  2UUB I;  4DR1 I;  4DR1 E;  1N33 E;  4LF5 I;  2UXB I;  3LNU A;  4HAC A;  4B3R E;  2VQE I;  3ZM7 A;  4JI1 E;  4LF6 I;  2UU9 I;  2BM0 A;  1FJG I;  4WFT A;  4JI0 E;  2E1R A;  1XNR I;  3LLH A;  1XNR E;  4NXN E;  1DI2 A;  3PYF A;  1HNZ I;  3ZKB A;  4LF6 E;  4JI8 E;  5L3J A;  1IBK I;  1ZBT A;  1Z0G A;  4K0K I;  1N33 I;  1XMO E;  4LFC E;  2A2D A;  3V5R A;  4JYA E;  1EKZ A;  4DV6 I;  1Z5A A;  3ADL A;  4DR4 I;  1BKN A;  3WU4 A;  4B3T E;  3T1Y E;  2J7K A;  4YHH E;  4YY3 I;  4DXL A;  4DUY E;  4JI2 I;  1MU5 A;  2HKJ A;  2L3J A;  4DV0 E;  4JI4 E;  2VQF I;  2HKE A;  4DR6 E;  4LFB E;  1MX0 A;  1Z0C A;  4AQY E;  2AJ4 A;  4HY1 A;  4JI3 I;  4JI3 E;  1XNQ E;  4DUZ E;  1H74 A;  4Z7C A;  2R42 A;  2RSM A;  2YT4 A;  1UIL A;  2HHH I;  4HYM A;  1WUU A;  2LJH A;  2JVA A;  3WU6 A;  4URL A;  5A2Q C;  2LJP A;  3LPS A;  4JI2 E;  4FW9 A;  2BV3 A;  2EFG A;  4YHH I;  3T1Y I;  2CZ9 A;  4ZVI A;  4PU9 A;  2Q2E B;  3JAM C;  5A2Q Q;  2KHX A;  4B3S I;  1XMO I;  4AQY I;  1N36 I;  1N32 I;  2F4V I;  2N3H A;  3J7A M;  1T4N A;  4DUY I;  2HFU A;  4NXN I;  2EZ6 A;  1B62 A;  4Z7Y A;  4B3T I;  1FJG E;  1XHK A;  4JV5 I;  5LMN E;  3B8H A;  3J7Y p;  3ZKD A;  4DKK A;  4DR7 I;  1S16 A;  2UUA I;  1Z0W A;  2R3V A;  3QT7 A;  4K0K E;  4XTJ A;  4LFA E;  3V2U C;  4DV1 I;  2L33 A;  1KTV A;  2UUA E;  1XMQ E;  4NXM E;  1N0V C;  4DR7 E;  4MYT A;  1PVG A;  2A2C A;  1ZM4 A; 
#chains in the Genus database with same CATH topology
 4MU4 A;  2B9D A;  2LVH A;  1H73 A;  4FWH A;  4J3D A;  1I94 E;  3M85 D;  1N34 I;  2V88 A;  4IZJ A;  2PO1 B;  3Q1Q A;  4IFD D;  1UEK A;  2DMI A;  1HNX I;  2LRS A;  5EL9 A;  1VI7 A;  2O1T A;  2YWQ A;  4LFB I;  1A1I A;  2EMH A;  1NHI A;  1NEI A;  1SR9 A;  1YYO A;  4USK A;  4IFD E;  2F4V E;  2MKN A;  1NCS A;  3THN A;  2VES A;  4FN5 A;  4PRV A;  3M7N G;  2EPZ A;  3ADJ A;  4JG4 A;  4FW7 A;  4DV1 E;  2BA1 G;  4WX9 A;  3OTO E;  2EMA A;  5ELW A;  4OX9 I;  1T4L B;  1Z0V A;  2JE6 B;  4JI7 I;  1RHY A;  1ZM9 A;  2YTF A;  4BCA A;  2BR2 A;  4DU7 A;  2KON A;  1RC7 A;  2CPN A;  4LF8 E;  5DNY A;  1STU A;  2MDG A;  2BA1 D;  4B3M E;  1P47 A;  2EN6 A;  1U2R A;  2YTQ A;  3Q6N A;  4I3H A;  2EM4 A;  1PKP A;  1DGC A;  1MG7 A;  5JEA E;  2PO1 A;  2EQ1 A;  2MDR A;  4WUD A;  2OI2 A;  2V85 A;  4GKJ E;  4LOM A;  2NN6 A;  1LLM C;  2GO3 A;  4DV3 E;  2EOF A;  2IES A;  2JR1 A;  1K47 A;  4QNJ A;  2H36 X;  2NUG A;  1Z0B A;  2YRK A;  1QZR A;  2RSI A;  4I8O A;  5GME A;  4DPY A;  4X64 E;  3WU5 A;  1ZBQ A;  1X49 A;  3K1J A;  4JI5 E;  1F2I G;  4IZJ B;  2HHH E;  1RR9 A;  2PO0 A;  4LTY A;  2BA0 D;  1N36 E;  1X5W A;  2O3Z A;  1SFE A;  2L2K B;  4F6M A;  1HNW E;  2ZIT A;  4DUZ I;  4X62 E;  5A69 A;  4USM A;  2EOR A;  2UXD I;  4X65 E;  4DR3 E;  4ZYG A;  4B3S E;  3ZZ0 A;  1IBM I;  1WHN A;  2CTD A;  1OJ4 A;  2L8T A;  4WXC A;  1DAR A;  2B7V A;  2J65 A;  1QU6 A;  2JY9 A;  4F9A B;  5AC4 A;  5JEA C;  3AV0 A;  5K36 E;  2GHF A;  2YTJ A;  4MDT A;  1ZXM A;  2ZBK B;  3BGH A;  4FW5 A;  1ZM3 A;  4DPT A;  5IXM B;  2NUF A;  4WPY A;  3C4B A;  1TF3 A;  2EM0 A;  4LF9 I;  4AID A;  2EQ3 A;  1Z5B A;  2ELZ A;  2C38 B;  2L2N A;  2VF3 A;  4X9J A;  1TF6 A;  5GMD A;  1G2D C;  2NPF A;  2EPO A;  4LF9 E;  2PNM A;  3K6Q A;  4FK5 C;  4KHP E;  1PIE A;  3J81 Q;  1EA6 A;  4O24 A;  2EPL X;  1BBG A;  2YRM A;  2RTX A;  2YU8 A;  2V83 A;  2E1M A;  1IBL E;  4P7D A;  4DR4 E;  1J5E I;  5A6A A;  2ENH A;  4F9B B;  2V2V A;  2KOU A;  4DV6 E;  5DRQ A;  2NA2 A;  2EJ4 A;  2RS6 A;  2YTN A;  3T1H E;  1B63 A;  2EMX A;  2EOH A;  4LFC I;  2IHR 1;  2PO0 B;  4DPX A;  2FGG A;  2Z5E A;  4OOG C;  1T38 A;  4R2D A;  2UXD E;  1OYP A;  2L92 A;  4X62 I;  3U1Y A;  4DPW A;  4R1F A;  2EOX A;  4IFD A;  2EM6 A;  5LMU E;  4GZN C;  2UUC E;  1GZ6 A;  1PJQ A;  1WJP A;  2EOS A;  3DF6 A;  4LU9 A;  2I13 A;  2EL5 A;  2EOM A;  3THO B;  5K36 A;  1UBD C;  4DR6 I;  1HNZ E;  4X64 I;  4BBY A;  4AM3 A;  1DQ3 A;  1X3C A;  2CSH A;  1YYW A;  2JE6 A;  4U3B A;  2LMZ A;  4OO1 C;  4M30 A;  2LUP B;  1ZAA C;  2BR2 B;  3KZY A;  2F1D A;  1S4E A;  4R2C A;  4HXZ A;  4DV5 I;  4YY3 E;  4J8Z A;  3LTO A;  2K4V A;  1T4O A;  2V2Z A;  1BBO A;  5K36 C;  3PS2 A;  5FWK A;  3BBG A;  4IJD A;  3CDI A;  1MEY C;  2EPP A;  4N3O A;  4P78 A;  1Y60 A;  4JI1 I;  2EE8 A;  5LL6 R;  3BF2 A;  3GLL A;  5FLX Q;  1HR0 E;  2DSY A;  3OTO I;  1A1H A;  1A1F A;  1Y4U A;  4JI7 E;  2HJJ A;  3QT8 A;  2V8P A;  1HNW I;  3FIG A;  2L3C A;  1AAY A;  2B3T B;  2EMC A;  2JT2 A;  4JI6 E;  2YSO A;  2HK3 A;  2WBS A;  1WHQ A;  3J80 C;  1KKH A;  2EML A;  1ZR9 A;  1VIS A;  4JI8 I;  2EMI A;  4ED4 A;  2EOQ A;  2WZO A;  2RQL A;  3P3C A;  4UTG A;  4GKK I;  2LUQ A;  1YZ9 A;  3J81 C;  3PS1 A;  4TUI A;  1N34 E;  2DRP A;  1I94 I;  1ZM2 A;  3P1X A;  4DR2 I;  4ZYH A;  2GQ0 A;  3GON A;  4OO1 D;  5KL3 A;  1H72 C;  5K36 B;  2YTG A;  2YPN A;  2RS7 A;  4IZK A;  2BBG A;  2UU9 E;  4IZK B;  2BB8 A;  2DIX A;  1YSA C;  3JAM Q;  3QT6 A;  3H09 A;  4RHB B;  2LJU A;  5IT9 C;  1ZXN A;  4LF8 I;  1KVK A;  2EMW A;  3DD6 A;  2L2M A;  1YYK A;  1GQE A;  2X36 A;  4OO1 F;  2V2Q A;  2EN2 A;  3ECR A;  2N3G A;  2ODR C;  1N3G A;  2C38 A;  2EPK X;  2GS8 A;  2UXB E;  1XMQ I;  2LTR A;  4F54 A;  4F9C B;  2R1F A;  2UUB E;  3ZZT A;  2X7I A;  4WSG A;  2DMY A;  3VHT B;  4LFA I;  4LF5 E;  2M1S A;  2JEA A;  3PYD A;  2YTE A;  1A6F A;  5FLX C;  1HR0 I;  4M1K A;  5BR8 E;  4R2R A;  2ENA A;  2V86 A;  2EPX A;  1USU A;  5IT9 Q;  2DEJ A;  4BA2 B;  3GCM A;  4R8O A;  1HNX E;  4JV5 E;  5LMN I;  2AE8 A;  2EM5 A;  3WU3 A;  1RRE A;  4DV5 E;  4DV2 I;  2EP3 A;  5DNX A;  4LF4 I;  2WCC 3;  4Q28 A;  3J80 Q;  4BC9 A;  4DR5 I;  2HC5 A;  2YTO A;  4KQV A;  4FWG A;  1IQS A;  2NN6 E;  4OO1 B;  4GKK E;  1JK2 A;  3KWR A;  1Y5Y A;  4OZE A;  1N32 E;  1NZ0 A;  4UT4 A;  2DLK A;  2D9H A;  1FWL A;  1FWK A;  2WW4 A;  1HK7 A;  5DRR A;  1X47 A;  3EQ1 A;  3JTZ A;  3VYX A;  2MC5 A;  5C0X E;  4NXM I;  2EMZ A;  3EPH A;  1RQ0 A;  2M7Q A;  5LMU I;  4WUB A;  5JEA D;  2UUC I;  3QT5 A;  3UK3 C;  3P06 A;  2ODR D;  3MSW A;  2JPA A;  3HUL A;  4P52 A;  2UXC E;  3ZZU A;  3B78 A;  3C4T A;  2JWO A;  3AUZ A;  2FV4 B;  1H7S A;  4EMD A;  2V87 A;  3PYE A;  2ZM6 I;  2EN7 A;  2MKD A;  5C0X C;  1YFH A;  2O1U A;  2HFS A;  4MYU A;  5DNL A;  4M2Z A;  4IS9 A;  1FKA E;  2E72 A;  3EPL A;  4WUC A;  1IBL I;  4MQY A;  2V34 A;  5AC5 A;  2E5L E;  3K17 A;  2Z5B B;  2EPC A;  2XEX A;  4KHP I;  1A1J A;  4GEQ B;  4L5N C;  4LPF A;  4ZYD A;  3EPJ A;  4JI6 I;  4DV4 I;  4MLV A;  4LF7 I;  4FWD A;  2EOI A;  2HK2 A;  4X66 I;  4P7A A;  2WBT A;  5KL5 A;  2HGH A;  2PNL A;  2IOQ A;  3PYG A;  4R2A A;  4RPF A;  5IWA I;  1BB8 A;  5A6K A;  1R6M A;  1O0W A;  1NHJ A;  4WYQ B;  1D6T A;  3CWV A;  4N4R B;  3T1H I;  4DV7 I;  4LCF A;  4X65 I;  4DV7 E;  3IWB A;  1FNM A;  3HJC A;  4DR3 I;  2GPI A;  1J26 A;  2YTI A;  4IZJ D;  1J5E E;  1OYR A;  2WNR B;  2K7I A;  2L6M A;  2LCE A;  5AE3 A;  3ADI A;  1Z0T A;  4X66 E;  5IWA E;  3GME A;  4DV0 I;  4F6N A;  4X8W A;  2EMK A;  1A1K A;  1E3P A;  4OKG A;  3F0N A;  4KZS A;  4JI4 I;  5LLQ A;  4FW4 A;  3C6M A;  3J7A G;  1IMU A;  3KZZ A;  2EOO A;  1L4S A;  2DB2 A;  4DV4 E;  4LF7 E;  2JEB B;  3H4L A;  4FW3 A;  2E5L I;  1Z59 A;  4DV3 I;  4IFD C;  2EQ0 A;  1ELO A;  4GKJ I;  2BM1 A;  2JOX A;  2WBU A;  4O4K A;  2EL4 A;  1USV A;  2LTS A;  1UDS A;  2LBS B;  2EM7 A;  2EM2 A;  2M9A A;  1H7U A;  3CDJ A;  4HAC B;  2EN8 A;  5BR8 I;  1AH5 A;  1UN6 B;  1IBM E;  1XNQ I;  4JYA I;  2ZM6 E;  2EM9 A;  1NHH A;  3U1K A;  2UXC I;  1Y4S A;  4KWY A;  2WNR A;  3B4T A;  2V89 A;  4OO1 A;  1UDQ A;  4OX9 E;  1Z5C A;  2CVE A;  3B82 A;  4GQU A;  1IBK E;  1IQO A;  2DEI A;  5A6B A;  5C0X B;  4JI5 I;  2YRH A;  3P76 A;  2Z5C B;  1N0U A;  2JOB A;  2VQF E;  3D4J A;  1G2F C;  2JEB A;  5A6B D;  1A1L A;  3VYY A;  3KRN A;  3PS3 A;  3ADG A;  1UHZ A;  4MU0 A;  2O1V A;  3HTX A;  4DR5 E;  4JI0 I;  2EN3 A;  2EPM X;  2NUE A;  4O43 A;  3H1C A;  1X6E A;  2LE2 A;  4DR2 E;  1KIJ A;  1FI4 A;  4FW6 A;  4DU8 A;  4LF4 E;  4B3M I;  1PDA A;  1Z0E A;  1YPN A;  4DV2 E;  4PRX A;  2DGC A;  2EMY A;  3M6A A;  3HPZ A;  4DMI A;  5DRP A;  4DPU A;  1EI1 A;  4B3R I;  2B7T A;  2Z5B A;  3ZOQ B;  1X48 A;  1YUI A;  3M99 B;  4M0V A;  5ADZ A;  5CFF E;  2VQE E;  2CT1 A;  2EOE A;  3P3E A;  4DR1 I;  2UUB I;  2EN1 A;  3IWC A;  4R2Q A;  4DR1 E;  1ZU1 A;  1JK1 A;  1N33 E;  4LF5 I;  2EL6 A;  3PRY A;  2UXB I;  2EWL A;  3LNU A;  4HAC A;  2ENC A;  2LO3 A;  4B3R E;  2VQE I;  2V8Q B;  4JI1 E;  3ZM7 A;  4LF6 I;  2DLQ A;  2F8B A;  2UU9 I;  2EMG A;  2BM0 A;  2GLI A;  1FJG I;  1EH6 A;  2EPN A;  4WFT A;  4BMJ A;  4JI0 E;  2E1R A;  2WP8 A;  1XNR I;  3LLH A;  2ELY A;  3MHH C;  1XNR E;  4NXN E;  4TUG A;  1XXE A;  1B69 A;  1DI2 A;  2GO4 A;  2JEA B;  3M7N D;  4R2S A;  2FTX B;  4IFD B;  3PYF A;  1HNZ I;  5EKW A;  3LML A;  3BID A;  3RMP A;  1WRJ A;  2EPA A;  4ISA A;  1EH7 A;  2MC6 A;  3ZKB A;  5KL6 A;  4LF6 E;  4BA2 A;  4MU3 A;  4JI8 E;  3HKM A;  3M85 G;  3UHM A;  5TSE A;  3VK6 A;  5L3J A;  1IBK I;  5KL2 A;  1ZBT A;  1Z0G A;  2NN6 C;  4K0K I;  1N33 I;  1XMO E;  1YUJ A;  5KL7 A;  3NZK A;  3L7Z A;  4LFC E;  2A2D A;  3V5R A;  4JYA E;  1EKZ A;  2NN6 F;  4DV6 I;  1Z5A A;  3ADL A;  4DR4 I;  4NBQ A;  1BKN A;  2IOP A;  4B3T E;  3WU4 A;  2YTP A;  3T1Y E;  2J7K A;  4IFD F;  1R6L A;  2O1W A;  5C0X F;  4YHH E;  4BC7 A;  4MLQ A;  4YY3 I;  4BHB A;  4DXL A;  1X6F A;  4DUY E;  4JI2 I;  4RH8 A;  2C37 B;  1MU5 A;  2HKJ A;  5K36 F;  2L3J A;  3P3G A;  2J7J A;  4DV0 E;  3QG5 C;  5C0X A;  4O5G A;  4JI4 E;  5JEA B;  2VQF I;  5JEA A;  2HKE A;  2WP8 B;  2EPU A;  4BS9 A;  4DR6 E;  1YH8 A;  2ADR A;  2A25 A;  4Q35 B;  4LFB E;  1PJS A;  1MX0 A;  1Z0C A;  4AQY E;  3MHS C;  2AJ4 A;  1OYS A;  1EH8 A;  4HY1 A;  5JEA F;  3HQ1 A;  4JI3 I;  2PO2 B;  4JI3 E;  1PJT A;  1XNQ E;  4DUZ E;  2EOZ A;  1YHC A;  1H74 A;  4Z7C A;  2R42 A;  2RSM A;  2YT4 A;  5AE2 A;  1UIL A;  2N8X A;  4L8N A;  5A6J A;  3L7Z B;  1QNT A;  1WUU A;  1Y6Z A;  4HYM A;  2HHH I;  2LJH A;  2JVA A;  2EMF A;  3WU6 A;  2Q8U A;  4URL A;  4WSP A;  2Z5C A;  4BHC A;  4ZYE A;  5A2Q C;  2LJP A;  3LPS A;  4R03 A;  1WXR A;  2EM8 A;  4JI2 E;  4FW9 A;  5IV8 B;  2BV3 A;  2C39 A;  2EN4 A;  2EFG A;  2YZT A;  4YHH I;  5F3W A;  2C37 A;  4LCG A;  3T1Y I;  3TQM A;  2CZ9 A;  5AE1 A;  5KL4 A;  2CG9 A;  4U3D A;  1KYQ A;  2I9I A;  1X6H A;  4ZVI A;  3F6G A;  3JU0 A;  4PU9 A;  1A1G A;  2Q2E B;  3JAM C;  5C0X D;  4QNK A;  3K85 A;  2G7H A;  5A2Q Q;  2KHX A;  4BA1 A;  4B3S I;  1RMD A;  4AQY I;  1XMO I;  2EOY A;  1E3H A;  1Z1B A;  2NN6 D;  5K36 D;  2R76 A;  1N36 I;  2NAB A;  2JYA A;  3HPS A;  2PO2 A;  1N32 I;  2F4V I;  2VF1 A;  5T6J A;  2M4I A;  3IWD A;  3EPK A;  2N3H A;  3J7A M;  1GTK A;  1KJK A;  5AAS A;  2C39 B;  4WXD A;  3HXL A;  2PNZ B;  1T4N A;  4DUY I;  2HFU A;  4NHR A;  4F2J C;  2EZ6 A;  4NXN I;  4MU1 A;  5DRO A;  2PRT A;  2JP9 A;  1B62 A;  4Z7Y A;  4B3T I;  4LCH A;  1FJG E;  1XHK A;  4HTG A;  4JV5 I;  5LMN E;  3B8H A;  3J7Y p;  3C6K A;  2LV2 A;  2YSP A;  3F6H A;  4DKK A;  1UDO A;  3ZKD A;  2EMB A;  4AIM A;  4BA1 B;  4DR7 I;  4R2E A;  2EPR A;  1S16 A;  2UUA I;  1Z0W A;  2CGE A;  2R3V A;  4NZV A;  2EM3 A;  1P42 A;  3QT7 A;  4K0K E;  4R2P A;  2VRD A;  1TN9 A;  1UDN A;  3L00 A;  3OML A;  4LFA E;  4XTJ A;  3V2U C;  4DV1 I;  2YU5 A;  2L33 A;  1MGT A;  4HEI A;  1KTV A;  2LT7 A;  2UUA E;  1XMQ E;  2JXP A;  4NXM E;  1N0V C;  2EOJ A;  4M9V C;  4DR7 E;  4MYT A;  2NN6 B;  4OO1 E;  2RPC A;  2YTD A;  4IS1 C;  1T39 A;  2PNZ A;  3DJW A;  1PVG A;  3Q6M A;  2A2C A;  2BA0 G;  2IER A;  1ZM4 A;  2VE7 C; 
#chains in the Genus database with same CATH homology
 2B9D A;  4FWH A;  1H73 A;  1I94 E;  1N34 I;  3Q1Q A;  2V88 A;  4IZJ A;  1UEK A;  1HNX I;  2LRS A;  2O1T A;  1NHI A;  1YYO A;  1SR9 A;  4USK A;  2F4V E;  4FN5 A;  4PRV A;  3ADJ A;  4JG4 A;  4DV1 E;  3OTO E;  4OX9 I;  1T4L B;  1Z0V A;  4JI7 I;  1ZM9 A;  4BCA A;  4DU7 A;  2KON A;  1RC7 A;  2CPN A;  4LF8 E;  5DNY A;  1STU A;  4B3M E;  1U2R A;  3Q6N A;  4I3H A;  1PKP A;  1MG7 A;  2MDR A;  4WUD A;  2OI2 A;  2V85 A;  4GKJ E;  4DV3 E;  2JR1 A;  1K47 A;  2H36 X;  2NUG A;  1Z0B A;  1QZR A;  4DPY A;  5GME A;  4I8O A;  4X64 E;  3WU5 A;  1ZBQ A;  1X49 A;  3K1J A;  4JI5 E;  4IZJ B;  2HHH E;  1RR9 A;  4LTY A;  1N36 E;  2L2K B;  4DUZ I;  1HNW E;  2ZIT A;  4X62 E;  4USM A;  2UXD I;  4X65 E;  4DR3 E;  4B3S E;  3ZZ0 A;  1IBM I;  1WHN A;  1OJ4 A;  2L8T A;  1DAR A;  2B7V A;  1QU6 A;  2JY9 A;  4F9A B;  3AV0 A;  1ZXM A;  2ZBK B;  1ZM3 A;  4DPT A;  2NUF A;  4WPY A;  3C4B A;  4LF9 I;  1Z5B A;  2L2N A;  2VF3 A;  5GMD A;  2NPF A;  4LF9 E;  2PNM A;  3K6Q A;  4KHP E;  1PIE A;  3J81 Q;  1EA6 A;  2RTX A;  2V83 A;  2E1M A;  1IBL E;  4P7D A;  4DR4 E;  1J5E I;  4F9B B;  2V2V A;  2KOU A;  4DV6 E;  2NA2 A;  2RS6 A;  3T1H E;  1B63 A;  4LFC I;  2IHR 1;  4DPX A;  2FGG A;  2Z5E A;  4OOG C;  2UXD E;  4X62 I;  4LFB I;  2L92 A;  4DPW A;  4R1F A;  5LMU E;  2UUC E;  1GZ6 A;  3DF6 A;  4LU9 A;  4DR6 I;  1HNZ E;  4X64 I;  4BBY A;  1DQ3 A;  1YYW A;  2LMZ A;  4M30 A;  2LUP B;  4HXZ A;  1S4E A;  4DV5 I;  4YY3 E;  4J8Z A;  3LTO A;  2K4V A;  1T4O A;  2V2Z A;  5FWK A;  4N3O A;  4P78 A;  4JI1 I;  5LL6 R;  5FLX Q;  1HR0 E;  2DSY A;  3OTO I;  1Y4U A;  4JI7 E;  3QT8 A;  2V8P A;  1HNW I;  3FIG A;  2L3C A;  2B3T B;  4JI6 E;  2HK3 A;  1WHQ A;  3J80 C;  1KKH A;  1VIS A;  4JI8 I;  4ED4 A;  2WZO A;  4UTG A;  4GKK I;  2LUQ A;  1YZ9 A;  3J81 C;  4TUI A;  1N34 E;  1I94 I;  1ZM2 A;  3P1X A;  4DR2 I;  2GQ0 A;  3GON A;  1H72 C;  2RS7 A;  4IZK A;  2UU9 E;  4IZK B;  2DIX A;  3JAM Q;  3QT6 A;  3H09 A;  5IT9 C;  1ZXN A;  4LF8 I;  1KVK A;  2L2M A;  1YYK A;  1GQE A;  2X36 A;  2V2Q A;  2N3G A;  2ODR C;  2GS8 A;  1XMQ I;  2UXB E;  2LTR A;  4F54 A;  4F9C B;  2UUB E;  3ZZT A;  2X7I A;  2DMY A;  4LFA I;  4LF5 E;  2M1S A;  3PYD A;  1HR0 I;  1A6F A;  5FLX C;  4M1K A;  5BR8 E;  2V86 A;  5IT9 Q;  1USU A;  2DEJ A;  5LMN I;  4R8O A;  1HNX E;  4JV5 E;  3WU3 A;  1RRE A;  4DV5 E;  4DV2 I;  4LF4 I;  3J80 Q;  4Q28 A;  4DR5 I;  4BC9 A;  4KQV A;  4FWG A;  4GKK E;  3KWR A;  4UT4 A;  1N32 E;  1NZ0 A;  1FWL A;  1FWK A;  2WW4 A;  1HK7 A;  1X47 A;  3JTZ A;  3VYX A;  4NXM I;  2MC5 A;  1RQ0 A;  2M7Q A;  5LMU I;  4WUB A;  2UUC I;  3QT5 A;  3P06 A;  2ODR D;  3MSW A;  3HUL A;  4P52 A;  2UXC E;  3ZZU A;  3B78 A;  3C4T A;  2JWO A;  3AUZ A;  2FV4 B;  1H7S A;  4EMD A;  2V87 A;  3PYE A;  2ZM6 I;  2O1U A;  2HFS A;  4MYU A;  4M2Z A;  1FKA E;  1IBL I;  4WUC A;  2V34 A;  2E5L E;  3K17 A;  2Z5B B;  4KHP I;  2XEX A;  4GEQ B;  4L5N C;  4DV4 I;  4LF7 I;  4FWD A;  2HK2 A;  4X66 I;  4P7A A;  2PNL A;  2IOQ A;  3PYG A;  5IWA I;  4RPF A;  1O0W A;  1NHJ A;  4WYQ B;  1D6T A;  3CWV A;  3T1H I;  4DV7 I;  4X65 I;  4DV7 E;  3IWB A;  1FNM A;  3HJC A;  4DR3 I;  1J26 A;  4IZJ D;  1J5E E;  2L6M A;  3ADI A;  5AE3 A;  1Z0T A;  4X66 E;  5IWA E;  4DV0 I;  4X8W A;  3F0N A;  4KZS A;  4JI4 I;  3J7A G;  2DB2 A;  4DV4 E;  4LF7 E;  3H4L A;  2E5L I;  1Z59 A;  4DV3 I;  1ELO A;  4GKJ I;  2BM1 A;  2JOX A;  1USV A;  2LTS A;  2LBS B;  1H7U A;  4HAC B;  5BR8 I;  1XNQ I;  1IBM E;  4JYA I;  2ZM6 E;  1NHH A;  2UXC I;  1Y4S A;  2V89 A;  4OX9 E;  1Z5C A;  3B82 A;  1IBK E;  2DEI A;  4JI5 I;  2Z5C B;  1N0U A;  2JOB A;  2VQF E;  3D4J A;  3VYY A;  3ADG A;  1UHZ A;  2O1V A;  3HTX A;  4DR5 E;  4JI0 I;  2NUE A;  2LE2 A;  4DR2 E;  1KIJ A;  1FI4 A;  4DU8 A;  4LF4 E;  4B3M I;  1Z0E A;  4DV2 E;  4PRX A;  3M6A A;  3HPZ A;  4DMI A;  4DPU A;  1EI1 A;  4B3R I;  2B7T A;  2Z5B A;  3ZOQ B;  1X48 A;  4JI6 I;  4M0V A;  5ADZ A;  5CFF E;  2VQE E;  2UUB I;  4DR1 I;  3IWC A;  4DR1 E;  1N33 E;  4LF5 I;  2UXB I;  3PRY A;  2EWL A;  3LNU A;  4HAC A;  4B3R E;  2VQE I;  2V8Q B;  4JI1 E;  3ZM7 A;  4LF6 I;  2F8B A;  2UU9 I;  2BM0 A;  1FJG I;  4WFT A;  4BMJ A;  4JI0 E;  2E1R A;  1XNR I;  3LLH A;  1XNR E;  4NXN E;  4TUG A;  1DI2 A;  2FTX B;  3PYF A;  1HNZ I;  3LML A;  3RMP A;  3ZKB A;  2MC6 A;  4LF6 E;  4JI8 E;  3VK6 A;  5L3J A;  1IBK I;  1ZBT A;  1Z0G A;  4K0K I;  1N33 I;  1XMO E;  4LFC E;  2A2D A;  3V5R A;  4JYA E;  1EKZ A;  4DV6 I;  1Z5A A;  3ADL A;  4DR4 I;  1BKN A;  2IOP A;  4B3T E;  3WU4 A;  3T1Y E;  2J7K A;  2O1W A;  4YHH E;  4BC7 A;  4YY3 I;  4DXL A;  4DUY E;  4JI2 I;  1MU5 A;  2HKJ A;  2L3J A;  4DV0 E;  4JI4 E;  2VQF I;  2HKE A;  4BS9 A;  4DR6 E;  4LFB E;  1MX0 A;  1Z0C A;  4AQY E;  2AJ4 A;  4HY1 A;  3HQ1 A;  4JI3 I;  4JI3 E;  1XNQ E;  4DUZ E;  1H74 A;  4Z7C A;  2R42 A;  2RSM A;  2YT4 A;  5AE2 A;  1UIL A;  4L8N A;  2HHH I;  4HYM A;  1Y6Z A;  1WUU A;  2LJH A;  2JVA A;  3WU6 A;  4URL A;  4WSP A;  2Z5C A;  5A2Q C;  2LJP A;  3LPS A;  4R03 A;  1WXR A;  4JI2 E;  4FW9 A;  2BV3 A;  2EFG A;  4YHH I;  2YZT A;  5F3W A;  3T1Y I;  2CZ9 A;  5AE1 A;  2CG9 A;  4ZVI A;  3F6G A;  3JU0 A;  4PU9 A;  2Q2E B;  3JAM C;  3K85 A;  2G7H A;  5A2Q Q;  2KHX A;  4B3S I;  1XMO I;  4AQY I;  1N36 I;  3HPS A;  1N32 I;  2F4V I;  2VF1 A;  5T6J A;  2M4I A;  3IWD A;  2N3H A;  3J7A M;  5AAS A;  3HXL A;  1T4N A;  4DUY I;  2HFU A;  4NXN I;  2EZ6 A;  1B62 A;  4Z7Y A;  4B3T I;  1FJG E;  1XHK A;  4JV5 I;  5LMN E;  3B8H A;  3J7Y p;  3ZKD A;  3F6H A;  4DKK A;  4DR7 I;  1S16 A;  2UUA I;  1Z0W A;  2CGE A;  2R3V A;  3QT7 A;  4K0K E;  4XTJ A;  3OML A;  4LFA E;  3V2U C;  4DV1 I;  2L33 A;  1KTV A;  2UUA E;  1XMQ E;  4NXM E;  1N0V C;  4DR7 E;  4MYT A;  3DJW A;  1PVG A;  3Q6M A;  2A2C A;  1ZM4 A;  2VE7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...