2UXBE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbE02
1N33I 1HNWE 1XMQI 3QT6A 2V34A 4RPFA 2HK2A 2ZM6E 1XNRE 1MG7A 4DPUA 1HR0E 4YY3E 4JI3E 3JAMQ 4Z7CA 5A2QC 1NHJA 2UXCE 2DMYA 2XEXA 4ED4A 2NUGA 1N34I 2JVAA 1FWLA 4FW9A 2N3GA 4GKKI 4AQYI 1J5EI 2UUCI 3VYXA 2RSMA 3K17A 4LF7I 4DKKA 4JI7E 4DUZI 2L33A 1HNZE 4JG4A 2LUQA 3ADGA 3T1YI 3LPSA 2J7KA 3ZZ0A 1N36E 5CFFE 4LF4E 4LF9I 2HK3A 4XTJA 4YHHE 1Z0EA 4KHPE 4JI4I 4B3TI 4X64E 4DV0E 1NHIA 4B3MI 2NA2A 4X66I 4M1KA 4LFBE 4DV2E 2R3VA 2ZBKB 2JY9A 3C4TA 4WUCA 1FWKA 2WW4A 4B3RE 4USKA 1QU6A 5BR8E 1VISA 4JYAI 2KHXA 2CZ9A 4DR6I 2V2ZA 1I94I 4WYQB 4DPTA 1XHKA 5IWAI 3LLHA 1WHNA 1YYKA 1IBLI 4LF8I 2UUBI 3ADJA 4DU7A 1UILA 1PKPA 3J7AM 4X65E 1ZBTA 4DUYE 4DV6E 2DEJA 4Z7YA 1IBKE 3Q1QA 4FN5A 1EKZA 3F0NA 3V5RA 4PRVA 1Z0BA 4JI6I 2R42A 4KQVA 4DV4I 5L3JA 1GQEA 1Z0VA 4DV1E 1DI2A 1KTVA 4FWDA 4LFAI 1KKHA 1PVGA 2UXBE 4JI1E 2HFUA 4DV5E 4JI2I 3P1XA 1XNQI 3K1JA 3H4LA 3J80Q 2EZ6A 1ZXMA 1ZM4A 2L2NA 1S16A 1B62A 2BM0A 1H72C 4JI5E 1FJGI 3QT8A 2E5LE 4DV3E 2BM1A 2L2MA 4LFCI 4DR2I 1FKAE 2N3HA 4B3SI 2UUAE 3V2UC 1OJ4A 1IBMI 1B63A 1STUA 2UU9E 1X48A 4P52A 2B7VA 5LMUE 2HHHE 1Z5BA 1RC7A 1H73A 3CWVA 1XMOI 1KIJA 2F4VI 4HXZA 1HNXE 4X62I 1Z0GA 2Q2EB 3WU3A 3LNUA 2B7TA 3J80C 4R1FA 1O0WA 2GS8A 2A2DA 4NXNE 4GKJE 4LF6I 1FNMA 1N33E 4OX9I 2E1RA 1XMQE 3B78A 3PYFA 2CPNA 1N0VC 4K0KI 1U2RA 4FWGA 4M2ZA 4DR3I 4DR4I 2DB2A 1KVKA 1H7UA 4JI8I 4ZVIA 2HKJA 1YYWA 2VQFI 3OTOI 4X8WA 1N34E 4WUBA 4GKKE 5IT9Q 4AQYE 2UUCE 1J5EE 1NZ0A 4DR7I 2VQEI 4LF7E 1UHZA 2B3TB 3QT7A 3WU6A 4DUZE 1H7SA 2LJHA 4HYMA 5LMNI 4JI0I 4NXMI 4JV5I 3WU4A 2NPFA 3T1YE 1ZXNA 2RS7A 4LF9E 2V2QA 4DV7I 4UTGA 5FLXC 1T4OA 1N32I 3T1HI 4DR1I 4DR5I 5GMEA 4JI4E 3D4JA 2UXDI 4LF5I 4B3TE 1DARA 4B3ME 1HNWI 4X66E 1EA6A 3B8HA 3QT5A 3ADIA 2IHR1 2X7IA 2ZM6I 1XNRI 2HFSA 2RTXA 1HR0I 4YY3I 4JI3I 1Z0CA 5IT9C 4JYAE 4DR6E 1D6TA 3VYYA 3HTXA 1T4NA 2L2KB 1MX0A 1I94E 2UXCI 1WUUA 1Z0TA 5IWAE 3ADLA 1Z5AA 1PIEA 1IBLE 4MYTA 4LF8E 2UUBE 3WU5A 2LTSA 4JI7I 1HNZI 1NHHA 3M6AA 4DPWA 4URLA 2L3CA 2BV3A 2AJ4A 1N36I 4LF4I 3ZM7A 1RREA 2DIXA 3ZKBA 1RR9A 4JI6E 2L3JA 4YHHI 4DV4E 2NUFA 4FWHA 4DPXA 4KHPI 4X64I 4DV0I 2OI2A 4LFAE 1N0UA 2LBSB 1ZM9A 5LL6R 3PYGA 2HKEA 4JI2E 4DV2I 4LFBI 1BKNA 1S4EA 4B3RI 1WHQA 1XNQE 5BR8I 1ZM2A 4USMA 4HY1A 3LTOA 3HULA 4HACB 1X49A 1FJGE 4DXLA 3ZZTA 4WUDA 5FLXQ 4PRXA 4UT4A 4LFCE 4DR2E 3J7Yp 3J81Q 4B3SE 4X65I 3C4BA 1RQ0A 1IBME 4DUYI 4M30A 1H74A 2VF3A 1Z59A 4DV6I 1IBKI 1XMOE 3JAMC 2F4VE 1Z5CA 4X62E 1A6FA 4DV1I 1J26A 1YYOA 2UXBI 4JI1I 4DV5I 2MDRA 4OOGC 1YZ9A 4LF6E 2ZITA 4OX9E 3J81C 2LTRA 4K0KE 1ELOA 3ZKDA 3B82A 1X47A 3J7AG 4WFTA 4EMDA 4DR3E 4DR4E 3PYEA 4JI5I 2E5LI 4DV3I 2LRSA 3ZZUA 4JI8E 1Z0WA 1UEKA 3PYDA 2DEIA 2V8PA 2UUAI 2VQFE 3OTOE 1MU5A 3GONA 2EFGA 1ZM3A 2UU9I 4DR7E 2V2VA 5A2QQ 2VQEE 5LMUI 2HHHI 1T4LB 4MYUA 4HACA 2A2CA 1QZRA 2YT4A 4PU9A 5LMNE 1FI4A 1EI1A 4JI0E 4NXME 4JV5E 1HNXI 1K47A 4P7AA 2LUPB 2RS6A 2X36A 4DV7E 1N32E 4DPYA 4NXNI 3T1HE 4DR1E 4DR5E 2NUEA 4I3HA 4GKJI 2UXDE 5GMDA 4LF5E 4DU8A 2LJPA
chains in the Genus database with same CATH superfamily
2A25A 5K36A 2L8TA 1KJKA 2PNLA 1N33I 4IZJD 1HNWE 1XMQI 1YH8A 2VESA 4R2QA 3QT6A 2PNZB 2EOIA 2EOMA 2V34A 4RPFA 2WCC3 2DMIA 2HK2A 5K36F 2V85A 2R1FA 2ZM6E 1XNRE 5JEAA 2RPCA 1MG7A 4DPUA 1HR0E 4YY3E 4JI3E 3JAMQ 4Z7CA 2EOHA 2LVHA 2MDGA 5A2QC 2EOQA 2V83A 1TF6A 2EMWA 2K7IA 4X9JA 5EL9A 5JEAF 2LMZA 1NHJA 2UXCE 3EPKA 2DMYA 2XEXA 2GPIA 2NN6D 2EPZA 4ED4A 1A1JA 2EMXA 2NUGA 2VRDA 2MC5A 4LPFA 2JVAA 2EM2A 4U3BA 1N34I 1FWLA 2LCEA 2N3GA 4FW9A 2JEAB 4GKKI 3F6HA 2EM9A 4AQYI 2EMGA 1J5EI 2UUCI 1EH6A 3VYXA 4M0VA 2CTDA 3MSWA 2BA1D 2RSMA 3K17A 4BBYA 4LF7I 2VE7C 4DKKA 3HXLA 4MLVA 4JI7E 4IS1C 2HC5A 5C0XE 1YFHA 2ADRA 5IXMB 2O1TA 4DUZI 2L33A 1HNZE 4IFDF 4LCGA 1EH7A 1USUA 5KL6A 4IS9A 4JG4A 3CDJA 1L4SA 2LUQA 3ADGA 4WSGA 4FW6A 3T1YI 3HJCA 2EL5A 3LPSA 1DGCA 2J7KA 3QG5C 2EM3A 2EPRA 4LCFA 3ZZ0A 5A6AA 2EPOA 5CFFE 1N36E 4LF4E 4LF9I 1X6FA 1ZBQA 2YTOA 2HK3A 3KRNA 3TQMA 2I13A 4XTJA 2YRMA 1MEYC 4YHHE 1RMDA 4F9AB 1Z0EA 5DNLA 3H1CA 3P3CA 4KHPE 4JI4I 4IZKA 2PO2B 2YTJA 4FW7A 4B3TI 4X64E 4DV0E 2J7JA 4WXDA 1TN9A 1NHIA 4B3MI 4FK5C 2N8XA 2NA2A 4X66I 2PO1A 4AM3A 2EE8A 4M1KA 1OYSA 4LFBE 2YU5A 4DV2E 2R3VA 2JY9A 3ZOQB 2ZBKB 5JEAB 3C4TA 4LTYA 4OZEA 4WUCA 1FWKA 2JE6A 2WW4A 4B3RE 4USKA 5A6JA 1QU6A 5BR8E 4R2DA 1VISA 4OX9I 2EQ0A 2EPKX 5C0XC 2KHXA 3EPHA 5DRRA 4JYAI 2EL6A 2CZ9A 2NN6E 2YTPA 1WRJA 4DR6I 2C38A 2V2ZA 3PS2A 2BA0D 2PNMA 2L6MA 1I94I 4WYQB 4DPTA 2EM8A 2O1VA 4RHBB 3AUZA 3L7ZB 1XHKA 2PO0B 5IWAI 2M7QA 2D9HA 2EPNA 3LLHA 1PDAA 1WHNA 2PNZA 3P3GA 2CT1A 1YYKA 1IBLI 4IFDB 1USVA 4LF8I 2UUBI 3ADJA 4DU7A 1E3HA 1UILA 1PKPA 1A1GA 1Y60A 2CG9A 3J7AM 3DJWA 4X65E 5EKWA 1YUJA 1BB8A 3FIGA 4BC9A 5KL2A 1Y5YA 1ZBTA 4DUYE 2EN4A 2IERA 2JEBA 3B4TA 2EPLX 4MU4A 5DROA 1PJSA 2EPXA 3IWBA 5K36D 4DV6E 2DEJA 4Z7YA 4GEQB 1IBKE 3Q1QA 3PS3A 1IQOA 4ZYGA 1A1LA 1A1FA 1PJTA 4FN5A 3DF6A 5A69A 1YPNA 5KL5A 1EKZA 3F0NA 2CVEA 3V5RA 4PRVA 2ENCA 2EMLA 1Z0BA 1F2IG 4JI6I 2R42A 4IZKB 4KQVA 4DV4I 4O4KA 2NN6C 2V8QB 1DQ3A 4BA1A 5KL4A 5L3JA 1GQEA 1Z0VA 4DV1E 1DI2A 4FW3A 4OO1B 1KTVA 4FWDA 3KZYA 4LFAI 1KKHA 2V86A 4P7DA 1PVGA 2EM7A 2UXBE 4JI1E 2HFUA 4DV5E 2DLKA 4JI2I 2B9DA 2EMAA 3P1XA 2EOOA 4R2RA 1EH8A 2EOXA 2LV2A 1XNQI 3K1JA 3H4LA 2C38B 4NBQA 5KL7A 2EPCA 3J80Q 4U3DA 1ZAAC 4WSPA 1A1KA 2EZ6A 1NEIA 1ZXMA 1T38A 2PO2A 4F9BB 1ZM4A 2L2NA 2LT7A 1S16A 1B62A 1YHCA 2J65A 3F6GA 2BM0A 1H72C 2M4IA 4JI5E 3QT8A 2E5LE 4DV3E 1FJGI 2BM1A 2L2MA 4LFCI 4BMJA 4DR2I 1FKAE 2N3HA 2WBSA 1HK7A 4B3SI 5K36E 2EJ4A 2UUAE 2JEBB 3V2UC 1OJ4A 1IBMI 1UN6B 2EPUA 1E3PA 2EOJA 2EPPA 2YTQA 3EPJA 1XXEA 3JTZA 1IQSA 1STUA 1B63A 2UU9E 1X48A 4Q35B 4P52A 1JK1A 4EMDA 2WBTA 2B7VA 5LMUE 2EN1A 2YTDA 2HHHE 3BIDA 1Z5BA 5DRPA 2CSHA 1AH5A 1RC7A 1H73A 2M1SA 2ODRC 2PO0A 3CWVA 3L7ZA 4LOMA 1XMOI 4IFDA 5A6BA 1UDQA 2DSYA 1KIJA 3K85A 2YTIA 2F4VI 4AIDA 4HXZA 2ENAA 1HNXE 4BA1B 4J3DA 4X62I 3M85G 1Z0GA 2EQ3A 2Q2EB 3WU3A 2EMIA 2YZTA 3LNUA 2B7TA 4F54A 4O24A 2VF1A 3J80C 2Z5BB 4O5GA 4R1FA 2AE8A 2FV4B 3KZZA 5AC5A 1O0WA 1BBOA 1UBDC 2GS8A 2O1WA 2A2DA 2MKNA 4NXNE 2F1DA 2YWQA 4GKJE 4RH8A 4LF6I 2BB8A 2HJJA 1FNMA 5K36C 1ZR9A 1N33E 2V88A 1G2FC 2EWLA 2IESA 3P3EA 2E1RA 1XMQE 3B78A 3P76A 3UK3C 3PYFA 5AE1A 2CPNA 2JR1A 1IMUA 1N0VC 2C37B 4K0KI 4L5NC 5JEAC 5FWKA 1OYPA 3PRYA 4OO1A 2Q8UA 1U2RA 2WBUA 4FWGA 4M2ZA 4DR3I 4DR4I 2DB2A 1KVKA 1H7UA 1ZU1A 1Y4SA 4JI8I 2YU8A 4ZVIA 4OO1F 2HKJA 1UDNA 1YYWA 1Y4UA 2ODRD 1GZ6A 2IOPA 4MU0A 2VQFI 3OTOI 4X8WA 3NZKA 4R03A 1N34E 4J8ZA 4WUBA 4GKKE 5IV8B 5IT9Q 4AQYE 4IFDC 1J5EE 2UUCE 1NZ0A 4DR7I 1R6LA 2VQEI 2YSOA 2EOZA 4NHRA 2MKDA 4LF7E 1UHZA 2B3TB 4ZYHA 3QT7A 3WU6A 2ELZA 4DUZE 1H7SA 2LJHA 2PRTA 4HYMA 5LMNI 4FW4A 3JU0A 4JI0I 4NXMI 2E1MA 4KWYA 4BCAA 3WU4A 4JV5I 2NPFA 3T1YE 1T39A 2EORA 1ZXNA 3LMLA 3EQ1A 2RS7A 3M99B 4LF9E 2V2QA 5C0XB 3BF2A 4DV7I 5FLXC 4UTGA 1T4OA 1N32I 3T1HI 4DR1I 4DR5I 5GMEA 2Z5CB 4JI4E 3ECRA 5JEAD 3C6KA 3D4JA 2UXDI 4LF5I 4B3TE 2L92A 3C6MA 1DARA 1X5WA 4B3ME 3GMEA 1HNWI 1YSAC 4X66E 2EOYA 2F8BA 2V87A 1EA6A 2NABA 3B8HA 3QT5A 3HQ1A 4BHBA 2IHR1 3ADIA 2X7IA 2FGGA 2ZM6I 1XNRI 2HFSA 4I8OA 2Z5BA 2RTXA 2M9AA 4IZJB 4GQUA 4YY3I 5IT9C 1Z0CA 1HR0I 4JI3I 4JYAE 4Q28A 2EN7A 5KL3A 4DR6E 4IFDD 1D6TA 3VYYA 2WP8A 1P47A 1T4NA 2L2KB 3HTXA 1MX0A 1I94E 3M7ND 2UXCI 1WUUA 1Z0TA 4F9CB 2JPAA 2LJPA 4MU1A 2K4VA 5IWAE 1WJPA 3ADLA 1Z5AA 1PIEA 1IBLE 4MYTA 4LF8E 2JYAA 2UUBE 3WU5A 1VI7A 2C37A 2YTEA 4IJDA 2NN6B 2LTSA 4JI7I 2DGCA 1BBGA 3OMLA 1HNZI 1NHHA 4KZSA 3M6AA 4DPWA 4URLA 2L3CA 2JP9A 2BV3A 2YTNA 2YSPA 4DMIA 1N3GA 2EMBA 5T6JA 5AE3A 2HGHA 1X6EA 1GTKA 3THNA 2AJ4A 2CGEA 2RQLA 2EP3A 5DNXA 2EOSA 1N36I 4LF4I 5JEAE 4OO1D 2O3ZA 3ZM7A 4R2AA 2EMHA 1RREA 2DIXA 4QNKA 3L00A 3ZKBA 1WXRA 1RR9A 3KWRA 4JI6E 5AASA 2L3JA 2GO3A 4DV4E 4YHHI 2JOXA 1OYRA 2NUFA 4FWHA 4DPXA 4KHPI 1QNTA 2I9IA 4BHCA 4X64I 4DV0I 2ENHA 4LFAE 4NZVA 2OI2A 1N0UA 1JK2A 3PS1A 4F2JC 2LBSB 5LL6R 1B69A 4F6MA 1ZM9A 3PYGA 2BA1G 2EN2A 2HKEA 4JI2E 3P06A 4DV2I 4LFBI 4QNJA 4IFDE 4F6NA 1BKNA 2EOFA 1LLMC 4JI5I 1S4EA 4P78A 2O1UA 3U1YA 4B3RI 1WHQA 1XNQE 5BR8I 4ZYEA 5C0XA 2WP8B 3HKMA 1ZM2A 3MHSC 4BA2A 4HEIA 4O43A 1A1HA 2YRHA 3HPSA 4USMA 2BBGA 3IWCA 2Z5CA 4HY1A 3M85D 1X3CA 2EM4A 5C0XF 3LTOA 2GO4A 3HULA 4HACB 4R2EA 1P42A 1X49A 3UHMA 2GLIA 1FJGE 1YUIA 3ZZTA 4DXLA 2GHFA 4WUDA 2LO3A 5FLXQ 4PRXA 4OKGA 3BGHA 4UT4A 4LFCE 4DR2E 3J7Yp 2EMZA 2Z5EA 4B3SE 3VHTB 3J81Q 2V89A 4X65I 2WNRB 4IZJA 3C4BA 5AC4A 3THOB 1RQ0A 1IBME 4DUYI 2JOBA 3RMPA 4M30A 1H74A 2VF3A 2E72A 2DRPA 1UDOA 2RSIA 1Z59A 4DV6I 4OO1E 2GQ0A 5ELWA 4GZNC 5LLQA 1IBKI 2DLQA 5DNYA 3BBGA 4ISAA 1XMOE 3JAMC 2EN3A 1Z1BA 4BC7A 5K36B 1AAYA 2F4VE 2BA0G 1Z5CA 4AIMA 4X62E 4L8NA 1A6FA 4HTGA 2NN6A 1X6HA 4DV1I 2EM0A 4FW5A 4N4RB 2IOQA 2YPNA 1J26A 4ZYDA 1YYOA 4R2CA 4WXCA 2NN6F 1RHYA 2UXBI 4JI1I 2C39A 4DV5I 2EQ1A 3GCMA 5AE2A 2EM5A 2MDRA 2BR2A 2EN8A 2LE2A 4OOGC 1YZ9A 4LF6E 2ZITA 4WX9A 4BA2B 2KONA 4MDTA 4WPYA 3AV0A 1NCSA 4OX9E 3J81C 4TUIA 2EPAA 3Q6MA 2EMKA 2LTRA 3IWDA 3Q6NA 2EMFA 2FTXB 4K0KE 4R8OA 2EMYA 1ELOA 3DD6A 4MLQA 3ZKDA 4TUGA 3B82A 4OO1C 1X47A 2LJUA 1PJQA 2EN6A 2KOUA 4WFTA 1A1IA 4DR3E 2JWOA 3MHHC 2H36X 4DR4E 1UDSA 1Y6ZA 3PYEA 2LRSA 3ZZUA 4DV3I 2E5LI 4JI8E 1SR9A 2EOEA 1Z0WA 1UEKA 2YRKA 3PYDA 2DEIA 2V8PA 2YTFA 2UUAI 2G7HA 2VQFE 3OTOE 3CDIA 1MU5A 5A6BD 3J7AG 3GONA 2EFGA 1ZM3A 2EL4A 5DRQA 2YTGA 1KYQA 2UU9I 4DR7E 2V2VA 5A6KA 2JXPA 5A2QQ 2VQEE 5LMUI 2JEAA 2HHHI 1T4LB 4MYUA 3K6QA 4HACA 2A2CA 3M7NG 1QZRA 4R2SA 2YT4A 4LU9A 2WZOA 4PU9A 5LMNE 1G2DC 1FI4A 2EPMX 1EI1A 4JI0E 4MQYA 1TF3A 4NXME 4LCHA 2PO1B 5ADZA 5TSEA 4JV5E 1SFEA 4MU3A 5C0XD 1K47A 1HNXI 2R76A 3H09A 4P7AA 2MC6A 2WNRA 4M9VC 3EPLA 1R6MA 3GLLA 2JE6B 3HPZA 2JT2A 2LUPB 4R2PA 2ELYA 5F3WA 2RS6A 2C39B 2EM6A 2X36A 4DV7E 1N32E 4N3OA 2BR2B 4DPYA 4NXNI 3T1HE 3VK6A 4DR1E 4DR5E 2NUEA 4I3HA 3U1KA 4GKJI 4BS9A 2UXDE 5GMDA 4LF5E 4DU8A 2EMCA 1MGTA
chains in the Genus database with same CATH topology
2L8TA 2PNLA 1N33I 4IZJD 1HNWE 1XMQI 3QT6A 2V34A 4RPFA 2HK2A 2V85A 2ZM6E 1XNRE 1MG7A 4DPUA 1HR0E 4YY3E 4JI3E 3JAMQ 4Z7CA 5A2QC 2V83A 2LMZA 1NHJA 2UXCE 2DMYA 2XEXA 4ED4A 2NUGA 1N34I 2MC5A 2JVAA 1FWLA 4FW9A 2N3GA 4GKKI 3F6HA 4AQYI 1J5EI 2UUCI 3VYXA 4M0VA 3MSWA 2RSMA 3K17A 4BBYA 4LF7I 2VE7C 4DKKA 3HXLA 4JI7E 4DUZI 2O1TA 2L33A 1HNZE 1USUA 4JG4A 2LUQA 3ADGA 3T1YI 3HJCA 3LPSA 2J7KA 3ZZ0A 1N36E 5CFFE 4LF4E 4LF9I 2HK3A 1ZBQA 4XTJA 4YHHE 4F9AB 1Z0EA 4KHPE 4JI4I 4IZKA 4B3TI 4X64E 4DV0E 1NHIA 4B3MI 2NA2A 4X66I 4M1KA 4LFBE 4DV2E 2R3VA 2ZBKB 2JY9A 3ZOQB 3C4TA 4LTYA 4WUCA 1FWKA 2WW4A 4B3RE 4USKA 1QU6A 5BR8E 1VISA 4JYAI 2KHXA 2CZ9A 4DR6I 2V2ZA 2PNMA 2L6MA 1I94I 4WYQB 4DPTA 2O1VA 3AUZA 1XHKA 5IWAI 2M7QA 3LLHA 1WHNA 1YYKA 1IBLI 1USVA 4LF8I 2UUBI 3ADJA 4DU7A 1UILA 1PKPA 2CG9A 3J7AM 3DJWA 4X65E 3FIGA 4BC9A 1ZBTA 4DUYE 3IWBA 4DV6E 2DEJA 4Z7YA 4GEQB 1IBKE 3Q1QA 4FN5A 3DF6A 1EKZA 3F0NA 3V5RA 4PRVA 1Z0BA 4JI6I 2R42A 4IZKB 4KQVA 4DV4I 2V8QB 1DQ3A 5L3JA 1GQEA 1Z0VA 4DV1E 1DI2A 1KTVA 4FWDA 4LFAI 1KKHA 2V86A 4P7DA 1PVGA 2UXBE 4JI1E 2HFUA 4DV5E 4JI2I 2B9DA 3P1XA 1XNQI 3K1JA 3H4LA 3J80Q 4WSPA 2EZ6A 1ZXMA 4F9BB 1ZM4A 2L2NA 1S16A 1B62A 3F6GA 2BM0A 1H72C 2M4IA 4JI5E 3QT8A 2E5LE 4DV3E 1FJGI 2BM1A 2L2MA 4LFCI 4BMJA 4DR2I 1FKAE 2N3HA 1HK7A 4B3SI 2UUAE 3V2UC 1OJ4A 1IBMI 3JTZA 1B63A 1STUA 2UU9E 1X48A 4P52A 2B7VA 5LMUE 2HHHE 1Z5BA 1RC7A 1H73A 2M1SA 2ODRC 3CWVA 1XMOI 2DSYA 1KIJA 3K85A 2F4VI 4HXZA 1HNXE 4X62I 1Z0GA 2Q2EB 3WU3A 2YZTA 3LNUA 2B7TA 4F54A 2VF1A 3J80C 2Z5BB 4R1FA 2FV4B 1O0WA 2GS8A 2O1WA 2A2DA 4NXNE 4GKJE 4LF6I 1FNMA 1N33E 2V88A 4OX9I 2EWLA 2E1RA 1XMQE 3B78A 3PYFA 5AE1A 2CPNA 2JR1A 1N0VC 4K0KI 4L5NC 5FWKA 3PRYA 1U2RA 4FWGA 4M2ZA 4DR3I 4DR4I 2DB2A 1KVKA 1H7UA 1Y4SA 4JI8I 4ZVIA 2HKJA 1YYWA 1Y4UA 2ODRD 1GZ6A 2IOPA 2VQFI 3OTOI 4X8WA 4R03A 1N34E 4J8ZA 4WUBA 4GKKE 5IT9Q 4AQYE 2UUCE 1J5EE 1NZ0A 4DR7I 2VQEI 4LF7E 1UHZA 2B3TB 3QT7A 3WU6A 4DUZE 1H7SA 2LJHA 4HYMA 5LMNI 3JU0A 4JI0I 4NXMI 2E1MA 4JV5I 4BCAA 3WU4A 2NPFA 3T1YE 1ZXNA 3LMLA 2RS7A 4LF9E 2V2QA 4DV7I 5FLXC 4UTGA 1T4OA 1N32I 3T1HI 4DR1I 4DR5I 5GMEA 2Z5CB 4JI4E 3D4JA 2UXDI 4LF5I 4B3TE 2L92A 1DARA 4B3ME 1HNWI 4X66E 2F8BA 2V87A 1EA6A 3B8HA 3QT5A 3HQ1A 3ADIA 2IHR1 2X7IA 2FGGA 2ZM6I 1XNRI 2HFSA 4I8OA 2Z5BA 2RTXA 1HR0I 4IZJB 4YY3I 4JI3I 5IT9C 1Z0CA 4JYAE 4Q28A 4DR6E 1D6TA 3VYYA 3HTXA 1T4NA 2L2KB 1MX0A 1I94E 2UXCI 1WUUA 1Z0TA 4F9CB 2K4VA 5IWAE 3ADLA 1Z5AA 1PIEA 1IBLE 4MYTA 4LF8E 2UUBE 3WU5A 2LTSA 4JI7I 3OMLA 1HNZI 1NHHA 4KZSA 3M6AA 4DPWA 4URLA 2L3CA 2BV3A 4DMIA 5AE3A 5T6JA 2AJ4A 2CGEA 1N36I 4LF4I 3ZM7A 1RREA 2DIXA 3ZKBA 1WXRA 1RR9A 3KWRA 4JI6E 5AASA 2L3JA 4YHHI 4DV4E 2JOXA 2NUFA 4FWHA 4DPXA 4KHPI 4X64I 4DV0I 2OI2A 4LFAE 1N0UA 2LBSB 5LL6R 1ZM9A 3PYGA 2HKEA 4JI2E 3P06A 4DV2I 4LFBI 1BKNA 1S4EA 4P78A 2O1UA 4B3RI 1WHQA 1XNQE 5BR8I 1ZM2A 3HPSA 4USMA 3IWCA 2Z5CA 4HY1A 3LTOA 3HULA 4HACB 1X49A 1FJGE 4DXLA 3ZZTA 4WUDA 5FLXQ 4PRXA 4UT4A 4LFCE 4DR2E 3J7Yp 2Z5EA 3J81Q 4B3SE 2V89A 4X65I 4IZJA 3C4BA 1RQ0A 1IBME 4DUYI 2JOBA 3RMPA 4M30A 1H74A 2VF3A 1Z59A 4DV6I 2GQ0A 1IBKI 5DNYA 1XMOE 3JAMC 4BC7A 2F4VE 1Z5CA 4X62E 4L8NA 1A6FA 4DV1I 2IOQA 1J26A 1YYOA 2UXBI 4JI1I 4DV5I 5AE2A 2MDRA 2LE2A 4OOGC 1YZ9A 4LF6E 2ZITA 2KONA 4WPYA 3AV0A 4OX9E 3J81C 4TUIA 3Q6MA 3IWDA 2LTRA 3Q6NA 2FTXB 4K0KE 4R8OA 1ELOA 3ZKDA 4TUGA 3B82A 1X47A 3J7AG 4WFTA 2KOUA 4EMDA 4DR3E 2JWOA 4DR4E 2H36X 3PYEA 1Y6ZA 4DV3I 2E5LI 2LRSA 3ZZUA 4JI5I 4JI8E 1SR9A 1Z0WA 1UEKA 3PYDA 2DEIA 2V8PA 2UUAI 2G7HA 2VQFE 3OTOE 1MU5A 3GONA 2EFGA 1ZM3A 2UU9I 4DR7E 2V2VA 5A2QQ 2VQEE 5LMUI 2HHHI 1T4LB 4MYUA 3K6QA 4HACA 2A2CA 1QZRA 2YT4A 4LU9A 2WZOA 4PU9A 5LMNE 1FI4A 1EI1A 4JI0E 4NXME 5ADZA 4JV5E 1HNXI 1K47A 3H09A 4P7AA 2MC6A 3HPZA 2LUPB 5F3WA 2RS6A 2X36A 4DV7E 1N32E 4N3OA 4DPYA 4NXNI 3T1HE 3VK6A 4DR1E 4DR5E 2NUEA 4I3HA 4GKJI 4BS9A 2UXDE 5GMDA 4LF5E 4DU8A 2LJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 I;  1HNW E;  1XMQ I;  3QT6 A;  2V34 A;  4RPF A;  2HK2 A;  2ZM6 E;  1XNR E;  1MG7 A;  4DPU A;  1HR0 E;  4YY3 E;  4JI3 E;  3JAM Q;  4Z7C A;  5A2Q C;  1NHJ A;  2UXC E;  2DMY A;  2XEX A;  4ED4 A;  2NUG A;  1N34 I;  2JVA A;  1FWL A;  4FW9 A;  2N3G A;  4GKK I;  4AQY I;  1J5E I;  2UUC I;  3VYX A;  2RSM A;  3K17 A;  4LF7 I;  4DKK A;  4JI7 E;  4DUZ I;  2L33 A;  1HNZ E;  4JG4 A;  2LUQ A;  3ADG A;  3T1Y I;  3LPS A;  2J7K A;  3ZZ0 A;  1N36 E;  5CFF E;  4LF4 E;  4LF9 I;  2HK3 A;  4XTJ A;  4YHH E;  1Z0E A;  4KHP E;  4JI4 I;  4B3T I;  4X64 E;  4DV0 E;  1NHI A;  4B3M I;  2NA2 A;  4X66 I;  4M1K A;  4LFB E;  4DV2 E;  2R3V A;  2ZBK B;  2JY9 A;  3C4T A;  4WUC A;  1FWK A;  2WW4 A;  4B3R E;  4USK A;  1QU6 A;  5BR8 E;  1VIS A;  4JYA I;  2KHX A;  2CZ9 A;  4DR6 I;  2V2Z A;  1I94 I;  4WYQ B;  4DPT A;  1XHK A;  5IWA I;  3LLH A;  1WHN A;  1YYK A;  1IBL I;  4LF8 I;  2UUB I;  3ADJ A;  4DU7 A;  1UIL A;  1PKP A;  3J7A M;  4X65 E;  1ZBT A;  4DUY E;  4DV6 E;  2DEJ A;  4Z7Y A;  1IBK E;  3Q1Q A;  4FN5 A;  1EKZ A;  3F0N A;  3V5R A;  4PRV A;  1Z0B A;  4JI6 I;  2R42 A;  4KQV A;  4DV4 I;  5L3J A;  1GQE A;  1Z0V A;  4DV1 E;  1DI2 A;  1KTV A;  4FWD A;  4LFA I;  1KKH A;  1PVG A;  2UXB E;  4JI1 E;  2HFU A;  4DV5 E;  4JI2 I;  3P1X A;  1XNQ I;  3K1J A;  3H4L A;  3J80 Q;  2EZ6 A;  1ZXM A;  1ZM4 A;  2L2N A;  1S16 A;  1B62 A;  2BM0 A;  1H72 C;  4JI5 E;  1FJG I;  3QT8 A;  2E5L E;  4DV3 E;  2BM1 A;  2L2M A;  4LFC I;  4DR2 I;  1FKA E;  2N3H A;  4B3S I;  2UUA E;  3V2U C;  1OJ4 A;  1IBM I;  1B63 A;  1STU A;  2UU9 E;  1X48 A;  4P52 A;  2B7V A;  5LMU E;  2HHH E;  1Z5B A;  1RC7 A;  1H73 A;  3CWV A;  1XMO I;  1KIJ A;  2F4V I;  4HXZ A;  1HNX E;  4X62 I;  1Z0G A;  2Q2E B;  3WU3 A;  3LNU A;  2B7T A;  3J80 C;  4R1F A;  1O0W A;  2GS8 A;  2A2D A;  4NXN E;  4GKJ E;  4LF6 I;  1FNM A;  1N33 E;  4OX9 I;  2E1R A;  1XMQ E;  3B78 A;  3PYF A;  2CPN A;  1N0V C;  4K0K I;  1U2R A;  4FWG A;  4M2Z A;  4DR3 I;  4DR4 I;  2DB2 A;  1KVK A;  1H7U A;  4JI8 I;  4ZVI A;  2HKJ A;  1YYW A;  2VQF I;  3OTO I;  4X8W A;  1N34 E;  4WUB A;  4GKK E;  5IT9 Q;  4AQY E;  2UUC E;  1J5E E;  1NZ0 A;  4DR7 I;  2VQE I;  4LF7 E;  1UHZ A;  2B3T B;  3QT7 A;  3WU6 A;  4DUZ E;  1H7S A;  2LJH A;  4HYM A;  5LMN I;  4JI0 I;  4NXM I;  4JV5 I;  3WU4 A;  2NPF A;  3T1Y E;  1ZXN A;  2RS7 A;  4LF9 E;  2V2Q A;  4DV7 I;  4UTG A;  5FLX C;  1T4O A;  1N32 I;  3T1H I;  4DR1 I;  4DR5 I;  5GME A;  4JI4 E;  3D4J A;  2UXD I;  4LF5 I;  4B3T E;  1DAR A;  4B3M E;  1HNW I;  4X66 E;  1EA6 A;  3B8H A;  3QT5 A;  3ADI A;  2IHR 1;  2X7I A;  2ZM6 I;  1XNR I;  2HFS A;  2RTX A;  1HR0 I;  4YY3 I;  4JI3 I;  1Z0C A;  5IT9 C;  4JYA E;  4DR6 E;  1D6T A;  3VYY A;  3HTX A;  1T4N A;  2L2K B;  1MX0 A;  1I94 E;  2UXC I;  1WUU A;  1Z0T A;  5IWA E;  3ADL A;  1Z5A A;  1PIE A;  1IBL E;  4MYT A;  4LF8 E;  2UUB E;  3WU5 A;  2LTS A;  4JI7 I;  1HNZ I;  1NHH A;  3M6A A;  4DPW A;  4URL A;  2L3C A;  2BV3 A;  2AJ4 A;  1N36 I;  4LF4 I;  3ZM7 A;  1RRE A;  2DIX A;  3ZKB A;  1RR9 A;  4JI6 E;  2L3J A;  4YHH I;  4DV4 E;  2NUF A;  4FWH A;  4DPX A;  4KHP I;  4X64 I;  4DV0 I;  2OI2 A;  4LFA E;  1N0U A;  2LBS B;  1ZM9 A;  5LL6 R;  3PYG A;  2HKE A;  4JI2 E;  4DV2 I;  4LFB I;  1BKN A;  1S4E A;  4B3R I;  1WHQ A;  1XNQ E;  5BR8 I;  1ZM2 A;  4USM A;  4HY1 A;  3LTO A;  3HUL A;  4HAC B;  1X49 A;  1FJG E;  4DXL A;  3ZZT A;  4WUD A;  5FLX Q;  4PRX A;  4UT4 A;  4LFC E;  4DR2 E;  3J7Y p;  3J81 Q;  4B3S E;  4X65 I;  3C4B A;  1RQ0 A;  1IBM E;  4DUY I;  4M30 A;  1H74 A;  2VF3 A;  1Z59 A;  4DV6 I;  1IBK I;  1XMO E;  3JAM C;  2F4V E;  1Z5C A;  4X62 E;  1A6F A;  4DV1 I;  1J26 A;  1YYO A;  2UXB I;  4JI1 I;  4DV5 I;  2MDR A;  4OOG C;  1YZ9 A;  4LF6 E;  2ZIT A;  4OX9 E;  3J81 C;  2LTR A;  4K0K E;  1ELO A;  3ZKD A;  3B82 A;  1X47 A;  3J7A G;  4WFT A;  4EMD A;  4DR3 E;  4DR4 E;  3PYE A;  4JI5 I;  2E5L I;  4DV3 I;  2LRS A;  3ZZU A;  4JI8 E;  1Z0W A;  1UEK A;  3PYD A;  2DEI A;  2V8P A;  2UUA I;  2VQF E;  3OTO E;  1MU5 A;  3GON A;  2EFG A;  1ZM3 A;  2UU9 I;  4DR7 E;  2V2V A;  5A2Q Q;  2VQE E;  5LMU I;  2HHH I;  1T4L B;  4MYU A;  4HAC A;  2A2C A;  1QZR A;  2YT4 A;  4PU9 A;  5LMN E;  1FI4 A;  1EI1 A;  4JI0 E;  4NXM E;  4JV5 E;  1HNX I;  1K47 A;  4P7A A;  2LUP B;  2RS6 A;  2X36 A;  4DV7 E;  1N32 E;  4DPY A;  4NXN I;  3T1H E;  4DR1 E;  4DR5 E;  2NUE A;  4I3H A;  4GKJ I;  2UXD E;  5GMD A;  4LF5 E;  4DU8 A;  2LJP A; 
#chains in the Genus database with same CATH topology
 2A25 A;  5K36 A;  2L8T A;  1KJK A;  2PNL A;  1N33 I;  4IZJ D;  1HNW E;  1XMQ I;  1YH8 A;  2VES A;  4R2Q A;  3QT6 A;  2PNZ B;  2EOI A;  2EOM A;  2V34 A;  4RPF A;  2WCC 3;  2DMI A;  2HK2 A;  5K36 F;  2V85 A;  2R1F A;  2ZM6 E;  1XNR E;  5JEA A;  2RPC A;  1MG7 A;  4DPU A;  1HR0 E;  4YY3 E;  4JI3 E;  3JAM Q;  4Z7C A;  2EOH A;  2LVH A;  2MDG A;  5A2Q C;  2EOQ A;  2V83 A;  1TF6 A;  2EMW A;  2K7I A;  4X9J A;  5EL9 A;  5JEA F;  2LMZ A;  1NHJ A;  2UXC E;  3EPK A;  2DMY A;  2XEX A;  2GPI A;  2NN6 D;  2EPZ A;  4ED4 A;  1A1J A;  2EMX A;  2NUG A;  2VRD A;  2MC5 A;  4LPF A;  2JVA A;  2EM2 A;  4U3B A;  1N34 I;  1FWL A;  2LCE A;  2N3G A;  4FW9 A;  2JEA B;  4GKK I;  3F6H A;  2EM9 A;  4AQY I;  2EMG A;  1J5E I;  2UUC I;  1EH6 A;  3VYX A;  4M0V A;  2CTD A;  3MSW A;  2BA1 D;  2RSM A;  3K17 A;  4BBY A;  4LF7 I;  2VE7 C;  4DKK A;  3HXL A;  4MLV A;  4JI7 E;  4IS1 C;  2HC5 A;  5C0X E;  1YFH A;  2ADR A;  5IXM B;  2O1T A;  4DUZ I;  2L33 A;  1HNZ E;  4IFD F;  4LCG A;  1EH7 A;  1USU A;  5KL6 A;  4IS9 A;  4JG4 A;  3CDJ A;  1L4S A;  2LUQ A;  3ADG A;  4WSG A;  4FW6 A;  3T1Y I;  3HJC A;  2EL5 A;  3LPS A;  1DGC A;  2J7K A;  3QG5 C;  2EM3 A;  2EPR A;  4LCF A;  3ZZ0 A;  5A6A A;  2EPO A;  5CFF E;  1N36 E;  4LF4 E;  4LF9 I;  1X6F A;  1ZBQ A;  2YTO A;  2HK3 A;  3KRN A;  3TQM A;  2I13 A;  4XTJ A;  2YRM A;  1MEY C;  4YHH E;  1RMD A;  4F9A B;  1Z0E A;  5DNL A;  3H1C A;  3P3C A;  4KHP E;  4JI4 I;  4IZK A;  2PO2 B;  2YTJ A;  4FW7 A;  4B3T I;  4X64 E;  4DV0 E;  2J7J A;  4WXD A;  1TN9 A;  1NHI A;  4B3M I;  4FK5 C;  2N8X A;  2NA2 A;  4X66 I;  2PO1 A;  4AM3 A;  2EE8 A;  4M1K A;  1OYS A;  4LFB E;  2YU5 A;  4DV2 E;  2R3V A;  2JY9 A;  3ZOQ B;  2ZBK B;  5JEA B;  3C4T A;  4LTY A;  4OZE A;  4WUC A;  1FWK A;  2JE6 A;  2WW4 A;  4B3R E;  4USK A;  5A6J A;  1QU6 A;  5BR8 E;  4R2D A;  1VIS A;  4OX9 I;  2EQ0 A;  2EPK X;  5C0X C;  2KHX A;  3EPH A;  5DRR A;  4JYA I;  2EL6 A;  2CZ9 A;  2NN6 E;  2YTP A;  1WRJ A;  4DR6 I;  2C38 A;  2V2Z A;  3PS2 A;  2BA0 D;  2PNM A;  2L6M A;  1I94 I;  4WYQ B;  4DPT A;  2EM8 A;  2O1V A;  4RHB B;  3AUZ A;  3L7Z B;  1XHK A;  2PO0 B;  5IWA I;  2M7Q A;  2D9H A;  2EPN A;  3LLH A;  1PDA A;  1WHN A;  2PNZ A;  3P3G A;  2CT1 A;  1YYK A;  1IBL I;  4IFD B;  1USV A;  4LF8 I;  2UUB I;  3ADJ A;  4DU7 A;  1E3H A;  1UIL A;  1PKP A;  1A1G A;  1Y60 A;  2CG9 A;  3J7A M;  3DJW A;  4X65 E;  5EKW A;  1YUJ A;  1BB8 A;  3FIG A;  4BC9 A;  5KL2 A;  1Y5Y A;  1ZBT A;  4DUY E;  2EN4 A;  2IER A;  2JEB A;  3B4T A;  2EPL X;  4MU4 A;  5DRO A;  1PJS A;  2EPX A;  3IWB A;  5K36 D;  4DV6 E;  2DEJ A;  4Z7Y A;  4GEQ B;  1IBK E;  3Q1Q A;  3PS3 A;  1IQO A;  4ZYG A;  1A1L A;  1A1F A;  1PJT A;  4FN5 A;  3DF6 A;  5A69 A;  1YPN A;  5KL5 A;  1EKZ A;  3F0N A;  2CVE A;  3V5R A;  4PRV A;  2ENC A;  2EML A;  1Z0B A;  1F2I G;  4JI6 I;  2R42 A;  4IZK B;  4KQV A;  4DV4 I;  4O4K A;  2NN6 C;  2V8Q B;  1DQ3 A;  4BA1 A;  5KL4 A;  5L3J A;  1GQE A;  1Z0V A;  4DV1 E;  1DI2 A;  4FW3 A;  4OO1 B;  1KTV A;  4FWD A;  3KZY A;  4LFA I;  1KKH A;  2V86 A;  4P7D A;  1PVG A;  2EM7 A;  2UXB E;  4JI1 E;  2HFU A;  4DV5 E;  2DLK A;  4JI2 I;  2B9D A;  2EMA A;  3P1X A;  2EOO A;  4R2R A;  1EH8 A;  2EOX A;  2LV2 A;  1XNQ I;  3K1J A;  3H4L A;  2C38 B;  4NBQ A;  5KL7 A;  2EPC A;  3J80 Q;  4U3D A;  1ZAA C;  4WSP A;  1A1K A;  2EZ6 A;  1NEI A;  1ZXM A;  1T38 A;  2PO2 A;  4F9B B;  1ZM4 A;  2L2N A;  2LT7 A;  1S16 A;  1B62 A;  1YHC A;  2J65 A;  3F6G A;  2BM0 A;  1H72 C;  2M4I A;  4JI5 E;  3QT8 A;  2E5L E;  4DV3 E;  1FJG I;  2BM1 A;  2L2M A;  4LFC I;  4BMJ A;  4DR2 I;  1FKA E;  2N3H A;  2WBS A;  1HK7 A;  4B3S I;  5K36 E;  2EJ4 A;  2UUA E;  2JEB B;  3V2U C;  1OJ4 A;  1IBM I;  1UN6 B;  2EPU A;  1E3P A;  2EOJ A;  2EPP A;  2YTQ A;  3EPJ A;  1XXE A;  3JTZ A;  1IQS A;  1STU A;  1B63 A;  2UU9 E;  1X48 A;  4Q35 B;  4P52 A;  1JK1 A;  4EMD A;  2WBT A;  2B7V A;  5LMU E;  2EN1 A;  2YTD A;  2HHH E;  3BID A;  1Z5B A;  5DRP A;  2CSH A;  1AH5 A;  1RC7 A;  1H73 A;  2M1S A;  2ODR C;  2PO0 A;  3CWV A;  3L7Z A;  4LOM A;  1XMO I;  4IFD A;  5A6B A;  1UDQ A;  2DSY A;  1KIJ A;  3K85 A;  2YTI A;  2F4V I;  4AID A;  4HXZ A;  2ENA A;  1HNX E;  4BA1 B;  4J3D A;  4X62 I;  3M85 G;  1Z0G A;  2EQ3 A;  2Q2E B;  3WU3 A;  2EMI A;  2YZT A;  3LNU A;  2B7T A;  4F54 A;  4O24 A;  2VF1 A;  3J80 C;  2Z5B B;  4O5G A;  4R1F A;  2AE8 A;  2FV4 B;  3KZZ A;  5AC5 A;  1O0W A;  1BBO A;  1UBD C;  2GS8 A;  2O1W A;  2A2D A;  2MKN A;  4NXN E;  2F1D A;  2YWQ A;  4GKJ E;  4RH8 A;  4LF6 I;  2BB8 A;  2HJJ A;  1FNM A;  5K36 C;  1ZR9 A;  1N33 E;  2V88 A;  1G2F C;  2EWL A;  2IES A;  3P3E A;  2E1R A;  1XMQ E;  3B78 A;  3P76 A;  3UK3 C;  3PYF A;  5AE1 A;  2CPN A;  2JR1 A;  1IMU A;  1N0V C;  2C37 B;  4K0K I;  4L5N C;  5JEA C;  5FWK A;  1OYP A;  3PRY A;  4OO1 A;  2Q8U A;  1U2R A;  2WBU A;  4FWG A;  4M2Z A;  4DR3 I;  4DR4 I;  2DB2 A;  1KVK A;  1H7U A;  1ZU1 A;  1Y4S A;  4JI8 I;  2YU8 A;  4ZVI A;  4OO1 F;  2HKJ A;  1UDN A;  1YYW A;  1Y4U A;  2ODR D;  1GZ6 A;  2IOP A;  4MU0 A;  2VQF I;  3OTO I;  4X8W A;  3NZK A;  4R03 A;  1N34 E;  4J8Z A;  4WUB A;  4GKK E;  5IV8 B;  5IT9 Q;  4AQY E;  4IFD C;  1J5E E;  2UUC E;  1NZ0 A;  4DR7 I;  1R6L A;  2VQE I;  2YSO A;  2EOZ A;  4NHR A;  2MKD A;  4LF7 E;  1UHZ A;  2B3T B;  4ZYH A;  3QT7 A;  3WU6 A;  2ELZ A;  4DUZ E;  1H7S A;  2LJH A;  2PRT A;  4HYM A;  5LMN I;  4FW4 A;  3JU0 A;  4JI0 I;  4NXM I;  2E1M A;  4KWY A;  4BCA A;  3WU4 A;  4JV5 I;  2NPF A;  3T1Y E;  1T39 A;  2EOR A;  1ZXN A;  3LML A;  3EQ1 A;  2RS7 A;  3M99 B;  4LF9 E;  2V2Q A;  5C0X B;  3BF2 A;  4DV7 I;  5FLX C;  4UTG A;  1T4O A;  1N32 I;  3T1H I;  4DR1 I;  4DR5 I;  5GME A;  2Z5C B;  4JI4 E;  3ECR A;  5JEA D;  3C6K A;  3D4J A;  2UXD I;  4LF5 I;  4B3T E;  2L92 A;  3C6M A;  1DAR A;  1X5W A;  4B3M E;  3GME A;  1HNW I;  1YSA C;  4X66 E;  2EOY A;  2F8B A;  2V87 A;  1EA6 A;  2NAB A;  3B8H A;  3QT5 A;  3HQ1 A;  4BHB A;  2IHR 1;  3ADI A;  2X7I A;  2FGG A;  2ZM6 I;  1XNR I;  2HFS A;  4I8O A;  2Z5B A;  2RTX A;  2M9A A;  4IZJ B;  4GQU A;  4YY3 I;  5IT9 C;  1Z0C A;  1HR0 I;  4JI3 I;  4JYA E;  4Q28 A;  2EN7 A;  5KL3 A;  4DR6 E;  4IFD D;  1D6T A;  3VYY A;  2WP8 A;  1P47 A;  1T4N A;  2L2K B;  3HTX A;  1MX0 A;  1I94 E;  3M7N D;  2UXC I;  1WUU A;  1Z0T A;  4F9C B;  2JPA A;  2LJP A;  4MU1 A;  2K4V A;  5IWA E;  1WJP A;  3ADL A;  1Z5A A;  1PIE A;  1IBL E;  4MYT A;  4LF8 E;  2JYA A;  2UUB E;  3WU5 A;  1VI7 A;  2C37 A;  2YTE A;  4IJD A;  2NN6 B;  2LTS A;  4JI7 I;  2DGC A;  1BBG A;  3OML A;  1HNZ I;  1NHH A;  4KZS A;  3M6A A;  4DPW A;  4URL A;  2L3C A;  2JP9 A;  2BV3 A;  2YTN A;  2YSP A;  4DMI A;  1N3G A;  2EMB A;  5T6J A;  5AE3 A;  2HGH A;  1X6E A;  1GTK A;  3THN A;  2AJ4 A;  2CGE A;  2RQL A;  2EP3 A;  5DNX A;  2EOS A;  1N36 I;  4LF4 I;  5JEA E;  4OO1 D;  2O3Z A;  3ZM7 A;  4R2A A;  2EMH A;  1RRE A;  2DIX A;  4QNK A;  3L00 A;  3ZKB A;  1WXR A;  1RR9 A;  3KWR A;  4JI6 E;  5AAS A;  2L3J A;  2GO3 A;  4DV4 E;  4YHH I;  2JOX A;  1OYR A;  2NUF A;  4FWH A;  4DPX A;  4KHP I;  1QNT A;  2I9I A;  4BHC A;  4X64 I;  4DV0 I;  2ENH A;  4LFA E;  4NZV A;  2OI2 A;  1N0U A;  1JK2 A;  3PS1 A;  4F2J C;  2LBS B;  5LL6 R;  1B69 A;  4F6M A;  1ZM9 A;  3PYG A;  2BA1 G;  2EN2 A;  2HKE A;  4JI2 E;  3P06 A;  4DV2 I;  4LFB I;  4QNJ A;  4IFD E;  4F6N A;  1BKN A;  2EOF A;  1LLM C;  4JI5 I;  1S4E A;  4P78 A;  2O1U A;  3U1Y A;  4B3R I;  1WHQ A;  1XNQ E;  5BR8 I;  4ZYE A;  5C0X A;  2WP8 B;  3HKM A;  1ZM2 A;  3MHS C;  4BA2 A;  4HEI A;  4O43 A;  1A1H A;  2YRH A;  3HPS A;  4USM A;  2BBG A;  3IWC A;  2Z5C A;  4HY1 A;  3M85 D;  1X3C A;  2EM4 A;  5C0X F;  3LTO A;  2GO4 A;  3HUL A;  4HAC B;  4R2E A;  1P42 A;  1X49 A;  3UHM A;  2GLI A;  1FJG E;  1YUI A;  3ZZT A;  4DXL A;  2GHF A;  4WUD A;  2LO3 A;  5FLX Q;  4PRX A;  4OKG A;  3BGH A;  4UT4 A;  4LFC E;  4DR2 E;  3J7Y p;  2EMZ A;  2Z5E A;  4B3S E;  3VHT B;  3J81 Q;  2V89 A;  4X65 I;  2WNR B;  4IZJ A;  3C4B A;  5AC4 A;  3THO B;  1RQ0 A;  1IBM E;  4DUY I;  2JOB A;  3RMP A;  4M30 A;  1H74 A;  2VF3 A;  2E72 A;  2DRP A;  1UDO A;  2RSI A;  1Z59 A;  4DV6 I;  4OO1 E;  2GQ0 A;  5ELW A;  4GZN C;  5LLQ A;  1IBK I;  2DLQ A;  5DNY A;  3BBG A;  4ISA A;  1XMO E;  3JAM C;  2EN3 A;  1Z1B A;  4BC7 A;  5K36 B;  1AAY A;  2F4V E;  2BA0 G;  1Z5C A;  4AIM A;  4X62 E;  4L8N A;  1A6F A;  4HTG A;  2NN6 A;  1X6H A;  4DV1 I;  2EM0 A;  4FW5 A;  4N4R B;  2IOQ A;  2YPN A;  1J26 A;  4ZYD A;  1YYO A;  4R2C A;  4WXC A;  2NN6 F;  1RHY A;  2UXB I;  4JI1 I;  2C39 A;  4DV5 I;  2EQ1 A;  3GCM A;  5AE2 A;  2EM5 A;  2MDR A;  2BR2 A;  2EN8 A;  2LE2 A;  4OOG C;  1YZ9 A;  4LF6 E;  2ZIT A;  4WX9 A;  4BA2 B;  2KON A;  4MDT A;  4WPY A;  3AV0 A;  1NCS A;  4OX9 E;  3J81 C;  4TUI A;  2EPA A;  3Q6M A;  2EMK A;  2LTR A;  3IWD A;  3Q6N A;  2EMF A;  2FTX B;  4K0K E;  4R8O A;  2EMY A;  1ELO A;  3DD6 A;  4MLQ A;  3ZKD A;  4TUG A;  3B82 A;  4OO1 C;  1X47 A;  2LJU A;  1PJQ A;  2EN6 A;  2KOU A;  4WFT A;  1A1I A;  4DR3 E;  2JWO A;  3MHH C;  2H36 X;  4DR4 E;  1UDS A;  1Y6Z A;  3PYE A;  2LRS A;  3ZZU A;  4DV3 I;  2E5L I;  4JI8 E;  1SR9 A;  2EOE A;  1Z0W A;  1UEK A;  2YRK A;  3PYD A;  2DEI A;  2V8P A;  2YTF A;  2UUA I;  2G7H A;  2VQF E;  3OTO E;  3CDI A;  1MU5 A;  5A6B D;  3J7A G;  3GON A;  2EFG A;  1ZM3 A;  2EL4 A;  5DRQ A;  2YTG A;  1KYQ A;  2UU9 I;  4DR7 E;  2V2V A;  5A6K A;  2JXP A;  5A2Q Q;  2VQE E;  5LMU I;  2JEA A;  2HHH I;  1T4L B;  4MYU A;  3K6Q A;  4HAC A;  2A2C A;  3M7N G;  1QZR A;  4R2S A;  2YT4 A;  4LU9 A;  2WZO A;  4PU9 A;  5LMN E;  1G2D C;  1FI4 A;  2EPM X;  1EI1 A;  4JI0 E;  4MQY A;  1TF3 A;  4NXM E;  4LCH A;  2PO1 B;  5ADZ A;  5TSE A;  4JV5 E;  1SFE A;  4MU3 A;  5C0X D;  1K47 A;  1HNX I;  2R76 A;  3H09 A;  4P7A A;  2MC6 A;  2WNR A;  4M9V C;  3EPL A;  1R6M A;  3GLL A;  2JE6 B;  3HPZ A;  2JT2 A;  2LUP B;  4R2P A;  2ELY A;  5F3W A;  2RS6 A;  2C39 B;  2EM6 A;  2X36 A;  4DV7 E;  1N32 E;  4N3O A;  2BR2 B;  4DPY A;  4NXN I;  3T1H E;  3VK6 A;  4DR1 E;  4DR5 E;  2NUE A;  4I3H A;  3U1K A;  4GKJ I;  4BS9 A;  2UXD E;  5GMD A;  4LF5 E;  4DU8 A;  2EMC A;  1MGT A; 
#chains in the Genus database with same CATH homology
 2L8T A;  2PNL A;  1N33 I;  4IZJ D;  1HNW E;  1XMQ I;  3QT6 A;  2V34 A;  4RPF A;  2HK2 A;  2V85 A;  2ZM6 E;  1XNR E;  1MG7 A;  4DPU A;  1HR0 E;  4YY3 E;  4JI3 E;  3JAM Q;  4Z7C A;  5A2Q C;  2V83 A;  2LMZ A;  1NHJ A;  2UXC E;  2DMY A;  2XEX A;  4ED4 A;  2NUG A;  1N34 I;  2MC5 A;  2JVA A;  1FWL A;  4FW9 A;  2N3G A;  4GKK I;  3F6H A;  4AQY I;  1J5E I;  2UUC I;  3VYX A;  4M0V A;  3MSW A;  2RSM A;  3K17 A;  4BBY A;  4LF7 I;  2VE7 C;  4DKK A;  3HXL A;  4JI7 E;  4DUZ I;  2O1T A;  2L33 A;  1HNZ E;  1USU A;  4JG4 A;  2LUQ A;  3ADG A;  3T1Y I;  3HJC A;  3LPS A;  2J7K A;  3ZZ0 A;  1N36 E;  5CFF E;  4LF4 E;  4LF9 I;  2HK3 A;  1ZBQ A;  4XTJ A;  4YHH E;  4F9A B;  1Z0E A;  4KHP E;  4JI4 I;  4IZK A;  4B3T I;  4X64 E;  4DV0 E;  1NHI A;  4B3M I;  2NA2 A;  4X66 I;  4M1K A;  4LFB E;  4DV2 E;  2R3V A;  2ZBK B;  2JY9 A;  3ZOQ B;  3C4T A;  4LTY A;  4WUC A;  1FWK A;  2WW4 A;  4B3R E;  4USK A;  1QU6 A;  5BR8 E;  1VIS A;  4JYA I;  2KHX A;  2CZ9 A;  4DR6 I;  2V2Z A;  2PNM A;  2L6M A;  1I94 I;  4WYQ B;  4DPT A;  2O1V A;  3AUZ A;  1XHK A;  5IWA I;  2M7Q A;  3LLH A;  1WHN A;  1YYK A;  1IBL I;  1USV A;  4LF8 I;  2UUB I;  3ADJ A;  4DU7 A;  1UIL A;  1PKP A;  2CG9 A;  3J7A M;  3DJW A;  4X65 E;  3FIG A;  4BC9 A;  1ZBT A;  4DUY E;  3IWB A;  4DV6 E;  2DEJ A;  4Z7Y A;  4GEQ B;  1IBK E;  3Q1Q A;  4FN5 A;  3DF6 A;  1EKZ A;  3F0N A;  3V5R A;  4PRV A;  1Z0B A;  4JI6 I;  2R42 A;  4IZK B;  4KQV A;  4DV4 I;  2V8Q B;  1DQ3 A;  5L3J A;  1GQE A;  1Z0V A;  4DV1 E;  1DI2 A;  1KTV A;  4FWD A;  4LFA I;  1KKH A;  2V86 A;  4P7D A;  1PVG A;  2UXB E;  4JI1 E;  2HFU A;  4DV5 E;  4JI2 I;  2B9D A;  3P1X A;  1XNQ I;  3K1J A;  3H4L A;  3J80 Q;  4WSP A;  2EZ6 A;  1ZXM A;  4F9B B;  1ZM4 A;  2L2N A;  1S16 A;  1B62 A;  3F6G A;  2BM0 A;  1H72 C;  2M4I A;  4JI5 E;  3QT8 A;  2E5L E;  4DV3 E;  1FJG I;  2BM1 A;  2L2M A;  4LFC I;  4BMJ A;  4DR2 I;  1FKA E;  2N3H A;  1HK7 A;  4B3S I;  2UUA E;  3V2U C;  1OJ4 A;  1IBM I;  3JTZ A;  1B63 A;  1STU A;  2UU9 E;  1X48 A;  4P52 A;  2B7V A;  5LMU E;  2HHH E;  1Z5B A;  1RC7 A;  1H73 A;  2M1S A;  2ODR C;  3CWV A;  1XMO I;  2DSY A;  1KIJ A;  3K85 A;  2F4V I;  4HXZ A;  1HNX E;  4X62 I;  1Z0G A;  2Q2E B;  3WU3 A;  2YZT A;  3LNU A;  2B7T A;  4F54 A;  2VF1 A;  3J80 C;  2Z5B B;  4R1F A;  2FV4 B;  1O0W A;  2GS8 A;  2O1W A;  2A2D A;  4NXN E;  4GKJ E;  4LF6 I;  1FNM A;  1N33 E;  2V88 A;  4OX9 I;  2EWL A;  2E1R A;  1XMQ E;  3B78 A;  3PYF A;  5AE1 A;  2CPN A;  2JR1 A;  1N0V C;  4K0K I;  4L5N C;  5FWK A;  3PRY A;  1U2R A;  4FWG A;  4M2Z A;  4DR3 I;  4DR4 I;  2DB2 A;  1KVK A;  1H7U A;  1Y4S A;  4JI8 I;  4ZVI A;  2HKJ A;  1YYW A;  1Y4U A;  2ODR D;  1GZ6 A;  2IOP A;  2VQF I;  3OTO I;  4X8W A;  4R03 A;  1N34 E;  4J8Z A;  4WUB A;  4GKK E;  5IT9 Q;  4AQY E;  2UUC E;  1J5E E;  1NZ0 A;  4DR7 I;  2VQE I;  4LF7 E;  1UHZ A;  2B3T B;  3QT7 A;  3WU6 A;  4DUZ E;  1H7S A;  2LJH A;  4HYM A;  5LMN I;  3JU0 A;  4JI0 I;  4NXM I;  2E1M A;  4JV5 I;  4BCA A;  3WU4 A;  2NPF A;  3T1Y E;  1ZXN A;  3LML A;  2RS7 A;  4LF9 E;  2V2Q A;  4DV7 I;  5FLX C;  4UTG A;  1T4O A;  1N32 I;  3T1H I;  4DR1 I;  4DR5 I;  5GME A;  2Z5C B;  4JI4 E;  3D4J A;  2UXD I;  4LF5 I;  4B3T E;  2L92 A;  1DAR A;  4B3M E;  1HNW I;  4X66 E;  2F8B A;  2V87 A;  1EA6 A;  3B8H A;  3QT5 A;  3HQ1 A;  3ADI A;  2IHR 1;  2X7I A;  2FGG A;  2ZM6 I;  1XNR I;  2HFS A;  4I8O A;  2Z5B A;  2RTX A;  1HR0 I;  4IZJ B;  4YY3 I;  4JI3 I;  5IT9 C;  1Z0C A;  4JYA E;  4Q28 A;  4DR6 E;  1D6T A;  3VYY A;  3HTX A;  1T4N A;  2L2K B;  1MX0 A;  1I94 E;  2UXC I;  1WUU A;  1Z0T A;  4F9C B;  2K4V A;  5IWA E;  3ADL A;  1Z5A A;  1PIE A;  1IBL E;  4MYT A;  4LF8 E;  2UUB E;  3WU5 A;  2LTS A;  4JI7 I;  3OML A;  1HNZ I;  1NHH A;  4KZS A;  3M6A A;  4DPW A;  4URL A;  2L3C A;  2BV3 A;  4DMI A;  5AE3 A;  5T6J A;  2AJ4 A;  2CGE A;  1N36 I;  4LF4 I;  3ZM7 A;  1RRE A;  2DIX A;  3ZKB A;  1WXR A;  1RR9 A;  3KWR A;  4JI6 E;  5AAS A;  2L3J A;  4YHH I;  4DV4 E;  2JOX A;  2NUF A;  4FWH A;  4DPX A;  4KHP I;  4X64 I;  4DV0 I;  2OI2 A;  4LFA E;  1N0U A;  2LBS B;  5LL6 R;  1ZM9 A;  3PYG A;  2HKE A;  4JI2 E;  3P06 A;  4DV2 I;  4LFB I;  1BKN A;  1S4E A;  4P78 A;  2O1U A;  4B3R I;  1WHQ A;  1XNQ E;  5BR8 I;  1ZM2 A;  3HPS A;  4USM A;  3IWC A;  2Z5C A;  4HY1 A;  3LTO A;  3HUL A;  4HAC B;  1X49 A;  1FJG E;  4DXL A;  3ZZT A;  4WUD A;  5FLX Q;  4PRX A;  4UT4 A;  4LFC E;  4DR2 E;  3J7Y p;  2Z5E A;  3J81 Q;  4B3S E;  2V89 A;  4X65 I;  4IZJ A;  3C4B A;  1RQ0 A;  1IBM E;  4DUY I;  2JOB A;  3RMP A;  4M30 A;  1H74 A;  2VF3 A;  1Z59 A;  4DV6 I;  2GQ0 A;  1IBK I;  5DNY A;  1XMO E;  3JAM C;  4BC7 A;  2F4V E;  1Z5C A;  4X62 E;  4L8N A;  1A6F A;  4DV1 I;  2IOQ A;  1J26 A;  1YYO A;  2UXB I;  4JI1 I;  4DV5 I;  5AE2 A;  2MDR A;  2LE2 A;  4OOG C;  1YZ9 A;  4LF6 E;  2ZIT A;  2KON A;  4WPY A;  3AV0 A;  4OX9 E;  3J81 C;  4TUI A;  3Q6M A;  3IWD A;  2LTR A;  3Q6N A;  2FTX B;  4K0K E;  4R8O A;  1ELO A;  3ZKD A;  4TUG A;  3B82 A;  1X47 A;  3J7A G;  4WFT A;  2KOU A;  4EMD A;  4DR3 E;  2JWO A;  4DR4 E;  2H36 X;  3PYE A;  1Y6Z A;  4DV3 I;  2E5L I;  2LRS A;  3ZZU A;  4JI5 I;  4JI8 E;  1SR9 A;  1Z0W A;  1UEK A;  3PYD A;  2DEI A;  2V8P A;  2UUA I;  2G7H A;  2VQF E;  3OTO E;  1MU5 A;  3GON A;  2EFG A;  1ZM3 A;  2UU9 I;  4DR7 E;  2V2V A;  5A2Q Q;  2VQE E;  5LMU I;  2HHH I;  1T4L B;  4MYU A;  3K6Q A;  4HAC A;  2A2C A;  1QZR A;  2YT4 A;  4LU9 A;  2WZO A;  4PU9 A;  5LMN E;  1FI4 A;  1EI1 A;  4JI0 E;  4NXM E;  5ADZ A;  4JV5 E;  1HNX I;  1K47 A;  3H09 A;  4P7A A;  2MC6 A;  3HPZ A;  2LUP B;  5F3W A;  2RS6 A;  2X36 A;  4DV7 E;  1N32 E;  4N3O A;  4DPY A;  4NXN I;  3T1H E;  3VK6 A;  4DR1 E;  4DR5 E;  2NUE A;  4I3H A;  4GKJ I;  4BS9 A;  2UXD E;  5GMD A;  4LF5 E;  4DU8 A;  2LJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...