2UXBE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbE02
1EI1A 3J80Q 5IT9C 2WW4A 2UUBE 4XTJA 4UT4A 5BR8I 2HFSA 2B7VA 3JAMC 3ZKDA 4OOGC 2L2KB 2Q2EB 4WUBA 4PRVA 5L3JA 4P7AA 1ELOA 4JI6E 2ZM6E 1FKAE 3K17A 4LFAE 4JI8I 4DV6I 1XMOI 4DR4I 4KHPI 4JI2E 4X66E 4Z7CA 1XMQI 3ADLA 2VQEE 4LFCI 3ZZTA 2N3HA 4DPXA 4DV0I 4URLA 2LTRA 3OTOI 2AJ4A 1H74A 4JI3E 1N33I 2DIXA 1T4OA 1H72C 2EZ6A 2F4VE 1RR9A 1IBLI 3QT8A 1XNRI 1ZXNA 2UXCI 4DR2I 1N0VC 4FWDA 4PU9A 1Z0GA 2HK2A 1HNWI 5GMEA 4KHPE 4LFAI 4K0KE 1MG7A 1MX0A 3WU5A 4LFBI 2EFGA 3T1YI 2J7KA 2L2NA 4DR7I 4B3MI 1Z0BA 3V2UC 3ADJA 4USKA 3HULA 1WHNA 2ZM6I 4FN5A 4WFTA 2DMYA 2ZBKB 4M1KA 4DR1I 4DPYA 3T1HE 2V34A 2BV3A 3T1YE 4DV4I 2NA2A 1FWLA 3PYFA 2LJPA 4JI4E 3QT7A 5LMUE 1XNQE 2DEIA 4DU7A 3QT5A 4EMDA 4P52A 4DR5I 2CZ9A 1XHKA 1PKPA 2L3CA 4NXNE 2RS6A 1U2RA 3C4BA 4JYAI 1EKZA 3ZM7A 2R42A 4JI7E 1S16A 4AQYE 4X66I 2V2ZA 4KQVA 1ZM2A 4DR2E 2NUEA 1NZ0A 4LF6E 4OX9I 4DPUA 2E5LE 1Z0EA 4RPFA 4X8WA 4X65I 1KVKA 2ZITA 1N33E 4WUCA 4B3SE 4NXME 4DR7E 2DB2A 1X49A 2DEJA 1A6FA 2RS7A 1DI2A 4HACA 1YZ9A 4JV5I 2RTXA 1H73A 4B3RE 1UEKA 2X36A 4JG4A 5GMDA 1HNXI 2NUFA 4JI6I 3K1JA 4B3SI 3H4LA 1KIJA 2BM0A 4DV7I 4DXLA 1K47A 4LF5E 1WUUA 2KHXA 1DARA 1HR0I 1N34I 4NXNI 2UXDI 2UU9E 2UUCE 4ED4A 2JVAA 1XNRE 1VISA 1FJGE 1QZRA 5BR8E 2UUBI 1N36I 1FI4A 1ZM4A 4LF4E 1IBMI 4FWGA 2L2MA 2F4VI 3VYYA 4X64I 1XNQI 4DV2I 1ZXMA 4LF8E 4DUZE 3OTOE 4JI5E 4DPTA 1IBKI 4DR1E 4B3TE 5A2QQ 1UHZA 1GQEA 1BKNA 4JI0E 1NHHA 1KTVA 2XEXA 4GKKI 3ADGA 2HHHE 2B7TA 3D4JA 4B3TI 1HNZI 2UXCE 1RQ0A 4AQYI 1ZM9A 1FNMA 2CPNA 2UXDE 3PYGA 1YYOA 4FWHA 4YY3E 1PIEA 2LUQA 2UUAI 2LJHA 1N36E 4DV7E 4LF7E 1B62A 3J7Yp 1RC7A 3J81Q 2E1RA 4YY3I 4YHHI 1HNZE 3J80C 1Z5BA 1YYKA 4B3RI 2IHR1 4DR3I 1N32E 3LTOA 4HACB 2HHHI 4B3ME 1HNWE 4ZVIA 3P1XA 5IWAI 1XMOE 4FW9A 2LUPB 4JI7I 4NXMI 1I94E 4JI8E 4DV6E 4LF7I 4K0KI 4DV3E 4YHHE 1J26A 4DPWA 1N34E 3M6AA 1NHIA 2BM1A 4M2ZA 3CWVA 3J81C 4DV0E 4DR6E 1O0WA 4LF5I 4JI1I 3LNUA 2HKEA 4X64E 1FJGI 4DV4E 1FWKA 1Z0VA 3B8HA 4GKJI 3Q1QA 4JV5E 1Z0CA 2JY9A 2RSMA 1S4EA 1X47A 2HK3A 1IBKE 1OJ4A 5CFFE 2YT4A 4X62I 4LFBE 4MYUA 3PYEA 2E5LI 4MYTA 3F0NA 4DV3I 1YYWA 4I3HA 3HTXA 1Z0TA 1J5EI 4JI2I 1STUA 3J7AM 2VQFE 4LF6I 4DU8A 5FLXQ 2LBSB 4HY1A 4USMA 4X62E 4DV1I 4DR5E 4WYQB 1EA6A 3JAMQ 1UILA 4DR6I 1RREA 1Z5AA 4DV2E 2HKJA 3J7AG 4HXZA 2NPFA 4OX9E 3WU6A 2UXBI 4JYAE 2UU9I 1ZM3A 3ADIA 3VYXA 5IWAE 3B82A 2A2DA 4DUYE 3WU4A 3ZZ0A 2UUCI 3ZZUA 1X48A 4DV5I 4PRXA 1WHQA 2LTSA 3PYDA 3V5RA 1XMQE 3C4TA 2L33A 3T1HI 5LMUI 2OI2A 1ZBTA 1QU6A 1IBME 4LF4I 4X65E 5FLXC 1Z59A 4GKJE 5LMNE 2V8PA 2NUGA 1H7UA 1Z5CA 4R1FA 2UUAE 2LRSA 4DR4E 1MU5A 4JI0I 4DUZI 4M30A 4DUYI 4Z7YA 1H7SA 2VF3A 4WUDA 3ZKBA 1HR0E 1N0UA 4JI1E 1B63A 4GKKE 1J5EE 4JI4I 3LLHA 2V2QA 1KKHA 3B78A 4DKKA 1PVGA 1T4LB 1I94I 4JI5I 2B3TB 4DV1E 2MDRA 3LPSA 2N3GA 5LMNI 2HFUA 1Z0WA 4DV5E 4LF8I 4JI3I 5IT9Q 4LF9E 1HNXE 1N32I 3QT6A 2VQFI 4LF9I 5A2QC 5LL6R 4DR3E 2A2CA 2L3JA 2UXBE 2GS8A 4HYMA 4UTGA 1D6TA 3WU3A 1NHJA 1T4NA 4LFCE 2X7IA 2R3VA 2VQEI 3GONA 2V2VA 1IBLE
chains in the Genus database with same CATH superfamily
4ZYDA 1E3PA 1EI1A 5TSEA 3J80Q 4L8NA 5IT9C 4I8OA 2WW4A 1YSAC 4BMJA 2UUBE 4XTJA 2HFSA 2Z5BA 4UT4A 5BR8I 4BCAA 5FWKA 2B7VA 3JAMC 2EOOA 2BA0D 4IZJA 3ZKDA 4OOGC 3THNA 1X6EA 3EPJA 4GZNC 2L2KB 1UDOA 2PO0B 2HC5A 4R03A 2GQ0A 2Q2EB 4IZKB 4OO1A 1OYPA 1BBOA 2EORA 4WUBA 4PRVA 4WX9A 2HGHA 5L3JA 2BB8A 2C39B 4P7AA 2EN6A 1ELOA 5DRQA 4JI6E 2EQ1A 4OZEA 2AE8A 5JEAA 3KRNA 2ZM6E 1RHYA 1FKAE 2IERA 4LFAE 1Y6ZA 3K17A 4JI8I 2EOIA 4DV6I 1XMOI 4JI2E 4X66E 4DR4I 2EPZA 3U1KA 4Z7CA 1XMQI 2EWLA 3ADLA 2PNLA 3IWDA 2VQEE 4LFCI 3ZZTA 2N3HA 2J7JA 1IQOA 4DPXA 4DV0I 2LO3A 5K36C 3H1CA 4URLA 1T39A 3EPLA 1X6FA 4MLQA 2LTRA 4R2AA 1A1LA 2EM6A 3OTOI 2AJ4A 4IJDA 1H74A 4JI3E 2I9IA 2EMWA 4LTYA 1N33I 1X5WA 2DIXA 1T4OA 2RPCA 3HPZA 2I13A 4QNKA 1H72C 5DRPA 2EZ6A 2F4VE 1RR9A 1IBLI 1KYQA 3QT8A 2E72A 1XNRI 1ZXNA 1YHCA 4KZSA 1Y4UA 2UXCI 2NN6F 4IFDD 1SFEA 4DR2I 4F54A 2PO1B 1N0VC 2IOQA 2Z5EA 4FWDA 4PU9A 3PS1A 5C0XF 2C38B 1Z0GA 3KWRA 3K85A 2HK2A 1HNWI 5AC5A 5GMEA 2V88A 3HQ1A 2YPNA 4IZJD 2YTPA 4KHPE 4LFAI 3HJCA 3EQ1A 4K0KE 1MG7A 4FW7A 2EMYA 2BA1G 2WCC3 1MX0A 2DRPA 2L92A 2YRHA 3WU5A 4LFBI 2EFGA 3QG5C 3T1YI 2J7KA 3L7ZB 1G2DC 2L2NA 4DR7I 2CT1A 3L7ZA 1Z0BA 3V2UC 2JXPA 3ADJA 1TF3A 1IMUA 4USKA 4B3MI 2D9HA 1BBGA 3JU0A 3HULA 1WHNA 2ZM6I 5F3WA 2PO0A 4FN5A 2DMYA 4WFTA 2ZBKB 4M1KA 4DR1I 4LCFA 4DPYA 5JEAF 2EOEA 1PJQA 1ZBQA 3T1HE 1DQ3A 1MGTA 2V34A 2BV3A 5T6JA 3T1YE 2LT7A 3LMLA 2BA1D 4FW6A 2CSHA 2NA2A 4DV4I 1FWLA 3PYFA 1VI7A 2LJPA 2K4VA 2VESA 4JI4E 3QT7A 2EM7A 5LMUE 2EM8A 1DGCA 1XNQE 4U3BA 1P42A 2DEIA 2WP8B 4P78A 3C6KA 2WP8A 4DU7A 3QT5A 4EMDA 2EMLA 4IFDB 4P52A 4DR5I 1UDSA 2CZ9A 1XHKA 1PKPA 2R1FA 4MDTA 2L3CA 4NXNE 2GO4A 2RS6A 2EMXA 1U2RA 3C4BA 4JYAI 1EKZA 3ZM7A 2R42A 4JI7E 1S16A 3DJWA 2EOHA 4AQYE 1UBDC 4X66I 2V2ZA 4KQVA 1ZM2A 4DR2E 4AIDA 2NUEA 4FW3A 3KZZA 2EOSA 2JPAA 5JEAD 1NZ0A 4LF6E 1EH7A 4WXDA 2DGCA 4DPUA 4OX9I 1ZU1A 2EN2A 2JOXA 2E5LE 1Z0EA 4MU0A 2YU5A 3Q6NA 2PO2A 4RPFA 4X8WA 4X65I 1KVKA 2ZITA 3KZYA 1N33E 4WUCA 4B3SE 1HK7A 4ISAA 3HPSA 2L6MA 2V89A 1Z1BA 4NXME 2DB2A 4DR7E 1X49A 2NN6D 2DEJA 1PJSA 4O4KA 1A6FA 2RS7A 2EM4A 2EMGA 1DI2A 5IXMB 1YZ9A 2WNRA 2RTXA 1H73A 4HACA 4B3RE 4BC9A 4QNJA 2WNRB 1UEKA 4JV5I 3P3GA 4N3OA 2X36A 4JG4A 3AUZA 2EN7A 5A69A 5GMDA 1HNXI 2EL4A 4OO1C 2NUFA 1BB8A 3K1JA 3H09A 3IWCA 4NZVA 4B3SI 4JI6I 5KL5A 1KIJA 3GLLA 3H4LA 4IS1C 5KL6A 2BM0A 2K7IA 4R2DA 4DXLA 4DV7I 1K47A 4F9CB 4MLVA 4LF5E 1WUUA 2KHXA 1YPNA 2EOXA 4BA1B 1DARA 1HR0I 3F6GA 1N34I 3UHMA 2EM5A 4R2PA 4FW5A 2B9DA 4WSGA 2FTXB 4BBYA 4ZYEA 4LCGA 5DNLA 4U3DA 3CDIA 2UU9E 4NXNI 2UXDI 2UUCE 2DLKA 4ED4A 2JVAA 2PO1A 2Q8UA 4IS9A 3L00A 1XNRE 3M85D 1VISA 2EN1A 4O24A 1FJGE 1NEIA 2M9AA 4KWYA 3IWBA 1QZRA 5BR8E 3P76A 2PNZB 2UUBI 1N36I 2PNZA 4MU4A 1L4SA 4ZYHA 1FI4A 1ZM4A 4LF4E 1IBMI 4FWGA 1ZAAC 2L2MA 2F4VI 3VYYA 4HEIA 4BHBA 4X64I 1XNQI 2WBTA 4NHRA 2O1UA 4DV2I 1ZXMA 4LF8E 4DUZE 2N8XA 4WPYA 2E1MA 2PRTA 2ELZA 4IZKA 4OO1B 3DD6A 3OTOE 3BBGA 2EM3A 4JI5E 4WXCA 4DPTA 1IBKI 2EPUA 4DR1E 4B3TE 5A2QQ 5AE3A 1UHZA 1GQEA 1YUIA 4AIMA 1BKNA 4JI0E 4RH8A 4O43A 1B69A 1NHHA 2YSOA 1KTVA 2JEAA 2XEXA 4GKKI 2M7QA 2JEAB 2FV4B 3ADGA 1JK2A 2HHHE 2B7TA 3D4JA 2EMAA 2O1TA 4B3TI 2V8QB 5K36D 2MC5A 4F6NA 1AAYA 3GMEA 1HNZI 2UXCE 3EPHA 1RQ0A 1OYSA 4AQYI 1EH8A 2LV2A 4J3DA 5LLQA 5C0XD 3OMLA 2EOMA 1ZM9A 1KJKA 3P3EA 1FNMA 2CPNA 5KL7A 2JEBB 2UXDE 3PYGA 2JYAA 5A6KA 1YYOA 4FWHA 4YY3E 1PIEA 2YTIA 1R6MA 2EQ3A 2C37A 2L8TA 2LUQA 1OYRA 4AM3A 2UUAI 4IFDC 2LJHA 1N36E 2YWQA 2EPOA 2V86A 4DV7E 4LF7E 2EMZA 1P47A 1B62A 3J7Yp 1RC7A 3M99B 3J81Q 4OO1F 2E1RA 4YY3I 1TN9A 2O1VA 1EH6A 4YHHI 2ENCA 1HNZE 3J80C 1Z5BA 1YYKA 4B3RI 2IHR1 5A6BD 2VF1A 1XXEA 2EPLX 4DR3I 1E3HA 1Y60A 1N32E 1UDQA 2EPCA 3LTOA 4HACB 2EM0A 2HHHI 2NN6A 1GTKA 1RMDA 4B3ME 2ODRD 3DF6A 1HNWE 5JEAE 4ZVIA 2EPMX 3P1XA 3MHSC 5IWAI 1A1IA 1XMOE 5DROA 1Y4SA 3BGHA 2ENAA 2JWOA 2M1SA 3VK6A 4FW9A 4BA1A 2LUPB 4JI7I 4NXMI 1I94E 4TUGA 1GZ6A 4JI8E 4DV6E 4F2JC 4LF7I 4F9BB 1TF6A 3RMPA 4K0KI 4DV3E 5KL4A 4HTGA 4BHCA 5DNYA 2JR1A 4YHHE 2EPRA 1J26A 1N34E 4DPWA 3M6AA 1NHIA 2ADRA 2FGGA 2JOBA 2BM1A 2NABA 2MKDA 4M2ZA 3CWVA 3J81C 3M85G 4DV0E 4DR6E 1O0WA 4LF5I 1USVA 4JI1I 3LNUA 2HKEA 2EQ0A 2WBSA 4X64E 1JK1A 1YH8A 3B4TA 5A6BA 2WBUA 4DV4E 1FJGI 1FWKA 1Z0VA 2JT2A 5A6AA 3FIGA 2A25A 4R2EA 1YFHA 2LCEA 2Z5BB 1SR9A 3B8HA 4GKJI 3Q1QA 2YTQA 2HJJA 4JV5E 1Z0CA 2JY9A 2RSMA 4J8ZA 2H36X 1S4EA 2EM9A 1X47A 2HK3A 3EPKA 1IBKE 5CFFE 1PDAA 2EPXA 1OJ4A 2YT4A 1R6LA 3U1YA 1QNTA 2DMIA 4X62I 4F6MA 3Q6MA 4LFBE 4N4RB 4FK5C 4MU1A 4MYUA 4M9VC 2F8BA 4R2CA 4OO1E 3PYEA 2EPPA 1UN6B 2EOFA 2E5LI 5K36B 4MYTA 2Z5CB 3F0NA 5K36A 2V83A 2O3ZA 4DV3I 1F2IG 2GLIA 2EMKA 1A1FA 5EKWA 3MHHC 4LOMA 4Q28A 1ZR9A 2EN4A 2GPIA 3M7ND 1YUJA 1YYWA 2YSPA 4GEQB 3HTXA 3CDJA 4I3HA 1Z0TA 5DRRA 2EE8A 1A1KA 1J5EI 2EP3A 2LJUA 1STUA 4GQUA 2VQFE 2F1DA 4JI2I 4LF6I 3J7AM 3AV0A 1T38A 4NBQA 4ZYGA 4DU8A 2M4IA 1LLMC 4IFDF 1N3GA 3BIDA 2LBSB 5FLXQ 4HY1A 4USMA 5C0XA 4X62E 4DMIA 2EN3A 4DR5E 4DV1I 1WJPA 2EMIA 4WYQB 1EA6A 2IOPA 4RHBB 2C37B 4BC7A 4FW4A 3JAMQ 1UILA 2BR2B 3HKMA 4DR6I 1A1HA 1RREA 2YTJA 4L5NC 4DV2E 2YTFA 1Z5AA 2HKJA 5K36E 3J7AG 4HXZA 4OX9E 2NPFA 4LCHA 2PNMA 3WU6A 4P7DA 2UXBI 4JYAE 3PS3A 2V85A 5A6JA 2UU9I 1ZM3A 3ADIA 2EJ4A 3VYXA 2V87A 2R76A 5IV8B 5IWAE 2A2DA 3B82A 3JTZA 1WRJA 2NN6B 2LE2A 1USUA 5DNXA 5ELWA 2YTGA 4DUYE 5AE1A 3WU4A 3ZZ0A 2UUCI 2DSYA 3MSWA 3ZZUA 5ADZA 1X48A 2WZOA 4PRXA 3P06A 2YTDA 4DV5I 1WHQA 2LVHA 2LTSA 3PYDA 3V5RA 1X6HA 3BF2A 4R2QA 1XMQE 3C4TA 2L33A 2YRKA 4BA2A 3T1HI 4BA2B 5LMUI 2OI2A 1ZBTA 1QU6A 1IBME 4LPFA 4LF4I 2YU8A 4X65E 5FLXC 2EPKX 2C39A 3F6HA 1Z59A 1UDNA 4GKJE 2EMBA 5LMNE 2V8PA 2NUGA 2DLQA 1H7UA 1Z5CA 4R1FA 2UUAE 2LRSA 4DR4E 1MU5A 4KHPI 2CTDA 2IESA 5KL2A 4JI0I 3UK3C 1AH5A 2GO3A 4R8OA 4DUZI 4M30A 2EPNA 4DUYI 4Z7YA 4IFDA 1H7SA 2YZTA 2VF3A 4BS9A 5C0XC 4WUDA 3C6MA 3ZKBA 1HR0E 4IFDE 1N0UA 4JI1E 3ZOQB 3HXLA 5AASA 4IZJB 2JEBA 2KONA 1IQSA 1WXRA 1B63A 4Q35B 4WSPA 4O5GA 3M7NG 2EMCA 4X9JA 4GKKE 1J5EE 4JI4I 3LLHA 2V2QA 1KKHA 3B78A 4F9AB 5K36F 4DKKA 2J65A 3TQMA 2EOZA 2YTNA 5C0XE 4MU3A 1PVGA 2O1WA 2EOJA 3VHTB 1T4LB 4R2SA 5JEAC 5KL3A 2PO2B 2GHFA 3GCMA 1I94I 2MKNA 4JI5I 5JEAB 2EOYA 2B3TB 4DV1E 2MDRA 3LPSA 2N3GA 2Z5CA 5LMNI 3ECRA 2CVEA 2HFUA 1Z0WA 4DV5E 2BA0G 4OKGA 4M0VA 2JP9A 4LF8I 3NZKA 4JI3I 2LMZA 2C38A 5IT9Q 2MDGA 5AC4A 4LF9E 2ODRC 2YRMA 2EL6A 1HNXE 2VE7C 2MC6A 2NN6C 2ELYA 2JE6B 3PRYA 2CGEA 2JE6A 1N32I 2RSIA 1PJTA 2EMHA 2BBGA 4LU9A 1Y5YA 3QT6A 5EL9A 1G2FC 2EMFA 2VQFI 4OO1D 5C0XB 1A1GA 4LF9I 3P3CA 5A2QC 3K6QA 5LL6R 4DR3E 2BR2A 1X3CA 1MEYC 2EM2A 2A2CA 2L3JA 2NN6E 3PS2A 2UXBE 1NCSA 2GS8A 4HYMA 4UTGA 2G7HA 1D6TA 4R2RA 1A1JA 4MQYA 2YTEA 4TUIA 3WU3A 2YTOA 2KOUA 1NHJA 2EPAA 2ENHA 1T4NA 4LFCE 3THOB 2VRDA 2R3VA 2X7IA 2CG9A 3GONA 2RQLA 2EN8A 2VQEI 2V2VA 2EL5A 1IBLE 5AE2A 2EOQA
chains in the Genus database with same CATH topology
1EI1A 3J80Q 4L8NA 5IT9C 4I8OA 2WW4A 2UUBE 4BMJA 4XTJA 4UT4A 2HFSA 2Z5BA 5BR8I 4BCAA 5FWKA 2B7VA 3JAMC 4IZJA 3ZKDA 4OOGC 2L2KB 4R03A 2GQ0A 2Q2EB 4IZKB 4WUBA 4PRVA 5L3JA 4P7AA 1ELOA 4JI6E 2ZM6E 1FKAE 3K17A 4LFAE 1Y6ZA 4JI8I 4DV6I 1XMOI 4DR4I 4KHPI 4JI2E 4X66E 4Z7CA 1XMQI 2EWLA 3ADLA 2PNLA 3IWDA 2VQEE 4LFCI 3ZZTA 2N3HA 4DPXA 4DV0I 4URLA 2LTRA 3OTOI 2AJ4A 1H74A 4JI3E 4LTYA 1N33I 2DIXA 1T4OA 3HPZA 1H72C 2EZ6A 2F4VE 1RR9A 1IBLI 3QT8A 1XNRI 1ZXNA 4KZSA 1Y4UA 2UXCI 4DR2I 4F54A 1N0VC 2IOQA 2Z5EA 4FWDA 4PU9A 1Z0GA 3KWRA 3K85A 2HK2A 1HNWI 5GMEA 2V88A 3HQ1A 4IZJD 4KHPE 4LFAI 3HJCA 4K0KE 1MG7A 1MX0A 2L92A 3WU5A 4LFBI 2EFGA 3T1YI 2J7KA 2L2NA 4DR7I 4B3MI 1Z0BA 3V2UC 3ADJA 4USKA 3JU0A 3HULA 1WHNA 2ZM6I 5F3WA 4FN5A 2DMYA 4WFTA 2ZBKB 4M1KA 4DR1I 4DPYA 1ZBQA 3T1HE 1DQ3A 2V34A 2BV3A 5T6JA 3T1YE 3LMLA 4DV4I 2NA2A 1FWLA 3PYFA 2LJPA 2K4VA 4JI4E 3QT7A 5LMUE 1XNQE 2DEIA 4P78A 4DU7A 3QT5A 4EMDA 4P52A 4DR5I 2CZ9A 1XHKA 1PKPA 2L3CA 4NXNE 2RS6A 1U2RA 3C4BA 4JYAI 1EKZA 3ZM7A 2R42A 4JI7E 1S16A 3DJWA 4AQYE 4X66I 2V2ZA 4KQVA 1ZM2A 4DR2E 2NUEA 1NZ0A 4LF6E 4OX9I 4DPUA 2JOXA 2E5LE 1Z0EA 3Q6NA 4RPFA 4X8WA 4X65I 1KVKA 2ZITA 1N33E 4WUCA 4B3SE 1HK7A 3HPSA 2L6MA 2V89A 4DR7E 4NXME 2DB2A 1X49A 2DEJA 1A6FA 2RS7A 1DI2A 4HACA 1YZ9A 4JV5I 2RTXA 1H73A 4B3RE 4BC9A 1UEKA 4N3OA 2X36A 4JG4A 3AUZA 5GMDA 1HNXI 2NUFA 4JI6I 3K1JA 3H09A 3IWCA 4B3SI 3H4LA 1KIJA 2BM0A 4DV7I 4DXLA 1K47A 4F9CB 4LF5E 1WUUA 2KHXA 1DARA 1HR0I 3F6GA 1N34I 2B9DA 2FTXB 4BBYA 4NXNI 2UXDI 2UU9E 2UUCE 4ED4A 2JVAA 1XNRE 1VISA 1FJGE 3IWBA 1QZRA 5BR8E 2UUBI 1N36I 1FI4A 1ZM4A 4LF4E 1IBMI 4FWGA 2L2MA 2F4VI 3VYYA 4X64I 1XNQI 4DV2I 2O1UA 1ZXMA 4LF8E 4DUZE 4WPYA 2E1MA 4IZKA 3OTOE 4JI5E 4DPTA 1IBKI 4DR1E 4B3TE 5A2QQ 5AE3A 1UHZA 1GQEA 1BKNA 4JI0E 1NHHA 1KTVA 2XEXA 4GKKI 2M7QA 2FV4B 3ADGA 2HHHE 2B7TA 3D4JA 2O1TA 4B3TI 2V8QB 2MC5A 1HNZI 2UXCE 1RQ0A 4AQYI 3OMLA 1ZM9A 1FNMA 2CPNA 2UXDE 3PYGA 1YYOA 4FWHA 4YY3E 1PIEA 2L8TA 2LUQA 2UUAI 2LJHA 1N36E 2V86A 4DV7E 4LF7E 1B62A 3J7Yp 1RC7A 3J81Q 2E1RA 4YY3I 2O1VA 4YHHI 1HNZE 3J80C 1Z5BA 1YYKA 4B3RI 2IHR1 4DR3I 2VF1A 1N32E 3LTOA 4HACB 2HHHI 4B3ME 2ODRD 3DF6A 1HNWE 4ZVIA 3P1XA 5IWAI 1XMOE 1Y4SA 2JWOA 2M1SA 3VK6A 4FW9A 2LUPB 4JI7I 4NXMI 1I94E 4TUGA 1GZ6A 4JI8E 4DV6E 4LF7I 4F9BB 3RMPA 4K0KI 4DV3E 5DNYA 4YHHE 2JR1A 1J26A 4DPWA 1N34E 3M6AA 1NHIA 2FGGA 2JOBA 2BM1A 4M2ZA 3CWVA 3J81C 4DV0E 4DR6E 1O0WA 4LF5I 1USVA 4JI1I 3LNUA 2HKEA 4X64E 1FJGI 4DV4E 1FWKA 1Z0VA 3FIGA 3B8HA 2Z5BB 1SR9A 4GKJI 3Q1QA 4JV5E 1Z0CA 2JY9A 2RSMA 4J8ZA 2H36X 1S4EA 1X47A 2HK3A 1IBKE 1OJ4A 5CFFE 2YT4A 4X62I 3Q6MA 4LFBE 4MYUA 2F8BA 3PYEA 2E5LI 4MYTA 2Z5CB 3F0NA 2V83A 4DV3I 4Q28A 1YYWA 4GEQB 3HTXA 4I3HA 1Z0TA 1J5EI 4JI2I 1STUA 3J7AM 2VQFE 4LF6I 3AV0A 4DU8A 2M4IA 5FLXQ 2LBSB 4HY1A 4USMA 4X62E 4DMIA 4DR5E 4DV1I 4WYQB 1EA6A 2IOPA 4BC7A 3JAMQ 1UILA 4DR6I 1RREA 4L5NC 4DV2E 1Z5AA 2HKJA 3J7AG 4HXZA 4OX9E 2NPFA 3WU6A 2PNMA 4P7DA 2UXBI 4JYAE 2V85A 2UU9I 1ZM3A 3ADIA 3VYXA 2V87A 5IWAE 3B82A 2A2DA 3JTZA 2LE2A 1USUA 4DUYE 5AE1A 3WU4A 3ZZ0A 2UUCI 2DSYA 3MSWA 3ZZUA 5ADZA 1X48A 2WZOA 4PRXA 3P06A 4DV5I 1WHQA 2LTSA 3PYDA 3V5RA 1XMQE 3C4TA 2L33A 3T1HI 5LMUI 2OI2A 1ZBTA 1QU6A 1IBME 4LF4I 4X65E 5FLXC 3F6HA 1Z59A 4GKJE 5LMNE 2V8PA 2NUGA 1H7UA 1Z5CA 4R1FA 2UUAE 2LRSA 4DR4E 1MU5A 4JI0I 4R8OA 4DUZI 4M30A 4DUYI 4Z7YA 1H7SA 2YZTA 2VF3A 4BS9A 4WUDA 3ZKBA 1HR0E 1N0UA 4JI1E 3ZOQB 3HXLA 5AASA 4IZJB 2KONA 1WXRA 1B63A 4WSPA 4GKKE 1J5EE 4JI4I 3LLHA 2V2QA 1KKHA 3B78A 4F9AB 4DKKA 1PVGA 2O1WA 1T4LB 1I94I 4JI5I 2B3TB 4DV1E 2MDRA 3LPSA 2N3GA 2Z5CA 5LMNI 2HFUA 1Z0WA 4DV5E 4M0VA 4LF8I 4JI3I 2LMZA 5IT9Q 4LF9E 2ODRC 1HNXE 2VE7C 2MC6A 3PRYA 2CGEA 1N32I 4LU9A 3QT6A 2VQFI 4LF9I 5A2QC 3K6QA 5LL6R 4DR3E 2A2CA 2L3JA 2UXBE 2GS8A 4HYMA 4UTGA 2G7HA 1D6TA 4TUIA 3WU3A 2KOUA 1NHJA 1T4NA 4LFCE 2X7IA 2R3VA 2VQEI 2CG9A 3GONA 2V2VA 1IBLE 5AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI1 A;  3J80 Q;  5IT9 C;  2WW4 A;  2UUB E;  4XTJ A;  4UT4 A;  5BR8 I;  2HFS A;  2B7V A;  3JAM C;  3ZKD A;  4OOG C;  2L2K B;  2Q2E B;  4WUB A;  4PRV A;  5L3J A;  4P7A A;  1ELO A;  4JI6 E;  2ZM6 E;  1FKA E;  3K17 A;  4LFA E;  4JI8 I;  4DV6 I;  1XMO I;  4DR4 I;  4KHP I;  4JI2 E;  4X66 E;  4Z7C A;  1XMQ I;  3ADL A;  2VQE E;  4LFC I;  3ZZT A;  2N3H A;  4DPX A;  4DV0 I;  4URL A;  2LTR A;  3OTO I;  2AJ4 A;  1H74 A;  4JI3 E;  1N33 I;  2DIX A;  1T4O A;  1H72 C;  2EZ6 A;  2F4V E;  1RR9 A;  1IBL I;  3QT8 A;  1XNR I;  1ZXN A;  2UXC I;  4DR2 I;  1N0V C;  4FWD A;  4PU9 A;  1Z0G A;  2HK2 A;  1HNW I;  5GME A;  4KHP E;  4LFA I;  4K0K E;  1MG7 A;  1MX0 A;  3WU5 A;  4LFB I;  2EFG A;  3T1Y I;  2J7K A;  2L2N A;  4DR7 I;  4B3M I;  1Z0B A;  3V2U C;  3ADJ A;  4USK A;  3HUL A;  1WHN A;  2ZM6 I;  4FN5 A;  4WFT A;  2DMY A;  2ZBK B;  4M1K A;  4DR1 I;  4DPY A;  3T1H E;  2V34 A;  2BV3 A;  3T1Y E;  4DV4 I;  2NA2 A;  1FWL A;  3PYF A;  2LJP A;  4JI4 E;  3QT7 A;  5LMU E;  1XNQ E;  2DEI A;  4DU7 A;  3QT5 A;  4EMD A;  4P52 A;  4DR5 I;  2CZ9 A;  1XHK A;  1PKP A;  2L3C A;  4NXN E;  2RS6 A;  1U2R A;  3C4B A;  4JYA I;  1EKZ A;  3ZM7 A;  2R42 A;  4JI7 E;  1S16 A;  4AQY E;  4X66 I;  2V2Z A;  4KQV A;  1ZM2 A;  4DR2 E;  2NUE A;  1NZ0 A;  4LF6 E;  4OX9 I;  4DPU A;  2E5L E;  1Z0E A;  4RPF A;  4X8W A;  4X65 I;  1KVK A;  2ZIT A;  1N33 E;  4WUC A;  4B3S E;  4NXM E;  4DR7 E;  2DB2 A;  1X49 A;  2DEJ A;  1A6F A;  2RS7 A;  1DI2 A;  4HAC A;  1YZ9 A;  4JV5 I;  2RTX A;  1H73 A;  4B3R E;  1UEK A;  2X36 A;  4JG4 A;  5GMD A;  1HNX I;  2NUF A;  4JI6 I;  3K1J A;  4B3S I;  3H4L A;  1KIJ A;  2BM0 A;  4DV7 I;  4DXL A;  1K47 A;  4LF5 E;  1WUU A;  2KHX A;  1DAR A;  1HR0 I;  1N34 I;  4NXN I;  2UXD I;  2UU9 E;  2UUC E;  4ED4 A;  2JVA A;  1XNR E;  1VIS A;  1FJG E;  1QZR A;  5BR8 E;  2UUB I;  1N36 I;  1FI4 A;  1ZM4 A;  4LF4 E;  1IBM I;  4FWG A;  2L2M A;  2F4V I;  3VYY A;  4X64 I;  1XNQ I;  4DV2 I;  1ZXM A;  4LF8 E;  4DUZ E;  3OTO E;  4JI5 E;  4DPT A;  1IBK I;  4DR1 E;  4B3T E;  5A2Q Q;  1UHZ A;  1GQE A;  1BKN A;  4JI0 E;  1NHH A;  1KTV A;  2XEX A;  4GKK I;  3ADG A;  2HHH E;  2B7T A;  3D4J A;  4B3T I;  1HNZ I;  2UXC E;  1RQ0 A;  4AQY I;  1ZM9 A;  1FNM A;  2CPN A;  2UXD E;  3PYG A;  1YYO A;  4FWH A;  4YY3 E;  1PIE A;  2LUQ A;  2UUA I;  2LJH A;  1N36 E;  4DV7 E;  4LF7 E;  1B62 A;  3J7Y p;  1RC7 A;  3J81 Q;  2E1R A;  4YY3 I;  4YHH I;  1HNZ E;  3J80 C;  1Z5B A;  1YYK A;  4B3R I;  2IHR 1;  4DR3 I;  1N32 E;  3LTO A;  4HAC B;  2HHH I;  4B3M E;  1HNW E;  4ZVI A;  3P1X A;  5IWA I;  1XMO E;  4FW9 A;  2LUP B;  4JI7 I;  4NXM I;  1I94 E;  4JI8 E;  4DV6 E;  4LF7 I;  4K0K I;  4DV3 E;  4YHH E;  1J26 A;  4DPW A;  1N34 E;  3M6A A;  1NHI A;  2BM1 A;  4M2Z A;  3CWV A;  3J81 C;  4DV0 E;  4DR6 E;  1O0W A;  4LF5 I;  4JI1 I;  3LNU A;  2HKE A;  4X64 E;  1FJG I;  4DV4 E;  1FWK A;  1Z0V A;  3B8H A;  4GKJ I;  3Q1Q A;  4JV5 E;  1Z0C A;  2JY9 A;  2RSM A;  1S4E A;  1X47 A;  2HK3 A;  1IBK E;  1OJ4 A;  5CFF E;  2YT4 A;  4X62 I;  4LFB E;  4MYU A;  3PYE A;  2E5L I;  4MYT A;  3F0N A;  4DV3 I;  1YYW A;  4I3H A;  3HTX A;  1Z0T A;  1J5E I;  4JI2 I;  1STU A;  3J7A M;  2VQF E;  4LF6 I;  4DU8 A;  5FLX Q;  2LBS B;  4HY1 A;  4USM A;  4X62 E;  4DV1 I;  4DR5 E;  4WYQ B;  1EA6 A;  3JAM Q;  1UIL A;  4DR6 I;  1RRE A;  1Z5A A;  4DV2 E;  2HKJ A;  3J7A G;  4HXZ A;  2NPF A;  4OX9 E;  3WU6 A;  2UXB I;  4JYA E;  2UU9 I;  1ZM3 A;  3ADI A;  3VYX A;  5IWA E;  3B82 A;  2A2D A;  4DUY E;  3WU4 A;  3ZZ0 A;  2UUC I;  3ZZU A;  1X48 A;  4DV5 I;  4PRX A;  1WHQ A;  2LTS A;  3PYD A;  3V5R A;  1XMQ E;  3C4T A;  2L33 A;  3T1H I;  5LMU I;  2OI2 A;  1ZBT A;  1QU6 A;  1IBM E;  4LF4 I;  4X65 E;  5FLX C;  1Z59 A;  4GKJ E;  5LMN E;  2V8P A;  2NUG A;  1H7U A;  1Z5C A;  4R1F A;  2UUA E;  2LRS A;  4DR4 E;  1MU5 A;  4JI0 I;  4DUZ I;  4M30 A;  4DUY I;  4Z7Y A;  1H7S A;  2VF3 A;  4WUD A;  3ZKB A;  1HR0 E;  1N0U A;  4JI1 E;  1B63 A;  4GKK E;  1J5E E;  4JI4 I;  3LLH A;  2V2Q A;  1KKH A;  3B78 A;  4DKK A;  1PVG A;  1T4L B;  1I94 I;  4JI5 I;  2B3T B;  4DV1 E;  2MDR A;  3LPS A;  2N3G A;  5LMN I;  2HFU A;  1Z0W A;  4DV5 E;  4LF8 I;  4JI3 I;  5IT9 Q;  4LF9 E;  1HNX E;  1N32 I;  3QT6 A;  2VQF I;  4LF9 I;  5A2Q C;  5LL6 R;  4DR3 E;  2A2C A;  2L3J A;  2UXB E;  2GS8 A;  4HYM A;  4UTG A;  1D6T A;  3WU3 A;  1NHJ A;  1T4N A;  4LFC E;  2X7I A;  2R3V A;  2VQE I;  3GON A;  2V2V A;  1IBL E; 
#chains in the Genus database with same CATH topology
 4ZYD A;  1E3P A;  1EI1 A;  5TSE A;  3J80 Q;  4L8N A;  5IT9 C;  4I8O A;  2WW4 A;  1YSA C;  4BMJ A;  2UUB E;  4XTJ A;  2HFS A;  2Z5B A;  4UT4 A;  5BR8 I;  4BCA A;  5FWK A;  2B7V A;  3JAM C;  2EOO A;  2BA0 D;  4IZJ A;  3ZKD A;  4OOG C;  3THN A;  1X6E A;  3EPJ A;  4GZN C;  2L2K B;  1UDO A;  2PO0 B;  2HC5 A;  4R03 A;  2GQ0 A;  2Q2E B;  4IZK B;  4OO1 A;  1OYP A;  1BBO A;  2EOR A;  4WUB A;  4PRV A;  4WX9 A;  2HGH A;  5L3J A;  2BB8 A;  2C39 B;  4P7A A;  2EN6 A;  1ELO A;  5DRQ A;  4JI6 E;  2EQ1 A;  4OZE A;  2AE8 A;  5JEA A;  3KRN A;  2ZM6 E;  1RHY A;  1FKA E;  2IER A;  4LFA E;  1Y6Z A;  3K17 A;  4JI8 I;  2EOI A;  4DV6 I;  1XMO I;  4JI2 E;  4X66 E;  4DR4 I;  2EPZ A;  3U1K A;  4Z7C A;  1XMQ I;  2EWL A;  3ADL A;  2PNL A;  3IWD A;  2VQE E;  4LFC I;  3ZZT A;  2N3H A;  2J7J A;  1IQO A;  4DPX A;  4DV0 I;  2LO3 A;  5K36 C;  3H1C A;  4URL A;  1T39 A;  3EPL A;  1X6F A;  4MLQ A;  2LTR A;  4R2A A;  1A1L A;  2EM6 A;  3OTO I;  2AJ4 A;  4IJD A;  1H74 A;  4JI3 E;  2I9I A;  2EMW A;  4LTY A;  1N33 I;  1X5W A;  2DIX A;  1T4O A;  2RPC A;  3HPZ A;  2I13 A;  4QNK A;  1H72 C;  5DRP A;  2EZ6 A;  2F4V E;  1RR9 A;  1IBL I;  1KYQ A;  3QT8 A;  2E72 A;  1XNR I;  1ZXN A;  1YHC A;  4KZS A;  1Y4U A;  2UXC I;  2NN6 F;  4IFD D;  1SFE A;  4DR2 I;  4F54 A;  2PO1 B;  1N0V C;  2IOQ A;  2Z5E A;  4FWD A;  4PU9 A;  3PS1 A;  5C0X F;  2C38 B;  1Z0G A;  3KWR A;  3K85 A;  2HK2 A;  1HNW I;  5AC5 A;  5GME A;  2V88 A;  3HQ1 A;  2YPN A;  4IZJ D;  2YTP A;  4KHP E;  4LFA I;  3HJC A;  3EQ1 A;  4K0K E;  1MG7 A;  4FW7 A;  2EMY A;  2BA1 G;  2WCC 3;  1MX0 A;  2DRP A;  2L92 A;  2YRH A;  3WU5 A;  4LFB I;  2EFG A;  3QG5 C;  3T1Y I;  2J7K A;  3L7Z B;  1G2D C;  2L2N A;  4DR7 I;  2CT1 A;  3L7Z A;  1Z0B A;  3V2U C;  2JXP A;  3ADJ A;  1TF3 A;  1IMU A;  4USK A;  4B3M I;  2D9H A;  1BBG A;  3JU0 A;  3HUL A;  1WHN A;  2ZM6 I;  5F3W A;  2PO0 A;  4FN5 A;  2DMY A;  4WFT A;  2ZBK B;  4M1K A;  4DR1 I;  4LCF A;  4DPY A;  5JEA F;  2EOE A;  1PJQ A;  1ZBQ A;  3T1H E;  1DQ3 A;  1MGT A;  2V34 A;  2BV3 A;  5T6J A;  3T1Y E;  2LT7 A;  3LML A;  2BA1 D;  4FW6 A;  2CSH A;  2NA2 A;  4DV4 I;  1FWL A;  3PYF A;  1VI7 A;  2LJP A;  2K4V A;  2VES A;  4JI4 E;  3QT7 A;  2EM7 A;  5LMU E;  2EM8 A;  1DGC A;  1XNQ E;  4U3B A;  1P42 A;  2DEI A;  2WP8 B;  4P78 A;  3C6K A;  2WP8 A;  4DU7 A;  3QT5 A;  4EMD A;  2EML A;  4IFD B;  4P52 A;  4DR5 I;  1UDS A;  2CZ9 A;  1XHK A;  1PKP A;  2R1F A;  4MDT A;  2L3C A;  4NXN E;  2GO4 A;  2RS6 A;  2EMX A;  1U2R A;  3C4B A;  4JYA I;  1EKZ A;  3ZM7 A;  2R42 A;  4JI7 E;  1S16 A;  3DJW A;  2EOH A;  4AQY E;  1UBD C;  4X66 I;  2V2Z A;  4KQV A;  1ZM2 A;  4DR2 E;  4AID A;  2NUE A;  4FW3 A;  3KZZ A;  2EOS A;  2JPA A;  5JEA D;  1NZ0 A;  4LF6 E;  1EH7 A;  4WXD A;  2DGC A;  4DPU A;  4OX9 I;  1ZU1 A;  2EN2 A;  2JOX A;  2E5L E;  1Z0E A;  4MU0 A;  2YU5 A;  3Q6N A;  2PO2 A;  4RPF A;  4X8W A;  4X65 I;  1KVK A;  2ZIT A;  3KZY A;  1N33 E;  4WUC A;  4B3S E;  1HK7 A;  4ISA A;  3HPS A;  2L6M A;  2V89 A;  1Z1B A;  4NXM E;  2DB2 A;  4DR7 E;  1X49 A;  2NN6 D;  2DEJ A;  1PJS A;  4O4K A;  1A6F A;  2RS7 A;  2EM4 A;  2EMG A;  1DI2 A;  5IXM B;  1YZ9 A;  2WNR A;  2RTX A;  1H73 A;  4HAC A;  4B3R E;  4BC9 A;  4QNJ A;  2WNR B;  1UEK A;  4JV5 I;  3P3G A;  4N3O A;  2X36 A;  4JG4 A;  3AUZ A;  2EN7 A;  5A69 A;  5GMD A;  1HNX I;  2EL4 A;  4OO1 C;  2NUF A;  1BB8 A;  3K1J A;  3H09 A;  3IWC A;  4NZV A;  4B3S I;  4JI6 I;  5KL5 A;  1KIJ A;  3GLL A;  3H4L A;  4IS1 C;  5KL6 A;  2BM0 A;  2K7I A;  4R2D A;  4DXL A;  4DV7 I;  1K47 A;  4F9C B;  4MLV A;  4LF5 E;  1WUU A;  2KHX A;  1YPN A;  2EOX A;  4BA1 B;  1DAR A;  1HR0 I;  3F6G A;  1N34 I;  3UHM A;  2EM5 A;  4R2P A;  4FW5 A;  2B9D A;  4WSG A;  2FTX B;  4BBY A;  4ZYE A;  4LCG A;  5DNL A;  4U3D A;  3CDI A;  2UU9 E;  4NXN I;  2UXD I;  2UUC E;  2DLK A;  4ED4 A;  2JVA A;  2PO1 A;  2Q8U A;  4IS9 A;  3L00 A;  1XNR E;  3M85 D;  1VIS A;  2EN1 A;  4O24 A;  1FJG E;  1NEI A;  2M9A A;  4KWY A;  3IWB A;  1QZR A;  5BR8 E;  3P76 A;  2PNZ B;  2UUB I;  1N36 I;  2PNZ A;  4MU4 A;  1L4S A;  4ZYH A;  1FI4 A;  1ZM4 A;  4LF4 E;  1IBM I;  4FWG A;  1ZAA C;  2L2M A;  2F4V I;  3VYY A;  4HEI A;  4BHB A;  4X64 I;  1XNQ I;  2WBT A;  4NHR A;  2O1U A;  4DV2 I;  1ZXM A;  4LF8 E;  4DUZ E;  2N8X A;  4WPY A;  2E1M A;  2PRT A;  2ELZ A;  4IZK A;  4OO1 B;  3DD6 A;  3OTO E;  3BBG A;  2EM3 A;  4JI5 E;  4WXC A;  4DPT A;  1IBK I;  2EPU A;  4DR1 E;  4B3T E;  5A2Q Q;  5AE3 A;  1UHZ A;  1GQE A;  1YUI A;  4AIM A;  1BKN A;  4JI0 E;  4RH8 A;  4O43 A;  1B69 A;  1NHH A;  2YSO A;  1KTV A;  2JEA A;  2XEX A;  4GKK I;  2M7Q A;  2JEA B;  2FV4 B;  3ADG A;  1JK2 A;  2HHH E;  2B7T A;  3D4J A;  2EMA A;  2O1T A;  4B3T I;  2V8Q B;  5K36 D;  2MC5 A;  4F6N A;  1AAY A;  3GME A;  1HNZ I;  2UXC E;  3EPH A;  1RQ0 A;  1OYS A;  4AQY I;  1EH8 A;  2LV2 A;  4J3D A;  5LLQ A;  5C0X D;  3OML A;  2EOM A;  1ZM9 A;  1KJK A;  3P3E A;  1FNM A;  2CPN A;  5KL7 A;  2JEB B;  2UXD E;  3PYG A;  2JYA A;  5A6K A;  1YYO A;  4FWH A;  4YY3 E;  1PIE A;  2YTI A;  1R6M A;  2EQ3 A;  2C37 A;  2L8T A;  2LUQ A;  1OYR A;  4AM3 A;  2UUA I;  4IFD C;  2LJH A;  1N36 E;  2YWQ A;  2EPO A;  2V86 A;  4DV7 E;  4LF7 E;  2EMZ A;  1P47 A;  1B62 A;  3J7Y p;  1RC7 A;  3M99 B;  3J81 Q;  4OO1 F;  2E1R A;  4YY3 I;  1TN9 A;  2O1V A;  1EH6 A;  4YHH I;  2ENC A;  1HNZ E;  3J80 C;  1Z5B A;  1YYK A;  4B3R I;  2IHR 1;  5A6B D;  2VF1 A;  1XXE A;  2EPL X;  4DR3 I;  1E3H A;  1Y60 A;  1N32 E;  1UDQ A;  2EPC A;  3LTO A;  4HAC B;  2EM0 A;  2HHH I;  2NN6 A;  1GTK A;  1RMD A;  4B3M E;  2ODR D;  3DF6 A;  1HNW E;  5JEA E;  4ZVI A;  2EPM X;  3P1X A;  3MHS C;  5IWA I;  1A1I A;  1XMO E;  5DRO A;  1Y4S A;  3BGH A;  2ENA A;  2JWO A;  2M1S A;  3VK6 A;  4FW9 A;  4BA1 A;  2LUP B;  4JI7 I;  4NXM I;  1I94 E;  4TUG A;  1GZ6 A;  4JI8 E;  4DV6 E;  4F2J C;  4LF7 I;  4F9B B;  1TF6 A;  3RMP A;  4K0K I;  4DV3 E;  5KL4 A;  4HTG A;  4BHC A;  5DNY A;  2JR1 A;  4YHH E;  2EPR A;  1J26 A;  1N34 E;  4DPW A;  3M6A A;  1NHI A;  2ADR A;  2FGG A;  2JOB A;  2BM1 A;  2NAB A;  2MKD A;  4M2Z A;  3CWV A;  3J81 C;  3M85 G;  4DV0 E;  4DR6 E;  1O0W A;  4LF5 I;  1USV A;  4JI1 I;  3LNU A;  2HKE A;  2EQ0 A;  2WBS A;  4X64 E;  1JK1 A;  1YH8 A;  3B4T A;  5A6B A;  2WBU A;  4DV4 E;  1FJG I;  1FWK A;  1Z0V A;  2JT2 A;  5A6A A;  3FIG A;  2A25 A;  4R2E A;  1YFH A;  2LCE A;  2Z5B B;  1SR9 A;  3B8H A;  4GKJ I;  3Q1Q A;  2YTQ A;  2HJJ A;  4JV5 E;  1Z0C A;  2JY9 A;  2RSM A;  4J8Z A;  2H36 X;  1S4E A;  2EM9 A;  1X47 A;  2HK3 A;  3EPK A;  1IBK E;  5CFF E;  1PDA A;  2EPX A;  1OJ4 A;  2YT4 A;  1R6L A;  3U1Y A;  1QNT A;  2DMI A;  4X62 I;  4F6M A;  3Q6M A;  4LFB E;  4N4R B;  4FK5 C;  4MU1 A;  4MYU A;  4M9V C;  2F8B A;  4R2C A;  4OO1 E;  3PYE A;  2EPP A;  1UN6 B;  2EOF A;  2E5L I;  5K36 B;  4MYT A;  2Z5C B;  3F0N A;  5K36 A;  2V83 A;  2O3Z A;  4DV3 I;  1F2I G;  2GLI A;  2EMK A;  1A1F A;  5EKW A;  3MHH C;  4LOM A;  4Q28 A;  1ZR9 A;  2EN4 A;  2GPI A;  3M7N D;  1YUJ A;  1YYW A;  2YSP A;  4GEQ B;  3HTX A;  3CDJ A;  4I3H A;  1Z0T A;  5DRR A;  2EE8 A;  1A1K A;  1J5E I;  2EP3 A;  2LJU A;  1STU A;  4GQU A;  2VQF E;  2F1D A;  4JI2 I;  4LF6 I;  3J7A M;  3AV0 A;  1T38 A;  4NBQ A;  4ZYG A;  4DU8 A;  2M4I A;  1LLM C;  4IFD F;  1N3G A;  3BID A;  2LBS B;  5FLX Q;  4HY1 A;  4USM A;  5C0X A;  4X62 E;  4DMI A;  2EN3 A;  4DR5 E;  4DV1 I;  1WJP A;  2EMI A;  4WYQ B;  1EA6 A;  2IOP A;  4RHB B;  2C37 B;  4BC7 A;  4FW4 A;  3JAM Q;  1UIL A;  2BR2 B;  3HKM A;  4DR6 I;  1A1H A;  1RRE A;  2YTJ A;  4L5N C;  4DV2 E;  2YTF A;  1Z5A A;  2HKJ A;  5K36 E;  3J7A G;  4HXZ A;  4OX9 E;  2NPF A;  4LCH A;  2PNM A;  3WU6 A;  4P7D A;  2UXB I;  4JYA E;  3PS3 A;  2V85 A;  5A6J A;  2UU9 I;  1ZM3 A;  3ADI A;  2EJ4 A;  3VYX A;  2V87 A;  2R76 A;  5IV8 B;  5IWA E;  2A2D A;  3B82 A;  3JTZ A;  1WRJ A;  2NN6 B;  2LE2 A;  1USU A;  5DNX A;  5ELW A;  2YTG A;  4DUY E;  5AE1 A;  3WU4 A;  3ZZ0 A;  2UUC I;  2DSY A;  3MSW A;  3ZZU A;  5ADZ A;  1X48 A;  2WZO A;  4PRX A;  3P06 A;  2YTD A;  4DV5 I;  1WHQ A;  2LVH A;  2LTS A;  3PYD A;  3V5R A;  1X6H A;  3BF2 A;  4R2Q A;  1XMQ E;  3C4T A;  2L33 A;  2YRK A;  4BA2 A;  3T1H I;  4BA2 B;  5LMU I;  2OI2 A;  1ZBT A;  1QU6 A;  1IBM E;  4LPF A;  4LF4 I;  2YU8 A;  4X65 E;  5FLX C;  2EPK X;  2C39 A;  3F6H A;  1Z59 A;  1UDN A;  4GKJ E;  2EMB A;  5LMN E;  2V8P A;  2NUG A;  2DLQ A;  1H7U A;  1Z5C A;  4R1F A;  2UUA E;  2LRS A;  4DR4 E;  1MU5 A;  4KHP I;  2CTD A;  2IES A;  5KL2 A;  4JI0 I;  3UK3 C;  1AH5 A;  2GO3 A;  4R8O A;  4DUZ I;  4M30 A;  2EPN A;  4DUY I;  4Z7Y A;  4IFD A;  1H7S A;  2YZT A;  2VF3 A;  4BS9 A;  5C0X C;  4WUD A;  3C6M A;  3ZKB A;  1HR0 E;  4IFD E;  1N0U A;  4JI1 E;  3ZOQ B;  3HXL A;  5AAS A;  4IZJ B;  2JEB A;  2KON A;  1IQS A;  1WXR A;  1B63 A;  4Q35 B;  4WSP A;  4O5G A;  3M7N G;  2EMC A;  4X9J A;  4GKK E;  1J5E E;  4JI4 I;  3LLH A;  2V2Q A;  1KKH A;  3B78 A;  4F9A B;  5K36 F;  4DKK A;  2J65 A;  3TQM A;  2EOZ A;  2YTN A;  5C0X E;  4MU3 A;  1PVG A;  2O1W A;  2EOJ A;  3VHT B;  1T4L B;  4R2S A;  5JEA C;  5KL3 A;  2PO2 B;  2GHF A;  3GCM A;  1I94 I;  2MKN A;  4JI5 I;  5JEA B;  2EOY A;  2B3T B;  4DV1 E;  2MDR A;  3LPS A;  2N3G A;  2Z5C A;  5LMN I;  3ECR A;  2CVE A;  2HFU A;  1Z0W A;  4DV5 E;  2BA0 G;  4OKG A;  4M0V A;  2JP9 A;  4LF8 I;  3NZK A;  4JI3 I;  2LMZ A;  2C38 A;  5IT9 Q;  2MDG A;  5AC4 A;  4LF9 E;  2ODR C;  2YRM A;  2EL6 A;  1HNX E;  2VE7 C;  2MC6 A;  2NN6 C;  2ELY A;  2JE6 B;  3PRY A;  2CGE A;  2JE6 A;  1N32 I;  2RSI A;  1PJT A;  2EMH A;  2BBG A;  4LU9 A;  1Y5Y A;  3QT6 A;  5EL9 A;  1G2F C;  2EMF A;  2VQF I;  4OO1 D;  5C0X B;  1A1G A;  4LF9 I;  3P3C A;  5A2Q C;  3K6Q A;  5LL6 R;  4DR3 E;  2BR2 A;  1X3C A;  1MEY C;  2EM2 A;  2A2C A;  2L3J A;  2NN6 E;  3PS2 A;  2UXB E;  1NCS A;  2GS8 A;  4HYM A;  4UTG A;  2G7H A;  1D6T A;  4R2R A;  1A1J A;  4MQY A;  2YTE A;  4TUI A;  3WU3 A;  2YTO A;  2KOU A;  1NHJ A;  2EPA A;  2ENH A;  1T4N A;  4LFC E;  3THO B;  2VRD A;  2R3V A;  2X7I A;  2CG9 A;  3GON A;  2RQL A;  2EN8 A;  2VQE I;  2V2V A;  2EL5 A;  1IBL E;  5AE2 A;  2EOQ A; 
#chains in the Genus database with same CATH homology
 1EI1 A;  3J80 Q;  4L8N A;  5IT9 C;  4I8O A;  2WW4 A;  2UUB E;  4BMJ A;  4XTJ A;  4UT4 A;  2HFS A;  2Z5B A;  5BR8 I;  4BCA A;  5FWK A;  2B7V A;  3JAM C;  4IZJ A;  3ZKD A;  4OOG C;  2L2K B;  4R03 A;  2GQ0 A;  2Q2E B;  4IZK B;  4WUB A;  4PRV A;  5L3J A;  4P7A A;  1ELO A;  4JI6 E;  2ZM6 E;  1FKA E;  3K17 A;  4LFA E;  1Y6Z A;  4JI8 I;  4DV6 I;  1XMO I;  4DR4 I;  4KHP I;  4JI2 E;  4X66 E;  4Z7C A;  1XMQ I;  2EWL A;  3ADL A;  2PNL A;  3IWD A;  2VQE E;  4LFC I;  3ZZT A;  2N3H A;  4DPX A;  4DV0 I;  4URL A;  2LTR A;  3OTO I;  2AJ4 A;  1H74 A;  4JI3 E;  4LTY A;  1N33 I;  2DIX A;  1T4O A;  3HPZ A;  1H72 C;  2EZ6 A;  2F4V E;  1RR9 A;  1IBL I;  3QT8 A;  1XNR I;  1ZXN A;  4KZS A;  1Y4U A;  2UXC I;  4DR2 I;  4F54 A;  1N0V C;  2IOQ A;  2Z5E A;  4FWD A;  4PU9 A;  1Z0G A;  3KWR A;  3K85 A;  2HK2 A;  1HNW I;  5GME A;  2V88 A;  3HQ1 A;  4IZJ D;  4KHP E;  4LFA I;  3HJC A;  4K0K E;  1MG7 A;  1MX0 A;  2L92 A;  3WU5 A;  4LFB I;  2EFG A;  3T1Y I;  2J7K A;  2L2N A;  4DR7 I;  4B3M I;  1Z0B A;  3V2U C;  3ADJ A;  4USK A;  3JU0 A;  3HUL A;  1WHN A;  2ZM6 I;  5F3W A;  4FN5 A;  2DMY A;  4WFT A;  2ZBK B;  4M1K A;  4DR1 I;  4DPY A;  1ZBQ A;  3T1H E;  1DQ3 A;  2V34 A;  2BV3 A;  5T6J A;  3T1Y E;  3LML A;  4DV4 I;  2NA2 A;  1FWL A;  3PYF A;  2LJP A;  2K4V A;  4JI4 E;  3QT7 A;  5LMU E;  1XNQ E;  2DEI A;  4P78 A;  4DU7 A;  3QT5 A;  4EMD A;  4P52 A;  4DR5 I;  2CZ9 A;  1XHK A;  1PKP A;  2L3C A;  4NXN E;  2RS6 A;  1U2R A;  3C4B A;  4JYA I;  1EKZ A;  3ZM7 A;  2R42 A;  4JI7 E;  1S16 A;  3DJW A;  4AQY E;  4X66 I;  2V2Z A;  4KQV A;  1ZM2 A;  4DR2 E;  2NUE A;  1NZ0 A;  4LF6 E;  4OX9 I;  4DPU A;  2JOX A;  2E5L E;  1Z0E A;  3Q6N A;  4RPF A;  4X8W A;  4X65 I;  1KVK A;  2ZIT A;  1N33 E;  4WUC A;  4B3S E;  1HK7 A;  3HPS A;  2L6M A;  2V89 A;  4DR7 E;  4NXM E;  2DB2 A;  1X49 A;  2DEJ A;  1A6F A;  2RS7 A;  1DI2 A;  4HAC A;  1YZ9 A;  4JV5 I;  2RTX A;  1H73 A;  4B3R E;  4BC9 A;  1UEK A;  4N3O A;  2X36 A;  4JG4 A;  3AUZ A;  5GMD A;  1HNX I;  2NUF A;  4JI6 I;  3K1J A;  3H09 A;  3IWC A;  4B3S I;  3H4L A;  1KIJ A;  2BM0 A;  4DV7 I;  4DXL A;  1K47 A;  4F9C B;  4LF5 E;  1WUU A;  2KHX A;  1DAR A;  1HR0 I;  3F6G A;  1N34 I;  2B9D A;  2FTX B;  4BBY A;  4NXN I;  2UXD I;  2UU9 E;  2UUC E;  4ED4 A;  2JVA A;  1XNR E;  1VIS A;  1FJG E;  3IWB A;  1QZR A;  5BR8 E;  2UUB I;  1N36 I;  1FI4 A;  1ZM4 A;  4LF4 E;  1IBM I;  4FWG A;  2L2M A;  2F4V I;  3VYY A;  4X64 I;  1XNQ I;  4DV2 I;  2O1U A;  1ZXM A;  4LF8 E;  4DUZ E;  4WPY A;  2E1M A;  4IZK A;  3OTO E;  4JI5 E;  4DPT A;  1IBK I;  4DR1 E;  4B3T E;  5A2Q Q;  5AE3 A;  1UHZ A;  1GQE A;  1BKN A;  4JI0 E;  1NHH A;  1KTV A;  2XEX A;  4GKK I;  2M7Q A;  2FV4 B;  3ADG A;  2HHH E;  2B7T A;  3D4J A;  2O1T A;  4B3T I;  2V8Q B;  2MC5 A;  1HNZ I;  2UXC E;  1RQ0 A;  4AQY I;  3OML A;  1ZM9 A;  1FNM A;  2CPN A;  2UXD E;  3PYG A;  1YYO A;  4FWH A;  4YY3 E;  1PIE A;  2L8T A;  2LUQ A;  2UUA I;  2LJH A;  1N36 E;  2V86 A;  4DV7 E;  4LF7 E;  1B62 A;  3J7Y p;  1RC7 A;  3J81 Q;  2E1R A;  4YY3 I;  2O1V A;  4YHH I;  1HNZ E;  3J80 C;  1Z5B A;  1YYK A;  4B3R I;  2IHR 1;  4DR3 I;  2VF1 A;  1N32 E;  3LTO A;  4HAC B;  2HHH I;  4B3M E;  2ODR D;  3DF6 A;  1HNW E;  4ZVI A;  3P1X A;  5IWA I;  1XMO E;  1Y4S A;  2JWO A;  2M1S A;  3VK6 A;  4FW9 A;  2LUP B;  4JI7 I;  4NXM I;  1I94 E;  4TUG A;  1GZ6 A;  4JI8 E;  4DV6 E;  4LF7 I;  4F9B B;  3RMP A;  4K0K I;  4DV3 E;  5DNY A;  4YHH E;  2JR1 A;  1J26 A;  4DPW A;  1N34 E;  3M6A A;  1NHI A;  2FGG A;  2JOB A;  2BM1 A;  4M2Z A;  3CWV A;  3J81 C;  4DV0 E;  4DR6 E;  1O0W A;  4LF5 I;  1USV A;  4JI1 I;  3LNU A;  2HKE A;  4X64 E;  1FJG I;  4DV4 E;  1FWK A;  1Z0V A;  3FIG A;  3B8H A;  2Z5B B;  1SR9 A;  4GKJ I;  3Q1Q A;  4JV5 E;  1Z0C A;  2JY9 A;  2RSM A;  4J8Z A;  2H36 X;  1S4E A;  1X47 A;  2HK3 A;  1IBK E;  1OJ4 A;  5CFF E;  2YT4 A;  4X62 I;  3Q6M A;  4LFB E;  4MYU A;  2F8B A;  3PYE A;  2E5L I;  4MYT A;  2Z5C B;  3F0N A;  2V83 A;  4DV3 I;  4Q28 A;  1YYW A;  4GEQ B;  3HTX A;  4I3H A;  1Z0T A;  1J5E I;  4JI2 I;  1STU A;  3J7A M;  2VQF E;  4LF6 I;  3AV0 A;  4DU8 A;  2M4I A;  5FLX Q;  2LBS B;  4HY1 A;  4USM A;  4X62 E;  4DMI A;  4DR5 E;  4DV1 I;  4WYQ B;  1EA6 A;  2IOP A;  4BC7 A;  3JAM Q;  1UIL A;  4DR6 I;  1RRE A;  4L5N C;  4DV2 E;  1Z5A A;  2HKJ A;  3J7A G;  4HXZ A;  4OX9 E;  2NPF A;  3WU6 A;  2PNM A;  4P7D A;  2UXB I;  4JYA E;  2V85 A;  2UU9 I;  1ZM3 A;  3ADI A;  3VYX A;  2V87 A;  5IWA E;  3B82 A;  2A2D A;  3JTZ A;  2LE2 A;  1USU A;  4DUY E;  5AE1 A;  3WU4 A;  3ZZ0 A;  2UUC I;  2DSY A;  3MSW A;  3ZZU A;  5ADZ A;  1X48 A;  2WZO A;  4PRX A;  3P06 A;  4DV5 I;  1WHQ A;  2LTS A;  3PYD A;  3V5R A;  1XMQ E;  3C4T A;  2L33 A;  3T1H I;  5LMU I;  2OI2 A;  1ZBT A;  1QU6 A;  1IBM E;  4LF4 I;  4X65 E;  5FLX C;  3F6H A;  1Z59 A;  4GKJ E;  5LMN E;  2V8P A;  2NUG A;  1H7U A;  1Z5C A;  4R1F A;  2UUA E;  2LRS A;  4DR4 E;  1MU5 A;  4JI0 I;  4R8O A;  4DUZ I;  4M30 A;  4DUY I;  4Z7Y A;  1H7S A;  2YZT A;  2VF3 A;  4BS9 A;  4WUD A;  3ZKB A;  1HR0 E;  1N0U A;  4JI1 E;  3ZOQ B;  3HXL A;  5AAS A;  4IZJ B;  2KON A;  1WXR A;  1B63 A;  4WSP A;  4GKK E;  1J5E E;  4JI4 I;  3LLH A;  2V2Q A;  1KKH A;  3B78 A;  4F9A B;  4DKK A;  1PVG A;  2O1W A;  1T4L B;  1I94 I;  4JI5 I;  2B3T B;  4DV1 E;  2MDR A;  3LPS A;  2N3G A;  2Z5C A;  5LMN I;  2HFU A;  1Z0W A;  4DV5 E;  4M0V A;  4LF8 I;  4JI3 I;  2LMZ A;  5IT9 Q;  4LF9 E;  2ODR C;  1HNX E;  2VE7 C;  2MC6 A;  3PRY A;  2CGE A;  1N32 I;  4LU9 A;  3QT6 A;  2VQF I;  4LF9 I;  5A2Q C;  3K6Q A;  5LL6 R;  4DR3 E;  2A2C A;  2L3J A;  2UXB E;  2GS8 A;  4HYM A;  4UTG A;  2G7H A;  1D6T A;  4TUI A;  3WU3 A;  2KOU A;  1NHJ A;  1T4N A;  4LFC E;  2X7I A;  2R3V A;  2VQE I;  2CG9 A;  3GON A;  2V2V A;  1IBL E;  5AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...