2UXBE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxbE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbE02
4YHHI 3ZZUA 4DV1I 3CWVA 3J80Q 4UTGA 3ZZTA 2VQEE 4M1KA 3J7AG 1FWLA 5LMUE 3HTXA 4X66E 1XNQE 4DR3I 2L2KB 4JG4A 1Z0CA 1X48A 3ZM7A 3J80C 1J5EI 4DR6I 1WUUA 4DR1E 4DV4I 2DEJA 1N36I 1EA6A 4B3RE 2GS8A 4DV0I 4DKKA 3B8HA 4DR5E 1IBLE 4NXMI 4LF4E 4USKA 2UXBI 2UXDE 4OX9I 2UU9E 4FW9A 4USMA 4B3TE 3PYFA 5FLXQ 4LF5I 4DV5I 2Q2EB 3QT6A 1Z59A 1N34I 4EMDA 2E5LI 5FLXC 1N32I 2BV3A 3K1JA 3ZZ0A 2B7TA 4MYUA 1I94I 2RS6A 4LF7E 2HFSA 2LUQA 1GQEA 4DR6E 3J81Q 2L3CA 4GKJI 1N36E 4KHPI 3ADIA 4AQYI 2UUCI 1PIEA 4FWDA 4JI3I 1FNMA 2LRSA 5LMNE 4DPXA 3J81C 1B63A 3J7AM 3ADLA 2R3VA 2UXBE 1BKNA 1H7UA 4LF8E 4PRVA 4OX9E 4X62I 2IHR1 2DMYA 3T1YE 3OTOE 4DV5E 4JI0E 4DPYA 4HXZA 2VQEI 1FJGI 2E5LE 3VYYA 4X66I 5LMUI 1XNQI 2BM1A 3ADJA 2LJHA 3JAMQ 4WUCA 1HNZE 5BR8E 4HYMA 4DPUA 2NA2A 2RSMA 2CZ9A 1QU6A 5GMEA 4DV2I 4DR1I 1Z0BA 3JAMC 2E1RA 3WU6A 2F4VI 2ZITA 4FWHA 1Z0WA 4DR5I 1IBLI 2UUCE 1ZM2A 4JI3E 4JYAE 4LF4I 2UXDI 2UU9I 4B3TI 1XNRE 4JI2I 2XEXA 2L2MA 1N33E 2UUBE 2HK3A 2LJPA 4UT4A 4X64E 2VQFI 1YYOA 3QT5A 2A2CA 4DUYI 2HKJA 5L3JA 1HNWE 4DPWA 2V34A 3HULA 1KKHA 1FJGE 5A2QQ 2AJ4A 3VYXA 4LF7I 2ZBKB 1PKPA 1UHZA 1RR9A 4GKKE 4DV2E 1H73A 2X36A 5A2QC 4B3ME 3B82A 4DV7I 3M6AA 3WU5A 2CPNA 2LBSB 2F4VE 3C4BA 5LMNI 4LF8I 2HFUA 4KQVA 1FWKA 1IBME 4JI2E 3T1YI 3OTOI 2KHXA 1DI2A 4DU7A 3PYDA 4JI0I 2VQFE 3GONA 2NUEA 1T4LB 3K17A 4FN5A 4DUYE 3PYGA 4ZVIA 1HNZI 5BR8I 4YY3E 2VF3A 3P1XA 1FKAE 3LTOA 3C4TA 2B7VA 4LF6E 4DV7E 1QZRA 4FWGA 5GMDA 4JYAI 4DU8A 1HNXE 1ZM3A 3ZKBA 1Z0VA 1RC7A 1XNRI 1OJ4A 4HACB 3V2UC 4P7AA 1N33I 4ED4A 2UUBI 3LNUA 4X64I 2JVAA 2V2ZA 3LLHA 1KVKA 1YZ9A 4NXNE 1HNWI 5LL6R 1HR0E 4DPTA 1X47A 4HACA 3WU4A 1NHJA 2RTXA 4GKKI 1D6TA 2MDRA 1S16A 4M30A 1WHQA 2RS7A 4JI5E 4B3MI 3LPSA 3H4LA 3B78A 1Z5BA 4LF9E 5CFFE 1NHIA 2UUAE 4DUZE 4DXLA 2N3HA 3T1HI 1IBMI 4LFCE 1J26A 1WHNA 4DR7E 2L2NA 1MU5A 2DEIA 1RQ0A 1ZM9A 3ZKDA 4JI7E 4DV6I 4DR2E 2B3TB 2LTSA 1XMQI 1KTVA 1UEKA 3D4JA 4JI6I 4YY3I 1H74A 4I3HA 2LUPB 1STUA 1ZXMA 3F0NA 3WU3A 2R42A 4WYQB 4Z7CA 2UXCE 2ZM6E 2HHHI 4LF6I 2HKEA 1ZXNA 3Q1QA 2DB2A 1DARA 4X65E 5IWAI 1HNXI 2A2DA 4Z7YA 1K47A 1Z0EA 2V2VA 4DV3E 1Z0TA 3T1HE 4JI1E 2NUGA 4DR4E 4JV5E 1XMOE 4LFBI 4P52A 1Z5AA 4HY1A 1YYKA 2X7IA 4NXNI 1HR0I 4JI4E 2LTRA 4DV6E 4B3SE 1IBKE 4WUBA 4MYTA 4K0KE 1XMQE 4JI6E 4JI8E 4URLA 2OI2A 3QT8A 5IT9Q 4LFAE 1U2RA 4JI5I 3QT7A 1FI4A 4PU9A 2N3GA 2BM0A 2HHHE 1EI1A 1O0WA 4YHHE 5IT9C 4LF9I 4DV1E 2UUAI 2HK2A 5IWAE 4DUZI 1RREA 2V2QA 1N0UA 4LFCI 4DR3E 4DR7I 4WUDA 1H7SA 2EFGA 2NPFA 4LFBE 1J5EE 4JI7I 4DV4E 4DR2I 1H72C 1KIJA 1MX0A 1XHKA 4XTJA 4PRXA 2DIXA 4DV0E 1PVGA 1NZ0A 4NXME 1ELOA 1ZBTA 1UILA 2UXCI 1N0VC 2ZM6I 3PYEA 4LF5E 3J7Yp 4X65I 1X49A 2EZ6A 1N34E 4M2ZA 1NHHA 1N32E 1VISA 4DV3I 1Z5CA 1YYWA 1B62A 4JI1I 4DR4I 4JV5I 1XMOI 1I94E 3V5RA 1A6FA 4X8WA 2JY9A 1T4NA 4JI4I 4B3RI 2L3JA 4GKJE 4KHPE 4B3SI 4AQYE 1IBKI 2L33A 4R1FA 3ADGA 4K0KI 1T4OA 2V8PA 2YT4A 4OOGC 4RPFA 2WW4A 1MG7A 4JI8I 4WFTA 1Z0GA 4LFAI 2J7KA 1ZM4A 1EKZA 4X62E 1S4EA 2NUFA
chains in the Genus database with same CATH superfamily
4YHHI 3ZZUA 2ENHA 4DV1I 3CWVA 4IJDA 2MDGA 3J80Q 2WP8B 1YFHA 2DLQA 4ZYHA 4Q35B 2EQ3A 2GO3A 4FW4A 4UTGA 2VQEE 3ZZTA 3J7AG 4M1KA 2D9HA 1FWLA 5LMUE 3HTXA 4X66E 1IQOA 1XNQE 4BA2A 1UDOA 4DR3I 2L2KB 4JG4A 2PO1A 1Z0CA 1X6EA 2EPAA 4I8OA 2Z5BB 1X48A 3J80C 3ZM7A 4IZJB 2VF1A 4NZVA 2K7IA 1J5EI 4DR6I 1WUUA 4DR1E 1SFEA 1X5WA 4DV4I 2EM7A 2DEJA 2WP8A 1N36I 1WXRA 3IWDA 4LPFA 1T38A 1EA6A 4OZEA 4B3RE 2Z5EA 4LFBI 2GS8A 4DV0I 4DKKA 2Z5BA 3B8HA 4DR5E 2EM5A 4KWYA 4ZYEA 4ISAA 1IBLE 2EMLA 4NXMI 2G7HA 2EOEA 3EQ1A 4LF4E 4USKA 2UXBI 3C6KA 3KWRA 2UXDE 2UU9E 3P3GA 4OX9I 4FW9A 4USMA 1P47A 4B3TE 1EH6A 2ELZA 3PYFA 5FLXQ 2KOUA 2FGGA 4LF5I 2BBGA 1ZU1A 4DV5I 2ELYA 4R2DA 2C39B 2Q2EB 3QT6A 4KZSA 1HK7A 1Z59A 1N34I 4EMDA 2O1TA 5KL2A 2E5LI 4AIMA 2GHFA 2M1SA 5FLXC 2JE6B 1N32I 2BV3A 3GCMA 3K1JA 2EQ0A 2LMZA 3ZZ0A 5JEAD 2B7TA 4MYUA 1I94I 4R2AA 3IWCA 2YTDA 2RS6A 4LF7E 2BA0G 2CTDA 5TSEA 1E3HA 3THNA 2HFSA 2LV2A 2LUQA 5ELWA 2C39A 2JXPA 1GQEA 3Q6NA 2GO4A 2YTFA 4DR6E 3J81Q 2L3CA 2JE6A 1X6FA 2C37B 4GKJI 1N36E 3P3CA 3ADIA 4AQYI 4KHPI 5KL5A 2EL4A 1YSAC 1P42A 2YRMA 2UUCI 1PIEA 4FWDA 4JI3I 1FNMA 2L8TA 2LRSA 1VI7A 2YZTA 5A6BA 2PNMA 5LMNE 4DPXA 4AIDA 3J81C 2EMHA 2PRTA 1B63A 1L4SA 4RH8A 3J7AM 3ADLA 2R3VA 2UXBE 1BKNA 1H7UA 4LF8E 4PRVA 4OX9E 2E1MA 2RQLA 1OYRA 4R2CA 1A1FA 2EN3A 2EOJA 2C37A 2IHR1 1LLMC 4X62I 2EMIA 2DMYA 2R76A 2RSIA 1QNTA 2EMBA 3OTOE 3T1YE 1MGTA 4OO1D 2M4IA 5KL6A 2FV4B 1Y6ZA 4DV5E 4JI0E 2CG9A 4DPYA 4HXZA 4B3SI 1Y5YA 2EMZA 3K85A 2VQEI 3QG5C 1FJGI 2E5LE 3VYYA 4X66I 5JEAC 5LMUI 2BM1A 1XNQI 3ADJA 2LJHA 3JAMQ 1AH5A 1TF3A 4WUCA 2WBSA 4MU1A 1HNZE 5BR8E 3M99B 2EOQA 4Q28A 4R2QA 4HYMA 2EOIA 3UHMA 4DPUA 2NA2A 4X9JA 2RSMA 1QU6A 2EL5A 2CZ9A 5GMEA 5DNLA 4DV2I 4DR1I 2BR2B 1Z0BA 3JAMC 3KZYA 2E1RA 4BHCA 1T39A 3WU6A 5JEAF 2ZITA 2YSPA 2F4VI 2B9DA 2MKDA 5DROA 1KYQA 1Z0WA 4FWHA 4DR5I 2MC6A 2V86A 2YTOA 2UUCE 2EQ1A 2IOPA 1IBLI 1ZM2A 2EN7A 4JI3E 4JYAE 2CGEA 4LF4I 2BA0D 5A6JA 2UXDI 2DRPA 2UU9I 3CDIA 4R03A 4B3TI 1XNRE 1USVA 1A1KA 1X6HA 2YWQA 2EPMX 1YUJA 1BB8A 2XEXA 4JI2I 3B4TA 2L2MA 3PS3A 1N33E 4LU9A 4OO1C 2I13A 2UUBE 2HK3A 2LJPA 4X64E 4UT4A 2EOHA 2VQFI 4RHBB 3PS2A 1AAYA 2CT1A 1YYOA 3QT5A 2A2CA 4DUYI 2HKJA 1GZ6A 1YH8A 5L3JA 1HNWE 5IXMB 4DPWA 2EM0A 2V34A 3HULA 1KJKA 1KKHA 1FJGE 2WNRA 3Q6MA 5A2QQ 5DNYA 2AJ4A 3VYXA 4LF7I 2ZBKB 1PKPA 2ODRD 2EMCA 2J65A 4L5NC 4OO1F 1UHZA 1RR9A 2NN6A 4F9CB 2Z5CB 3VHTB 4GKKE 1Y4UA 3AV0A 3EPHA 4DV2E 1H73A 3HPSA 3JU0A 2JT2A 2X36A 5A2QC 4IS9A 2EM3A 2L92A 4AM3A 1WRJA 4WPYA 4BCAA 4B3ME 4O5GA 3B82A 3GLLA 4DV7I 1GTKA 5K36D 3M6AA 2EOOA 2EOMA 3WU5A 2CPNA 2LBSB 2PNZB 2EPPA 2EPUA 4BHBA 5AE2A 2F4VE 2O1UA 3GMEA 2O1VA 3C4BA 5LMNI 1PJQA 2YU5A 1UDSA 2YU8A 4FK5C 2NABA 4IZJA 2Z5CA 3P3EA 2EN4A 2HC5A 1F2IG 1R6MA 4LCFA 4LF8I 2HFUA 1PJSA 4KQVA 1FWKA 1IBME 4JI2E 3T1YI 5EL9A 3OTOI 2KHXA 1DI2A 3HXLA 4F2JC 1UDNA 4DU7A 2EM6A 2PNZA 2E72A 5DRQA 3HQ1A 2JPAA 3PYDA 4JI0I 2EP3A 2VQFE 2JP9A 1UN6B 5AASA 3GONA 2NUEA 2MC5A 2EPNA 4MLVA 3F6GA 1T4LB 1R6LA 3EPLA 4DUYE 3K17A 4FN5A 3PYGA 2DLKA 2YTJA 4ZVIA 1HNZI 5BR8I 5C0XD 2ODRC 2PO0B 3EPKA 4YY3E 5AE3A 2VF3A 3P1XA 1FKAE 2NN6B 3LTOA 4R2PA 2IESA 2VRDA 3C4TA 3HJCA 5K36C 2FTXB 2B7VA 4X64I 2L6MA 4LF6E 4DV7E 2PO2B 2EMXA 2R1FA 2C38B 1QZRA 4FWGA 2EMFA 5GMDA 5JEAE 4JYAI 4DU8A 2PO0A 2M7QA 4R2SA 1HNXE 1ZM3A 4WX9A 3ZKBA 2EOFA 1Z0VA 2EMWA 1RC7A 1XNRI 1JK1A 2EM8A 2EM9A 1OJ4A 2EPLX 4HACB 2YTQA 3LMLA 3V2UC 4P7AA 2EOYA 1BBGA 2EORA 1N33I 5K36F 1DGCA 4ED4A 2UUBI 2MKNA 3OMLA 3ECRA 2JVAA 3LNUA 4NHRA 2EOZA 4R2EA 2PO2A 4WSPA 2V2ZA 2A25A 2Q8UA 3LLHA 2PNLA 4NBQA 1KVKA 1YZ9A 3F6HA 2M9AA 4NXNE 1HNWI 3VK6A 5LL6R 5A6AA 2GLIA 4P7DA 1HR0E 4WSGA 4DPTA 1YPNA 2YTEA 4IFDD 2WBTA 1X47A 5JEAB 4BMJA 5C0XC 4HACA 3PS1A 4FW5A 3WU4A 1NHJA 1RMDA 2RTXA 1MEYC 2EPCA 4GKKI 1D6TA 4M9VC 2MDRA 1S16A 2EPRA 4M30A 4BC9A 1UDQA 4LCGA 4OO1E 2EE8A 3M85G 1WHQA 2RS7A 4JI5E 4B3MI 3LPSA 1EH8A 3H4LA 2NN6D 1A1JA 5F3WA 2WCC3 4DMIA 4IS1C 2VESA 5JEAA 1BBOA 3B78A 1Z5BA 5C0XF 4HEIA 3HPZA 5CFFE 5ADZA 4LF9E 1NHIA 2LO3A 4GZNC 1XXEA 2UUAE 2EN1A 4DUZE 4DXLA 2N3HA 3T1HI 2ADRA 4F6NA 1IBMI 2BR2A 4MU3A 4WXDA 4LFCE 1J26A 1WHNA 2EN6A 4DR7E 2L2NA 2I9IA 1MU5A 3IWBA 4LCHA 4OO1B 1A1IA 2V89A 2DEIA 1RQ0A 1ZM9A 4FW6A 3ZKDA 3C6MA 4BS9A 4OKGA 4JI7E 4QNKA 5AC4A 1UBDC 4DV6I 4GEQB 4DR2E 1G2FC 4IFDC 2B3TB 2EPZA 2WBUA 2LTSA 3BF2A 2LJUA 1TF6A 1XMQI 1KTVA 1DQ3A 1UEKA 3D4JA 3MHHC 2CVEA 4N3OA 4JI6I 4YY3I 2JEAB 1H74A 2EOXA 4I3HA 2JOXA 2LUPB 4WXCA 2LVHA 1STUA 1ZBQA 3DF6A 1A1GA 4OO1A 1ZXMA 2LT7A 3F0NA 3WU3A 5A6KA 2PO1B 2R42A 2EN2A 4J8ZA 2JYAA 4WYQB 4BBYA 3RMPA 4Z7CA 2UXCE 2ZM6E 2NN6C 2HHHI 4P78A 1EH7A 4LF6I 4IFDF 1IMUA 2HKEA 1ZXNA 2RPCA 3Q1QA 2DB2A 1DARA 4X65E 5IWAI 1HNXI 2A2DA 2LCEA 3H09A 4HTGA 3M7ND 4Z7YA 4FW7A 1X3CA 1ZR9A 1K47A 1Z0EA 2ENAA 2O1WA 4DV3E 1ZAAC 2V2VA 1Z0TA 3T1HE 1RHYA 4JI1E 2NUGA 3BGHA 1TN9A 2JR1A 1XMOE 5A6BD 2ENCA 4DR4E 4JV5E 4MDTA 2LE2A 2V87A 2EMAA 5A69A 2NN6F 3M85D 4U3DA 1Y4SA 2YTPA 3PRYA 3UK3C 4P52A 5DRPA 5K36E 1Z5AA 4HY1A 1YYKA 2X7IA 4LTYA 4NXNI 4O24A 5DNXA 1HR0I 2YRHA 2EM4A 4JI4E 2LTRA 4DV6E 4F9AB 2EPKX 3KZZA 1IBKE 2V88A 4B3SE 4MYTA 4WUBA 1PJTA 4K0KE 1XMQE 2EPOA 4JI6E 1Y60A 4JI8E 4URLA 1IQSA 2OI2A 2AE8A 3QT8A 5IT9Q 4LFAE 2IERA 3CDJA 3L7ZB 1U2RA 4JI5I 3QT7A 1FI4A 4O43A 1JK2A 2EN8A 4PU9A 2J7JA 2N3GA 3BIDA 5K36B 4O4KA 3HKMA 2BM0A 3BBGA 2HHHE 1EI1A 1O0WA 4YHHE 3U1YA 5IT9C 2GQ0A 4DV1E 3EPJA 4LF9I 2KONA 5IV8B 4LOMA 2UUAI 2HK2A 5C0XE 5IWAE 4DUZI 5KL3A 1RREA 3JTZA 2V2QA 1N0UA 3L7ZA 4LFCI 2K4VA 1G2DC 2BA1D 4DR3E 2EOSA 3TQMA 5KL7A 4DR7I 4WUDA 1H7SA 5T6JA 2EFGA 2NPFA 5K36A 4LFBE 2YTNA 1NCSA 1J5EE 1OYPA 4BA1B 2C38A 4JI7I 3DJWA 4DV4E 4DR2I 4F6MA 4MQYA 5LLQA 1H72C 1KIJA 1MX0A 4MU4A 1XHKA 3U1KA 2GPIA 1NEIA 3L00A 2F1DA 2DIXA 4TUIA 3P06A 4PRXA 4XTJA 2YPNA 2BB8A 4ZYDA 4L8NA 4DV0E 5C0XB 3MSWA 1PVGA 5EKWA 1NZ0A 3DD6A 2JWOA 4TUGA 2JEBB 4NXME 3M7NG 2HJJA 2EL6A 3AUZA 1E3PA 1ELOA 4BA1A 1ZBTA 1UILA 2V85A 4R8OA 4BC7A 2UXCI 1N0VC 4FW3A 2ZM6I 3MHSC 3PYEA 2YSOA 4LF5E 3J7Yp 3ZOQB 5FWKA 2F8BA 2V83A 4X65I 1X49A 2YTGA 4IFDE 2EMYA 2EZ6A 1A1LA 5C0XA 1N34E 2YTIA 4M2ZA 1NHHA 1Z1BA 5AC5A 2O3ZA 2JEBA 1YUIA 1N32E 2EMKA 1VISA 1SR9A 4DV3I 2DMIA 4ZYGA 2N8XA 2HGHA 2EM2A 1YYWA 1B62A 4MLQA 4F9BB 1Z5CA 4GQUA 4IZKB 5DRRA 4JI1I 3H1CA 1XMOI 4DR4I 1I94E 4JV5I 3V5RA 2EPXA 3NZKA 1YHCA 1A6FA 4IZJD 4X8WA 2JY9A 4J3DA 1WJPA 5AE1A 2NN6E 2DGCA 1T4NA 2DSYA 2H36X 1A1HA 2IOQA 2WZOA 4JI4I 2VE7C 4U3BA 3FIGA 1OYSA 4B3RI 2L3JA 4GKJE 4R2RA 4KHPE 4AQYE 1IBKI 2L33A 4IZKA 5KL4A 3ADGA 4M0VA 4QNJA 4R1FA 4IFDB 4K0KI 1T4OA 2EWLA 2V8PA 1PDAA 2JOBA 2YT4A 4OOGC 4RPFA 2WW4A 1MG7A 3KRNA 4JI8I 4WFTA 4N4RB 1Z0GA 4MU0A 4LFAI 2V8QB 4F54A 1B69A 2WNRB 2EMGA 4BA2B 2BA1G 1N3GA 3K6QA 2EJ4A 2J7KA 3THOB 3P76A 2YRKA 1ZM4A 1EKZA 1USUA 4X62E 1S4EA 2CSHA 2JEAA 2NUFA 4IFDA
chains in the Genus database with same CATH topology
4YHHI 3ZZUA 4DV1I 3CWVA 3J80Q 4UTGA 3ZZTA 2VQEE 3J7AG 4M1KA 1FWLA 5LMUE 3HTXA 4X66E 1XNQE 4DR3I 2L2KB 4JG4A 1Z0CA 2Z5BB 4I8OA 1X48A 3J80C 3ZM7A 4IZJB 2VF1A 1J5EI 4DR6I 1WUUA 4DR1E 4DV4I 2DEJA 1N36I 1WXRA 3IWDA 1EA6A 4B3RE 2Z5EA 2GS8A 4DV0I 4DKKA 2Z5BA 3B8HA 4DR5E 1IBLE 4NXMI 2G7HA 4LF4E 4USKA 2UXBI 3KWRA 2UXDE 2UU9E 4OX9I 4FW9A 4USMA 4B3TE 3PYFA 5FLXQ 2KOUA 2FGGA 4LF5I 4DV5I 2Q2EB 3QT6A 4KZSA 1HK7A 1Z59A 1N34I 4EMDA 2O1TA 2E5LI 2M1SA 5FLXC 1N32I 2BV3A 3K1JA 2LMZA 3ZZ0A 2B7TA 4MYUA 1I94I 3IWCA 2RS6A 4LF7E 2HFSA 2LUQA 1GQEA 3Q6NA 4DR6E 3J81Q 2L3CA 4GKJI 1N36E 4KHPI 3ADIA 4AQYI 2UUCI 1PIEA 4FWDA 4JI3I 1FNMA 2L8TA 2LRSA 2YZTA 2PNMA 5LMNE 4DPXA 3J81C 1B63A 3J7AM 3ADLA 2R3VA 2UXBE 1H7UA 1BKNA 4LF8E 4PRVA 4OX9E 2E1MA 4X62I 2IHR1 2DMYA 3T1YE 3OTOE 2M4IA 2FV4B 1Y6ZA 4DV5E 4JI0E 2CG9A 4DPYA 4HXZA 3K85A 2VQEI 1FJGI 2E5LE 3VYYA 4X66I 5LMUI 1XNQI 2BM1A 3ADJA 2LJHA 3JAMQ 4WUCA 1HNZE 5BR8E 4Q28A 4HYMA 4DPUA 2NA2A 2RSMA 1QU6A 2CZ9A 5GMEA 4DV2I 4DR1I 1Z0BA 3JAMC 2E1RA 3WU6A 2F4VI 2ZITA 2B9DA 4FWHA 1Z0WA 4DR5I 2MC6A 2V86A 1IBLI 2UUCE 2IOPA 1ZM2A 4JI3E 4JYAE 2CGEA 4LF4I 2UXDI 2UU9I 4R03A 4B3TI 1XNRE 1USVA 4JI2I 2XEXA 2L2MA 1N33E 4LU9A 2UUBE 2HK3A 2LJPA 4UT4A 4X64E 2VQFI 1YYOA 3QT5A 2A2CA 4DUYI 2HKJA 1GZ6A 5L3JA 1HNWE 4DPWA 2V34A 3HULA 1KKHA 1FJGE 3Q6MA 5A2QQ 5DNYA 2AJ4A 3VYXA 4LF7I 2ZBKB 1PKPA 2ODRD 4L5NC 1UHZA 1RR9A 4F9CB 2Z5CB 4GKKE 1Y4UA 3AV0A 4DV2E 1H73A 3HPSA 3JU0A 2X36A 5A2QC 2L92A 4WPYA 4BCAA 4B3ME 3B82A 4DV7I 3M6AA 3WU5A 2CPNA 2LBSB 5AE2A 2F4VE 2O1UA 2O1VA 3C4BA 5LMNI 4IZJA 2Z5CA 4LF8I 2HFUA 4KQVA 1FWKA 1IBME 4JI2E 3T1YI 3OTOI 2KHXA 1DI2A 3HXLA 4DU7A 3HQ1A 3PYDA 4JI0I 2VQFE 5AASA 3GONA 2NUEA 2MC5A 3F6GA 1T4LB 3K17A 4FN5A 4DUYE 3PYGA 4ZVIA 1HNZI 5BR8I 2ODRC 4YY3E 5AE3A 2VF3A 3P1XA 1FKAE 3LTOA 3C4TA 3HJCA 2FTXB 2B7VA 2L6MA 4LF6E 4DV7E 1QZRA 4FWGA 5GMDA 4JYAI 4DU8A 2M7QA 1HNXE 1ZM3A 3ZKBA 1Z0VA 1RC7A 1XNRI 1OJ4A 4HACB 3LMLA 3V2UC 4P7AA 1N33I 4ED4A 2UUBI 3LNUA 3OMLA 4X64I 2JVAA 2V2ZA 4WSPA 2PNLA 3LLHA 1KVKA 1YZ9A 3F6HA 4NXNE 1HNWI 3VK6A 5LL6R 4P7DA 1HR0E 4DPTA 1X47A 4BMJA 4HACA 3WU4A 1NHJA 2RTXA 4GKKI 1D6TA 2MDRA 1S16A 4BC9A 4M30A 1WHQA 2RS7A 4JI5E 4B3MI 3LPSA 3H4LA 5F3WA 4DMIA 3B78A 1Z5BA 3HPZA 5CFFE 5ADZA 4LF9E 1NHIA 2UUAE 4DUZE 4DXLA 2N3HA 3T1HI 1IBMI 4LFCE 1J26A 1WHNA 4DR7E 2L2NA 1MU5A 3IWBA 2V89A 2DEIA 1RQ0A 1ZM9A 3ZKDA 4BS9A 4JI7E 4DV6I 4GEQB 4DR2E 2B3TB 2LTSA 1XMQI 1KTVA 1DQ3A 1UEKA 3D4JA 4N3OA 4JI6I 4YY3I 1H74A 4I3HA 2JOXA 2LUPB 1STUA 1ZBQA 3DF6A 1ZXMA 3F0NA 3WU3A 2R42A 3RMPA 4J8ZA 4WYQB 4BBYA 4Z7CA 2UXCE 2ZM6E 2HHHI 4P78A 4LF6I 2HKEA 1ZXNA 3Q1QA 2DB2A 1DARA 4X65E 5IWAI 1HNXI 2A2DA 3H09A 4Z7YA 1K47A 1Z0EA 2O1WA 2V2VA 4DV3E 1Z0TA 3T1HE 4JI1E 2NUGA 4DR4E 4JV5E 2JR1A 1XMOE 4LFBI 2LE2A 2V87A 3PRYA 4P52A 1Z5AA 4HY1A 1YYKA 2X7IA 4LTYA 4NXNI 1HR0I 4JI4E 2LTRA 4DV6E 4F9AB 4B3SE 1IBKE 2V88A 4MYTA 4WUBA 4K0KE 1XMQE 4JI6E 4JI8E 4URLA 2OI2A 3QT8A 5IT9Q 4LFAE 1U2RA 4JI5I 3QT7A 1FI4A 4PU9A 2N3GA 2BM0A 2HHHE 1EI1A 1O0WA 4YHHE 5IT9C 2GQ0A 4DV1E 4LF9I 2KONA 2UUAI 2HK2A 5IWAE 4DUZI 1RREA 3JTZA 2V2QA 1N0UA 4LFCI 2K4VA 4DR3E 4DR7I 4WUDA 1H7SA 5T6JA 2EFGA 2NPFA 4LFBE 1J5EE 4JI7I 3DJWA 4DV4E 4DR2I 1H72C 1KIJA 1MX0A 1XHKA 3P06A 4XTJA 4PRXA 2DIXA 4TUIA 4L8NA 4DV0E 3MSWA 1PVGA 1NZ0A 2JWOA 4TUGA 4NXME 3AUZA 1ELOA 1ZBTA 1UILA 2V85A 4R8OA 4BC7A 2UXCI 1N0VC 2ZM6I 3PYEA 4LF5E 3J7Yp 3ZOQB 5FWKA 2F8BA 2V83A 4X65I 1X49A 2EZ6A 1N34E 4M2ZA 1NHHA 1N32E 1VISA 1SR9A 4DV3I 4IZKB 1Z5CA 1YYWA 1B62A 4F9BB 4JI1I 4DR4I 4JV5I 1XMOI 1I94E 3V5RA 1A6FA 4IZJD 4X8WA 2JY9A 5AE1A 1T4NA 2DSYA 2H36X 2IOQA 2WZOA 4JI4I 2VE7C 3FIGA 4B3RI 2L3JA 4GKJE 4KHPE 4B3SI 4AQYE 1IBKI 2L33A 4IZKA 4R1FA 3ADGA 4M0VA 4K0KI 1T4OA 2EWLA 2V8PA 2JOBA 2YT4A 4OOGC 4RPFA 2WW4A 1MG7A 4JI8I 4WFTA 1Z0GA 4LFAI 2V8QB 4F54A 3K6QA 2J7KA 1ZM4A 1EKZA 1USUA 4X62E 1S4EA 1Y4SA 2NUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH I;  3ZZU A;  4DV1 I;  3CWV A;  3J80 Q;  4UTG A;  3ZZT A;  2VQE E;  4M1K A;  3J7A G;  1FWL A;  5LMU E;  3HTX A;  4X66 E;  1XNQ E;  4DR3 I;  2L2K B;  4JG4 A;  1Z0C A;  1X48 A;  3ZM7 A;  3J80 C;  1J5E I;  4DR6 I;  1WUU A;  4DR1 E;  4DV4 I;  2DEJ A;  1N36 I;  1EA6 A;  4B3R E;  2GS8 A;  4DV0 I;  4DKK A;  3B8H A;  4DR5 E;  1IBL E;  4NXM I;  4LF4 E;  4USK A;  2UXB I;  2UXD E;  4OX9 I;  2UU9 E;  4FW9 A;  4USM A;  4B3T E;  3PYF A;  5FLX Q;  4LF5 I;  4DV5 I;  2Q2E B;  3QT6 A;  1Z59 A;  1N34 I;  4EMD A;  2E5L I;  5FLX C;  1N32 I;  2BV3 A;  3K1J A;  3ZZ0 A;  2B7T A;  4MYU A;  1I94 I;  2RS6 A;  4LF7 E;  2HFS A;  2LUQ A;  1GQE A;  4DR6 E;  3J81 Q;  2L3C A;  4GKJ I;  1N36 E;  4KHP I;  3ADI A;  4AQY I;  2UUC I;  1PIE A;  4FWD A;  4JI3 I;  1FNM A;  2LRS A;  5LMN E;  4DPX A;  3J81 C;  1B63 A;  3J7A M;  3ADL A;  2R3V A;  2UXB E;  1BKN A;  1H7U A;  4LF8 E;  4PRV A;  4OX9 E;  4X62 I;  2IHR 1;  2DMY A;  3T1Y E;  3OTO E;  4DV5 E;  4JI0 E;  4DPY A;  4HXZ A;  2VQE I;  1FJG I;  2E5L E;  3VYY A;  4X66 I;  5LMU I;  1XNQ I;  2BM1 A;  3ADJ A;  2LJH A;  3JAM Q;  4WUC A;  1HNZ E;  5BR8 E;  4HYM A;  4DPU A;  2NA2 A;  2RSM A;  2CZ9 A;  1QU6 A;  5GME A;  4DV2 I;  4DR1 I;  1Z0B A;  3JAM C;  2E1R A;  3WU6 A;  2F4V I;  2ZIT A;  4FWH A;  1Z0W A;  4DR5 I;  1IBL I;  2UUC E;  1ZM2 A;  4JI3 E;  4JYA E;  4LF4 I;  2UXD I;  2UU9 I;  4B3T I;  1XNR E;  4JI2 I;  2XEX A;  2L2M A;  1N33 E;  2UUB E;  2HK3 A;  2LJP A;  4UT4 A;  4X64 E;  2VQF I;  1YYO A;  3QT5 A;  2A2C A;  4DUY I;  2HKJ A;  5L3J A;  1HNW E;  4DPW A;  2V34 A;  3HUL A;  1KKH A;  1FJG E;  5A2Q Q;  2AJ4 A;  3VYX A;  4LF7 I;  2ZBK B;  1PKP A;  1UHZ A;  1RR9 A;  4GKK E;  4DV2 E;  1H73 A;  2X36 A;  5A2Q C;  4B3M E;  3B82 A;  4DV7 I;  3M6A A;  3WU5 A;  2CPN A;  2LBS B;  2F4V E;  3C4B A;  5LMN I;  4LF8 I;  2HFU A;  4KQV A;  1FWK A;  1IBM E;  4JI2 E;  3T1Y I;  3OTO I;  2KHX A;  1DI2 A;  4DU7 A;  3PYD A;  4JI0 I;  2VQF E;  3GON A;  2NUE A;  1T4L B;  3K17 A;  4FN5 A;  4DUY E;  3PYG A;  4ZVI A;  1HNZ I;  5BR8 I;  4YY3 E;  2VF3 A;  3P1X A;  1FKA E;  3LTO A;  3C4T A;  2B7V A;  4LF6 E;  4DV7 E;  1QZR A;  4FWG A;  5GMD A;  4JYA I;  4DU8 A;  1HNX E;  1ZM3 A;  3ZKB A;  1Z0V A;  1RC7 A;  1XNR I;  1OJ4 A;  4HAC B;  3V2U C;  4P7A A;  1N33 I;  4ED4 A;  2UUB I;  3LNU A;  4X64 I;  2JVA A;  2V2Z A;  3LLH A;  1KVK A;  1YZ9 A;  4NXN E;  1HNW I;  5LL6 R;  1HR0 E;  4DPT A;  1X47 A;  4HAC A;  3WU4 A;  1NHJ A;  2RTX A;  4GKK I;  1D6T A;  2MDR A;  1S16 A;  4M30 A;  1WHQ A;  2RS7 A;  4JI5 E;  4B3M I;  3LPS A;  3H4L A;  3B78 A;  1Z5B A;  4LF9 E;  5CFF E;  1NHI A;  2UUA E;  4DUZ E;  4DXL A;  2N3H A;  3T1H I;  1IBM I;  4LFC E;  1J26 A;  1WHN A;  4DR7 E;  2L2N A;  1MU5 A;  2DEI A;  1RQ0 A;  1ZM9 A;  3ZKD A;  4JI7 E;  4DV6 I;  4DR2 E;  2B3T B;  2LTS A;  1XMQ I;  1KTV A;  1UEK A;  3D4J A;  4JI6 I;  4YY3 I;  1H74 A;  4I3H A;  2LUP B;  1STU A;  1ZXM A;  3F0N A;  3WU3 A;  2R42 A;  4WYQ B;  4Z7C A;  2UXC E;  2ZM6 E;  2HHH I;  4LF6 I;  2HKE A;  1ZXN A;  3Q1Q A;  2DB2 A;  1DAR A;  4X65 E;  5IWA I;  1HNX I;  2A2D A;  4Z7Y A;  1K47 A;  1Z0E A;  2V2V A;  4DV3 E;  1Z0T A;  3T1H E;  4JI1 E;  2NUG A;  4DR4 E;  4JV5 E;  1XMO E;  4LFB I;  4P52 A;  1Z5A A;  4HY1 A;  1YYK A;  2X7I A;  4NXN I;  1HR0 I;  4JI4 E;  2LTR A;  4DV6 E;  4B3S E;  1IBK E;  4WUB A;  4MYT A;  4K0K E;  1XMQ E;  4JI6 E;  4JI8 E;  4URL A;  2OI2 A;  3QT8 A;  5IT9 Q;  4LFA E;  1U2R A;  4JI5 I;  3QT7 A;  1FI4 A;  4PU9 A;  2N3G A;  2BM0 A;  2HHH E;  1EI1 A;  1O0W A;  4YHH E;  5IT9 C;  4LF9 I;  4DV1 E;  2UUA I;  2HK2 A;  5IWA E;  4DUZ I;  1RRE A;  2V2Q A;  1N0U A;  4LFC I;  4DR3 E;  4DR7 I;  4WUD A;  1H7S A;  2EFG A;  2NPF A;  4LFB E;  1J5E E;  4JI7 I;  4DV4 E;  4DR2 I;  1H72 C;  1KIJ A;  1MX0 A;  1XHK A;  4XTJ A;  4PRX A;  2DIX A;  4DV0 E;  1PVG A;  1NZ0 A;  4NXM E;  1ELO A;  1ZBT A;  1UIL A;  2UXC I;  1N0V C;  2ZM6 I;  3PYE A;  4LF5 E;  3J7Y p;  4X65 I;  1X49 A;  2EZ6 A;  1N34 E;  4M2Z A;  1NHH A;  1N32 E;  1VIS A;  4DV3 I;  1Z5C A;  1YYW A;  1B62 A;  4JI1 I;  4DR4 I;  4JV5 I;  1XMO I;  1I94 E;  3V5R A;  1A6F A;  4X8W A;  2JY9 A;  1T4N A;  4JI4 I;  4B3R I;  2L3J A;  4GKJ E;  4KHP E;  4B3S I;  4AQY E;  1IBK I;  2L33 A;  4R1F A;  3ADG A;  4K0K I;  1T4O A;  2V8P A;  2YT4 A;  4OOG C;  4RPF A;  2WW4 A;  1MG7 A;  4JI8 I;  4WFT A;  1Z0G A;  4LFA I;  2J7K A;  1ZM4 A;  1EKZ A;  4X62 E;  1S4E A;  2NUF A; 
#chains in the Genus database with same CATH topology
 4YHH I;  3ZZU A;  2ENH A;  4DV1 I;  3CWV A;  4IJD A;  2MDG A;  3J80 Q;  2WP8 B;  1YFH A;  2DLQ A;  4ZYH A;  4Q35 B;  2EQ3 A;  2GO3 A;  4FW4 A;  4UTG A;  2VQE E;  3ZZT A;  3J7A G;  4M1K A;  2D9H A;  1FWL A;  5LMU E;  3HTX A;  4X66 E;  1IQO A;  1XNQ E;  4BA2 A;  1UDO A;  4DR3 I;  2L2K B;  4JG4 A;  2PO1 A;  1Z0C A;  1X6E A;  2EPA A;  4I8O A;  2Z5B B;  1X48 A;  3J80 C;  3ZM7 A;  4IZJ B;  2VF1 A;  4NZV A;  2K7I A;  1J5E I;  4DR6 I;  1WUU A;  4DR1 E;  1SFE A;  1X5W A;  4DV4 I;  2EM7 A;  2DEJ A;  2WP8 A;  1N36 I;  1WXR A;  3IWD A;  4LPF A;  1T38 A;  1EA6 A;  4OZE A;  4B3R E;  2Z5E A;  4LFB I;  2GS8 A;  4DV0 I;  4DKK A;  2Z5B A;  3B8H A;  4DR5 E;  2EM5 A;  4KWY A;  4ZYE A;  4ISA A;  1IBL E;  2EML A;  4NXM I;  2G7H A;  2EOE A;  3EQ1 A;  4LF4 E;  4USK A;  2UXB I;  3C6K A;  3KWR A;  2UXD E;  2UU9 E;  3P3G A;  4OX9 I;  4FW9 A;  4USM A;  1P47 A;  4B3T E;  1EH6 A;  2ELZ A;  3PYF A;  5FLX Q;  2KOU A;  2FGG A;  4LF5 I;  2BBG A;  1ZU1 A;  4DV5 I;  2ELY A;  4R2D A;  2C39 B;  2Q2E B;  3QT6 A;  4KZS A;  1HK7 A;  1Z59 A;  1N34 I;  4EMD A;  2O1T A;  5KL2 A;  2E5L I;  4AIM A;  2GHF A;  2M1S A;  5FLX C;  2JE6 B;  1N32 I;  2BV3 A;  3GCM A;  3K1J A;  2EQ0 A;  2LMZ A;  3ZZ0 A;  5JEA D;  2B7T A;  4MYU A;  1I94 I;  4R2A A;  3IWC A;  2YTD A;  2RS6 A;  4LF7 E;  2BA0 G;  2CTD A;  5TSE A;  1E3H A;  3THN A;  2HFS A;  2LV2 A;  2LUQ A;  5ELW A;  2C39 A;  2JXP A;  1GQE A;  3Q6N A;  2GO4 A;  2YTF A;  4DR6 E;  3J81 Q;  2L3C A;  2JE6 A;  1X6F A;  2C37 B;  4GKJ I;  1N36 E;  3P3C A;  3ADI A;  4AQY I;  4KHP I;  5KL5 A;  2EL4 A;  1YSA C;  1P42 A;  2YRM A;  2UUC I;  1PIE A;  4FWD A;  4JI3 I;  1FNM A;  2L8T A;  2LRS A;  1VI7 A;  2YZT A;  5A6B A;  2PNM A;  5LMN E;  4DPX A;  4AID A;  3J81 C;  2EMH A;  2PRT A;  1B63 A;  1L4S A;  4RH8 A;  3J7A M;  3ADL A;  2R3V A;  2UXB E;  1BKN A;  1H7U A;  4LF8 E;  4PRV A;  4OX9 E;  2E1M A;  2RQL A;  1OYR A;  4R2C A;  1A1F A;  2EN3 A;  2EOJ A;  2C37 A;  2IHR 1;  1LLM C;  4X62 I;  2EMI A;  2DMY A;  2R76 A;  2RSI A;  1QNT A;  2EMB A;  3OTO E;  3T1Y E;  1MGT A;  4OO1 D;  2M4I A;  5KL6 A;  2FV4 B;  1Y6Z A;  4DV5 E;  4JI0 E;  2CG9 A;  4DPY A;  4HXZ A;  4B3S I;  1Y5Y A;  2EMZ A;  3K85 A;  2VQE I;  3QG5 C;  1FJG I;  2E5L E;  3VYY A;  4X66 I;  5JEA C;  5LMU I;  2BM1 A;  1XNQ I;  3ADJ A;  2LJH A;  3JAM Q;  1AH5 A;  1TF3 A;  4WUC A;  2WBS A;  4MU1 A;  1HNZ E;  5BR8 E;  3M99 B;  2EOQ A;  4Q28 A;  4R2Q A;  4HYM A;  2EOI A;  3UHM A;  4DPU A;  2NA2 A;  4X9J A;  2RSM A;  1QU6 A;  2EL5 A;  2CZ9 A;  5GME A;  5DNL A;  4DV2 I;  4DR1 I;  2BR2 B;  1Z0B A;  3JAM C;  3KZY A;  2E1R A;  4BHC A;  1T39 A;  3WU6 A;  5JEA F;  2ZIT A;  2YSP A;  2F4V I;  2B9D A;  2MKD A;  5DRO A;  1KYQ A;  1Z0W A;  4FWH A;  4DR5 I;  2MC6 A;  2V86 A;  2YTO A;  2UUC E;  2EQ1 A;  2IOP A;  1IBL I;  1ZM2 A;  2EN7 A;  4JI3 E;  4JYA E;  2CGE A;  4LF4 I;  2BA0 D;  5A6J A;  2UXD I;  2DRP A;  2UU9 I;  3CDI A;  4R03 A;  4B3T I;  1XNR E;  1USV A;  1A1K A;  1X6H A;  2YWQ A;  2EPM X;  1YUJ A;  1BB8 A;  2XEX A;  4JI2 I;  3B4T A;  2L2M A;  3PS3 A;  1N33 E;  4LU9 A;  4OO1 C;  2I13 A;  2UUB E;  2HK3 A;  2LJP A;  4X64 E;  4UT4 A;  2EOH A;  2VQF I;  4RHB B;  3PS2 A;  1AAY A;  2CT1 A;  1YYO A;  3QT5 A;  2A2C A;  4DUY I;  2HKJ A;  1GZ6 A;  1YH8 A;  5L3J A;  1HNW E;  5IXM B;  4DPW A;  2EM0 A;  2V34 A;  3HUL A;  1KJK A;  1KKH A;  1FJG E;  2WNR A;  3Q6M A;  5A2Q Q;  5DNY A;  2AJ4 A;  3VYX A;  4LF7 I;  2ZBK B;  1PKP A;  2ODR D;  2EMC A;  2J65 A;  4L5N C;  4OO1 F;  1UHZ A;  1RR9 A;  2NN6 A;  4F9C B;  2Z5C B;  3VHT B;  4GKK E;  1Y4U A;  3AV0 A;  3EPH A;  4DV2 E;  1H73 A;  3HPS A;  3JU0 A;  2JT2 A;  2X36 A;  5A2Q C;  4IS9 A;  2EM3 A;  2L92 A;  4AM3 A;  1WRJ A;  4WPY A;  4BCA A;  4B3M E;  4O5G A;  3B82 A;  3GLL A;  4DV7 I;  1GTK A;  5K36 D;  3M6A A;  2EOO A;  2EOM A;  3WU5 A;  2CPN A;  2LBS B;  2PNZ B;  2EPP A;  2EPU A;  4BHB A;  5AE2 A;  2F4V E;  2O1U A;  3GME A;  2O1V A;  3C4B A;  5LMN I;  1PJQ A;  2YU5 A;  1UDS A;  2YU8 A;  4FK5 C;  2NAB A;  4IZJ A;  2Z5C A;  3P3E A;  2EN4 A;  2HC5 A;  1F2I G;  1R6M A;  4LCF A;  4LF8 I;  2HFU A;  1PJS A;  4KQV A;  1FWK A;  1IBM E;  4JI2 E;  3T1Y I;  5EL9 A;  3OTO I;  2KHX A;  1DI2 A;  3HXL A;  4F2J C;  1UDN A;  4DU7 A;  2EM6 A;  2PNZ A;  2E72 A;  5DRQ A;  3HQ1 A;  2JPA A;  3PYD A;  4JI0 I;  2EP3 A;  2VQF E;  2JP9 A;  1UN6 B;  5AAS A;  3GON A;  2NUE A;  2MC5 A;  2EPN A;  4MLV A;  3F6G A;  1T4L B;  1R6L A;  3EPL A;  4DUY E;  3K17 A;  4FN5 A;  3PYG A;  2DLK A;  2YTJ A;  4ZVI A;  1HNZ I;  5BR8 I;  5C0X D;  2ODR C;  2PO0 B;  3EPK A;  4YY3 E;  5AE3 A;  2VF3 A;  3P1X A;  1FKA E;  2NN6 B;  3LTO A;  4R2P A;  2IES A;  2VRD A;  3C4T A;  3HJC A;  5K36 C;  2FTX B;  2B7V A;  4X64 I;  2L6M A;  4LF6 E;  4DV7 E;  2PO2 B;  2EMX A;  2R1F A;  2C38 B;  1QZR A;  4FWG A;  2EMF A;  5GMD A;  5JEA E;  4JYA I;  4DU8 A;  2PO0 A;  2M7Q A;  4R2S A;  1HNX E;  1ZM3 A;  4WX9 A;  3ZKB A;  2EOF A;  1Z0V A;  2EMW A;  1RC7 A;  1XNR I;  1JK1 A;  2EM8 A;  2EM9 A;  1OJ4 A;  2EPL X;  4HAC B;  2YTQ A;  3LML A;  3V2U C;  4P7A A;  2EOY A;  1BBG A;  2EOR A;  1N33 I;  5K36 F;  1DGC A;  4ED4 A;  2UUB I;  2MKN A;  3OML A;  3ECR A;  2JVA A;  3LNU A;  4NHR A;  2EOZ A;  4R2E A;  2PO2 A;  4WSP A;  2V2Z A;  2A25 A;  2Q8U A;  3LLH A;  2PNL A;  4NBQ A;  1KVK A;  1YZ9 A;  3F6H A;  2M9A A;  4NXN E;  1HNW I;  3VK6 A;  5LL6 R;  5A6A A;  2GLI A;  4P7D A;  1HR0 E;  4WSG A;  4DPT A;  1YPN A;  2YTE A;  4IFD D;  2WBT A;  1X47 A;  5JEA B;  4BMJ A;  5C0X C;  4HAC A;  3PS1 A;  4FW5 A;  3WU4 A;  1NHJ A;  1RMD A;  2RTX A;  1MEY C;  2EPC A;  4GKK I;  1D6T A;  4M9V C;  2MDR A;  1S16 A;  2EPR A;  4M30 A;  4BC9 A;  1UDQ A;  4LCG A;  4OO1 E;  2EE8 A;  3M85 G;  1WHQ A;  2RS7 A;  4JI5 E;  4B3M I;  3LPS A;  1EH8 A;  3H4L A;  2NN6 D;  1A1J A;  5F3W A;  2WCC 3;  4DMI A;  4IS1 C;  2VES A;  5JEA A;  1BBO A;  3B78 A;  1Z5B A;  5C0X F;  4HEI A;  3HPZ A;  5CFF E;  5ADZ A;  4LF9 E;  1NHI A;  2LO3 A;  4GZN C;  1XXE A;  2UUA E;  2EN1 A;  4DUZ E;  4DXL A;  2N3H A;  3T1H I;  2ADR A;  4F6N A;  1IBM I;  2BR2 A;  4MU3 A;  4WXD A;  4LFC E;  1J26 A;  1WHN A;  2EN6 A;  4DR7 E;  2L2N A;  2I9I A;  1MU5 A;  3IWB A;  4LCH A;  4OO1 B;  1A1I A;  2V89 A;  2DEI A;  1RQ0 A;  1ZM9 A;  4FW6 A;  3ZKD A;  3C6M A;  4BS9 A;  4OKG A;  4JI7 E;  4QNK A;  5AC4 A;  1UBD C;  4DV6 I;  4GEQ B;  4DR2 E;  1G2F C;  4IFD C;  2B3T B;  2EPZ A;  2WBU A;  2LTS A;  3BF2 A;  2LJU A;  1TF6 A;  1XMQ I;  1KTV A;  1DQ3 A;  1UEK A;  3D4J A;  3MHH C;  2CVE A;  4N3O A;  4JI6 I;  4YY3 I;  2JEA B;  1H74 A;  2EOX A;  4I3H A;  2JOX A;  2LUP B;  4WXC A;  2LVH A;  1STU A;  1ZBQ A;  3DF6 A;  1A1G A;  4OO1 A;  1ZXM A;  2LT7 A;  3F0N A;  3WU3 A;  5A6K A;  2PO1 B;  2R42 A;  2EN2 A;  4J8Z A;  2JYA A;  4WYQ B;  4BBY A;  3RMP A;  4Z7C A;  2UXC E;  2ZM6 E;  2NN6 C;  2HHH I;  4P78 A;  1EH7 A;  4LF6 I;  4IFD F;  1IMU A;  2HKE A;  1ZXN A;  2RPC A;  3Q1Q A;  2DB2 A;  1DAR A;  4X65 E;  5IWA I;  1HNX I;  2A2D A;  2LCE A;  3H09 A;  4HTG A;  3M7N D;  4Z7Y A;  4FW7 A;  1X3C A;  1ZR9 A;  1K47 A;  1Z0E A;  2ENA A;  2O1W A;  4DV3 E;  1ZAA C;  2V2V A;  1Z0T A;  3T1H E;  1RHY A;  4JI1 E;  2NUG A;  3BGH A;  1TN9 A;  2JR1 A;  1XMO E;  5A6B D;  2ENC A;  4DR4 E;  4JV5 E;  4MDT A;  2LE2 A;  2V87 A;  2EMA A;  5A69 A;  2NN6 F;  3M85 D;  4U3D A;  1Y4S A;  2YTP A;  3PRY A;  3UK3 C;  4P52 A;  5DRP A;  5K36 E;  1Z5A A;  4HY1 A;  1YYK A;  2X7I A;  4LTY A;  4NXN I;  4O24 A;  5DNX A;  1HR0 I;  2YRH A;  2EM4 A;  4JI4 E;  2LTR A;  4DV6 E;  4F9A B;  2EPK X;  3KZZ A;  1IBK E;  2V88 A;  4B3S E;  4MYT A;  4WUB A;  1PJT A;  4K0K E;  1XMQ E;  2EPO A;  4JI6 E;  1Y60 A;  4JI8 E;  4URL A;  1IQS A;  2OI2 A;  2AE8 A;  3QT8 A;  5IT9 Q;  4LFA E;  2IER A;  3CDJ A;  3L7Z B;  1U2R A;  4JI5 I;  3QT7 A;  1FI4 A;  4O43 A;  1JK2 A;  2EN8 A;  4PU9 A;  2J7J A;  2N3G A;  3BID A;  5K36 B;  4O4K A;  3HKM A;  2BM0 A;  3BBG A;  2HHH E;  1EI1 A;  1O0W A;  4YHH E;  3U1Y A;  5IT9 C;  2GQ0 A;  4DV1 E;  3EPJ A;  4LF9 I;  2KON A;  5IV8 B;  4LOM A;  2UUA I;  2HK2 A;  5C0X E;  5IWA E;  4DUZ I;  5KL3 A;  1RRE A;  3JTZ A;  2V2Q A;  1N0U A;  3L7Z A;  4LFC I;  2K4V A;  1G2D C;  2BA1 D;  4DR3 E;  2EOS A;  3TQM A;  5KL7 A;  4DR7 I;  4WUD A;  1H7S A;  5T6J A;  2EFG A;  2NPF A;  5K36 A;  4LFB E;  2YTN A;  1NCS A;  1J5E E;  1OYP A;  4BA1 B;  2C38 A;  4JI7 I;  3DJW A;  4DV4 E;  4DR2 I;  4F6M A;  4MQY A;  5LLQ A;  1H72 C;  1KIJ A;  1MX0 A;  4MU4 A;  1XHK A;  3U1K A;  2GPI A;  1NEI A;  3L00 A;  2F1D A;  2DIX A;  4TUI A;  3P06 A;  4PRX A;  4XTJ A;  2YPN A;  2BB8 A;  4ZYD A;  4L8N A;  4DV0 E;  5C0X B;  3MSW A;  1PVG A;  5EKW A;  1NZ0 A;  3DD6 A;  2JWO A;  4TUG A;  2JEB B;  4NXM E;  3M7N G;  2HJJ A;  2EL6 A;  3AUZ A;  1E3P A;  1ELO A;  4BA1 A;  1ZBT A;  1UIL A;  2V85 A;  4R8O A;  4BC7 A;  2UXC I;  1N0V C;  4FW3 A;  2ZM6 I;  3MHS C;  3PYE A;  2YSO A;  4LF5 E;  3J7Y p;  3ZOQ B;  5FWK A;  2F8B A;  2V83 A;  4X65 I;  1X49 A;  2YTG A;  4IFD E;  2EMY A;  2EZ6 A;  1A1L A;  5C0X A;  1N34 E;  2YTI A;  4M2Z A;  1NHH A;  1Z1B A;  5AC5 A;  2O3Z A;  2JEB A;  1YUI A;  1N32 E;  2EMK A;  1VIS A;  1SR9 A;  4DV3 I;  2DMI A;  4ZYG A;  2N8X A;  2HGH A;  2EM2 A;  1YYW A;  1B62 A;  4MLQ A;  4F9B B;  1Z5C A;  4GQU A;  4IZK B;  5DRR A;  4JI1 I;  3H1C A;  1XMO I;  4DR4 I;  1I94 E;  4JV5 I;  3V5R A;  2EPX A;  3NZK A;  1YHC A;  1A6F A;  4IZJ D;  4X8W A;  2JY9 A;  4J3D A;  1WJP A;  5AE1 A;  2NN6 E;  2DGC A;  1T4N A;  2DSY A;  2H36 X;  1A1H A;  2IOQ A;  2WZO A;  4JI4 I;  2VE7 C;  4U3B A;  3FIG A;  1OYS A;  4B3R I;  2L3J A;  4GKJ E;  4R2R A;  4KHP E;  4AQY E;  1IBK I;  2L33 A;  4IZK A;  5KL4 A;  3ADG A;  4M0V A;  4QNJ A;  4R1F A;  4IFD B;  4K0K I;  1T4O A;  2EWL A;  2V8P A;  1PDA A;  2JOB A;  2YT4 A;  4OOG C;  4RPF A;  2WW4 A;  1MG7 A;  3KRN A;  4JI8 I;  4WFT A;  4N4R B;  1Z0G A;  4MU0 A;  4LFA I;  2V8Q B;  4F54 A;  1B69 A;  2WNR B;  2EMG A;  4BA2 B;  2BA1 G;  1N3G A;  3K6Q A;  2EJ4 A;  2J7K A;  3THO B;  3P76 A;  2YRK A;  1ZM4 A;  1EKZ A;  1USU A;  4X62 E;  1S4E A;  2CSH A;  2JEA A;  2NUF A;  4IFD A; 
#chains in the Genus database with same CATH homology
 4YHH I;  3ZZU A;  4DV1 I;  3CWV A;  3J80 Q;  4UTG A;  3ZZT A;  2VQE E;  3J7A G;  4M1K A;  1FWL A;  5LMU E;  3HTX A;  4X66 E;  1XNQ E;  4DR3 I;  2L2K B;  4JG4 A;  1Z0C A;  2Z5B B;  4I8O A;  1X48 A;  3J80 C;  3ZM7 A;  4IZJ B;  2VF1 A;  1J5E I;  4DR6 I;  1WUU A;  4DR1 E;  4DV4 I;  2DEJ A;  1N36 I;  1WXR A;  3IWD A;  1EA6 A;  4B3R E;  2Z5E A;  2GS8 A;  4DV0 I;  4DKK A;  2Z5B A;  3B8H A;  4DR5 E;  1IBL E;  4NXM I;  2G7H A;  4LF4 E;  4USK A;  2UXB I;  3KWR A;  2UXD E;  2UU9 E;  4OX9 I;  4FW9 A;  4USM A;  4B3T E;  3PYF A;  5FLX Q;  2KOU A;  2FGG A;  4LF5 I;  4DV5 I;  2Q2E B;  3QT6 A;  4KZS A;  1HK7 A;  1Z59 A;  1N34 I;  4EMD A;  2O1T A;  2E5L I;  2M1S A;  5FLX C;  1N32 I;  2BV3 A;  3K1J A;  2LMZ A;  3ZZ0 A;  2B7T A;  4MYU A;  1I94 I;  3IWC A;  2RS6 A;  4LF7 E;  2HFS A;  2LUQ A;  1GQE A;  3Q6N A;  4DR6 E;  3J81 Q;  2L3C A;  4GKJ I;  1N36 E;  4KHP I;  3ADI A;  4AQY I;  2UUC I;  1PIE A;  4FWD A;  4JI3 I;  1FNM A;  2L8T A;  2LRS A;  2YZT A;  2PNM A;  5LMN E;  4DPX A;  3J81 C;  1B63 A;  3J7A M;  3ADL A;  2R3V A;  2UXB E;  1H7U A;  1BKN A;  4LF8 E;  4PRV A;  4OX9 E;  2E1M A;  4X62 I;  2IHR 1;  2DMY A;  3T1Y E;  3OTO E;  2M4I A;  2FV4 B;  1Y6Z A;  4DV5 E;  4JI0 E;  2CG9 A;  4DPY A;  4HXZ A;  3K85 A;  2VQE I;  1FJG I;  2E5L E;  3VYY A;  4X66 I;  5LMU I;  1XNQ I;  2BM1 A;  3ADJ A;  2LJH A;  3JAM Q;  4WUC A;  1HNZ E;  5BR8 E;  4Q28 A;  4HYM A;  4DPU A;  2NA2 A;  2RSM A;  1QU6 A;  2CZ9 A;  5GME A;  4DV2 I;  4DR1 I;  1Z0B A;  3JAM C;  2E1R A;  3WU6 A;  2F4V I;  2ZIT A;  2B9D A;  4FWH A;  1Z0W A;  4DR5 I;  2MC6 A;  2V86 A;  1IBL I;  2UUC E;  2IOP A;  1ZM2 A;  4JI3 E;  4JYA E;  2CGE A;  4LF4 I;  2UXD I;  2UU9 I;  4R03 A;  4B3T I;  1XNR E;  1USV A;  4JI2 I;  2XEX A;  2L2M A;  1N33 E;  4LU9 A;  2UUB E;  2HK3 A;  2LJP A;  4UT4 A;  4X64 E;  2VQF I;  1YYO A;  3QT5 A;  2A2C A;  4DUY I;  2HKJ A;  1GZ6 A;  5L3J A;  1HNW E;  4DPW A;  2V34 A;  3HUL A;  1KKH A;  1FJG E;  3Q6M A;  5A2Q Q;  5DNY A;  2AJ4 A;  3VYX A;  4LF7 I;  2ZBK B;  1PKP A;  2ODR D;  4L5N C;  1UHZ A;  1RR9 A;  4F9C B;  2Z5C B;  4GKK E;  1Y4U A;  3AV0 A;  4DV2 E;  1H73 A;  3HPS A;  3JU0 A;  2X36 A;  5A2Q C;  2L92 A;  4WPY A;  4BCA A;  4B3M E;  3B82 A;  4DV7 I;  3M6A A;  3WU5 A;  2CPN A;  2LBS B;  5AE2 A;  2F4V E;  2O1U A;  2O1V A;  3C4B A;  5LMN I;  4IZJ A;  2Z5C A;  4LF8 I;  2HFU A;  4KQV A;  1FWK A;  1IBM E;  4JI2 E;  3T1Y I;  3OTO I;  2KHX A;  1DI2 A;  3HXL A;  4DU7 A;  3HQ1 A;  3PYD A;  4JI0 I;  2VQF E;  5AAS A;  3GON A;  2NUE A;  2MC5 A;  3F6G A;  1T4L B;  3K17 A;  4FN5 A;  4DUY E;  3PYG A;  4ZVI A;  1HNZ I;  5BR8 I;  2ODR C;  4YY3 E;  5AE3 A;  2VF3 A;  3P1X A;  1FKA E;  3LTO A;  3C4T A;  3HJC A;  2FTX B;  2B7V A;  2L6M A;  4LF6 E;  4DV7 E;  1QZR A;  4FWG A;  5GMD A;  4JYA I;  4DU8 A;  2M7Q A;  1HNX E;  1ZM3 A;  3ZKB A;  1Z0V A;  1RC7 A;  1XNR I;  1OJ4 A;  4HAC B;  3LML A;  3V2U C;  4P7A A;  1N33 I;  4ED4 A;  2UUB I;  3LNU A;  3OML A;  4X64 I;  2JVA A;  2V2Z A;  4WSP A;  2PNL A;  3LLH A;  1KVK A;  1YZ9 A;  3F6H A;  4NXN E;  1HNW I;  3VK6 A;  5LL6 R;  4P7D A;  1HR0 E;  4DPT A;  1X47 A;  4BMJ A;  4HAC A;  3WU4 A;  1NHJ A;  2RTX A;  4GKK I;  1D6T A;  2MDR A;  1S16 A;  4BC9 A;  4M30 A;  1WHQ A;  2RS7 A;  4JI5 E;  4B3M I;  3LPS A;  3H4L A;  5F3W A;  4DMI A;  3B78 A;  1Z5B A;  3HPZ A;  5CFF E;  5ADZ A;  4LF9 E;  1NHI A;  2UUA E;  4DUZ E;  4DXL A;  2N3H A;  3T1H I;  1IBM I;  4LFC E;  1J26 A;  1WHN A;  4DR7 E;  2L2N A;  1MU5 A;  3IWB A;  2V89 A;  2DEI A;  1RQ0 A;  1ZM9 A;  3ZKD A;  4BS9 A;  4JI7 E;  4DV6 I;  4GEQ B;  4DR2 E;  2B3T B;  2LTS A;  1XMQ I;  1KTV A;  1DQ3 A;  1UEK A;  3D4J A;  4N3O A;  4JI6 I;  4YY3 I;  1H74 A;  4I3H A;  2JOX A;  2LUP B;  1STU A;  1ZBQ A;  3DF6 A;  1ZXM A;  3F0N A;  3WU3 A;  2R42 A;  3RMP A;  4J8Z A;  4WYQ B;  4BBY A;  4Z7C A;  2UXC E;  2ZM6 E;  2HHH I;  4P78 A;  4LF6 I;  2HKE A;  1ZXN A;  3Q1Q A;  2DB2 A;  1DAR A;  4X65 E;  5IWA I;  1HNX I;  2A2D A;  3H09 A;  4Z7Y A;  1K47 A;  1Z0E A;  2O1W A;  2V2V A;  4DV3 E;  1Z0T A;  3T1H E;  4JI1 E;  2NUG A;  4DR4 E;  4JV5 E;  2JR1 A;  1XMO E;  4LFB I;  2LE2 A;  2V87 A;  3PRY A;  4P52 A;  1Z5A A;  4HY1 A;  1YYK A;  2X7I A;  4LTY A;  4NXN I;  1HR0 I;  4JI4 E;  2LTR A;  4DV6 E;  4F9A B;  4B3S E;  1IBK E;  2V88 A;  4MYT A;  4WUB A;  4K0K E;  1XMQ E;  4JI6 E;  4JI8 E;  4URL A;  2OI2 A;  3QT8 A;  5IT9 Q;  4LFA E;  1U2R A;  4JI5 I;  3QT7 A;  1FI4 A;  4PU9 A;  2N3G A;  2BM0 A;  2HHH E;  1EI1 A;  1O0W A;  4YHH E;  5IT9 C;  2GQ0 A;  4DV1 E;  4LF9 I;  2KON A;  2UUA I;  2HK2 A;  5IWA E;  4DUZ I;  1RRE A;  3JTZ A;  2V2Q A;  1N0U A;  4LFC I;  2K4V A;  4DR3 E;  4DR7 I;  4WUD A;  1H7S A;  5T6J A;  2EFG A;  2NPF A;  4LFB E;  1J5E E;  4JI7 I;  3DJW A;  4DV4 E;  4DR2 I;  1H72 C;  1KIJ A;  1MX0 A;  1XHK A;  3P06 A;  4XTJ A;  4PRX A;  2DIX A;  4TUI A;  4L8N A;  4DV0 E;  3MSW A;  1PVG A;  1NZ0 A;  2JWO A;  4TUG A;  4NXM E;  3AUZ A;  1ELO A;  1ZBT A;  1UIL A;  2V85 A;  4R8O A;  4BC7 A;  2UXC I;  1N0V C;  2ZM6 I;  3PYE A;  4LF5 E;  3J7Y p;  3ZOQ B;  5FWK A;  2F8B A;  2V83 A;  4X65 I;  1X49 A;  2EZ6 A;  1N34 E;  4M2Z A;  1NHH A;  1N32 E;  1VIS A;  1SR9 A;  4DV3 I;  4IZK B;  1Z5C A;  1YYW A;  1B62 A;  4F9B B;  4JI1 I;  4DR4 I;  4JV5 I;  1XMO I;  1I94 E;  3V5R A;  1A6F A;  4IZJ D;  4X8W A;  2JY9 A;  5AE1 A;  1T4N A;  2DSY A;  2H36 X;  2IOQ A;  2WZO A;  4JI4 I;  2VE7 C;  3FIG A;  4B3R I;  2L3J A;  4GKJ E;  4KHP E;  4B3S I;  4AQY E;  1IBK I;  2L33 A;  4IZK A;  4R1F A;  3ADG A;  4M0V A;  4K0K I;  1T4O A;  2EWL A;  2V8P A;  2JOB A;  2YT4 A;  4OOG C;  4RPF A;  2WW4 A;  1MG7 A;  4JI8 I;  4WFT A;  1Z0G A;  4LFA I;  2V8Q B;  4F54 A;  3K6Q A;  2J7K A;  1ZM4 A;  1EKZ A;  1USU A;  4X62 E;  1S4E A;  1Y4S A;  2NUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...