5LMUI

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuI00
2ZITA 3JAMC 5FLXC 2E1RA 4B3ME 3V2UC 1PIEA 1XMQE 5LMUI 4JG4A 4X66E 1HNWE 1Z5AA 3T1YE 4Z7YA 1B62A 1Z0GA 5FLXQ 1MG7A 4B3MI 4OX9E 1FJGE 4JI7E 3HULA 1I94I 4NXME 1HNZE 1HNWI 3LPSA 3T1YI 1H72C 4DPXA 3K17A 1FJGI 1IBMI 4JI7I 4DV1E 1Z0VA 4NXMI 4DV7I 1ZM9A 4FN5A 3H4LA 4DPWA 4HYMA 3PYDA 5IT9C 4DUZI 1XNRI 4PRXA 5IT9Q 2HKJA 4DR5I 4GKJI 4DR7E 2HFUA 4LF8E 4Z7CA 3PYEA 2VQEI 4FW9A 4HY1A 1OJ4A 3J80C 3QT5A 2OI2A 1MX0A 2HFSA 3CWVA 1U2RA 2UUBE 1N0UA 2UUCE 3D4JA 1KTVA 2R3VA 1EA6A 1NHIA 3K1JA 1ELOA 4FWDA 4RPFA 4URLA 4MYTA 4WUCA 3J80Q 4JI0E 4ZVIA 3ZM7A 2V2VA 2UUAE 4LFBE 2UUCI 5IWAE 4DR2E 1KVKA 4LFAE 3QT8A 2F4VE 2E5LI 4LF6E 4JI0I 2BM0A 1N36E 4DR4I 4LF4I 4DV0I 2UUAI 4FWHA 4P52A 4DV3I 4LFBI 4UT4A 1N0VC 3T1HI 4LF9E 4LFAI 4FWGA 2F4VI 4DR1I 4LF6I 4LF5I 4YY3E 2HKEA 4LF9I 3WU6A 4DR3E 4AQYE 1Z0EA 4DPTA 2DEJA 1ZM4A 1J5EE 1EI1A 4YY3I 4DV2E 3JAMQ 4X62E 1D6TA 1IBLE 2BM1A 4AQYI 1XMQI 2X7IA 5GMEA 4X66I 1NZ0A 4ED4A 1HNXE 4JI3E 4JYAE 4JI5E 4JV5E 3WU4A 4X62I 2HHHE 4OX9I 2DEIA 1UEKA 1IBLI 2ZM6E 3J7AG 1QZRA 1WUUA 4WUBA 1HNZI 1XNQE 4HACB 4DUYE 4DV4E 4JI3I 4JYAI 4JV5I 4P7AA 2ZM6I 4DV1I 4JI4E 3OTOE 1N33E 1XNQI 1FI4A 1XMOE 4B3RE 2BV3A 2UXDE 1PVGA 3WU3A 1BKNA 4USMA 1B63A 4JI4I 3OTOI 1FWLA 3B78A 4JI6E 4LF7E 1N33I 1ZM3A 4XTJA 1XMOI 1FKAE 1XHKA 4DR6E 4I3HA 5A2QC 1N34E 1PKPA 4LF7I 3LNUA 5L3JA 3QT7A 3PYFA 4DR7I 4LF8I 2AJ4A 1HR0E 5A2QQ 4NXNE 4EMDA 4WUDA 2UUBI 1Z0CA 5LL6R 1K47A 1MU5A 1S4EA 4LFCE 3QT6A 1Z0BA 3F0NA 4M1KA 4JI8E 2Q2EB 1HR0I 4USKA 4JI2E 4NXNI 5IWAI 4DR2I 3J81C 4B3TE 2VQFE 4GKKE 4JI8I 1Z0WA 1N36I 5GMDA 1RR9A 1VISA 2NPFA 5BR8E 3WU5A 2GS8A 3ZKBA 3J81Q 3ZZTA 1ZXMA 2VQFI 1H74A 3ZZUA 3GONA 5LMUE 1IBKE 1KIJA 1FNMA 4DU7A 4JI1E 5BR8I 1Z5CA 4DR3I 1Z59A 3B82A 2CZ9A 4K0KE 1J5EI 1FWKA 1I94E 2UXBE 1IBKI 4DV2I 1RREA 4JI1I 4KHPE 2V2ZA 4DU8A 3Q1QA 2UXCE 2HK3A 4K0KI 1IBME 1HNXI 2UXBI 4DV7E 3J7AM 4JI5I 4DV6E 2UU9E 2HHHI 4KHPI 3M6AA 2VF3A 1ZM2A 4R1FA 2UXCI 2R42A 4DUYI 1ZXNA 4DV4I 4DV6I 2UU9I 4UTGA 4DUZE 2V8PA 4X64E 1XNRE 3B8HA 4B3RI 4DR5E 4GKJE 1N32E 3ZZ0A 5LMNE 4X64I 2J7KA 2V34A 2UXDI 2VQEE 4JI6I 3V5RA 1Z5BA 2A2DA 2ZBKB 4DPUA 2X36A 4DR6I 1N32I 3PYGA 5LMNI 2A2CA 1N34I 2HK2A 2XEXA 3LTOA 1NHHA 4X65E 4PU9A 2WW4A 1H7UA 4DV5E 4B3SE 1H7SA 2E5LE 2LJPA 1H73A 4DPYA 4DR4E 1NHJA 4HACA 4X65I 4LF4E 4DV0E 4LFCI 2V2QA 4DV3E 1DARA 4MYUA 4YHHE 1A6FA 3T1HE 4JI2I 4DV5I 4DR1E 4B3SI 2EFGA 4LF5E 4PRVA 4B3TI 1Z0TA 1S16A 4KQVA 4GKKI 4YHHI 3ZKDA 4HXZA 4DXLA 1KKHA
chains in the Genus database with same CATH superfamily
2ZITA 5C0XB 3PS1A 3JAMC 5FLXC 2E1RA 4B3ME 3V2UC 1PIEA 1XMQE 5LMUI 4JG4A 4LCGA 4X66E 5DRRA 1HNWE 5JEAE 1UDOA 1Z5AA 3T1YE 4Z7YA 1B62A 1Z0GA 1XXEA 5FLXQ 1MG7A 2C37A 5JEAC 4B3MI 4OX9E 1FJGE 5K36D 4JI7E 3HULA 4OO1B 1I94I 2PO2B 4NXME 1HNZE 1HNWI 3LPSA 3P06A 3T1YI 1H72C 4DPXA 3KRNA 4MQYA 3K17A 1FJGI 1IBMI 1Y4UA 4JI7I 4DV1E 4IFDD 1Z0VA 4NXMI 4DV7I 3Q6MA 1ZM9A 4FN5A 2PO1A 2GQ0A 3H4LA 4DPWA 4HYMA 4LOMA 2PNZB 3PYDA 4FW3A 5FWKA 5IT9C 4DUZI 1XNRI 2JEAB 5C0XE 4MU1A 4PRXA 3UHMA 4AIDA 5C0XC 2Z5CB 5IT9Q 1UDQA 3NZKA 2HKJA 4DR5I 4GKJI 4DR7E 2HFUA 4MU0A 2BA0G 4LF8E 4Z7CA 3PYEA 2VQEI 1YH8A 4FW9A 4HY1A 1OJ4A 3J80C 3QT5A 2OI2A 1MX0A 2HFSA 4NBQA 4LCFA 3CWVA 4FW5A 3HKMA 4OO1E 1U2RA 2UUBE 1N0UA 2UUCE 3D4JA 1KTVA 1RHYA 2R3VA 1EA6A 1NHIA 4OO1C 3K1JA 1ELOA 4FWDA 2IERA 4RPFA 4URLA 4MYTA 4WUCA 4FW7A 3J80Q 4JI0E 4ZVIA 3ZM7A 2V2VA 3M85D 2UUAE 4LFBE 3P76A 2UUCI 5K36F 5IWAE 3PS2A 4DR2E 2NN6A 5K36A 1KVKA 4LFAE 3QT8A 2F4VE 2E5LI 4LF6E 4JI0I 2BM0A 1N36E 4DR4I 2C39A 1Y4SA 4LF4I 4DV0I 2UUAI 4FWHA 4P52A 4DV3I 4LFBI 1R6LA 4IFDF 4UT4A 1N0VC 3T1HI 2C38B 4LF9E 4LFAI 4FWGA 2F4VI 4DR1I 2BA1D 4LF6I 4LF5I 4U3DA 4YY3E 4IZJB 2HKEA 3PS3A 2F1DA 4LF9I 5DNLA 3WU6A 4DR3E 4AQYE 1Z0EA 4ISAA 4DPTA 4BA2A 2DEJA 1ZM4A 1J5EE 1EI1A 3L7ZB 2IESA 4YY3I 4DV2E 1R6MA 4N3OA 3JAMQ 2BR2B 4X62E 4FW4A 4QNJA 5DRQA 2Z5BB 1D6TA 1IBLE 2CVEA 2NN6D 2BM1A 2O1VA 1UDSA 4AQYI 1XMQI 2X7IA 4IZKA 5GMEA 1OYPA 4X66I 1NZ0A 3HJCA 5JEAA 4ED4A 1HNXE 3CDJA 4JI3E 4JYAE 4J3DA 4JI5E 1E3PA 2WP8A 3H1CA 4JV5E 4MDTA 3WU4A 4X62I 2HHHE 4BA1B 4OX9I 2DEIA 1UEKA 1IBLI 2ZM6E 3J7AG 1QZRA 3U1KA 1WUUA 4WUBA 1HNZI 4IS9A 4HACB 1XNQE 4DUYE 2JEBA 2PO0A 4DV4E 4JI3I 4JYAI 2GO3A 4JV5I 3M85G 4P7AA 2ZM6I 4DV1I 4JI4E 4U3BA 3OTOE 1N33E 1XNQI 1FI4A 1XMOE 4B3RE 5DNXA 4IFDB 2BV3A 2GO4A 2JE6B 1Y5YA 1PVGA 3WU3A 1BKNA 4USMA 1B63A 2UXDE 4JI4I 3P3GA 3OTOI 1FWLA 3B78A 4JI6E 4LF7E 1N33I 3DD6A 1ZM3A 4XTJA 2BA1G 2WNRA 1XMOI 5JEAD 1FKAE 2O1WA 2PNMA 5C0XA 1XHKA 4DR6E 4I3HA 5A2QC 1N34E 1PKPA 4LF7I 3LNUA 3PRYA 5L3JA 2O1TA 3QT7A 3PYFA 4DR7I 4LF8I 2AJ4A 2C37B 4LPFA 4LCHA 1P42A 1HR0E 5A2QQ 1OYRA 4NXNE 1OYSA 4EMDA 3CDIA 4OO1A 4WUDA 2UUBI 1Z0CA 2NN6F 1Y60A 1K47A 2PO2A 5LL6R 1MU5A 3U1YA 1S4EA 4LFCE 3QT6A 1Z0BA 3F0NA 4M1KA 4JI8E 2Q2EB 1Y6ZA 1HR0I 4USKA 4JI2E 4NXNI 2PO1B 5EL9A 5IWAI 4MU4A 4DR2I 3J81C 4B3TE 2VQFE 4GKKE 4JI8I 5C0XD 2J65A 1Z0WA 4IFDE 4IZJD 2PNZA 1N36I 5GMDA 4FW6A 2JT2A 4GQUA 4IFDC 1RR9A 1VISA 2NPFA 5BR8E 3WU5A 2GS8A 3ZKBA 3J81Q 3ZZTA 1ZXMA 2VQFI 1H74A 4AIMA 3GLLA 3ZZUA 5DROA 3GONA 1USVA 5LMUE 1IBKE 1KIJA 1FNMA 2Z5CA 4OO1D 4DU7A 4JI1E 5BR8I 1Z5CA 3M7NG 4DR3I 1Z59A 2VESA 3B82A 2CZ9A 3GMEA 4K0KE 5JEAF 1J5EI 1FWKA 3Q6NA 1I94E 2UXBE 1IBKI 4DV2I 2Z5EA 1RREA 4JI1I 4KHPE 2V2ZA 4DU8A 3Q1QA 4QNKA 2UXCE 2HK3A 4K0KI 1IBME 1HNXI 2UXBI 4DV7E 3J7AM 4JI5I 3GCMA 4DV6E 2NN6B 5K36B 2UU9E 2HHHI 4KHPI 3M6AA 2VF3A 2IOQA 2IOPA 2CG9A 1ZM2A 2PNLA 4R1FA 5ELWA 2UXCI 2C39B 2R42A 4DUYI 1YHCA 1ZXNA 4DV4I 4DV6I 2UU9I 4UTGA 4DUZE 1HK7A 2V8PA 4X64E 1XNRE 2C38A 5EKWA 4MU3A 3M7ND 5C0XF 1USUA 2AE8A 3B8HA 3P3CA 4B3RI 4DR5E 4IZJA 4GKJE 1N32E 3ZZ0A 5LMNE 4X64I 2J7KA 2O1UA 2V34A 2UXDI 4BA2B 2VQEE 4JI6I 3V5RA 1Z5BA 2A2DA 3L7ZA 2ZBKB 4DPUA 2X36A 4DR6I 1N32I 4OKGA 3PYGA 2BR2A 5LMNI 2A2CA 4IZKB 4OO1F 2Z5BA 1N34I 2HK2A 2XEXA 3LTOA 1UDNA 1NHHA 5JEAB 4X65E 2WP8B 3K85A 4PU9A 3B4TA 2CGEA 2NN6E 5K36E 2WW4A 1H7UA 4BA1A 4DV5E 2NN6C 5K36C 4B3SE 1H7SA 2E5LE 2LJPA 1H73A 4DPYA 2JEBB 2PO0B 1NHJA 4HACA 4DR4E 4X65I 4LF4E 4DV0E 4LFCI 2V2QA 4DV3E 1DARA 4MYUA 4YHHE 1A6FA 3T1HE 4JI2I 4DV5I 4DR1E 4OZEA 4B3SI 5DRPA 2EFGA 3P3EA 4LF5E 4PRVA 1VI7A 2O3ZA 4B3TI 1Z0TA 1S16A 4KQVA 4GKKI 4YHHI 2JEAA 4AM3A 4IFDA 1E3HA 2JE6A 3ZKDA 2BA0D 2WNRB 4HXZA 4DXLA 1KKHA
chains in the Genus database with same CATH topology
2ZITA 3JAMC 5FLXC 2E1RA 4B3ME 3V2UC 1PIEA 1XMQE 5LMUI 4JG4A 4X66E 1HNWE 1Z5AA 3T1YE 4Z7YA 1B62A 1Z0GA 5FLXQ 1MG7A 4B3MI 4OX9E 1FJGE 4JI7E 3HULA 1I94I 4NXME 1HNZE 1HNWI 3LPSA 3P06A 3T1YI 1H72C 4DPXA 3K17A 1FJGI 1IBMI 1Y4UA 4JI7I 4DV1E 1Z0VA 4NXMI 4DV7I 3Q6MA 1ZM9A 4FN5A 2GQ0A 3H4LA 4DPWA 4HYMA 3PYDA 5FWKA 5IT9C 4DUZI 1XNRI 4PRXA 2Z5CB 5IT9Q 2HKJA 4DR5I 4GKJI 4DR7E 2HFUA 4LF8E 4Z7CA 3PYEA 2VQEI 4FW9A 4HY1A 1OJ4A 3J80C 3QT5A 2OI2A 1MX0A 2HFSA 3CWVA 1U2RA 2UUBE 1N0UA 2UUCE 3D4JA 1KTVA 2R3VA 1EA6A 1NHIA 3K1JA 1ELOA 4FWDA 4RPFA 4URLA 4MYTA 4WUCA 3J80Q 4JI0E 4ZVIA 3ZM7A 2V2VA 2UUAE 4LFBE 2UUCI 5IWAE 4DR2E 1KVKA 4LFAE 3QT8A 2F4VE 2E5LI 4LF6E 4JI0I 2BM0A 1N36E 4DR4I 1Y4SA 4LF4I 4DV0I 2UUAI 4FWHA 4P52A 4DV3I 4LFBI 4UT4A 1N0VC 3T1HI 4LF9E 4LFAI 4FWGA 2F4VI 4DR1I 4LF6I 4LF5I 4YY3E 4IZJB 2HKEA 4LF9I 3WU6A 4DR3E 4AQYE 1Z0EA 4DPTA 2DEJA 1ZM4A 1J5EE 1EI1A 4YY3I 4DV2E 4N3OA 3JAMQ 4X62E 2Z5BB 1D6TA 1IBLE 2BM1A 2O1VA 4AQYI 1XMQI 2X7IA 4IZKA 5GMEA 4X66I 1NZ0A 3HJCA 4ED4A 1HNXE 4JI3E 4JYAE 4JI5E 4JV5E 3WU4A 4X62I 2HHHE 4OX9I 2DEIA 1UEKA 1IBLI 2ZM6E 3J7AG 1QZRA 1WUUA 4WUBA 1HNZI 1XNQE 4HACB 4DUYE 4DV4E 4JI3I 4JYAI 4JV5I 4P7AA 2ZM6I 4DV1I 4JI4E 3OTOE 1N33E 1XNQI 1FI4A 1XMOE 4B3RE 2BV3A 2UXDE 1PVGA 3WU3A 1BKNA 4USMA 1B63A 4JI4I 3OTOI 1FWLA 3B78A 4JI6E 4LF7E 1N33I 1ZM3A 4XTJA 1XMOI 1FKAE 2O1WA 2PNMA 1XHKA 4DR6E 4I3HA 5A2QC 1N34E 1PKPA 4LF7I 3LNUA 3PRYA 5L3JA 2O1TA 3QT7A 3PYFA 4DR7I 4LF8I 2AJ4A 1HR0E 5A2QQ 4NXNE 4EMDA 4WUDA 2UUBI 1Z0CA 5LL6R 1K47A 1MU5A 1S4EA 4LFCE 3QT6A 1Z0BA 3F0NA 4M1KA 4JI8E 2Q2EB 1Y6ZA 1HR0I 4USKA 4JI2E 4NXNI 5IWAI 4DR2I 3J81C 4B3TE 2VQFE 4GKKE 4JI8I 1Z0WA 4IZJD 1N36I 5GMDA 1RR9A 1VISA 2NPFA 5BR8E 3WU5A 2GS8A 3ZKBA 3J81Q 3ZZTA 1ZXMA 2VQFI 1H74A 3ZZUA 3GONA 1USVA 5LMUE 1IBKE 1KIJA 1FNMA 2Z5CA 4DU7A 4JI1E 5BR8I 1Z5CA 4DR3I 1Z59A 3B82A 2CZ9A 4K0KE 1J5EI 1FWKA 3Q6NA 1I94E 2UXBE 1IBKI 4DV2I 2Z5EA 1RREA 4JI1I 4KHPE 2V2ZA 4DU8A 3Q1QA 2UXCE 2HK3A 4K0KI 1IBME 1HNXI 2UXBI 4DV7E 3J7AM 4JI5I 4DV6E 2UU9E 2HHHI 4KHPI 3M6AA 2VF3A 2IOQA 2IOPA 2CG9A 1ZM2A 2PNLA 4R1FA 2UXCI 2R42A 4DUYI 1ZXNA 4DV4I 4DV6I 2UU9I 4UTGA 4DUZE 1HK7A 2V8PA 4X64E 1XNRE 1USUA 3B8HA 4B3RI 4DR5E 4IZJA 4GKJE 1N32E 3ZZ0A 5LMNE 4X64I 2J7KA 2O1UA 2V34A 2UXDI 2VQEE 4JI6I 3V5RA 1Z5BA 2A2DA 2ZBKB 4DPUA 2X36A 4DR6I 1N32I 3PYGA 5LMNI 2A2CA 4IZKB 2Z5BA 1N34I 2HK2A 2XEXA 3LTOA 1NHHA 4X65E 3K85A 4PU9A 2CGEA 2WW4A 1H7UA 4DV5E 4B3SE 1H7SA 2E5LE 2LJPA 1H73A 4DPYA 4DR4E 1NHJA 4HACA 4X65I 4LF4E 4DV0E 4LFCI 2V2QA 4DV3E 1DARA 4MYUA 4YHHE 1A6FA 3T1HE 4JI2I 4DV5I 4DR1E 4B3SI 2EFGA 4LF5E 4PRVA 4B3TI 1Z0TA 1S16A 4KQVA 4GKKI 4YHHI 3ZKDA 4HXZA 4DXLA 1KKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  3JAM C;  5FLX C;  2E1R A;  4B3M E;  3V2U C;  1PIE A;  1XMQ E;  5LMU I;  4JG4 A;  4X66 E;  1HNW E;  1Z5A A;  3T1Y E;  4Z7Y A;  1B62 A;  1Z0G A;  5FLX Q;  1MG7 A;  4B3M I;  4OX9 E;  1FJG E;  4JI7 E;  3HUL A;  1I94 I;  4NXM E;  1HNZ E;  1HNW I;  3LPS A;  3T1Y I;  1H72 C;  4DPX A;  3K17 A;  1FJG I;  1IBM I;  4JI7 I;  4DV1 E;  1Z0V A;  4NXM I;  4DV7 I;  1ZM9 A;  4FN5 A;  3H4L A;  4DPW A;  4HYM A;  3PYD A;  5IT9 C;  4DUZ I;  1XNR I;  4PRX A;  5IT9 Q;  2HKJ A;  4DR5 I;  4GKJ I;  4DR7 E;  2HFU A;  4LF8 E;  4Z7C A;  3PYE A;  2VQE I;  4FW9 A;  4HY1 A;  1OJ4 A;  3J80 C;  3QT5 A;  2OI2 A;  1MX0 A;  2HFS A;  3CWV A;  1U2R A;  2UUB E;  1N0U A;  2UUC E;  3D4J A;  1KTV A;  2R3V A;  1EA6 A;  1NHI A;  3K1J A;  1ELO A;  4FWD A;  4RPF A;  4URL A;  4MYT A;  4WUC A;  3J80 Q;  4JI0 E;  4ZVI A;  3ZM7 A;  2V2V A;  2UUA E;  4LFB E;  2UUC I;  5IWA E;  4DR2 E;  1KVK A;  4LFA E;  3QT8 A;  2F4V E;  2E5L I;  4LF6 E;  4JI0 I;  2BM0 A;  1N36 E;  4DR4 I;  4LF4 I;  4DV0 I;  2UUA I;  4FWH A;  4P52 A;  4DV3 I;  4LFB I;  4UT4 A;  1N0V C;  3T1H I;  4LF9 E;  4LFA I;  4FWG A;  2F4V I;  4DR1 I;  4LF6 I;  4LF5 I;  4YY3 E;  2HKE A;  4LF9 I;  3WU6 A;  4DR3 E;  4AQY E;  1Z0E A;  4DPT A;  2DEJ A;  1ZM4 A;  1J5E E;  1EI1 A;  4YY3 I;  4DV2 E;  3JAM Q;  4X62 E;  1D6T A;  1IBL E;  2BM1 A;  4AQY I;  1XMQ I;  2X7I A;  5GME A;  4X66 I;  1NZ0 A;  4ED4 A;  1HNX E;  4JI3 E;  4JYA E;  4JI5 E;  4JV5 E;  3WU4 A;  4X62 I;  2HHH E;  4OX9 I;  2DEI A;  1UEK A;  1IBL I;  2ZM6 E;  3J7A G;  1QZR A;  1WUU A;  4WUB A;  1HNZ I;  1XNQ E;  4HAC B;  4DUY E;  4DV4 E;  4JI3 I;  4JYA I;  4JV5 I;  4P7A A;  2ZM6 I;  4DV1 I;  4JI4 E;  3OTO E;  1N33 E;  1XNQ I;  1FI4 A;  1XMO E;  4B3R E;  2BV3 A;  2UXD E;  1PVG A;  3WU3 A;  1BKN A;  4USM A;  1B63 A;  4JI4 I;  3OTO I;  1FWL A;  3B78 A;  4JI6 E;  4LF7 E;  1N33 I;  1ZM3 A;  4XTJ A;  1XMO I;  1FKA E;  1XHK A;  4DR6 E;  4I3H A;  5A2Q C;  1N34 E;  1PKP A;  4LF7 I;  3LNU A;  5L3J A;  3QT7 A;  3PYF A;  4DR7 I;  4LF8 I;  2AJ4 A;  1HR0 E;  5A2Q Q;  4NXN E;  4EMD A;  4WUD A;  2UUB I;  1Z0C A;  5LL6 R;  1K47 A;  1MU5 A;  1S4E A;  4LFC E;  3QT6 A;  1Z0B A;  3F0N A;  4M1K A;  4JI8 E;  2Q2E B;  1HR0 I;  4USK A;  4JI2 E;  4NXN I;  5IWA I;  4DR2 I;  3J81 C;  4B3T E;  2VQF E;  4GKK E;  4JI8 I;  1Z0W A;  1N36 I;  5GMD A;  1RR9 A;  1VIS A;  2NPF A;  5BR8 E;  3WU5 A;  2GS8 A;  3ZKB A;  3J81 Q;  3ZZT A;  1ZXM A;  2VQF I;  1H74 A;  3ZZU A;  3GON A;  5LMU E;  1IBK E;  1KIJ A;  1FNM A;  4DU7 A;  4JI1 E;  5BR8 I;  1Z5C A;  4DR3 I;  1Z59 A;  3B82 A;  2CZ9 A;  4K0K E;  1J5E I;  1FWK A;  1I94 E;  2UXB E;  1IBK I;  4DV2 I;  1RRE A;  4JI1 I;  4KHP E;  2V2Z A;  4DU8 A;  3Q1Q A;  2UXC E;  2HK3 A;  4K0K I;  1IBM E;  1HNX I;  2UXB I;  4DV7 E;  3J7A M;  4JI5 I;  4DV6 E;  2UU9 E;  2HHH I;  4KHP I;  3M6A A;  2VF3 A;  1ZM2 A;  4R1F A;  2UXC I;  2R42 A;  4DUY I;  1ZXN A;  4DV4 I;  4DV6 I;  2UU9 I;  4UTG A;  4DUZ E;  2V8P A;  4X64 E;  1XNR E;  3B8H A;  4B3R I;  4DR5 E;  4GKJ E;  1N32 E;  3ZZ0 A;  5LMN E;  4X64 I;  2J7K A;  2V34 A;  2UXD I;  2VQE E;  4JI6 I;  3V5R A;  1Z5B A;  2A2D A;  2ZBK B;  4DPU A;  2X36 A;  4DR6 I;  1N32 I;  3PYG A;  5LMN I;  2A2C A;  1N34 I;  2HK2 A;  2XEX A;  3LTO A;  1NHH A;  4X65 E;  4PU9 A;  2WW4 A;  1H7U A;  4DV5 E;  4B3S E;  1H7S A;  2E5L E;  2LJP A;  1H73 A;  4DPY A;  4DR4 E;  1NHJ A;  4HAC A;  4X65 I;  4LF4 E;  4DV0 E;  4LFC I;  2V2Q A;  4DV3 E;  1DAR A;  4MYU A;  4YHH E;  1A6F A;  3T1H E;  4JI2 I;  4DV5 I;  4DR1 E;  4B3S I;  2EFG A;  4LF5 E;  4PRV A;  4B3T I;  1Z0T A;  1S16 A;  4KQV A;  4GKK I;  4YHH I;  3ZKD A;  4HXZ A;  4DXL A;  1KKH A; 
#chains in the Genus database with same CATH topology
 2ZIT A;  5C0X B;  3PS1 A;  3JAM C;  5FLX C;  2E1R A;  4B3M E;  3V2U C;  1PIE A;  1XMQ E;  5LMU I;  4JG4 A;  4LCG A;  4X66 E;  5DRR A;  1HNW E;  5JEA E;  1UDO A;  1Z5A A;  3T1Y E;  4Z7Y A;  1B62 A;  1Z0G A;  1XXE A;  5FLX Q;  1MG7 A;  2C37 A;  5JEA C;  4B3M I;  4OX9 E;  1FJG E;  5K36 D;  4JI7 E;  3HUL A;  4OO1 B;  1I94 I;  2PO2 B;  4NXM E;  1HNZ E;  1HNW I;  3LPS A;  3P06 A;  3T1Y I;  1H72 C;  4DPX A;  3KRN A;  4MQY A;  3K17 A;  1FJG I;  1IBM I;  1Y4U A;  4JI7 I;  4DV1 E;  4IFD D;  1Z0V A;  4NXM I;  4DV7 I;  3Q6M A;  1ZM9 A;  4FN5 A;  2PO1 A;  2GQ0 A;  3H4L A;  4DPW A;  4HYM A;  4LOM A;  2PNZ B;  3PYD A;  4FW3 A;  5FWK A;  5IT9 C;  4DUZ I;  1XNR I;  2JEA B;  5C0X E;  4MU1 A;  4PRX A;  3UHM A;  4AID A;  5C0X C;  2Z5C B;  5IT9 Q;  1UDQ A;  3NZK A;  2HKJ A;  4DR5 I;  4GKJ I;  4DR7 E;  2HFU A;  4MU0 A;  2BA0 G;  4LF8 E;  4Z7C A;  3PYE A;  2VQE I;  1YH8 A;  4FW9 A;  4HY1 A;  1OJ4 A;  3J80 C;  3QT5 A;  2OI2 A;  1MX0 A;  2HFS A;  4NBQ A;  4LCF A;  3CWV A;  4FW5 A;  3HKM A;  4OO1 E;  1U2R A;  2UUB E;  1N0U A;  2UUC E;  3D4J A;  1KTV A;  1RHY A;  2R3V A;  1EA6 A;  1NHI A;  4OO1 C;  3K1J A;  1ELO A;  4FWD A;  2IER A;  4RPF A;  4URL A;  4MYT A;  4WUC A;  4FW7 A;  3J80 Q;  4JI0 E;  4ZVI A;  3ZM7 A;  2V2V A;  3M85 D;  2UUA E;  4LFB E;  3P76 A;  2UUC I;  5K36 F;  5IWA E;  3PS2 A;  4DR2 E;  2NN6 A;  5K36 A;  1KVK A;  4LFA E;  3QT8 A;  2F4V E;  2E5L I;  4LF6 E;  4JI0 I;  2BM0 A;  1N36 E;  4DR4 I;  2C39 A;  1Y4S A;  4LF4 I;  4DV0 I;  2UUA I;  4FWH A;  4P52 A;  4DV3 I;  4LFB I;  1R6L A;  4IFD F;  4UT4 A;  1N0V C;  3T1H I;  2C38 B;  4LF9 E;  4LFA I;  4FWG A;  2F4V I;  4DR1 I;  2BA1 D;  4LF6 I;  4LF5 I;  4U3D A;  4YY3 E;  4IZJ B;  2HKE A;  3PS3 A;  2F1D A;  4LF9 I;  5DNL A;  3WU6 A;  4DR3 E;  4AQY E;  1Z0E A;  4ISA A;  4DPT A;  4BA2 A;  2DEJ A;  1ZM4 A;  1J5E E;  1EI1 A;  3L7Z B;  2IES A;  4YY3 I;  4DV2 E;  1R6M A;  4N3O A;  3JAM Q;  2BR2 B;  4X62 E;  4FW4 A;  4QNJ A;  5DRQ A;  2Z5B B;  1D6T A;  1IBL E;  2CVE A;  2NN6 D;  2BM1 A;  2O1V A;  1UDS A;  4AQY I;  1XMQ I;  2X7I A;  4IZK A;  5GME A;  1OYP A;  4X66 I;  1NZ0 A;  3HJC A;  5JEA A;  4ED4 A;  1HNX E;  3CDJ A;  4JI3 E;  4JYA E;  4J3D A;  4JI5 E;  1E3P A;  2WP8 A;  3H1C A;  4JV5 E;  4MDT A;  3WU4 A;  4X62 I;  2HHH E;  4BA1 B;  4OX9 I;  2DEI A;  1UEK A;  1IBL I;  2ZM6 E;  3J7A G;  1QZR A;  3U1K A;  1WUU A;  4WUB A;  1HNZ I;  4IS9 A;  4HAC B;  1XNQ E;  4DUY E;  2JEB A;  2PO0 A;  4DV4 E;  4JI3 I;  4JYA I;  2GO3 A;  4JV5 I;  3M85 G;  4P7A A;  2ZM6 I;  4DV1 I;  4JI4 E;  4U3B A;  3OTO E;  1N33 E;  1XNQ I;  1FI4 A;  1XMO E;  4B3R E;  5DNX A;  4IFD B;  2BV3 A;  2GO4 A;  2JE6 B;  1Y5Y A;  1PVG A;  3WU3 A;  1BKN A;  4USM A;  1B63 A;  2UXD E;  4JI4 I;  3P3G A;  3OTO I;  1FWL A;  3B78 A;  4JI6 E;  4LF7 E;  1N33 I;  3DD6 A;  1ZM3 A;  4XTJ A;  2BA1 G;  2WNR A;  1XMO I;  5JEA D;  1FKA E;  2O1W A;  2PNM A;  5C0X A;  1XHK A;  4DR6 E;  4I3H A;  5A2Q C;  1N34 E;  1PKP A;  4LF7 I;  3LNU A;  3PRY A;  5L3J A;  2O1T A;  3QT7 A;  3PYF A;  4DR7 I;  4LF8 I;  2AJ4 A;  2C37 B;  4LPF A;  4LCH A;  1P42 A;  1HR0 E;  5A2Q Q;  1OYR A;  4NXN E;  1OYS A;  4EMD A;  3CDI A;  4OO1 A;  4WUD A;  2UUB I;  1Z0C A;  2NN6 F;  1Y60 A;  1K47 A;  2PO2 A;  5LL6 R;  1MU5 A;  3U1Y A;  1S4E A;  4LFC E;  3QT6 A;  1Z0B A;  3F0N A;  4M1K A;  4JI8 E;  2Q2E B;  1Y6Z A;  1HR0 I;  4USK A;  4JI2 E;  4NXN I;  2PO1 B;  5EL9 A;  5IWA I;  4MU4 A;  4DR2 I;  3J81 C;  4B3T E;  2VQF E;  4GKK E;  4JI8 I;  5C0X D;  2J65 A;  1Z0W A;  4IFD E;  4IZJ D;  2PNZ A;  1N36 I;  5GMD A;  4FW6 A;  2JT2 A;  4GQU A;  4IFD C;  1RR9 A;  1VIS A;  2NPF A;  5BR8 E;  3WU5 A;  2GS8 A;  3ZKB A;  3J81 Q;  3ZZT A;  1ZXM A;  2VQF I;  1H74 A;  4AIM A;  3GLL A;  3ZZU A;  5DRO A;  3GON A;  1USV A;  5LMU E;  1IBK E;  1KIJ A;  1FNM A;  2Z5C A;  4OO1 D;  4DU7 A;  4JI1 E;  5BR8 I;  1Z5C A;  3M7N G;  4DR3 I;  1Z59 A;  2VES A;  3B82 A;  2CZ9 A;  3GME A;  4K0K E;  5JEA F;  1J5E I;  1FWK A;  3Q6N A;  1I94 E;  2UXB E;  1IBK I;  4DV2 I;  2Z5E A;  1RRE A;  4JI1 I;  4KHP E;  2V2Z A;  4DU8 A;  3Q1Q A;  4QNK A;  2UXC E;  2HK3 A;  4K0K I;  1IBM E;  1HNX I;  2UXB I;  4DV7 E;  3J7A M;  4JI5 I;  3GCM A;  4DV6 E;  2NN6 B;  5K36 B;  2UU9 E;  2HHH I;  4KHP I;  3M6A A;  2VF3 A;  2IOQ A;  2IOP A;  2CG9 A;  1ZM2 A;  2PNL A;  4R1F A;  5ELW A;  2UXC I;  2C39 B;  2R42 A;  4DUY I;  1YHC A;  1ZXN A;  4DV4 I;  4DV6 I;  2UU9 I;  4UTG A;  4DUZ E;  1HK7 A;  2V8P A;  4X64 E;  1XNR E;  2C38 A;  5EKW A;  4MU3 A;  3M7N D;  5C0X F;  1USU A;  2AE8 A;  3B8H A;  3P3C A;  4B3R I;  4DR5 E;  4IZJ A;  4GKJ E;  1N32 E;  3ZZ0 A;  5LMN E;  4X64 I;  2J7K A;  2O1U A;  2V34 A;  2UXD I;  4BA2 B;  2VQE E;  4JI6 I;  3V5R A;  1Z5B A;  2A2D A;  3L7Z A;  2ZBK B;  4DPU A;  2X36 A;  4DR6 I;  1N32 I;  4OKG A;  3PYG A;  2BR2 A;  5LMN I;  2A2C A;  4IZK B;  4OO1 F;  2Z5B A;  1N34 I;  2HK2 A;  2XEX A;  3LTO A;  1UDN A;  1NHH A;  5JEA B;  4X65 E;  2WP8 B;  3K85 A;  4PU9 A;  3B4T A;  2CGE A;  2NN6 E;  5K36 E;  2WW4 A;  1H7U A;  4BA1 A;  4DV5 E;  2NN6 C;  5K36 C;  4B3S E;  1H7S A;  2E5L E;  2LJP A;  1H73 A;  4DPY A;  2JEB B;  2PO0 B;  1NHJ A;  4HAC A;  4DR4 E;  4X65 I;  4LF4 E;  4DV0 E;  4LFC I;  2V2Q A;  4DV3 E;  1DAR A;  4MYU A;  4YHH E;  1A6F A;  3T1H E;  4JI2 I;  4DV5 I;  4DR1 E;  4OZE A;  4B3S I;  5DRP A;  2EFG A;  3P3E A;  4LF5 E;  4PRV A;  1VI7 A;  2O3Z A;  4B3T I;  1Z0T A;  1S16 A;  4KQV A;  4GKK I;  4YHH I;  2JEA A;  4AM3 A;  4IFD A;  1E3H A;  2JE6 A;  3ZKD A;  2BA0 D;  2WNR B;  4HXZ A;  4DXL A;  1KKH A; 
#chains in the Genus database with same CATH homology
 2ZIT A;  3JAM C;  5FLX C;  2E1R A;  4B3M E;  3V2U C;  1PIE A;  1XMQ E;  5LMU I;  4JG4 A;  4X66 E;  1HNW E;  1Z5A A;  3T1Y E;  4Z7Y A;  1B62 A;  1Z0G A;  5FLX Q;  1MG7 A;  4B3M I;  4OX9 E;  1FJG E;  4JI7 E;  3HUL A;  1I94 I;  4NXM E;  1HNZ E;  1HNW I;  3LPS A;  3P06 A;  3T1Y I;  1H72 C;  4DPX A;  3K17 A;  1FJG I;  1IBM I;  1Y4U A;  4JI7 I;  4DV1 E;  1Z0V A;  4NXM I;  4DV7 I;  3Q6M A;  1ZM9 A;  4FN5 A;  2GQ0 A;  3H4L A;  4DPW A;  4HYM A;  3PYD A;  5FWK A;  5IT9 C;  4DUZ I;  1XNR I;  4PRX A;  2Z5C B;  5IT9 Q;  2HKJ A;  4DR5 I;  4GKJ I;  4DR7 E;  2HFU A;  4LF8 E;  4Z7C A;  3PYE A;  2VQE I;  4FW9 A;  4HY1 A;  1OJ4 A;  3J80 C;  3QT5 A;  2OI2 A;  1MX0 A;  2HFS A;  3CWV A;  1U2R A;  2UUB E;  1N0U A;  2UUC E;  3D4J A;  1KTV A;  2R3V A;  1EA6 A;  1NHI A;  3K1J A;  1ELO A;  4FWD A;  4RPF A;  4URL A;  4MYT A;  4WUC A;  3J80 Q;  4JI0 E;  4ZVI A;  3ZM7 A;  2V2V A;  2UUA E;  4LFB E;  2UUC I;  5IWA E;  4DR2 E;  1KVK A;  4LFA E;  3QT8 A;  2F4V E;  2E5L I;  4LF6 E;  4JI0 I;  2BM0 A;  1N36 E;  4DR4 I;  1Y4S A;  4LF4 I;  4DV0 I;  2UUA I;  4FWH A;  4P52 A;  4DV3 I;  4LFB I;  4UT4 A;  1N0V C;  3T1H I;  4LF9 E;  4LFA I;  4FWG A;  2F4V I;  4DR1 I;  4LF6 I;  4LF5 I;  4YY3 E;  4IZJ B;  2HKE A;  4LF9 I;  3WU6 A;  4DR3 E;  4AQY E;  1Z0E A;  4DPT A;  2DEJ A;  1ZM4 A;  1J5E E;  1EI1 A;  4YY3 I;  4DV2 E;  4N3O A;  3JAM Q;  4X62 E;  2Z5B B;  1D6T A;  1IBL E;  2BM1 A;  2O1V A;  4AQY I;  1XMQ I;  2X7I A;  4IZK A;  5GME A;  4X66 I;  1NZ0 A;  3HJC A;  4ED4 A;  1HNX E;  4JI3 E;  4JYA E;  4JI5 E;  4JV5 E;  3WU4 A;  4X62 I;  2HHH E;  4OX9 I;  2DEI A;  1UEK A;  1IBL I;  2ZM6 E;  3J7A G;  1QZR A;  1WUU A;  4WUB A;  1HNZ I;  1XNQ E;  4HAC B;  4DUY E;  4DV4 E;  4JI3 I;  4JYA I;  4JV5 I;  4P7A A;  2ZM6 I;  4DV1 I;  4JI4 E;  3OTO E;  1N33 E;  1XNQ I;  1FI4 A;  1XMO E;  4B3R E;  2BV3 A;  2UXD E;  1PVG A;  3WU3 A;  1BKN A;  4USM A;  1B63 A;  4JI4 I;  3OTO I;  1FWL A;  3B78 A;  4JI6 E;  4LF7 E;  1N33 I;  1ZM3 A;  4XTJ A;  1XMO I;  1FKA E;  2O1W A;  2PNM A;  1XHK A;  4DR6 E;  4I3H A;  5A2Q C;  1N34 E;  1PKP A;  4LF7 I;  3LNU A;  3PRY A;  5L3J A;  2O1T A;  3QT7 A;  3PYF A;  4DR7 I;  4LF8 I;  2AJ4 A;  1HR0 E;  5A2Q Q;  4NXN E;  4EMD A;  4WUD A;  2UUB I;  1Z0C A;  5LL6 R;  1K47 A;  1MU5 A;  1S4E A;  4LFC E;  3QT6 A;  1Z0B A;  3F0N A;  4M1K A;  4JI8 E;  2Q2E B;  1Y6Z A;  1HR0 I;  4USK A;  4JI2 E;  4NXN I;  5IWA I;  4DR2 I;  3J81 C;  4B3T E;  2VQF E;  4GKK E;  4JI8 I;  1Z0W A;  4IZJ D;  1N36 I;  5GMD A;  1RR9 A;  1VIS A;  2NPF A;  5BR8 E;  3WU5 A;  2GS8 A;  3ZKB A;  3J81 Q;  3ZZT A;  1ZXM A;  2VQF I;  1H74 A;  3ZZU A;  3GON A;  1USV A;  5LMU E;  1IBK E;  1KIJ A;  1FNM A;  2Z5C A;  4DU7 A;  4JI1 E;  5BR8 I;  1Z5C A;  4DR3 I;  1Z59 A;  3B82 A;  2CZ9 A;  4K0K E;  1J5E I;  1FWK A;  3Q6N A;  1I94 E;  2UXB E;  1IBK I;  4DV2 I;  2Z5E A;  1RRE A;  4JI1 I;  4KHP E;  2V2Z A;  4DU8 A;  3Q1Q A;  2UXC E;  2HK3 A;  4K0K I;  1IBM E;  1HNX I;  2UXB I;  4DV7 E;  3J7A M;  4JI5 I;  4DV6 E;  2UU9 E;  2HHH I;  4KHP I;  3M6A A;  2VF3 A;  2IOQ A;  2IOP A;  2CG9 A;  1ZM2 A;  2PNL A;  4R1F A;  2UXC I;  2R42 A;  4DUY I;  1ZXN A;  4DV4 I;  4DV6 I;  2UU9 I;  4UTG A;  4DUZ E;  1HK7 A;  2V8P A;  4X64 E;  1XNR E;  1USU A;  3B8H A;  4B3R I;  4DR5 E;  4IZJ A;  4GKJ E;  1N32 E;  3ZZ0 A;  5LMN E;  4X64 I;  2J7K A;  2O1U A;  2V34 A;  2UXD I;  2VQE E;  4JI6 I;  3V5R A;  1Z5B A;  2A2D A;  2ZBK B;  4DPU A;  2X36 A;  4DR6 I;  1N32 I;  3PYG A;  5LMN I;  2A2C A;  4IZK B;  2Z5B A;  1N34 I;  2HK2 A;  2XEX A;  3LTO A;  1NHH A;  4X65 E;  3K85 A;  4PU9 A;  2CGE A;  2WW4 A;  1H7U A;  4DV5 E;  4B3S E;  1H7S A;  2E5L E;  2LJP A;  1H73 A;  4DPY A;  4DR4 E;  1NHJ A;  4HAC A;  4X65 I;  4LF4 E;  4DV0 E;  4LFC I;  2V2Q A;  4DV3 E;  1DAR A;  4MYU A;  4YHH E;  1A6F A;  3T1H E;  4JI2 I;  4DV5 I;  4DR1 E;  4B3S I;  2EFG A;  4LF5 E;  4PRV A;  4B3T I;  1Z0T A;  1S16 A;  4KQV A;  4GKK I;  4YHH I;  3ZKD A;  4HXZ A;  4DXL A;  1KKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...