5LMUI

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
source organism Thermus thermophilus hb8
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuI00
3QT5A 3J7AM 4B3TI 4LFCI 4M1KA 4DR4I 3M6AA 1MG7A 4DR6I 4JI7E 1ZXMA 4USKA 4X62I 5LMNE 1HR0I 1NHJA 4UTGA 2F4VE 1PKPA 4GKJE 1D6TA 4HYMA 2UUBI 2UXBI 2UXCI 3PYGA 5GMDA 3LPSA 4DV0I 4JI3E 1N33I 1HR0E 1Z0EA 2UXDE 3WU5A 2DEIA 5LL6R 1ZM9A 4B3MI 4FN5A 3PYDA 4JI5E 3J7AG 1KKHA 4DR7I 3JAMQ 1FWLA 1PVGA 2UXDI 4JYAI 3H4LA 2HFUA 3J80Q 5IWAI 2HKEA 4LF6I 3ZZUA 4JI1E 2HFSA 4I3HA 4DV5E 4USMA 4K0KI 3HULA 1N0VC 3ZKDA 3J81Q 1VISA 1H74A 1I94I 3LTOA 2F4VI 3F0NA 3OTOE 1N34I 4JI4E 4LF4E 4DV5I 4DUZE 1N0UA 4LF9I 2A2CA 3LNUA 4DPXA 1FKAE 5IT9Q 4DPWA 2HK3A 2Q2EB 1IBKI 4LF8I 4URLA 5FLXQ 4JI4I 5BR8E 4JI2I 4DUZI 4PU9A 4LF7E 4EMDA 4FW9A 3QT7A 4DV3I 1FJGE 1EA6A 4NXME 2HK2A 2X7IA 3CWVA 3V5RA 1ZM3A 1ZM2A 2HHHE 2UUBE 2UXBE 1NHIA 1J5EI 2BV3A 4JV5E 3ZZ0A 4LFBE 1Z0TA 4WUCA 5L3JA 2GS8A 4NXNI 2E1RA 4LFAI 4DV1I 2UXCE 5FLXC 1I94E 3OTOI 2A2DA 4RPFA 3QT8A 1Z5CA 3ZM7A 2WW4A 2AJ4A 4P7AA 2VQFI 1Z0CA 5IT9C 1IBLE 1N36E 3T1HE 2HKJA 2ZM6I 3ZZTA 4DR4E 4HACA 4LF6E 4DV2E 5A2QQ 3ZKBA 4HY1A 2VQFE 1IBLI 5LMUE 1N36I 4B3SI 4FWHA 1XMOE 2E5LI 1FJGI 4GKJI 3T1HI 2UUAE 1S16A 4DR5E 4X64E 4KHPE 4K0KE 2X36A 4DV2I 1N34E 2XEXA 1N33E 1QZRA 1J5EE 4X66E 4DU7A 1Z0WA 1MU5A 2V2VA 2UU9I 3K17A 4DR3E 4DU8A 4JI5I 5A2QC 1WUUA 4ED4A 4DR7E 1NHHA 3WU6A 5LMNI 1H7SA 1H7UA 1IBME 5BR8I 1Z0VA 1ZM4A 4DR3I 3B82A 4WUBA 3WU3A 1OJ4A 1KIJA 4FWDA 4DV0E 2UUCE 2V34A 2V8PA 3T1YI 2J7KA 4LF5I 4YHHE 1IBMI 4X64I 4LF9E 4DR6E 1HNWE 4PRVA 4AQYE 4DUYI 4DV7E 4DR2E 3Q1QA 4JG4A 4LFAE 3T1YE 4JI1I 4YHHI 3PYFA 1FNMA 2VF3A 4JI2E 2OI2A 2ZM6E 4JI6E 4PRXA 4AQYI 1HNWI 4B3RE 1U2RA 1H73A 2NPFA 1B63A 4XTJA 4LF4I 5GMEA 1XNRI 1Z5BA 4B3ME 1UEKA 1XMOI 4LFBI 2ZITA 1KVKA 4JYAE 4NXNE 1PIEA 2UUCI 1EI1A 5IWAE 4X66I 4DV6E 4DR1E 3PYEA 1KTVA 4GKKE 2BM0A 1XMQE 2ZBKB 3B8HA 4LF7I 4WUDA 4DV3E 3WU4A 1NZ0A 3JAMC 1XHKA 1RR9A 4DPYA 3QT6A 4KQVA 1XNQI 4DV6I 4DR1I 4R1FA 4GKKI 4LFCE 1HNXE 4JI6I 1IBKE 4X62E 3B78A 4JI7I 4FWGA 4ZVIA 2R3VA 4MYUA 4JI0I 1HNZE 4DR2I 4JI3I 3J81C 1FWKA 3GONA 1DARA 4JV5I 1N32E 1Z0BA 4DV4I 4OX9I 2VQEE 4JI0E 2DEJA 2V2QA 4DPTA 4UT4A 4DV1E 4KHPI 4HACB 1A6FA 4X65I 1Z0GA 4JI8E 1ZXNA 3V2UC 1XNRE 4YY3I 1FI4A 2R42A 1N32I 4OX9E 4DV4E 3K1JA 4LF5E 2VQEI 1MX0A 1B62A 3D4JA 2UU9E 1Z59A 4P52A 4NXMI 1RREA 4Z7CA 4X65E 4DUYE 4DV7I 2HHHI 4JI8I 4MYTA 4YY3E 1BKNA 4DXLA 1H72C 5LMUI 1K47A 2E5LE 1S4EA 4B3SE 1HNZI 1ELOA 4DR5I 2UUAI 4B3TE 1XMQI 4LF8E 4HXZA 2LJPA 2CZ9A 1Z5AA 4DPUA 4B3RI 2V2ZA 2EFGA 1HNXI 4Z7YA 3J80C 2BM1A 1XNQE
chains in the Genus database with same CATH superfamily
3QT5A 3J7AM 4B3TI 4LFCI 5ELWA 1Y6ZA 4M1KA 4DR4I 3M6AA 1MG7A 3CDIA 4IFDD 4DR6I 2J65A 4JI7E 1ZXMA 3P76A 4USKA 4X62I 1HK7A 2PNLA 5LMNE 1HR0I 1NHJA 4UTGA 2F4VE 4FW3A 1PKPA 4GKJE 1E3PA 1D6TA 4HYMA 2UUBI 2UXBI 2UXCI 3PYGA 4IZJD 5GMDA 3LPSA 3P3GA 4DV0I 2NN6D 1Y4UA 4JI3E 1N33I 1HR0E 4IFDA 3K85A 2WP8A 1Z0EA 2BA0D 2UXDE 3WU5A 2DEIA 5LL6R 2Z5CA 1ZM9A 4OO1E 4B3MI 3CDJA 4FN5A 3PYDA 1UDOA 4JI5E 3J7AG 5C0XD 1KKHA 4DR7I 3JAMQ 3L7ZB 2NN6B 1FWLA 4MDTA 1PVGA 2O1WA 2UXDI 4JYAI 3H4LA 2HFUA 5DRQA 3J80Q 5IWAI 2HKEA 4LF6I 3ZZUA 4JI1E 2HFSA 3UHMA 3B4TA 4I3HA 4IZKA 4DV5E 4USMA 4K0KI 3HULA 2Z5BA 1N0VC 3M7ND 3ZKDA 3J81Q 1VISA 1H74A 1I94I 3LTOA 2F4VI 3F0NA 5C0XC 3OTOE 1N34I 4FW7A 4GQUA 4JI4E 4LF4E 1OYSA 4OZEA 4DV5I 4DUZE 1N0UA 4LF9I 2A2CA 1UDNA 3LNUA 4DPXA 1FKAE 5IT9Q 4DPWA 2HK3A 2Q2EB 1IBKI 4OO1B 2JE6B 4U3BA 4LF8I 4NBQA 4URLA 5FLXQ 4JI4I 5BR8E 4JI2I 4DUZI 5K36D 4PU9A 4LF7E 4EMDA 4FW9A 3QT7A 1E3HA 4DV3I 1FJGE 1EA6A 4IZKB 5C0XB 2JE6A 4NXME 2HK2A 2X7IA 3CWVA 3V5RA 1ZM3A 1ZM2A 4IZJB 4MU4A 2HHHE 2UUBE 2UXBE 5K36B 1NHIA 1J5EI 2BV3A 4JV5E 3ZZ0A 4LFBE 1Z0TA 5DRPA 4WUCA 3P3CA 5L3JA 2GS8A 4NXNI 2E1RA 4LFAI 4DV1I 2UXCE 3Q6MA 5FLXC 1I94E 3OTOI 2A2DA 4RPFA 3QT8A 4QNJA 1Z5CA 2O1UA 3ZM7A 2WW4A 2AJ4A 2O3ZA 4P7AA 4OO1F 2VQFI 4FW4A 1Z0CA 5IT9C 1IBLE 2WNRB 3T1HE 1N36E 5K36A 2HKJA 2C39B 2ZM6I 3ZZTA 4DR4E 4HACA 4LF6E 2BR2A 4DV2E 5A2QQ 5DROA 1XXEA 4MU1A 3ZKBA 4HY1A 2VQFE 2IERA 1IBLI 5LMUE 1N36I 4B3SI 4FWHA 1XMOE 2E5LI 1FJGI 4GKJI 3T1HI 2UUAE 3Q6NA 1S16A 4DR5E 4X64E 2C39A 4KHPE 4K0KE 4FW5A 2X36A 4DV2I 1N34E 2XEXA 3NZKA 2PO0B 1N33E 3L7ZA 1QZRA 1J5EE 4X66E 2IOPA 4DU7A 1Z0WA 1MU5A 3P06A 2V2VA 1VI7A 2UU9I 2Z5CB 2GO3A 3K17A 4DR3E 4DU8A 3DD6A 4JI5I 2BA0G 5A2QC 1WUUA 4OO1A 4ED4A 4DR7E 1NHHA 2NN6C 3WU6A 1USVA 5LMNI 2WNRA 1H7SA 2Z5EA 2PO2A 1Y60A 1H7UA 1IBME 5BR8I 1Z0VA 4LCGA 1ZM4A 4DR3I 1R6MA 3GCMA 4AIDA 3B82A 4IFDE 4WUBA 3H1CA 3WU3A 2VESA 1OJ4A 1KIJA 4FWDA 4DV0E 2UUCE 4BA1A 3KRNA 2V34A 5DNLA 5FWKA 2V8PA 3T1YI 2O1VA 2NN6E 2J7KA 4LF5I 4YHHE 2PNMA 1IBMI 4X64I 4LF9E 5DRRA 2F1DA 1USUA 1OYPA 4DR6E 1HNWE 5DNXA 4PRVA 4AQYE 4DUYI 4DV7E 4DR2E 3Q1QA 4JG4A 2PO1B 2PO1A 2O1TA 2AE8A 4AM3A 4LFAE 4IZJA 3T1YE 4JI1I 4YHHI 3PYFA 1FNMA 2VF3A 2CGEA 4JI2E 2OI2A 1OYRA 2ZM6E 4BA2B 3HJCA 4JI6E 4PRXA 5JEAD 4AQYI 5K36F 1HNWI 2JT2A 3PS3A 4U3DA 4B3RE 1U2RA 1H73A 2C38A 5JEAA 2NPFA 4QNKA 1B63A 3PRYA 4XTJA 4LF4I 5GMEA 2IESA 1XNRI 1Z5BA 3PS2A 4B3ME 1UEKA 4IS9A 2BA1G 1XMOI 4LFBI 2ZITA 2NN6A 5EKWA 1KVKA 4FW6A 3HKMA 4JYAE 4NXNE 1PIEA 2UUCI 2C37B 1EI1A 5IWAE 4X66I 2GQ0A 4DV6E 4DR1E 1UDSA 3PYEA 1KTVA 4GKKE 2BM0A 2JEAB 2NN6F 1XMQE 2ZBKB 3B8HA 1P42A 4LF7I 4WUDA 4DV3E 3U1YA 3WU4A 1NZ0A 2C37A 1R6LA 3JAMC 1XHKA 1RR9A 4DPYA 3QT6A 4KQVA 5JEAF 1XNQI 4DV6I 4DR1I 4R1FA 4GKKI 4LFCE 2BA1D 2CG9A 1YH8A 2PO2B 1HNXE 4LCFA 4JI6I 3M7NG 1IBKE 5EL9A 2C38B 1RHYA 5JEAB 4X62E 3M85D 3B78A 3U1KA 4JI7I 4FWGA 2WP8B 4BA1B 4AIMA 2GO4A 3M85G 4ZVIA 2R3VA 4MU3A 4MYUA 3PS1A 1Y4SA 4JI0I 3P3EA 1HNZE 2BR2B 4DR2I 4MQYA 4JI3I 5JEAC 3J81C 1FWKA 4OO1C 5C0XA 3GMEA 3GONA 4OKGA 1DARA 5C0XE 4JV5I 1N32E 1Z0BA 4DV4I 2Z5BB 4OX9I 2VQEE 4JI0E 2DEJA 4N3OA 2PNZB 2V2QA 5K36E 4DPTA 4UT4A 4DV1E 4KHPI 4HACB 4J3DA 1A6FA 4X65I 1Z0GA 4JI8E 1ZXNA 4LOMA 3V2UC 1XNRE 4YY3I 5JEAE 4LCHA 4MU0A 1FI4A 2R42A 2JEBA 4IFDF 1N32I 2JEBB 4IFDC 4OX9E 4DV4E 3K1JA 4LF5E 4LPFA 2VQEI 1MX0A 1B62A 3D4JA 2UU9E 1Z59A 4P52A 2IOQA 4NXMI 1RREA 2CVEA 4Z7CA 2PNZA 4X65E 4DUYE 4DV7I 2HHHI 4JI8I 5K36C 4MYTA 4YY3E 1BKNA 1YHCA 1UDQA 4DXLA 4IFDB 1H72C 5LMUI 1K47A 2E5LE 1S4EA 4B3SE 1HNZI 1ELOA 4DR5I 2UUAI 4ISAA 1Y5YA 4B3TE 1XMQI 4LF8E 4BA2A 4HXZA 4OO1D 2LJPA 3GLLA 2CZ9A 1Z5AA 2PO0A 4DPUA 4B3RI 2V2ZA 2EFGA 1HNXI 4Z7YA 5C0XF 3J80C 2BM1A 2JEAA 1XNQE
chains in the Genus database with same CATH topology
3QT5A 3J7AM 4B3TI 4LFCI 1Y6ZA 4M1KA 4DR4I 3M6AA 1MG7A 4DR6I 4JI7E 1ZXMA 4USKA 4X62I 1HK7A 2PNLA 5LMNE 1HR0I 1NHJA 4UTGA 2F4VE 1PKPA 4GKJE 1D6TA 4HYMA 2UUBI 2UXBI 2UXCI 3PYGA 4IZJD 5GMDA 3LPSA 4DV0I 1Y4UA 4JI3E 1N33I 1HR0E 3K85A 1Z0EA 2UXDE 3WU5A 2DEIA 5LL6R 2Z5CA 1ZM9A 4B3MI 4FN5A 3PYDA 4JI5E 3J7AG 1KKHA 4DR7I 3JAMQ 1FWLA 1PVGA 2O1WA 2UXDI 4JYAI 3H4LA 2HFUA 3J80Q 5IWAI 2HKEA 4LF6I 3ZZUA 4JI1E 2HFSA 4I3HA 4IZKA 4DV5E 4USMA 4K0KI 3HULA 2Z5BA 1N0VC 3ZKDA 3J81Q 1VISA 1H74A 1I94I 3LTOA 2F4VI 3F0NA 3OTOE 1N34I 4JI4E 4LF4E 4DV5I 4DUZE 1N0UA 4LF9I 2A2CA 3LNUA 4DPXA 1FKAE 5IT9Q 4DPWA 2HK3A 2Q2EB 1IBKI 4LF8I 4URLA 5FLXQ 4JI4I 5BR8E 4JI2I 4DUZI 4PU9A 4LF7E 4EMDA 4FW9A 3QT7A 4DV3I 1FJGE 1EA6A 4IZKB 4NXME 2HK2A 2X7IA 3CWVA 3V5RA 1ZM3A 1ZM2A 4IZJB 2HHHE 2UUBE 2UXBE 1NHIA 1J5EI 2BV3A 4JV5E 3ZZ0A 4LFBE 1Z0TA 4WUCA 5L3JA 2GS8A 4NXNI 2E1RA 4LFAI 4DV1I 2UXCE 3Q6MA 5FLXC 1I94E 3OTOI 2A2DA 4RPFA 3QT8A 1Z5CA 2O1UA 3ZM7A 2WW4A 2AJ4A 4P7AA 2VQFI 1Z0CA 5IT9C 1IBLE 1N36E 3T1HE 2HKJA 2ZM6I 3ZZTA 4DR4E 4HACA 4LF6E 4DV2E 5A2QQ 3ZKBA 4HY1A 2VQFE 1IBLI 5LMUE 1N36I 4B3SI 4FWHA 1XMOE 2E5LI 1FJGI 4GKJI 3T1HI 2UUAE 3Q6NA 1S16A 4DR5E 4X64E 4KHPE 4K0KE 2X36A 4DV2I 1N34E 2XEXA 1N33E 1QZRA 1J5EE 4X66E 2IOPA 4DU7A 1Z0WA 1MU5A 3P06A 2V2VA 2UU9I 2Z5CB 3K17A 4DR3E 4DU8A 4JI5I 5A2QC 1WUUA 4ED4A 4DR7E 1NHHA 3WU6A 1USVA 5LMNI 1H7SA 2Z5EA 1H7UA 1IBME 5BR8I 1Z0VA 1ZM4A 4DR3I 3B82A 4WUBA 3WU3A 1OJ4A 1KIJA 4FWDA 4DV0E 2UUCE 2V34A 5FWKA 2V8PA 3T1YI 2O1VA 2J7KA 4LF5I 4YHHE 2PNMA 1IBMI 4X64I 4LF9E 1USUA 4DR6E 1HNWE 4PRVA 4AQYE 4DUYI 4DV7E 4DR2E 3Q1QA 4JG4A 2O1TA 4LFAE 4IZJA 3T1YE 4JI1I 4YHHI 3PYFA 1FNMA 2VF3A 2CGEA 4JI2E 2OI2A 2ZM6E 3HJCA 4JI6E 4PRXA 4AQYI 1HNWI 4B3RE 1U2RA 1H73A 2NPFA 1B63A 3PRYA 4XTJA 4LF4I 5GMEA 1XNRI 1Z5BA 4B3ME 1UEKA 1XMOI 4LFBI 2ZITA 1KVKA 4JYAE 4NXNE 1PIEA 2UUCI 1EI1A 5IWAE 4X66I 2GQ0A 4DV6E 4DR1E 3PYEA 1KTVA 4GKKE 2BM0A 1XMQE 2ZBKB 3B8HA 4LF7I 4WUDA 4DV3E 3WU4A 1NZ0A 3JAMC 1XHKA 1RR9A 4DPYA 3QT6A 4KQVA 1XNQI 4DV6I 4DR1I 4R1FA 4GKKI 4LFCE 2CG9A 1HNXE 4JI6I 1IBKE 4X62E 3B78A 4JI7I 4FWGA 4ZVIA 2R3VA 4MYUA 1Y4SA 4JI0I 1HNZE 4DR2I 4JI3I 3J81C 1FWKA 3GONA 1DARA 4JV5I 1N32E 1Z0BA 4DV4I 2Z5BB 4OX9I 2VQEE 4JI0E 2DEJA 4N3OA 2V2QA 4DPTA 4UT4A 4DV1E 4KHPI 4HACB 1A6FA 4X65I 1Z0GA 4JI8E 1ZXNA 3V2UC 1XNRE 4YY3I 1FI4A 2R42A 1N32I 4OX9E 4DV4E 3K1JA 4LF5E 2VQEI 1MX0A 1B62A 3D4JA 2UU9E 1Z59A 4P52A 2IOQA 4NXMI 1RREA 4Z7CA 4X65E 4DUYE 4DV7I 2HHHI 4JI8I 4MYTA 4YY3E 1BKNA 4DXLA 1H72C 5LMUI 1K47A 2E5LE 1S4EA 4B3SE 1HNZI 1ELOA 2UUAI 4DR5I 4B3TE 1XMQI 4LF8E 4HXZA 2LJPA 2CZ9A 1Z5AA 4DPUA 4B3RI 2V2ZA 2EFGA 1HNXI 4Z7YA 3J80C 2BM1A 1XNQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT5 A;  3J7A M;  4B3T I;  4LFC I;  4M1K A;  4DR4 I;  3M6A A;  1MG7 A;  4DR6 I;  4JI7 E;  1ZXM A;  4USK A;  4X62 I;  5LMN E;  1HR0 I;  1NHJ A;  4UTG A;  2F4V E;  1PKP A;  4GKJ E;  1D6T A;  4HYM A;  2UUB I;  2UXB I;  2UXC I;  3PYG A;  5GMD A;  3LPS A;  4DV0 I;  4JI3 E;  1N33 I;  1HR0 E;  1Z0E A;  2UXD E;  3WU5 A;  2DEI A;  5LL6 R;  1ZM9 A;  4B3M I;  4FN5 A;  3PYD A;  4JI5 E;  3J7A G;  1KKH A;  4DR7 I;  3JAM Q;  1FWL A;  1PVG A;  2UXD I;  4JYA I;  3H4L A;  2HFU A;  3J80 Q;  5IWA I;  2HKE A;  4LF6 I;  3ZZU A;  4JI1 E;  2HFS A;  4I3H A;  4DV5 E;  4USM A;  4K0K I;  3HUL A;  1N0V C;  3ZKD A;  3J81 Q;  1VIS A;  1H74 A;  1I94 I;  3LTO A;  2F4V I;  3F0N A;  3OTO E;  1N34 I;  4JI4 E;  4LF4 E;  4DV5 I;  4DUZ E;  1N0U A;  4LF9 I;  2A2C A;  3LNU A;  4DPX A;  1FKA E;  5IT9 Q;  4DPW A;  2HK3 A;  2Q2E B;  1IBK I;  4LF8 I;  4URL A;  5FLX Q;  4JI4 I;  5BR8 E;  4JI2 I;  4DUZ I;  4PU9 A;  4LF7 E;  4EMD A;  4FW9 A;  3QT7 A;  4DV3 I;  1FJG E;  1EA6 A;  4NXM E;  2HK2 A;  2X7I A;  3CWV A;  3V5R A;  1ZM3 A;  1ZM2 A;  2HHH E;  2UUB E;  2UXB E;  1NHI A;  1J5E I;  2BV3 A;  4JV5 E;  3ZZ0 A;  4LFB E;  1Z0T A;  4WUC A;  5L3J A;  2GS8 A;  4NXN I;  2E1R A;  4LFA I;  4DV1 I;  2UXC E;  5FLX C;  1I94 E;  3OTO I;  2A2D A;  4RPF A;  3QT8 A;  1Z5C A;  3ZM7 A;  2WW4 A;  2AJ4 A;  4P7A A;  2VQF I;  1Z0C A;  5IT9 C;  1IBL E;  1N36 E;  3T1H E;  2HKJ A;  2ZM6 I;  3ZZT A;  4DR4 E;  4HAC A;  4LF6 E;  4DV2 E;  5A2Q Q;  3ZKB A;  4HY1 A;  2VQF E;  1IBL I;  5LMU E;  1N36 I;  4B3S I;  4FWH A;  1XMO E;  2E5L I;  1FJG I;  4GKJ I;  3T1H I;  2UUA E;  1S16 A;  4DR5 E;  4X64 E;  4KHP E;  4K0K E;  2X36 A;  4DV2 I;  1N34 E;  2XEX A;  1N33 E;  1QZR A;  1J5E E;  4X66 E;  4DU7 A;  1Z0W A;  1MU5 A;  2V2V A;  2UU9 I;  3K17 A;  4DR3 E;  4DU8 A;  4JI5 I;  5A2Q C;  1WUU A;  4ED4 A;  4DR7 E;  1NHH A;  3WU6 A;  5LMN I;  1H7S A;  1H7U A;  1IBM E;  5BR8 I;  1Z0V A;  1ZM4 A;  4DR3 I;  3B82 A;  4WUB A;  3WU3 A;  1OJ4 A;  1KIJ A;  4FWD A;  4DV0 E;  2UUC E;  2V34 A;  2V8P A;  3T1Y I;  2J7K A;  4LF5 I;  4YHH E;  1IBM I;  4X64 I;  4LF9 E;  4DR6 E;  1HNW E;  4PRV A;  4AQY E;  4DUY I;  4DV7 E;  4DR2 E;  3Q1Q A;  4JG4 A;  4LFA E;  3T1Y E;  4JI1 I;  4YHH I;  3PYF A;  1FNM A;  2VF3 A;  4JI2 E;  2OI2 A;  2ZM6 E;  4JI6 E;  4PRX A;  4AQY I;  1HNW I;  4B3R E;  1U2R A;  1H73 A;  2NPF A;  1B63 A;  4XTJ A;  4LF4 I;  5GME A;  1XNR I;  1Z5B A;  4B3M E;  1UEK A;  1XMO I;  4LFB I;  2ZIT A;  1KVK A;  4JYA E;  4NXN E;  1PIE A;  2UUC I;  1EI1 A;  5IWA E;  4X66 I;  4DV6 E;  4DR1 E;  3PYE A;  1KTV A;  4GKK E;  2BM0 A;  1XMQ E;  2ZBK B;  3B8H A;  4LF7 I;  4WUD A;  4DV3 E;  3WU4 A;  1NZ0 A;  3JAM C;  1XHK A;  1RR9 A;  4DPY A;  3QT6 A;  4KQV A;  1XNQ I;  4DV6 I;  4DR1 I;  4R1F A;  4GKK I;  4LFC E;  1HNX E;  4JI6 I;  1IBK E;  4X62 E;  3B78 A;  4JI7 I;  4FWG A;  4ZVI A;  2R3V A;  4MYU A;  4JI0 I;  1HNZ E;  4DR2 I;  4JI3 I;  3J81 C;  1FWK A;  3GON A;  1DAR A;  4JV5 I;  1N32 E;  1Z0B A;  4DV4 I;  4OX9 I;  2VQE E;  4JI0 E;  2DEJ A;  2V2Q A;  4DPT A;  4UT4 A;  4DV1 E;  4KHP I;  4HAC B;  1A6F A;  4X65 I;  1Z0G A;  4JI8 E;  1ZXN A;  3V2U C;  1XNR E;  4YY3 I;  1FI4 A;  2R42 A;  1N32 I;  4OX9 E;  4DV4 E;  3K1J A;  4LF5 E;  2VQE I;  1MX0 A;  1B62 A;  3D4J A;  2UU9 E;  1Z59 A;  4P52 A;  4NXM I;  1RRE A;  4Z7C A;  4X65 E;  4DUY E;  4DV7 I;  2HHH I;  4JI8 I;  4MYT A;  4YY3 E;  1BKN A;  4DXL A;  1H72 C;  5LMU I;  1K47 A;  2E5L E;  1S4E A;  4B3S E;  1HNZ I;  1ELO A;  4DR5 I;  2UUA I;  4B3T E;  1XMQ I;  4LF8 E;  4HXZ A;  2LJP A;  2CZ9 A;  1Z5A A;  4DPU A;  4B3R I;  2V2Z A;  2EFG A;  1HNX I;  4Z7Y A;  3J80 C;  2BM1 A;  1XNQ E; 
#chains in the Genus database with same CATH topology
 3QT5 A;  3J7A M;  4B3T I;  4LFC I;  5ELW A;  1Y6Z A;  4M1K A;  4DR4 I;  3M6A A;  1MG7 A;  3CDI A;  4IFD D;  4DR6 I;  2J65 A;  4JI7 E;  1ZXM A;  3P76 A;  4USK A;  4X62 I;  1HK7 A;  2PNL A;  5LMN E;  1HR0 I;  1NHJ A;  4UTG A;  2F4V E;  4FW3 A;  1PKP A;  4GKJ E;  1E3P A;  1D6T A;  4HYM A;  2UUB I;  2UXB I;  2UXC I;  3PYG A;  4IZJ D;  5GMD A;  3LPS A;  3P3G A;  4DV0 I;  2NN6 D;  1Y4U A;  4JI3 E;  1N33 I;  1HR0 E;  4IFD A;  3K85 A;  2WP8 A;  1Z0E A;  2BA0 D;  2UXD E;  3WU5 A;  2DEI A;  5LL6 R;  2Z5C A;  1ZM9 A;  4OO1 E;  4B3M I;  3CDJ A;  4FN5 A;  3PYD A;  1UDO A;  4JI5 E;  3J7A G;  5C0X D;  1KKH A;  4DR7 I;  3JAM Q;  3L7Z B;  2NN6 B;  1FWL A;  4MDT A;  1PVG A;  2O1W A;  2UXD I;  4JYA I;  3H4L A;  2HFU A;  5DRQ A;  3J80 Q;  5IWA I;  2HKE A;  4LF6 I;  3ZZU A;  4JI1 E;  2HFS A;  3UHM A;  3B4T A;  4I3H A;  4IZK A;  4DV5 E;  4USM A;  4K0K I;  3HUL A;  2Z5B A;  1N0V C;  3M7N D;  3ZKD A;  3J81 Q;  1VIS A;  1H74 A;  1I94 I;  3LTO A;  2F4V I;  3F0N A;  5C0X C;  3OTO E;  1N34 I;  4FW7 A;  4GQU A;  4JI4 E;  4LF4 E;  1OYS A;  4OZE A;  4DV5 I;  4DUZ E;  1N0U A;  4LF9 I;  2A2C A;  1UDN A;  3LNU A;  4DPX A;  1FKA E;  5IT9 Q;  4DPW A;  2HK3 A;  2Q2E B;  1IBK I;  4OO1 B;  2JE6 B;  4U3B A;  4LF8 I;  4NBQ A;  4URL A;  5FLX Q;  4JI4 I;  5BR8 E;  4JI2 I;  4DUZ I;  5K36 D;  4PU9 A;  4LF7 E;  4EMD A;  4FW9 A;  3QT7 A;  1E3H A;  4DV3 I;  1FJG E;  1EA6 A;  4IZK B;  5C0X B;  2JE6 A;  4NXM E;  2HK2 A;  2X7I A;  3CWV A;  3V5R A;  1ZM3 A;  1ZM2 A;  4IZJ B;  4MU4 A;  2HHH E;  2UUB E;  2UXB E;  5K36 B;  1NHI A;  1J5E I;  2BV3 A;  4JV5 E;  3ZZ0 A;  4LFB E;  1Z0T A;  5DRP A;  4WUC A;  3P3C A;  5L3J A;  2GS8 A;  4NXN I;  2E1R A;  4LFA I;  4DV1 I;  2UXC E;  3Q6M A;  5FLX C;  1I94 E;  3OTO I;  2A2D A;  4RPF A;  3QT8 A;  4QNJ A;  1Z5C A;  2O1U A;  3ZM7 A;  2WW4 A;  2AJ4 A;  2O3Z A;  4P7A A;  4OO1 F;  2VQF I;  4FW4 A;  1Z0C A;  5IT9 C;  1IBL E;  2WNR B;  3T1H E;  1N36 E;  5K36 A;  2HKJ A;  2C39 B;  2ZM6 I;  3ZZT A;  4DR4 E;  4HAC A;  4LF6 E;  2BR2 A;  4DV2 E;  5A2Q Q;  5DRO A;  1XXE A;  4MU1 A;  3ZKB A;  4HY1 A;  2VQF E;  2IER A;  1IBL I;  5LMU E;  1N36 I;  4B3S I;  4FWH A;  1XMO E;  2E5L I;  1FJG I;  4GKJ I;  3T1H I;  2UUA E;  3Q6N A;  1S16 A;  4DR5 E;  4X64 E;  2C39 A;  4KHP E;  4K0K E;  4FW5 A;  2X36 A;  4DV2 I;  1N34 E;  2XEX A;  3NZK A;  2PO0 B;  1N33 E;  3L7Z A;  1QZR A;  1J5E E;  4X66 E;  2IOP A;  4DU7 A;  1Z0W A;  1MU5 A;  3P06 A;  2V2V A;  1VI7 A;  2UU9 I;  2Z5C B;  2GO3 A;  3K17 A;  4DR3 E;  4DU8 A;  3DD6 A;  4JI5 I;  2BA0 G;  5A2Q C;  1WUU A;  4OO1 A;  4ED4 A;  4DR7 E;  1NHH A;  2NN6 C;  3WU6 A;  1USV A;  5LMN I;  2WNR A;  1H7S A;  2Z5E A;  2PO2 A;  1Y60 A;  1H7U A;  1IBM E;  5BR8 I;  1Z0V A;  4LCG A;  1ZM4 A;  4DR3 I;  1R6M A;  3GCM A;  4AID A;  3B82 A;  4IFD E;  4WUB A;  3H1C A;  3WU3 A;  2VES A;  1OJ4 A;  1KIJ A;  4FWD A;  4DV0 E;  2UUC E;  4BA1 A;  3KRN A;  2V34 A;  5DNL A;  5FWK A;  2V8P A;  3T1Y I;  2O1V A;  2NN6 E;  2J7K A;  4LF5 I;  4YHH E;  2PNM A;  1IBM I;  4X64 I;  4LF9 E;  5DRR A;  2F1D A;  1USU A;  1OYP A;  4DR6 E;  1HNW E;  5DNX A;  4PRV A;  4AQY E;  4DUY I;  4DV7 E;  4DR2 E;  3Q1Q A;  4JG4 A;  2PO1 B;  2PO1 A;  2O1T A;  2AE8 A;  4AM3 A;  4LFA E;  4IZJ A;  3T1Y E;  4JI1 I;  4YHH I;  3PYF A;  1FNM A;  2VF3 A;  2CGE A;  4JI2 E;  2OI2 A;  1OYR A;  2ZM6 E;  4BA2 B;  3HJC A;  4JI6 E;  4PRX A;  5JEA D;  4AQY I;  5K36 F;  1HNW I;  2JT2 A;  3PS3 A;  4U3D A;  4B3R E;  1U2R A;  1H73 A;  2C38 A;  5JEA A;  2NPF A;  4QNK A;  1B63 A;  3PRY A;  4XTJ A;  4LF4 I;  5GME A;  2IES A;  1XNR I;  1Z5B A;  3PS2 A;  4B3M E;  1UEK A;  4IS9 A;  2BA1 G;  1XMO I;  4LFB I;  2ZIT A;  2NN6 A;  5EKW A;  1KVK A;  4FW6 A;  3HKM A;  4JYA E;  4NXN E;  1PIE A;  2UUC I;  2C37 B;  1EI1 A;  5IWA E;  4X66 I;  2GQ0 A;  4DV6 E;  4DR1 E;  1UDS A;  3PYE A;  1KTV A;  4GKK E;  2BM0 A;  2JEA B;  2NN6 F;  1XMQ E;  2ZBK B;  3B8H A;  1P42 A;  4LF7 I;  4WUD A;  4DV3 E;  3U1Y A;  3WU4 A;  1NZ0 A;  2C37 A;  1R6L A;  3JAM C;  1XHK A;  1RR9 A;  4DPY A;  3QT6 A;  4KQV A;  5JEA F;  1XNQ I;  4DV6 I;  4DR1 I;  4R1F A;  4GKK I;  4LFC E;  2BA1 D;  2CG9 A;  1YH8 A;  2PO2 B;  1HNX E;  4LCF A;  4JI6 I;  3M7N G;  1IBK E;  5EL9 A;  2C38 B;  1RHY A;  5JEA B;  4X62 E;  3M85 D;  3B78 A;  3U1K A;  4JI7 I;  4FWG A;  2WP8 B;  4BA1 B;  4AIM A;  2GO4 A;  3M85 G;  4ZVI A;  2R3V A;  4MU3 A;  4MYU A;  3PS1 A;  1Y4S A;  4JI0 I;  3P3E A;  1HNZ E;  2BR2 B;  4DR2 I;  4MQY A;  4JI3 I;  5JEA C;  3J81 C;  1FWK A;  4OO1 C;  5C0X A;  3GME A;  3GON A;  4OKG A;  1DAR A;  5C0X E;  4JV5 I;  1N32 E;  1Z0B A;  4DV4 I;  2Z5B B;  4OX9 I;  2VQE E;  4JI0 E;  2DEJ A;  4N3O A;  2PNZ B;  2V2Q A;  5K36 E;  4DPT A;  4UT4 A;  4DV1 E;  4KHP I;  4HAC B;  4J3D A;  1A6F A;  4X65 I;  1Z0G A;  4JI8 E;  1ZXN A;  4LOM A;  3V2U C;  1XNR E;  4YY3 I;  5JEA E;  4LCH A;  4MU0 A;  1FI4 A;  2R42 A;  2JEB A;  4IFD F;  1N32 I;  2JEB B;  4IFD C;  4OX9 E;  4DV4 E;  3K1J A;  4LF5 E;  4LPF A;  2VQE I;  1MX0 A;  1B62 A;  3D4J A;  2UU9 E;  1Z59 A;  4P52 A;  2IOQ A;  4NXM I;  1RRE A;  2CVE A;  4Z7C A;  2PNZ A;  4X65 E;  4DUY E;  4DV7 I;  2HHH I;  4JI8 I;  5K36 C;  4MYT A;  4YY3 E;  1BKN A;  1YHC A;  1UDQ A;  4DXL A;  4IFD B;  1H72 C;  5LMU I;  1K47 A;  2E5L E;  1S4E A;  4B3S E;  1HNZ I;  1ELO A;  4DR5 I;  2UUA I;  4ISA A;  1Y5Y A;  4B3T E;  1XMQ I;  4LF8 E;  4BA2 A;  4HXZ A;  4OO1 D;  2LJP A;  3GLL A;  2CZ9 A;  1Z5A A;  2PO0 A;  4DPU A;  4B3R I;  2V2Z A;  2EFG A;  1HNX I;  4Z7Y A;  5C0X F;  3J80 C;  2BM1 A;  2JEA A;  1XNQ E; 
#chains in the Genus database with same CATH homology
 3QT5 A;  3J7A M;  4B3T I;  4LFC I;  1Y6Z A;  4M1K A;  4DR4 I;  3M6A A;  1MG7 A;  4DR6 I;  4JI7 E;  1ZXM A;  4USK A;  4X62 I;  1HK7 A;  2PNL A;  5LMN E;  1HR0 I;  1NHJ A;  4UTG A;  2F4V E;  1PKP A;  4GKJ E;  1D6T A;  4HYM A;  2UUB I;  2UXB I;  2UXC I;  3PYG A;  4IZJ D;  5GMD A;  3LPS A;  4DV0 I;  1Y4U A;  4JI3 E;  1N33 I;  1HR0 E;  3K85 A;  1Z0E A;  2UXD E;  3WU5 A;  2DEI A;  5LL6 R;  2Z5C A;  1ZM9 A;  4B3M I;  4FN5 A;  3PYD A;  4JI5 E;  3J7A G;  1KKH A;  4DR7 I;  3JAM Q;  1FWL A;  1PVG A;  2O1W A;  2UXD I;  4JYA I;  3H4L A;  2HFU A;  3J80 Q;  5IWA I;  2HKE A;  4LF6 I;  3ZZU A;  4JI1 E;  2HFS A;  4I3H A;  4IZK A;  4DV5 E;  4USM A;  4K0K I;  3HUL A;  2Z5B A;  1N0V C;  3ZKD A;  3J81 Q;  1VIS A;  1H74 A;  1I94 I;  3LTO A;  2F4V I;  3F0N A;  3OTO E;  1N34 I;  4JI4 E;  4LF4 E;  4DV5 I;  4DUZ E;  1N0U A;  4LF9 I;  2A2C A;  3LNU A;  4DPX A;  1FKA E;  5IT9 Q;  4DPW A;  2HK3 A;  2Q2E B;  1IBK I;  4LF8 I;  4URL A;  5FLX Q;  4JI4 I;  5BR8 E;  4JI2 I;  4DUZ I;  4PU9 A;  4LF7 E;  4EMD A;  4FW9 A;  3QT7 A;  4DV3 I;  1FJG E;  1EA6 A;  4IZK B;  4NXM E;  2HK2 A;  2X7I A;  3CWV A;  3V5R A;  1ZM3 A;  1ZM2 A;  4IZJ B;  2HHH E;  2UUB E;  2UXB E;  1NHI A;  1J5E I;  2BV3 A;  4JV5 E;  3ZZ0 A;  4LFB E;  1Z0T A;  4WUC A;  5L3J A;  2GS8 A;  4NXN I;  2E1R A;  4LFA I;  4DV1 I;  2UXC E;  3Q6M A;  5FLX C;  1I94 E;  3OTO I;  2A2D A;  4RPF A;  3QT8 A;  1Z5C A;  2O1U A;  3ZM7 A;  2WW4 A;  2AJ4 A;  4P7A A;  2VQF I;  1Z0C A;  5IT9 C;  1IBL E;  1N36 E;  3T1H E;  2HKJ A;  2ZM6 I;  3ZZT A;  4DR4 E;  4HAC A;  4LF6 E;  4DV2 E;  5A2Q Q;  3ZKB A;  4HY1 A;  2VQF E;  1IBL I;  5LMU E;  1N36 I;  4B3S I;  4FWH A;  1XMO E;  2E5L I;  1FJG I;  4GKJ I;  3T1H I;  2UUA E;  3Q6N A;  1S16 A;  4DR5 E;  4X64 E;  4KHP E;  4K0K E;  2X36 A;  4DV2 I;  1N34 E;  2XEX A;  1N33 E;  1QZR A;  1J5E E;  4X66 E;  2IOP A;  4DU7 A;  1Z0W A;  1MU5 A;  3P06 A;  2V2V A;  2UU9 I;  2Z5C B;  3K17 A;  4DR3 E;  4DU8 A;  4JI5 I;  5A2Q C;  1WUU A;  4ED4 A;  4DR7 E;  1NHH A;  3WU6 A;  1USV A;  5LMN I;  1H7S A;  2Z5E A;  1H7U A;  1IBM E;  5BR8 I;  1Z0V A;  1ZM4 A;  4DR3 I;  3B82 A;  4WUB A;  3WU3 A;  1OJ4 A;  1KIJ A;  4FWD A;  4DV0 E;  2UUC E;  2V34 A;  5FWK A;  2V8P A;  3T1Y I;  2O1V A;  2J7K A;  4LF5 I;  4YHH E;  2PNM A;  1IBM I;  4X64 I;  4LF9 E;  1USU A;  4DR6 E;  1HNW E;  4PRV A;  4AQY E;  4DUY I;  4DV7 E;  4DR2 E;  3Q1Q A;  4JG4 A;  2O1T A;  4LFA E;  4IZJ A;  3T1Y E;  4JI1 I;  4YHH I;  3PYF A;  1FNM A;  2VF3 A;  2CGE A;  4JI2 E;  2OI2 A;  2ZM6 E;  3HJC A;  4JI6 E;  4PRX A;  4AQY I;  1HNW I;  4B3R E;  1U2R A;  1H73 A;  2NPF A;  1B63 A;  3PRY A;  4XTJ A;  4LF4 I;  5GME A;  1XNR I;  1Z5B A;  4B3M E;  1UEK A;  1XMO I;  4LFB I;  2ZIT A;  1KVK A;  4JYA E;  4NXN E;  1PIE A;  2UUC I;  1EI1 A;  5IWA E;  4X66 I;  2GQ0 A;  4DV6 E;  4DR1 E;  3PYE A;  1KTV A;  4GKK E;  2BM0 A;  1XMQ E;  2ZBK B;  3B8H A;  4LF7 I;  4WUD A;  4DV3 E;  3WU4 A;  1NZ0 A;  3JAM C;  1XHK A;  1RR9 A;  4DPY A;  3QT6 A;  4KQV A;  1XNQ I;  4DV6 I;  4DR1 I;  4R1F A;  4GKK I;  4LFC E;  2CG9 A;  1HNX E;  4JI6 I;  1IBK E;  4X62 E;  3B78 A;  4JI7 I;  4FWG A;  4ZVI A;  2R3V A;  4MYU A;  1Y4S A;  4JI0 I;  1HNZ E;  4DR2 I;  4JI3 I;  3J81 C;  1FWK A;  3GON A;  1DAR A;  4JV5 I;  1N32 E;  1Z0B A;  4DV4 I;  2Z5B B;  4OX9 I;  2VQE E;  4JI0 E;  2DEJ A;  4N3O A;  2V2Q A;  4DPT A;  4UT4 A;  4DV1 E;  4KHP I;  4HAC B;  1A6F A;  4X65 I;  1Z0G A;  4JI8 E;  1ZXN A;  3V2U C;  1XNR E;  4YY3 I;  1FI4 A;  2R42 A;  1N32 I;  4OX9 E;  4DV4 E;  3K1J A;  4LF5 E;  2VQE I;  1MX0 A;  1B62 A;  3D4J A;  2UU9 E;  1Z59 A;  4P52 A;  2IOQ A;  4NXM I;  1RRE A;  4Z7C A;  4X65 E;  4DUY E;  4DV7 I;  2HHH I;  4JI8 I;  4MYT A;  4YY3 E;  1BKN A;  4DXL A;  1H72 C;  5LMU I;  1K47 A;  2E5L E;  1S4E A;  4B3S E;  1HNZ I;  1ELO A;  2UUA I;  4DR5 I;  4B3T E;  1XMQ I;  4LF8 E;  4HXZ A;  2LJP A;  2CZ9 A;  1Z5A A;  4DPU A;  4B3R I;  2V2Z A;  2EFG A;  1HNX I;  4Z7Y A;  3J80 C;  2BM1 A;  1XNQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...