5LMUI

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuI00
3B78A 1KIJA 2VQEI 4EMDA 3WU3A 4XTJA 4DU7A 4DV7E 4DU8A 3QT6A 3JAMQ 1NHJA 4KHPE 1ZXNA 3PYGA 4MYUA 4LFAI 1XNQE 4UTGA 4X64E 4JI6I 3PYFA 4PRXA 1MU5A 3QT7A 2J7KA 2UXBE 1NHHA 2EFGA 2UUAE 5BR8E 4JI0E 3J7AG 3J7AM 1KKHA 1Z5BA 4UT4A 4Z7YA 4X65I 1WUUA 4B3RE 1H73A 1XNQI 1N0UA 4X64I 4LF4I 2E1RA 2BV3A 2UXBI 2UU9E 2UUAI 1PKPA 1XHKA 4JI3E 5BR8I 4FWGA 1H7UA 1KVKA 1N33E 5LMNE 1XMOE 3HULA 1Z0EA 1FI4A 2XEXA 3WU6A 2DEIA 1J5EE 3QT8A 4DUZE 5L3JA 3D4JA 2V2VA 2A2DA 4Z7CA 4X66I 4NXME 2UU9I 3B8HA 1BKNA 2AJ4A 3CWVA 4LFCE 3PYEA 4OX9E 5LMNI 1XMOI 3ZZ0A 4LF8E 4DV1E 4YHHI 4RPFA 1ZM3A 2V2QA 4DUZI 1Z0WA 4DR1E 2X7IA 1N34E 2LJPA 2CZ9A 4LF7E 4NXMI 4B3ME 4LFBE 3LNUA 4LFCI 4OX9I 5FLXC 4URLA 4LF8I 1PVGA 2OI2A 4DV1I 1IBKE 1B63A 2BM0A 4DR7E 4DR1I 1NZ0A 1N34I 4P7AA 1N32E 2V2ZA 4LF7I 4DV4E 1I94E 2A2CA 1Z59A 3OTOE 4JI7I 2BM1A 4HXZA 4B3MI 4LFBI 1EI1A 2Q2EB 2HFSA 1H7SA 2ZM6I 4X62I 4DR2I 1FKAE 4JV5E 5A2QC 2VF3A 3J81Q 1IBKI 4X65E 4DR7I 4FWHA 1K47A 1Z0BA 1ZM4A 4M1KA 3PYDA 1N32I 4LF4E 1FNMA 4DV4I 1I94I 2R3VA 3OTOI 3V5RA 1B62A 4R1FA 1DARA 4PRVA 4JV5I 3QT5A 4WUBA 3ZKBA 4WUCA 5LMUE 1Z0TA 5FLXQ 1RR9A 5GMEA 4DPUA 4X66E 4DR5E 4LF9E 3Q1QA 1HR0E 3B82A 4DR6E 4YHHE 4PU9A 3K17A 5LMUI 1Z0VA 2HK2A 3ZZTA 4DR3E 4I3HA 5IWAE 4HACA 2E5LE 4DR5I 4YY3E 2WW4A 4LF9I 1VISA 1HR0I 2NPFA 3LPSA 3T1HE 1H72C 4JI8E 4DR6I 2UUBE 1UEKA 3JAMC 3ZKDA 1HNWE 4DR3I 5IWAI 2E5LI 1H74A 1ZM2A 4JI7E 4YY3I 3F0NA 3H4LA 2HFUA 2HKEA 3K1JA 2ZM6E 4X62E 4DR2E 4DPTA 3T1HI 4LF5E 4AQYE 1ELOA 4JI8I 1FWKA 2UUBI 4DR4E 1HNWI 4DXLA 1FJGI 5GMDA 1ZXMA 4HACB 4FWDA 1QZRA 4DV3E 5IT9C 4DV0E 1IBLI 4LF5I 4AQYI 1A6FA 4ED4A 4USKA 2VQFI 1S16A 2UXDE 4DR4I 4DV6E 4NXNI 1N36E 4DV3I 4DPWA 3WU5A 1D6TA 1Z0GA 4DV0I 4DV2E 4B3SE 4JI4E 4GKJE 1S4EA 2V8PA 4HY1A 3WU4A 2UXDI 3T1YE 4P52A 4DV6I 1Z5CA 1IBME 2UUCE 3J80C 4MYTA 1N36I 2UXCE 2R42A 1NHIA 4DV5E 4DV7I 2HK3A 1N0VC 1HNXE 4KQVA 4KHPI 4DV2I 4B3SI 4LF6E 4JI4I 4USMA 4GKJI 1EA6A 1MX0A 4JI1E 4GKKE 1RREA 1U2RA 5IT9Q 3T1YI 4K0KE 2HKJA 4FW9A 2GS8A 5A2QQ 1XMQE 1IBMI 2UUCI 4JI0I 1MG7A 2UXCI 4JI2E 3LTOA 4FN5A 4DV5I 1HNZE 1FWLA 1HNXI 1Z0CA 1Z5AA 4WUDA 4DPXA 4LF6I 2F4VE 4B3RI 4JI1I 4GKKI 2X36A 3J81C 2V34A 4K0KI 1FJGE 4B3TE 3GONA 1XMQI 4JI3I 2ZBKB 1KTVA 4JI2I 1N33I 1HNZI 1OJ4A 4DUYE 4ZVIA 2HHHE 4JI5E 1IBLE 1XNRE 2F4VI 4JYAE 1J5EI 2VQFE 3J80Q 3V2UC 3ZM7A 4B3TI 4NXNE 2VQEE 4HYMA 4DUYI 5LL6R 1ZM9A 2HHHI 2ZITA 4JI5I 3M6AA 4JG4A 3ZZUA 1XNRI 4JYAI 1PIEA 4DPYA 4LFAE 2DEJA 4JI6E
chains in the Genus database with same CATH superfamily
1Y4UA 5C0XC 3GMEA 3B78A 1KIJA 2VQEI 4EMDA 3WU3A 4XTJA 4DU7A 4MQYA 4DV7E 2AE8A 4DU8A 1USUA 3QT6A 5DNXA 2PO2A 3JAMQ 1NHJA 4KHPE 1ZXNA 3PYGA 4MYUA 1VI7A 1R6MA 4LFAI 2PO1B 1Y5YA 1OYSA 1XNQE 3HKMA 4UTGA 4X64E 4JI6I 3PYFA 4PRXA 1MU5A 3QT7A 2J7KA 2UXBE 1NHHA 5C0XB 2EFGA 2UUAE 4IZJD 5BR8E 5EKWA 4JI0E 3J7AG 3B4TA 3J7AM 2C38B 4IZKB 2O1WA 1KKHA 1Z5BA 4UT4A 4Z7YA 4X65I 4IFDA 1WUUA 2NN6A 4B3RE 1H73A 2C37A 1XNQI 1N0UA 4X64I 4LF4I 2E1RA 2BV3A 2UXBI 4U3DA 1USVA 2UU9E 2UUAI 1PKPA 1XHKA 4JI3E 5BR8I 4FWGA 4FW6A 1H7UA 1KVKA 1N33E 4QNJA 5LMNE 1XMOE 3HULA 1Z0EA 2PO2B 4IFDE 1FI4A 2XEXA 2WNRA 4U3BA 2Z5BA 2IOPA 2NN6E 3WU6A 2DEIA 1J5EE 3QT8A 4DUZE 5L3JA 3D4JA 2V2VA 2BA0D 2A2DA 4Z7CA 5C0XD 4X66I 4NXME 4N3OA 2UU9I 2PNMA 3P3GA 3B8HA 2PO0A 1BKNA 2AJ4A 3CWVA 4LFCE 3PYEA 4OX9E 5LMNI 1XMOI 3ZZ0A 4LF8E 4IFDB 4DV1E 4YHHI 1R6LA 4RPFA 1ZM3A 4LCHA 2V2QA 4DUZI 1RHYA 1Z0WA 4DR1E 2C37B 3M85D 2X7IA 1N34E 2LJPA 2IESA 2CZ9A 4LF7E 4OO1E 4AM3A 4NXMI 4QNKA 3P06A 4B3ME 4LFBE 3LNUA 5DNLA 4LFCI 4OX9I 3L7ZA 5FLXC 4URLA 4LF8I 1PVGA 2OI2A 2WNRB 4DV1I 2Z5BB 1IBKE 1B63A 2BM0A 4DR7E 1YH8A 4DR1I 1NZ0A 1N34I 4P7AA 1UDSA 1N32E 2V2ZA 4LF7I 4DV4E 1I94E 2A2CA 1Z59A 3OTOE 4JI7I 3M85G 2BM1A 2PO0B 4HXZA 5EL9A 4B3MI 4LFBI 1EI1A 2Q2EB 2HFSA 1H7SA 2ZM6I 1OYPA 4X62I 4DR2I 1FKAE 4JV5E 5JEAA 5A2QC 2VF3A 4J3DA 4IFDD 2GQ0A 3J81Q 1IBKI 4X65E 5K36A 4DR7I 4FWHA 1Z0BA 1K47A 1ZM4A 4M1KA 3M7ND 3PYDA 1N32I 4LF4E 1FNMA 2JE6A 4DV4I 5JEAF 2F1DA 2BA1D 1I94I 3NZKA 2R3VA 3OTOI 1HK7A 2CVEA 3L7ZB 3V5RA 1B62A 4R1FA 5JEAE 1DARA 2WP8A 4PRVA 4JV5I 3QT5A 4WUBA 2BR2A 5K36E 3HJCA 2O1VA 3ZKBA 4WUCA 4FW5A 4BA2B 1XXEA 5LMUE 1E3PA 1Z0TA 5FLXQ 1RR9A 1Y4SA 2J65A 5GMEA 4DPUA 4X66E 4IFDF 4DR5E 4LF9E 3Q1QA 1HR0E 3M7NG 2PNLA 2NN6F 2Z5EA 5JEAB 3B82A 2BA1G 4IFDC 4DR6E 4YHHE 4PU9A 4MU0A 2NN6C 1UDQA 4LPFA 3K17A 2IOQA 5LMUI 1Z0VA 3CDIA 2C39A 2JE6B 2HK2A 3ZZTA 4DR3E 4I3HA 1OYRA 2VESA 4OO1A 5IWAE 4HACA 2E5LE 3PS2A 3GCMA 4DR5I 4YY3E 2WW4A 4LF9I 1VISA 1HR0I 3U1KA 2WP8B 2NPFA 3LPSA 1P42A 3T1HE 2BR2B 1H72C 4JI8E 4DR6I 2NN6B 4OO1F 2UUBE 4BA1A 2JEBA 1UEKA 3JAMC 3ZKDA 1HNWE 2JT2A 4DR3I 5IWAI 2E5LI 1H74A 1ZM2A 4JI7E 4YY3I 4FW7A 3F0NA 4ISAA 3H4LA 2HFUA 2HKEA 3K1JA 5JEAD 2ZM6E 4X62E 4DR2E 4DPTA 3T1HI 4LF5E 4AQYE 1ELOA 4JI8I 1FWKA 5DRQA 2UUBI 3P76A 5DRRA 4DR4E 2C39B 1HNWI 2O3ZA 4DXLA 1FJGI 5GMDA 1ZXMA 4OKGA 4OO1B 4HACB 4FWDA 4FW4A 1QZRA 4DV3E 5IT9C 4DV0E 1E3HA 1IBLI 4LF5I 4AQYI 1A6FA 4ED4A 3P3EA 4USKA 2NN6D 2VQFI 2JEBB 2IERA 1S16A 2UXDE 4DR4I 1UDOA 4DV6E 5C0XE 4NXNI 3K85A 5FWKA 4AIMA 3PS1A 1N36E 4DV3I 4DPWA 3Q6NA 4GQUA 3WU5A 5K36F 1D6TA 1Z0GA 5JEAC 3U1YA 4DV0I 4LCFA 3CDJA 4DV2E 3H1CA 4B3SE 5K36C 4JI4E 4GKJE 1S4EA 2V8PA 3KRNA 1Y6ZA 2JEAA 4HY1A 3WU4A 2UXDI 3T1YE 4P52A 4DV6I 2Z5CA 1Z5CA 4OO1D 1IBME 2UUCE 3J80C 4MYTA 1N36I 2UXCE 2R42A 1NHIA 4DV5E 4DV7I 2HK3A 1N0VC 1HNXE 3DD6A 4KQVA 4KHPI 3P3CA 2GO4A 4DV2I 4B3SI 4LF6E 2O1UA 4JI4I 4USMA 5K36B 4GKJI 4MDTA 1EA6A 1MX0A 4JI1E 4GKKE 1RREA 1UDNA 1U2RA 5IT9Q 3T1YI 4K0KE 2HKJA 3GLLA 4FW9A 2GS8A 5A2QQ 1XMQE 1IBMI 2UUCI 4IZJA 1MG7A 4JI0I 2UXCI 4JI2E 3LTOA 4FN5A 4DV5I 1HNZE 1FWLA 1HNXI 1Z0CA 1Z5AA 4WUDA 4DPXA 4IS9A 4LF6I 2F4VE 4B3RI 2PNZA 2JEAB 4JI1I 4GKKI 2X36A 3J81C 2V34A 5DROA 1Y60A 1YHCA 4K0KI 4LCGA 2Z5CB 1FJGE 4B3TE 4OO1C 4MU3A 3GONA 1XMQI 4JI3I 2ZBKB 4OZEA 1KTVA 4JI2I 1N33I 1HNZI 1OJ4A 4FW3A 4DUYE 4ZVIA 2HHHE 4LOMA 4JI5E 3PS3A 1IBLE 1XNRE 2CGEA 2F4VI 4JYAE 4MU4A 1J5EI 5K36D 4NBQA 2VQFE 3J80Q 3V2UC 2PO1A 5ELWA 3ZM7A 4MU1A 4B3TI 2GO3A 5DRPA 5C0XA 4NXNE 4IZJB 2VQEE 2CG9A 2BA0G 4HYMA 4DUYI 5LL6R 3UHMA 1ZM9A 2HHHI 2C38A 2ZITA 2O1TA 4IZKA 3M6AA 4JG4A 4JI5I 3ZZUA 1XNRI 4JYAI 1PIEA 4DPYA 4AIDA 2PNZB 5C0XF 4BA1B 4BA2A 4LFAE 2DEJA 3Q6MA 3PRYA 4JI6E
chains in the Genus database with same CATH topology
1Y4UA 3B78A 1KIJA 2VQEI 4EMDA 3WU3A 4XTJA 4DU7A 4DV7E 4DU8A 1USUA 3QT6A 3JAMQ 1NHJA 4KHPE 1ZXNA 3PYGA 4MYUA 4LFAI 1XNQE 4UTGA 4X64E 4JI6I 3PYFA 4PRXA 1MU5A 3QT7A 2J7KA 2UXBE 1NHHA 2EFGA 2UUAE 4IZJD 5BR8E 4JI0E 3J7AG 3J7AM 4IZKB 2O1WA 1KKHA 1Z5BA 4UT4A 4Z7YA 4X65I 1WUUA 4B3RE 1H73A 1XNQI 1N0UA 4X64I 4LF4I 2E1RA 2BV3A 2UXBI 1USVA 2UU9E 2UUAI 1PKPA 1XHKA 4JI3E 5BR8I 4FWGA 1H7UA 1KVKA 1N33E 5LMNE 1XMOE 3HULA 1Z0EA 1FI4A 2XEXA 2Z5BA 2IOPA 3WU6A 2DEIA 1J5EE 3QT8A 4DUZE 5L3JA 3D4JA 2V2VA 2A2DA 4Z7CA 4X66I 4NXME 4N3OA 2UU9I 2PNMA 3B8HA 1BKNA 2AJ4A 3CWVA 4LFCE 3PYEA 4OX9E 5LMNI 1XMOI 3ZZ0A 4LF8E 4DV1E 4YHHI 4RPFA 1ZM3A 2V2QA 4DUZI 1Z0WA 4DR1E 2X7IA 1N34E 2LJPA 2CZ9A 4LF7E 4NXMI 3P06A 4B3ME 4LFBE 3LNUA 4LFCI 4OX9I 5FLXC 4URLA 4LF8I 1PVGA 2OI2A 4DV1I 2Z5BB 1IBKE 1B63A 2BM0A 4DR7E 4DR1I 1NZ0A 1N34I 4P7AA 1N32E 2V2ZA 4LF7I 4DV4E 1I94E 2A2CA 1Z59A 3OTOE 4JI7I 2BM1A 4HXZA 4B3MI 4LFBI 1EI1A 2Q2EB 2HFSA 1H7SA 2ZM6I 4X62I 4DR2I 1FKAE 4JV5E 5A2QC 2VF3A 2GQ0A 3J81Q 1IBKI 4X65E 4DR7I 4FWHA 1K47A 1Z0BA 1ZM4A 4M1KA 3PYDA 1N32I 4LF4E 1FNMA 4DV4I 1I94I 2R3VA 3OTOI 1HK7A 3V5RA 1B62A 4R1FA 1DARA 4PRVA 4JV5I 3QT5A 4WUBA 3HJCA 2O1VA 3ZKBA 4WUCA 5LMUE 1Z0TA 5FLXQ 1RR9A 1Y4SA 5GMEA 4DPUA 4X66E 4DR5E 4LF9E 3Q1QA 1HR0E 2PNLA 2Z5EA 3B82A 4DR6E 4YHHE 4PU9A 3K17A 2IOQA 5LMUI 1Z0VA 2HK2A 3ZZTA 4DR3E 4I3HA 5IWAE 4HACA 2E5LE 4DR5I 4YY3E 2WW4A 4LF9I 1VISA 1HR0I 2NPFA 3LPSA 3T1HE 1H72C 4JI8E 4DR6I 2UUBE 1UEKA 3JAMC 3ZKDA 1HNWE 4DR3I 5IWAI 2E5LI 1H74A 1ZM2A 4JI7E 4YY3I 3F0NA 3H4LA 2HFUA 2HKEA 3K1JA 2ZM6E 4X62E 4DR2E 4DPTA 3T1HI 4LF5E 4AQYE 1ELOA 4JI8I 1FWKA 2UUBI 4DR4E 1HNWI 4DXLA 1FJGI 5GMDA 1ZXMA 4HACB 4FWDA 1QZRA 4DV3E 5IT9C 4DV0E 1IBLI 4LF5I 4AQYI 1A6FA 4ED4A 4USKA 2VQFI 1S16A 2UXDE 4DR4I 4DV6E 4NXNI 3K85A 5FWKA 1N36E 4DV3I 4DPWA 3Q6NA 3WU5A 1D6TA 1Z0GA 4DV0I 4DV2E 4B3SE 4JI4E 4GKJE 1S4EA 2V8PA 1Y6ZA 4HY1A 3WU4A 2UXDI 3T1YE 4P52A 4DV6I 2Z5CA 1Z5CA 1IBME 2UUCE 3J80C 4MYTA 1N36I 2UXCE 2R42A 1NHIA 4DV5E 4DV7I 2HK3A 1N0VC 1HNXE 4KQVA 4KHPI 4DV2I 4B3SI 4LF6E 2O1UA 4JI4I 4USMA 4GKJI 1EA6A 1MX0A 4JI1E 4GKKE 1RREA 1U2RA 5IT9Q 3T1YI 4K0KE 2HKJA 4FW9A 2GS8A 5A2QQ 1XMQE 1IBMI 2UUCI 4IZJA 1MG7A 4JI0I 2UXCI 4JI2E 3LTOA 4FN5A 4DV5I 1HNZE 1FWLA 1HNXI 1Z0CA 1Z5AA 4WUDA 4DPXA 4LF6I 2F4VE 4B3RI 4JI1I 4GKKI 2X36A 3J81C 2V34A 4K0KI 2Z5CB 1FJGE 4B3TE 3GONA 1XMQI 4JI3I 2ZBKB 1KTVA 4JI2I 1N33I 1HNZI 1OJ4A 4DUYE 4ZVIA 2HHHE 4JI5E 1IBLE 1XNRE 2CGEA 2F4VI 4JYAE 1J5EI 2VQFE 3J80Q 3V2UC 3ZM7A 4B3TI 4NXNE 4IZJB 2VQEE 2CG9A 4HYMA 4DUYI 5LL6R 1ZM9A 2HHHI 2ZITA 2O1TA 4IZKA 3M6AA 4JG4A 4JI5I 3ZZUA 1XNRI 4JYAI 1PIEA 4DPYA 4LFAE 2DEJA 3Q6MA 3PRYA 4JI6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B78 A;  1KIJ A;  2VQE I;  4EMD A;  3WU3 A;  4XTJ A;  4DU7 A;  4DV7 E;  4DU8 A;  3QT6 A;  3JAM Q;  1NHJ A;  4KHP E;  1ZXN A;  3PYG A;  4MYU A;  4LFA I;  1XNQ E;  4UTG A;  4X64 E;  4JI6 I;  3PYF A;  4PRX A;  1MU5 A;  3QT7 A;  2J7K A;  2UXB E;  1NHH A;  2EFG A;  2UUA E;  5BR8 E;  4JI0 E;  3J7A G;  3J7A M;  1KKH A;  1Z5B A;  4UT4 A;  4Z7Y A;  4X65 I;  1WUU A;  4B3R E;  1H73 A;  1XNQ I;  1N0U A;  4X64 I;  4LF4 I;  2E1R A;  2BV3 A;  2UXB I;  2UU9 E;  2UUA I;  1PKP A;  1XHK A;  4JI3 E;  5BR8 I;  4FWG A;  1H7U A;  1KVK A;  1N33 E;  5LMN E;  1XMO E;  3HUL A;  1Z0E A;  1FI4 A;  2XEX A;  3WU6 A;  2DEI A;  1J5E E;  3QT8 A;  4DUZ E;  5L3J A;  3D4J A;  2V2V A;  2A2D A;  4Z7C A;  4X66 I;  4NXM E;  2UU9 I;  3B8H A;  1BKN A;  2AJ4 A;  3CWV A;  4LFC E;  3PYE A;  4OX9 E;  5LMN I;  1XMO I;  3ZZ0 A;  4LF8 E;  4DV1 E;  4YHH I;  4RPF A;  1ZM3 A;  2V2Q A;  4DUZ I;  1Z0W A;  4DR1 E;  2X7I A;  1N34 E;  2LJP A;  2CZ9 A;  4LF7 E;  4NXM I;  4B3M E;  4LFB E;  3LNU A;  4LFC I;  4OX9 I;  5FLX C;  4URL A;  4LF8 I;  1PVG A;  2OI2 A;  4DV1 I;  1IBK E;  1B63 A;  2BM0 A;  4DR7 E;  4DR1 I;  1NZ0 A;  1N34 I;  4P7A A;  1N32 E;  2V2Z A;  4LF7 I;  4DV4 E;  1I94 E;  2A2C A;  1Z59 A;  3OTO E;  4JI7 I;  2BM1 A;  4HXZ A;  4B3M I;  4LFB I;  1EI1 A;  2Q2E B;  2HFS A;  1H7S A;  2ZM6 I;  4X62 I;  4DR2 I;  1FKA E;  4JV5 E;  5A2Q C;  2VF3 A;  3J81 Q;  1IBK I;  4X65 E;  4DR7 I;  4FWH A;  1K47 A;  1Z0B A;  1ZM4 A;  4M1K A;  3PYD A;  1N32 I;  4LF4 E;  1FNM A;  4DV4 I;  1I94 I;  2R3V A;  3OTO I;  3V5R A;  1B62 A;  4R1F A;  1DAR A;  4PRV A;  4JV5 I;  3QT5 A;  4WUB A;  3ZKB A;  4WUC A;  5LMU E;  1Z0T A;  5FLX Q;  1RR9 A;  5GME A;  4DPU A;  4X66 E;  4DR5 E;  4LF9 E;  3Q1Q A;  1HR0 E;  3B82 A;  4DR6 E;  4YHH E;  4PU9 A;  3K17 A;  5LMU I;  1Z0V A;  2HK2 A;  3ZZT A;  4DR3 E;  4I3H A;  5IWA E;  4HAC A;  2E5L E;  4DR5 I;  4YY3 E;  2WW4 A;  4LF9 I;  1VIS A;  1HR0 I;  2NPF A;  3LPS A;  3T1H E;  1H72 C;  4JI8 E;  4DR6 I;  2UUB E;  1UEK A;  3JAM C;  3ZKD A;  1HNW E;  4DR3 I;  5IWA I;  2E5L I;  1H74 A;  1ZM2 A;  4JI7 E;  4YY3 I;  3F0N A;  3H4L A;  2HFU A;  2HKE A;  3K1J A;  2ZM6 E;  4X62 E;  4DR2 E;  4DPT A;  3T1H I;  4LF5 E;  4AQY E;  1ELO A;  4JI8 I;  1FWK A;  2UUB I;  4DR4 E;  1HNW I;  4DXL A;  1FJG I;  5GMD A;  1ZXM A;  4HAC B;  4FWD A;  1QZR A;  4DV3 E;  5IT9 C;  4DV0 E;  1IBL I;  4LF5 I;  4AQY I;  1A6F A;  4ED4 A;  4USK A;  2VQF I;  1S16 A;  2UXD E;  4DR4 I;  4DV6 E;  4NXN I;  1N36 E;  4DV3 I;  4DPW A;  3WU5 A;  1D6T A;  1Z0G A;  4DV0 I;  4DV2 E;  4B3S E;  4JI4 E;  4GKJ E;  1S4E A;  2V8P A;  4HY1 A;  3WU4 A;  2UXD I;  3T1Y E;  4P52 A;  4DV6 I;  1Z5C A;  1IBM E;  2UUC E;  3J80 C;  4MYT A;  1N36 I;  2UXC E;  2R42 A;  1NHI A;  4DV5 E;  4DV7 I;  2HK3 A;  1N0V C;  1HNX E;  4KQV A;  4KHP I;  4DV2 I;  4B3S I;  4LF6 E;  4JI4 I;  4USM A;  4GKJ I;  1EA6 A;  1MX0 A;  4JI1 E;  4GKK E;  1RRE A;  1U2R A;  5IT9 Q;  3T1Y I;  4K0K E;  2HKJ A;  4FW9 A;  2GS8 A;  5A2Q Q;  1XMQ E;  1IBM I;  2UUC I;  4JI0 I;  1MG7 A;  2UXC I;  4JI2 E;  3LTO A;  4FN5 A;  4DV5 I;  1HNZ E;  1FWL A;  1HNX I;  1Z0C A;  1Z5A A;  4WUD A;  4DPX A;  4LF6 I;  2F4V E;  4B3R I;  4JI1 I;  4GKK I;  2X36 A;  3J81 C;  2V34 A;  4K0K I;  1FJG E;  4B3T E;  3GON A;  1XMQ I;  4JI3 I;  2ZBK B;  1KTV A;  4JI2 I;  1N33 I;  1HNZ I;  1OJ4 A;  4DUY E;  4ZVI A;  2HHH E;  4JI5 E;  1IBL E;  1XNR E;  2F4V I;  4JYA E;  1J5E I;  2VQF E;  3J80 Q;  3V2U C;  3ZM7 A;  4B3T I;  4NXN E;  2VQE E;  4HYM A;  4DUY I;  5LL6 R;  1ZM9 A;  2HHH I;  2ZIT A;  4JI5 I;  3M6A A;  4JG4 A;  3ZZU A;  1XNR I;  4JYA I;  1PIE A;  4DPY A;  4LFA E;  2DEJ A;  4JI6 E; 
#chains in the Genus database with same CATH topology
 1Y4U A;  5C0X C;  3GME A;  3B78 A;  1KIJ A;  2VQE I;  4EMD A;  3WU3 A;  4XTJ A;  4DU7 A;  4MQY A;  4DV7 E;  2AE8 A;  4DU8 A;  1USU A;  3QT6 A;  5DNX A;  2PO2 A;  3JAM Q;  1NHJ A;  4KHP E;  1ZXN A;  3PYG A;  4MYU A;  1VI7 A;  1R6M A;  4LFA I;  2PO1 B;  1Y5Y A;  1OYS A;  1XNQ E;  3HKM A;  4UTG A;  4X64 E;  4JI6 I;  3PYF A;  4PRX A;  1MU5 A;  3QT7 A;  2J7K A;  2UXB E;  1NHH A;  5C0X B;  2EFG A;  2UUA E;  4IZJ D;  5BR8 E;  5EKW A;  4JI0 E;  3J7A G;  3B4T A;  3J7A M;  2C38 B;  4IZK B;  2O1W A;  1KKH A;  1Z5B A;  4UT4 A;  4Z7Y A;  4X65 I;  4IFD A;  1WUU A;  2NN6 A;  4B3R E;  1H73 A;  2C37 A;  1XNQ I;  1N0U A;  4X64 I;  4LF4 I;  2E1R A;  2BV3 A;  2UXB I;  4U3D A;  1USV A;  2UU9 E;  2UUA I;  1PKP A;  1XHK A;  4JI3 E;  5BR8 I;  4FWG A;  4FW6 A;  1H7U A;  1KVK A;  1N33 E;  4QNJ A;  5LMN E;  1XMO E;  3HUL A;  1Z0E A;  2PO2 B;  4IFD E;  1FI4 A;  2XEX A;  2WNR A;  4U3B A;  2Z5B A;  2IOP A;  2NN6 E;  3WU6 A;  2DEI A;  1J5E E;  3QT8 A;  4DUZ E;  5L3J A;  3D4J A;  2V2V A;  2BA0 D;  2A2D A;  4Z7C A;  5C0X D;  4X66 I;  4NXM E;  4N3O A;  2UU9 I;  2PNM A;  3P3G A;  3B8H A;  2PO0 A;  1BKN A;  2AJ4 A;  3CWV A;  4LFC E;  3PYE A;  4OX9 E;  5LMN I;  1XMO I;  3ZZ0 A;  4LF8 E;  4IFD B;  4DV1 E;  4YHH I;  1R6L A;  4RPF A;  1ZM3 A;  4LCH A;  2V2Q A;  4DUZ I;  1RHY A;  1Z0W A;  4DR1 E;  2C37 B;  3M85 D;  2X7I A;  1N34 E;  2LJP A;  2IES A;  2CZ9 A;  4LF7 E;  4OO1 E;  4AM3 A;  4NXM I;  4QNK A;  3P06 A;  4B3M E;  4LFB E;  3LNU A;  5DNL A;  4LFC I;  4OX9 I;  3L7Z A;  5FLX C;  4URL A;  4LF8 I;  1PVG A;  2OI2 A;  2WNR B;  4DV1 I;  2Z5B B;  1IBK E;  1B63 A;  2BM0 A;  4DR7 E;  1YH8 A;  4DR1 I;  1NZ0 A;  1N34 I;  4P7A A;  1UDS A;  1N32 E;  2V2Z A;  4LF7 I;  4DV4 E;  1I94 E;  2A2C A;  1Z59 A;  3OTO E;  4JI7 I;  3M85 G;  2BM1 A;  2PO0 B;  4HXZ A;  5EL9 A;  4B3M I;  4LFB I;  1EI1 A;  2Q2E B;  2HFS A;  1H7S A;  2ZM6 I;  1OYP A;  4X62 I;  4DR2 I;  1FKA E;  4JV5 E;  5JEA A;  5A2Q C;  2VF3 A;  4J3D A;  4IFD D;  2GQ0 A;  3J81 Q;  1IBK I;  4X65 E;  5K36 A;  4DR7 I;  4FWH A;  1Z0B A;  1K47 A;  1ZM4 A;  4M1K A;  3M7N D;  3PYD A;  1N32 I;  4LF4 E;  1FNM A;  2JE6 A;  4DV4 I;  5JEA F;  2F1D A;  2BA1 D;  1I94 I;  3NZK A;  2R3V A;  3OTO I;  1HK7 A;  2CVE A;  3L7Z B;  3V5R A;  1B62 A;  4R1F A;  5JEA E;  1DAR A;  2WP8 A;  4PRV A;  4JV5 I;  3QT5 A;  4WUB A;  2BR2 A;  5K36 E;  3HJC A;  2O1V A;  3ZKB A;  4WUC A;  4FW5 A;  4BA2 B;  1XXE A;  5LMU E;  1E3P A;  1Z0T A;  5FLX Q;  1RR9 A;  1Y4S A;  2J65 A;  5GME A;  4DPU A;  4X66 E;  4IFD F;  4DR5 E;  4LF9 E;  3Q1Q A;  1HR0 E;  3M7N G;  2PNL A;  2NN6 F;  2Z5E A;  5JEA B;  3B82 A;  2BA1 G;  4IFD C;  4DR6 E;  4YHH E;  4PU9 A;  4MU0 A;  2NN6 C;  1UDQ A;  4LPF A;  3K17 A;  2IOQ A;  5LMU I;  1Z0V A;  3CDI A;  2C39 A;  2JE6 B;  2HK2 A;  3ZZT A;  4DR3 E;  4I3H A;  1OYR A;  2VES A;  4OO1 A;  5IWA E;  4HAC A;  2E5L E;  3PS2 A;  3GCM A;  4DR5 I;  4YY3 E;  2WW4 A;  4LF9 I;  1VIS A;  1HR0 I;  3U1K A;  2WP8 B;  2NPF A;  3LPS A;  1P42 A;  3T1H E;  2BR2 B;  1H72 C;  4JI8 E;  4DR6 I;  2NN6 B;  4OO1 F;  2UUB E;  4BA1 A;  2JEB A;  1UEK A;  3JAM C;  3ZKD A;  1HNW E;  2JT2 A;  4DR3 I;  5IWA I;  2E5L I;  1H74 A;  1ZM2 A;  4JI7 E;  4YY3 I;  4FW7 A;  3F0N A;  4ISA A;  3H4L A;  2HFU A;  2HKE A;  3K1J A;  5JEA D;  2ZM6 E;  4X62 E;  4DR2 E;  4DPT A;  3T1H I;  4LF5 E;  4AQY E;  1ELO A;  4JI8 I;  1FWK A;  5DRQ A;  2UUB I;  3P76 A;  5DRR A;  4DR4 E;  2C39 B;  1HNW I;  2O3Z A;  4DXL A;  1FJG I;  5GMD A;  1ZXM A;  4OKG A;  4OO1 B;  4HAC B;  4FWD A;  4FW4 A;  1QZR A;  4DV3 E;  5IT9 C;  4DV0 E;  1E3H A;  1IBL I;  4LF5 I;  4AQY I;  1A6F A;  4ED4 A;  3P3E A;  4USK A;  2NN6 D;  2VQF I;  2JEB B;  2IER A;  1S16 A;  2UXD E;  4DR4 I;  1UDO A;  4DV6 E;  5C0X E;  4NXN I;  3K85 A;  5FWK A;  4AIM A;  3PS1 A;  1N36 E;  4DV3 I;  4DPW A;  3Q6N A;  4GQU A;  3WU5 A;  5K36 F;  1D6T A;  1Z0G A;  5JEA C;  3U1Y A;  4DV0 I;  4LCF A;  3CDJ A;  4DV2 E;  3H1C A;  4B3S E;  5K36 C;  4JI4 E;  4GKJ E;  1S4E A;  2V8P A;  3KRN A;  1Y6Z A;  2JEA A;  4HY1 A;  3WU4 A;  2UXD I;  3T1Y E;  4P52 A;  4DV6 I;  2Z5C A;  1Z5C A;  4OO1 D;  1IBM E;  2UUC E;  3J80 C;  4MYT A;  1N36 I;  2UXC E;  2R42 A;  1NHI A;  4DV5 E;  4DV7 I;  2HK3 A;  1N0V C;  1HNX E;  3DD6 A;  4KQV A;  4KHP I;  3P3C A;  2GO4 A;  4DV2 I;  4B3S I;  4LF6 E;  2O1U A;  4JI4 I;  4USM A;  5K36 B;  4GKJ I;  4MDT A;  1EA6 A;  1MX0 A;  4JI1 E;  4GKK E;  1RRE A;  1UDN A;  1U2R A;  5IT9 Q;  3T1Y I;  4K0K E;  2HKJ A;  3GLL A;  4FW9 A;  2GS8 A;  5A2Q Q;  1XMQ E;  1IBM I;  2UUC I;  4IZJ A;  1MG7 A;  4JI0 I;  2UXC I;  4JI2 E;  3LTO A;  4FN5 A;  4DV5 I;  1HNZ E;  1FWL A;  1HNX I;  1Z0C A;  1Z5A A;  4WUD A;  4DPX A;  4IS9 A;  4LF6 I;  2F4V E;  4B3R I;  2PNZ A;  2JEA B;  4JI1 I;  4GKK I;  2X36 A;  3J81 C;  2V34 A;  5DRO A;  1Y60 A;  1YHC A;  4K0K I;  4LCG A;  2Z5C B;  1FJG E;  4B3T E;  4OO1 C;  4MU3 A;  3GON A;  1XMQ I;  4JI3 I;  2ZBK B;  4OZE A;  1KTV A;  4JI2 I;  1N33 I;  1HNZ I;  1OJ4 A;  4FW3 A;  4DUY E;  4ZVI A;  2HHH E;  4LOM A;  4JI5 E;  3PS3 A;  1IBL E;  1XNR E;  2CGE A;  2F4V I;  4JYA E;  4MU4 A;  1J5E I;  5K36 D;  4NBQ A;  2VQF E;  3J80 Q;  3V2U C;  2PO1 A;  5ELW A;  3ZM7 A;  4MU1 A;  4B3T I;  2GO3 A;  5DRP A;  5C0X A;  4NXN E;  4IZJ B;  2VQE E;  2CG9 A;  2BA0 G;  4HYM A;  4DUY I;  5LL6 R;  3UHM A;  1ZM9 A;  2HHH I;  2C38 A;  2ZIT A;  2O1T A;  4IZK A;  3M6A A;  4JG4 A;  4JI5 I;  3ZZU A;  1XNR I;  4JYA I;  1PIE A;  4DPY A;  4AID A;  2PNZ B;  5C0X F;  4BA1 B;  4BA2 A;  4LFA E;  2DEJ A;  3Q6M A;  3PRY A;  4JI6 E; 
#chains in the Genus database with same CATH homology
 1Y4U A;  3B78 A;  1KIJ A;  2VQE I;  4EMD A;  3WU3 A;  4XTJ A;  4DU7 A;  4DV7 E;  4DU8 A;  1USU A;  3QT6 A;  3JAM Q;  1NHJ A;  4KHP E;  1ZXN A;  3PYG A;  4MYU A;  4LFA I;  1XNQ E;  4UTG A;  4X64 E;  4JI6 I;  3PYF A;  4PRX A;  1MU5 A;  3QT7 A;  2J7K A;  2UXB E;  1NHH A;  2EFG A;  2UUA E;  4IZJ D;  5BR8 E;  4JI0 E;  3J7A G;  3J7A M;  4IZK B;  2O1W A;  1KKH A;  1Z5B A;  4UT4 A;  4Z7Y A;  4X65 I;  1WUU A;  4B3R E;  1H73 A;  1XNQ I;  1N0U A;  4X64 I;  4LF4 I;  2E1R A;  2BV3 A;  2UXB I;  1USV A;  2UU9 E;  2UUA I;  1PKP A;  1XHK A;  4JI3 E;  5BR8 I;  4FWG A;  1H7U A;  1KVK A;  1N33 E;  5LMN E;  1XMO E;  3HUL A;  1Z0E A;  1FI4 A;  2XEX A;  2Z5B A;  2IOP A;  3WU6 A;  2DEI A;  1J5E E;  3QT8 A;  4DUZ E;  5L3J A;  3D4J A;  2V2V A;  2A2D A;  4Z7C A;  4X66 I;  4NXM E;  4N3O A;  2UU9 I;  2PNM A;  3B8H A;  1BKN A;  2AJ4 A;  3CWV A;  4LFC E;  3PYE A;  4OX9 E;  5LMN I;  1XMO I;  3ZZ0 A;  4LF8 E;  4DV1 E;  4YHH I;  4RPF A;  1ZM3 A;  2V2Q A;  4DUZ I;  1Z0W A;  4DR1 E;  2X7I A;  1N34 E;  2LJP A;  2CZ9 A;  4LF7 E;  4NXM I;  3P06 A;  4B3M E;  4LFB E;  3LNU A;  4LFC I;  4OX9 I;  5FLX C;  4URL A;  4LF8 I;  1PVG A;  2OI2 A;  4DV1 I;  2Z5B B;  1IBK E;  1B63 A;  2BM0 A;  4DR7 E;  4DR1 I;  1NZ0 A;  1N34 I;  4P7A A;  1N32 E;  2V2Z A;  4LF7 I;  4DV4 E;  1I94 E;  2A2C A;  1Z59 A;  3OTO E;  4JI7 I;  2BM1 A;  4HXZ A;  4B3M I;  4LFB I;  1EI1 A;  2Q2E B;  2HFS A;  1H7S A;  2ZM6 I;  4X62 I;  4DR2 I;  1FKA E;  4JV5 E;  5A2Q C;  2VF3 A;  2GQ0 A;  3J81 Q;  1IBK I;  4X65 E;  4DR7 I;  4FWH A;  1K47 A;  1Z0B A;  1ZM4 A;  4M1K A;  3PYD A;  1N32 I;  4LF4 E;  1FNM A;  4DV4 I;  1I94 I;  2R3V A;  3OTO I;  1HK7 A;  3V5R A;  1B62 A;  4R1F A;  1DAR A;  4PRV A;  4JV5 I;  3QT5 A;  4WUB A;  3HJC A;  2O1V A;  3ZKB A;  4WUC A;  5LMU E;  1Z0T A;  5FLX Q;  1RR9 A;  1Y4S A;  5GME A;  4DPU A;  4X66 E;  4DR5 E;  4LF9 E;  3Q1Q A;  1HR0 E;  2PNL A;  2Z5E A;  3B82 A;  4DR6 E;  4YHH E;  4PU9 A;  3K17 A;  2IOQ A;  5LMU I;  1Z0V A;  2HK2 A;  3ZZT A;  4DR3 E;  4I3H A;  5IWA E;  4HAC A;  2E5L E;  4DR5 I;  4YY3 E;  2WW4 A;  4LF9 I;  1VIS A;  1HR0 I;  2NPF A;  3LPS A;  3T1H E;  1H72 C;  4JI8 E;  4DR6 I;  2UUB E;  1UEK A;  3JAM C;  3ZKD A;  1HNW E;  4DR3 I;  5IWA I;  2E5L I;  1H74 A;  1ZM2 A;  4JI7 E;  4YY3 I;  3F0N A;  3H4L A;  2HFU A;  2HKE A;  3K1J A;  2ZM6 E;  4X62 E;  4DR2 E;  4DPT A;  3T1H I;  4LF5 E;  4AQY E;  1ELO A;  4JI8 I;  1FWK A;  2UUB I;  4DR4 E;  1HNW I;  4DXL A;  1FJG I;  5GMD A;  1ZXM A;  4HAC B;  4FWD A;  1QZR A;  4DV3 E;  5IT9 C;  4DV0 E;  1IBL I;  4LF5 I;  4AQY I;  1A6F A;  4ED4 A;  4USK A;  2VQF I;  1S16 A;  2UXD E;  4DR4 I;  4DV6 E;  4NXN I;  3K85 A;  5FWK A;  1N36 E;  4DV3 I;  4DPW A;  3Q6N A;  3WU5 A;  1D6T A;  1Z0G A;  4DV0 I;  4DV2 E;  4B3S E;  4JI4 E;  4GKJ E;  1S4E A;  2V8P A;  1Y6Z A;  4HY1 A;  3WU4 A;  2UXD I;  3T1Y E;  4P52 A;  4DV6 I;  2Z5C A;  1Z5C A;  1IBM E;  2UUC E;  3J80 C;  4MYT A;  1N36 I;  2UXC E;  2R42 A;  1NHI A;  4DV5 E;  4DV7 I;  2HK3 A;  1N0V C;  1HNX E;  4KQV A;  4KHP I;  4DV2 I;  4B3S I;  4LF6 E;  2O1U A;  4JI4 I;  4USM A;  4GKJ I;  1EA6 A;  1MX0 A;  4JI1 E;  4GKK E;  1RRE A;  1U2R A;  5IT9 Q;  3T1Y I;  4K0K E;  2HKJ A;  4FW9 A;  2GS8 A;  5A2Q Q;  1XMQ E;  1IBM I;  2UUC I;  4IZJ A;  1MG7 A;  4JI0 I;  2UXC I;  4JI2 E;  3LTO A;  4FN5 A;  4DV5 I;  1HNZ E;  1FWL A;  1HNX I;  1Z0C A;  1Z5A A;  4WUD A;  4DPX A;  4LF6 I;  2F4V E;  4B3R I;  4JI1 I;  4GKK I;  2X36 A;  3J81 C;  2V34 A;  4K0K I;  2Z5C B;  1FJG E;  4B3T E;  3GON A;  1XMQ I;  4JI3 I;  2ZBK B;  1KTV A;  4JI2 I;  1N33 I;  1HNZ I;  1OJ4 A;  4DUY E;  4ZVI A;  2HHH E;  4JI5 E;  1IBL E;  1XNR E;  2CGE A;  2F4V I;  4JYA E;  1J5E I;  2VQF E;  3J80 Q;  3V2U C;  3ZM7 A;  4B3T I;  4NXN E;  4IZJ B;  2VQE E;  2CG9 A;  4HYM A;  4DUY I;  5LL6 R;  1ZM9 A;  2HHH I;  2ZIT A;  2O1T A;  4IZK A;  3M6A A;  4JG4 A;  4JI5 I;  3ZZU A;  1XNR I;  4JYA I;  1PIE A;  4DPY A;  4LFA E;  2DEJ A;  3Q6M A;  3PRY A;  4JI6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...