5K36E

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
265
structure length
259
Chain Sequence
MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 57
structure length 259
sequence length 265
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36E00
4BA1B 3KRNA 3M85G 1E3PA 4OO1D 1E3HA 2C39B 4IFDF 1R6LA 2C38B 5JEAD 2PO2B 2C37A 2JEAA 2BA1D 4OO1C 3GCMA 4BA2A 4AIMA 5JEAC 2NN6A 1UDSA 2BA0G 2BR2A 3U1KA 4BA1A 2NN6D 4OO1A 3L7ZB 2C39A 5JEAA 2NN6C 2C38A 4AM3A 2WNRB 3CDIA 2PO2A 2JE6B 5K36D 4NBQA 5K36B 2PO0B 5K36E 5C0XB 3M85D 4OO1F 5C0XE 3GMEA 5K36C 5JEAF 5C0XC 2PNZB 2PO1B 2JEBA 3M7ND 1OYRA 3L7ZA 2BA0D 2WNRA 1UDQA 5K36A 2PO0A 2NN6F 5C0XA 4IFDB 4IFDE 1R6MA 3CDJA 5C0XD 4IFDC 2C37B 2WP8B 2BR2B 4IFDA 1OYSA 3B4TA 2JE6A 4OO1B 1UDOA 4IFDD 4OO1E 2BA1G 3DD6A 3H1CA 5JEAB 5JEAE 3GLLA 2WP8A 3HKMA 2PNZA 5K36F 3M7NG 2PO1A 5C0XF 4AIDA 2JEAB 4BA2B 1UDNA 2JEBB 2NN6B 2NN6E 1OYPA
chains in the Genus database with same CATH superfamily
2VQFE 1HR0E 3PYFA 2CVEA 2F1DA 4B3ME 3P3EA 4OKGA 3ZZTA 5JEAD 3OTOE 4OO1C 4X65I 4DR7E 4DV2E 2UXDI 1RHYA 4B3RI 4DPUA 4AIMA 1UDSA 1ZXNA 3U1KA 4X64E 2HFSA 3K1JA 1XNQI 4OO1A 4Z7CA 1J5EE 2C39A 4GKJI 2NN6C 2WNRB 2IOPA 4MU4A 4DR3I 4HY1A 2UU9E 1N0VC 4JI8E 5C0XE 5K36C 4JI0E 5JEAF 1KKHA 2PNLA 1XXEA 2PO1B 1IBLI 4LOMA 2E1RA 5DNLA 2JEBA 2GO3A 4LFAI 3ZKBA 4LCHA 3T1YE 4WUBA 4NXNI 4LFBE 2BA0D 4FW6A 4IZJB 2Z5CB 5K36A 4LF8I 4IFDE 1I94I 4DUZE 4DR6E 2V2QA 4FN5A 1YHCA 4LCGA 3U1YA 1K47A 4DV3I 2IERA 3B82A 4JI5I 4X62E 4EMDA 4MU3A 4QNJA 4X65E 2UUCI 1B63A 2UXDE 3J81C 3F0NA 4B3RE 4OO1E 4OX9I 4YHHI 5JEAB 3V2UC 4MDTA 1HNWI 5K36F 4DV5E 2PO1A 4USMA 1XNQE 3PS2A 1WUUA 1HNZI 4JYAI 2V2VA 5EL9A 1FWLA 1PVGA 5DRPA 1EI1A 4GKKE 4IZJA 4DR3E 3WU6A 2NN6E 2R42A 3PS1A 4K0KI 4DPXA 4X66I 1ZXMA 4HACA 1N32I 3M85G 1H74A 1U2RA 1VISA 1IBLE 1E3HA 3J81Q 2UXCE 2C39B 3QT5A 4NXME 2Q2EB 1Y60A 1N36E 1MX0A 4LFAE 2BA1D 3GCMA 4DV6E 4USKA 4BA2A 1PKPA 2BM0A 4DUYE 5IT9Q 2ZITA 5JEAC 2A2DA 1NHIA 4B3TE 2IESA 4LF6E 4WUDA 3WU4A 5IWAI 1Z0BA 2HKEA 2GS8A 4MU1A 4ED4A 4U3BA 1I94E 3JAMC 4IZKB 3NZKA 5BR8I 2AJ4A 4JI7E 1BKNA 1USUA 4B3SI 5JEAA 2UUBI 4ISAA 4AM3A 5K36B 1VI7A 3M6AA 4NBQA 1ELOA 3P06A 2DEJA 4DPYA 1NHHA 3D4JA 2GQ0A 3ZZUA 4DV3E 2LJPA 3LNUA 4DV7I 4JI5E 2UXBI 1H72C 3M7ND 4U3DA 1OYRA 4URLA 4OX9E 4JV5E 3J7AG 1H73A 3ZZ0A 4DPWA 3JAMQ 1HNWE 1QZRA 1ZM9A 2EFGA 4OZEA 1N33I 4LFCE 1XNRE 4JYAE 4FW4A 4JI4I 2HFUA 4DV0E 1Y4UA 4QNKA 1XHKA 4LF7I 4DV4I 5LMUE 2C37B 3PRYA 2CG9A 4ZVIA 4K0KE 4X66E 1IBKE 2WW4A 2J65A 2X36A 1DARA 1XMQI 1N32E 2UUAE 4WUCA 3WU5A 4IZKA 2A2CA 4PRXA 2BR2B 1MU5A 4N3OA 3QT7A 1UDOA 1FJGI 1P42A 1Z0WA 2HHHI 1ZM3A 4HACB 3H1CA 2Z5EA 5ELWA 5JEAE 4DV1I 2O1UA 2WP8A 3Q6NA 3HKMA 3QT6A 5IWAE 5LMNI 4JI3I 3M7NG 2O3ZA 3CWVA 3V5RA 2CZ9A 4BA2B 4FWDA 5BR8E 4B3SE 2UUBE 3QT8A 2ZM6I 4DR5I 1Z59A 2VF3A 3ZKDA 3KRNA 4LF4I 5FLXC 1E3PA 4HXZA 4DV7E 4FW3A 2UXBE 2C37A 1Z5CA 4FWGA 1Y6ZA 4HYMA 2JEAA 1HNXI 1PIEA 1RREA 4DPTA 3PYGA 3OTOI 2BA0G 2BR2A 4DV2I 2IOQA 1N33E 4GKJE 4BA1A 1ZM2A 2O1VA 1Y5YA 4JI4E 4LF7E 2HK3A 4X64I 1Z0GA 2C38A 1IBMI 2PO2A 4DR1I 2F4VI 5K36E 1NHJA 1Z5BA 2V34A 4FW7A 4KHPI 4LF9I 1Z5AA 4NXNE 5C0XC 2HK2A 5A2QC 4AQYI 2UU9I 4DU8A 1RR9A 4LF5I 2AE8A 4LF8E 2PNMA 1FJGE 3ZM7A 3L7ZA 4DU7A 4MU0A 3UHMA 2OI2A 4IS9A 5DROA 1UDQA 5GMEA 3J80C 3PYDA 2PO0A 5LMNE 4JI3E 5C0XA 3P3CA 3T1YI 5DNXA 4DR2I 1S4EA 1FKAE 1R6MA 1KVKA 3CDJA 3LTOA 5C0XD 4IFDC 1Y4SA 4YY3I 2VESA 1H7SA 3GONA 4DR4I 2WP8B 1FI4A 4DR5E 2ZBKB 2UUCE 5DRRA 4IFDA 1OYSA 3T1HI 4I3HA 4YHHE 3B4TA 4MQYA 3J80Q 5LL6R 1HNXE 4IFDD 1USVA 1FWKA 1Z0EA 2BA1G 3DD6A 1HNZE 4X62I 4JI6I 3B78A 4LPFA 2R3VA 5C0XF 2DEIA 2JEAB 4UT4A 5GMDA 4LCFA 4JI1I 1NZ0A 4DV5I 4RPFA 1IBME 4DR1E 1OYPA 2F4VE 4KQVA 4BA1B 4JI2I 4Z7YA 4GKKI 4KHPE 4LF9E 1H7UA 1Z0CA 4OO1D 4AQYE 4LF5E 4IFDF 1R6LA 2C38B 2PO2B 2GO4A 2NPFA 2UXCI 1S16A 1N34I 4NXMI 2NN6A 1N36I 3H4LA 4DV6I 4R1FA 3Q6MA 4DUYI 4DR2E 2NN6D 4B3TI 2VQEI 2E5LI 3L7ZB 4LF6I 4YY3E 1XMOI 3B8HA 1EA6A 3CDIA 2JE6B 1Z0TA 4DR4E 5K36D 2PO0B 5C0XB 3M85D 2VQFI 1HR0I 4OO1F 1A6FA 4JI7I 4P7AA 3GMEA 3K85A 4B3MI 2Z5BB 4DXLA 2PNZB 5EKWA 3T1HE 4UTGA 4J3DA 4MYTA 4DR7I 2O1WA 1B62A 1Z0VA 3P3GA 2WNRA 3PS3A 4JI6E 4PRVA 2NN6F 4IFDB 4DV4E 4JG4A 2BV3A 4FW9A 4JV5I 5FLXQ 4FWHA 2O1TA 4M1KA 1J5EI 5IT9C 4MYUA 4JI1E 1XMQE 4LFCI 5FWKA 1XNRI 4GQUA 1FNMA 4FW5A 2JT2A 2X7IA 2V8PA 4DV0I 2XEXA 1ZM4A 4JI2E 4JI8I 3WU3A 2BM1A 2Z5CA 4PU9A 5LMUI 2J7KA 4JI0I 1KIJA 3K17A 2HHHE 3LPSA 1IBKI 4IZJD 1HK7A 1MG7A 2CGEA 2JE6A 5DRQA 4DV1E 2UUAI 4OO1B 1D6TA 3PYEA 4P52A 1N34E 4LFBI 2HKJA 3Q1QA 2V2ZA 2Z5BA 3GLLA 2PNZA 1UEKA 3HJCA 3HULA 3J7AM 5L3JA 4AIDA 1YH8A 3P76A 1N0UA 2ZM6E 2VQEE 4XTJA 2E5LE 1OJ4A 1XMOE 1UDNA 1KTVA 4DUZI 4LF4E 5A2QQ 4DR6I 2JEBB 2NN6B
chains in the Genus database with same CATH topology
4BA1B 3KRNA 3M85G 1E3PA 4OO1D 1E3HA 2C39B 4IFDF 1R6LA 2C38B 5JEAD 2PO2B 2C37A 2JEAA 2BA1D 4OO1C 3GCMA 4BA2A 4AIMA 5JEAC 2NN6A 1UDSA 2BA0G 2BR2A 3U1KA 4BA1A 2NN6D 4OO1A 3L7ZB 2C39A 5JEAA 2NN6C 2C38A 4AM3A 2WNRB 3CDIA 2PO2A 2JE6B 5K36D 4NBQA 5K36B 2PO0B 5K36E 5C0XB 3M85D 4OO1F 5C0XE 3GMEA 5K36C 5JEAF 5C0XC 2PNZB 2PO1B 2JEBA 3M7ND 1OYRA 3L7ZA 2BA0D 2WNRA 1UDQA 5K36A 2PO0A 2NN6F 5C0XA 4IFDB 4IFDE 1R6MA 3CDJA 5C0XD 4IFDC 2C37B 2WP8B 2BR2B 4IFDA 1OYSA 3B4TA 2JE6A 4OO1B 1UDOA 4IFDD 4OO1E 2BA1G 3DD6A 3H1CA 5JEAB 5JEAE 3GLLA 2WP8A 3HKMA 2PNZA 5K36F 3M7NG 2PO1A 5C0XF 4AIDA 2JEAB 4BA2B 1UDNA 2JEBB 2NN6B 2NN6E 1OYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA1 B;  3KRN A;  3M85 G;  1E3P A;  4OO1 D;  1E3H A;  2C39 B;  4IFD F;  1R6L A;  2C38 B;  5JEA D;  2PO2 B;  2C37 A;  2JEA A;  2BA1 D;  4OO1 C;  3GCM A;  4BA2 A;  4AIM A;  5JEA C;  2NN6 A;  1UDS A;  2BA0 G;  2BR2 A;  3U1K A;  4BA1 A;  2NN6 D;  4OO1 A;  3L7Z B;  2C39 A;  5JEA A;  2NN6 C;  2C38 A;  4AM3 A;  2WNR B;  3CDI A;  2PO2 A;  2JE6 B;  5K36 D;  4NBQ A;  5K36 B;  2PO0 B;  5K36 E;  5C0X B;  3M85 D;  4OO1 F;  5C0X E;  3GME A;  5K36 C;  5JEA F;  5C0X C;  2PNZ B;  2PO1 B;  2JEB A;  3M7N D;  1OYR A;  3L7Z A;  2BA0 D;  2WNR A;  1UDQ A;  5K36 A;  2PO0 A;  2NN6 F;  5C0X A;  4IFD B;  4IFD E;  1R6M A;  3CDJ A;  5C0X D;  4IFD C;  2C37 B;  2WP8 B;  2BR2 B;  4IFD A;  1OYS A;  3B4T A;  2JE6 A;  4OO1 B;  1UDO A;  4IFD D;  4OO1 E;  2BA1 G;  3DD6 A;  3H1C A;  5JEA B;  5JEA E;  3GLL A;  2WP8 A;  3HKM A;  2PNZ A;  5K36 F;  3M7N G;  2PO1 A;  5C0X F;  4AID A;  2JEA B;  4BA2 B;  1UDN A;  2JEB B;  2NN6 B;  2NN6 E;  1OYP A; 
#chains in the Genus database with same CATH topology
 2VQF E;  1HR0 E;  3PYF A;  2CVE A;  2F1D A;  4B3M E;  3P3E A;  4OKG A;  3ZZT A;  5JEA D;  3OTO E;  4OO1 C;  4X65 I;  4DR7 E;  4DV2 E;  2UXD I;  1RHY A;  4B3R I;  4DPU A;  4AIM A;  1UDS A;  1ZXN A;  3U1K A;  4X64 E;  2HFS A;  3K1J A;  1XNQ I;  4OO1 A;  4Z7C A;  1J5E E;  2C39 A;  4GKJ I;  2NN6 C;  2WNR B;  2IOP A;  4MU4 A;  4DR3 I;  4HY1 A;  2UU9 E;  1N0V C;  4JI8 E;  5C0X E;  5K36 C;  4JI0 E;  5JEA F;  1KKH A;  2PNL A;  1XXE A;  2PO1 B;  1IBL I;  4LOM A;  2E1R A;  5DNL A;  2JEB A;  2GO3 A;  4LFA I;  3ZKB A;  4LCH A;  3T1Y E;  4WUB A;  4NXN I;  4LFB E;  2BA0 D;  4FW6 A;  4IZJ B;  2Z5C B;  5K36 A;  4LF8 I;  4IFD E;  1I94 I;  4DUZ E;  4DR6 E;  2V2Q A;  4FN5 A;  1YHC A;  4LCG A;  3U1Y A;  1K47 A;  4DV3 I;  2IER A;  3B82 A;  4JI5 I;  4X62 E;  4EMD A;  4MU3 A;  4QNJ A;  4X65 E;  2UUC I;  1B63 A;  2UXD E;  3J81 C;  3F0N A;  4B3R E;  4OO1 E;  4OX9 I;  4YHH I;  5JEA B;  3V2U C;  4MDT A;  1HNW I;  5K36 F;  4DV5 E;  2PO1 A;  4USM A;  1XNQ E;  3PS2 A;  1WUU A;  1HNZ I;  4JYA I;  2V2V A;  5EL9 A;  1FWL A;  1PVG A;  5DRP A;  1EI1 A;  4GKK E;  4IZJ A;  4DR3 E;  3WU6 A;  2NN6 E;  2R42 A;  3PS1 A;  4K0K I;  4DPX A;  4X66 I;  1ZXM A;  4HAC A;  1N32 I;  3M85 G;  1H74 A;  1U2R A;  1VIS A;  1IBL E;  1E3H A;  3J81 Q;  2UXC E;  2C39 B;  3QT5 A;  4NXM E;  2Q2E B;  1Y60 A;  1N36 E;  1MX0 A;  4LFA E;  2BA1 D;  3GCM A;  4DV6 E;  4USK A;  4BA2 A;  1PKP A;  2BM0 A;  4DUY E;  5IT9 Q;  2ZIT A;  5JEA C;  2A2D A;  1NHI A;  4B3T E;  2IES A;  4LF6 E;  4WUD A;  3WU4 A;  5IWA I;  1Z0B A;  2HKE A;  2GS8 A;  4MU1 A;  4ED4 A;  4U3B A;  1I94 E;  3JAM C;  4IZK B;  3NZK A;  5BR8 I;  2AJ4 A;  4JI7 E;  1BKN A;  1USU A;  4B3S I;  5JEA A;  2UUB I;  4ISA A;  4AM3 A;  5K36 B;  1VI7 A;  3M6A A;  4NBQ A;  1ELO A;  3P06 A;  2DEJ A;  4DPY A;  1NHH A;  3D4J A;  2GQ0 A;  3ZZU A;  4DV3 E;  2LJP A;  3LNU A;  4DV7 I;  4JI5 E;  2UXB I;  1H72 C;  3M7N D;  4U3D A;  1OYR A;  4URL A;  4OX9 E;  4JV5 E;  3J7A G;  1H73 A;  3ZZ0 A;  4DPW A;  3JAM Q;  1HNW E;  1QZR A;  1ZM9 A;  2EFG A;  4OZE A;  1N33 I;  4LFC E;  1XNR E;  4JYA E;  4FW4 A;  4JI4 I;  2HFU A;  4DV0 E;  1Y4U A;  4QNK A;  1XHK A;  4LF7 I;  4DV4 I;  5LMU E;  2C37 B;  3PRY A;  2CG9 A;  4ZVI A;  4K0K E;  4X66 E;  1IBK E;  2WW4 A;  2J65 A;  2X36 A;  1DAR A;  1XMQ I;  1N32 E;  2UUA E;  4WUC A;  3WU5 A;  4IZK A;  2A2C A;  4PRX A;  2BR2 B;  1MU5 A;  4N3O A;  3QT7 A;  1UDO A;  1FJG I;  1P42 A;  1Z0W A;  2HHH I;  1ZM3 A;  4HAC B;  3H1C A;  2Z5E A;  5ELW A;  5JEA E;  4DV1 I;  2O1U A;  2WP8 A;  3Q6N A;  3HKM A;  3QT6 A;  5IWA E;  5LMN I;  4JI3 I;  3M7N G;  2O3Z A;  3CWV A;  3V5R A;  2CZ9 A;  4BA2 B;  4FWD A;  5BR8 E;  4B3S E;  2UUB E;  3QT8 A;  2ZM6 I;  4DR5 I;  1Z59 A;  2VF3 A;  3ZKD A;  3KRN A;  4LF4 I;  5FLX C;  1E3P A;  4HXZ A;  4DV7 E;  4FW3 A;  2UXB E;  2C37 A;  1Z5C A;  4FWG A;  1Y6Z A;  4HYM A;  2JEA A;  1HNX I;  1PIE A;  1RRE A;  4DPT A;  3PYG A;  3OTO I;  2BA0 G;  2BR2 A;  4DV2 I;  2IOQ A;  1N33 E;  4GKJ E;  4BA1 A;  1ZM2 A;  2O1V A;  1Y5Y A;  4JI4 E;  4LF7 E;  2HK3 A;  4X64 I;  1Z0G A;  2C38 A;  1IBM I;  2PO2 A;  4DR1 I;  2F4V I;  5K36 E;  1NHJ A;  1Z5B A;  2V34 A;  4FW7 A;  4KHP I;  4LF9 I;  1Z5A A;  4NXN E;  5C0X C;  2HK2 A;  5A2Q C;  4AQY I;  2UU9 I;  4DU8 A;  1RR9 A;  4LF5 I;  2AE8 A;  4LF8 E;  2PNM A;  1FJG E;  3ZM7 A;  3L7Z A;  4DU7 A;  4MU0 A;  3UHM A;  2OI2 A;  4IS9 A;  5DRO A;  1UDQ A;  5GME A;  3J80 C;  3PYD A;  2PO0 A;  5LMN E;  4JI3 E;  5C0X A;  3P3C A;  3T1Y I;  5DNX A;  4DR2 I;  1S4E A;  1FKA E;  1R6M A;  1KVK A;  3CDJ A;  3LTO A;  5C0X D;  4IFD C;  1Y4S A;  4YY3 I;  2VES A;  1H7S A;  3GON A;  4DR4 I;  2WP8 B;  1FI4 A;  4DR5 E;  2ZBK B;  2UUC E;  5DRR A;  4IFD A;  1OYS A;  3T1H I;  4I3H A;  4YHH E;  3B4T A;  4MQY A;  3J80 Q;  5LL6 R;  1HNX E;  4IFD D;  1USV A;  1FWK A;  1Z0E A;  2BA1 G;  3DD6 A;  1HNZ E;  4X62 I;  4JI6 I;  3B78 A;  4LPF A;  2R3V A;  5C0X F;  2DEI A;  2JEA B;  4UT4 A;  5GMD A;  4LCF A;  4JI1 I;  1NZ0 A;  4DV5 I;  4RPF A;  1IBM E;  4DR1 E;  1OYP A;  2F4V E;  4KQV A;  4BA1 B;  4JI2 I;  4Z7Y A;  4GKK I;  4KHP E;  4LF9 E;  1H7U A;  1Z0C A;  4OO1 D;  4AQY E;  4LF5 E;  4IFD F;  1R6L A;  2C38 B;  2PO2 B;  2GO4 A;  2NPF A;  2UXC I;  1S16 A;  1N34 I;  4NXM I;  2NN6 A;  1N36 I;  3H4L A;  4DV6 I;  4R1F A;  3Q6M A;  4DUY I;  4DR2 E;  2NN6 D;  4B3T I;  2VQE I;  2E5L I;  3L7Z B;  4LF6 I;  4YY3 E;  1XMO I;  3B8H A;  1EA6 A;  3CDI A;  2JE6 B;  1Z0T A;  4DR4 E;  5K36 D;  2PO0 B;  5C0X B;  3M85 D;  2VQF I;  1HR0 I;  4OO1 F;  1A6F A;  4JI7 I;  4P7A A;  3GME A;  3K85 A;  4B3M I;  2Z5B B;  4DXL A;  2PNZ B;  5EKW A;  3T1H E;  4UTG A;  4J3D A;  4MYT A;  4DR7 I;  2O1W A;  1B62 A;  1Z0V A;  3P3G A;  2WNR A;  3PS3 A;  4JI6 E;  4PRV A;  2NN6 F;  4IFD B;  4DV4 E;  4JG4 A;  2BV3 A;  4FW9 A;  4JV5 I;  5FLX Q;  4FWH A;  2O1T A;  4M1K A;  1J5E I;  5IT9 C;  4MYU A;  4JI1 E;  1XMQ E;  4LFC I;  5FWK A;  1XNR I;  4GQU A;  1FNM A;  4FW5 A;  2JT2 A;  2X7I A;  2V8P A;  4DV0 I;  2XEX A;  1ZM4 A;  4JI2 E;  4JI8 I;  3WU3 A;  2BM1 A;  2Z5C A;  4PU9 A;  5LMU I;  2J7K A;  4JI0 I;  1KIJ A;  3K17 A;  2HHH E;  3LPS A;  1IBK I;  4IZJ D;  1HK7 A;  1MG7 A;  2CGE A;  2JE6 A;  5DRQ A;  4DV1 E;  2UUA I;  4OO1 B;  1D6T A;  3PYE A;  4P52 A;  1N34 E;  4LFB I;  2HKJ A;  3Q1Q A;  2V2Z A;  2Z5B A;  3GLL A;  2PNZ A;  1UEK A;  3HJC A;  3HUL A;  3J7A M;  5L3J A;  4AID A;  1YH8 A;  3P76 A;  1N0U A;  2ZM6 E;  2VQE E;  4XTJ A;  2E5L E;  1OJ4 A;  1XMO E;  1UDN A;  1KTV A;  4DUZ I;  4LF4 E;  5A2Q Q;  4DR6 I;  2JEB B;  2NN6 B; 
#chains in the Genus database with same CATH homology
 4BA1 B;  3KRN A;  3M85 G;  1E3P A;  4OO1 D;  1E3H A;  2C39 B;  4IFD F;  1R6L A;  2C38 B;  5JEA D;  2PO2 B;  2C37 A;  2JEA A;  2BA1 D;  4OO1 C;  3GCM A;  4BA2 A;  4AIM A;  5JEA C;  2NN6 A;  1UDS A;  2BA0 G;  2BR2 A;  3U1K A;  4BA1 A;  2NN6 D;  4OO1 A;  3L7Z B;  2C39 A;  5JEA A;  2NN6 C;  2C38 A;  4AM3 A;  2WNR B;  3CDI A;  2PO2 A;  2JE6 B;  5K36 D;  4NBQ A;  5K36 B;  2PO0 B;  5K36 E;  5C0X B;  3M85 D;  4OO1 F;  5C0X E;  3GME A;  5K36 C;  5JEA F;  5C0X C;  2PNZ B;  2PO1 B;  2JEB A;  3M7N D;  1OYR A;  3L7Z A;  2BA0 D;  2WNR A;  1UDQ A;  5K36 A;  2PO0 A;  2NN6 F;  5C0X A;  4IFD B;  4IFD E;  1R6M A;  3CDJ A;  5C0X D;  4IFD C;  2C37 B;  2WP8 B;  2BR2 B;  4IFD A;  1OYS A;  3B4T A;  2JE6 A;  4OO1 B;  1UDO A;  4IFD D;  4OO1 E;  2BA1 G;  3DD6 A;  3H1C A;  5JEA B;  5JEA E;  3GLL A;  2WP8 A;  3HKM A;  2PNZ A;  5K36 F;  3M7N G;  2PO1 A;  5C0X F;  4AID A;  2JEA B;  4BA2 B;  1UDN A;  2JEB B;  2NN6 B;  2NN6 E;  1OYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...