5K36E

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
265
structure length
259
Chain Sequence
MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 57
structure length 259
sequence length 265
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36E00
5K36B 4AM3A 5K36D 2C37A 2WP8A 2C39A 2JEBB 2BR2B 3CDJA 2PO1A 2BA0D 2NN6B 4AIMA 2C38B 2NN6D 2JEAB 3M85D 5K36C 1OYRA 1UDSA 2JE6A 5JEAE 2BA0G 4OO1B 5K36F 2PO2A 4AIDA 4IFDE 4OO1D 5C0XE 3M85G 2PO0A 3GLLA 5K36A 2BA1D 2PNZB 3L7ZB 3B4TA 1UDOA 2BA1G 3H1CA 2C37B 2NN6C 2NN6F 4BA2A 4BA1B 4OO1C 2WP8B 2WNRB 4OO1F 3GMEA 1R6LA 2C39B 5JEAB 2C38A 4IFDB 2PO1B 5JEAD 5C0XB 4IFDD 4OO1A 5C0XD 3M7ND 1E3HA 2PO2B 2PNZA 3M7NG 5K36E 3U1KA 4NBQA 1E3PA 3HKMA 2JEBA 1OYSA 2BR2A 5JEAC 5JEAF 2NN6A 4IFDC 4IFDF 1R6MA 4BA1A 5C0XC 3DD6A 5C0XF 1UDNA 2WNRA 2JEAA 4BA2B 1UDQA 5JEAA 2NN6E 2JE6B 4IFDA 3GCMA 5C0XA 3KRNA 3CDIA 4OO1E 2PO0B 1OYPA 3L7ZA
chains in the Genus database with same CATH superfamily
4DU7A 1Y4UA 2ZM6I 1HNWE 4DU8A 2DEIA 5K36D 4WUBA 2C37A 4X64E 2WW4A 4FWDA 4PRXA 1USVA 4B3RE 3B78A 1DARA 2WP8A 2O1TA 1RR9A 3WU4A 2BM0A 5LL6R 3V5RA 5FLXQ 2JEBB 4NXNI 1KKHA 4LF8I 1S16A 2ZM6E 2BA0D 2NN6B 4LF5I 4AIMA 1NZ0A 1OYRA 5JEAE 2BA0G 4MU0A 2PO2A 4IFDE 3P3GA 3Q1QA 2PO0A 4K0KI 4NXNE 4DV5I 4LF8E 3K1JA 5DROA 2Z5EA 3ZZTA 1Z0EA 3JAMC 2ZBKB 4IZJD 4R1FA 4HY1A 5L3JA 4JI8I 2V2VA 2NN6C 2R42A 2NN6F 5GMEA 4FWGA 4U3BA 4BA1B 4UTGA 5LMUI 4K0KE 1BKNA 4DV5E 4LFBI 3HULA 1A6FA 4JI8E 5JEAD 4DPXA 4DXLA 5C0XB 4DV6I 2UXDI 4IFDD 5LMNI 5DNLA 4Z7YA 4USKA 5DNXA 5LMUE 1E3HA 5BR8I 4LFBE 1XHKA 1ZM2A 4LPFA 1XNQE 4AQYI 3QT8A 4DV6E 2UXDE 2PNMA 2JEBA 5LMNE 2F4VI 3HJCA 1EI1A 3CWVA 3J81Q 4DR5I 1B63A 2NN6A 4LF4I 2X7IA 5BR8E 5C0XC 5C0XF 1UDNA 1N33I 1UDQA 1D6TA 2VQEI 4RPFA 2J65A 4LCGA 4FN5A 4AQYE 1PKPA 4M1KA 2HK3A 1NHHA 5A2QC 1U2RA 3PRYA 1UEKA 4ISAA 2F4VE 3QT5A 4OO1E 4P52A 2PO0B 4DR5E 4IZKA 4LF4E 4DR6I 2UU9I 4OZEA 3OTOI 4JI2I 1N33E 4OX9I 1H7UA 3WU5A 2VQEE 3P06A 5IT9C 4NXME 1FWKA 4DR6E 2PNLA 3QT6A 2HKEA 2OI2A 2VF3A 3OTOE 4JI2E 4OX9E 1K47A 4KHPI 4X66I 1Z0VA 2AJ4A 4N3OA 1YH8A 3M85D 1Z0CA 2UUBI 1PVGA 4ED4A 4FW3A 4OO1D 3M85G 2IOPA 4DV3I 4KQVA 4QNJA 1RREA 3PYFA 1OJ4A 1VISA 5K36A 2HFSA 1Z5CA 4DPUA 4KHPE 1H72C 4X66E 2HK2A 1Z0TA 3B4TA 1UDOA 4LF9I 4X65I 2UUBE 1Y4SA 4DV3E 3K17A 1PIEA 2CVEA 2C39B 4EMDA 2C38A 2UUCI 1HR0I 2PO1B 3J80C 2LJPA 3ZZUA 4LF9E 5DRQA 1Z5AA 4X65E 4IZKB 4LF5E 4LF6I 4DUYI 3M7ND 1EA6A 2O1WA 3UHMA 4GKJI 2PNZA 4FW6A 3M7NG 2BV3A 4MU4A 4JI0I 1N0VC 1E3PA 2Z5CA 4IS9A 3U1KA 4DUZI 1Z0WA 1ZM4A 3T1YI 1HR0E 2UUCE 3ZZ0A 4B3TI 2GQ0A 4GQUA 2EFGA 2Z5BB 1IBLI 4LF6E 4DUYE 2BM1A 2V2ZA 3WU3A 1IBKI 2V2QA 4GKJE 4J3DA 2CGEA 4BA2B 5IWAI 4JI0E 4DUZE 1FNMA 2E1RA 5JEAA 2NN6E 3T1YE 3J7AM 4IFDA 4B3TE 1KIJA 1IBLE 1OYPA 4JI6I 3LNUA 4YY3I 2V34A 3PS3A 5K36B 4DR3I 4AM3A 5IWAE 2JT2A 1I94I 1N32I 3JAMQ 4B3SI 4DPWA 3ZKDA 4LCFA 4P7AA 4DR7I 2CG9A 4JI6E 2Q2EB 2C39A 4LCHA 1USUA 2GS8A 2IESA 2PO1A 4DR3E 2C38B 2NN6D 1I94E 4FW7A 1N32E 5K36C 5K36F 3PYGA 3H4LA 4B3SE 2X36A 4U3DA 4AIDA 3LTOA 2DEJA 5DRRA 1J5EI 5C0XE 4DR7E 1NHIA 4PU9A 3K85A 4DV1I 2NPFA 4FW4A 3GLLA 2BA1D 2PNZB 3M6AA 3GONA 5DRPA 3L7ZB 1ZXNA 3Q6NA 2Z5CB 2V8PA 1P42A 2Z5BA 2BA1G 4I3HA 5FLXC 2UU9E 4URLA 2O3ZA 4BA2A 1ZXMA 1MG7A 4LFCI 4DV1E 2HKJA 3GMEA 5JEAB 4MQYA 4IFDB 4UT4A 4OO1A 3PS1A 4JI3I 5C0XD 5A2QQ 3LPSA 4JV5I 4LFCE 1QZRA 5ELWA 2A2CA 4JI4I 1XMOI 4HACA 3NZKA 2AE8A 1YHCA 1H7SA 2VQFI 4MU3A 2ZITA 1FWLA 1Y60A 3HKMA 2A2DA 4MU1A 1OYSA 4JI3E 4YHHI 5JEAC 3WU6A 5JEAF 1XXEA 1KTVA 3P3CA 4IFDC 4JV5E 4IFDF 3QT7A 5IT9Q 4MYTA 4JG4A 3DD6A 4JI4E 1XMOE 2WNRA 3PS2A 3T1HI 2R3VA 2CZ9A 2VQFE 3GCMA 3V2UC 4DPTA 3CDIA 1HNXI 4YHHE 1XNRI 4IZJA 3P76A 3L7ZA 2IOQA 4JI5I 3T1HE 4LF7I 4FWHA 1Z5BA 1XMQI 4HYMA 1ZM3A 3J81C 4LOMA 1HNXE 4DPYA 1KVKA 1XNRE 1ELOA 4FW9A 3PYEA 4JI1I 1S4EA 4JYAI 1Z0GA 3U1YA 2BR2B 2UXCI 3CDJA 4JI5E 1WUUA 4DV0I 4LF7E 1FJGI 3B82A 1XMQE 5EL9A 1N36I 2JEAB 4JI7I 2JE6A 1UDSA 1IBKE 4OO1B 1Y6ZA 1XNQI 3J80Q 4JI1E 4DR1I 1N34I 4GKKI 2UXBI 4JYAE 1FKAE 4HACB 2UXCE 1MU5A 2E5LI 4DV0E 1FJGE 2IERA 3B8HA 1H74A 4DV2I 1N36E 4PRVA 1NHJA 2GO3A 4JI7E 4YY3E 4Z7CA 3H1CA 3P3EA 2C37B 1Z59A 1MX0A 2F1DA 4XTJA 4QNKA 4DR1E 4ZVIA 1N34E 4GKKE 2UXBE 1Z0BA 2WP8B 4OO1C 2WNRB 4B3MI 4OO1F 3ZM7A 2E5LE 2UUAI 4OKGA 1R6LA 4FW5A 1IBMI 3D4JA 4DV2E 1ZM9A 4DV7I 4DV4I 1FI4A 4X62I 4IZJB 1RHYA 1HNZI 4MDTA 2HHHI 2PO2B 4DR2I 4B3ME 2UUAE 4NXMI 1IBME 5K36E 3PYDA 1J5EE 4NBQA 3ZKBA 3J7AG 2HFUA 4DV7E 4MYUA 4DV4E 2O1UA 1Y5YA 4X62E 1N0UA 1HK7A 2BR2A 2O1VA 3F0NA 4LFAI 4HXZA 3Q6MA 1H73A 1HNZE 4DR4I 1R6MA 4BA1A 5EKWA 4DR2E 2HHHE 4WUDA 5FWKA 2JEAA 1VI7A 2XEXA 1HNWI 4X64I 2JE6B 4USMA 2VESA 4B3RI 2GO4A 5C0XA 3KRNA 5GMDA 4WUCA 4LFAE 1B62A 2J7KA 4DR4E
chains in the Genus database with same CATH topology
5K36B 4AM3A 5K36D 2C37A 2WP8A 2C39A 2JEBB 2BR2B 3CDJA 2PO1A 2BA0D 2NN6B 4AIMA 2C38B 2NN6D 2JEAB 3M85D 5K36C 1OYRA 1UDSA 2JE6A 5JEAE 2BA0G 4OO1B 5K36F 2PO2A 4AIDA 4IFDE 4OO1D 5C0XE 3M85G 2PO0A 3GLLA 5K36A 2BA1D 2PNZB 3L7ZB 3B4TA 1UDOA 2BA1G 3H1CA 2C37B 2NN6C 2NN6F 4BA2A 4BA1B 4OO1C 2WP8B 2WNRB 4OO1F 3GMEA 1R6LA 2C39B 5JEAB 2C38A 4IFDB 2PO1B 5JEAD 5C0XB 4IFDD 4OO1A 5C0XD 3M7ND 1E3HA 2PO2B 2PNZA 3M7NG 5K36E 3U1KA 4NBQA 1E3PA 3HKMA 2JEBA 1OYSA 2BR2A 5JEAC 5JEAF 2NN6A 4IFDC 4IFDF 1R6MA 4BA1A 5C0XC 3DD6A 5C0XF 1UDNA 2WNRA 2JEAA 4BA2B 1UDQA 5JEAA 2NN6E 2JE6B 4IFDA 3GCMA 5C0XA 3KRNA 3CDIA 4OO1E 2PO0B 1OYPA 3L7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 B;  4AM3 A;  5K36 D;  2C37 A;  2WP8 A;  2C39 A;  2JEB B;  2BR2 B;  3CDJ A;  2PO1 A;  2BA0 D;  2NN6 B;  4AIM A;  2C38 B;  2NN6 D;  2JEA B;  3M85 D;  5K36 C;  1OYR A;  1UDS A;  2JE6 A;  5JEA E;  2BA0 G;  4OO1 B;  5K36 F;  2PO2 A;  4AID A;  4IFD E;  4OO1 D;  5C0X E;  3M85 G;  2PO0 A;  3GLL A;  5K36 A;  2BA1 D;  2PNZ B;  3L7Z B;  3B4T A;  1UDO A;  2BA1 G;  3H1C A;  2C37 B;  2NN6 C;  2NN6 F;  4BA2 A;  4BA1 B;  4OO1 C;  2WP8 B;  2WNR B;  4OO1 F;  3GME A;  1R6L A;  2C39 B;  5JEA B;  2C38 A;  4IFD B;  2PO1 B;  5JEA D;  5C0X B;  4IFD D;  4OO1 A;  5C0X D;  3M7N D;  1E3H A;  2PO2 B;  2PNZ A;  3M7N G;  5K36 E;  3U1K A;  4NBQ A;  1E3P A;  3HKM A;  2JEB A;  1OYS A;  2BR2 A;  5JEA C;  5JEA F;  2NN6 A;  4IFD C;  4IFD F;  1R6M A;  4BA1 A;  5C0X C;  3DD6 A;  5C0X F;  1UDN A;  2WNR A;  2JEA A;  4BA2 B;  1UDQ A;  5JEA A;  2NN6 E;  2JE6 B;  4IFD A;  3GCM A;  5C0X A;  3KRN A;  3CDI A;  4OO1 E;  2PO0 B;  1OYP A;  3L7Z A; 
#chains in the Genus database with same CATH topology
 4DU7 A;  1Y4U A;  2ZM6 I;  1HNW E;  4DU8 A;  2DEI A;  5K36 D;  4WUB A;  2C37 A;  4X64 E;  2WW4 A;  4FWD A;  4PRX A;  1USV A;  4B3R E;  3B78 A;  1DAR A;  2WP8 A;  2O1T A;  1RR9 A;  3WU4 A;  2BM0 A;  5LL6 R;  3V5R A;  5FLX Q;  2JEB B;  4NXN I;  1KKH A;  4LF8 I;  1S16 A;  2ZM6 E;  2BA0 D;  2NN6 B;  4LF5 I;  4AIM A;  1NZ0 A;  1OYR A;  5JEA E;  2BA0 G;  4MU0 A;  2PO2 A;  4IFD E;  3P3G A;  3Q1Q A;  2PO0 A;  4K0K I;  4NXN E;  4DV5 I;  4LF8 E;  3K1J A;  5DRO A;  2Z5E A;  3ZZT A;  1Z0E A;  3JAM C;  2ZBK B;  4IZJ D;  4R1F A;  4HY1 A;  5L3J A;  4JI8 I;  2V2V A;  2NN6 C;  2R42 A;  2NN6 F;  5GME A;  4FWG A;  4U3B A;  4BA1 B;  4UTG A;  5LMU I;  4K0K E;  1BKN A;  4DV5 E;  4LFB I;  3HUL A;  1A6F A;  4JI8 E;  5JEA D;  4DPX A;  4DXL A;  5C0X B;  4DV6 I;  2UXD I;  4IFD D;  5LMN I;  5DNL A;  4Z7Y A;  4USK A;  5DNX A;  5LMU E;  1E3H A;  5BR8 I;  4LFB E;  1XHK A;  1ZM2 A;  4LPF A;  1XNQ E;  4AQY I;  3QT8 A;  4DV6 E;  2UXD E;  2PNM A;  2JEB A;  5LMN E;  2F4V I;  3HJC A;  1EI1 A;  3CWV A;  3J81 Q;  4DR5 I;  1B63 A;  2NN6 A;  4LF4 I;  2X7I A;  5BR8 E;  5C0X C;  5C0X F;  1UDN A;  1N33 I;  1UDQ A;  1D6T A;  2VQE I;  4RPF A;  2J65 A;  4LCG A;  4FN5 A;  4AQY E;  1PKP A;  4M1K A;  2HK3 A;  1NHH A;  5A2Q C;  1U2R A;  3PRY A;  1UEK A;  4ISA A;  2F4V E;  3QT5 A;  4OO1 E;  4P52 A;  2PO0 B;  4DR5 E;  4IZK A;  4LF4 E;  4DR6 I;  2UU9 I;  4OZE A;  3OTO I;  4JI2 I;  1N33 E;  4OX9 I;  1H7U A;  3WU5 A;  2VQE E;  3P06 A;  5IT9 C;  4NXM E;  1FWK A;  4DR6 E;  2PNL A;  3QT6 A;  2HKE A;  2OI2 A;  2VF3 A;  3OTO E;  4JI2 E;  4OX9 E;  1K47 A;  4KHP I;  4X66 I;  1Z0V A;  2AJ4 A;  4N3O A;  1YH8 A;  3M85 D;  1Z0C A;  2UUB I;  1PVG A;  4ED4 A;  4FW3 A;  4OO1 D;  3M85 G;  2IOP A;  4DV3 I;  4KQV A;  4QNJ A;  1RRE A;  3PYF A;  1OJ4 A;  1VIS A;  5K36 A;  2HFS A;  1Z5C A;  4DPU A;  4KHP E;  1H72 C;  4X66 E;  2HK2 A;  1Z0T A;  3B4T A;  1UDO A;  4LF9 I;  4X65 I;  2UUB E;  1Y4S A;  4DV3 E;  3K17 A;  1PIE A;  2CVE A;  2C39 B;  4EMD A;  2C38 A;  2UUC I;  1HR0 I;  2PO1 B;  3J80 C;  2LJP A;  3ZZU A;  4LF9 E;  5DRQ A;  1Z5A A;  4X65 E;  4IZK B;  4LF5 E;  4LF6 I;  4DUY I;  3M7N D;  1EA6 A;  2O1W A;  3UHM A;  4GKJ I;  2PNZ A;  4FW6 A;  3M7N G;  2BV3 A;  4MU4 A;  4JI0 I;  1N0V C;  1E3P A;  2Z5C A;  4IS9 A;  3U1K A;  4DUZ I;  1Z0W A;  1ZM4 A;  3T1Y I;  1HR0 E;  2UUC E;  3ZZ0 A;  4B3T I;  2GQ0 A;  4GQU A;  2EFG A;  2Z5B B;  1IBL I;  4LF6 E;  4DUY E;  2BM1 A;  2V2Z A;  3WU3 A;  1IBK I;  2V2Q A;  4GKJ E;  4J3D A;  2CGE A;  4BA2 B;  5IWA I;  4JI0 E;  4DUZ E;  1FNM A;  2E1R A;  5JEA A;  2NN6 E;  3T1Y E;  3J7A M;  4IFD A;  4B3T E;  1KIJ A;  1IBL E;  1OYP A;  4JI6 I;  3LNU A;  4YY3 I;  2V34 A;  3PS3 A;  5K36 B;  4DR3 I;  4AM3 A;  5IWA E;  2JT2 A;  1I94 I;  1N32 I;  3JAM Q;  4B3S I;  4DPW A;  3ZKD A;  4LCF A;  4P7A A;  4DR7 I;  2CG9 A;  4JI6 E;  2Q2E B;  2C39 A;  4LCH A;  1USU A;  2GS8 A;  2IES A;  2PO1 A;  4DR3 E;  2C38 B;  2NN6 D;  1I94 E;  4FW7 A;  1N32 E;  5K36 C;  5K36 F;  3PYG A;  3H4L A;  4B3S E;  2X36 A;  4U3D A;  4AID A;  3LTO A;  2DEJ A;  5DRR A;  1J5E I;  5C0X E;  4DR7 E;  1NHI A;  4PU9 A;  3K85 A;  4DV1 I;  2NPF A;  4FW4 A;  3GLL A;  2BA1 D;  2PNZ B;  3M6A A;  3GON A;  5DRP A;  3L7Z B;  1ZXN A;  3Q6N A;  2Z5C B;  2V8P A;  1P42 A;  2Z5B A;  2BA1 G;  4I3H A;  5FLX C;  2UU9 E;  4URL A;  2O3Z A;  4BA2 A;  1ZXM A;  1MG7 A;  4LFC I;  4DV1 E;  2HKJ A;  3GME A;  5JEA B;  4MQY A;  4IFD B;  4UT4 A;  4OO1 A;  3PS1 A;  4JI3 I;  5C0X D;  5A2Q Q;  3LPS A;  4JV5 I;  4LFC E;  1QZR A;  5ELW A;  2A2C A;  4JI4 I;  1XMO I;  4HAC A;  3NZK A;  2AE8 A;  1YHC A;  1H7S A;  2VQF I;  4MU3 A;  2ZIT A;  1FWL A;  1Y60 A;  3HKM A;  2A2D A;  4MU1 A;  1OYS A;  4JI3 E;  4YHH I;  5JEA C;  3WU6 A;  5JEA F;  1XXE A;  1KTV A;  3P3C A;  4IFD C;  4JV5 E;  4IFD F;  3QT7 A;  5IT9 Q;  4MYT A;  4JG4 A;  3DD6 A;  4JI4 E;  1XMO E;  2WNR A;  3PS2 A;  3T1H I;  2R3V A;  2CZ9 A;  2VQF E;  3GCM A;  3V2U C;  4DPT A;  3CDI A;  1HNX I;  4YHH E;  1XNR I;  4IZJ A;  3P76 A;  3L7Z A;  2IOQ A;  4JI5 I;  3T1H E;  4LF7 I;  4FWH A;  1Z5B A;  1XMQ I;  4HYM A;  1ZM3 A;  3J81 C;  4LOM A;  1HNX E;  4DPY A;  1KVK A;  1XNR E;  1ELO A;  4FW9 A;  3PYE A;  4JI1 I;  1S4E A;  4JYA I;  1Z0G A;  3U1Y A;  2BR2 B;  2UXC I;  3CDJ A;  4JI5 E;  1WUU A;  4DV0 I;  4LF7 E;  1FJG I;  3B82 A;  1XMQ E;  5EL9 A;  1N36 I;  2JEA B;  4JI7 I;  2JE6 A;  1UDS A;  1IBK E;  4OO1 B;  1Y6Z A;  1XNQ I;  3J80 Q;  4JI1 E;  4DR1 I;  1N34 I;  4GKK I;  2UXB I;  4JYA E;  1FKA E;  4HAC B;  2UXC E;  1MU5 A;  2E5L I;  4DV0 E;  1FJG E;  2IER A;  3B8H A;  1H74 A;  4DV2 I;  1N36 E;  4PRV A;  1NHJ A;  2GO3 A;  4JI7 E;  4YY3 E;  4Z7C A;  3H1C A;  3P3E A;  2C37 B;  1Z59 A;  1MX0 A;  2F1D A;  4XTJ A;  4QNK A;  4DR1 E;  4ZVI A;  1N34 E;  4GKK E;  2UXB E;  1Z0B A;  2WP8 B;  4OO1 C;  2WNR B;  4B3M I;  4OO1 F;  3ZM7 A;  2E5L E;  2UUA I;  4OKG A;  1R6L A;  4FW5 A;  1IBM I;  3D4J A;  4DV2 E;  1ZM9 A;  4DV7 I;  4DV4 I;  1FI4 A;  4X62 I;  4IZJ B;  1RHY A;  1HNZ I;  4MDT A;  2HHH I;  2PO2 B;  4DR2 I;  4B3M E;  2UUA E;  4NXM I;  1IBM E;  5K36 E;  3PYD A;  1J5E E;  4NBQ A;  3ZKB A;  3J7A G;  2HFU A;  4DV7 E;  4MYU A;  4DV4 E;  2O1U A;  1Y5Y A;  4X62 E;  1N0U A;  1HK7 A;  2BR2 A;  2O1V A;  3F0N A;  4LFA I;  4HXZ A;  3Q6M A;  1H73 A;  1HNZ E;  4DR4 I;  1R6M A;  4BA1 A;  5EKW A;  4DR2 E;  2HHH E;  4WUD A;  5FWK A;  2JEA A;  1VI7 A;  2XEX A;  1HNW I;  4X64 I;  2JE6 B;  4USM A;  2VES A;  4B3R I;  2GO4 A;  5C0X A;  3KRN A;  5GMD A;  4WUC A;  4LFA E;  1B62 A;  2J7K A;  4DR4 E; 
#chains in the Genus database with same CATH homology
 5K36 B;  4AM3 A;  5K36 D;  2C37 A;  2WP8 A;  2C39 A;  2JEB B;  2BR2 B;  3CDJ A;  2PO1 A;  2BA0 D;  2NN6 B;  4AIM A;  2C38 B;  2NN6 D;  2JEA B;  3M85 D;  5K36 C;  1OYR A;  1UDS A;  2JE6 A;  5JEA E;  2BA0 G;  4OO1 B;  5K36 F;  2PO2 A;  4AID A;  4IFD E;  4OO1 D;  5C0X E;  3M85 G;  2PO0 A;  3GLL A;  5K36 A;  2BA1 D;  2PNZ B;  3L7Z B;  3B4T A;  1UDO A;  2BA1 G;  3H1C A;  2C37 B;  2NN6 C;  2NN6 F;  4BA2 A;  4BA1 B;  4OO1 C;  2WP8 B;  2WNR B;  4OO1 F;  3GME A;  1R6L A;  2C39 B;  5JEA B;  2C38 A;  4IFD B;  2PO1 B;  5JEA D;  5C0X B;  4IFD D;  4OO1 A;  5C0X D;  3M7N D;  1E3H A;  2PO2 B;  2PNZ A;  3M7N G;  5K36 E;  3U1K A;  4NBQ A;  1E3P A;  3HKM A;  2JEB A;  1OYS A;  2BR2 A;  5JEA C;  5JEA F;  2NN6 A;  4IFD C;  4IFD F;  1R6M A;  4BA1 A;  5C0X C;  3DD6 A;  5C0X F;  1UDN A;  2WNR A;  2JEA A;  4BA2 B;  1UDQ A;  5JEA A;  2NN6 E;  2JE6 B;  4IFD A;  3GCM A;  5C0X A;  3KRN A;  3CDI A;  4OO1 E;  2PO0 B;  1OYP A;  3L7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...