5K36E

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
265
structure length
259
Chain Sequence
b'MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 57
structure length 259
sequence length 265
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36E00
4IFDA 1UDOA 3L7ZA 3GMEA 5JEAB 2BA0D 2WNRA 4BA2B 3CDIA 1UDNA 2C38A 3M7NG 2C37B 4OO1E 3H1CA 5C0XE 3CDJA 3M7ND 4IFDE 5C0XB 2JE6A 4IFDB 3L7ZB 5K36F 4NBQA 4BA1B 2NN6F 5JEAE 1UDQA 3KRNA 2C39A 2WNRB 4OO1F 2C38B 2PO2B 3M85D 2PO0A 5K36C 2JEBA 2NN6C 1E3HA 2BR2A 2PO1A 2BA1G 4AIMA 2JE6B 2WP8A 1R6MA 2PNZB 4OO1C 5JEAF 1UDSA 3DD6A 1OYSA 2JEAA 2BA1D 1OYPA 3M85G 3HKMA 2C39B 5K36A 4AIDA 2NN6A 4AM3A 2PO0B 5JEAC 2C37A 5K36D 4OO1A 2BR2B 5C0XF 2NN6D 4IFDF 1OYRA 5C0XA 4OO1D 4BA1A 1R6LA 3B4TA 2JEAB 5K36E 5C0XC 3U1KA 5C0XD 5K36B 4IFDC 5JEAA 4IFDD 2NN6E 2NN6B 2PO2A 4BA2A 1E3PA 2JEBB 4OO1B 5JEAD 3GCMA 2PO1B 3GLLA 2WP8B 2PNZA 2BA0G
chains in the Genus database with same CATH superfamily
2GS8A 1J5EE 1UDOA 2HKJA 2UUBI 1RHYA 4QNJA 4B3SE 4IZKA 1FJGE 2UXCE 4FWDA 4LF7E 4JI1I 4DUYI 2WNRA 4NXNE 1KIJA 5L3JA 4DR1E 1NHHA 4LF9E 3WU6A 3PS3A 1J5EI 4MYUA 1S4EA 1ZM3A 3ZZTA 4DR3I 4JI5I 1Z0CA 4K0KE 2UXCI 3QT5A 3ZZUA 4LF7I 1Z0WA 1H7UA 2IERA 1H72C 4X66I 4NXNI 5LMUE 5K36F 4LF9I 4AQYI 5DRRA 2IOPA 1FKAE 3WU5A 1I94E 3KRNA 2WNRB 1Z0GA 3ZM7A 1KVKA 4MQYA 4LF6E 2F4VE 2VQEE 2NN6C 4LPFA 2HK3A 3OTOI 2PO1A 4FW3A 3J7AG 1I94I 2O1WA 4OO1C 4OX9E 1HNXE 1HNWE 3T1YI 1FNMA 1Z5CA 2JEAA 4JI4E 3V2UC 4LF6I 2F4VI 2VQEI 3JAMC 5K36A 5FLXQ 4P52A 4PRXA 1Z5AA 5EKWA 4MU0A 5JEAC 4YY3I 1HNXI 1U2RA 1HNWI 4JI4I 4MU1A 3B82A 1OYRA 5IT9Q 4HY1A 3PYGA 1S16A 1ZXMA 5LMNE 1R6LA 2JEAB 3J81Q 5ELWA 2UUAE 4LFCE 4JV5E 2HFUA 2HKEA 5BR8I 4NXME 5C0XC 5K36B 4LF4I 4IFDC 2NN6E 1Z59A 2PO2A 4BA2A 3QT7A 2UXDE 2UU9I 5DRPA 4UT4A 4DV4E 4LFCI 2UUAI 4JV5I 2BM0A 2O1TA 4J3DA 1NZ0A 4OZEA 4QNKA 4LCGA 4ZVIA 4DV5I 1IBME 3GMEA 2E5LE 2BV3A 3K17A 4DV4I 4X62E 2OI2A 1HNZE 4B3ME 1N34E 4BA2B 1UDNA 3M7NG 1P42A 1IBMI 4DV3I 2C37B 4XTJA 1MX0A 4MU3A 2E5LI 3ZKDA 3B8HA 4USKA 5DNXA 4YHHE 4FW9A 4OKGA 5DNLA 5C0XE 4IFDE 3M7ND 4WUDA 1HNZI 4B3MI 2CVEA 3HULA 1N34I 1IBKE 1IBLE 3P76A 4FW7A 2HHHI 4GKKE 2HFSA 4KHPE 1ZM2A 4JI7E 5A2QQ 2V8PA 1NHJA 4B3RE 2V34A 3HJCA 2X7IA 2UXBE 2C39A 4YHHI 5FWKA 4FW6A 3U1YA 1D6TA 1Y60A 2JEBA 4P7AA 1IBKI 1HR0I 4I3HA 4GKKI 1E3HA 1NHIA 2JT2A 3LNUA 4DPUA 3WU3A 4B3SI 1FJGI 4LFAE 4FWGA 2R3VA 4Z7CA 4DV0E 1KTVA 2PNMA 4JI0E 2UUCE 3ZZ0A 1UDSA 4DR1I 4IZKB 1USVA 1ZM4A 3Q6MA 3UHMA 3HKMA 2C39B 4AM3A 2A2CA 4K0KI 2NPFA 1ZXNA 4JI0I 5K36D 2UUCI 1XXEA 5LMUI 4JG4A 5C0XA 5IWAE 4FW4A 4M1KA 5GMDA 4BA1A 3B4TA 1K47A 4GKJE 2Z5EA 1BKNA 1YH8A 3NZKA 1QZRA 1Y4SA 1Z5BA 2O1VA 3H4LA 3PRYA 4OX9I 4ISAA 2DEJA 3P3CA 2J65A 5EL9A 1N36E 5DRQA 4U3BA 2Q2EB 2GO3A 2PO1B 2VF3A 2DEIA 4DPYA 2PNZA 2BA0G 4LFBE 3L7ZA 1H74A 2CGEA 2XEXA 4DR6E 2CZ9A 2Z5BA 2BA0D 3M6AA 1N36I 4DR2E 4WUCA 3CDIA 4HXZA 2C38A 1VISA 5FLXC 4OO1E 4LFBI 4LF8E 4DR6I 2LJPA 2WW4A 1MG7A 5LMNI 3CDJA 3J80Q 4NXMI 3B78A 2JE6A 4R1FA 4Z7YA 3L7ZB 4NBQA 2Z5BB 4DV1E 2UXDI 2NN6F 5IT9C 5JEAE 4LF8I 1B63A 3F0NA 1USUA 1XMOE 4JYAE 3J81C 1N33E 4OO1F 2C38B 4FW5A 2PO2B 3M85D 2PO0A 1FWKA 4MYTA 5K36C 4ED4A 4DU8A 2BR2A 4DV1I 1VI7A 2BA1G 4PRVA 2JE6B 5DROA 1Z0TA 2WP8A 1XMOI 2A2DA 3QT6A 4X62I 2HK2A 4JI6E 5JEAF 2PNLA 1XMQE 4LCHA 1OYSA 2BA1D 1OYPA 3CWVA 4IZJD 4AIDA 2UUBE 2NN6A 3J7AM 2PO0B 3ZKBA 1XHKA 3LTOA 4OO1A 1N0UA 4JI1E 4DXLA 1XMQI 2BR2B 1IBLI 5C0XF 1WUUA 2GQ0A 4IFDF 4KHPI 1Y6ZA 4JI7I 2VESA 4GQUA 4B3RI 2UXBI 2IOQA 1A6FA 3P06A 1ELOA 4IZJA 1PIEA 4DR3E 3K85A 2F1DA 4DV7E 4JI5E 2J7KA 4DV2E 2EFGA 5K36E 3V5RA 1N32E 5C0XD 1MU5A 5JEAA 4IFDD 4DV6E 4X66E 2NN6B 1Y4UA 5A2QC 4AQYE 4LFAI 2V2VA 1Z0BA 4LOMA 2BM1A 4USMA 2JEBB 4OO1B 4DV0I 3PYEA 3GCMA 4JI2E 4DV7I 4HYMA 4DV2I 4UTGA 1N32I 4DV6I 2AJ4A 4IFDA 4IZJB 4DR4E 3JAMQ 3OTOE 1UEKA 1Y5YA 3PS2A 5GMEA 5JEAB 4JI2I 4FWHA 1KKHA 3T1YE 2AE8A 3GONA 4DPTA 4U3DA 3H1CA 5IWAI 4DR4I 4LCFA 4GKJI 2CG9A 4DPXA 4YY3E 5C0XB 4MDTA 4IFDB 3K1JA 2R42A 4BA1B 2ZITA 1H73A 3LPSA 4DU7A 1UDQA 4B3TE 1EI1A 2ZBKB 4DUZE 4DPWA 4HACA 4RPFA 5BR8E 4KQVA 4LF4E 4URLA 4PU9A 4WUBA 3P3GA 4B3TI 4AIMA 1Z0VA 1RR9A 4IS9A 1R6MA 4DUZI 2PNZB 2UU9E 1EA6A 4JI3E 1PVGA 2V2ZA 1RREA 1Z0EA 4DR2I 2O1UA 3QT8A 1B62A 3DD6A 1FI4A 3Q1QA 3M85G 4DV5E 1XNRE 4HACB 4JI8E 2GO4A 4X64E 4X65E 3Q6NA 1DARA 1OJ4A 1ZM9A 2C37A 4DR7E 4N3OA 4JI3I 4FN5A 2IESA 3PS1A 3PYDA 2ZM6E 2V2QA 4DR5E 2NN6D 5LL6R 3WU4A 1XNQE 3PYFA 1FWLA 4DV3E 4MU4A 1XNRI 2Z5CA 4JI8I 4JYAI 4OO1D 1YHCA 4X64I 2VQFE 4LF5E 1N33I 4X65I 3J80C 3T1HE 4DR7I 3U1KA 2ZM6I 4DR5I 2O3ZA 1N0VC 2HHHE 3D4JA 1XNQI 1E3PA 3P3EA 5JEAD 2VQFI 4LF5I 4JI6I 2X36A 1H7SA 2E1RA 3T1HI 4DUYE 3GLLA 4EMDA 1HK7A 2Z5CB 1PKPA 2WP8B 1HR0E
chains in the Genus database with same CATH topology
4IFDA 1UDOA 3L7ZA 3GMEA 5JEAB 2BA0D 2WNRA 4BA2B 3CDIA 1UDNA 2C38A 3M7NG 2C37B 4OO1E 3H1CA 5C0XE 3CDJA 3M7ND 4IFDE 5C0XB 2JE6A 4IFDB 3L7ZB 5K36F 4NBQA 4BA1B 2NN6F 5JEAE 1UDQA 3KRNA 2C39A 2WNRB 4OO1F 2C38B 2PO2B 3M85D 2PO0A 5K36C 2JEBA 2NN6C 1E3HA 2BR2A 2PO1A 2BA1G 4AIMA 2JE6B 2WP8A 1R6MA 2PNZB 4OO1C 5JEAF 1UDSA 3DD6A 1OYSA 2JEAA 2BA1D 1OYPA 3M85G 3HKMA 2C39B 5K36A 4AIDA 2NN6A 4AM3A 2PO0B 5JEAC 2C37A 5K36D 4OO1A 2BR2B 5C0XF 2NN6D 4IFDF 1OYRA 5C0XA 4OO1D 4BA1A 1R6LA 3B4TA 2JEAB 5K36E 5C0XC 3U1KA 5C0XD 5K36B 4IFDC 5JEAA 4IFDD 2NN6E 2NN6B 2PO2A 4BA2A 1E3PA 2JEBB 4OO1B 5JEAD 3GCMA 2PO1B 3GLLA 2WP8B 2PNZA 2BA0G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD A;  1UDO A;  3L7Z A;  3GME A;  5JEA B;  2BA0 D;  2WNR A;  4BA2 B;  3CDI A;  1UDN A;  2C38 A;  3M7N G;  2C37 B;  4OO1 E;  3H1C A;  5C0X E;  3CDJ A;  3M7N D;  4IFD E;  5C0X B;  2JE6 A;  4IFD B;  3L7Z B;  5K36 F;  4NBQ A;  4BA1 B;  2NN6 F;  5JEA E;  1UDQ A;  3KRN A;  2C39 A;  2WNR B;  4OO1 F;  2C38 B;  2PO2 B;  3M85 D;  2PO0 A;  5K36 C;  2JEB A;  2NN6 C;  1E3H A;  2BR2 A;  2PO1 A;  2BA1 G;  4AIM A;  2JE6 B;  2WP8 A;  1R6M A;  2PNZ B;  4OO1 C;  5JEA F;  1UDS A;  3DD6 A;  1OYS A;  2JEA A;  2BA1 D;  1OYP A;  3M85 G;  3HKM A;  2C39 B;  5K36 A;  4AID A;  2NN6 A;  4AM3 A;  2PO0 B;  5JEA C;  2C37 A;  5K36 D;  4OO1 A;  2BR2 B;  5C0X F;  2NN6 D;  4IFD F;  1OYR A;  5C0X A;  4OO1 D;  4BA1 A;  1R6L A;  3B4T A;  2JEA B;  5K36 E;  5C0X C;  3U1K A;  5C0X D;  5K36 B;  4IFD C;  5JEA A;  4IFD D;  2NN6 E;  2NN6 B;  2PO2 A;  4BA2 A;  1E3P A;  2JEB B;  4OO1 B;  5JEA D;  3GCM A;  2PO1 B;  3GLL A;  2WP8 B;  2PNZ A;  2BA0 G; 
#chains in the Genus database with same CATH topology
 2GS8 A;  1J5E E;  1UDO A;  2HKJ A;  2UUB I;  1RHY A;  4QNJ A;  4B3S E;  4IZK A;  1FJG E;  2UXC E;  4FWD A;  4LF7 E;  4JI1 I;  4DUY I;  2WNR A;  4NXN E;  1KIJ A;  5L3J A;  4DR1 E;  1NHH A;  4LF9 E;  3WU6 A;  3PS3 A;  1J5E I;  4MYU A;  1S4E A;  1ZM3 A;  3ZZT A;  4DR3 I;  4JI5 I;  1Z0C A;  4K0K E;  2UXC I;  3QT5 A;  3ZZU A;  4LF7 I;  1Z0W A;  1H7U A;  2IER A;  1H72 C;  4X66 I;  4NXN I;  5LMU E;  5K36 F;  4LF9 I;  4AQY I;  5DRR A;  2IOP A;  1FKA E;  3WU5 A;  1I94 E;  3KRN A;  2WNR B;  1Z0G A;  3ZM7 A;  1KVK A;  4MQY A;  4LF6 E;  2F4V E;  2VQE E;  2NN6 C;  4LPF A;  2HK3 A;  3OTO I;  2PO1 A;  4FW3 A;  3J7A G;  1I94 I;  2O1W A;  4OO1 C;  4OX9 E;  1HNX E;  1HNW E;  3T1Y I;  1FNM A;  1Z5C A;  2JEA A;  4JI4 E;  3V2U C;  4LF6 I;  2F4V I;  2VQE I;  3JAM C;  5K36 A;  5FLX Q;  4P52 A;  4PRX A;  1Z5A A;  5EKW A;  4MU0 A;  5JEA C;  4YY3 I;  1HNX I;  1U2R A;  1HNW I;  4JI4 I;  4MU1 A;  3B82 A;  1OYR A;  5IT9 Q;  4HY1 A;  3PYG A;  1S16 A;  1ZXM A;  5LMN E;  1R6L A;  2JEA B;  3J81 Q;  5ELW A;  2UUA E;  4LFC E;  4JV5 E;  2HFU A;  2HKE A;  5BR8 I;  4NXM E;  5C0X C;  5K36 B;  4LF4 I;  4IFD C;  2NN6 E;  1Z59 A;  2PO2 A;  4BA2 A;  3QT7 A;  2UXD E;  2UU9 I;  5DRP A;  4UT4 A;  4DV4 E;  4LFC I;  2UUA I;  4JV5 I;  2BM0 A;  2O1T A;  4J3D A;  1NZ0 A;  4OZE A;  4QNK A;  4LCG A;  4ZVI A;  4DV5 I;  1IBM E;  3GME A;  2E5L E;  2BV3 A;  3K17 A;  4DV4 I;  4X62 E;  2OI2 A;  1HNZ E;  4B3M E;  1N34 E;  4BA2 B;  1UDN A;  3M7N G;  1P42 A;  1IBM I;  4DV3 I;  2C37 B;  4XTJ A;  1MX0 A;  4MU3 A;  2E5L I;  3ZKD A;  3B8H A;  4USK A;  5DNX A;  4YHH E;  4FW9 A;  4OKG A;  5DNL A;  5C0X E;  4IFD E;  3M7N D;  4WUD A;  1HNZ I;  4B3M I;  2CVE A;  3HUL A;  1N34 I;  1IBK E;  1IBL E;  3P76 A;  4FW7 A;  2HHH I;  4GKK E;  2HFS A;  4KHP E;  1ZM2 A;  4JI7 E;  5A2Q Q;  2V8P A;  1NHJ A;  4B3R E;  2V34 A;  3HJC A;  2X7I A;  2UXB E;  2C39 A;  4YHH I;  5FWK A;  4FW6 A;  3U1Y A;  1D6T A;  1Y60 A;  2JEB A;  4P7A A;  1IBK I;  1HR0 I;  4I3H A;  4GKK I;  1E3H A;  1NHI A;  2JT2 A;  3LNU A;  4DPU A;  3WU3 A;  4B3S I;  1FJG I;  4LFA E;  4FWG A;  2R3V A;  4Z7C A;  4DV0 E;  1KTV A;  2PNM A;  4JI0 E;  2UUC E;  3ZZ0 A;  1UDS A;  4DR1 I;  4IZK B;  1USV A;  1ZM4 A;  3Q6M A;  3UHM A;  3HKM A;  2C39 B;  4AM3 A;  2A2C A;  4K0K I;  2NPF A;  1ZXN A;  4JI0 I;  5K36 D;  2UUC I;  1XXE A;  5LMU I;  4JG4 A;  5C0X A;  5IWA E;  4FW4 A;  4M1K A;  5GMD A;  4BA1 A;  3B4T A;  1K47 A;  4GKJ E;  2Z5E A;  1BKN A;  1YH8 A;  3NZK A;  1QZR A;  1Y4S A;  1Z5B A;  2O1V A;  3H4L A;  3PRY A;  4OX9 I;  4ISA A;  2DEJ A;  3P3C A;  2J65 A;  5EL9 A;  1N36 E;  5DRQ A;  4U3B A;  2Q2E B;  2GO3 A;  2PO1 B;  2VF3 A;  2DEI A;  4DPY A;  2PNZ A;  2BA0 G;  4LFB E;  3L7Z A;  1H74 A;  2CGE A;  2XEX A;  4DR6 E;  2CZ9 A;  2Z5B A;  2BA0 D;  3M6A A;  1N36 I;  4DR2 E;  4WUC A;  3CDI A;  4HXZ A;  2C38 A;  1VIS A;  5FLX C;  4OO1 E;  4LFB I;  4LF8 E;  4DR6 I;  2LJP A;  2WW4 A;  1MG7 A;  5LMN I;  3CDJ A;  3J80 Q;  4NXM I;  3B78 A;  2JE6 A;  4R1F A;  4Z7Y A;  3L7Z B;  4NBQ A;  2Z5B B;  4DV1 E;  2UXD I;  2NN6 F;  5IT9 C;  5JEA E;  4LF8 I;  1B63 A;  3F0N A;  1USU A;  1XMO E;  4JYA E;  3J81 C;  1N33 E;  4OO1 F;  2C38 B;  4FW5 A;  2PO2 B;  3M85 D;  2PO0 A;  1FWK A;  4MYT A;  5K36 C;  4ED4 A;  4DU8 A;  2BR2 A;  4DV1 I;  1VI7 A;  2BA1 G;  4PRV A;  2JE6 B;  5DRO A;  1Z0T A;  2WP8 A;  1XMO I;  2A2D A;  3QT6 A;  4X62 I;  2HK2 A;  4JI6 E;  5JEA F;  2PNL A;  1XMQ E;  4LCH A;  1OYS A;  2BA1 D;  1OYP A;  3CWV A;  4IZJ D;  4AID A;  2UUB E;  2NN6 A;  3J7A M;  2PO0 B;  3ZKB A;  1XHK A;  3LTO A;  4OO1 A;  1N0U A;  4JI1 E;  4DXL A;  1XMQ I;  2BR2 B;  1IBL I;  5C0X F;  1WUU A;  2GQ0 A;  4IFD F;  4KHP I;  1Y6Z A;  4JI7 I;  2VES A;  4GQU A;  4B3R I;  2UXB I;  2IOQ A;  1A6F A;  3P06 A;  1ELO A;  4IZJ A;  1PIE A;  4DR3 E;  3K85 A;  2F1D A;  4DV7 E;  4JI5 E;  2J7K A;  4DV2 E;  2EFG A;  5K36 E;  3V5R A;  1N32 E;  5C0X D;  1MU5 A;  5JEA A;  4IFD D;  4DV6 E;  4X66 E;  2NN6 B;  1Y4U A;  5A2Q C;  4AQY E;  4LFA I;  2V2V A;  1Z0B A;  4LOM A;  2BM1 A;  4USM A;  2JEB B;  4OO1 B;  4DV0 I;  3PYE A;  3GCM A;  4JI2 E;  4DV7 I;  4HYM A;  4DV2 I;  4UTG A;  1N32 I;  4DV6 I;  2AJ4 A;  4IFD A;  4IZJ B;  4DR4 E;  3JAM Q;  3OTO E;  1UEK A;  1Y5Y A;  3PS2 A;  5GME A;  5JEA B;  4JI2 I;  4FWH A;  1KKH A;  3T1Y E;  2AE8 A;  3GON A;  4DPT A;  4U3D A;  3H1C A;  5IWA I;  4DR4 I;  4LCF A;  4GKJ I;  2CG9 A;  4DPX A;  4YY3 E;  5C0X B;  4MDT A;  4IFD B;  3K1J A;  2R42 A;  4BA1 B;  2ZIT A;  1H73 A;  3LPS A;  4DU7 A;  1UDQ A;  4B3T E;  1EI1 A;  2ZBK B;  4DUZ E;  4DPW A;  4HAC A;  4RPF A;  5BR8 E;  4KQV A;  4LF4 E;  4URL A;  4PU9 A;  4WUB A;  3P3G A;  4B3T I;  4AIM A;  1Z0V A;  1RR9 A;  4IS9 A;  1R6M A;  4DUZ I;  2PNZ B;  2UU9 E;  1EA6 A;  4JI3 E;  1PVG A;  2V2Z A;  1RRE A;  1Z0E A;  4DR2 I;  2O1U A;  3QT8 A;  1B62 A;  3DD6 A;  1FI4 A;  3Q1Q A;  3M85 G;  4DV5 E;  1XNR E;  4HAC B;  4JI8 E;  2GO4 A;  4X64 E;  4X65 E;  3Q6N A;  1DAR A;  1OJ4 A;  1ZM9 A;  2C37 A;  4DR7 E;  4N3O A;  4JI3 I;  4FN5 A;  2IES A;  3PS1 A;  3PYD A;  2ZM6 E;  2V2Q A;  4DR5 E;  2NN6 D;  5LL6 R;  3WU4 A;  1XNQ E;  3PYF A;  1FWL A;  4DV3 E;  4MU4 A;  1XNR I;  2Z5C A;  4JI8 I;  4JYA I;  4OO1 D;  1YHC A;  4X64 I;  2VQF E;  4LF5 E;  1N33 I;  4X65 I;  3J80 C;  3T1H E;  4DR7 I;  3U1K A;  2ZM6 I;  4DR5 I;  2O3Z A;  1N0V C;  2HHH E;  3D4J A;  1XNQ I;  1E3P A;  3P3E A;  5JEA D;  2VQF I;  4LF5 I;  4JI6 I;  2X36 A;  1H7S A;  2E1R A;  3T1H I;  4DUY E;  3GLL A;  4EMD A;  1HK7 A;  2Z5C B;  1PKP A;  2WP8 B;  1HR0 E; 
#chains in the Genus database with same CATH homology
 4IFD A;  1UDO A;  3L7Z A;  3GME A;  5JEA B;  2BA0 D;  2WNR A;  4BA2 B;  3CDI A;  1UDN A;  2C38 A;  3M7N G;  2C37 B;  4OO1 E;  3H1C A;  5C0X E;  3CDJ A;  3M7N D;  4IFD E;  5C0X B;  2JE6 A;  4IFD B;  3L7Z B;  5K36 F;  4NBQ A;  4BA1 B;  2NN6 F;  5JEA E;  1UDQ A;  3KRN A;  2C39 A;  2WNR B;  4OO1 F;  2C38 B;  2PO2 B;  3M85 D;  2PO0 A;  5K36 C;  2JEB A;  2NN6 C;  1E3H A;  2BR2 A;  2PO1 A;  2BA1 G;  4AIM A;  2JE6 B;  2WP8 A;  1R6M A;  2PNZ B;  4OO1 C;  5JEA F;  1UDS A;  3DD6 A;  1OYS A;  2JEA A;  2BA1 D;  1OYP A;  3M85 G;  3HKM A;  2C39 B;  5K36 A;  4AID A;  2NN6 A;  4AM3 A;  2PO0 B;  5JEA C;  2C37 A;  5K36 D;  4OO1 A;  2BR2 B;  5C0X F;  2NN6 D;  4IFD F;  1OYR A;  5C0X A;  4OO1 D;  4BA1 A;  1R6L A;  3B4T A;  2JEA B;  5K36 E;  5C0X C;  3U1K A;  5C0X D;  5K36 B;  4IFD C;  5JEA A;  4IFD D;  2NN6 E;  2NN6 B;  2PO2 A;  4BA2 A;  1E3P A;  2JEB B;  4OO1 B;  5JEA D;  3GCM A;  2PO1 B;  3GLL A;  2WP8 B;  2PNZ A;  2BA0 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...