5K36E

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
265
structure length
259
Chain Sequence
MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 57
structure length 259
sequence length 265
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36E00
4OO1F 2PO0B 4OO1D 2BA0D 2BA1G 3H1CA 2JE6B 2PO0A 5K36B 3M85D 2NN6E 5JEAA 3U1KA 3L7ZB 5C0XB 4AIMA 4IFDC 2PO2A 4NBQA 1OYPA 2PO1A 2NN6A 2C38A 4OO1C 2BA0G 2BR2A 5JEAB 1OYSA 4IFDE 1E3PA 3M85G 1R6MA 3M7NG 5K36F 2PO2B 4OO1E 5K36D 2PO1B 2WNRA 2C37A 2NN6B 2C38B 1UDOA 2JEAA 5C0XD 2BR2B 4IFDA 2JEBB 2WP8A 4BA2A 4AIDA 3GCMA 2PNZA 4OO1A 1E3HA 1UDNA 3CDJA 1OYRA 2JEBA 4AM3A 2C39A 5JEAF 5JEAD 2WNRB 1UDQA 2C37B 3GLLA 2JEAB 4IFDB 5K36C 2WP8B 4BA2B 3KRNA 5C0XF 2NN6F 5C0XC 2PNZB 4OO1B 2NN6D 3GMEA 2BA1D 2C39B 4BA1A 3HKMA 5K36E 1UDSA 5C0XE 5JEAC 3M7ND 1R6LA 3DD6A 3CDIA 5JEAE 2JE6A 4IFDF 5K36A 4BA1B 3B4TA 4IFDD 3L7ZA 5C0XA 2NN6C
chains in the Genus database with same CATH superfamily
4OO1D 3P3CA 2BA0D 1BKNA 2HK3A 1Z5BA 2O1WA 3H1CA 2Z5BA 3PS1A 2E1RA 5JEAA 3LPSA 5IT9C 2DEJA 3L7ZB 5C0XB 4AIMA 4IZKB 2Z5CB 3M6AA 3ZZTA 1NHHA 2PO2A 5LMNI 4DR7I 3QT5A 1N32E 4JI0I 4OO1C 2BA0G 4JI7I 3JAMQ 4DR7E 2UUCI 4DR5I 5LL6R 4IFDE 2Q2EB 1E3PA 4JI0E 3HJCA 1R6MA 4JI7E 3WU6A 4LCGA 1EI1A 5K36D 4DR5E 4OKGA 2PO1B 2NN6B 4B3TI 2C38B 4OX9E 2BR2B 4FN5A 3PYEA 1Z59A 2BV3A 2WP8A 4Z7CA 4BA2A 3Q6MA 1MG7A 3Q6NA 1VISA 4OO1A 1E3HA 4MDTA 1RR9A 1OJ4A 4J3DA 2V34A 3J7AM 4DV7I 1MU5A 4JI8I 5K36C 4DXLA 4IZJD 4PRVA 2HKEA 3WU5A 1FWLA 3H4LA 2NN6F 1Y6ZA 4DV7E 2GS8A 1HK7A 4K0KI 4JI8E 3J80Q 2AJ4A 3ZM7A 5DROA 2X7IA 4K0KE 5C0XE 2EFGA 1VI7A 4DV1I 1R6LA 4DV3E 4LFAE 1Z0VA 2JE6A 3P76A 4P52A 5K36A 4B3RI 4MYTA 4DPUA 4DV1E 2V2VA 1FWKA 4HACB 4B3MI 2R42A 4DPWA 1DARA 4QNJA 4DR4E 4LPFA 1N36I 4MYUA 4HYMA 1Y4UA 5ELWA 4B3ME 1USUA 5BR8I 1Y4SA 3M85D 2NN6E 3J7AG 3LNUA 3PRYA 5IWAE 1N36E 2GO4A 4WUCA 3K85A 2CGEA 5GMDA 2XEXA 2VQFI 4YHHE 4DR3I 4IZJA 2Z5EA 4NBQA 4JI1I 1OYPA 4LFBE 2V2QA 1FJGI 5DRPA 4IS9A 1ZXNA 2Z5BB 1N34I 4DU7A 2VQFE 4DR3E 5A2QQ 5JEAB 1OYSA 3LTOA 1B62A 2VESA 4GKKI 1FJGE 1N34E 3M85G 4N3OA 4WUBA 4USKA 1H73A 3QT6A 2PO2B 1ZM3A 4JI3I 1N0VC 1ZM2A 1Z0EA 2WNRA 2GQ0A 2C37A 1Z0WA 4GKKE 1UDOA 1XXEA 3F0NA 4JI6I 3B78A 4U3BA 2VF3A 4JI3E 4HY1A 4DV5I 1WUUA 4M1KA 3NZKA 1NZ0A 4LOMA 2PNZA 3CDJA 4JI6E 4DPXA 2C39A 2NPFA 5LMNE 5JEAF 2J7KA 2J65A 4FW3A 4FW7A 5GMEA 3GLLA 1UDQA 3PYFA 4XTJA 5L3JA 3PYDA 1K47A 4JI4I 2IOQA 1Z0BA 1XNRI 2WP8B 4BA2B 3J81C 4DUZI 2UUCE 3KRNA 4LF7I 4UTGA 5C0XF 1XMOI 4OO1B 2X36A 2UUAI 1HR0I 4JI4E 2O1UA 1XNRE 1N0UA 4DR6I 2O1TA 4DUZE 3HKMA 4LF7E 3V2UC 4ED4A 2R3VA 4FWHA 5DNLA 4NXNI 4B3TE 1XMOE 2UUAE 1Y5YA 4LFCI 4DR6E 3M7ND 1NHJA 2ZITA 4MU3A 4NXNE 2CG9A 4MQYA 1HNWI 4FW5A 4UT4A 4LFCE 2UUBI 1U2RA 3B4TA 4IFDD 2PNLA 1Y60A 5JEAE 4KQVA 4OO1F 4FWGA 4FWDA 1RREA 2PO0B 1HNWE 4B3SI 2UUBE 2HHHI 3JAMC 2JE6B 2PO0A 4HXZA 5K36B 4B3SE 2UXBI 1KIJA 3K17A 3U1KA 5LMUI 1P42A 2HHHE 2IESA 4LF4I 1S16A 2UXCI 3T1YI 2HKJA 2UXDI 4LF8I 3ZKBA 4IFDC 1HNZI 1J5EI 1PVGA 4DV4I 2UXBE 4I3HA 5LMUE 4U3DA 3T1HI 4LF4E 2UXCE 5DRQA 3T1YE 3OTOI 2UXDE 1IBMI 2PNMA 4B3RE 2AE8A 1HNZE 1J5EE 1Z0CA 4DV2I 5IT9Q 3OTOE 1IBME 1ZM4A 2F4VI 4IZJB 5K36F 2JT2A 5EL9A 1IBLI 4OO1E 4JYAI 4DV2E 4X62I 3UHMA 2JEAA 2VQEI 5BR8E 2F4VE 2BM1A 5C0XD 4IFDA 2JEBB 1ZXMA 1IBKI 1IBLE 4EMDA 4JYAE 3V5RA 2OI2A 4X62E 4FW6A 3PYGA 2BM0A 3ZZ0A 4FW4A 3J80C 2VQEE 1UDNA 1I94I 3QT8A 1OYRA 2JEBA 4QNKA 1IBKE 4JI1E 3Q1QA 2HK2A 2HFSA 3P06A 2WNRB 2C37B 4MU0A 4GKJI 1ZM9A 1I94E 4OZEA 4AQYI 1FI4A 4DR1I 3CWVA 3D4JA 2PNZB 5C0XC 4GKJE 2IERA 2NN6D 3GMEA 2BA1D 4LF9I 2C39B 4DR2I 2F1DA 4BA1A 4AQYE 1PIEA 5K36E 3B82A 4DR1E 1S4EA 2A2DA 4LF9E 4DR2E 4DV5E 1KKHA 4JG4A 4YY3I 3DD6A 1N32I 2CZ9A 2ZBKB 1UEKA 4DU8A 3HULA 4DUYI 4YY3E 4PRXA 3L7ZA 3WU3A 2V2ZA 2NN6C 2BA1G 4MU1A 5C0XA 4IZKA 2Z5CA 4LF6I 1H7SA 3U1YA 4DUYE 4LF5I 4NXMI 4PU9A 4ZVIA 5A2QC 1HR0E 4OX9I 1B63A 4LF6E 2WW4A 1KVKA 4LF5E 4NXME 3P3EA 3B8HA 2V8PA 4JV5I 3P3GA 2GO3A 3WU4A 4FW9A 4LCHA 1A6FA 3GONA 3PS3A 3K1JA 2PO1A 1NHIA 2NN6A 4R1FA 2C38A 1EA6A 4JV5E 2BR2A 4DPYA 1RHYA 3PS2A 3ZKDA 4USMA 4Z7YA 1N33I 1XNQI 3QT7A 1H74A 1KTVA 5FLXQ 3M7NG 5DRRA 1Z5AA 4KHPI 1N33E 2O3ZA 1YHCA 1XNQE 1USVA 4X64I 1FKAE 4AIDA 4JI5I 3GCMA 4KHPE 2E5LI 4DV3I 4LFAI 4RPFA 1FNMA 2O1VA 4URLA 4LF8E 4X64E 4AM3A 1QZRA 4DV4E 5FWKA 1H7UA 4JI5E 3ZZUA 5JEAD 3T1HE 4GQUA 2ZM6I 1H72C 4ISAA 2E5LE 1Z5CA 2HFUA 2JEAB 4IFDB 4DR4I 1Z0TA 1PKPA 4X65I 2ZM6E 4LCFA 5DNXA 1D6TA 5IWAI 1MX0A 4X66I 4DPTA 4JI2I 2UU9I 2LJPA 4X65E 4HACA 4DV6I 4DV0I 1YH8A 1XMQI 1UDSA 4YHHI 2DEIA 2CVEA 5JEAC 5FLXC 4X66E 4JI2E 2UU9E 2A2CA 3CDIA 4LFBI 4WUDA 3J81Q 1ELOA 4DV6E 1HNXI 4DV0E 1XHKA 1XMQE 4IFDF 4BA1B 1Z0GA 2IOPA 4P7AA 4MU4A 5EKWA 1HNXE
chains in the Genus database with same CATH topology
4OO1F 2PO0B 4OO1D 2BA0D 2BA1G 3H1CA 2JE6B 2PO0A 5K36B 3M85D 2NN6E 5JEAA 3U1KA 3L7ZB 5C0XB 4AIMA 4IFDC 2PO2A 4NBQA 1OYPA 2PO1A 2NN6A 2C38A 4OO1C 2BA0G 2BR2A 5JEAB 1OYSA 4IFDE 1E3PA 3M85G 1R6MA 3M7NG 5K36F 2PO2B 4OO1E 5K36D 2PO1B 2WNRA 2C37A 2NN6B 2C38B 1UDOA 2JEAA 5C0XD 2BR2B 4IFDA 2JEBB 2WP8A 4BA2A 4AIDA 3GCMA 2PNZA 4OO1A 1E3HA 1UDNA 3CDJA 1OYRA 2JEBA 4AM3A 2C39A 5JEAF 5JEAD 2WNRB 1UDQA 2C37B 3GLLA 2JEAB 4IFDB 5K36C 2WP8B 4BA2B 3KRNA 5C0XF 2NN6F 5C0XC 2PNZB 4OO1B 2NN6D 3GMEA 2BA1D 2C39B 4BA1A 3HKMA 5K36E 1UDSA 5C0XE 5JEAC 3M7ND 1R6LA 3DD6A 3CDIA 5JEAE 2JE6A 4IFDF 5K36A 4BA1B 3B4TA 4IFDD 3L7ZA 5C0XA 2NN6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 F;  2PO0 B;  4OO1 D;  2BA0 D;  2BA1 G;  3H1C A;  2JE6 B;  2PO0 A;  5K36 B;  3M85 D;  2NN6 E;  5JEA A;  3U1K A;  3L7Z B;  5C0X B;  4AIM A;  4IFD C;  2PO2 A;  4NBQ A;  1OYP A;  2PO1 A;  2NN6 A;  2C38 A;  4OO1 C;  2BA0 G;  2BR2 A;  5JEA B;  1OYS A;  4IFD E;  1E3P A;  3M85 G;  1R6M A;  3M7N G;  5K36 F;  2PO2 B;  4OO1 E;  5K36 D;  2PO1 B;  2WNR A;  2C37 A;  2NN6 B;  2C38 B;  1UDO A;  2JEA A;  5C0X D;  2BR2 B;  4IFD A;  2JEB B;  2WP8 A;  4BA2 A;  4AID A;  3GCM A;  2PNZ A;  4OO1 A;  1E3H A;  1UDN A;  3CDJ A;  1OYR A;  2JEB A;  4AM3 A;  2C39 A;  5JEA F;  5JEA D;  2WNR B;  1UDQ A;  2C37 B;  3GLL A;  2JEA B;  4IFD B;  5K36 C;  2WP8 B;  4BA2 B;  3KRN A;  5C0X F;  2NN6 F;  5C0X C;  2PNZ B;  4OO1 B;  2NN6 D;  3GME A;  2BA1 D;  2C39 B;  4BA1 A;  3HKM A;  5K36 E;  1UDS A;  5C0X E;  5JEA C;  3M7N D;  1R6L A;  3DD6 A;  3CDI A;  5JEA E;  2JE6 A;  4IFD F;  5K36 A;  4BA1 B;  3B4T A;  4IFD D;  3L7Z A;  5C0X A;  2NN6 C; 
#chains in the Genus database with same CATH topology
 4OO1 D;  3P3C A;  2BA0 D;  1BKN A;  2HK3 A;  1Z5B A;  2O1W A;  3H1C A;  2Z5B A;  3PS1 A;  2E1R A;  5JEA A;  3LPS A;  5IT9 C;  2DEJ A;  3L7Z B;  5C0X B;  4AIM A;  4IZK B;  2Z5C B;  3M6A A;  3ZZT A;  1NHH A;  2PO2 A;  5LMN I;  4DR7 I;  3QT5 A;  1N32 E;  4JI0 I;  4OO1 C;  2BA0 G;  4JI7 I;  3JAM Q;  4DR7 E;  2UUC I;  4DR5 I;  5LL6 R;  4IFD E;  2Q2E B;  1E3P A;  4JI0 E;  3HJC A;  1R6M A;  4JI7 E;  3WU6 A;  4LCG A;  1EI1 A;  5K36 D;  4DR5 E;  4OKG A;  2PO1 B;  2NN6 B;  4B3T I;  2C38 B;  4OX9 E;  2BR2 B;  4FN5 A;  3PYE A;  1Z59 A;  2BV3 A;  2WP8 A;  4Z7C A;  4BA2 A;  3Q6M A;  1MG7 A;  3Q6N A;  1VIS A;  4OO1 A;  1E3H A;  4MDT A;  1RR9 A;  1OJ4 A;  4J3D A;  2V34 A;  3J7A M;  4DV7 I;  1MU5 A;  4JI8 I;  5K36 C;  4DXL A;  4IZJ D;  4PRV A;  2HKE A;  3WU5 A;  1FWL A;  3H4L A;  2NN6 F;  1Y6Z A;  4DV7 E;  2GS8 A;  1HK7 A;  4K0K I;  4JI8 E;  3J80 Q;  2AJ4 A;  3ZM7 A;  5DRO A;  2X7I A;  4K0K E;  5C0X E;  2EFG A;  1VI7 A;  4DV1 I;  1R6L A;  4DV3 E;  4LFA E;  1Z0V A;  2JE6 A;  3P76 A;  4P52 A;  5K36 A;  4B3R I;  4MYT A;  4DPU A;  4DV1 E;  2V2V A;  1FWK A;  4HAC B;  4B3M I;  2R42 A;  4DPW A;  1DAR A;  4QNJ A;  4DR4 E;  4LPF A;  1N36 I;  4MYU A;  4HYM A;  1Y4U A;  5ELW A;  4B3M E;  1USU A;  5BR8 I;  1Y4S A;  3M85 D;  2NN6 E;  3J7A G;  3LNU A;  3PRY A;  5IWA E;  1N36 E;  2GO4 A;  4WUC A;  3K85 A;  2CGE A;  5GMD A;  2XEX A;  2VQF I;  4YHH E;  4DR3 I;  4IZJ A;  2Z5E A;  4NBQ A;  4JI1 I;  1OYP A;  4LFB E;  2V2Q A;  1FJG I;  5DRP A;  4IS9 A;  1ZXN A;  2Z5B B;  1N34 I;  4DU7 A;  2VQF E;  4DR3 E;  5A2Q Q;  5JEA B;  1OYS A;  3LTO A;  1B62 A;  2VES A;  4GKK I;  1FJG E;  1N34 E;  3M85 G;  4N3O A;  4WUB A;  4USK A;  1H73 A;  3QT6 A;  2PO2 B;  1ZM3 A;  4JI3 I;  1N0V C;  1ZM2 A;  1Z0E A;  2WNR A;  2GQ0 A;  2C37 A;  1Z0W A;  4GKK E;  1UDO A;  1XXE A;  3F0N A;  4JI6 I;  3B78 A;  4U3B A;  2VF3 A;  4JI3 E;  4HY1 A;  4DV5 I;  1WUU A;  4M1K A;  3NZK A;  1NZ0 A;  4LOM A;  2PNZ A;  3CDJ A;  4JI6 E;  4DPX A;  2C39 A;  2NPF A;  5LMN E;  5JEA F;  2J7K A;  2J65 A;  4FW3 A;  4FW7 A;  5GME A;  3GLL A;  1UDQ A;  3PYF A;  4XTJ A;  5L3J A;  3PYD A;  1K47 A;  4JI4 I;  2IOQ A;  1Z0B A;  1XNR I;  2WP8 B;  4BA2 B;  3J81 C;  4DUZ I;  2UUC E;  3KRN A;  4LF7 I;  4UTG A;  5C0X F;  1XMO I;  4OO1 B;  2X36 A;  2UUA I;  1HR0 I;  4JI4 E;  2O1U A;  1XNR E;  1N0U A;  4DR6 I;  2O1T A;  4DUZ E;  3HKM A;  4LF7 E;  3V2U C;  4ED4 A;  2R3V A;  4FWH A;  5DNL A;  4NXN I;  4B3T E;  1XMO E;  2UUA E;  1Y5Y A;  4LFC I;  4DR6 E;  3M7N D;  1NHJ A;  2ZIT A;  4MU3 A;  4NXN E;  2CG9 A;  4MQY A;  1HNW I;  4FW5 A;  4UT4 A;  4LFC E;  2UUB I;  1U2R A;  3B4T A;  4IFD D;  2PNL A;  1Y60 A;  5JEA E;  4KQV A;  4OO1 F;  4FWG A;  4FWD A;  1RRE A;  2PO0 B;  1HNW E;  4B3S I;  2UUB E;  2HHH I;  3JAM C;  2JE6 B;  2PO0 A;  4HXZ A;  5K36 B;  4B3S E;  2UXB I;  1KIJ A;  3K17 A;  3U1K A;  5LMU I;  1P42 A;  2HHH E;  2IES A;  4LF4 I;  1S16 A;  2UXC I;  3T1Y I;  2HKJ A;  2UXD I;  4LF8 I;  3ZKB A;  4IFD C;  1HNZ I;  1J5E I;  1PVG A;  4DV4 I;  2UXB E;  4I3H A;  5LMU E;  4U3D A;  3T1H I;  4LF4 E;  2UXC E;  5DRQ A;  3T1Y E;  3OTO I;  2UXD E;  1IBM I;  2PNM A;  4B3R E;  2AE8 A;  1HNZ E;  1J5E E;  1Z0C A;  4DV2 I;  5IT9 Q;  3OTO E;  1IBM E;  1ZM4 A;  2F4V I;  4IZJ B;  5K36 F;  2JT2 A;  5EL9 A;  1IBL I;  4OO1 E;  4JYA I;  4DV2 E;  4X62 I;  3UHM A;  2JEA A;  2VQE I;  5BR8 E;  2F4V E;  2BM1 A;  5C0X D;  4IFD A;  2JEB B;  1ZXM A;  1IBK I;  1IBL E;  4EMD A;  4JYA E;  3V5R A;  2OI2 A;  4X62 E;  4FW6 A;  3PYG A;  2BM0 A;  3ZZ0 A;  4FW4 A;  3J80 C;  2VQE E;  1UDN A;  1I94 I;  3QT8 A;  1OYR A;  2JEB A;  4QNK A;  1IBK E;  4JI1 E;  3Q1Q A;  2HK2 A;  2HFS A;  3P06 A;  2WNR B;  2C37 B;  4MU0 A;  4GKJ I;  1ZM9 A;  1I94 E;  4OZE A;  4AQY I;  1FI4 A;  4DR1 I;  3CWV A;  3D4J A;  2PNZ B;  5C0X C;  4GKJ E;  2IER A;  2NN6 D;  3GME A;  2BA1 D;  4LF9 I;  2C39 B;  4DR2 I;  2F1D A;  4BA1 A;  4AQY E;  1PIE A;  5K36 E;  3B82 A;  4DR1 E;  1S4E A;  2A2D A;  4LF9 E;  4DR2 E;  4DV5 E;  1KKH A;  4JG4 A;  4YY3 I;  3DD6 A;  1N32 I;  2CZ9 A;  2ZBK B;  1UEK A;  4DU8 A;  3HUL A;  4DUY I;  4YY3 E;  4PRX A;  3L7Z A;  3WU3 A;  2V2Z A;  2NN6 C;  2BA1 G;  4MU1 A;  5C0X A;  4IZK A;  2Z5C A;  4LF6 I;  1H7S A;  3U1Y A;  4DUY E;  4LF5 I;  4NXM I;  4PU9 A;  4ZVI A;  5A2Q C;  1HR0 E;  4OX9 I;  1B63 A;  4LF6 E;  2WW4 A;  1KVK A;  4LF5 E;  4NXM E;  3P3E A;  3B8H A;  2V8P A;  4JV5 I;  3P3G A;  2GO3 A;  3WU4 A;  4FW9 A;  4LCH A;  1A6F A;  3GON A;  3PS3 A;  3K1J A;  2PO1 A;  1NHI A;  2NN6 A;  4R1F A;  2C38 A;  1EA6 A;  4JV5 E;  2BR2 A;  4DPY A;  1RHY A;  3PS2 A;  3ZKD A;  4USM A;  4Z7Y A;  1N33 I;  1XNQ I;  3QT7 A;  1H74 A;  1KTV A;  5FLX Q;  3M7N G;  5DRR A;  1Z5A A;  4KHP I;  1N33 E;  2O3Z A;  1YHC A;  1XNQ E;  1USV A;  4X64 I;  1FKA E;  4AID A;  4JI5 I;  3GCM A;  4KHP E;  2E5L I;  4DV3 I;  4LFA I;  4RPF A;  1FNM A;  2O1V A;  4URL A;  4LF8 E;  4X64 E;  4AM3 A;  1QZR A;  4DV4 E;  5FWK A;  1H7U A;  4JI5 E;  3ZZU A;  5JEA D;  3T1H E;  4GQU A;  2ZM6 I;  1H72 C;  4ISA A;  2E5L E;  1Z5C A;  2HFU A;  2JEA B;  4IFD B;  4DR4 I;  1Z0T A;  1PKP A;  4X65 I;  2ZM6 E;  4LCF A;  5DNX A;  1D6T A;  5IWA I;  1MX0 A;  4X66 I;  4DPT A;  4JI2 I;  2UU9 I;  2LJP A;  4X65 E;  4HAC A;  4DV6 I;  4DV0 I;  1YH8 A;  1XMQ I;  1UDS A;  4YHH I;  2DEI A;  2CVE A;  5JEA C;  5FLX C;  4X66 E;  4JI2 E;  2UU9 E;  2A2C A;  3CDI A;  4LFB I;  4WUD A;  3J81 Q;  1ELO A;  4DV6 E;  1HNX I;  4DV0 E;  1XHK A;  1XMQ E;  4IFD F;  4BA1 B;  1Z0G A;  2IOP A;  4P7A A;  4MU4 A;  5EKW A;  1HNX E; 
#chains in the Genus database with same CATH homology
 4OO1 F;  2PO0 B;  4OO1 D;  2BA0 D;  2BA1 G;  3H1C A;  2JE6 B;  2PO0 A;  5K36 B;  3M85 D;  2NN6 E;  5JEA A;  3U1K A;  3L7Z B;  5C0X B;  4AIM A;  4IFD C;  2PO2 A;  4NBQ A;  1OYP A;  2PO1 A;  2NN6 A;  2C38 A;  4OO1 C;  2BA0 G;  2BR2 A;  5JEA B;  1OYS A;  4IFD E;  1E3P A;  3M85 G;  1R6M A;  3M7N G;  5K36 F;  2PO2 B;  4OO1 E;  5K36 D;  2PO1 B;  2WNR A;  2C37 A;  2NN6 B;  2C38 B;  1UDO A;  2JEA A;  5C0X D;  2BR2 B;  4IFD A;  2JEB B;  2WP8 A;  4BA2 A;  4AID A;  3GCM A;  2PNZ A;  4OO1 A;  1E3H A;  1UDN A;  3CDJ A;  1OYR A;  2JEB A;  4AM3 A;  2C39 A;  5JEA F;  5JEA D;  2WNR B;  1UDQ A;  2C37 B;  3GLL A;  2JEA B;  4IFD B;  5K36 C;  2WP8 B;  4BA2 B;  3KRN A;  5C0X F;  2NN6 F;  5C0X C;  2PNZ B;  4OO1 B;  2NN6 D;  3GME A;  2BA1 D;  2C39 B;  4BA1 A;  3HKM A;  5K36 E;  1UDS A;  5C0X E;  5JEA C;  3M7N D;  1R6L A;  3DD6 A;  3CDI A;  5JEA E;  2JE6 A;  4IFD F;  5K36 A;  4BA1 B;  3B4T A;  4IFD D;  3L7Z A;  5C0X A;  2NN6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...