4B3RI

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3rI00
4B3TI 1H7UA 3QT8A 4JI3I 4LF7E 4DV2E 4LFCE 4HXZA 3LTOA 5LMUI 4DR6E 4DV6I 4X62I 2V2QA 4LF5I 3LNUA 4LF7I 4DR7E 4DV2I 4LFCI 3LPSA 4DXLA 1Z0BA 4OX9E 1MX0A 4DR6I 1N0VC 2HK3A 4GKKE 4UTGA 4K0KI 4GKJE 2HFUA 4ZVIA 1RREA 5LMNE 4DR7I 4DPUA 1N32E 1Z59A 2E5LE 4GKJI 1J5EI 1PIEA 5LMNI 3OTOE 3D4JA 2UXDE 4DR5E 2E5LI 4PRVA 2VF3A 1DARA 4P52A 4DUZE 3OTOI 4JV5E 4YY3I 1HR0E 2OI2A 2EFGA 4JI8E 4DV3E 1HNXE 2V2ZA 4P7AA 4LF8I 2BV3A 1QZRA 3WU5A 4DV1E 4JV5I 3F0NA 4B3SE 3WU6A 4JI8I 1EI1A 4DV3I 4FW9A 1HNXI 2VQFI 5BR8E 3B82A 2ZITA 4DV1I 3PYEA 3H4LA 4DR2E 5BR8I 2XEXA 1B63A 2HHHE 1ZM9A 3B8HA 4B3MI 4JI0E 4DR2I 1ZM3A 1FWKA 2HHHI 4LF9I 3J81C 2V2VA 2UUAE 2V34A 1H7SA 4UT4A 2BM0A 4JI0I 4USMA 2Q2EB 1Z0EA 4Z7CA 4DV4E 1Z5CA 1VISA 4XTJA 4DPTA 2HFSA 1ZM4A 4AQYE 4KHPE 1FKAE 5LMUE 4DV4I 3J81Q 4X62E 4WUCA 4YHHI 1PKPA 4LFBE 2UUBE 1BKNA 4AQYI 4DR3I 4KHPI 4WUBA 4X66E 2J7KA 4K0KE 3V2UC 5IWAI 4LFBI 1KVKA 2UUBI 4JI6E 2WW4A 4X66I 4KQVA 1J5EE 1NZ0A 1Z5BA 4MYTA 4JI6I 4DPWA 3QT6A 1ELOA 4ED4A 4LFAE 4DU8A 1IBMI 4FWGA 2UU9I 1XHKA 5FLXC 4DV0E 5IT9C 1N0UA 1NHIA 4YY3E 1H72C 4PRXA 1HNZI 4LFAI 1IBKE 4DV0I 4LF8E 4EMDA 5LL6R 1FNMA 3WU4A 3M6AA 2F4VE 1FWLA 3QT5A 2VQFE 1IBKI 5FLXQ 1RR9A 5IT9Q 4LF4E 3J7AG 1I94E 1WUUA 2X36A 2F4VI 3ZZUA 2AJ4A 4X64E 4LF4I 4JYAI 1I94I 1N34I 4B3ME 3QT7A 4X64I 4LF9E 4JI4I 1HNWE 2HKEA 2ZM6E 1MU5A 1KTVA 2BM1A 2VQEE 3ZZ0A 1N33E 1HNWI 4DV5E 2ZM6I 3ZM7A 4NXME 2CZ9A 3K17A 2DEJA 1U2RA 2VQEI 3ZZTA 4YHHE 1N33I 2R3VA 4DV5I 1Z0VA 4DR3E 4HY1A 1KKHA 4NXMI 2UUCE 1ZXMA 2UXBE 5IWAE 1Z0GA 5GMEA 1A6FA 2GS8A 4DV7E 4HACB 1H74A 4LF6E 1FI4A 3PYGA 2UUCI 2UXBI 1Z0WA 1XNQE 3CWVA 4DV7I 4LF6I 3ZKBA 1NHHA 4FWDA 1IBME 2UU9E 1D6TA 2A2CA 3V5RA 3JAMC 1XNQI 4DU7A 4JI5I 1UEKA 1B62A 1HNZE 3T1YE 4X65E 1OJ4A 1H73A 3PYFA 4URLA 3T1HE 4Z7YA 3B78A 2NPFA 3GONA 3T1YI 5L3JA 4JI1E 4X65I 3J7AM 3JAMQ 4HYMA 1XMOE 4OX9I 3T1HI 4DPYA 4USKA 4GKKI 1MG7A 4I3HA 4JI1I 5A2QC 1IBLE 4R1FA 5GMDA 2A2DA 4M1KA 4HACA 4PU9A 1XMOI 4FN5A 1N32I 2E1RA 4JYAE 4DR4E 1FJGE 1N34E 4B3RE 4DR1E 4MYUA 2DEIA 1IBLI 1XMQE 1S4EA 2UXDI 1XNRE 1N36E 4JI4E 4DR4I 3PYDA 1FJGI 4DR5I 4B3RI 4DR1I 5A2QQ 4DUZI 4JI2E 1XMQI 1XNRI 1N36I 4JI7E 1HR0I 3WU3A 1Z5AA 4WUDA 3J80C 4NXNE 4JI2I 1NHJA 2X7IA 2ZBKB 4JG4A 4B3SI 4JI7I 3Q1QA 2LJPA 3HULA 1S16A 1ZXNA 2UXCE 4NXNI 1Z0CA 1ZM2A 1PVGA 3J80Q 2UXCI 2HK2A 1Z0TA 3ZKDA 1K47A 1KIJA 4DPXA 2V8PA 4DUYE 3K1JA 4RPFA 2UUAI 4B3TE 4JI3E 2HKJA 4FWHA 4DUYI 4JI5E 2R42A 1EA6A 4DV6E 4LF5E
chains in the Genus database with same CATH superfamily
3CDJA 4B3TI 1H7UA 3QT8A 2WNRB 4OO1C 2JEBB 4JI3I 4LF7E 4DV2E 4LFCE 4HXZA 3LTOA 4IZKA 4MU0A 5LMUI 4DR6E 2O1UA 4DV6I 4X62I 3PS1A 2V2QA 4LF5I 4U3BA 3LNUA 5JEAA 3L7ZA 4LF7I 4DR7E 4DV2I 4LFCI 2GO3A 3LPSA 1YH8A 4DXLA 1Z0BA 4OX9E 1MX0A 4DR6I 2NN6A 4IFDB 4BA1A 1N0VC 2VESA 2HK3A 2C39A 4UTGA 4GKKE 4K0KI 4GKJE 4IS9A 4FW4A 5ELWA 2HFUA 4ZVIA 1RREA 5LMNE 4DR7I 2GO4A 3P76A 4DPUA 4IFDE 4LCFA 2JE6A 1N32E 1Z59A 2PNLA 5JEAC 2E5LE 4GKJI 1J5EI 1PIEA 5LMNI 3OTOE 3D4JA 2NN6C 2UXDE 2PO1A 3GMEA 1UDNA 4DR5E 2Z5BA 2E5LI 4PRVA 2VF3A 1DARA 4P52A 4DUZE 3PRYA 1Y6ZA 4FW7A 3OTOI 4JV5E 4IZJA 4AIMA 2BA0D 4YY3I 1HR0E 2OI2A 2EFGA 4JI8E 2WNRA 4DV3E 1HNXE 2V2ZA 4P7AA 4LF8I 2BV3A 4LCGA 1QZRA 3WU5A 3P3EA 4DV1E 4JV5I 5K36B 2BR2A 3F0NA 5C0XD 3M85G 4B3SE 3WU6A 4JI8I 1EI1A 1USVA 4FW9A 4DV3I 1HNXI 5K36E 2VQFI 5BR8E 3B82A 2ZITA 4DV1I 2PNMA 3PYEA 4IFDA 3B4TA 3H4LA 4DR2E 5BR8I 2XEXA 4N3OA 1B63A 2HHHE 2C38A 1ZM9A 3B8HA 4B3MI 4JI0E 4DR2I 1ZM3A 5JEAF 1FWKA 1R6MA 2HHHI 4LF9I 3J81C 2V2VA 2UUAE 2V34A 1H7SA 4UT4A 2NN6F 2BM0A 3M7ND 4JI0I 4USMA 2Q2EB 1Z0EA 4Z7CA 4OO1D 4DV4E 4MU1A 3K85A 3PS2A 1OYRA 1Z5CA 1VISA 4XTJA 4DPTA 3H1CA 2HFSA 4ISAA 1ZM4A 4AQYE 4KHPE 5K36A 1Y60A 1FKAE 5LMUE 4DV4I 3J81Q 4X62E 4WUCA 4YHHI 1PKPA 4LFBE 2CVEA 2UUBE 1BKNA 4AQYI 4DR3I 4KHPI 2JT2A 1UDQA 2PO2B 4WUBA 4X66E 2J7KA 4K0KE 3V2UC 5IWAI 5JEAD 5K36C 4LFBI 1KVKA 2UUBI 4JI6E 2BA1D 3U1YA 2WW4A 4X66I 3P3CA 4KQVA 1J5EE 1NZ0A 1Z5BA 1R6LA 1OYPA 3KRNA 4FW5A 4MYTA 2Z5CA 4JI6I 3Q6NA 4DPWA 5C0XB 3QT6A 1ELOA 4ED4A 4LFAE 3P06A 1RHYA 4IFDF 4DU8A 1IBMI 4FWGA 2UU9I 1XHKA 5FLXC 1HK7A 5C0XE 4DV0E 5IT9C 2IOPA 1N0UA 1NHIA 4YY3E 1H72C 4PRXA 4GQUA 1HNZI 1E3HA 4LFAI 2WP8A 1IBKE 4DV0I 4LF8E 4AIDA 4IZJD 3UHMA 3HJCA 4EMDA 5LL6R 1FNMA 2C37B 3WU4A 3M6AA 4FW3A 2F4VE 1FWLA 3DD6A 2JEBA 3QT5A 2VQFE 1IBKI 5FLXQ 1RR9A 5IT9Q 4BA2B 2O1WA 4LF4E 3J7AG 1Y5YA 1I94E 1WUUA 2X36A 2F4VI 3ZZUA 4OO1B 2AJ4A 4X64E 1VI7A 4LF4I 5K36F 4JYAI 4J3DA 1I94I 1N34I 4B3ME 3QT7A 4OO1E 2PO0B 4MQYA 4X64I 4LF9E 2F1DA 5C0XA 4JI4I 3U1KA 2IERA 1HNWE 2HKEA 3P3GA 2ZM6E 1MU5A 1KTVA 4IZKB 4U3DA 2BM1A 4IFDC 2VQEE 4AM3A 3ZZ0A 1N33E 5DNLA 1HNWI 5JEAB 3L7ZB 4DV5E 2ZM6I 5C0XC 3ZM7A 4NXME 2CZ9A 3K17A 2DEJA 1U2RA 4LPFA 2VQEI 3ZZTA 4LCHA 4YHHE 1N33I 5DRRA 1YHCA 2Z5EA 2R3VA 4DV5I 5K36D 1Z0VA 4DR3E 4HY1A 3CDIA 1KKHA 4NXMI 5EL9A 2JE6B 2UUCE 1ZXMA 2UXBE 1UDSA 5IWAE 1Z0GA 5GMEA 1A6FA 4OO1A 2GS8A 4DV7E 4HACB 1H74A 4LF6E 3M85D 1FI4A 3PYGA 2BA0G 2UUCI 4QNKA 4LOMA 1USUA 2PO0A 2UXBI 1UDOA 1Z0WA 1XNQE 3CWVA 4DV7I 4LF6I 3ZKBA 4MDTA 1NHHA 2NN6D 2IOQA 4FWDA 1IBME 2UU9E 4MU3A 1D6TA 2A2CA 3V5RA 3JAMC 1XNQI 4DU7A 4JI5I 2BR2B 1UEKA 1B62A 2CGEA 5DNXA 3GLLA 1HNZE 3T1YE 2O3ZA 4OKGA 4X65E 4FW6A 1OJ4A 1H73A 3PYFA 4URLA 3NZKA 3T1HE 4Z7YA 3B78A 5C0XF 2NPFA 3GONA 3PS3A 3T1YI 5L3JA 4JI1E 4X65I 3J7AM 2PNZB 3JAMQ 4HYMA 1XMOE 4OX9I 2C38B 3T1HI 4DPYA 1P42A 5FWKA 4USKA 2O1TA 4GKKI 1Y4UA 1MG7A 4I3HA 4JI1I 2IESA 5A2QC 1IBLE 3M7NG 4R1FA 5GMDA 2A2DA 4M1KA 4HACA 4PU9A 1XMOI 4FN5A 4MU4A 1N32I 2E1RA 4JYAE 4DR4E 2PO2A 1FJGE 1N34E 4B3RE 4DR1E 4MYUA 2DEIA 1IBLI 4NBQA 1XMQE 1S4EA 2UXDI 1XNRE 1N36E 4JI4E 4IFDD 4DR4I 3PYDA 2JEAB 1FJGI 4DR5I 4B3RI 4DR1I 5A2QQ 4DUZI 4JI2E 5DROA 3HKMA 4OZEA 4OO1F 1XMQI 2O1VA 1XNRI 1N36I 4JI7E 3GCMA 1HR0I 3WU3A 1Z5AA 4WUDA 4QNJA 3J80C 4NXNE 4JI2I 1NHJA 2X7IA 2BA1G 1OYSA 2ZBKB 4JG4A 4B3SI 4JI7I 3Q1QA 2LJPA 3HULA 1S16A 1ZXNA 2UXCE 1XXEA 2GQ0A 2PNZA 4NXNI 1Z0CA 1ZM2A 1E3PA 3Q6MA 1Y4SA 1PVGA 2C37A 5DRQA 2NN6B 4BA1B 5JEAE 2C39B 3J80Q 2UXCI 2HK2A 1Z0TA 2Z5CB 2NN6E 4BA2A 5DRPA 5EKWA 3ZKDA 1K47A 1KIJA 4DPXA 2CG9A 2V8PA 4DUYE 3K1JA 4RPFA 2JEAA 2PO1B 2UUAI 2WP8B 4B3TE 2Z5BB 4JI3E 2HKJA 4FWHA 2J65A 4DUYI 4JI5E 2R42A 4IZJB 1EA6A 4DV6E 2AE8A 4LF5E
chains in the Genus database with same CATH topology
4B3TI 1H7UA 3QT8A 4JI3I 4LF7E 4DV2E 4LFCE 4HXZA 3LTOA 4IZKA 5LMUI 4DR6E 2O1UA 4DV6I 4X62I 2V2QA 4LF5I 3LNUA 4LF7I 4DR7E 4DV2I 4LFCI 3LPSA 4DXLA 1Z0BA 4OX9E 1MX0A 4DR6I 1N0VC 2HK3A 4GKKE 4UTGA 4K0KI 4GKJE 2HFUA 4ZVIA 1RREA 5LMNE 4DR7I 4DPUA 1N32E 1Z59A 2PNLA 2E5LE 4GKJI 1J5EI 1PIEA 5LMNI 3OTOE 3D4JA 2UXDE 4DR5E 2Z5BA 2E5LI 4PRVA 2VF3A 1DARA 4P52A 4DUZE 3PRYA 1Y6ZA 3OTOI 4JV5E 4IZJA 4YY3I 1HR0E 2OI2A 2EFGA 4JI8E 4DV3E 1HNXE 2V2ZA 4P7AA 4LF8I 2BV3A 1QZRA 3WU5A 4DV1E 4JV5I 3F0NA 4B3SE 3WU6A 4JI8I 1EI1A 1USVA 4FW9A 4DV3I 1HNXI 2VQFI 5BR8E 3B82A 2ZITA 4DV1I 2PNMA 3PYEA 3H4LA 4DR2E 5BR8I 2XEXA 4N3OA 1B63A 2HHHE 1ZM9A 3B8HA 4B3MI 4JI0E 4DR2I 1ZM3A 1FWKA 2HHHI 4LF9I 3J81C 2V2VA 2UUAE 2V34A 1H7SA 4UT4A 2BM0A 4JI0I 4USMA 2Q2EB 1Z0EA 4Z7CA 4DV4E 3K85A 1Z5CA 1VISA 4XTJA 4DPTA 2HFSA 1ZM4A 4AQYE 4KHPE 1FKAE 5LMUE 4DV4I 3J81Q 4X62E 4WUCA 4YHHI 1PKPA 4LFBE 2UUBE 1BKNA 4AQYI 4DR3I 4KHPI 4WUBA 4X66E 2J7KA 4K0KE 3V2UC 5IWAI 4LFBI 1KVKA 2UUBI 4JI6E 2WW4A 4X66I 4KQVA 1J5EE 1NZ0A 1Z5BA 4MYTA 2Z5CA 4JI6I 3Q6NA 4DPWA 3QT6A 1ELOA 4ED4A 4LFAE 3P06A 4DU8A 1IBMI 4FWGA 2UU9I 1XHKA 5FLXC 1HK7A 4DV0E 5IT9C 2IOPA 1N0UA 1NHIA 4YY3E 1H72C 4PRXA 1HNZI 4LFAI 1IBKE 4DV0I 4LF8E 4IZJD 3HJCA 4EMDA 5LL6R 1FNMA 3WU4A 3M6AA 2F4VE 1FWLA 3QT5A 2VQFE 1IBKI 5FLXQ 1RR9A 5IT9Q 2O1WA 4LF4E 3J7AG 1I94E 1WUUA 2X36A 2F4VI 3ZZUA 2AJ4A 4X64E 4LF4I 4JYAI 1I94I 1N34I 4B3ME 3QT7A 4X64I 4LF9E 4JI4I 1HNWE 2HKEA 2ZM6E 1MU5A 1KTVA 4IZKB 2BM1A 2VQEE 3ZZ0A 1N33E 1HNWI 4DV5E 2ZM6I 3ZM7A 4NXME 2CZ9A 3K17A 2DEJA 1U2RA 2VQEI 3ZZTA 4YHHE 1N33I 2Z5EA 2R3VA 4DV5I 1Z0VA 4DR3E 4HY1A 1KKHA 4NXMI 2UUCE 1ZXMA 2UXBE 5IWAE 1Z0GA 5GMEA 1A6FA 2GS8A 4DV7E 4HACB 1H74A 4LF6E 1FI4A 3PYGA 2UUCI 1USUA 2UXBI 1Z0WA 1XNQE 3CWVA 4DV7I 4LF6I 3ZKBA 1NHHA 2IOQA 4FWDA 1IBME 2UU9E 1D6TA 2A2CA 3V5RA 3JAMC 1XNQI 4DU7A 4JI5I 2CGEA 1UEKA 1B62A 1HNZE 3T1YE 4X65E 1OJ4A 1H73A 3PYFA 4URLA 3T1HE 4Z7YA 3B78A 2NPFA 3GONA 3T1YI 5L3JA 4JI1E 4X65I 3J7AM 3JAMQ 4HYMA 1XMOE 4OX9I 3T1HI 4DPYA 5FWKA 4USKA 2O1TA 4GKKI 1Y4UA 1MG7A 4I3HA 4JI1I 5A2QC 1IBLE 4R1FA 5GMDA 2A2DA 4M1KA 4HACA 4PU9A 1XMOI 4FN5A 1N32I 2E1RA 4JYAE 4DR4E 1FJGE 1N34E 4B3RE 4DR1E 4MYUA 2DEIA 1IBLI 1XMQE 1S4EA 2UXDI 1XNRE 1N36E 4JI4E 4DR4I 3PYDA 1FJGI 4DR5I 4B3RI 4DR1I 5A2QQ 4DUZI 4JI2E 1XMQI 2O1VA 1XNRI 1N36I 4JI7E 1HR0I 3WU3A 1Z5AA 4WUDA 3J80C 4NXNE 4JI2I 1NHJA 2X7IA 2ZBKB 4JG4A 4B3SI 4JI7I 3Q1QA 2LJPA 3HULA 1S16A 1ZXNA 2UXCE 2GQ0A 4NXNI 1Z0CA 1ZM2A 3Q6MA 1Y4SA 1PVGA 3J80Q 2UXCI 2HK2A 1Z0TA 2Z5CB 3ZKDA 1K47A 1KIJA 4DPXA 2CG9A 2V8PA 4DUYE 3K1JA 4RPFA 2UUAI 4B3TE 2Z5BB 4JI3E 2HKJA 4FWHA 4DUYI 4JI5E 2R42A 4IZJB 1EA6A 4DV6E 4LF5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T I;  1H7U A;  3QT8 A;  4JI3 I;  4LF7 E;  4DV2 E;  4LFC E;  4HXZ A;  3LTO A;  5LMU I;  4DR6 E;  4DV6 I;  4X62 I;  2V2Q A;  4LF5 I;  3LNU A;  4LF7 I;  4DR7 E;  4DV2 I;  4LFC I;  3LPS A;  4DXL A;  1Z0B A;  4OX9 E;  1MX0 A;  4DR6 I;  1N0V C;  2HK3 A;  4GKK E;  4UTG A;  4K0K I;  4GKJ E;  2HFU A;  4ZVI A;  1RRE A;  5LMN E;  4DR7 I;  4DPU A;  1N32 E;  1Z59 A;  2E5L E;  4GKJ I;  1J5E I;  1PIE A;  5LMN I;  3OTO E;  3D4J A;  2UXD E;  4DR5 E;  2E5L I;  4PRV A;  2VF3 A;  1DAR A;  4P52 A;  4DUZ E;  3OTO I;  4JV5 E;  4YY3 I;  1HR0 E;  2OI2 A;  2EFG A;  4JI8 E;  4DV3 E;  1HNX E;  2V2Z A;  4P7A A;  4LF8 I;  2BV3 A;  1QZR A;  3WU5 A;  4DV1 E;  4JV5 I;  3F0N A;  4B3S E;  3WU6 A;  4JI8 I;  1EI1 A;  4DV3 I;  4FW9 A;  1HNX I;  2VQF I;  5BR8 E;  3B82 A;  2ZIT A;  4DV1 I;  3PYE A;  3H4L A;  4DR2 E;  5BR8 I;  2XEX A;  1B63 A;  2HHH E;  1ZM9 A;  3B8H A;  4B3M I;  4JI0 E;  4DR2 I;  1ZM3 A;  1FWK A;  2HHH I;  4LF9 I;  3J81 C;  2V2V A;  2UUA E;  2V34 A;  1H7S A;  4UT4 A;  2BM0 A;  4JI0 I;  4USM A;  2Q2E B;  1Z0E A;  4Z7C A;  4DV4 E;  1Z5C A;  1VIS A;  4XTJ A;  4DPT A;  2HFS A;  1ZM4 A;  4AQY E;  4KHP E;  1FKA E;  5LMU E;  4DV4 I;  3J81 Q;  4X62 E;  4WUC A;  4YHH I;  1PKP A;  4LFB E;  2UUB E;  1BKN A;  4AQY I;  4DR3 I;  4KHP I;  4WUB A;  4X66 E;  2J7K A;  4K0K E;  3V2U C;  5IWA I;  4LFB I;  1KVK A;  2UUB I;  4JI6 E;  2WW4 A;  4X66 I;  4KQV A;  1J5E E;  1NZ0 A;  1Z5B A;  4MYT A;  4JI6 I;  4DPW A;  3QT6 A;  1ELO A;  4ED4 A;  4LFA E;  4DU8 A;  1IBM I;  4FWG A;  2UU9 I;  1XHK A;  5FLX C;  4DV0 E;  5IT9 C;  1N0U A;  1NHI A;  4YY3 E;  1H72 C;  4PRX A;  1HNZ I;  4LFA I;  1IBK E;  4DV0 I;  4LF8 E;  4EMD A;  5LL6 R;  1FNM A;  3WU4 A;  3M6A A;  2F4V E;  1FWL A;  3QT5 A;  2VQF E;  1IBK I;  5FLX Q;  1RR9 A;  5IT9 Q;  4LF4 E;  3J7A G;  1I94 E;  1WUU A;  2X36 A;  2F4V I;  3ZZU A;  2AJ4 A;  4X64 E;  4LF4 I;  4JYA I;  1I94 I;  1N34 I;  4B3M E;  3QT7 A;  4X64 I;  4LF9 E;  4JI4 I;  1HNW E;  2HKE A;  2ZM6 E;  1MU5 A;  1KTV A;  2BM1 A;  2VQE E;  3ZZ0 A;  1N33 E;  1HNW I;  4DV5 E;  2ZM6 I;  3ZM7 A;  4NXM E;  2CZ9 A;  3K17 A;  2DEJ A;  1U2R A;  2VQE I;  3ZZT A;  4YHH E;  1N33 I;  2R3V A;  4DV5 I;  1Z0V A;  4DR3 E;  4HY1 A;  1KKH A;  4NXM I;  2UUC E;  1ZXM A;  2UXB E;  5IWA E;  1Z0G A;  5GME A;  1A6F A;  2GS8 A;  4DV7 E;  4HAC B;  1H74 A;  4LF6 E;  1FI4 A;  3PYG A;  2UUC I;  2UXB I;  1Z0W A;  1XNQ E;  3CWV A;  4DV7 I;  4LF6 I;  3ZKB A;  1NHH A;  4FWD A;  1IBM E;  2UU9 E;  1D6T A;  2A2C A;  3V5R A;  3JAM C;  1XNQ I;  4DU7 A;  4JI5 I;  1UEK A;  1B62 A;  1HNZ E;  3T1Y E;  4X65 E;  1OJ4 A;  1H73 A;  3PYF A;  4URL A;  3T1H E;  4Z7Y A;  3B78 A;  2NPF A;  3GON A;  3T1Y I;  5L3J A;  4JI1 E;  4X65 I;  3J7A M;  3JAM Q;  4HYM A;  1XMO E;  4OX9 I;  3T1H I;  4DPY A;  4USK A;  4GKK I;  1MG7 A;  4I3H A;  4JI1 I;  5A2Q C;  1IBL E;  4R1F A;  5GMD A;  2A2D A;  4M1K A;  4HAC A;  4PU9 A;  1XMO I;  4FN5 A;  1N32 I;  2E1R A;  4JYA E;  4DR4 E;  1FJG E;  1N34 E;  4B3R E;  4DR1 E;  4MYU A;  2DEI A;  1IBL I;  1XMQ E;  1S4E A;  2UXD I;  1XNR E;  1N36 E;  4JI4 E;  4DR4 I;  3PYD A;  1FJG I;  4DR5 I;  4B3R I;  4DR1 I;  5A2Q Q;  4DUZ I;  4JI2 E;  1XMQ I;  1XNR I;  1N36 I;  4JI7 E;  1HR0 I;  3WU3 A;  1Z5A A;  4WUD A;  3J80 C;  4NXN E;  4JI2 I;  1NHJ A;  2X7I A;  2ZBK B;  4JG4 A;  4B3S I;  4JI7 I;  3Q1Q A;  2LJP A;  3HUL A;  1S16 A;  1ZXN A;  2UXC E;  4NXN I;  1Z0C A;  1ZM2 A;  1PVG A;  3J80 Q;  2UXC I;  2HK2 A;  1Z0T A;  3ZKD A;  1K47 A;  1KIJ A;  4DPX A;  2V8P A;  4DUY E;  3K1J A;  4RPF A;  2UUA I;  4B3T E;  4JI3 E;  2HKJ A;  4FWH A;  4DUY I;  4JI5 E;  2R42 A;  1EA6 A;  4DV6 E;  4LF5 E; 
#chains in the Genus database with same CATH topology
 3CDJ A;  4B3T I;  1H7U A;  3QT8 A;  2WNR B;  4OO1 C;  2JEB B;  4JI3 I;  4LF7 E;  4DV2 E;  4LFC E;  4HXZ A;  3LTO A;  4IZK A;  4MU0 A;  5LMU I;  4DR6 E;  2O1U A;  4DV6 I;  4X62 I;  3PS1 A;  2V2Q A;  4LF5 I;  4U3B A;  3LNU A;  5JEA A;  3L7Z A;  4LF7 I;  4DR7 E;  4DV2 I;  4LFC I;  2GO3 A;  3LPS A;  1YH8 A;  4DXL A;  1Z0B A;  4OX9 E;  1MX0 A;  4DR6 I;  2NN6 A;  4IFD B;  4BA1 A;  1N0V C;  2VES A;  2HK3 A;  2C39 A;  4UTG A;  4GKK E;  4K0K I;  4GKJ E;  4IS9 A;  4FW4 A;  5ELW A;  2HFU A;  4ZVI A;  1RRE A;  5LMN E;  4DR7 I;  2GO4 A;  3P76 A;  4DPU A;  4IFD E;  4LCF A;  2JE6 A;  1N32 E;  1Z59 A;  2PNL A;  5JEA C;  2E5L E;  4GKJ I;  1J5E I;  1PIE A;  5LMN I;  3OTO E;  3D4J A;  2NN6 C;  2UXD E;  2PO1 A;  3GME A;  1UDN A;  4DR5 E;  2Z5B A;  2E5L I;  4PRV A;  2VF3 A;  1DAR A;  4P52 A;  4DUZ E;  3PRY A;  1Y6Z A;  4FW7 A;  3OTO I;  4JV5 E;  4IZJ A;  4AIM A;  2BA0 D;  4YY3 I;  1HR0 E;  2OI2 A;  2EFG A;  4JI8 E;  2WNR A;  4DV3 E;  1HNX E;  2V2Z A;  4P7A A;  4LF8 I;  2BV3 A;  4LCG A;  1QZR A;  3WU5 A;  3P3E A;  4DV1 E;  4JV5 I;  5K36 B;  2BR2 A;  3F0N A;  5C0X D;  3M85 G;  4B3S E;  3WU6 A;  4JI8 I;  1EI1 A;  1USV A;  4FW9 A;  4DV3 I;  1HNX I;  5K36 E;  2VQF I;  5BR8 E;  3B82 A;  2ZIT A;  4DV1 I;  2PNM A;  3PYE A;  4IFD A;  3B4T A;  3H4L A;  4DR2 E;  5BR8 I;  2XEX A;  4N3O A;  1B63 A;  2HHH E;  2C38 A;  1ZM9 A;  3B8H A;  4B3M I;  4JI0 E;  4DR2 I;  1ZM3 A;  5JEA F;  1FWK A;  1R6M A;  2HHH I;  4LF9 I;  3J81 C;  2V2V A;  2UUA E;  2V34 A;  1H7S A;  4UT4 A;  2NN6 F;  2BM0 A;  3M7N D;  4JI0 I;  4USM A;  2Q2E B;  1Z0E A;  4Z7C A;  4OO1 D;  4DV4 E;  4MU1 A;  3K85 A;  3PS2 A;  1OYR A;  1Z5C A;  1VIS A;  4XTJ A;  4DPT A;  3H1C A;  2HFS A;  4ISA A;  1ZM4 A;  4AQY E;  4KHP E;  5K36 A;  1Y60 A;  1FKA E;  5LMU E;  4DV4 I;  3J81 Q;  4X62 E;  4WUC A;  4YHH I;  1PKP A;  4LFB E;  2CVE A;  2UUB E;  1BKN A;  4AQY I;  4DR3 I;  4KHP I;  2JT2 A;  1UDQ A;  2PO2 B;  4WUB A;  4X66 E;  2J7K A;  4K0K E;  3V2U C;  5IWA I;  5JEA D;  5K36 C;  4LFB I;  1KVK A;  2UUB I;  4JI6 E;  2BA1 D;  3U1Y A;  2WW4 A;  4X66 I;  3P3C A;  4KQV A;  1J5E E;  1NZ0 A;  1Z5B A;  1R6L A;  1OYP A;  3KRN A;  4FW5 A;  4MYT A;  2Z5C A;  4JI6 I;  3Q6N A;  4DPW A;  5C0X B;  3QT6 A;  1ELO A;  4ED4 A;  4LFA E;  3P06 A;  1RHY A;  4IFD F;  4DU8 A;  1IBM I;  4FWG A;  2UU9 I;  1XHK A;  5FLX C;  1HK7 A;  5C0X E;  4DV0 E;  5IT9 C;  2IOP A;  1N0U A;  1NHI A;  4YY3 E;  1H72 C;  4PRX A;  4GQU A;  1HNZ I;  1E3H A;  4LFA I;  2WP8 A;  1IBK E;  4DV0 I;  4LF8 E;  4AID A;  4IZJ D;  3UHM A;  3HJC A;  4EMD A;  5LL6 R;  1FNM A;  2C37 B;  3WU4 A;  3M6A A;  4FW3 A;  2F4V E;  1FWL A;  3DD6 A;  2JEB A;  3QT5 A;  2VQF E;  1IBK I;  5FLX Q;  1RR9 A;  5IT9 Q;  4BA2 B;  2O1W A;  4LF4 E;  3J7A G;  1Y5Y A;  1I94 E;  1WUU A;  2X36 A;  2F4V I;  3ZZU A;  4OO1 B;  2AJ4 A;  4X64 E;  1VI7 A;  4LF4 I;  5K36 F;  4JYA I;  4J3D A;  1I94 I;  1N34 I;  4B3M E;  3QT7 A;  4OO1 E;  2PO0 B;  4MQY A;  4X64 I;  4LF9 E;  2F1D A;  5C0X A;  4JI4 I;  3U1K A;  2IER A;  1HNW E;  2HKE A;  3P3G A;  2ZM6 E;  1MU5 A;  1KTV A;  4IZK B;  4U3D A;  2BM1 A;  4IFD C;  2VQE E;  4AM3 A;  3ZZ0 A;  1N33 E;  5DNL A;  1HNW I;  5JEA B;  3L7Z B;  4DV5 E;  2ZM6 I;  5C0X C;  3ZM7 A;  4NXM E;  2CZ9 A;  3K17 A;  2DEJ A;  1U2R A;  4LPF A;  2VQE I;  3ZZT A;  4LCH A;  4YHH E;  1N33 I;  5DRR A;  1YHC A;  2Z5E A;  2R3V A;  4DV5 I;  5K36 D;  1Z0V A;  4DR3 E;  4HY1 A;  3CDI A;  1KKH A;  4NXM I;  5EL9 A;  2JE6 B;  2UUC E;  1ZXM A;  2UXB E;  1UDS A;  5IWA E;  1Z0G A;  5GME A;  1A6F A;  4OO1 A;  2GS8 A;  4DV7 E;  4HAC B;  1H74 A;  4LF6 E;  3M85 D;  1FI4 A;  3PYG A;  2BA0 G;  2UUC I;  4QNK A;  4LOM A;  1USU A;  2PO0 A;  2UXB I;  1UDO A;  1Z0W A;  1XNQ E;  3CWV A;  4DV7 I;  4LF6 I;  3ZKB A;  4MDT A;  1NHH A;  2NN6 D;  2IOQ A;  4FWD A;  1IBM E;  2UU9 E;  4MU3 A;  1D6T A;  2A2C A;  3V5R A;  3JAM C;  1XNQ I;  4DU7 A;  4JI5 I;  2BR2 B;  1UEK A;  1B62 A;  2CGE A;  5DNX A;  3GLL A;  1HNZ E;  3T1Y E;  2O3Z A;  4OKG A;  4X65 E;  4FW6 A;  1OJ4 A;  1H73 A;  3PYF A;  4URL A;  3NZK A;  3T1H E;  4Z7Y A;  3B78 A;  5C0X F;  2NPF A;  3GON A;  3PS3 A;  3T1Y I;  5L3J A;  4JI1 E;  4X65 I;  3J7A M;  2PNZ B;  3JAM Q;  4HYM A;  1XMO E;  4OX9 I;  2C38 B;  3T1H I;  4DPY A;  1P42 A;  5FWK A;  4USK A;  2O1T A;  4GKK I;  1Y4U A;  1MG7 A;  4I3H A;  4JI1 I;  2IES A;  5A2Q C;  1IBL E;  3M7N G;  4R1F A;  5GMD A;  2A2D A;  4M1K A;  4HAC A;  4PU9 A;  1XMO I;  4FN5 A;  4MU4 A;  1N32 I;  2E1R A;  4JYA E;  4DR4 E;  2PO2 A;  1FJG E;  1N34 E;  4B3R E;  4DR1 E;  4MYU A;  2DEI A;  1IBL I;  4NBQ A;  1XMQ E;  1S4E A;  2UXD I;  1XNR E;  1N36 E;  4JI4 E;  4IFD D;  4DR4 I;  3PYD A;  2JEA B;  1FJG I;  4DR5 I;  4B3R I;  4DR1 I;  5A2Q Q;  4DUZ I;  4JI2 E;  5DRO A;  3HKM A;  4OZE A;  4OO1 F;  1XMQ I;  2O1V A;  1XNR I;  1N36 I;  4JI7 E;  3GCM A;  1HR0 I;  3WU3 A;  1Z5A A;  4WUD A;  4QNJ A;  3J80 C;  4NXN E;  4JI2 I;  1NHJ A;  2X7I A;  2BA1 G;  1OYS A;  2ZBK B;  4JG4 A;  4B3S I;  4JI7 I;  3Q1Q A;  2LJP A;  3HUL A;  1S16 A;  1ZXN A;  2UXC E;  1XXE A;  2GQ0 A;  2PNZ A;  4NXN I;  1Z0C A;  1ZM2 A;  1E3P A;  3Q6M A;  1Y4S A;  1PVG A;  2C37 A;  5DRQ A;  2NN6 B;  4BA1 B;  5JEA E;  2C39 B;  3J80 Q;  2UXC I;  2HK2 A;  1Z0T A;  2Z5C B;  2NN6 E;  4BA2 A;  5DRP A;  5EKW A;  3ZKD A;  1K47 A;  1KIJ A;  4DPX A;  2CG9 A;  2V8P A;  4DUY E;  3K1J A;  4RPF A;  2JEA A;  2PO1 B;  2UUA I;  2WP8 B;  4B3T E;  2Z5B B;  4JI3 E;  2HKJ A;  4FWH A;  2J65 A;  4DUY I;  4JI5 E;  2R42 A;  4IZJ B;  1EA6 A;  4DV6 E;  2AE8 A;  4LF5 E; 
#chains in the Genus database with same CATH homology
 4B3T I;  1H7U A;  3QT8 A;  4JI3 I;  4LF7 E;  4DV2 E;  4LFC E;  4HXZ A;  3LTO A;  4IZK A;  5LMU I;  4DR6 E;  2O1U A;  4DV6 I;  4X62 I;  2V2Q A;  4LF5 I;  3LNU A;  4LF7 I;  4DR7 E;  4DV2 I;  4LFC I;  3LPS A;  4DXL A;  1Z0B A;  4OX9 E;  1MX0 A;  4DR6 I;  1N0V C;  2HK3 A;  4GKK E;  4UTG A;  4K0K I;  4GKJ E;  2HFU A;  4ZVI A;  1RRE A;  5LMN E;  4DR7 I;  4DPU A;  1N32 E;  1Z59 A;  2PNL A;  2E5L E;  4GKJ I;  1J5E I;  1PIE A;  5LMN I;  3OTO E;  3D4J A;  2UXD E;  4DR5 E;  2Z5B A;  2E5L I;  4PRV A;  2VF3 A;  1DAR A;  4P52 A;  4DUZ E;  3PRY A;  1Y6Z A;  3OTO I;  4JV5 E;  4IZJ A;  4YY3 I;  1HR0 E;  2OI2 A;  2EFG A;  4JI8 E;  4DV3 E;  1HNX E;  2V2Z A;  4P7A A;  4LF8 I;  2BV3 A;  1QZR A;  3WU5 A;  4DV1 E;  4JV5 I;  3F0N A;  4B3S E;  3WU6 A;  4JI8 I;  1EI1 A;  1USV A;  4FW9 A;  4DV3 I;  1HNX I;  2VQF I;  5BR8 E;  3B82 A;  2ZIT A;  4DV1 I;  2PNM A;  3PYE A;  3H4L A;  4DR2 E;  5BR8 I;  2XEX A;  4N3O A;  1B63 A;  2HHH E;  1ZM9 A;  3B8H A;  4B3M I;  4JI0 E;  4DR2 I;  1ZM3 A;  1FWK A;  2HHH I;  4LF9 I;  3J81 C;  2V2V A;  2UUA E;  2V34 A;  1H7S A;  4UT4 A;  2BM0 A;  4JI0 I;  4USM A;  2Q2E B;  1Z0E A;  4Z7C A;  4DV4 E;  3K85 A;  1Z5C A;  1VIS A;  4XTJ A;  4DPT A;  2HFS A;  1ZM4 A;  4AQY E;  4KHP E;  1FKA E;  5LMU E;  4DV4 I;  3J81 Q;  4X62 E;  4WUC A;  4YHH I;  1PKP A;  4LFB E;  2UUB E;  1BKN A;  4AQY I;  4DR3 I;  4KHP I;  4WUB A;  4X66 E;  2J7K A;  4K0K E;  3V2U C;  5IWA I;  4LFB I;  1KVK A;  2UUB I;  4JI6 E;  2WW4 A;  4X66 I;  4KQV A;  1J5E E;  1NZ0 A;  1Z5B A;  4MYT A;  2Z5C A;  4JI6 I;  3Q6N A;  4DPW A;  3QT6 A;  1ELO A;  4ED4 A;  4LFA E;  3P06 A;  4DU8 A;  1IBM I;  4FWG A;  2UU9 I;  1XHK A;  5FLX C;  1HK7 A;  4DV0 E;  5IT9 C;  2IOP A;  1N0U A;  1NHI A;  4YY3 E;  1H72 C;  4PRX A;  1HNZ I;  4LFA I;  1IBK E;  4DV0 I;  4LF8 E;  4IZJ D;  3HJC A;  4EMD A;  5LL6 R;  1FNM A;  3WU4 A;  3M6A A;  2F4V E;  1FWL A;  3QT5 A;  2VQF E;  1IBK I;  5FLX Q;  1RR9 A;  5IT9 Q;  2O1W A;  4LF4 E;  3J7A G;  1I94 E;  1WUU A;  2X36 A;  2F4V I;  3ZZU A;  2AJ4 A;  4X64 E;  4LF4 I;  4JYA I;  1I94 I;  1N34 I;  4B3M E;  3QT7 A;  4X64 I;  4LF9 E;  4JI4 I;  1HNW E;  2HKE A;  2ZM6 E;  1MU5 A;  1KTV A;  4IZK B;  2BM1 A;  2VQE E;  3ZZ0 A;  1N33 E;  1HNW I;  4DV5 E;  2ZM6 I;  3ZM7 A;  4NXM E;  2CZ9 A;  3K17 A;  2DEJ A;  1U2R A;  2VQE I;  3ZZT A;  4YHH E;  1N33 I;  2Z5E A;  2R3V A;  4DV5 I;  1Z0V A;  4DR3 E;  4HY1 A;  1KKH A;  4NXM I;  2UUC E;  1ZXM A;  2UXB E;  5IWA E;  1Z0G A;  5GME A;  1A6F A;  2GS8 A;  4DV7 E;  4HAC B;  1H74 A;  4LF6 E;  1FI4 A;  3PYG A;  2UUC I;  1USU A;  2UXB I;  1Z0W A;  1XNQ E;  3CWV A;  4DV7 I;  4LF6 I;  3ZKB A;  1NHH A;  2IOQ A;  4FWD A;  1IBM E;  2UU9 E;  1D6T A;  2A2C A;  3V5R A;  3JAM C;  1XNQ I;  4DU7 A;  4JI5 I;  2CGE A;  1UEK A;  1B62 A;  1HNZ E;  3T1Y E;  4X65 E;  1OJ4 A;  1H73 A;  3PYF A;  4URL A;  3T1H E;  4Z7Y A;  3B78 A;  2NPF A;  3GON A;  3T1Y I;  5L3J A;  4JI1 E;  4X65 I;  3J7A M;  3JAM Q;  4HYM A;  1XMO E;  4OX9 I;  3T1H I;  4DPY A;  5FWK A;  4USK A;  2O1T A;  4GKK I;  1Y4U A;  1MG7 A;  4I3H A;  4JI1 I;  5A2Q C;  1IBL E;  4R1F A;  5GMD A;  2A2D A;  4M1K A;  4HAC A;  4PU9 A;  1XMO I;  4FN5 A;  1N32 I;  2E1R A;  4JYA E;  4DR4 E;  1FJG E;  1N34 E;  4B3R E;  4DR1 E;  4MYU A;  2DEI A;  1IBL I;  1XMQ E;  1S4E A;  2UXD I;  1XNR E;  1N36 E;  4JI4 E;  4DR4 I;  3PYD A;  1FJG I;  4DR5 I;  4B3R I;  4DR1 I;  5A2Q Q;  4DUZ I;  4JI2 E;  1XMQ I;  2O1V A;  1XNR I;  1N36 I;  4JI7 E;  1HR0 I;  3WU3 A;  1Z5A A;  4WUD A;  3J80 C;  4NXN E;  4JI2 I;  1NHJ A;  2X7I A;  2ZBK B;  4JG4 A;  4B3S I;  4JI7 I;  3Q1Q A;  2LJP A;  3HUL A;  1S16 A;  1ZXN A;  2UXC E;  2GQ0 A;  4NXN I;  1Z0C A;  1ZM2 A;  3Q6M A;  1Y4S A;  1PVG A;  3J80 Q;  2UXC I;  2HK2 A;  1Z0T A;  2Z5C B;  3ZKD A;  1K47 A;  1KIJ A;  4DPX A;  2CG9 A;  2V8P A;  4DUY E;  3K1J A;  4RPF A;  2UUA I;  4B3T E;  2Z5B B;  4JI3 E;  2HKJ A;  4FWH A;  4DUY I;  4JI5 E;  2R42 A;  4IZJ B;  1EA6 A;  4DV6 E;  4LF5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...