4B3RI

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3rI00
3T1HE 2ZBKB 1HNZI 1A6FA 2VQEI 4DPTA 1XMQI 3D4JA 1Z0CA 3CWVA 1NHJA 4DUYI 4JI2E 4DR6E 1ZM3A 1J5EI 5BR8I 2NPFA 1ZM2A 4JI4I 3ZZ0A 3ZKDA 4LF8E 4DR2I 3ZZTA 3QT5A 4LFBE 3T1YI 1ELOA 4X66I 1ZM4A 3QT7A 1Z59A 4PRXA 1Z0TA 2UXBI 4DR5I 4X62E 4JG4A 4OX9I 4DUZE 1XNRI 4K0KI 4B3SE 1B63A 3OTOI 3LPSA 3V5RA 1N36E 4JI8I 4I3HA 4JI3E 2HKEA 3PYGA 4DXLA 4B3RE 2E5LI 4X64E 2BM1A 4LFAE 5LMNE 4KQVA 3QT8A 3ZM7A 2UU9E 4DR6I 2V34A 4DR4I 1H7SA 1HNZE 2BV3A 2X7IA 1XMQE 4LF9I 1MU5A 4DUYE 2WW4A 4JI5I 4B3TI 3H4LA 1Z0VA 3LNUA 1J5EE 4PU9A 3JAMC 2CZ9A 1N0UA 2HHHI 1EI1A 1N34I 4JI4E 4JYAI 4XTJA 2DEJA 2V2VA 2R42A 1RREA 3T1YE 3J81C 4FWHA 4X66E 4JI3I 3ZKBA 3ZZUA 4YHHE 1B62A 4NXMI 4DV2E 1KTVA 2BM0A 1Z0BA 4DR5E 4JV5I 4B3RI 4OX9E 1HNXE 1XNRE 4K0KE 5GMEA 1XMOI 3WU6A 2V2ZA 1ZM9A 1Z5BA 2UU9I 5FLXC 2X36A 4Z7YA 3LTOA 4MYUA 2E5LE 4DR7E 4B3ME 4NXNE 1XNQE 1KVKA 4DPUA 4USMA 1H7UA 5IT9Q 4DR4E 4GKKI 4DV7I 5IWAI 2GS8A 4M1KA 4HYMA 4LF9E 5IT9C 2UUAI 1WUUA 1NZ0A 4DU7A 1ZXMA 4WUBA 3J80Q 4JI5E 1N0VC 4DPWA 4B3TE 2DEIA 4YHHI 4DV2I 4URLA 2UXCE 2HHHE 3J80C 1N34E 4JYAE 1HNXI 2EFGA 3M6AA 4DV3I 1BKNA 2VQFI 4RPFA 1NHIA 1K47A 1IBMI 4AQYE 1FI4A 4NXME 2F4VI 1IBKI 1FWKA 2R3VA 4JV5E 2HK2A 1FWLA 1MG7A 4WUCA 4DR7I 1PIEA 4B3MI 4JI7E 4NXNI 1XNQI 4HACA 1XMOE 4X65I 1PKPA 4FWGA 4USKA 1S16A 2UXDI 1ZXNA 4DV0I 4HXZA 4ED4A 2HKJA 1FJGI 4DU8A 3HULA 4MYTA 1N32I 1H74A 4GKKE 1VISA 4DV7E 5IWAE 2UXCI 1KKHA 1NHHA 2UUBI 2UUAE 4JI0E 4LF5E 4DV1E 1IBLI 1S4EA 3F0NA 4AQYI 4DPXA 1HNWE 2HFUA 1PVGA 2OI2A 4YY3I 4DV3E 4JI7I 4DPYA 2UUCI 2VQFE 1XHKA 4P52A 4DR1I 1MX0A 4DV4I 1HR0I 1FNMA 2Q2EB 1IBME 2V8PA 4R1FA 4LF6I 2F4VE 3QT6A 1IBKE 4EMDA 3J7AM 4JI6I 1KIJA 4X65E 2A2DA 3B82A 1H73A 4KHPI 2UXDE 2HFSA 4DV0E 1Z5CA 1Z0GA 1FJGE 4DV5I 1N33E 4JI0I 1Z0WA 3WU4A 5L3JA 4LF5I 4DV1I 3Q1QA 3B78A 5GMDA 4LFCE 1N32E 1OJ4A 4UTGA 3B8HA 3PYDA 2LJPA 1HNWI 4LF4I 2UUBE 4DR3E 4LF7E 4Z7CA 1EA6A 3K1JA 1IBLE 2XEXA 4FWDA 1I94I 2AJ4A 4JI1E 4GKJI 3V2UC 1Z5AA 4YY3E 4WUDA 2UUCE 4PRVA 1H72C 4DR1E 2ZITA 3WU3A 4DV4E 1HR0E 2ZM6E 3T1HI 1UEKA 4DV6E 4LF6E 2VF3A 3PYEA 4JI6E 1N33I 5LMUE 2E1RA 4UT4A 4LFCI 4HY1A 3WU5A 4JI2I 3PYFA 2HK3A 4KHPE 2J7KA 1Z0EA 2VQEE 4DV5E 4DR3I 4LF7I 4LF8I 4HACB 3JAMQ 1U2RA 2V2QA 4LFBI 2A2CA 4JI1I 1DARA 4LF4E 5BR8E 3J81Q 4X62I 4P7AA 4DUZI 4DR2E 5LL6R 4B3SI 1QZRA 4FN5A 4ZVIA 1N36I 2ZM6I 1I94E 4FW9A 1RR9A 4DV6I 4GKJE 5A2QQ 2UXBE 5FLXQ 3J7AG 1FKAE 5LMUI 4X64I 4LFAI 5LMNI 1D6TA 5A2QC 3GONA 3OTOE 3K17A 4JI8E
chains in the Genus database with same CATH superfamily
3T1HE 2ZBKB 1HNZI 1A6FA 2VESA 5K36F 2VQEI 4DPTA 1XMQI 3D4JA 1Z0CA 2BA0D 3CWVA 2C37A 4MDTA 1NHJA 4DUYI 4JI2E 4DR6E 3NZKA 2O1VA 4AIDA 1ZM3A 1J5EI 5BR8I 2O1UA 2NPFA 1ZM2A 5C0XB 4JI4I 2JE6B 3ZZ0A 2NN6B 4IFDB 3ZKDA 4LF8E 4DR2I 3ZZTA 3QT5A 4LFBE 3T1YI 1ELOA 4X66I 2BA0G 1ZM4A 3QT7A 1Z59A 4PRXA 1Z0TA 2UXBI 4DR5I 4X62E 4JG4A 4OX9I 4DUZE 3P3EA 1XNRI 4K0KI 2BR2A 4B3SE 1B63A 3OTOI 3LPSA 3V5RA 1N36E 4JI8I 4I3HA 4JI3E 2HKEA 4FW6A 3PYGA 4U3DA 2PO1A 4DXLA 4J3DA 4B3RE 3P06A 2E5LI 4X64E 2BM1A 4MU1A 5LMNE 4IZKA 4LFAE 4KQVA 3QT8A 3ZM7A 2UU9E 4DR6I 2V34A 2AE8A 1R6LA 4DR4I 1H7SA 1HNZE 2BV3A 2X7IA 4OO1F 2C39B 1XMQE 2O3ZA 1R6MA 2CVEA 2PNLA 4LF9I 1MU5A 3H1CA 4OKGA 2CG9A 3M85G 4DUYE 2WW4A 4JI5I 4B3TI 3H4LA 1Z0VA 3LNUA 3Q6MA 1J5EE 4PU9A 3JAMC 2PO1B 2CZ9A 1N0UA 2HHHI 1EI1A 1N34I 4JI4E 4JYAI 4XTJA 2DEJA 4IZKB 2V2VA 2R42A 1RREA 3T1YE 3J81C 4FWHA 4X66E 4JI3I 2WP8A 4FW4A 3ZKBA 3ZZUA 4YHHE 3GLLA 1B62A 4NXMI 4DV2E 1KTVA 3M7ND 2BM0A 1Z0BA 4DR5E 3GCMA 2C38A 4JV5I 4B3RI 4OX9E 5EL9A 1HNXE 1XNRE 4K0KE 5C0XF 5GMEA 2Z5CA 2PO0A 1XMOI 3WU6A 2V2ZA 1ZM9A 1Z5BA 2NN6F 5FLXC 2X36A 2UU9I 4AIMA 4IFDF 4AM3A 1USUA 4Z7YA 3LTOA 4MYUA 1OYSA 1UDQA 4NBQA 2E5LE 4DR7E 4FW3A 4B3ME 3M7NG 4NXNE 1XNQE 3CDJA 1KVKA 4DPUA 4USMA 5K36A 1H7UA 5IT9Q 4DR4E 4GKKI 4DV7I 5JEAF 5IWAI 2GS8A 4M1KA 4HYMA 5DROA 4LF9E 5IT9C 2UUAI 1WUUA 2JT2A 1NZ0A 2O1TA 4DU7A 1ZXMA 1VI7A 4WUBA 3J80Q 1N0VC 4DPWA 4JI5E 4B3TE 2DEIA 4YHHI 2GQ0A 4DV2I 4URLA 2UXCE 1OYPA 2HHHE 3J80C 1N34E 4JYAE 1HNXI 2EFGA 3M6AA 4DV3I 1BKNA 3Q6NA 2VQFI 4RPFA 2C37B 5DNXA 4IZJA 1XXEA 2IOQA 1NHIA 2J65A 1K47A 1IBMI 4AQYE 1FI4A 4NXME 2F4VI 2Z5BA 1UDSA 1IBKI 1FWKA 2PNMA 2PO2A 2R3VA 4JV5E 2HK2A 1FWLA 1MG7A 4WUCA 3UHMA 4DR7I 1PIEA 4B3MI 4JI7E 1E3HA 4NXNI 4HACA 1XNQI 2PNZA 1XMOE 5DRRA 4X65I 1PKPA 2WNRA 3L7ZA 4FWGA 4USKA 1S16A 3GMEA 2UXDI 1ZXNA 4DV0I 4ISAA 1E3PA 4HXZA 4N3OA 4FW7A 4MQYA 4FW5A 2HKJA 4ED4A 1FJGI 4DU8A 3HULA 1Y5YA 2BR2B 4MYTA 1Y6ZA 1N32I 1H74A 4OO1A 4GKKE 1VISA 4DV7E 1Y4UA 2O1WA 5IWAE 2IESA 1YH8A 2UXCI 4LCGA 4BA2A 1KKHA 2Z5BB 3PS1A 1NHHA 2PO2B 2UUBI 2UUAE 4JI0E 4LF5E 2JEBA 4DV1E 4U3BA 1IBLI 1S4EA 3L7ZB 3F0NA 5K36E 4AQYI 4DPXA 1HNWE 1RHYA 2HFUA 2Z5EA 2GO3A 3P76A 1PVGA 2OI2A 4YY3I 4DV3E 4JI7I 4DPYA 2UUCI 2VQFE 2F1DA 1XHKA 3K85A 4P52A 4DR1I 1MX0A 4DV4I 1HR0I 5K36D 1FNMA 2Q2EB 1IBME 4MU4A 5DNLA 1Y4SA 2V8PA 4R1FA 4LF6I 2F4VE 3QT6A 1IBKE 5C0XA 4EMDA 3J7AM 4BA2B 2JE6A 2NN6A 4IFDA 4JI6I 1KIJA 1UDOA 4X65E 2A2DA 3B82A 5K36C 1H73A 3P3CA 5JEAD 4KHPI 2UXDE 2WP8B 2BA1D 2HFSA 5EKWA 4DV0E 1Z5CA 1Z0GA 3HJCA 2C38B 1FJGE 4DV5I 1N33E 4JI0I 1Z0WA 3WU4A 5L3JA 4LF5I 4LCHA 4DV1I 3Q1QA 2Z5CB 2PO0B 3B78A 3P3GA 5JEAC 5GMDA 4LFCE 5JEAA 3DD6A 1N32E 1OJ4A 1UDNA 4IZJD 4UTGA 1OYRA 3B8HA 3PYDA 2LJPA 1HNWI 4LF4I 1HK7A 2JEAA 2UUBE 2BA1G 2IOPA 4DR3E 4LF7E 4Z7CA 4MU0A 1EA6A 3K1JA 1IBLE 2XEXA 5FWKA 5K36B 4FWDA 1I94I 1P42A 4OO1E 2AJ4A 4JI1E 1YHCA 3V2UC 1USVA 4GKJI 2C39A 4OZEA 1Z5AA 4YY3E 4WUDA 3KRNA 2UUCE 4PRVA 1H72C 4DR1E 2ZITA 3WU3A 4DV4E 4BA1A 1HR0E 2ZM6E 5ELWA 5JEAB 4OO1D 3T1HI 1UEKA 4DV6E 4LF6E 2VF3A 3U1YA 3PYEA 3M85D 2JEAB 4JI6E 1N33I 5LMUE 3B4TA 2E1RA 4UT4A 4QNJA 4OO1C 4LFCI 4LOMA 4HY1A 4IZJB 3WU5A 4JI2I 3PYFA 2HK3A 4KHPE 1Y60A 4LPFA 2J7KA 4IS9A 1Z0EA 4QNKA 2VQEE 5C0XE 4DV5E 4DR3I 4LF7I 4GQUA 2NN6E 4IFDE 4LF8I 4HACB 3HKMA 3PRYA 2PNZB 3JAMQ 1U2RA 2V2QA 2WNRB 3PS2A 2GO4A 4BA1B 4LFBI 2A2CA 4JI1I 3CDIA 1DARA 4LF4E 5BR8E 5C0XD 3J81Q 4LCFA 4X62I 3U1KA 2NN6D 4IFDD 4P7AA 4DUZI 4DR2E 5DRPA 5LL6R 4B3SI 1QZRA 4FN5A 4ZVIA 1N36I 2ZM6I 3PS3A 4OO1B 1I94E 5JEAE 4FW9A 1RR9A 4DV6I 4GKJE 5C0XC 5A2QQ 2UXBE 2NN6C 4IFDC 4MU3A 5FLXQ 3J7AG 1FKAE 5DRQA 5LMUI 4X64I 4LFAI 5LMNI 1D6TA 2JEBB 2IERA 5A2QC 3GONA 3OTOE 3K17A 4JI8E 2CGEA
chains in the Genus database with same CATH topology
3T1HE 2ZBKB 1HNZI 1A6FA 2VQEI 4DPTA 1XMQI 3D4JA 1Z0CA 3CWVA 1NHJA 4DUYI 4JI2E 4DR6E 2O1VA 1ZM3A 1J5EI 5BR8I 2O1UA 2NPFA 1ZM2A 4JI4I 3ZZ0A 3ZKDA 4LF8E 4DR2I 3ZZTA 3QT5A 4LFBE 3T1YI 1ELOA 4X66I 1ZM4A 3QT7A 1Z59A 4PRXA 1Z0TA 2UXBI 4DR5I 4X62E 4JG4A 4OX9I 4DUZE 1XNRI 4K0KI 4B3SE 1B63A 3OTOI 3LPSA 3V5RA 1N36E 4JI8I 4I3HA 4JI3E 2HKEA 3PYGA 4DXLA 4B3RE 3P06A 2E5LI 4X64E 2BM1A 4LFAE 5LMNE 4IZKA 4KQVA 3QT8A 3ZM7A 2UU9E 4DR6I 2V34A 4DR4I 1H7SA 1HNZE 2BV3A 2X7IA 1XMQE 2PNLA 4LF9I 1MU5A 2CG9A 4DUYE 2WW4A 4JI5I 4B3TI 3H4LA 1Z0VA 3LNUA 3Q6MA 1J5EE 4PU9A 3JAMC 2CZ9A 1N0UA 2HHHI 1EI1A 1N34I 4JI4E 4JYAI 4XTJA 2DEJA 4IZKB 2V2VA 2R42A 1RREA 3T1YE 3J81C 4FWHA 4X66E 4JI3I 3ZKBA 3ZZUA 4YHHE 1B62A 4NXMI 4DV2E 1KTVA 2BM0A 1Z0BA 4DR5E 4JV5I 4B3RI 4OX9E 1HNXE 1XNRE 4K0KE 5GMEA 2Z5CA 1XMOI 3WU6A 2V2ZA 1ZM9A 1Z5BA 2UU9I 5FLXC 2X36A 1USUA 4Z7YA 3LTOA 4MYUA 2E5LE 4DR7E 4B3ME 4NXNE 1XNQE 1KVKA 4DPUA 4USMA 1H7UA 5IT9Q 4DR4E 4GKKI 4DV7I 5IWAI 2GS8A 4M1KA 4HYMA 4LF9E 5IT9C 2UUAI 1WUUA 2O1TA 1NZ0A 4DU7A 1ZXMA 4WUBA 3J80Q 4JI5E 1N0VC 4DPWA 4B3TE 2DEIA 4YHHI 2GQ0A 4DV2I 4URLA 2UXCE 2HHHE 3J80C 1N34E 4JYAE 1HNXI 2EFGA 3M6AA 4DV3I 1BKNA 3Q6NA 2VQFI 4RPFA 4IZJA 2IOQA 1NHIA 1K47A 1IBMI 4AQYE 1FI4A 4NXME 2F4VI 2Z5BA 1IBKI 1FWKA 2PNMA 2R3VA 4JV5E 2HK2A 1FWLA 1MG7A 4WUCA 4DR7I 1PIEA 4B3MI 4JI7E 4NXNI 1XNQI 4HACA 1XMOE 4X65I 1PKPA 4FWGA 4USKA 1S16A 2UXDI 1ZXNA 4DV0I 4HXZA 4N3OA 4ED4A 2HKJA 1FJGI 4DU8A 3HULA 4MYTA 1Y6ZA 1N32I 1H74A 4GKKE 1VISA 4DV7E 1Y4UA 2O1WA 5IWAE 2UXCI 1KKHA 2Z5BB 1NHHA 2UUBI 2UUAE 4JI0E 4LF5E 4DV1E 1IBLI 1S4EA 3F0NA 4AQYI 4DPXA 1HNWE 2HFUA 2Z5EA 1PVGA 2OI2A 4YY3I 4DV3E 4JI7I 4DPYA 2UUCI 2VQFE 1XHKA 3K85A 4P52A 4DR1I 1MX0A 4DV4I 1HR0I 1FNMA 2Q2EB 1IBME 1Y4SA 2V8PA 4R1FA 4LF6I 2F4VE 3QT6A 1IBKE 4EMDA 3J7AM 4JI6I 1KIJA 4X65E 2A2DA 3B82A 1H73A 4KHPI 2UXDE 2HFSA 4DV0E 1Z5CA 1Z0GA 3HJCA 1FJGE 4DV5I 1N33E 4JI0I 1Z0WA 3WU4A 5L3JA 4LF5I 4DV1I 3Q1QA 2Z5CB 3B78A 5GMDA 4LFCE 1N32E 1OJ4A 4IZJD 4UTGA 3B8HA 3PYDA 2LJPA 1HNWI 4LF4I 1HK7A 2UUBE 2IOPA 4DR3E 4LF7E 4Z7CA 1EA6A 3K1JA 1IBLE 2XEXA 5FWKA 4FWDA 1I94I 2AJ4A 4JI1E 4GKJI 3V2UC 1USVA 1Z5AA 4YY3E 4WUDA 2UUCE 4PRVA 1H72C 4DR1E 2ZITA 3WU3A 4DV4E 1HR0E 2ZM6E 3T1HI 1UEKA 4DV6E 4LF6E 2VF3A 3PYEA 4JI6E 1N33I 5LMUE 2E1RA 4UT4A 4LFCI 4HY1A 4IZJB 3WU5A 4JI2I 3PYFA 2HK3A 4KHPE 2J7KA 1Z0EA 2VQEE 4DV5E 4DR3I 4LF7I 4LF8I 4HACB 3PRYA 3JAMQ 1U2RA 2V2QA 4LFBI 2A2CA 4JI1I 1DARA 4LF4E 5BR8E 3J81Q 4X62I 4P7AA 4DUZI 4DR2E 5LL6R 4B3SI 1QZRA 4FN5A 4ZVIA 1N36I 2ZM6I 1I94E 4FW9A 1RR9A 4DV6I 4GKJE 5A2QQ 2UXBE 5FLXQ 3J7AG 1FKAE 5LMUI 4X64I 4LFAI 5LMNI 1D6TA 5A2QC 3GONA 3OTOE 3K17A 4JI8E 2CGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H E;  2ZBK B;  1HNZ I;  1A6F A;  2VQE I;  4DPT A;  1XMQ I;  3D4J A;  1Z0C A;  3CWV A;  1NHJ A;  4DUY I;  4JI2 E;  4DR6 E;  1ZM3 A;  1J5E I;  5BR8 I;  2NPF A;  1ZM2 A;  4JI4 I;  3ZZ0 A;  3ZKD A;  4LF8 E;  4DR2 I;  3ZZT A;  3QT5 A;  4LFB E;  3T1Y I;  1ELO A;  4X66 I;  1ZM4 A;  3QT7 A;  1Z59 A;  4PRX A;  1Z0T A;  2UXB I;  4DR5 I;  4X62 E;  4JG4 A;  4OX9 I;  4DUZ E;  1XNR I;  4K0K I;  4B3S E;  1B63 A;  3OTO I;  3LPS A;  3V5R A;  1N36 E;  4JI8 I;  4I3H A;  4JI3 E;  2HKE A;  3PYG A;  4DXL A;  4B3R E;  2E5L I;  4X64 E;  2BM1 A;  4LFA E;  5LMN E;  4KQV A;  3QT8 A;  3ZM7 A;  2UU9 E;  4DR6 I;  2V34 A;  4DR4 I;  1H7S A;  1HNZ E;  2BV3 A;  2X7I A;  1XMQ E;  4LF9 I;  1MU5 A;  4DUY E;  2WW4 A;  4JI5 I;  4B3T I;  3H4L A;  1Z0V A;  3LNU A;  1J5E E;  4PU9 A;  3JAM C;  2CZ9 A;  1N0U A;  2HHH I;  1EI1 A;  1N34 I;  4JI4 E;  4JYA I;  4XTJ A;  2DEJ A;  2V2V A;  2R42 A;  1RRE A;  3T1Y E;  3J81 C;  4FWH A;  4X66 E;  4JI3 I;  3ZKB A;  3ZZU A;  4YHH E;  1B62 A;  4NXM I;  4DV2 E;  1KTV A;  2BM0 A;  1Z0B A;  4DR5 E;  4JV5 I;  4B3R I;  4OX9 E;  1HNX E;  1XNR E;  4K0K E;  5GME A;  1XMO I;  3WU6 A;  2V2Z A;  1ZM9 A;  1Z5B A;  2UU9 I;  5FLX C;  2X36 A;  4Z7Y A;  3LTO A;  4MYU A;  2E5L E;  4DR7 E;  4B3M E;  4NXN E;  1XNQ E;  1KVK A;  4DPU A;  4USM A;  1H7U A;  5IT9 Q;  4DR4 E;  4GKK I;  4DV7 I;  5IWA I;  2GS8 A;  4M1K A;  4HYM A;  4LF9 E;  5IT9 C;  2UUA I;  1WUU A;  1NZ0 A;  4DU7 A;  1ZXM A;  4WUB A;  3J80 Q;  4JI5 E;  1N0V C;  4DPW A;  4B3T E;  2DEI A;  4YHH I;  4DV2 I;  4URL A;  2UXC E;  2HHH E;  3J80 C;  1N34 E;  4JYA E;  1HNX I;  2EFG A;  3M6A A;  4DV3 I;  1BKN A;  2VQF I;  4RPF A;  1NHI A;  1K47 A;  1IBM I;  4AQY E;  1FI4 A;  4NXM E;  2F4V I;  1IBK I;  1FWK A;  2R3V A;  4JV5 E;  2HK2 A;  1FWL A;  1MG7 A;  4WUC A;  4DR7 I;  1PIE A;  4B3M I;  4JI7 E;  4NXN I;  1XNQ I;  4HAC A;  1XMO E;  4X65 I;  1PKP A;  4FWG A;  4USK A;  1S16 A;  2UXD I;  1ZXN A;  4DV0 I;  4HXZ A;  4ED4 A;  2HKJ A;  1FJG I;  4DU8 A;  3HUL A;  4MYT A;  1N32 I;  1H74 A;  4GKK E;  1VIS A;  4DV7 E;  5IWA E;  2UXC I;  1KKH A;  1NHH A;  2UUB I;  2UUA E;  4JI0 E;  4LF5 E;  4DV1 E;  1IBL I;  1S4E A;  3F0N A;  4AQY I;  4DPX A;  1HNW E;  2HFU A;  1PVG A;  2OI2 A;  4YY3 I;  4DV3 E;  4JI7 I;  4DPY A;  2UUC I;  2VQF E;  1XHK A;  4P52 A;  4DR1 I;  1MX0 A;  4DV4 I;  1HR0 I;  1FNM A;  2Q2E B;  1IBM E;  2V8P A;  4R1F A;  4LF6 I;  2F4V E;  3QT6 A;  1IBK E;  4EMD A;  3J7A M;  4JI6 I;  1KIJ A;  4X65 E;  2A2D A;  3B82 A;  1H73 A;  4KHP I;  2UXD E;  2HFS A;  4DV0 E;  1Z5C A;  1Z0G A;  1FJG E;  4DV5 I;  1N33 E;  4JI0 I;  1Z0W A;  3WU4 A;  5L3J A;  4LF5 I;  4DV1 I;  3Q1Q A;  3B78 A;  5GMD A;  4LFC E;  1N32 E;  1OJ4 A;  4UTG A;  3B8H A;  3PYD A;  2LJP A;  1HNW I;  4LF4 I;  2UUB E;  4DR3 E;  4LF7 E;  4Z7C A;  1EA6 A;  3K1J A;  1IBL E;  2XEX A;  4FWD A;  1I94 I;  2AJ4 A;  4JI1 E;  4GKJ I;  3V2U C;  1Z5A A;  4YY3 E;  4WUD A;  2UUC E;  4PRV A;  1H72 C;  4DR1 E;  2ZIT A;  3WU3 A;  4DV4 E;  1HR0 E;  2ZM6 E;  3T1H I;  1UEK A;  4DV6 E;  4LF6 E;  2VF3 A;  3PYE A;  4JI6 E;  1N33 I;  5LMU E;  2E1R A;  4UT4 A;  4LFC I;  4HY1 A;  3WU5 A;  4JI2 I;  3PYF A;  2HK3 A;  4KHP E;  2J7K A;  1Z0E A;  2VQE E;  4DV5 E;  4DR3 I;  4LF7 I;  4LF8 I;  4HAC B;  3JAM Q;  1U2R A;  2V2Q A;  4LFB I;  2A2C A;  4JI1 I;  1DAR A;  4LF4 E;  5BR8 E;  3J81 Q;  4X62 I;  4P7A A;  4DUZ I;  4DR2 E;  5LL6 R;  4B3S I;  1QZR A;  4FN5 A;  4ZVI A;  1N36 I;  2ZM6 I;  1I94 E;  4FW9 A;  1RR9 A;  4DV6 I;  4GKJ E;  5A2Q Q;  2UXB E;  5FLX Q;  3J7A G;  1FKA E;  5LMU I;  4X64 I;  4LFA I;  5LMN I;  1D6T A;  5A2Q C;  3GON A;  3OTO E;  3K17 A;  4JI8 E; 
#chains in the Genus database with same CATH topology
 3T1H E;  2ZBK B;  1HNZ I;  1A6F A;  2VES A;  5K36 F;  2VQE I;  4DPT A;  1XMQ I;  3D4J A;  1Z0C A;  2BA0 D;  3CWV A;  2C37 A;  4MDT A;  1NHJ A;  4DUY I;  4JI2 E;  4DR6 E;  3NZK A;  2O1V A;  4AID A;  1ZM3 A;  1J5E I;  5BR8 I;  2O1U A;  2NPF A;  1ZM2 A;  5C0X B;  4JI4 I;  2JE6 B;  3ZZ0 A;  2NN6 B;  4IFD B;  3ZKD A;  4LF8 E;  4DR2 I;  3ZZT A;  3QT5 A;  4LFB E;  3T1Y I;  1ELO A;  4X66 I;  2BA0 G;  1ZM4 A;  3QT7 A;  1Z59 A;  4PRX A;  1Z0T A;  2UXB I;  4DR5 I;  4X62 E;  4JG4 A;  4OX9 I;  4DUZ E;  3P3E A;  1XNR I;  4K0K I;  2BR2 A;  4B3S E;  1B63 A;  3OTO I;  3LPS A;  3V5R A;  1N36 E;  4JI8 I;  4I3H A;  4JI3 E;  2HKE A;  4FW6 A;  3PYG A;  4U3D A;  2PO1 A;  4DXL A;  4J3D A;  4B3R E;  3P06 A;  2E5L I;  4X64 E;  2BM1 A;  4MU1 A;  5LMN E;  4IZK A;  4LFA E;  4KQV A;  3QT8 A;  3ZM7 A;  2UU9 E;  4DR6 I;  2V34 A;  2AE8 A;  1R6L A;  4DR4 I;  1H7S A;  1HNZ E;  2BV3 A;  2X7I A;  4OO1 F;  2C39 B;  1XMQ E;  2O3Z A;  1R6M A;  2CVE A;  2PNL A;  4LF9 I;  1MU5 A;  3H1C A;  4OKG A;  2CG9 A;  3M85 G;  4DUY E;  2WW4 A;  4JI5 I;  4B3T I;  3H4L A;  1Z0V A;  3LNU A;  3Q6M A;  1J5E E;  4PU9 A;  3JAM C;  2PO1 B;  2CZ9 A;  1N0U A;  2HHH I;  1EI1 A;  1N34 I;  4JI4 E;  4JYA I;  4XTJ A;  2DEJ A;  4IZK B;  2V2V A;  2R42 A;  1RRE A;  3T1Y E;  3J81 C;  4FWH A;  4X66 E;  4JI3 I;  2WP8 A;  4FW4 A;  3ZKB A;  3ZZU A;  4YHH E;  3GLL A;  1B62 A;  4NXM I;  4DV2 E;  1KTV A;  3M7N D;  2BM0 A;  1Z0B A;  4DR5 E;  3GCM A;  2C38 A;  4JV5 I;  4B3R I;  4OX9 E;  5EL9 A;  1HNX E;  1XNR E;  4K0K E;  5C0X F;  5GME A;  2Z5C A;  2PO0 A;  1XMO I;  3WU6 A;  2V2Z A;  1ZM9 A;  1Z5B A;  2NN6 F;  5FLX C;  2X36 A;  2UU9 I;  4AIM A;  4IFD F;  4AM3 A;  1USU A;  4Z7Y A;  3LTO A;  4MYU A;  1OYS A;  1UDQ A;  4NBQ A;  2E5L E;  4DR7 E;  4FW3 A;  4B3M E;  3M7N G;  4NXN E;  1XNQ E;  3CDJ A;  1KVK A;  4DPU A;  4USM A;  5K36 A;  1H7U A;  5IT9 Q;  4DR4 E;  4GKK I;  4DV7 I;  5JEA F;  5IWA I;  2GS8 A;  4M1K A;  4HYM A;  5DRO A;  4LF9 E;  5IT9 C;  2UUA I;  1WUU A;  2JT2 A;  1NZ0 A;  2O1T A;  4DU7 A;  1ZXM A;  1VI7 A;  4WUB A;  3J80 Q;  1N0V C;  4DPW A;  4JI5 E;  4B3T E;  2DEI A;  4YHH I;  2GQ0 A;  4DV2 I;  4URL A;  2UXC E;  1OYP A;  2HHH E;  3J80 C;  1N34 E;  4JYA E;  1HNX I;  2EFG A;  3M6A A;  4DV3 I;  1BKN A;  3Q6N A;  2VQF I;  4RPF A;  2C37 B;  5DNX A;  4IZJ A;  1XXE A;  2IOQ A;  1NHI A;  2J65 A;  1K47 A;  1IBM I;  4AQY E;  1FI4 A;  4NXM E;  2F4V I;  2Z5B A;  1UDS A;  1IBK I;  1FWK A;  2PNM A;  2PO2 A;  2R3V A;  4JV5 E;  2HK2 A;  1FWL A;  1MG7 A;  4WUC A;  3UHM A;  4DR7 I;  1PIE A;  4B3M I;  4JI7 E;  1E3H A;  4NXN I;  4HAC A;  1XNQ I;  2PNZ A;  1XMO E;  5DRR A;  4X65 I;  1PKP A;  2WNR A;  3L7Z A;  4FWG A;  4USK A;  1S16 A;  3GME A;  2UXD I;  1ZXN A;  4DV0 I;  4ISA A;  1E3P A;  4HXZ A;  4N3O A;  4FW7 A;  4MQY A;  4FW5 A;  2HKJ A;  4ED4 A;  1FJG I;  4DU8 A;  3HUL A;  1Y5Y A;  2BR2 B;  4MYT A;  1Y6Z A;  1N32 I;  1H74 A;  4OO1 A;  4GKK E;  1VIS A;  4DV7 E;  1Y4U A;  2O1W A;  5IWA E;  2IES A;  1YH8 A;  2UXC I;  4LCG A;  4BA2 A;  1KKH A;  2Z5B B;  3PS1 A;  1NHH A;  2PO2 B;  2UUB I;  2UUA E;  4JI0 E;  4LF5 E;  2JEB A;  4DV1 E;  4U3B A;  1IBL I;  1S4E A;  3L7Z B;  3F0N A;  5K36 E;  4AQY I;  4DPX A;  1HNW E;  1RHY A;  2HFU A;  2Z5E A;  2GO3 A;  3P76 A;  1PVG A;  2OI2 A;  4YY3 I;  4DV3 E;  4JI7 I;  4DPY A;  2UUC I;  2VQF E;  2F1D A;  1XHK A;  3K85 A;  4P52 A;  4DR1 I;  1MX0 A;  4DV4 I;  1HR0 I;  5K36 D;  1FNM A;  2Q2E B;  1IBM E;  4MU4 A;  5DNL A;  1Y4S A;  2V8P A;  4R1F A;  4LF6 I;  2F4V E;  3QT6 A;  1IBK E;  5C0X A;  4EMD A;  3J7A M;  4BA2 B;  2JE6 A;  2NN6 A;  4IFD A;  4JI6 I;  1KIJ A;  1UDO A;  4X65 E;  2A2D A;  3B82 A;  5K36 C;  1H73 A;  3P3C A;  5JEA D;  4KHP I;  2UXD E;  2WP8 B;  2BA1 D;  2HFS A;  5EKW A;  4DV0 E;  1Z5C A;  1Z0G A;  3HJC A;  2C38 B;  1FJG E;  4DV5 I;  1N33 E;  4JI0 I;  1Z0W A;  3WU4 A;  5L3J A;  4LF5 I;  4LCH A;  4DV1 I;  3Q1Q A;  2Z5C B;  2PO0 B;  3B78 A;  3P3G A;  5JEA C;  5GMD A;  4LFC E;  5JEA A;  3DD6 A;  1N32 E;  1OJ4 A;  1UDN A;  4IZJ D;  4UTG A;  1OYR A;  3B8H A;  3PYD A;  2LJP A;  1HNW I;  4LF4 I;  1HK7 A;  2JEA A;  2UUB E;  2BA1 G;  2IOP A;  4DR3 E;  4LF7 E;  4Z7C A;  4MU0 A;  1EA6 A;  3K1J A;  1IBL E;  2XEX A;  5FWK A;  5K36 B;  4FWD A;  1I94 I;  1P42 A;  4OO1 E;  2AJ4 A;  4JI1 E;  1YHC A;  3V2U C;  1USV A;  4GKJ I;  2C39 A;  4OZE A;  1Z5A A;  4YY3 E;  4WUD A;  3KRN A;  2UUC E;  4PRV A;  1H72 C;  4DR1 E;  2ZIT A;  3WU3 A;  4DV4 E;  4BA1 A;  1HR0 E;  2ZM6 E;  5ELW A;  5JEA B;  4OO1 D;  3T1H I;  1UEK A;  4DV6 E;  4LF6 E;  2VF3 A;  3U1Y A;  3PYE A;  3M85 D;  2JEA B;  4JI6 E;  1N33 I;  5LMU E;  3B4T A;  2E1R A;  4UT4 A;  4QNJ A;  4OO1 C;  4LFC I;  4LOM A;  4HY1 A;  4IZJ B;  3WU5 A;  4JI2 I;  3PYF A;  2HK3 A;  4KHP E;  1Y60 A;  4LPF A;  2J7K A;  4IS9 A;  1Z0E A;  4QNK A;  2VQE E;  5C0X E;  4DV5 E;  4DR3 I;  4LF7 I;  4GQU A;  2NN6 E;  4IFD E;  4LF8 I;  4HAC B;  3HKM A;  3PRY A;  2PNZ B;  3JAM Q;  1U2R A;  2V2Q A;  2WNR B;  3PS2 A;  2GO4 A;  4BA1 B;  4LFB I;  2A2C A;  4JI1 I;  3CDI A;  1DAR A;  4LF4 E;  5BR8 E;  5C0X D;  3J81 Q;  4LCF A;  4X62 I;  3U1K A;  2NN6 D;  4IFD D;  4P7A A;  4DUZ I;  4DR2 E;  5DRP A;  5LL6 R;  4B3S I;  1QZR A;  4FN5 A;  4ZVI A;  1N36 I;  2ZM6 I;  3PS3 A;  4OO1 B;  1I94 E;  5JEA E;  4FW9 A;  1RR9 A;  4DV6 I;  4GKJ E;  5C0X C;  5A2Q Q;  2UXB E;  2NN6 C;  4IFD C;  4MU3 A;  5FLX Q;  3J7A G;  1FKA E;  5DRQ A;  5LMU I;  4X64 I;  4LFA I;  5LMN I;  1D6T A;  2JEB B;  2IER A;  5A2Q C;  3GON A;  3OTO E;  3K17 A;  4JI8 E;  2CGE A; 
#chains in the Genus database with same CATH homology
 3T1H E;  2ZBK B;  1HNZ I;  1A6F A;  2VQE I;  4DPT A;  1XMQ I;  3D4J A;  1Z0C A;  3CWV A;  1NHJ A;  4DUY I;  4JI2 E;  4DR6 E;  2O1V A;  1ZM3 A;  1J5E I;  5BR8 I;  2O1U A;  2NPF A;  1ZM2 A;  4JI4 I;  3ZZ0 A;  3ZKD A;  4LF8 E;  4DR2 I;  3ZZT A;  3QT5 A;  4LFB E;  3T1Y I;  1ELO A;  4X66 I;  1ZM4 A;  3QT7 A;  1Z59 A;  4PRX A;  1Z0T A;  2UXB I;  4DR5 I;  4X62 E;  4JG4 A;  4OX9 I;  4DUZ E;  1XNR I;  4K0K I;  4B3S E;  1B63 A;  3OTO I;  3LPS A;  3V5R A;  1N36 E;  4JI8 I;  4I3H A;  4JI3 E;  2HKE A;  3PYG A;  4DXL A;  4B3R E;  3P06 A;  2E5L I;  4X64 E;  2BM1 A;  4LFA E;  5LMN E;  4IZK A;  4KQV A;  3QT8 A;  3ZM7 A;  2UU9 E;  4DR6 I;  2V34 A;  4DR4 I;  1H7S A;  1HNZ E;  2BV3 A;  2X7I A;  1XMQ E;  2PNL A;  4LF9 I;  1MU5 A;  2CG9 A;  4DUY E;  2WW4 A;  4JI5 I;  4B3T I;  3H4L A;  1Z0V A;  3LNU A;  3Q6M A;  1J5E E;  4PU9 A;  3JAM C;  2CZ9 A;  1N0U A;  2HHH I;  1EI1 A;  1N34 I;  4JI4 E;  4JYA I;  4XTJ A;  2DEJ A;  4IZK B;  2V2V A;  2R42 A;  1RRE A;  3T1Y E;  3J81 C;  4FWH A;  4X66 E;  4JI3 I;  3ZKB A;  3ZZU A;  4YHH E;  1B62 A;  4NXM I;  4DV2 E;  1KTV A;  2BM0 A;  1Z0B A;  4DR5 E;  4JV5 I;  4B3R I;  4OX9 E;  1HNX E;  1XNR E;  4K0K E;  5GME A;  2Z5C A;  1XMO I;  3WU6 A;  2V2Z A;  1ZM9 A;  1Z5B A;  2UU9 I;  5FLX C;  2X36 A;  1USU A;  4Z7Y A;  3LTO A;  4MYU A;  2E5L E;  4DR7 E;  4B3M E;  4NXN E;  1XNQ E;  1KVK A;  4DPU A;  4USM A;  1H7U A;  5IT9 Q;  4DR4 E;  4GKK I;  4DV7 I;  5IWA I;  2GS8 A;  4M1K A;  4HYM A;  4LF9 E;  5IT9 C;  2UUA I;  1WUU A;  2O1T A;  1NZ0 A;  4DU7 A;  1ZXM A;  4WUB A;  3J80 Q;  4JI5 E;  1N0V C;  4DPW A;  4B3T E;  2DEI A;  4YHH I;  2GQ0 A;  4DV2 I;  4URL A;  2UXC E;  2HHH E;  3J80 C;  1N34 E;  4JYA E;  1HNX I;  2EFG A;  3M6A A;  4DV3 I;  1BKN A;  3Q6N A;  2VQF I;  4RPF A;  4IZJ A;  2IOQ A;  1NHI A;  1K47 A;  1IBM I;  4AQY E;  1FI4 A;  4NXM E;  2F4V I;  2Z5B A;  1IBK I;  1FWK A;  2PNM A;  2R3V A;  4JV5 E;  2HK2 A;  1FWL A;  1MG7 A;  4WUC A;  4DR7 I;  1PIE A;  4B3M I;  4JI7 E;  4NXN I;  1XNQ I;  4HAC A;  1XMO E;  4X65 I;  1PKP A;  4FWG A;  4USK A;  1S16 A;  2UXD I;  1ZXN A;  4DV0 I;  4HXZ A;  4N3O A;  4ED4 A;  2HKJ A;  1FJG I;  4DU8 A;  3HUL A;  4MYT A;  1Y6Z A;  1N32 I;  1H74 A;  4GKK E;  1VIS A;  4DV7 E;  1Y4U A;  2O1W A;  5IWA E;  2UXC I;  1KKH A;  2Z5B B;  1NHH A;  2UUB I;  2UUA E;  4JI0 E;  4LF5 E;  4DV1 E;  1IBL I;  1S4E A;  3F0N A;  4AQY I;  4DPX A;  1HNW E;  2HFU A;  2Z5E A;  1PVG A;  2OI2 A;  4YY3 I;  4DV3 E;  4JI7 I;  4DPY A;  2UUC I;  2VQF E;  1XHK A;  3K85 A;  4P52 A;  4DR1 I;  1MX0 A;  4DV4 I;  1HR0 I;  1FNM A;  2Q2E B;  1IBM E;  1Y4S A;  2V8P A;  4R1F A;  4LF6 I;  2F4V E;  3QT6 A;  1IBK E;  4EMD A;  3J7A M;  4JI6 I;  1KIJ A;  4X65 E;  2A2D A;  3B82 A;  1H73 A;  4KHP I;  2UXD E;  2HFS A;  4DV0 E;  1Z5C A;  1Z0G A;  3HJC A;  1FJG E;  4DV5 I;  1N33 E;  4JI0 I;  1Z0W A;  3WU4 A;  5L3J A;  4LF5 I;  4DV1 I;  3Q1Q A;  2Z5C B;  3B78 A;  5GMD A;  4LFC E;  1N32 E;  1OJ4 A;  4IZJ D;  4UTG A;  3B8H A;  3PYD A;  2LJP A;  1HNW I;  4LF4 I;  1HK7 A;  2UUB E;  2IOP A;  4DR3 E;  4LF7 E;  4Z7C A;  1EA6 A;  3K1J A;  1IBL E;  2XEX A;  5FWK A;  4FWD A;  1I94 I;  2AJ4 A;  4JI1 E;  4GKJ I;  3V2U C;  1USV A;  1Z5A A;  4YY3 E;  4WUD A;  2UUC E;  4PRV A;  1H72 C;  4DR1 E;  2ZIT A;  3WU3 A;  4DV4 E;  1HR0 E;  2ZM6 E;  3T1H I;  1UEK A;  4DV6 E;  4LF6 E;  2VF3 A;  3PYE A;  4JI6 E;  1N33 I;  5LMU E;  2E1R A;  4UT4 A;  4LFC I;  4HY1 A;  4IZJ B;  3WU5 A;  4JI2 I;  3PYF A;  2HK3 A;  4KHP E;  2J7K A;  1Z0E A;  2VQE E;  4DV5 E;  4DR3 I;  4LF7 I;  4LF8 I;  4HAC B;  3PRY A;  3JAM Q;  1U2R A;  2V2Q A;  4LFB I;  2A2C A;  4JI1 I;  1DAR A;  4LF4 E;  5BR8 E;  3J81 Q;  4X62 I;  4P7A A;  4DUZ I;  4DR2 E;  5LL6 R;  4B3S I;  1QZR A;  4FN5 A;  4ZVI A;  1N36 I;  2ZM6 I;  1I94 E;  4FW9 A;  1RR9 A;  4DV6 I;  4GKJ E;  5A2Q Q;  2UXB E;  5FLX Q;  3J7A G;  1FKA E;  5LMU I;  4X64 I;  4LFA I;  5LMN I;  1D6T A;  5A2Q C;  3GON A;  3OTO E;  3K17 A;  4JI8 E;  2CGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...