4B3RI

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3rI00
4R1FA 1MU5A 2HHHI 2UUBI 1MG7A 1N33E 4AQYI 2A2DA 1N36E 4DR4E 2AJ4A 3QT6A 3ZZUA 5L3JA 4B3SE 4DV5I 4DPTA 4DUZE 2VQEI 1HR0E 1NHIA 1PIEA 1FKAE 2BM1A 1N36I 1ZXNA 2E1RA 4JI4E 4LF7E 3LNUA 1EA6A 2GS8A 3V5RA 4B3SI 3M6AA 4DR5E 4JI5E 4XTJA 4JI2I 4LF9I 4P7AA 2CZ9A 4AQYE 3H4LA 4DR6I 4FWDA 3T1HE 1ZXMA 1FWKA 2UXDI 1XHKA 1Z5CA 4LF6E 4DV0I 4WUBA 1IBKI 1D6TA 3LTOA 1Z0CA 5GMDA 1OJ4A 1Z5AA 1XNRE 5LMUI 1N32I 2V2ZA 1I94I 2UXBI 1IBME 4HY1A 2HFSA 3WU5A 4X65E 4LFAI 3PYDA 4WUCA 1ZM2A 1U2RA 4LFCI 4DV3E 3D4JA 4LF5I 4LF4I 2F4VE 4DU7A 2ZBKB 2V2VA 4JI3E 1XNQI 4DUYI 3QT8A 4DR2E 5LMNI 2HFUA 1S16A 5A2QQ 2UXBE 4DV1E 1XMQI 4X64E 2BV3A 4KQVA 4K0KI 2Q2EB 4FW9A 1IBKE 4FN5A 5IWAE 1NHJA 4NXMI 4USMA 1DARA 5FLXC 1N0VC 1Z5BA 3J7AM 4DV6E 1UEKA 1RR9A 4DV5E 4ED4A 2VF3A 3K1JA 5FLXQ 4JV5I 4DV4E 3ZKDA 4LF8I 4Z7CA 2VQFI 4B3TE 5LMNE 5LL6R 1XMOE 2X36A 4LFBE 4X62I 4JI7I 3F0NA 1N34E 4K0KE 3ZZ0A 4LF6I 5A2QC 2HKEA 3T1YE 4DPWA 2E5LE 4DU8A 4NXME 2V2QA 1J5EI 4ZVIA 3CWVA 1I94E 4URLA 2V34A 1N34I 1B62A 4NXNE 4X65I 4LFAE 1FJGI 3B8HA 4YY3E 3Q1QA 2R3VA 1KKHA 4HACA 1HNZI 4DPXA 4YHHE 4DV7E 2UUAE 3GONA 1PKPA 1N0UA 2HK3A 4DV0E 2BM0A 1H73A 5GMEA 4DR1E 2V8PA 2WW4A 4DR2I 2HHHE 2UUBE 1XNQE 1N33I 3QT7A 2ZITA 5IT9C 2UUAI 4DV1I 1ZM4A 2HK2A 2ZM6I 1Z0WA 1Z0EA 4NXNI 4DV6I 3PYGA 4PU9A 2DEJA 4JI0I 4GKJE 4B3MI 4JI3I 4DR5I 1FNMA 1K47A 4JI2E 4LF8E 1WUUA 4B3TI 4HXZA 4DV2E 3K17A 1KVKA 2EFGA 3V2UC 4DXLA 2UXDE 4I3HA 1NZ0A 5IWAI 1VISA 4JI1I 5IT9Q 2UXCI 4FWGA 1N32E 1H72C 1FI4A 1S4EA 2UUCI 4JI6E 4DR6E 1HNXE 4DPYA 3LPSA 4HACB 4JYAE 4X66E 5BR8E 3ZKBA 4JG4A 4OX9I 4RPFA 4JI1E 2VQFE 2F4VI 1NHHA 4Z7YA 2VQEE 2A2CA 1HR0I 1Z0BA 1H7UA 1EI1A 3OTOE 4YHHI 1IBLE 3J80Q 4DR7I 2UXCE 1H7SA 4DUYE 3B82A 2UUCE 3PYFA 4KHPE 4X64I 2LJPA 4WUDA 4JV5E 4JI0E 1HNZE 4DR1I 4HYMA 1XNRI 1ZM3A 4JI7E 4X62E 4MYUA 3OTOI 1IBMI 4M1KA 3ZM7A 4GKKI 2NPFA 4LF5E 1A6FA 2E5LI 1FWLA 1Z0VA 1PVGA 4LFBI 3J80C 4EMDA 4UTGA 2ZM6E 3JAMQ 2XEXA 3J7AG 1XMQE 4JI8I 3J81C 1BKNA 4B3ME 1MX0A 3JAMC 4YY3I 5BR8I 3T1YI 2DEIA 3ZZTA 4DUZI 1KTVA 3HULA 1B63A 2X7IA 4JI6I 2HKJA 4LF7I 1ZM9A 1H74A 1RREA 1FJGE 1Z0TA 4OX9E 3B78A 4JI5I 2J7KA 2UU9E 4DV7I 1HNXI 1ELOA 4JI4I 3T1HI 4B3RI 1HNWE 4PRVA 1IBLI 3WU3A 4GKJI 4LFCE 4DR7E 2R42A 4DV4I 4DV3I 4LF9E 4USKA 1KIJA 1XMOI 4DV2I 4DR3I 1Z0GA 4FWHA 4PRXA 3PYEA 4MYTA 2OI2A 5LMUE 1J5EE 2UU9I 4P52A 3QT5A 4KHPI 4DR4I 4DR3E 3WU4A 3WU6A 4B3RE 1HNWI 4JI8E 4JYAI 3J81Q 4X66I 4DPUA 1QZRA 1Z59A 4LF4E 4GKKE 4UT4A
chains in the Genus database with same CATH superfamily
4R1FA 1MU5A 2JEBB 2HHHI 2UUBI 1MG7A 1N33E 4AQYI 3M85G 2A2DA 1N36E 4DR4E 2AJ4A 3QT6A 3ZZUA 2PO2B 2WP8A 2NN6D 2WNRA 5L3JA 2AE8A 4B3SE 4DV5I 4DPTA 1UDNA 4DUZE 1E3PA 2IOQA 2VQEI 1HR0E 4IZKB 1NHIA 4AM3A 5DRQA 3CDJA 1PIEA 1FKAE 2BM1A 1N36I 1ZXNA 2E1RA 4JI4E 4LF7E 3LNUA 5DNLA 2PO1B 1EA6A 2GS8A 3V5RA 4B3SI 3M6AA 4OO1B 4DR5E 5DRRA 3L7ZA 4JI5E 4XTJA 4JI2I 4LF9I 4P7AA 4QNKA 2CZ9A 4J3DA 4AQYE 3H4LA 4DR6I 4FWDA 4U3DA 4MU0A 3T1HE 1ZXMA 1FWKA 2UXDI 1XHKA 1Z5CA 4LF6E 2JT2A 4DV0I 4WUBA 1Y4SA 1IBKI 1D6TA 3LTOA 1Z0CA 2JE6A 5GMDA 1OJ4A 1Z5AA 1XNRE 5LMUI 2BA0D 4IS9A 1N32I 2V2ZA 5K36A 1I94I 2BA1D 3K85A 2J65A 2UXBI 4MU1A 1IBME 4HY1A 2HFSA 3WU5A 4X65E 4LFAI 3PYDA 4WUCA 1ZM2A 1U2RA 4LFCI 4FW5A 2GO3A 4DV3E 3D4JA 4LF5I 4LF4I 2F4VE 4DU7A 4FW3A 2ZBKB 2V2VA 4JI3E 1XNQI 4DUYI 3QT8A 4DR2E 5LMNI 2HFUA 1S16A 5A2QQ 1OYRA 2UXBE 4DV1E 1XMQI 5K36C 4X64E 2BV3A 4KQVA 4K0KI 1UDOA 3PS1A 5C0XC 2Q2EB 4FW9A 3UHMA 1IBKE 4FN5A 5IWAE 4IFDD 1NHJA 2C38B 1RHYA 2PNLA 1USUA 4NXMI 2C37B 2PO1A 4USMA 1DARA 4BA2B 5EL9A 5FLXC 1N0VC 1Z5BA 3J7AM 4FW6A 4DV6E 4QNJA 1UEKA 1RR9A 3PS2A 2GQ0A 4ED4A 5DROA 4DV5E 2VF3A 3K1JA 5FLXQ 4JV5I 2NN6C 5FWKA 1UDSA 4DV4E 5JEAB 3ZKDA 4LF8I 2CVEA 3HJCA 4Z7CA 2VQFI 4B3TE 5LMNE 4NBQA 5LL6R 1XMOE 4IFDA 2X36A 2JEAB 4LFBE 4X62I 4JI7I 3F0NA 1N34E 1Y5YA 1Y4UA 3P3EA 5C0XA 4K0KE 2C39B 3ZZ0A 4LF6I 3PRYA 5A2QC 2BA0G 2HKEA 3T1YE 4DPWA 2E5LE 5JEAC 4IZJA 4DU8A 5K36F 4NXME 2NN6B 2V2QA 2PO2A 3U1YA 1J5EI 4ZVIA 3CWVA 2IOPA 1I94E 3U1KA 4URLA 2Z5BB 2V34A 1N34I 2NN6E 1B62A 4NXNE 2PNMA 2IESA 4X65I 4LFAE 1FJGI 3B8HA 4YY3E 3Q1QA 2R3VA 1KKHA 4HACA 1HNZI 4DPXA 3HKMA 5K36D 4YHHE 4DV7E 2UUAE 4IZKA 3GONA 3H1CA 1PKPA 1N0UA 2HK3A 4DV0E 5K36E 2BM0A 4BA2A 1H73A 3DD6A 5GMEA 4DR1E 2V8PA 2WW4A 4U3BA 4DR2I 2HHHE 2UUBE 1XNQE 1N33I 4LCHA 3P06A 2O1UA 3QT7A 3GCMA 2ZITA 5IT9C 2UUAI 1XXEA 1ZM4A 4DV1I 2HK2A 2ZM6I 1Z0WA 1Z0EA 4NXNI 2BR2A 4DV6I 4OO1E 4N3OA 3PYGA 4PU9A 2DEJA 4JI0I 4GKJE 4B3MI 4JI3I 4DR5I 1FNMA 1K47A 4JI2E 4LF8E 2JE6B 1WUUA 3PS3A 4B3TI 4HXZA 4DV2E 3K17A 3P76A 4LCFA 1KVKA 2EFGA 3V2UC 4DXLA 2UXDE 1Y6ZA 3GLLA 4I3HA 1VI7A 1NZ0A 5IWAI 1VISA 4JI1I 2NN6F 1HK7A 5IT9Q 2UXCI 4BA1A 2WNRB 4FWGA 1N32E 4OO1C 1H72C 1FI4A 1S4EA 2UUCI 4JI6E 4DR6E 1HNXE 4DPYA 3LPSA 4HACB 4JYAE 2C37A 4X66E 5BR8E 3ZKBA 4JG4A 4OX9I 4RPFA 4JI1E 2VQFE 2F4VI 1NHHA 5JEAF 2O1TA 4Z7YA 2VQEE 2A2CA 4OO1A 1HR0I 1Z0BA 1H7UA 2VESA 1EI1A 3OTOE 4YHHI 2PO0B 1IBLE 3J80Q 2JEBA 4DR7I 3NZKA 2JEAA 4AIDA 2UXCE 1UDQA 1H7SA 4DUYE 4OO1F 3B82A 5DNXA 5JEAA 5C0XB 2PNZB 5EKWA 2UUCE 2WP8B 3PYFA 4KHPE 4X64I 2LJPA 5K36B 4WUDA 1R6MA 4ISAA 4JV5E 3M7NG 4JI0E 3CDIA 1HNZE 4DR1I 1R6LA 4HYMA 1XNRI 1ZM3A 1E3HA 1USVA 4JI7E 4X62E 2NN6A 4MYUA 3OTOI 1IBMI 4M1KA 5C0XF 4BA1B 3ZM7A 4GKKI 2NPFA 4IFDF 4LF5E 1A6FA 2E5LI 2O1VA 2O3ZA 1FWLA 4MU4A 1Z0VA 1PVGA 2O1WA 4FW4A 4LFBI 1P42A 3J80C 4EMDA 1OYSA 4UTGA 2ZM6E 3JAMQ 4OO1D 2XEXA 2Z5CA 3L7ZB 3J7AG 1XMQE 4JI8I 3J81C 1BKNA 1Y60A 4B3ME 1MX0A 3JAMC 4YY3I 5BR8I 4MDTA 3T1YI 2GO4A 4FW7A 2DEIA 3ZZTA 4DUZI 1KTVA 2PO0A 5C0XE 3HULA 1B63A 2X7IA 3Q6NA 4JI6I 2C39A 3GMEA 2HKJA 4LF7I 4IFDE 2IERA 1ZM9A 1H74A 5ELWA 1RREA 4IFDB 4IZJD 1FJGE 1Z0TA 4OX9E 2PNZA 4IFDC 2BR2B 3B78A 4JI5I 1YH8A 5C0XD 2J7KA 2Z5BA 3KRNA 4LOMA 2UU9E 4DV7I 1HNXI 1ELOA 4JI4I 4IZJB 3T1HI 4B3RI 1HNWE 4PRVA 4OKGA 1IBLI 3WU3A 4LCGA 4GKJI 4LFCE 4DR7E 1OYPA 2R42A 4DV3I 4DV4I 1YHCA 4LF9E 4GQUA 4USKA 1KIJA 4LPFA 1XMOI 4OZEA 4DV2I 3Q6MA 4DR3I 2C38A 1Z0GA 5JEAE 4FWHA 4PRXA 4AIMA 5DRPA 3M7ND 2F1DA 3PYEA 2OI2A 4MYTA 2Z5CB 5LMUE 2CGEA 3P3CA 1J5EE 2Z5EA 2CG9A 2UU9I 4P52A 3QT5A 4KHPI 4DR4I 4DR3E 3WU4A 3WU6A 4B3RE 1HNWI 4MQYA 2BA1G 5JEAD 3M85D 4JI8E 4JYAI 3P3GA 3J81Q 4X66I 4DPUA 1QZRA 1Z59A 4MU3A 4LF4E 4GKKE 3B4TA 4UT4A
chains in the Genus database with same CATH topology
4R1FA 1MU5A 2HHHI 2UUBI 1MG7A 1N33E 4AQYI 2A2DA 1N36E 4DR4E 2AJ4A 3QT6A 3ZZUA 5L3JA 4B3SE 4DV5I 4DPTA 4DUZE 2IOQA 2VQEI 1HR0E 4IZKB 1NHIA 1PIEA 1FKAE 2BM1A 1N36I 1ZXNA 2E1RA 4JI4E 4LF7E 3LNUA 1EA6A 2GS8A 3V5RA 4B3SI 3M6AA 4DR5E 4JI5E 4XTJA 4JI2I 4LF9I 4P7AA 2CZ9A 4AQYE 3H4LA 4DR6I 4FWDA 3T1HE 1ZXMA 1FWKA 2UXDI 1XHKA 1Z5CA 4LF6E 4DV0I 4WUBA 1Y4SA 1IBKI 1D6TA 3LTOA 1Z0CA 5GMDA 1OJ4A 1Z5AA 1XNRE 5LMUI 1N32I 2V2ZA 1I94I 3K85A 2UXBI 1IBME 4HY1A 2HFSA 3WU5A 4X65E 4LFAI 3PYDA 4WUCA 1ZM2A 1U2RA 4LFCI 4DV3E 3D4JA 4LF5I 4LF4I 2F4VE 4DU7A 2ZBKB 2V2VA 4JI3E 1XNQI 4DUYI 3QT8A 4DR2E 5LMNI 2HFUA 1S16A 5A2QQ 2UXBE 4DV1E 1XMQI 4X64E 2BV3A 4KQVA 4K0KI 2Q2EB 4FW9A 1IBKE 4FN5A 5IWAE 1NHJA 2PNLA 1USUA 4NXMI 4USMA 1DARA 5FLXC 1N0VC 1Z5BA 3J7AM 4DV6E 1UEKA 1RR9A 2GQ0A 4ED4A 4DV5E 2VF3A 3K1JA 5FLXQ 4JV5I 5FWKA 4DV4E 3ZKDA 4LF8I 3HJCA 4Z7CA 2VQFI 4B3TE 5LMNE 5LL6R 1XMOE 2X36A 4LFBE 4X62I 4JI7I 3F0NA 1N34E 1Y4UA 4K0KE 3ZZ0A 4LF6I 3PRYA 5A2QC 2HKEA 3T1YE 4DPWA 2E5LE 4IZJA 4DU8A 4NXME 2V2QA 1J5EI 4ZVIA 3CWVA 2IOPA 1I94E 4URLA 2Z5BB 2V34A 1N34I 1B62A 4NXNE 2PNMA 4X65I 4LFAE 1FJGI 3B8HA 4YY3E 3Q1QA 2R3VA 1KKHA 4HACA 1HNZI 4DPXA 4YHHE 4DV7E 2UUAE 4IZKA 3GONA 1PKPA 1N0UA 2HK3A 4DV0E 2BM0A 1H73A 5GMEA 4DR1E 2V8PA 2WW4A 4DR2I 2UUBE 2HHHE 1XNQE 1N33I 3P06A 2O1UA 3QT7A 2ZITA 5IT9C 2UUAI 4DV1I 1ZM4A 2HK2A 2ZM6I 1Z0WA 1Z0EA 4NXNI 4DV6I 4N3OA 3PYGA 4PU9A 2DEJA 4JI0I 4GKJE 4B3MI 4JI3I 4DR5I 1FNMA 1K47A 4JI2E 4LF8E 1WUUA 4B3TI 4HXZA 4DV2E 3K17A 1KVKA 2EFGA 3V2UC 4DXLA 2UXDE 1Y6ZA 4I3HA 1NZ0A 5IWAI 1VISA 4JI1I 1HK7A 5IT9Q 2UXCI 4FWGA 1N32E 1H72C 1FI4A 1S4EA 2UUCI 4JI6E 4DR6E 1HNXE 4DPYA 3LPSA 4HACB 4JYAE 4X66E 5BR8E 3ZKBA 4JG4A 4OX9I 4RPFA 4JI1E 2VQFE 2F4VI 1NHHA 2O1TA 4Z7YA 2VQEE 2A2CA 1HR0I 1Z0BA 1H7UA 1EI1A 3OTOE 4YHHI 1IBLE 3J80Q 4DR7I 2UXCE 1H7SA 4DUYE 3B82A 2UUCE 3PYFA 4KHPE 4X64I 2LJPA 4WUDA 4JV5E 4JI0E 1HNZE 4DR1I 4HYMA 1XNRI 1ZM3A 1USVA 4JI7E 4X62E 4MYUA 3OTOI 1IBMI 4M1KA 3ZM7A 4GKKI 2NPFA 4LF5E 1A6FA 2E5LI 2O1VA 1FWLA 1Z0VA 1PVGA 2O1WA 4LFBI 3J80C 4EMDA 4UTGA 2ZM6E 3JAMQ 2XEXA 2Z5CA 3J7AG 1XMQE 4JI8I 3J81C 1BKNA 4B3ME 1MX0A 3JAMC 4YY3I 5BR8I 3T1YI 2DEIA 3ZZTA 4DUZI 1KTVA 3HULA 1B63A 2X7IA 3Q6NA 4JI6I 2HKJA 4LF7I 1ZM9A 1H74A 1RREA 4IZJD 1FJGE 1Z0TA 4OX9E 3B78A 4JI5I 2J7KA 2Z5BA 2UU9E 4DV7I 1HNXI 1ELOA 4JI4I 4IZJB 3T1HI 4B3RI 1HNWE 4PRVA 1IBLI 3WU3A 4GKJI 4LFCE 4DR7E 2R42A 4DV4I 4DV3I 4LF9E 4USKA 1KIJA 1XMOI 4DV2I 3Q6MA 4DR3I 1Z0GA 4FWHA 4PRXA 3PYEA 4MYTA 2OI2A 5LMUE 2Z5CB 2CGEA 1J5EE 2Z5EA 2CG9A 2UU9I 4P52A 3QT5A 4KHPI 4DR4I 4DR3E 3WU4A 3WU6A 4B3RE 1HNWI 4JI8E 4JYAI 3J81Q 4X66I 4DPUA 1QZRA 1Z59A 4LF4E 4GKKE 4UT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1F A;  1MU5 A;  2HHH I;  2UUB I;  1MG7 A;  1N33 E;  4AQY I;  2A2D A;  1N36 E;  4DR4 E;  2AJ4 A;  3QT6 A;  3ZZU A;  5L3J A;  4B3S E;  4DV5 I;  4DPT A;  4DUZ E;  2VQE I;  1HR0 E;  1NHI A;  1PIE A;  1FKA E;  2BM1 A;  1N36 I;  1ZXN A;  2E1R A;  4JI4 E;  4LF7 E;  3LNU A;  1EA6 A;  2GS8 A;  3V5R A;  4B3S I;  3M6A A;  4DR5 E;  4JI5 E;  4XTJ A;  4JI2 I;  4LF9 I;  4P7A A;  2CZ9 A;  4AQY E;  3H4L A;  4DR6 I;  4FWD A;  3T1H E;  1ZXM A;  1FWK A;  2UXD I;  1XHK A;  1Z5C A;  4LF6 E;  4DV0 I;  4WUB A;  1IBK I;  1D6T A;  3LTO A;  1Z0C A;  5GMD A;  1OJ4 A;  1Z5A A;  1XNR E;  5LMU I;  1N32 I;  2V2Z A;  1I94 I;  2UXB I;  1IBM E;  4HY1 A;  2HFS A;  3WU5 A;  4X65 E;  4LFA I;  3PYD A;  4WUC A;  1ZM2 A;  1U2R A;  4LFC I;  4DV3 E;  3D4J A;  4LF5 I;  4LF4 I;  2F4V E;  4DU7 A;  2ZBK B;  2V2V A;  4JI3 E;  1XNQ I;  4DUY I;  3QT8 A;  4DR2 E;  5LMN I;  2HFU A;  1S16 A;  5A2Q Q;  2UXB E;  4DV1 E;  1XMQ I;  4X64 E;  2BV3 A;  4KQV A;  4K0K I;  2Q2E B;  4FW9 A;  1IBK E;  4FN5 A;  5IWA E;  1NHJ A;  4NXM I;  4USM A;  1DAR A;  5FLX C;  1N0V C;  1Z5B A;  3J7A M;  4DV6 E;  1UEK A;  1RR9 A;  4DV5 E;  4ED4 A;  2VF3 A;  3K1J A;  5FLX Q;  4JV5 I;  4DV4 E;  3ZKD A;  4LF8 I;  4Z7C A;  2VQF I;  4B3T E;  5LMN E;  5LL6 R;  1XMO E;  2X36 A;  4LFB E;  4X62 I;  4JI7 I;  3F0N A;  1N34 E;  4K0K E;  3ZZ0 A;  4LF6 I;  5A2Q C;  2HKE A;  3T1Y E;  4DPW A;  2E5L E;  4DU8 A;  4NXM E;  2V2Q A;  1J5E I;  4ZVI A;  3CWV A;  1I94 E;  4URL A;  2V34 A;  1N34 I;  1B62 A;  4NXN E;  4X65 I;  4LFA E;  1FJG I;  3B8H A;  4YY3 E;  3Q1Q A;  2R3V A;  1KKH A;  4HAC A;  1HNZ I;  4DPX A;  4YHH E;  4DV7 E;  2UUA E;  3GON A;  1PKP A;  1N0U A;  2HK3 A;  4DV0 E;  2BM0 A;  1H73 A;  5GME A;  4DR1 E;  2V8P A;  2WW4 A;  4DR2 I;  2HHH E;  2UUB E;  1XNQ E;  1N33 I;  3QT7 A;  2ZIT A;  5IT9 C;  2UUA I;  4DV1 I;  1ZM4 A;  2HK2 A;  2ZM6 I;  1Z0W A;  1Z0E A;  4NXN I;  4DV6 I;  3PYG A;  4PU9 A;  2DEJ A;  4JI0 I;  4GKJ E;  4B3M I;  4JI3 I;  4DR5 I;  1FNM A;  1K47 A;  4JI2 E;  4LF8 E;  1WUU A;  4B3T I;  4HXZ A;  4DV2 E;  3K17 A;  1KVK A;  2EFG A;  3V2U C;  4DXL A;  2UXD E;  4I3H A;  1NZ0 A;  5IWA I;  1VIS A;  4JI1 I;  5IT9 Q;  2UXC I;  4FWG A;  1N32 E;  1H72 C;  1FI4 A;  1S4E A;  2UUC I;  4JI6 E;  4DR6 E;  1HNX E;  4DPY A;  3LPS A;  4HAC B;  4JYA E;  4X66 E;  5BR8 E;  3ZKB A;  4JG4 A;  4OX9 I;  4RPF A;  4JI1 E;  2VQF E;  2F4V I;  1NHH A;  4Z7Y A;  2VQE E;  2A2C A;  1HR0 I;  1Z0B A;  1H7U A;  1EI1 A;  3OTO E;  4YHH I;  1IBL E;  3J80 Q;  4DR7 I;  2UXC E;  1H7S A;  4DUY E;  3B82 A;  2UUC E;  3PYF A;  4KHP E;  4X64 I;  2LJP A;  4WUD A;  4JV5 E;  4JI0 E;  1HNZ E;  4DR1 I;  4HYM A;  1XNR I;  1ZM3 A;  4JI7 E;  4X62 E;  4MYU A;  3OTO I;  1IBM I;  4M1K A;  3ZM7 A;  4GKK I;  2NPF A;  4LF5 E;  1A6F A;  2E5L I;  1FWL A;  1Z0V A;  1PVG A;  4LFB I;  3J80 C;  4EMD A;  4UTG A;  2ZM6 E;  3JAM Q;  2XEX A;  3J7A G;  1XMQ E;  4JI8 I;  3J81 C;  1BKN A;  4B3M E;  1MX0 A;  3JAM C;  4YY3 I;  5BR8 I;  3T1Y I;  2DEI A;  3ZZT A;  4DUZ I;  1KTV A;  3HUL A;  1B63 A;  2X7I A;  4JI6 I;  2HKJ A;  4LF7 I;  1ZM9 A;  1H74 A;  1RRE A;  1FJG E;  1Z0T A;  4OX9 E;  3B78 A;  4JI5 I;  2J7K A;  2UU9 E;  4DV7 I;  1HNX I;  1ELO A;  4JI4 I;  3T1H I;  4B3R I;  1HNW E;  4PRV A;  1IBL I;  3WU3 A;  4GKJ I;  4LFC E;  4DR7 E;  2R42 A;  4DV4 I;  4DV3 I;  4LF9 E;  4USK A;  1KIJ A;  1XMO I;  4DV2 I;  4DR3 I;  1Z0G A;  4FWH A;  4PRX A;  3PYE A;  4MYT A;  2OI2 A;  5LMU E;  1J5E E;  2UU9 I;  4P52 A;  3QT5 A;  4KHP I;  4DR4 I;  4DR3 E;  3WU4 A;  3WU6 A;  4B3R E;  1HNW I;  4JI8 E;  4JYA I;  3J81 Q;  4X66 I;  4DPU A;  1QZR A;  1Z59 A;  4LF4 E;  4GKK E;  4UT4 A; 
#chains in the Genus database with same CATH topology
 4R1F A;  1MU5 A;  2JEB B;  2HHH I;  2UUB I;  1MG7 A;  1N33 E;  4AQY I;  3M85 G;  2A2D A;  1N36 E;  4DR4 E;  2AJ4 A;  3QT6 A;  3ZZU A;  2PO2 B;  2WP8 A;  2NN6 D;  2WNR A;  5L3J A;  2AE8 A;  4B3S E;  4DV5 I;  4DPT A;  1UDN A;  4DUZ E;  1E3P A;  2IOQ A;  2VQE I;  1HR0 E;  4IZK B;  1NHI A;  4AM3 A;  5DRQ A;  3CDJ A;  1PIE A;  1FKA E;  2BM1 A;  1N36 I;  1ZXN A;  2E1R A;  4JI4 E;  4LF7 E;  3LNU A;  5DNL A;  2PO1 B;  1EA6 A;  2GS8 A;  3V5R A;  4B3S I;  3M6A A;  4OO1 B;  4DR5 E;  5DRR A;  3L7Z A;  4JI5 E;  4XTJ A;  4JI2 I;  4LF9 I;  4P7A A;  4QNK A;  2CZ9 A;  4J3D A;  4AQY E;  3H4L A;  4DR6 I;  4FWD A;  4U3D A;  4MU0 A;  3T1H E;  1ZXM A;  1FWK A;  2UXD I;  1XHK A;  1Z5C A;  4LF6 E;  2JT2 A;  4DV0 I;  4WUB A;  1Y4S A;  1IBK I;  1D6T A;  3LTO A;  1Z0C A;  2JE6 A;  5GMD A;  1OJ4 A;  1Z5A A;  1XNR E;  5LMU I;  2BA0 D;  4IS9 A;  1N32 I;  2V2Z A;  5K36 A;  1I94 I;  2BA1 D;  3K85 A;  2J65 A;  2UXB I;  4MU1 A;  1IBM E;  4HY1 A;  2HFS A;  3WU5 A;  4X65 E;  4LFA I;  3PYD A;  4WUC A;  1ZM2 A;  1U2R A;  4LFC I;  4FW5 A;  2GO3 A;  4DV3 E;  3D4J A;  4LF5 I;  4LF4 I;  2F4V E;  4DU7 A;  4FW3 A;  2ZBK B;  2V2V A;  4JI3 E;  1XNQ I;  4DUY I;  3QT8 A;  4DR2 E;  5LMN I;  2HFU A;  1S16 A;  5A2Q Q;  1OYR A;  2UXB E;  4DV1 E;  1XMQ I;  5K36 C;  4X64 E;  2BV3 A;  4KQV A;  4K0K I;  1UDO A;  3PS1 A;  5C0X C;  2Q2E B;  4FW9 A;  3UHM A;  1IBK E;  4FN5 A;  5IWA E;  4IFD D;  1NHJ A;  2C38 B;  1RHY A;  2PNL A;  1USU A;  4NXM I;  2C37 B;  2PO1 A;  4USM A;  1DAR A;  4BA2 B;  5EL9 A;  5FLX C;  1N0V C;  1Z5B A;  3J7A M;  4FW6 A;  4DV6 E;  4QNJ A;  1UEK A;  1RR9 A;  3PS2 A;  2GQ0 A;  4ED4 A;  5DRO A;  4DV5 E;  2VF3 A;  3K1J A;  5FLX Q;  4JV5 I;  2NN6 C;  5FWK A;  1UDS A;  4DV4 E;  5JEA B;  3ZKD A;  4LF8 I;  2CVE A;  3HJC A;  4Z7C A;  2VQF I;  4B3T E;  5LMN E;  4NBQ A;  5LL6 R;  1XMO E;  4IFD A;  2X36 A;  2JEA B;  4LFB E;  4X62 I;  4JI7 I;  3F0N A;  1N34 E;  1Y5Y A;  1Y4U A;  3P3E A;  5C0X A;  4K0K E;  2C39 B;  3ZZ0 A;  4LF6 I;  3PRY A;  5A2Q C;  2BA0 G;  2HKE A;  3T1Y E;  4DPW A;  2E5L E;  5JEA C;  4IZJ A;  4DU8 A;  5K36 F;  4NXM E;  2NN6 B;  2V2Q A;  2PO2 A;  3U1Y A;  1J5E I;  4ZVI A;  3CWV A;  2IOP A;  1I94 E;  3U1K A;  4URL A;  2Z5B B;  2V34 A;  1N34 I;  2NN6 E;  1B62 A;  4NXN E;  2PNM A;  2IES A;  4X65 I;  4LFA E;  1FJG I;  3B8H A;  4YY3 E;  3Q1Q A;  2R3V A;  1KKH A;  4HAC A;  1HNZ I;  4DPX A;  3HKM A;  5K36 D;  4YHH E;  4DV7 E;  2UUA E;  4IZK A;  3GON A;  3H1C A;  1PKP A;  1N0U A;  2HK3 A;  4DV0 E;  5K36 E;  2BM0 A;  4BA2 A;  1H73 A;  3DD6 A;  5GME A;  4DR1 E;  2V8P A;  2WW4 A;  4U3B A;  4DR2 I;  2HHH E;  2UUB E;  1XNQ E;  1N33 I;  4LCH A;  3P06 A;  2O1U A;  3QT7 A;  3GCM A;  2ZIT A;  5IT9 C;  2UUA I;  1XXE A;  1ZM4 A;  4DV1 I;  2HK2 A;  2ZM6 I;  1Z0W A;  1Z0E A;  4NXN I;  2BR2 A;  4DV6 I;  4OO1 E;  4N3O A;  3PYG A;  4PU9 A;  2DEJ A;  4JI0 I;  4GKJ E;  4B3M I;  4JI3 I;  4DR5 I;  1FNM A;  1K47 A;  4JI2 E;  4LF8 E;  2JE6 B;  1WUU A;  3PS3 A;  4B3T I;  4HXZ A;  4DV2 E;  3K17 A;  3P76 A;  4LCF A;  1KVK A;  2EFG A;  3V2U C;  4DXL A;  2UXD E;  1Y6Z A;  3GLL A;  4I3H A;  1VI7 A;  1NZ0 A;  5IWA I;  1VIS A;  4JI1 I;  2NN6 F;  1HK7 A;  5IT9 Q;  2UXC I;  4BA1 A;  2WNR B;  4FWG A;  1N32 E;  4OO1 C;  1H72 C;  1FI4 A;  1S4E A;  2UUC I;  4JI6 E;  4DR6 E;  1HNX E;  4DPY A;  3LPS A;  4HAC B;  4JYA E;  2C37 A;  4X66 E;  5BR8 E;  3ZKB A;  4JG4 A;  4OX9 I;  4RPF A;  4JI1 E;  2VQF E;  2F4V I;  1NHH A;  5JEA F;  2O1T A;  4Z7Y A;  2VQE E;  2A2C A;  4OO1 A;  1HR0 I;  1Z0B A;  1H7U A;  2VES A;  1EI1 A;  3OTO E;  4YHH I;  2PO0 B;  1IBL E;  3J80 Q;  2JEB A;  4DR7 I;  3NZK A;  2JEA A;  4AID A;  2UXC E;  1UDQ A;  1H7S A;  4DUY E;  4OO1 F;  3B82 A;  5DNX A;  5JEA A;  5C0X B;  2PNZ B;  5EKW A;  2UUC E;  2WP8 B;  3PYF A;  4KHP E;  4X64 I;  2LJP A;  5K36 B;  4WUD A;  1R6M A;  4ISA A;  4JV5 E;  3M7N G;  4JI0 E;  3CDI A;  1HNZ E;  4DR1 I;  1R6L A;  4HYM A;  1XNR I;  1ZM3 A;  1E3H A;  1USV A;  4JI7 E;  4X62 E;  2NN6 A;  4MYU A;  3OTO I;  1IBM I;  4M1K A;  5C0X F;  4BA1 B;  3ZM7 A;  4GKK I;  2NPF A;  4IFD F;  4LF5 E;  1A6F A;  2E5L I;  2O1V A;  2O3Z A;  1FWL A;  4MU4 A;  1Z0V A;  1PVG A;  2O1W A;  4FW4 A;  4LFB I;  1P42 A;  3J80 C;  4EMD A;  1OYS A;  4UTG A;  2ZM6 E;  3JAM Q;  4OO1 D;  2XEX A;  2Z5C A;  3L7Z B;  3J7A G;  1XMQ E;  4JI8 I;  3J81 C;  1BKN A;  1Y60 A;  4B3M E;  1MX0 A;  3JAM C;  4YY3 I;  5BR8 I;  4MDT A;  3T1Y I;  2GO4 A;  4FW7 A;  2DEI A;  3ZZT A;  4DUZ I;  1KTV A;  2PO0 A;  5C0X E;  3HUL A;  1B63 A;  2X7I A;  3Q6N A;  4JI6 I;  2C39 A;  3GME A;  2HKJ A;  4LF7 I;  4IFD E;  2IER A;  1ZM9 A;  1H74 A;  5ELW A;  1RRE A;  4IFD B;  4IZJ D;  1FJG E;  1Z0T A;  4OX9 E;  2PNZ A;  4IFD C;  2BR2 B;  3B78 A;  4JI5 I;  1YH8 A;  5C0X D;  2J7K A;  2Z5B A;  3KRN A;  4LOM A;  2UU9 E;  4DV7 I;  1HNX I;  1ELO A;  4JI4 I;  4IZJ B;  3T1H I;  4B3R I;  1HNW E;  4PRV A;  4OKG A;  1IBL I;  3WU3 A;  4LCG A;  4GKJ I;  4LFC E;  4DR7 E;  1OYP A;  2R42 A;  4DV3 I;  4DV4 I;  1YHC A;  4LF9 E;  4GQU A;  4USK A;  1KIJ A;  4LPF A;  1XMO I;  4OZE A;  4DV2 I;  3Q6M A;  4DR3 I;  2C38 A;  1Z0G A;  5JEA E;  4FWH A;  4PRX A;  4AIM A;  5DRP A;  3M7N D;  2F1D A;  3PYE A;  2OI2 A;  4MYT A;  2Z5C B;  5LMU E;  2CGE A;  3P3C A;  1J5E E;  2Z5E A;  2CG9 A;  2UU9 I;  4P52 A;  3QT5 A;  4KHP I;  4DR4 I;  4DR3 E;  3WU4 A;  3WU6 A;  4B3R E;  1HNW I;  4MQY A;  2BA1 G;  5JEA D;  3M85 D;  4JI8 E;  4JYA I;  3P3G A;  3J81 Q;  4X66 I;  4DPU A;  1QZR A;  1Z59 A;  4MU3 A;  4LF4 E;  4GKK E;  3B4T A;  4UT4 A; 
#chains in the Genus database with same CATH homology
 4R1F A;  1MU5 A;  2HHH I;  2UUB I;  1MG7 A;  1N33 E;  4AQY I;  2A2D A;  1N36 E;  4DR4 E;  2AJ4 A;  3QT6 A;  3ZZU A;  5L3J A;  4B3S E;  4DV5 I;  4DPT A;  4DUZ E;  2IOQ A;  2VQE I;  1HR0 E;  4IZK B;  1NHI A;  1PIE A;  1FKA E;  2BM1 A;  1N36 I;  1ZXN A;  2E1R A;  4JI4 E;  4LF7 E;  3LNU A;  1EA6 A;  2GS8 A;  3V5R A;  4B3S I;  3M6A A;  4DR5 E;  4JI5 E;  4XTJ A;  4JI2 I;  4LF9 I;  4P7A A;  2CZ9 A;  4AQY E;  3H4L A;  4DR6 I;  4FWD A;  3T1H E;  1ZXM A;  1FWK A;  2UXD I;  1XHK A;  1Z5C A;  4LF6 E;  4DV0 I;  4WUB A;  1Y4S A;  1IBK I;  1D6T A;  3LTO A;  1Z0C A;  5GMD A;  1OJ4 A;  1Z5A A;  1XNR E;  5LMU I;  1N32 I;  2V2Z A;  1I94 I;  3K85 A;  2UXB I;  1IBM E;  4HY1 A;  2HFS A;  3WU5 A;  4X65 E;  4LFA I;  3PYD A;  4WUC A;  1ZM2 A;  1U2R A;  4LFC I;  4DV3 E;  3D4J A;  4LF5 I;  4LF4 I;  2F4V E;  4DU7 A;  2ZBK B;  2V2V A;  4JI3 E;  1XNQ I;  4DUY I;  3QT8 A;  4DR2 E;  5LMN I;  2HFU A;  1S16 A;  5A2Q Q;  2UXB E;  4DV1 E;  1XMQ I;  4X64 E;  2BV3 A;  4KQV A;  4K0K I;  2Q2E B;  4FW9 A;  1IBK E;  4FN5 A;  5IWA E;  1NHJ A;  2PNL A;  1USU A;  4NXM I;  4USM A;  1DAR A;  5FLX C;  1N0V C;  1Z5B A;  3J7A M;  4DV6 E;  1UEK A;  1RR9 A;  2GQ0 A;  4ED4 A;  4DV5 E;  2VF3 A;  3K1J A;  5FLX Q;  4JV5 I;  5FWK A;  4DV4 E;  3ZKD A;  4LF8 I;  3HJC A;  4Z7C A;  2VQF I;  4B3T E;  5LMN E;  5LL6 R;  1XMO E;  2X36 A;  4LFB E;  4X62 I;  4JI7 I;  3F0N A;  1N34 E;  1Y4U A;  4K0K E;  3ZZ0 A;  4LF6 I;  3PRY A;  5A2Q C;  2HKE A;  3T1Y E;  4DPW A;  2E5L E;  4IZJ A;  4DU8 A;  4NXM E;  2V2Q A;  1J5E I;  4ZVI A;  3CWV A;  2IOP A;  1I94 E;  4URL A;  2Z5B B;  2V34 A;  1N34 I;  1B62 A;  4NXN E;  2PNM A;  4X65 I;  4LFA E;  1FJG I;  3B8H A;  4YY3 E;  3Q1Q A;  2R3V A;  1KKH A;  4HAC A;  1HNZ I;  4DPX A;  4YHH E;  4DV7 E;  2UUA E;  4IZK A;  3GON A;  1PKP A;  1N0U A;  2HK3 A;  4DV0 E;  2BM0 A;  1H73 A;  5GME A;  4DR1 E;  2V8P A;  2WW4 A;  4DR2 I;  2UUB E;  2HHH E;  1XNQ E;  1N33 I;  3P06 A;  2O1U A;  3QT7 A;  2ZIT A;  5IT9 C;  2UUA I;  4DV1 I;  1ZM4 A;  2HK2 A;  2ZM6 I;  1Z0W A;  1Z0E A;  4NXN I;  4DV6 I;  4N3O A;  3PYG A;  4PU9 A;  2DEJ A;  4JI0 I;  4GKJ E;  4B3M I;  4JI3 I;  4DR5 I;  1FNM A;  1K47 A;  4JI2 E;  4LF8 E;  1WUU A;  4B3T I;  4HXZ A;  4DV2 E;  3K17 A;  1KVK A;  2EFG A;  3V2U C;  4DXL A;  2UXD E;  1Y6Z A;  4I3H A;  1NZ0 A;  5IWA I;  1VIS A;  4JI1 I;  1HK7 A;  5IT9 Q;  2UXC I;  4FWG A;  1N32 E;  1H72 C;  1FI4 A;  1S4E A;  2UUC I;  4JI6 E;  4DR6 E;  1HNX E;  4DPY A;  3LPS A;  4HAC B;  4JYA E;  4X66 E;  5BR8 E;  3ZKB A;  4JG4 A;  4OX9 I;  4RPF A;  4JI1 E;  2VQF E;  2F4V I;  1NHH A;  2O1T A;  4Z7Y A;  2VQE E;  2A2C A;  1HR0 I;  1Z0B A;  1H7U A;  1EI1 A;  3OTO E;  4YHH I;  1IBL E;  3J80 Q;  4DR7 I;  2UXC E;  1H7S A;  4DUY E;  3B82 A;  2UUC E;  3PYF A;  4KHP E;  4X64 I;  2LJP A;  4WUD A;  4JV5 E;  4JI0 E;  1HNZ E;  4DR1 I;  4HYM A;  1XNR I;  1ZM3 A;  1USV A;  4JI7 E;  4X62 E;  4MYU A;  3OTO I;  1IBM I;  4M1K A;  3ZM7 A;  4GKK I;  2NPF A;  4LF5 E;  1A6F A;  2E5L I;  2O1V A;  1FWL A;  1Z0V A;  1PVG A;  2O1W A;  4LFB I;  3J80 C;  4EMD A;  4UTG A;  2ZM6 E;  3JAM Q;  2XEX A;  2Z5C A;  3J7A G;  1XMQ E;  4JI8 I;  3J81 C;  1BKN A;  4B3M E;  1MX0 A;  3JAM C;  4YY3 I;  5BR8 I;  3T1Y I;  2DEI A;  3ZZT A;  4DUZ I;  1KTV A;  3HUL A;  1B63 A;  2X7I A;  3Q6N A;  4JI6 I;  2HKJ A;  4LF7 I;  1ZM9 A;  1H74 A;  1RRE A;  4IZJ D;  1FJG E;  1Z0T A;  4OX9 E;  3B78 A;  4JI5 I;  2J7K A;  2Z5B A;  2UU9 E;  4DV7 I;  1HNX I;  1ELO A;  4JI4 I;  4IZJ B;  3T1H I;  4B3R I;  1HNW E;  4PRV A;  1IBL I;  3WU3 A;  4GKJ I;  4LFC E;  4DR7 E;  2R42 A;  4DV4 I;  4DV3 I;  4LF9 E;  4USK A;  1KIJ A;  1XMO I;  4DV2 I;  3Q6M A;  4DR3 I;  1Z0G A;  4FWH A;  4PRX A;  3PYE A;  4MYT A;  2OI2 A;  5LMU E;  2Z5C B;  2CGE A;  1J5E E;  2Z5E A;  2CG9 A;  2UU9 I;  4P52 A;  3QT5 A;  4KHP I;  4DR4 I;  4DR3 E;  3WU4 A;  3WU6 A;  4B3R E;  1HNW I;  4JI8 E;  4JYA I;  3J81 Q;  4X66 I;  4DPU A;  1QZR A;  1Z59 A;  4LF4 E;  4GKK E;  4UT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...