3GONA

Streptococcus pneumoniae phosphomevalonate kinase in complex with phosphomevalonate and amppnp
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
329
structure length
329
Chain Sequence
MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphomevalonate kinase
publication title Structure of the ternary complex of phosphomevalonate kinase: the enzyme and its family
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 115
structure length 329
sequence length 329
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3gonA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3gonA01
3ZZ0A 1Z5AA 1EA6A 4LFCI 2J7KA 2HKJA 2E5LI 4DV7E 2V2QA 3LTOA 3Q1QA 2X36A 4KQVA 1N33I 2UU9I 1MU5A 3QT6A 1FWLA 1I94E 1Z5BA 1A6FA 2V2VA 2AJ4A 1J5EE 4UT4A 1ELOA 4LFCE 1HNZI 2A2DA 4JI2E 3WU4A 2A2CA 4K0KI 4XTJA 1IBLI 1ZM3A 1HR0E 3M6AA 5LMNI 4Z7YA 3PYEA 2HHHI 4FN5A 1XNQI 1N33E 3T1YE 1XMOE 2UU9E 1Z0EA 3B8HA 4DV6E 2EFGA 4DPTA 2UUBI 1H72C 2UXBI 4JI7E 3PYDA 4DV5I 4B3RI 1DARA 4JI6E 3ZM7A 4LFBI 2F4VI 4WUCA 4JI0I 1NHJA 2V8PA 1XNQE 3J81C 1HNWE 5A2QC 1IBME 3J7AM 4NXNI 2BV3A 1Z0VA 4HYMA 1MX0A 2F4VE 4JYAI 1Z0GA 5IWAI 3WU3A 2UUAI 3ZKDA 2V34A 4B3MI 1XHKA 4DR6E 2VQEE 3ZZTA 4LF9I 4DV4I 4OX9I 4PRVA 1Z0CA 4DPXA 5L3JA 4NXNE 2X7IA 1Z0TA 4P7AA 1FI4A 3GONA 4DR3I 1FKAE 1H73A 4JI1I 1N32E 4DPYA 2DEJA 5IWAE 2UUAE 3J81Q 1KIJA 5A2QQ 3OTOI 4B3ME 2ZBKB 3K1JA 2ZITA 4HY1A 4Z7CA 1KKHA 5BR8I 4JG4A 3J7AG 3PYGA 4LFAE 2UUCI 4JI4I 1S4EA 4YHHE 3K17A 4WUBA 1ZM2A 3QT7A 4YY3I 1N0UA 4DR4E 4P52A 4UTGA 4JI5I 5LMUI 1UEKA 2BM0A 3OTOE 4X64I 4GKKI 2HK2A 2UXDI 3T1HI 5BR8E 1Z0WA 5IT9C 1N36I 2E5LE 1VISA 4JI4E 2V2ZA 3J80C 2E1RA 4FW9A 4YY3E 4DV3I 3QT5A 3H4LA 4JI8I 2UXCI 4GKKE 4GKJI 1WUUA 4DU7A 4DXLA 4DUYI 4RPFA 4X65I 1HNZE 4K0KE 1IBLE 1N36E 5GMDA 4X66I 5LMNE 1PVGA 2HHHE 1RR9A 4FWGA 4DV3E 2HFUA 1HNXI 2UUBE 1RREA 2UXBE 4LF7I 3LPSA 4DV5E 2Q2EB 3ZZUA 4AQYI 4B3RE 4GKJE 3D4JA 4DV0I 4LFBE 5IT9Q 1KTVA 1N34I 4DR7I 1NZ0A 4JI0E 4NXMI 2VQFI 4LF4I 4EMDA 4DV1I 4B3SI 4DUZI 1IBKI 1D6TA 4X62I 5GMEA 4AQYE 4LF8I 4LF6I 4KHPI 4PRXA 3WU6A 1FJGI 4JYAE 4LF5I 4LF4E 1PKPA 1PIEA 4DV7I 4LF9E 4FWDA 4DV4E 4OX9E 3CWVA 4ED4A 3LNUA 1B62A 3JAMC 1QZRA 3B82A 4B3TI 1NHIA 1ZXMA 4DR3E 1I94I 1ZM9A 1FJGE 4JI1E 3F0NA 4USKA 1J5EI 1BKNA 4JI2I 4R1FA 1HR0I 4DV2I 4HXZA 2R3VA 1XMQI 3T1YI 1XMOI 4B3TE 1FWKA 2WW4A 4DV6I 2UUCE 1MG7A 1KVKA 2VF3A 4JI7I 4DU8A 3QT8A 4JI5E 2OI2A 5LMUE 4JI6I 2DEIA 1OJ4A 4X64E 4ZVIA 5LL6R 2UXDE 3T1HE 4JI3I 1ZXNA 4DV2E 3JAMQ 1H74A 2LJPA 1XMQE 1HNWI 1IBMI 2GS8A 4HACA 4MYTA 4DR2I 5FLXC 4DR1I 4M1KA 4DR5I 2XEXA 4JI8E 2UXCE 1Z0BA 2HKEA 3B78A 1B63A 4JI3E 4DUYE 4X65E 4HACB 4USMA 2CZ9A 3J80Q 1N0VC 1Z5CA 2ZM6I 4DPWA 4DR6I 4X66E 2VQEI 4DR2E 4FWHA 1K47A 3WU5A 4MYUA 4DR1E 1HNXE 1NHHA 1XNRI 4JV5I 4DR5E 4LF7E 3HULA 4URLA 1H7UA 1N32I 3PYFA 4DV0E 3V2UC 2BM1A 1N34E 2ZM6E 1Z59A 4DR7E 2HFSA 4NXME 4I3HA 2VQFE 2R42A 5FLXQ 2HK3A 3ZKBA 4WUDA 3V5RA 1H7SA 4DV1E 1FNMA 4B3SE 4DUZE 1XNRE 1S16A 4JV5E 4LFAI 1ZM4A 1IBKE 4YHHI 4DPUA 4X62E 4PU9A 4DR4I 4LF8E 4LF6E 4KHPE 1U2RA 2NPFA 4LF5E 1EI1A
chains in the Genus database with same CATH superfamily
3TUZC 2CQ2A 4ZHRB 4J37A 1S1VA 3R5GA 4DV7E 4H4MA 3MEEA 5GADU 3OSPA 2ASYA 1K0VA 4FXWA 1VQ7S 2GHPA 1H2TZ 3WC0A 3PJWA 2D9OA 5L1KA 2CA9A 4UT4A 3IO1A 4QR1A 2MKCA 3WU4A 2LQJA 1JLBA 2MKHA 4RLEA 4Q0BA 3WDOA 2AJ2A 2MZQA 4F3MA 1RBOB 2PDAA 1K44A 5IC6B 3QZ8A 2CVIA 3PYDA 1IR0A 2E1MC 4ZVRB 3BGOP 3KK1B 1T11A 3QIDA 3E3XA 4L76A 1N48A 3W8PA 3K5NA 5I42A 1X4FA 4U7UD 4ID5A 2BJ3A 5C2GA 4JI0F 4ILMA 2C42A 2LP4A 4EU0A 1T9WA 3K8WA 1H38A 4RW4B 3ICLA 3T1YJ 2UU9J 2R7WA 1N6QB 2UP1A 1S9FA 2DGUA 4JI7J 3JQJA 4KV8A 2WBRA 3EVOA 3HZGA 2BOPA 1Z0GA 2DNNA 4LIRA 2DNOA 2P6SA 4NA3A 2V34A 5THWA 1S1UA 4JV1A 4OYBA 1S0MA 4DR6E 3DXSX 3RU0A 1D8YA 5KFTA 5EWEA 1CSJA 1X4HA 3ZZTA 4OI4A 1VFJA 2EFNA 4ZVUB 3FRZA 2Z5CB 4NXNE 2Y1IA 3CC4S 1VIXA 4K59A 1CLFA 1VC0A 2IM0A 3KG1A 4DHVA 1NHKL 4ZLNA 2XMUA 3DRSB 3ETMA 2FJDB 1UW4A 3EUNA 3DGPB 5ETKA 1UFKA 2VG7B 5LSLA 3OTOE 4OHZA 2DNHA 3CC7S 5ITHA 2QC3A 3KJQB 1GEHA 4W4MA 1N36I 1RT6B 1IXKA 5AXMA 1DRZA 2HRTA 4IZKA 1MN9A 2JWNA 2PC6A 3JTOA 2CG4A 2AD9A 1NZ8A 1RT5A 1HBOB 2GQQA 1KN6A 4DXLA 1HI8A 2W1BA 1HNZE 3GIRA 1FO1A 3KJFB 1F2GA 5LMNE 3QGIA 3CCUS 4QIEA 1R27B 3EXYA 4K4SA 2XZDB 2PO2B 2ZFHA 4OMFG 3LA0A 4CLPA 3Q89A 4RUCA 1T7PA 5FDLB 2W9BB 4MIAA 1N34I 4RW6B 1NZ0A 1B4SA 3AQPA 3DOKB 1LQ9A 5KFSA 3D1OA 2XC9A 2NSBA 3GFZA 3P5BP 4BLGA 4DV1F 4MKAA 3OHAA 2BABA 4JV5F 5DDPC 3L9ZA 1RP5A 2H51B 1BY9A 3L7ZB 1GX6A 4JYAE 2MGZA 4LF8F 4FBTA 2W4PA 1B70B 3N9UC 4LSNA 2B6AB 3BGUA 4P7TA 3AD9C 2E9RX 1RACB 1RWWB 1RU1A 2Q79A 4QIFA 4OZ3A 4EBEA 4DV7I 2CAJA 1TTHB 1M1KT 4FWDA 3S8SA 1RHYA 5L1LA 4OZNA 3B82A 4TYAA 3C14A 2IRXA 3CO0P 2J9EA 2EI5A 4ZPTR 3AD8C 4OX8A 3CXCR 3CMAS 1FKPA 3VZHA 3KLFA 1JLAA 4MK7A 3EXCX 2BEFA 1UJ6A 4ELUA 4J9UE 4JI2F 2R3VA 4IKAA 1HA1A 1QY7A 3BPSP 1HQUB 3OVSA 3IWNC 3W9JA 1UEUA 4CO0A 1YG0A 1S0OA 5K9FA 3BEGB 5BXIA 4ZPWR 2JLEA 4ED8A 3PW0A 2FJXA 1Y4SA 3JAMQ 1N5YA 4WFBQ 2L08A 5ETRA 4HACA 1XNQF 1GNKA 3AA8A 4DR5I 2W4CA 3FQKA 2UXCE 2D7SA 3RBZA 3M8PB 2V8GA 4NLOA 2UXDJ 2AGQA 1R0AA 3S01A 4DR6I 4NCGA 1RWXB 2YNIB 3I0SA 1FHTA 4FWHA 4DQPA 5KG2A 1PGZA 4QIGA 2AWZA 1NAQA 1C4CA 3Q2TC 3PHEA 2N3OA 5AJ3J 3GJQB 2BA1G 3V2UC 4C8MA 3DXBA 3MPWA 5JEAD 5IWAF 1SC4B 5DG7A 3CF5Q 3M2RB 5FLXQ 2KT2A 4WUDA 2QFIA 1TUVA 1NJIT 3MM6B 3CNQP 3LF0A 3R3TA 4P2XA 4DR1J 1Q82T 2PI5A 4QOTA 2DD8S 2IM1A 3HXMA 1YVFA 1C4AA 3SQOP 5CXTA 3W2VA 4IZJD 4PAAA 1RCXB 3FUYA 4J9NA 2FLNA 4ZCIA 3L7UA 1TMJA 2RRNA 4URQU 3IC1A 2V2QA 4OO1E 5H9EJ 3D6MB 2UU9I 1MU5A 5CYMB 3LP1A 2NQPA 5IQQA 4X62J 2X3GA 3QATA 1MU2A 1TP7A 2Z2MA 4A8YA 1HNZI 3AOAA 4BA1B 3GWCA 1MW7A 3QBCA 5LMNI 3PS3A 3CTRA 4K0KF 1DTTB 2YNHA 1FF2A 4Y2CA 2NN6C 4JUZA 3J81j 4B9LA 4XK8C 4DFMA 3E51A 1RYSA 3PX4A 4YN3B 2B9EA 2UXBF 2KVIA 1U8WA 1LWEB 4X84A 1Y5YA 2JT2A 3PO4A 3DMJA 1YBUA 3C6UB 5L46A 2ZC4A 4LSLB 3K5PA 3KLEB 3J81C 1HR0J 4RL1A 5D6GA 1BWEA 2DBBA 4FBUA 1S57A 3HHLA 1XMQJ 2PSZA 1XMOJ 3K57A 1FXRA 2A18A 2B4PA 4AIMA 4JYAI 2ADBA 1B0PA 4V19J 1P9QC 1VLYA 4UZBA 4ZS6A 4FW7A 2FJBB 1AYEA 4K4XA 4NLDA 1F9FA 2BQRA 1U1MA 4LR8A 3GONA 2MKSA 4BBYA 3TNVA 1UTAA 4ZLLA 3H2UB 1VK8A 4WIIA 3RJMB 3NNHA 2CQ4A 5I3UB 4DQQA 3V81A 1BD6A 2HHPA 4O23A 3QLHA 2HVHA 2WSEC 3FEYB 1P42A 4LCGA 4XDCA 1S4FA 4ZA1A 2JEAA 2EBEA 3PZPA 1DTQA 4O4RA 3CT9A 1NDKA 3OFEA 4YHHE 1Q81T 3GMGA 1N0UA 3KUGA 4QWCA 4JP8A 4UTGA 3NRBA 2CPYA 2B9WA 3M1VA 2VG5A 3ADAC 1U47A 1Z0WA 2HHQA 3GJRB 1IJEB 1T8EA 1RTZA 1UCNA 2FGOA 1WHXA 1ZAWA 4ER8A 1PAUB 2OHDA 4P10A 2CADA 5AE1A 3H4LA 3HKZD 2UXCI 1TL3B 1EETA 1RT3A 2B7CB 1JMTA 1JNZB 1RT2B 1YJ7A 2XSJA 2CRLA 4F4ZA 5GAHU 1Q95G 3AY0A 3RRKA 3CDAA 2E5LJ 3HVTA 2HFVA 2M52A 1R6YA 2HFUA 3BYRA 2BKPA 2BJDA 3Q23A 3OLAA 1EQ0A 4EZ6A 2Q2EB 4GKJE 1S1XA 1U1LA 4LFBE 2IJNA 3TAQA 3CJRA 3AHPA 2FYXA 2J6SA 1S77D 4DR7F 4M5HA 2V63A 2MJUA 3SDEB 2ZD1A 1VK3A 2QMWA 4OYAA 1CULB 4AD6A 3IR6B 4OLOA 5LXYA 2IVFB 3BKTA 3BQ1A 4C0OC 4B3RJ 3ENQA 4MIWA 2ZH4A 3WC2A 2OELA 4F4WA 2UVVA 2XHWA 3FBFA 2SXLA 3DGVA 1VRUB 1KQKA 4CWBA 2Y0BB 4BDPA 4OZ5A 4OX9E 2FHMA 2GZOA 3LNUA 2BA0G 1RHRB 2ATCB 1FJCA 4DR3E 2HHTA 1FJGE 3A3PB 2C1EB 3F0NA 1EB0A 4FVMA 2H1YA 4ZVPB 4OZ0A 4TU9A 3Q6NA 1QSSA 4IFDC 2DHXA 3W5XA 1QSYA 4PUOB 1SL2A 1JLCA 1N56A 4CYUA 1OY6A 2CKWA 5DETA 2VB6A 5RUBA 3BM7A 3GTYX 2RKIA 2MKYA 3QT8A 2NXJA 2ZH2A 3TEGA 2AW0A 3PJ9A 4X64E 2VJUA 3NGSA 3CJSA 2K8GA 1WI8A 1H74A 3J7Z5 4DSJA 4NA2A 4P2SA 4DR1I 1IBMF 2Y1RI 2HNDB 2ZH1A 1P8GA 4AM3A 4H4OB 1TL7A 1BQMB 1UJ5A 3V4IA 4RNNA 1VS3A 4J91A 2VUGA 2HVEA 4ZITA 5C25A 1N88A 1KDNA 2JJ4D 4G1QB 1M90T 2CPZA 2VQEF 1HNXE 3SFGA 3PEJA 3K85A 4LF7E 2HQGA 4CM0A 4RW7B 2L3MA 3KMQA 3Q8UA 3GJTB 2AYEA 3JSRA 3EWGA 1H6KX 3WIVA 5KTQA 3NS6A 3ZKBA 4CLLA 1N52B 4B3SE 2BW2A 2E7WA 4X4OA 2XMWA 4YHHI 2HGMA 2XYGB 2VHGA 5CYQB 1ZPVA 1HHSA 4L72B 3W5ZA 3AFGA 3IR5B 4RKUC 4CNYA 1UVMA 3OR2A 2GVDA 1FVQA 4I68A 2IAJA 2YKOA 4LFCF 4FS1A 4RWXA 2VDHA 5K36F 2ACYA 3TZXA 4K4TA 5K36C 1UJ4A 1BQXA 4A8SA 3NBPB 1Z5BA 2WOMA 4CLTA 2Z2YB 2AEMA 2FJEB 2PNZB 1HBUB 2FTRA 4ZJLA 4H54A 4XTJA 8ATCB 4CI0B 3TA2A 4EFAC 1ITPA 2MHEA 2C28A 1WEYA 4ED1A 5J2QB 1RCOB 3QMQA 9ATCB 2YKAA 2JE6A 2B51A 2B9XA 5IT9Y 2LU1A 2J9DA 3C46A 4ITSA 4LFBI 1YZ6A 5CQGA 3Q6MA 4MIBA 2VZ9A 5DM6Q 3PW5A 3G86A 2Y1JA 1I5OB 2UVUA 3P06A 4WFAQ 3IWLA 3H59A 2IYIA 1U2CA 1O5JA 3F56A 1Q79A 3N6LA 3V4MA 1FKAF 3O2IA 2XMVA 3RAXA 2WONB 2QG9B 4RUHA 1XHKA 4RNOA 2VC1A 5MAOA 4NPOA 4OX9I 1Z0CA 3QWUA 1PBAA 2KT3A 2KT5A 4DV4F 4DR3I 1NK6A 3DHXA 2JX2A 3KJVB 3LP2B 4OO1D 3QQCD 4LIWA 1AZSB 1A9NB 3EGVA 3GG1A 3G8TA 3JQMA 3CMES 2CXEA 2J6UA 2I38A 1S4EA 1ZM2A 2UV8G 3MCMA 2UUCF 5M2RA 1C0UB 1N32J 2V6AA 1Y5NB 4RBTA 4U95A 4X64I 2PMHA 3M8QA 5BR8E 1S72S 1S6QB 3DM2B 4YP3A 3W2WB 4UUWA 4JI4E 3T41A 3NNCA 2GFFA 2ZJPQ 3T5KA 3NZKA 2OPQA 3KFWX 4HTJA 1U0HB 3BBBA 5KFOA 3PKMA 2BE2A 1UW9A 3G6VA 2C2DA 2DHAA 3SFUA 2EK1A 4EZ9A 1F5BA 2JVOA 3NS7B 1FRXA 2RB7A 1HNXI 4NYOA 4M63A 2QGFB 4WU2A 1HBNA 1FKOA 4LF7I 5KFYA 1ZTTA 1B7FA 1LWFA 4DR5F 4DV5E 1JJCB 1H2VZ 1RAEB 3P3GA 2BJEA 4P71A 2WVEA 2XI3A 4DL4A 4LRFA 1I51B 4B3SI 2YWWA 1IJFB 2KZZA 2PO4A 2F40A 1VOMA 4OHVA 1D6TA 2DHGA 4ZKAA 4P72A 2B4VA 2BOAA 1T03A 1LNQA 2VESA 4IFYA 5DQHA 1HL6A 3QAEA 3M6UA 5C7PA 1VC6A 5KT2A 7FD1A 3QJPA 3MR2A 4MAKA 4F2SA 1UVNA 4DX8H 4YR3A 5IM0A 1CQNA 3C2PA 3CDIA 5E33A 4FF4A 2IA0A 2GJFA 5IS2A 1K0TA 4QIWD 2MQLA 3MECB 1VQYA 2D1CA 5HMYA 3U27A 4O44B 1IKXB 3GSIA 4ENOA 4U9RA 1E3PA 5L8RC 3T1YF 3IP0A 4QBUA 2UU9F 4C3MA 1DBDA 1FNXH 1KVJA 2F63A 4JI1J 2F65A 1CJKA 3J7YI 4JI7F 2LA4A 5LL6d 1APSA 4CO2A 3T1HE 2MQ8A 5BYQA 4IO9Q 3VAIA 1R6MA 2XS5A 1K1SA 2CPFA 1XN9A 5HBMB 2AYBA 4FS2A 4ZJQA 1PJ6A 4B3TJ 2KTQA 2LXUA 4ECUA 2WTFA 2XEXA 1SB6A 5JEAA 1KC8T 1FFWB 1QAXA 1U6FA 3T6JA 4AYBD 2WK4A 3DCAA 1TL1B 4KAIA 4ED2A 3HSJA 1SI9A 4OIXA 5GVQA 2ZM6F 4WE1B 3BR9A 3DN9A 3J81U 4LREA 4UQTA 4TKTA 2WRMA 1KWMA 2A0FB 1GH8A 2I8EA 3DLKA 3CSKA 2KG0A 4IZJA 2NS1B 4BWMA 1WOPA 3DRRA 5EL9A 1XMBA 5KOXA 1LV5A 5CA5A 3I87A 2CJKA 5IOLA 1S6PB 1TKTB 3VWSA 1HW9A 3PCOB 3HHLC 1M5OC 1RHMB 4M5DB 5KFGA 2XS2A 2KVQE 4LF6E 4ID8A 4AFFA 5F3TA 1T05B 5A0YB 4ANDA 4USIA 2RS2A 2F1DA 3G96A 1C1CA 4FYXB 4R8UA 3T19A 2XSFA 3MGJA 1DY3A 4AXJA 2YKNA 3GCXP 5E3CA 4C0HA 3KHLA 4XPCA 3DYAA 2X36A 4KQVA 4DG1B 2Z30B 1IBKJ 4Q2LA 3OFGA 1Y4ZB 4MDTA 1I94E 2IRYA 2VL1A 2MY8A 1Q0NA 4JV2A 3KWMA 4USJC 2GMHA 1KEKA 3EVWA 4R5PA 4LF5J 2A2DA 1QSLA 1HYSA 3RR7A 2ZNZA 3N5FA 2RDIA 3I0RA 1FCAA 2XM3A 4YB6A 1TKDA 4U96A 3IS9B 4DV5I 5GAEI 3Q24A 1F6TA 3GYGA 1TVRA 4UUXA 3EYZA 2DVIA 4R0JA 2OH2A 2FHKA 2EVZA 3J7AM 4DV6J 2LQ8A 1QVGR 3K0JA 3QSIA 5LJ5Y 4OHWA 1PC4A 4EBCA 4KGZB 4I2PB 1UVJA 4KHMA 3RAQA 1FK9B 4DJBA 5IXUA 2CZ4A 4A8FA 3MEGA 3J7A1 3PS1A 1U1PA 1FESA 3MMBB 4PRVA 3NGRA 3UCZP 3KG0A 4QW9A 2CPJA 4RX6A 1WKLA 2WVFA 5AXKA 2DEJA 1VR6A 2KFNA 3V6HA 2E5JA 2M70A 3W61A 5A2QQ 1Y4UA 2H4YB 3RRHA 4OI1A 1G2EA 4ZPVR 4LF1A 2KN4A 4LFAE 1R89A 2EKNA 1EX8A 3QO9A 2D3O1 3ENVA 3TAMA 2RQCA 2LEBA 5F3ZA 3Q2SC 5C0XF 2BM0A 2XMMA 3T1HI 2NN6B 2BE7D 2EEYA 1RHUB 1FX2A 2OSQA 2UXDF 2G0JA 3MFHA 2V2ZA 3QRRA 4HR2A 3CCRS 3V6DA 2CQ0A 3W63A 2AJ1A 1YJWS 1SH3A 4JB8B 4CP5A 2DGOA 4NOHA 1V9OA 5AJ3F 3AXMA 1X31C 5EWFA 1S6UA 2M8HA 2ZBPA 2HHHE 2AEJA 4ICLA 4P2FA 1RWUA 1FRJA 4HVZA 2J65A 3H2LA 4NRTA 1YKWA 4DR1F 4E0DA 3MAAB 1AFIA 2GHVC 5HN0A 1NHVA 2COLA 1LFPA 4KT0C 3CWJA 3N0VA 2AIRB 2RRAA 3NOCA 3D67A 1HWUA 2MDAA 2V4JB 2ASLA 4AQYE 3ISZA 4LF6I 1HFEL 3PW2A 3TYTA 2N7YA 4X62F 5HMXA 5FJ4A 1RWPB 3BN7A 3OHBA 1KHWA 2ZZTA 4TNOA 3TJ9A 4M95A 4K4ZA 4C3LA 3FEZA 4B3TI 4F0MA 1I94I 4ZVHA 1U49A 1LOUA 2I2YA 4K2JA 1HD1A 3TJAA 3MM9B 1T9TA 4R1FA 1W2BR 3H90A 4I1TA 3GIIA 3IR7B 1HR0F 4LF9J 3TVYA 1XMQF 4O0IA 2MZ1A 2HIQA 1XMOF 4LVOP 1RT7A 4DL0C 4DL2A 4DCOB 4K4VA 1RXOB 3SXLA 2GIQA 2K1RA 1OY8A 2ZH7A 3QIPA 5HI7A 2ZE2B 2Y3YA 1TK8A 2B3TB 1LK5A 3H1CA 4ZCLA 3OD2A 3FCVA 2MKJA 5LMUJ 3SCLE 2AU0A 2B56A 2C2NA 3AJDA 2HWHA 2ZHAA 3H7HB 1HD0A 2JFKA 4RR5A 1ACMB 2R4FA 3O44A 2MSTA 3OL6A 1JLGA 1S9EA 4FW6A 4V1Ak 1RLDA 3UQSA 5G0RA 4I3HA 4UQGA 3QAUA 5A76A 3I4PA 1RQ0A 1SJ3P 4LFAI 5D3GA 2YH0A 2VOPA 1JLFA 3SQGA 4PU9A 1X7VA 2LEPA 4IFDB 2EXUA 4HDHA 3CCVS 4X2BA 4LSZB 5F0UA 2FHJD 2VQFJ 3C15A 2Q1LA 2E5LF 3VV2B 2J7WA 1FWLA 2B8PA 4DN9A 1A6FA 2IVYA 1YRTA 3D54A 1S1VB 1G3OA 3DLJA 5F0WA 3P6YC 1KTQA 3MEEB 4NLPA 5KG7A 3M8ZA 2HHHI 3EVMA 3BO2A 4IH6A 1S12A 4JI6E 2YNFA 1JLBB 4Q0BB 4A48A 4QYZK 4B3RF 4EO8A 1KONA 3TRGA 5E3QA 2FZKB 1JJ4A 2ZH9A 3GP9A 4GQUA 1HNWE 5J2NA 2EKYA 4ZIWA 2YKPA 4LF2A 3H0PA 2IFXA 4OO1A 3GFXA 5CCLA 4QR0A 5I42B 1JXEA 4WIQA 2HSEB 3BBCA 2YWHA 2FQQB 4DOZA 3FFIB 1R8CA 4HKQA 3FRYA 1FEHA 2XY6A 4WBFA 4ZPAA 1S99A 4KV8B 1R43A 2NLWA 4M5KA 3D1HA 2B7BB 1YX2A 1S1UB 1CJUB 3NY0A 2GMLA 3RRGA 4HT5A 1EJ7L 3MWBA 3CD0A 4B3ME 4HY1A 1DQ9A 3EZOA 2O5DA 2GGPB 5A8WA 1GMWD 1UWBA 2NXNA 2UUWA 4Y34A 3QPIA 4KB7A 4TLRA 4WUBA 3QT7A 4W98A 5KFHA 3SCJE 4NYZA 1LW2A 1E3HA 2K7KA 1TMMA 1RBAA 1FFGB 4H4KC 2GQ2A 3U02A 2E66A 2IRUA 2AEFA 1JNRB 5FIIA 1L3TA 4CLKA 2DYAA 2JVRA 1F5CA 3M7VA 1HK7A 1S48A 2PFDA 4ZLPA 4NYPA 1YH8A 3S7RA 4QWBA 2WB4A 4B9VA 3S6EA 1UDOA 4IZKB 1HWJA 3CDEA 1PVGA 3TJ8A 4RW9A 5AE2A 1IUJA 4CH7A 4CO4A 1RT5B 3CDWA 2DY1A 4CT8A 4B9NA 4YY3J 5LM7E 2CNNB 4Q44A 2H9ZA 1U1QA 4X4PA 1WSRA 4JI0E 2NREA 1TUGB 1QAIA 3C66A 5D0HA 3UHMA 2QT7A 1CJVA 4RZRA 1HBMA 3DLEB 4DZDA 3MUTP 2ZVSA 1UPMB 5JEAC 4C6AA 2OKQA 2V9KA 4NZ0A 2OD6A 4XIUA 2CJYB 2OAUA 2MGZB 4L3KA 1SH0A 1NKBA 4HL9A 4LSNB 3THPA 4XO0A 1HIYA 2DISA 2K2PA 4ILRA 3HVWA 2DHHA 3QGPA 3C14B 2BR2A 2PO0A 3BO4A 3IM9A 4PPZA 4UF4A 2EG2A 1FKPB 3KLFB 1JLAB 2HZCA 4ES3A 4M5GA 5GAHI 4JI6I 1UVLA 4QQBA 2HHWA 4QPTA 3DRPA 1FERA 2FVRA 5A8RA 3W62A 1MMNA 2PFFB 1HNWI 7AT1B 4ED6A 5J2PA 3TQEA 2RRBA 3K5OA 1SV5B 1ZZFA 1REVA 3TEHB 1DHMA 3D6FB 3UN3A 5F8HA 2PO1A 5EX0A 2QLWA 2R7RA 2HKEA 3UNGC 4CZCA 4YS2A 4JI3E 1WC6A 3R27A 4HACB 3H40A 1IQZA 2F9DA 3CJ5A 2LXIA 5EUHA 1O0PA 4NLWA 2R8KA 2HLTA 2M9KA 3PYFA 1FVSA 1R0AB 4JI8J 1MMDA 2VPZB 3I32A 1N32F 3I0SB 1VC5A 1PSDA 2KJWA 3UPFA 2HK3A 3PXGa 3G2XA 3RGIA 4DV1E 4JV5E 4KE5A 2FD2A 2QE5A 4WJBA 1RA6A 2KU7A 3VF0B 3BSOA 4LF8E 1XQIA 2O1PA 1KVIA 3NGKA 4CTAB 4DV0J 1EI1A 2MLZA 3RUBL 5L9NA 1EA6A 4MKBA 2C3PA 4OI2A 3LPEA 4ILLA 5HROA 2P9EA 2CJBA 1KHVA 1M5SA 1RB0A 1IR2A 5ETOA 1RHKB 3W2VB 4WP8A 5J2MA 2RAQA 3KTQA 2BA1D 5C5JA 4KHPJ 4C7QA 3PX0A 4OKGA 1X60A 1FD2A 3M6XA 2A2CA 4JI2E 3IRXA 1VRQC 3J7ZT 1NK0A 4ED0A 1RWKB 1VBZA 3LP1B 2MSSA 2ZHBA 2NR0A 4A8KA 1N33E 5D15A 1MU2B 3D3BJ 4KRWA 3GZ7A 1TR0A 2B5JA 3RBXA 2EFVA 1B99A 1VBKA 2XQCA 3ZM7A 3N5BA 3MM5A 3F41A 3K2YA 3PEHA 3JYTA 4JI0I 1Q8LA 1VQKS 4P73A 4UW2A 1XNQE 3FSYA 2Z0GA 1OIAA 1ZYQA 1D9AA 2VKZG 5K14A 5D0RA 5HANA 1ZPWX 4ZP6A 2DXFA 3DMJB 2CJ9A 4OQJA 1JKHA 3O8WA 4C9DA 4IRKA 1WACA 3HHLB 2HGLA 4XPEA 1H2UX 4NLUA 3L95X 4A8MP 3D1QA 3NWGA 1Z0TA 1NDPA 1RGVA 1I6JA 3BJYA 1SKWA 3CJ0A 2FZCB 1K1QA 5IWAE 4J9QA 4JI1F 4O4GA 1T95A 5D8HB 5B08A 2OPPB 1ROFA 5DO2A 1WWHA 4JG4A 3J7AG 2G9OA 3GR1A 4QWEA 1JJ2R 4OYWA 5FD1A 2AMCB 1REGX 2YQ1A 2O1VA 4YY3I 3TVKA 2V8DA 3V81B 4B3TF 2QA4S 4P52A 2PNLA 1NCLA 4OJHA 1UEKA 2RVJA 2JEAB 2DO4A 3I31A 4YMEA 4PWWA 1DTQB 2MB0B 3TARA 3NCRA 1D9FA 4FPIA 1FFSB 4PXCA 1KLMA 3M1VB 2CWKA 1C2PA 4OZ2A 2VG5B 2DK2A 3UE2A 3CCLS 4DR4J 3G4SS 2RJZA 4EGLA 5M2UA 3Q83A 4Q8EA 1SC1B 4K0KE 2OEJA 2Z2LA 4B08A 4XTTA 3IBWA 3HKMA 1NO8A 1ZH5A 1WKKA 1RWNB 1PCAA 2J0XA 2MHNA 1EETB 2UXBE 2QLXA 4U8YA 1RT3B 4IG3B 2XSJB 3D4JA 2R7QA 1UDQA 5LSOA 4TLQA 3L4BC 3HVTB 2KI2A 4LUBA 5DJBA 1X5TA 5KT6A 2LEAA 1IBLJ 3QYYA 4DV1I 3T5HA 2IJRA 3TX8A 1LW0A 4TQSA 2UUBJ 1VLOA 4L74A 1IBKF 3GCMA 4LF8I 2J7UA 1Q53A 3NAIA 2CGEA 2DGTA 2W2OP 3EMTA 1QDUB 1FRKA 4C2MA 3UR0A 1URRA 4PEOA 2ZVIA 4OJGA 4U3BA 2QO3A 4LF5F 1BUXA 3R2DJ 2ZD1B 5ADZA 1EARA 2J9DE 4KPYA 4ED4A 1X0FA 3HT3A 1X4AA 5ETPA 2CPIA 2ROEA 2QJ3A 3D6TB 4DEZA 4OX6A 2FVQA 3CGIA 4JI2I 2LFVA 3A3OB 5KFBA 5L1IA 2XY5A 1QVFR 3VGSA 2CWXA 2PEBA 4IQXA 1JLQA 4K8RA 3ET6A 1MG7A 3ILJA 2O1WA 2AE8A 2DNYA 3HM9A 3F73A 4GO5X 3HDSA 3ZZZA 4DV6F 3TOQA 2BQUA 5DQGA 1OSCA 4USWA 3CCJS 5KFPA 2XB2D 3ITHA 2PA3A 4BC7A 3NXZA 1JLCB 3GE9A 5I3QA 5K8PA 5IC4B 4Q45A 1H7WA 1R6VA 2RKIB 3M7NG 4EBDA 4EYIB 2BA0D 2F7VA 4C11A 2EC0A 2DR6A 2J8SA 1KOHA 2DR7A 1NU4A 2LDIA 4OJ1A 2RIJA 2VPYB 3AJ1A 1Z0BA 4K4YA 2C2RA 4JI5J 1Q5YA 1Y9OA 4K4UA 3BGFA 4DX7A 3RW6A 2Z5BA 2NYIA 2F5GA 1TL7B 2DCLA 1HNVA 3V4IB 2B6AA 1Z2ZA 3TVZA 2VBZA 2XI2A 3J81Y 3KOAA 2KHDA 5C25B 1ICEB 2OJ3A 3BSCA 2I0XA 4DR7E 2FHJA 4DUYJ 2VD3A 4LVNP 2J9CA 4U7UK 2GIRA 4DSEA 1Q16B 5KFKA 4DQIA 4A8XA 1S1TA 4OO1C 1IN0A 2D3UA 1PYSB 1LKZA 2RE1A 4I2QA 3OVAA 3A12A 2GC8A 2FDNA 3IBCB 4NXMJ 3R1HA 1VRTA 3KK3A 4Q7AA 3TQ1A 3VR1A 4FDFA 4ZP9A 3ZZRA 6FDRA 4C8ZA 3QT6A 3OR2B 2AJ4A 3KHRA 2IAJB 1TUWA 1S49A 2F8MA 2AHOB 4K0KI 2FLOA 3CC2S 1ZM3A 4CDIA 4Z7YA 4Q43A 4F2RA 2HQIA 2KM8C 1QAYA 2MQMA 4AXIA 2UXBI 2QMUB 3DOMA 1DLOB 2M7SA 3SEOA 2YNIA 2Y1LB 3PRBA 2IC3A 5ETLA 5F8JA 4PYDA 4YOEA 4BHQA 2IVMA 2A6OA 1RDRA 2HBQB 3HHDA 2JE6B 4QYZJ 1IBME 2MPUA 4X4SA 3L7OA 2BV3A 1KBRA 1JXLA 1MX0A 1YHCA 2HNYA 3TUIC 3DD6A 1RK8A 2MEWA 2W4DA 4NLVA 1NHUA 1KQGB 2POKA 2VQEE 1GMWA 2CZVC 4CT9A 1F3FA 2XO7A 4XDDA 4LF9F 1VQ4S 1RAGB 1EQMA 1Y3JA 3X1LB 5ELWA 2FIUA 4OL8A 2PIIA 3W9IA 2HG4A 4Y6IA 4Z37A 2CQDA 3ONQA 1EKSA 1X4BA 3H2VE 4C8OA 1NJWA 3DC2A 2P6TA 1VJQA 2IOPA 3HVAA 2DH9A 4ES1A 3HO1A 2XNQA 3DLGA 2DB1A 2UUAJ 3PHTA 4GMKA 4LOMA 2WP8A 3MUVP 5LMUF 1J5OB 4O3NA 5DS7A 1NDCA 1X5PA 3I56S 3G82A 4WK1A 4ZN1A 3IGNA 1VQ6S 1PAEX 4CLUA 5JXSA 5KG4A 3KLEA 3SSSA 2ZHOA 3M8QB 4IFVA 5L39A 3CJKA 3TA1A 1IVZA 2J5AA 3GIKA 3HI9A 2C22A 4KIAA 4U67Q 1N36E 2OPQB 1KD1T 2E7XA 1OYDA 2AZ1A 5LT5A 2OPSA 1VYAA 5B0BA 4MQYA 2HAIA 2BE2B 1DZ5A 1ZA2B 4UOFA 1WG5A 5H9FJ 4HEA9 1KTVA 1OO0B 3P8BB 5KFIA 4DR7I 3CD5A 1P6TA 6FD1A 4MU0A 1HBNB 1FKOB 5DNXA 2VQFF 1LWFB 2JDJA 3HPOA 3UI3A 1X9MA 3NMRA 3QFHA 4RUBA 2HHXA 3D28A 1L3SA 1V3RA 2L9NA 2DHSA 3AD7C 2PMZD 1YDLA 1OPZA 4DV4E 3ZNJ1 3VALA 3JAMC 1ZM9A 3OSNA 3O6QA 1TU0B 2RF2B 1T03B 2IERA 2O3DA 1SL0A 1VCTA 4IFYB 1M5VC 3H20A 1RISA 3MPVA 1FDNA 3E01A 2VASA 4C0BA 4RU9A 5D0EA 4LF4J 4ELTA 3HJVA 3I82A 2HAFA 4F4AA 4F02A 1TL3A 1WTFA 5IM0B 3ISNC 2UUCE 2VFVA 3PIPQ 1XR6A 4DU8A 3SIPB 1FJEB 3M8RA 2BKNA 1NSAA 1XXEA 1EHWA 3PR5B 3FBEA 3A8EA 1YBTA 2Q66A 1MROA 1GMVA 2H54B 3B6BA 1IBMI 5FLXC 1CJKB 1LWXA 3QSYB 4AL7A 1SPBP 4M1KA 3G6YA 5B09A 3SYZA 2YQ0A 1T3NA 1NSPA 1RZMA 3SDEA 4M5NA 2WSFC 3PRDA 4QZVB 2XHCA 1WF0A 1HQ2A 2VQEI 4DV2J 4ELVA 3PRYA 1VQOS 2MZJA 5JEAB 1CS4B 1HW8A 4DR5E 2AX1A 4L3NA 4KQZA 3B4DA 1SH2A 3O1LA 1AFJA 2FY8A 2DTJA 4X66J 4USHA 1U25A 2CDRB 2GCFA 3DLKB 3UDVA 5DZ6A 4IZJB 1RADB 3ENWA 1I3OB 5CCMA 1XC9A 1MSWD 3DRRB 5EDWA 2F8EX 1GQEA 4LQ3A 1AROP 2RH3A 2AYMA 1PG5B 4LFCI 2ZM6J 2KL8A 1YBAA 4NLRA 4WF9Q 2LDYA 4MH8A 1XNRJ 3JSMA 4TXSA 2GNKA 1YSJA 1C1CB 1RTJA 4YY3F 3MCNA 2YKNB 5E7OB 3EGNA 2AJ0A 1G1XA 4M94A 4M5MA 3DYAB 2DR5A 3UCUP 5FWKA 1KP6A 1SC6A 4FN5A 1JLEB 3T1YE 1JK9B 2UU9E 1XIQA 2G2ZA 4OX7A 3KG4A 4R5PB 4JI7E 4G1IA 2YX1A 4G1QA 3BR8A 4L75A 1HYSB 5KT7A 1TKXA 3EDRB 1J5EJ 3CDUA 3I0RB 3NL0A 2MLYA 4MKYA 2QA1A 2DRBA 3R7BB 3H5XA 5KFJA 4NASA 4ZN3A 4IG0B 2XGQA 1EAYC 1RWMB 1RTDA 1LWCA 1Q8BA 2JEBA 3PIOQ 3K89A 1TVRB 4A8WA 4DLEA 3WHIA 3M4XA 2BW7A 1TAUA 2UUAI 4MFBA 1WOOA 2I5JA 3FNNA 4JI3J 2VG6B 2QYGA 3W9HA 4DV4I 3U1MA 5L3JA 4DFKA 3HMJG 4F67A 1OSDA 4DMZA 5KFAA 3MEGB 2Y9HA 1EIYB 3D6HB 4QU7A 2F4VJ 3MCSA 2GQ0A 3D0IE 3KLGA 4RBUA 2FLLA 4DN0A 3M9OB 3FMWA 2UUCI 5A8KB 2ZBCA 2N82B 2DR8A 3J7AN 1V3SA 4NRUA 1H7XA 5HMZA 1GX5A 4DF8A 3QO9B 2AF6A 4QWAA 4YEAA 5EN1A 4FXDA 3TAMB 5T7LA 1X5OA 1KS2A 3PDNA 2FB0A 1R6LA 1AXQA 4MTPA 1OYEA 5LOQA 2KFZA 2CPXA 2CUYA 3R8YA 4YDDB 4TQRA 4UOCA 2VIHA 4JI8F 3DU6A 4OLPA 1Y00A 3V6DB 4A4JA 4YR2A 4F4KA 4P7VA 1NMEB 1QM9A 4I6AA 2BJ7A 2FUG9 1N33J 2ZOGA 2C2KB 3OPKA 2PT0A 3VVUA 5IT9Q 3K7RA 3FJ2A 1T3OA 4DV0F 4ICLB 4WK3A 2WAQD 4LF4I 3M6WA 3HHNB 3AODA 4LRAA 5AE3A 4DV3J 2KO1A 3ELHA 2EBGA 3KUEA 3TUPA 3BPDA 2R8JA 4KHPF 3VHQA 5CABA 1FDDA 2W7AA 1WORA 5C42B 2YWKA 3OFHA 1B3TA 4OV6A 2XO6A 1UZHA 4D3HA 5K36D 4ZIVA 2MYFA 4NI2A 2W2NP 3W2WA 4NCAA 2U2FA 2E9ZA 3K59A 1Y5LB 5D4OA 4ECSA 4DV2I 1FT8A 2ZNYA 3DI6A 5DGBA 3T1YI 1X4DA 2JOQA 2QV6A 5D4LA 5C0XE 2W9CA 4JI7I 3S1TA 3P4UB 3MEDA 4HYKA 5KFQA 3M2UA 1HWKA 2FGCA 2UXDE 3VAJA 1RAJA 1ZXNA 2H65B 1TL5A 3N79A 3OT9A 1X4EA 2LJPA 2NN6F 4MYTA 1RT7B 4ZVOB 4DX6A 2CDQA 1CJTB 3M32A 2K1RB 1WF1A 3M2VA 4USUA 1X4GA 2D9PA 3DKDA 5CHCB 4WFNQ 3QIPB 2BYCA 3B78A 3TI0A 2R2UA 2B9YA 3H5UA 3GG0A 2IBOA 2CZ9A 2W24A 2ZM6I 1FTRA 5JVGQ 4F8RA 4DR1E 2C37A 1XNRI 3JS9A 2VFSA 3LW5C 3FK4A 3BN4A 3R5JB 1Z59A 2RD5C 4RW8A 4X65J 3P49B 1WC3A 1DJ0A 2ZKTA 5HO4A 5LSRA 2ALZA 1JLGB 1S9EB 4X62E 4FYDA 1WEZA 3FQLA 2QL5B 5G0RB 4BA2B 3BREA 3GV7B 3MECA 4DR4F 4CLYA 4O44A 3HF5A 3BGRA 3K5MA 2W8LA 2HKJA 5D3GB 1V5VA 1JLFB 4AT1B 2BZ2A 4DUZJ 3ZTOA 2Z2ZA 4MMOA 4F3OA 3FZ2A 2HW3A 3H5YA 4TY9A 1PJ5A 4QCLA 2V2VA 1IM6A 1V3ZA 4ECXA 3LAMA 3FBCA 2HEKA 3IA0A 2RUSA 1HR0E 3OL7A 3KDNA 2KDOA 1T9UA 2AT1B 1IBLF 1F3VA 1KFDA 2L41A 2U1AA 4FPRA 1XMOE 3OL9A 4I6WA 3N6MA 2H5JB 4OHYA 3ZTPA 2UUBF 4WE1A 3KHHA 2F4VI 2PNMA 2GJ2A 4GRSA 2GW8A 5D4PA 2Y8WA 1HPZB 5U47A 2ZDOA 3VAKA 3I5BA 2M4MA 4ETZA 3UN5A 2YNFB 3HD2A 1Z0VA 3MCOA 3IG1A 4NLSA 1NK8A 2K3KA 1S6PA 5B0GA 4L73A 2BR0A 3T9NA 4M5DA 3TO8A 4WYWA 4URSA 5KFWA 1NUEA 5A0YA 1J27A 4OO1B 3NKYA 2HMIA 2NXCA 1Q8KA 1SQEA 5KFNA 4V19X 3FBBA 1H73A 4DPYA 1UVIA 4DG1A 2J0WA 3M30A 4NEYA 1HHTP 2YKMA 4IH5A 2ZBKB 3QRQA 5CZXA 2YX4A 4Z2XA 2W8KA 4DL3A 5DROA 5DG8A 1VBXA 2IESA 4J90A 4DSLA 2Q6BA 3JAMU 1KSPA 4OI3A 3TZYA 4IFDF 4K2XA 4JI5F 2KM8B 2XS7A 3BDEA 2UXDI 2KRBA 1OQ3A 5A8WB 1UWBB 2AKWB 1F9EB 1MWYA 2E5LE 4CQ1A 2QEXS 4KTQA 1OYSA 1F2HA 2NYHA 2N7CA 2UV8A 2FVCA 4NMXA 1LW2B 2OEKA 4DV3I 3FVYA 4A8QA 4DCPB 4PRFA 3GLJA 1RBLA 2CJAA 4RPFA 3J80Y 2XMKA 4LPFA 2X51A 2ADCA 2C3UA 4DUYF 2HLUA 1Q4RA 3Q22A 4X4RA 4KC5A 3I6PA 1JXVA 4PCQA 1IKWA 5D78A 1HI1A 5B0AA 1KR4A 2MKIA 2DT9A 5FLXU 3LPSA 1VQ5S 4BC9A 4B3RE 4ECWA 3I5CA 4GKKJ 2Q3PA 4RW9B 1T94A 3OW2R 2DH7A 4NXMF 4CO1A 1RHQB 2CQBA 1P1LA 3DU5A 3KXDA 1TAQA 2JL9A 1RA7A 4X62I 2DNQA 3JB9k 3M85G 1E6VB 3LO3A 1CJVB 2B4OA 1C0TA 4CO5A 1HBMB 2BRLA 2CG9A 2V8VA 4LMZA 1YRXA 1SIZA 1UPPA 2YPZA 1ZXMA 3HSGA 5AXLA 2QL9B 2H5IB 1HR0I 2AYGA 1RAOA 5KG5A 1XMQI 1XMOI 1FWKA 3P3DA 2VBWA 5KFMA 1VI7A 4IQMA 1BHNA 2DNGA 1KRPA 1SKSA 2BR2B 2PO0B 3C6TB 4NX9A 5LL6R 1XERA 2RQKA 3I96A 2IHR1 3FKBA 5SUHA 1A0OB 2WW8A 5HSPA 4KGVB 3J7YU 3CCES 1EZZB 1U4BA 3AA9A 1NSKL 3NOGA 1RSCA 4HH1A 3DRPB 1U8SA 2BA9A 5A8RB 3RBDA 4GVBA 3OUYA 2V4JA 4FNIA 4KBIA 5J2PB 1M0SA 1N0VC 4DPWA 1REVB 2ZWOA 1U6ZA 1N36J 4PXDA 1K47A 5D4NA 2WCXA 4NLGA 4EK2A 1UEVA 3VCDA 1GXLA 2XYPB 4TVAB 2UUAF 2XCAA 3GR0A 1HARA 2N4DA 3VAMA 2W2PP 3HZEA 1Y0HA 4NLYA 4DR2J 4NZ7A 1RTHA 5DLGA 3MM9A 3LPYA 4I7FA 3A13A 4OV1A 1N34J 4Y2KA 4OYMA 5EHHA 2M3DA 5C0XD 1T9YA 2E5LI 4BCAA 3AB4B 3Q1QA 3K5LA 5IV3A 3KRNA 1Q86T 4PWDA 1CPZA 3A8IA 5F41A 2C38A 3IM8A 1R8PA 2KYZA 2V69A 4DL6A 3W5YA 5HROB 3FEXB 4F36A 4N8OA 1FRLA 5J2MB 4DV7J 1Z0EA 2C2OB 2BDPA 3G9CA 3DOLA 2NXEA 1H72C 3NP5A 1FEEA 4NZ6A 4QNKA 3K8VA 5KFDA 3IRXB 4B3RI 1GXUA 2ZC3A 5ETTA 1Q5VA 3T5LA 4CNZA 2BX6A 1TQLA 3KK2A 2RHSB 4OFZA 1V5IB 4WKYA 4HLBA 2DR9A 5A2QC 4TU8A 2KH9A 3C8YA 5GAEU 1HNIB 2D69A 1FRMA 1RWOB 4FYWB 2DY9A 1TFWA 2BVZA 3MM5B 3DDIA 3JYTB 1VGYA 2AJQA 2G2YA 3ENAA 2ACMA 1ZA1B 3WU3A 2UVRA 1HQEB 3FDSA 1WF2A 3U1LA 2I1RA 3BGLA 2G4BA 2WSCC 5K14B 4LF4F 4KKOA 5J1EA 1RI7A 4ZCKA 2DO0A 4O3SA 1JKHB 3RYLA 3DLLQ 4KGKA 4N7TA 1MNEA 4Y0FA 1N32E 5ETQA 4C8NA 2LVWA 1DAXA 1RAIB 3K1JA 4ZCMA 3HSDA 5ETNA 5B0DA 3CE8A 5E5NA 3THVA 4DR6J 3LWLA 3PJXA 5C24A 3GYXB 4F50A 1SC3B 3MOJB 1Y3KA 2VFTA 4NXNJ 4JOUA 4IDKA 4O4GB 2ZH8A 1OYRA 2M0GB 3GV8B 3GSDA 2QZ8A 3CIMA 2E1CA 4ZOSA 3MR5A 4PG5A 4GKKI 2WNRA 2G1DA 2C3MA 1USVA 2FC8A 2EC2A 1YJUA 4HI2A 1QTNB 4DX5A 4DV2F 1N5SA 2D3OR 3ZTQA 3T1AA 1LEOA 3SCKE 4P2MA 4OI6A 5F8MA 2V68A 4KPCA 2W2MP 3GYNA 3NLCA 1WUUA 4QWDA 3OTOJ 3FZBA 1KLMB 4MJKA 2C39A 1CBKA 3NGDA 3OR1A 3FFIA 4X66F 1RTIA 1IR1A 2HFZA 2R7TA 4C4WA 1NBEB 3ZZUA 2X3DA 1GTHA 1IKYB 4PYAA 5KAKA 1VQNS 1QLNA 1HNZJ 1CJUA 3BZQA 3SMZA 3SI8A 5LMNJ 1RABB 2HFOA 3MR6A 3GQCA 5K36A 5KG1A 3A1YG 1XNRF 5KFLA 2DNPA 2RS8A 3UDLA 2GGPA 1YIJS 4YDXA 4F3QA 2OLWA 2ALYB 3CDBA 1LW0B 3AAWB 5B0FA 5HAOA 3CEDA 1YJTA 5GAGI 1M1HA 4NL5A 1UZDA 2FHOB 3K58A 4NLXA 1NHIA 4HHUA 1WDDA 1EKRA 1WJ9A 4P6QA 4JI1E 1QUPA 4IUFA 4USKA 3LH2S 3TWZA 4JYAJ 3M8SA 2I9SA 1XR7A 4F4YA 2HIYA 1J5EF 1PJ7A 4CLZA 2ZJRQ 4LT6A 1OMSA 3CJ3A 4B3TE 2PN6A 1DQ8A 3TUJC 1F9HA 1Y5IB 4ZVSB 1R31A 2BJ8A 2ZWPA 2DEIA 3X3UA 3GPAA 1JLQB 5BJRA 3ET6B 4OYPA 2WVBA 4W90B 3IRWP 2MY7A 2ZDPA 3IGVA 3AB2B 4JI3F 1Q78A 4DR2I 3ITHB 1CG2A 4K50A 4WTYA 3T9ZA 3MMCA 2AZ3A 4EYHB 5HP1A 4FXVA 3DDNA 1B63A 2EWHA 2DXDA 2F4VF 1X9SA 4ZPBA 2DNKA 1NPRA 3DLEA 3KLVA 2D74B 1WG1A 3MPYA 4C11B 1HMVA 2XYHB 3EZUA 1BMQB 2GAHC 3BDPA 1OY9A 1N32I 4B9SA 4TY8A 2J0QD 2UXCJ 4HT7A 2Z5BB 3W64A 5DQIA 5J1PA 2MQPA 4K5RA 4N3OA 1HNVB 2R42A 5K8MA 5ETMA 1A7GE 3VGTA 4N77A 3M7ND 3HT0A 1IBKE 2JFDA 4YQWA 5IT4A 4AL6A 5GADI 4LF5E 2IIHA 4R25A 1I1GA 2VOOA 4C97A 4Y2IA 1G7CB 2VA2A 2BMBA 5HJXA 1S1TB 2ZOMA 3GFHA 3LANA 1BE4A 2HWTA 1SCJB 4I2QB 3ZTRA 1FNOA 1N33F 1U7LA 1W7WA 3JTPA 1FE0A 4YB1P 1SV5A 1VRTB 1ELOA 3KK3B 2ZBRA 5DLFA 2AJFE 1FWPA 1QJHA 1UA1A 4F4XA 4PZVA 3VZIA 2LQ9A 4MKVA 3GFYA 3B8HA 4DV6E 4P9SA 4DPTA 3NCPA 5HL7Q 4DV3F 3TA0A 3PO5A 1TZ0A 2F4FA 2O1UA 4JV0A 2K06A 3RG6A 4OYIA 2FVPA 1BXNA 3DOMB 3HFKA 2IC3B 4NXNI 3U1NA 3MEKA 5HLFA 1JX4A 2V2KA 3N01A 3VGUA 1KQSR 9RUBA 2A6MA 1KOOA 1XR5A 3ZKDA 3CCTA 1NZAA 3HHKA 3UVJB 2YXLA 3UWTA 2C2MB 3H4BA 1YHQS 2HGNA 4CTAA 3KLIA 4DPXA 1F60B 2FY1A 2HNYB 5IT0A 4P7AA 1HI0P 1P27B 1D0EA 4JI1I 2RHQB 1QE1A 4KGXB 4KO0B 1KIJA 3OTOI 2VFUA 2ZITA 5K5MA 4PXEA 3SCIE 4ZJOA 1KKHA 1LXNA 3MURP 4DUTA 3HFVA 3PKYA 3QJLA 3RB4A 3D3CJ 2ASJA 5K8OA 2AP6A 4BWJA 1X5SA 4FNHA 2JEGA 3JTNA 3D66A 5F9LA 3KLHB 1SJRA 2CPEA 3GJSB 2YVSA 2FJWA 2P8IA 3AQOA 4XAKA 3J80C 3MM8A 4OZJA 3DLGB 4YHHJ 1OYPA 2CG8A 2WP8B 2BUNA 4FW3A 2HS3A 2Z4PA 4P74A 3OVBA 2HRUA 2LECA 4DU7A 1NJYA 2HHUA 1XEZA 4X4NA 3GV5B 3G82B 3JSYA 1TL4A 2O3ZA 4X65F 2E1AA 4IFVB 3CJKB 1YJVA 1U1RA 3OFFA 5H1SV 5DZ7A 3N28A 1NB7A 3MMAA 3CJQA 4QR2A 2OPSB 3MXHP 2W25A 5E2QA 2ATLA 1IBKI 4HHHA 1S1WA 2OPPA 4DUZF 1CEZA 3DLHA 2Q6CA 2L9WA 1E6YA 3POTA 4FVCA 3LAKA 4GKJJ 3BH7B 4LF5I 4LFBJ 3WBZA 2CQGA 4LF9E 1RT1A 1PYOB 2HHVA 2DGVA 4LRDA 2QA2A 1W2IA 2DIUA 4J9OA 3BQ2A 5SZTA 2IMWP 3CCWA 2RMLA 3D9BA 2XZTB 3N6NA 3H25A 4GVLA 2A10A 2W9AA 2HS0A 2WW4A 3OTEA 4DV6I 2WHOA 4OX9J 2L9DA 5IFMA 2VF3A 5CH7B 4DL5A 2IPOB 2DPJA 4CCHA 4DR3J 3E01B 5LMUE 1FJGJ 2VU5A 3PG9A 1CC8A 4H4MB 1NRKA 2YNGA 2WB1D 2CPDA 4IG3A 1BQNA 2ZKUA 4PQUA 2YX7A 4QW8A 2GO3A 1IKVA 2PGCA 2OEMA 4PG7A 1NK5A 1FE4A 4OZ1A 1MROB 3KKFA 1RAHB 3ZFVA 1NJXA 3NMAA 4MK9A 4X64J 5I4MA 3LUYA 4RNHA 4USMA 2QL7B 3G87A 5DRKA 3OV7A 1GFWB 5A2QU 1EP4A 1LFWA 1UL3A 4NEZA 2NCKL 4URLA 1F5AA 1H7UA 4ID5B 3VAFA 4K4WA 3ZTSA 1VQLS 2MKKA 4O3OA 5C0XA 1H0HB 3LGNA 5E41A 4F25A 2G1HA 2VQFE 1IQTA 1GT8A 2MZSA 1S9GA 4F0HA 1RWVB 1HNXJ 4WFZA 2OUGA 4UZCA 4F26A 5HJYA 4LF7J 2JC0A 4A47A 2DKOB 3H42A 3OXLA 3P5TL 2WVDA 1VBYA 2DNLA 1Z5AA 3I4HX 3R5AA 1V6HA 4USTA 5HVFA 1SJQA 2ZZMA 3OBIA 5ETSA 3QNWB 3CJ2A 4N8NA 3H8YA 4B3SJ 2XULA 1VDHA 1Z4UA 2OPRA 3CCMS 3EGWB 4USVA 3FGVA 4DS5A 2R9LA 2CJXB 1OWXA 2VKRA 5A6WA 4GKKF 3PTWA 3JSMB 3M6AA 2XMJA 3W60A 4GC7A 4C8KA 3ZZPA 1RTJB 1UMJA 2KZMA 3IFEA 1UKUA 2EFGA 2HYIB 2IDEA 1S10A 5I3PA 5DRRA 2ABYA 4ZVTB 3PX6A 1ZTWA 2F9JA 4DFPA 3R5BA 4BS2A 1S7IA 3HJCA 2C3YA 1B0TA 5ETVA 4I56A 2VPXB 3B4MA 2HVIA 2V8PA 2DGSA 5EWGA 3AT1B 2EG1A 4QU6A 3BBFA 2MQNA 3SSQA 2I6WA 3M05A 3EZ5A 2HS4A 1NK7A 1TKXB 1U09A 2KXFA 5HK4A 2P9CA 4E8UA 4ETXA 2BANA 3P45B 2VH7A 1U6BA 3M9NB 2JLGA 4PG8A 3HFZB 2XGPA 1RTDB 1LWCB 2JEBB 1L3VA 4LF9I 2ILZA 5CD4H 3P3CA 1TKZA 1FI4A 4C3KA 2V4RA 4MFBB 2F3JA 3SBMA 4ZK7M 4FW4A 5JEAF 2I5JB 3WZ0A 4ZP7A 3J81Q 3DLBA 2ZUGA 3MPDA 2RU9A 2XWYA 2NSCA 3OJSA 2CYYA 4C8YA 3UR3C 4PG6A 3PYGA 2XLJA 2M8DB 3K17A 3LP0A 1MN7A 3CDJA 1SUQA 2O67A 2NZCA 3UDCA 5LMUI 2XWXA 3KLGB 1VQPS 2HK2A 2CFXA 3JAMY 1DLOA 4MU3A 4LBPA 3VVTA 2R7SA 5HVHA 4M5JA 2W01A 1N36F 4YY3E 1YITS 2LMIA 3UFCX 3ZXWA 4F7VA 1NKEA 4LCHA 2BBEA 3MM7A 1C1BA 3LOUA 4NMLA 4GKJI 2YY3A 1RT4A 2JNJA 3I9ZA 2GVZA 5T7LB 4F0KA 5BR8J 1OS5A 2R2RA 1VHIA 1XJWB 2WZ1A 3GIJA 2LXFA 1FTCA 4JI4J 2E7VA 1KQFB 2Z5EA 2GIFA 3R7SB 4DR2F 3CD7A 2CQHA 4LQ9A 2YWEA 1RAAB 1N5YB 5KT5A 4KFBA 1Y60A 5B7WA 5FLXY 3MD3A 2VQFI 1N34F 4KHRA 1NPPA 4TYBA 3ILIA 2H48B 3HK2A 2PE8A 3UW1A 4RNMA 2LQBA 4EO6A 2QLFB 4E2FB 3MUMP 3W8GA 5F8NA 3AOCA 3BS9A 4NCGB 1FJGI 3RZAA 3PFOA 4DV5J 4OZLA 4PG4A 2GJIA 5KFCA 2VONA 1D9DA 1O8BA 4ANEA 3BKFA 4Q2MA 3CWVA 3W66A 1FRIA 1PC5A 1L5UA 4DV7F 1J5OA 4J5OA 3C16A 3EGZA 1RE1B 4B3OA 1DFDA 3ZNUA 2XNRA 4DF4A 2V5HG 4CM2A 4NI2B 2BQ3A 2DPIA 3D68A 2FJAB 1F0XA 4PXBA 4N56A 2MLXA 3P3EA 2PA8D 1NKCA 4C48A 2HNZA 3NS5A 3HP6A 1NB2A 5IV4A 1K9MT 4ZVIA 3DI6B 2PD1A 2J8AA 2M2BA 2RDDA 3SV3A 1S0NA 2W9CB 2E29A 3FCWA 3MEDB 3M2UB 2RILA 1YRUA 3ILLA 4JI8E 3B4TA 3PW7A 5K20B 3IXQA 3BYPA 2ROGA 3OTBA 1ZZNA 4CLSA 2YNHB 1O51A 2VPWB 1WD6A 3KUHA 3T1HJ 3R6GB 2V0NA 2J0SD 2UUTA 5KT4A 4DR6F 3M32B 3M2VB 2VJVA 5F8LA 1SJ4P 1QD1A 2CIMA 3CCQS 4NXNF 1WTBA 2ZH3A 1X8DA 4DV0E 1KFSA 2BM1A 4H4KA 2K7JA 1IBCB 2C37B 2RF2A 5L1JA 4OI0A 4RO0A 3GIMA 1RU2A 1WDTA 1TV6A 4Q5VA 1FNMA 1NLKL 4ZHRA 3BKUA 1ZM4A 3R2CJ 2HVZA 2VODA 4WZQA 2V67A 4WZMA 4RW8B 4KHPE 2HQFA 4O3QA 1U2RA 2QSFA 2QX0A 3AJ2A 2R7VA 3CUNA 3ZZ0A 5GMKa 3OTCA 2OIHA 2CPHA 3OTOF 2ZH6A 2YBVA 1GAOA 2MMYA 4OHXA 2OD4A 4LBHA 1NM2A 4ED7A 3QLHB 3BGRB 2JEIA 3Q8SB 4W92B 5MLCV 4N5SA 4LF6J 1Z2LA 1UFWA 4J9VA 2IYGA 5DM7Q 1YTYA 3PS2A 4RNFA 1NXIA 4GC6A 3KK1A 1HNZF 2XMAA 3EJMA 4U6PA 2HRYA 1Y10A 5LMNF 1FD8A 3J80U 3HCXA 3TX0A 4IH7A 2RNEA 2B0GA 3UDEA 1NDLA 1I94J 1DARA 4RW4A 3MAQA 2F8HA 3VQTA 1CS4A 4OYZA 3B54A 1N6QA 2NN6E 2VA3A 2MTLA 2D41A 1JQGA 2J6TA 4P75A 5EKWA 3BF4A 1WOSA 4NBQA 1U1NA 5HVGA 5DDOC 1MWZA 2GA7A 4WCEQ 2EK6A 1U0SA 2Z5CA 2VICA 5F8GA 4F04B 2P9GA 2O01C 4JYAF 2HURA 4WU3A 5HQLA 4RU2A 1S1XB 3IG1B 2X7IA 4KYZA 1L3KA 3ETOA 3PVXA 2MJNA 4I67A 3DRSA 3CULA 3G71S 1S97A 1TELA 1HLWA 3DGPA 2OMLA 1ZAVA 2VG7A 2YWGA 2HMIB 5BR8I 2OP5A 1R8HA 4Y3CA 2H3EB 2GO4A 3WX4A 3VQSA 3LWMA 1FX4A 4ZVQB 3JQKA 3Q8YA 4RBVA 4JI4I 5JMNA 2FJVA 4J3DA 3ISND 4NCBA 1RT6A 3I55S 4K7QA 4DR4E 3M30B 3PRVA 4ALZA 5KG6A 2YKMB 1TK5A 1JLEA 1BWVA 4L6V3 1WKJA 5DGAA 3HJFA 1PYTA 3NGTA 1Y7PA 1HBOA 4NE9C 4YR0A 4X4UA 2RU3A 4WFYA 4J9KA 3QZ7A 4LFAJ 4RWWA 3NWRA 4LBIA 2V9WA 3CMQA 4QIVA 4JI8I 1OPIA 1WC5A 2PO2A 2MQQA 4IG0A 3EDQB 2UXCF 2CQIA 3W65A 4CYUB 2P2CB 3KDOA 1IBLE 2Z8QA 1S79A 5FDLA 1GTEA 2W9BA 3NCQA 3MZIA 1R8AA 3ZC4A 4RW6A 1RR9A 4FWGA 4I6YA 3DOKA 2UUBE 2VG6A 1G4CA 3IN5A 4DV0I 5B0EA 3L7ZA 2RQ4A 3A8KA 1IKWB 2YH1A 4UY85 4WKRA 4DWIA 4EMDA 4B9UA 2BKOA 2HHHJ 2V94A 4DQSA 3WIUA 2KRRA 1S6OA 1ZOTA 3MOZA 1XBWA 5GMEA 4ANCA 1NSQA 3EX7B 4KHPI 2PI4A 2O66A 5A8KA 1U26A 2AGOA 4ZVEA 1RUSA 3PW4A 3ILOA 1J2VA 3MHYA 2KG1A 4ECQA 2IBKA 1B62A 2Z58B 4OO1F 1Y6ZA 2DCUB 3R9LA 3O5TB 4AQYJ 4C8LA 2DRAA 3DHWC 1YGYA 1C0TB 1FJ7A 1SL1A 1HQUA 5C0XC 1WI6A 4FKYA 5CD4A 4HXZA 2AGPA 1N4LA 2FPHX 2HQ3A 4LRCA 4WXOA 2GVDB 4IFDE 3M85D 4JI5E 3DRYA 3FSXA 4GO7X 3E2EA 1SJ1A 2HHSA 1OJ4A 4ECZA 3EICA 1QUVA 3CCSS 3OJUA 4CO3A 2WOMB 2QLJB 3M8PA 2YTCA 3D0GE 2KHCA 2ILYA 1FXLA 1UA0A 2O1TA 1TFYA 2CQPA 4DUYE 1P1TA 1H98A 2JHEA 4FF1A 2DNMA 1Z5CA 3GILA 3VTIA 2M88A 1S59A 2HZAA 3M2RA 1RKIA 1NHHA 2HWIA 1CC7A 5C42A 1OQ6A 2FZGB 3HULA 4OJ3A 4GVBB 5E0OA 1PO6A 3OUYB 1UWAA 3MM6A 2QMXA 1HWIA 4Y28C 2LA6A 3M8YA 1P9YA 2AQ4A 3CJ4A 4N47A 2AX0A 4NXME 2E9TA 1H7SA 2IMOA 2VBYA 5T14A 4G6VB 4I4BA 5EX3A 1Y11A 4KY3A 5E3RA 2IDLA 3UD5A 3KJNB 3MD1A 4DR4I 3DDKA 4YHHF 2CJQA 4ERDA 3TANA 4WWSA 2NPFA 5CYMA 4E98A 3R7NB 2MQOA 4IS9A 1Q7LB 4U3DA 3MR7A 6AT1B 5D0GA 2CQ1A 2E1PA 2GMJA 3N4WA 1RTHB 4N41A 1LXJA 4BA1A 4I7FB 4D3GA 3GMEA 2RDJA 1DTTA 2EFQA 3PV8A 1TK0A 2RQMA 1AUSL 1N5TA 4LFCE 5HQ8A 5K36E 1IBLI 1CJTA 4PWDB 1VJWA 1LWEA 5KG0A 3UNYA 8RUCA 3PYEA 2ZBQA 2XCPA 3TW0A 1U1OA 4U7CA 4DCJB 2C38B 1K73T 3C6UA 2DXEA 2HQDA 2UUBI 4LSLA 4FYYB 1JB0C 4B9TA 1ZETA 1RAFB 2BXJA 5HQMA 2IM3A 4X4VA 4WPAA 2VV5A 5T41A 4ED3A 2L48A 1VMBA 2E5HA 4GKJF 2V8HA 4WP9A 4LFBF 1NHJA 3L09A 4CLWA 2MZTA 3DOLB 2GO8A 4EUVA 5J1NA 3EM1A 3D2WA 1NK4A 3R5CA 4HYMA 3KK2B 3GCWP 4JI6J 2RT3A 1DQAA 1SBRA 2X1GA 1SKRA 2C2ZB 4FYVB 3TR5A 1S0VA 5KFFA 4BA2A 3R5DA 5I3UA 2DJWA 4J9LA 2HZVA 1HNWJ 1B64A 1YZ7A 1PBUA 4OX9F 4I69A 1FKAE 3W1YC 1XTZA 2HFNA 2UUAE 4DR3F 1FJGF 2DH8A 4KKOB 5J1EB 4EI2A 4DLGA 3TP2A 4OYOA 2RUGA 1IM4A 1SXLA 4HDGA 3BQ0A 2BACA 1IWAA 3FSIA 1MWQA 3WQPA 5E3AA 4MU4A 3TZWA 4C98A 4PKDB 2Z56B 4JI5I 2HQCA 3HKWA 4IOCQ 1X9WA 5L9XA 1M5PC 5M2PA 3MMJA 4O0NA 2R7UA 5C24B 3MDFA 1WG4A 4B3MJ 4X64F 5IT9C 3UCGA 2XZWA 3THTA 1FA0A 4IDKB 4OYXA 1VISA 2ERRA 4G65A 4PABA 1RT2A 3MPUB 3PM9A 3O3LA 1HPZA 2IOQA 2NN6D 4CH1A 3A3NB 2Q43A 2IM2A 2QSWA 4ECTA 2WNRB 2PEHA 3NNAA 1VIOA 2B8QA 3BO3A 4DUYI 1BLUA 3PACA 3MAHA 4MT1A 5GMDA 2XG8A 5EGYA 3NG8A 2DNRA 3KNGA 1QTMA 1L3UA 5CAAA 4J7CA 4X4QA 3ULHA 4PPDA 1HNXF 4AQYI 4LF7F 5B0CA 2C39B 1R0BG 3OR1B 1CULA 2R7OA 4NXMI 1RTIB 4LCFA 1N8RT 1YJRA 2VBXA 3RB0A 2Y8YA 1FRHA 3T5JA 1VRUA 4B3SF 5KT3A 4CLFA 3CJTA 4PRXA 1WNEA 4IR1A 2EFOA 4LF4E 1RKJA 5KFVA 2R2TA 4WXWA 5K36B 4JI0J 2WBMA 4PUOA 2WVCA 4FF3A 3OTDA 2JZ5A 2PMWA 4A8OA 2G0CA 2C2EA 4X4TA 3W3SA 3PR4A 1X4CA 1X0PA 1VQ8S 3VAGA 1T0TV 5BYRA 4HTIA 1S76D 2JEJA 1U02A 3RB6A 3OXGA 1NEEA 3RW7A 3I9V9 4ZPCA 4R8UB 3HHEA 4OZEA 3OQ2A 1NH7A 4WFXA 1U24A 2HNDA 3W7BA 2KKHA 3IWXA 1KNZA 4H4OA 2DNZA 4RUAA 2FC9A 1BQMA 4DV2E 4QJVA 3SZ2A 5JUMA 1YQHA 1U48A 1PILA 5HATA 2GS8A 2BJ9A 5H9FK 5JJBA 1UVKA 4KH1B 3AOBA 1A6LA 1CQMA 4EWTA 3FCHA 4LR7A 2W7PA 3GLLA 3M9MB 3LQVA 4RW7A 3GB0A 3J80Q 4J9MA 2HPUA 4X66E 2IJFA 1E6VA 3A4TA 4ZP8A 3UD4P 3WU5A 4MYUA 4QYRA 3MMCB 5HP1B 1SQFA 1FDBA 4ZMMA 2JH3A 5A2QY 3H4DA 1NNDA 5CYQA 4J9SA 1HMVB 2ZM6E 4KR0B 3G8SA 3V5RA 4R0EA 2GV1A 1IWGA 1XNRE 4HI1A 1HKAA 3TZZA 4TY8B 4ISAA 4O3PA 4IR9A 1NJZA 5CZVA 3U1YA 3NBPA 1CVJA 2XLIA 3EE3A 4Y2MA 2OO4A 2PNZA 4IFDD 1R8BA 5DG9A 1HBUA 4DS4A 5BR8F 1YK9A 4URGA 3LTOA 3C6TA 4DV1J 1SKUB 4B9MA 4JV5J 4AUKA 4JI4F 2FVSA 1F1BB 1W25A 4M5LA 5J2QA 1WC1A 4LF8J 1UDSA 1J5EE 3BSNA 1FDAA 7FDRA 3WX8A 4ZDNA 2DGWA 3DFEA 5KOWA 4MU1A 2X1AA 5BYSA 1M5HA 2V50A 1T9XA 3PNIA 3G8QA 4DV5F 2MZRA 3H5SA 4RJVA 4JI2J 3I5AA 5KG3A 2BE9B 2WONA 1R7IA 2UZAA 2HBRB 3DRXA 3CO9A 3TAPA 3V6KA 2NUHA 3ZZOA 2F4VE 4UOGA 4Y2AA 2OTLS 4A46A 2NXUA 1VHFA 3QGHA 2X1FA 2EFPA 4ECVA 3VGVA 3KJVA 4B3MI 3LP2A 2R8HA 1AZSA 2VFRA 5HLFB 1XNQJ 3Q8RB 5IZHA 3MF5A 1VQMS 3CJ8A 4CRJA 3CPWR 3KMSA 3KLIB 4NA1A 2KXHA 1C0UA 1WHWA 4Z7CA 4I64A 2OTJS 3QGGA 3E8OA 1QE1B 1S6QA 3DM2A 4FKXA 3QRPA 5IWAJ 5KFXA 2RSQA 4ZPDA 4DFJA 1BC6A 1Q7YT 5KFRA 1S7HA 3T1HF 1N54B 3D0HE 1U0HA 2JEFA 3HVRA 2D3ZA 4ZVGA 3LALA 3Q0AA 2QIFA 1RJJA 3PY8A 4YB5A 3P96A 3M8WA 3HLUA 3QT5A 1N5QA 1YJ9S 1HNIA 5F9NA 2JSXA 3IAS9 1B7YB 4AIDA 2G0IA 3MM8B 3KNAA 1D3WA 2XBPA 1URNA 4X66I 3R6LB 2Y0SD 4DV3E 1HQEA 2CQCA 2W7OA 3Q8QB 3LGHA 2BRKA 2A1BA 1BGXT 2OFHX 1R0CB 1YLXA 4YFUA 4TN2A 1MLAA 2F1FA 1USUA 2G2OA 4K0KJ 3OXFA 1H3DA 1YI2S 2KJVA 2OSRA 2IY5B 4ED5A 4M5IA 3PFEA 2OGUA 3MMAB 4ZLJA 2UXBJ 2NPIA 5A6PA 1HHQA 3WU6A 2LLZA 3LGMA 4LF6F 1U2FA 2YQ3A 3QWPA 4IRCA 1PKPA 3BSAA 3MFIA 1S1WB 2GX8A 1YJNS 1ULRA 3CD6S 1E6YB 3POTB 3SSRA 1UETA 1RYRA 2LQ5A 1IKXA 1YWXA 1I94F 1J5EI 4J9RA 2B43A 2BJ1A 4IYQA 2QYCA 1LK7A 1RT1B 1RHJB 2CVEA 2G13A 4B02A 3SQGB 1QAJA 1RLCL 1WHVA 3FC9A 1T9VA 5HBMA 1U45A 5AXNA 2LU2A 2M5YA 2R7XA 4KJIA 2OI2A 4MK8A 5KFUA 2CNLB 2QTWA 3C15B 1JWWA 2QFJA 3C3LA 2E44A 4JI3I 2B4UA 4Y00A 5LJ3Y 1XMQE 3VAHA 1TL1A 1IKYA 2APOA 2HBYB 4ATNA 4CIOA 4ECYA 2YNGB 5D77A 3SV4A 4IO1A 2ROPA 1SVDA 1BQNB 4PQUB 4X65E 3L7PA 1IKVB 4QPXA 4YUDA 1G6BA 3U1KA 1O6XA 1XK8A 1S5ZA 4JV5I 4HH0A 2IA6A 3ZO7A 3A8JA 1TKTA 3NEKA 4Y65A 2OMOA 5J2NB 4LR9A 4U8VA 2EPIA 1WSVA 1T05A 1EP4B 1NK9A 1PKUA 3HX9A 1JIHA 1WEXA 4DUZE 4PWUA 3NAHA 3D5MA 4ECRA 3EPGA 3V6JA 5C0XB 2XY7A 1FXDA 4LFAF 2YKQA 4DSIA 4EEYA 1AB8A 4O3RA 3KYLA 3KHGA 1GXTA 1VQ9S 3CVKA 3JXOA 4S0MA 4ZVFA 5H9EK 2DGXA 1S9GB 1T02A 2J7KA 1UAWA 4DR7J 3U7JA 3P76A 3US5A 1N33I 2A3JA 4FZVA 3G6XA 4WYLA 2QN6B 1DURA 3RB3A 3D7SB 2MXYA 3IS9A 5DDRC 3R97A 2V4QA 4NLTA 5AT1B 2OPRB 3IMQJ 1M1GA 5HMWA 5IT9U 1XNQI 2W2QP 3BH6B 2HHHF 2LYVA 5DNLA 2XTJP 2ZOFA 4JBCA 1AA1B 4DSKA 4IOAQ 4WUCA 2CNKB 3BV8A 1AW0A 3MTKA 4I2PA 2GQCA 1FK9A 1UP1A 1SJFA 2DGQA 4QNJA 1D1UA 1Q1KA 3CIZA 2XMTA 4WTOB 4KSEB 2EW9A 2H5EA 3MMBA 2NUUG 2JLFA 4AQYF 3MR3A 5IWAI 2N3LA 3L3CA 1AT1B 2XLKA 5IQ6A 4Q8FA 2JRSA 2KB2A 4I0WA 4J9PA 1IBMJ 4DL7A 5K8NA 2BANB 2VC0A 3HHLD 3R1LA 1AUDA 5F8IA 3RAMA 3M6VA 4FW5A 3QFWA 1TKZB 2DRDA 2JC1A 1UFLA 1K8AT 2VQEJ 2R8GA 2NN6A 5DRQA 4LJMA 2KFYA 3IAM9 1WC0A 4DI6A 3T3FA 2ZZNA 1R3NA 3AXKA 3OL8A 2DITA 3H98A 4WP3A 3LP0B 5DDQC 1SUQB 2E1RA 3QJJA 4FW9A 1GK8A 1KLNA 1M5KC 3GU0A 4DSFA 2CQ3A 4GKKE 4FF2A 4DQRA 1WHYA 4TU7A 2OFGX 4X65I 1XWLA 1GMUA 5CYJA 2Z57B 4LFCJ 3MAAA 2X1BA 2C3OA 3RR8A 2N4CA 2ZBIA 3MM7B 4K5SA 1C1BB 1RREA 3UVJA 1VQSA 5G4DA 2QRRA 4IRDA 4IOBA 2E5GA 1RT4B 2R2SA 2GVZB 2ZUAA 1UDNA 4DZ6A 5E3PA 3AH6A 3T6BA 3RBEA 2PO1B 2QLBB 3NGUA 4KH0B 4LRBA 4KO0A 4DUZI 4AL5A 1N5VA 3FMBA 4KFBB 2HVDA 1WELA 3UD3P 1B0VA 4KGMA 1WC4A 2J76E 2DIVA 2ZEJA 3HSZA 4N76A 1JJHA 5L38A 3MI7X 1ZBTA 3IBFB 5LXRA 2ZH5A 4AE5A 1PIEA 4HHJA 1SQGA 1D09B 4DPOA 3KLHA 5JEAE 1QZRA 3CW2C 4G1PA 5DRPA 1ZAXA 1W26A 5GAGU 5KFEA 3Q86A 1ZS6A 2K3IA 3BB5A 4B17A 3OLBA 1U1KA 1BKNA 1NPKA 2R8IA 4ES2A 4FP9A 3JSBA 2NZ4A 1D8ZA 3C16B 3ZZYA 2QA4G 4DV4J 2ASDA 2LKZA 1KVKA 3UN2A 4B3OB 2E5IA 2LCWA 2ZE2A 2VDIA 1Z1ZA 2ZJQQ 5KFZA 2GO9A 4JI6F 4PQAA 4M8LA 3MTJA 2KYXA 2GHWA 1MMLA 2HNZB 8AT1B 2FLPA 1HNWF 3HD1A 2YWFA 2UUCJ 4PR6A 1HWLA 1NH8A 3CB4A 4UY8T 4UOHA 2YPYA 2H4WB 3UO0A 2HBZB 2B5JB 2AV5A 4DR2E 4NWBA 3DNCA 2UVWA 5JVHQ 3F44A 1Q8IA 1N34E 3Q8PB 3EPIA 4IFDA 2HFSA 2KXNB 4G3IA 4DDFA 4B3MF 3CCZA 4DBQA 1S16A 2P5VA 4DPUA 3G6ES 5C2CA 4DR5J 3C19A 2CNOB 4NLQA 4CH0S 1SIWB 1TV6B 4YB7A 3RTVA 3Q8VA 2GAGC
chains in the Genus database with same CATH topology
3ZZ0A 4IZJD 1Z5AA 1EA6A 4LFCI 2J7KA 2HKJA 2E5LI 4DV7E 2V2QA 3LTOA 3Q1QA 2X36A 4KQVA 1N33I 2UU9I 1MU5A 3QT6A 1FWLA 1I94E 1Z5BA 1A6FA 2V2VA 2AJ4A 1J5EE 4UT4A 1ELOA 4LFCE 1HNZI 2A2DA 4JI2E 3WU4A 2A2CA 4K0KI 4XTJA 1IBLI 1ZM3A 5FWKA 1HR0E 3M6AA 5LMNI 4Z7YA 3PYEA 2HHHI 4FN5A 1XNQI 1N33E 3T1YE 1XMOE 1Z0EA 2UU9E 3B8HA 4DV6E 2EFGA 4DPTA 2UUBI 1H72C 2UXBI 4JI7E 3PYDA 4DV5I 4B3RI 1DARA 4JI6E 3ZM7A 3HJCA 4LFBI 2F4VI 4WUCA 2PNMA 2O1UA 4JI0I 1NHJA 3Q6MA 2V8PA 1XNQE 3J81C 1HNWE 5A2QC 1IBME 3J7AM 4NXNI 2BV3A 1Z0VA 3P06A 1MX0A 4HYMA 2F4VE 2Z5CA 4JYAI 1Z0GA 5IWAI 3WU3A 2UUAI 3ZKDA 2V34A 4B3MI 1XHKA 4DR6E 2VQEE 3ZZTA 4LF9I 4DV4I 4OX9I 4PRVA 1Z0CA 4DPXA 5L3JA 2Z5CB 4NXNE 2X7IA 1Z0TA 4P7AA 1FI4A 3GONA 4DR3I 1FKAE 1H73A 4JI1I 1N32E 4DPYA 2DEJA 5IWAE 2UUAE 3J81Q 1KIJA 5A2QQ 1Y4UA 2GQ0A 3OTOI 4B3ME 2ZBKB 3K1JA 2ZITA 4HY1A 4Z7CA 1KKHA 5BR8I 4JG4A 3J7AG 3PYGA 2IOPA 4LFAE 2UUCI 4JI4I 1S4EA 4YHHE 3K17A 4WUBA 1ZM2A 3QT7A 2O1VA 4YY3I 1N0UA 4DR4E 4P52A 4UTGA 2PNLA 4JI5I 5LMUI 1UEKA 2BM0A 3OTOE 4X64I 4GKKI 2HK2A 2UXDI 3T1HI 5BR8E 1Z0WA 1USVA 5IT9C 1N36I 2E5LE 1VISA 4JI4E 2V2ZA 3J80C 2E1RA 4FW9A 4IZKA 1HK7A 4YY3E 2IOQA 4DV3I 3QT5A 3H4LA 4JI8I 2UXCI 4GKKE 4GKJI 1WUUA 4DU7A 4DXLA 4DUYI 4RPFA 4X65I 1HNZE 4K0KE 1IBLE 1N36E 5GMDA 4IZKB 4X66I 5LMNE 1PVGA 2HHHE 1RR9A 4FWGA 4DV3E 2HFUA 1HNXI 2Z5EA 2UUBE 1RREA 2UXBE 4LF7I 3LPSA 4DV5E 2Q2EB 3ZZUA 4AQYI 4B3RE 4GKJE 3D4JA 4DV0I 4LFBE 5IT9Q 1KTVA 1N34I 4DR7I 1NZ0A 4JI0E 4NXMI 1USUA 2VQFI 4LF4I 4EMDA 4DV1I 4B3SI 4DUZI 1IBKI 1D6TA 4X62I 5GMEA 4AQYE 4LF8I 4LF6I 4KHPI 4PRXA 3WU6A 1FJGI 4JYAE 2CGEA 4LF5I 4LF4E 1PKPA 1PIEA 2CG9A 4DV7I 4LF9E 4FWDA 4DV4E 4OX9E 3CWVA 4ED4A 3LNUA 1B62A 3JAMC 1QZRA 3B82A 4B3TI 1NHIA 1ZXMA 1Y6ZA 4DR3E 1I94I 1ZM9A 1FJGE 4JI1E 3F0NA 4USKA 1J5EI 1BKNA 4JI2I 3Q6NA 4R1FA 1HR0I 4DV2I 4HXZA 2R3VA 1XMQI 3T1YI 1XMOI 1FWKA 4B3TE 2WW4A 4DV6I 2UUCE 1MG7A 2O1WA 1KVKA 2VF3A 4JI7I 4DU8A 3QT8A 4JI5E 2OI2A 5LMUE 4JI6I 2DEIA 1OJ4A 4X64E 4ZVIA 5LL6R 2UXDE 3T1HE 4JI3I 1ZXNA 4DV2E 1Y4SA 3JAMQ 1H74A 2LJPA 1XMQE 1HNWI 1IBMI 2GS8A 4HACA 4MYTA 4DR2I 5FLXC 2O1TA 4DR1I 4M1KA 4DR5I 2XEXA 4JI8E 2UXCE 1Z0BA 2HKEA 3B78A 1B63A 4JI3E 4DUYE 4X65E 4HACB 4USMA 2CZ9A 2ZM6I 1N0VC 1Z5CA 3J80Q 4DPWA 4DR6I 4X66E 2VQEI 2Z5BA 3PRYA 4DR2E 4FWHA 1K47A 3WU5A 4MYUA 4DR1E 1HNXE 1NHHA 1XNRI 4JV5I 4DR5E 3K85A 4LF7E 3HULA 4URLA 1H7UA 1N32I 3PYFA 4IZJA 4DV0E 3V2UC 2BM1A 2Z5BB 1N34E 4N3OA 1Z59A 2ZM6E 4DR7E 2HFSA 4NXME 4I3HA 2VQFE 2R42A 5FLXQ 2HK3A 3ZKBA 4WUDA 3V5RA 1H7SA 4DV1E 1FNMA 4B3SE 4DUZE 1XNRE 1S16A 4JV5E 4LFAI 1ZM4A 1IBKE 4IZJB 4YHHI 4DPUA 4X62E 4PU9A 4DR4I 4LF8E 4LF6E 4KHPE 1U2RA 2NPFA 4LF5E 1EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZ0 A;  1Z5A A;  1EA6 A;  4LFC I;  2J7K A;  2HKJ A;  2E5L I;  4DV7 E;  2V2Q A;  3LTO A;  3Q1Q A;  2X36 A;  4KQV A;  1N33 I;  2UU9 I;  1MU5 A;  3QT6 A;  1FWL A;  1I94 E;  1Z5B A;  1A6F A;  2V2V A;  2AJ4 A;  1J5E E;  4UT4 A;  1ELO A;  4LFC E;  1HNZ I;  2A2D A;  4JI2 E;  3WU4 A;  2A2C A;  4K0K I;  4XTJ A;  1IBL I;  1ZM3 A;  1HR0 E;  3M6A A;  5LMN I;  4Z7Y A;  3PYE A;  2HHH I;  4FN5 A;  1XNQ I;  1N33 E;  3T1Y E;  1XMO E;  2UU9 E;  1Z0E A;  3B8H A;  4DV6 E;  2EFG A;  4DPT A;  2UUB I;  1H72 C;  2UXB I;  4JI7 E;  3PYD A;  4DV5 I;  4B3R I;  1DAR A;  4JI6 E;  3ZM7 A;  4LFB I;  2F4V I;  4WUC A;  4JI0 I;  1NHJ A;  2V8P A;  1XNQ E;  3J81 C;  1HNW E;  5A2Q C;  1IBM E;  3J7A M;  4NXN I;  2BV3 A;  1Z0V A;  4HYM A;  1MX0 A;  2F4V E;  4JYA I;  1Z0G A;  5IWA I;  3WU3 A;  2UUA I;  3ZKD A;  2V34 A;  4B3M I;  1XHK A;  4DR6 E;  2VQE E;  3ZZT A;  4LF9 I;  4DV4 I;  4OX9 I;  4PRV A;  1Z0C A;  4DPX A;  5L3J A;  4NXN E;  2X7I A;  1Z0T A;  4P7A A;  1FI4 A;  3GON A;  4DR3 I;  1FKA E;  1H73 A;  4JI1 I;  1N32 E;  4DPY A;  2DEJ A;  5IWA E;  2UUA E;  3J81 Q;  1KIJ A;  5A2Q Q;  3OTO I;  4B3M E;  2ZBK B;  3K1J A;  2ZIT A;  4HY1 A;  4Z7C A;  1KKH A;  5BR8 I;  4JG4 A;  3J7A G;  3PYG A;  4LFA E;  2UUC I;  4JI4 I;  1S4E A;  4YHH E;  3K17 A;  4WUB A;  1ZM2 A;  3QT7 A;  4YY3 I;  1N0U A;  4DR4 E;  4P52 A;  4UTG A;  4JI5 I;  5LMU I;  1UEK A;  2BM0 A;  3OTO E;  4X64 I;  4GKK I;  2HK2 A;  2UXD I;  3T1H I;  5BR8 E;  1Z0W A;  5IT9 C;  1N36 I;  2E5L E;  1VIS A;  4JI4 E;  2V2Z A;  3J80 C;  2E1R A;  4FW9 A;  4YY3 E;  4DV3 I;  3QT5 A;  3H4L A;  4JI8 I;  2UXC I;  4GKK E;  4GKJ I;  1WUU A;  4DU7 A;  4DXL A;  4DUY I;  4RPF A;  4X65 I;  1HNZ E;  4K0K E;  1IBL E;  1N36 E;  5GMD A;  4X66 I;  5LMN E;  1PVG A;  2HHH E;  1RR9 A;  4FWG A;  4DV3 E;  2HFU A;  1HNX I;  2UUB E;  1RRE A;  2UXB E;  4LF7 I;  3LPS A;  4DV5 E;  2Q2E B;  3ZZU A;  4AQY I;  4B3R E;  4GKJ E;  3D4J A;  4DV0 I;  4LFB E;  5IT9 Q;  1KTV A;  1N34 I;  4DR7 I;  1NZ0 A;  4JI0 E;  4NXM I;  2VQF I;  4LF4 I;  4EMD A;  4DV1 I;  4B3S I;  4DUZ I;  1IBK I;  1D6T A;  4X62 I;  5GME A;  4AQY E;  4LF8 I;  4LF6 I;  4KHP I;  4PRX A;  3WU6 A;  1FJG I;  4JYA E;  4LF5 I;  4LF4 E;  1PKP A;  1PIE A;  4DV7 I;  4LF9 E;  4FWD A;  4DV4 E;  4OX9 E;  3CWV A;  4ED4 A;  3LNU A;  1B62 A;  3JAM C;  1QZR A;  3B82 A;  4B3T I;  1NHI A;  1ZXM A;  4DR3 E;  1I94 I;  1ZM9 A;  1FJG E;  4JI1 E;  3F0N A;  4USK A;  1J5E I;  1BKN A;  4JI2 I;  4R1F A;  1HR0 I;  4DV2 I;  4HXZ A;  2R3V A;  1XMQ I;  3T1Y I;  1XMO I;  4B3T E;  1FWK A;  2WW4 A;  4DV6 I;  2UUC E;  1MG7 A;  1KVK A;  2VF3 A;  4JI7 I;  4DU8 A;  3QT8 A;  4JI5 E;  2OI2 A;  5LMU E;  4JI6 I;  2DEI A;  1OJ4 A;  4X64 E;  4ZVI A;  5LL6 R;  2UXD E;  3T1H E;  4JI3 I;  1ZXN A;  4DV2 E;  3JAM Q;  1H74 A;  2LJP A;  1XMQ E;  1HNW I;  1IBM I;  2GS8 A;  4HAC A;  4MYT A;  4DR2 I;  5FLX C;  4DR1 I;  4M1K A;  4DR5 I;  2XEX A;  4JI8 E;  2UXC E;  1Z0B A;  2HKE A;  3B78 A;  1B63 A;  4JI3 E;  4DUY E;  4X65 E;  4HAC B;  4USM A;  2CZ9 A;  3J80 Q;  1N0V C;  1Z5C A;  2ZM6 I;  4DPW A;  4DR6 I;  4X66 E;  2VQE I;  4DR2 E;  4FWH A;  1K47 A;  3WU5 A;  4MYU A;  4DR1 E;  1HNX E;  1NHH A;  1XNR I;  4JV5 I;  4DR5 E;  4LF7 E;  3HUL A;  4URL A;  1H7U A;  1N32 I;  3PYF A;  4DV0 E;  3V2U C;  2BM1 A;  1N34 E;  2ZM6 E;  1Z59 A;  4DR7 E;  2HFS A;  4NXM E;  4I3H A;  2VQF E;  2R42 A;  5FLX Q;  2HK3 A;  3ZKB A;  4WUD A;  3V5R A;  1H7S A;  4DV1 E;  1FNM A;  4B3S E;  4DUZ E;  1XNR E;  1S16 A;  4JV5 E;  4LFA I;  1ZM4 A;  1IBK E;  4YHH I;  4DPU A;  4X62 E;  4PU9 A;  4DR4 I;  4LF8 E;  4LF6 E;  4KHP E;  1U2R A;  2NPF A;  4LF5 E;  1EI1 A; 
#chains in the Genus database with same CATH topology
 3TUZ C;  2CQ2 A;  4ZHR B;  4J37 A;  1S1V A;  3R5G A;  4DV7 E;  4H4M A;  3MEE A;  5GAD U;  3OSP A;  2ASY A;  1K0V A;  4FXW A;  1VQ7 S;  2GHP A;  1H2T Z;  3WC0 A;  3PJW A;  2D9O A;  5L1K A;  2CA9 A;  4UT4 A;  3IO1 A;  4QR1 A;  2MKC A;  3WU4 A;  2LQJ A;  1JLB A;  2MKH A;  4RLE A;  4Q0B A;  3WDO A;  2AJ2 A;  2MZQ A;  4F3M A;  1RBO B;  2PDA A;  1K44 A;  5IC6 B;  3QZ8 A;  2CVI A;  3PYD A;  1IR0 A;  2E1M C;  4ZVR B;  3BGO P;  3KK1 B;  1T11 A;  3QID A;  3E3X A;  4L76 A;  1N48 A;  3W8P A;  3K5N A;  5I42 A;  1X4F A;  4U7U D;  4ID5 A;  2BJ3 A;  5C2G A;  4JI0 F;  4ILM A;  2C42 A;  2LP4 A;  4EU0 A;  1T9W A;  3K8W A;  1H38 A;  4RW4 B;  3ICL A;  3T1Y J;  2UU9 J;  2R7W A;  1N6Q B;  2UP1 A;  1S9F A;  2DGU A;  4JI7 J;  3JQJ A;  4KV8 A;  2WBR A;  3EVO A;  3HZG A;  2BOP A;  1Z0G A;  2DNN A;  4LIR A;  2DNO A;  2P6S A;  4NA3 A;  2V34 A;  5THW A;  1S1U A;  4JV1 A;  4OYB A;  1S0M A;  4DR6 E;  3DXS X;  3RU0 A;  1D8Y A;  5KFT A;  5EWE A;  1CSJ A;  1X4H A;  3ZZT A;  4OI4 A;  1VFJ A;  2EFN A;  4ZVU B;  3FRZ A;  2Z5C B;  4NXN E;  2Y1I A;  3CC4 S;  1VIX A;  4K59 A;  1CLF A;  1VC0 A;  2IM0 A;  3KG1 A;  4DHV A;  1NHK L;  4ZLN A;  2XMU A;  3DRS B;  3ETM A;  2FJD B;  1UW4 A;  3EUN A;  3DGP B;  5ETK A;  1UFK A;  2VG7 B;  5LSL A;  3OTO E;  4OHZ A;  2DNH A;  3CC7 S;  5ITH A;  2QC3 A;  3KJQ B;  1GEH A;  4W4M A;  1N36 I;  1RT6 B;  1IXK A;  5AXM A;  1DRZ A;  2HRT A;  4IZK A;  1MN9 A;  2JWN A;  2PC6 A;  3JTO A;  2CG4 A;  2AD9 A;  1NZ8 A;  1RT5 A;  1HBO B;  2GQQ A;  1KN6 A;  4DXL A;  1HI8 A;  2W1B A;  1HNZ E;  3GIR A;  1FO1 A;  3KJF B;  1F2G A;  5LMN E;  3QGI A;  3CCU S;  4QIE A;  1R27 B;  3EXY A;  4K4S A;  2XZD B;  2PO2 B;  2ZFH A;  4OMF G;  3LA0 A;  4CLP A;  3Q89 A;  4RUC A;  1T7P A;  5FDL B;  2W9B B;  4MIA A;  1N34 I;  4RW6 B;  1NZ0 A;  1B4S A;  3AQP A;  3DOK B;  1LQ9 A;  5KFS A;  3D1O A;  2XC9 A;  2NSB A;  3GFZ A;  3P5B P;  4BLG A;  4DV1 F;  4MKA A;  3OHA A;  2BAB A;  4JV5 F;  5DDP C;  3L9Z A;  1RP5 A;  2H51 B;  1BY9 A;  3L7Z B;  1GX6 A;  4JYA E;  2MGZ A;  4LF8 F;  4FBT A;  2W4P A;  1B70 B;  3N9U C;  4LSN A;  2B6A B;  3BGU A;  4P7T A;  3AD9 C;  2E9R X;  1RAC B;  1RWW B;  1RU1 A;  2Q79 A;  4QIF A;  4OZ3 A;  4EBE A;  4DV7 I;  2CAJ A;  1TTH B;  1M1K T;  4FWD A;  3S8S A;  1RHY A;  5L1L A;  4OZN A;  3B82 A;  4TYA A;  3C14 A;  2IRX A;  3CO0 P;  2J9E A;  2EI5 A;  4ZPT R;  3AD8 C;  4OX8 A;  3CXC R;  3CMA S;  1FKP A;  3VZH A;  3KLF A;  1JLA A;  4MK7 A;  3EXC X;  2BEF A;  1UJ6 A;  4ELU A;  4J9U E;  4JI2 F;  2R3V A;  4IKA A;  1HA1 A;  1QY7 A;  3BPS P;  1HQU B;  3OVS A;  3IWN C;  3W9J A;  1UEU A;  4CO0 A;  1YG0 A;  1S0O A;  5K9F A;  3BEG B;  5BXI A;  4ZPW R;  2JLE A;  4ED8 A;  3PW0 A;  2FJX A;  1Y4S A;  3JAM Q;  1N5Y A;  4WFB Q;  2L08 A;  5ETR A;  4HAC A;  1XNQ F;  1GNK A;  3AA8 A;  4DR5 I;  2W4C A;  3FQK A;  2UXC E;  2D7S A;  3RBZ A;  3M8P B;  2V8G A;  4NLO A;  2UXD J;  2AGQ A;  1R0A A;  3S01 A;  4DR6 I;  4NCG A;  1RWX B;  2YNI B;  3I0S A;  1FHT A;  4FWH A;  4DQP A;  5KG2 A;  1PGZ A;  4QIG A;  2AWZ A;  1NAQ A;  1C4C A;  3Q2T C;  3PHE A;  2N3O A;  5AJ3 J;  3GJQ B;  2BA1 G;  3V2U C;  4C8M A;  3DXB A;  3MPW A;  5JEA D;  5IWA F;  1SC4 B;  5DG7 A;  3CF5 Q;  3M2R B;  5FLX Q;  2KT2 A;  4WUD A;  2QFI A;  1TUV A;  1NJI T;  3MM6 B;  3CNQ P;  3LF0 A;  3R3T A;  4P2X A;  4DR1 J;  1Q82 T;  2PI5 A;  4QOT A;  2DD8 S;  2IM1 A;  3HXM A;  1YVF A;  1C4A A;  3SQO P;  5CXT A;  3W2V A;  4IZJ D;  4PAA A;  1RCX B;  3FUY A;  4J9N A;  2FLN A;  4ZCI A;  3L7U A;  1TMJ A;  2RRN A;  4URQ U;  3IC1 A;  2V2Q A;  4OO1 E;  5H9E J;  3D6M B;  2UU9 I;  1MU5 A;  5CYM B;  3LP1 A;  2NQP A;  5IQQ A;  4X62 J;  2X3G A;  3QAT A;  1MU2 A;  1TP7 A;  2Z2M A;  4A8Y A;  1HNZ I;  3AOA A;  4BA1 B;  3GWC A;  1MW7 A;  3QBC A;  5LMN I;  3PS3 A;  3CTR A;  4K0K F;  1DTT B;  2YNH A;  1FF2 A;  4Y2C A;  2NN6 C;  4JUZ A;  3J81 j;  4B9L A;  4XK8 C;  4DFM A;  3E51 A;  1RYS A;  3PX4 A;  4YN3 B;  2B9E A;  2UXB F;  2KVI A;  1U8W A;  1LWE B;  4X84 A;  1Y5Y A;  2JT2 A;  3PO4 A;  3DMJ A;  1YBU A;  3C6U B;  5L46 A;  2ZC4 A;  4LSL B;  3K5P A;  3KLE B;  3J81 C;  1HR0 J;  4RL1 A;  5D6G A;  1BWE A;  2DBB A;  4FBU A;  1S57 A;  3HHL A;  1XMQ J;  2PSZ A;  1XMO J;  3K57 A;  1FXR A;  2A18 A;  2B4P A;  4AIM A;  4JYA I;  2ADB A;  1B0P A;  4V19 J;  1P9Q C;  1VLY A;  4UZB A;  4ZS6 A;  4FW7 A;  2FJB B;  1AYE A;  4K4X A;  4NLD A;  1F9F A;  2BQR A;  1U1M A;  4LR8 A;  3GON A;  2MKS A;  4BBY A;  3TNV A;  1UTA A;  4ZLL A;  3H2U B;  1VK8 A;  4WII A;  3RJM B;  3NNH A;  2CQ4 A;  5I3U B;  4DQQ A;  3V81 A;  1BD6 A;  2HHP A;  4O23 A;  3QLH A;  2HVH A;  2WSE C;  3FEY B;  1P42 A;  4LCG A;  4XDC A;  1S4F A;  4ZA1 A;  2JEA A;  2EBE A;  3PZP A;  1DTQ A;  4O4R A;  3CT9 A;  1NDK A;  3OFE A;  4YHH E;  1Q81 T;  3GMG A;  1N0U A;  3KUG A;  4QWC A;  4JP8 A;  4UTG A;  3NRB A;  2CPY A;  2B9W A;  3M1V A;  2VG5 A;  3ADA C;  1U47 A;  1Z0W A;  2HHQ A;  3GJR B;  1IJE B;  1T8E A;  1RTZ A;  1UCN A;  2FGO A;  1WHX A;  1ZAW A;  4ER8 A;  1PAU B;  2OHD A;  4P10 A;  2CAD A;  5AE1 A;  3H4L A;  3HKZ D;  2UXC I;  1TL3 B;  1EET A;  1RT3 A;  2B7C B;  1JMT A;  1JNZ B;  1RT2 B;  1YJ7 A;  2XSJ A;  2CRL A;  4F4Z A;  5GAH U;  1Q95 G;  3AY0 A;  3RRK A;  3CDA A;  2E5L J;  3HVT A;  2HFV A;  2M52 A;  1R6Y A;  2HFU A;  3BYR A;  2BKP A;  2BJD A;  3Q23 A;  3OLA A;  1EQ0 A;  4EZ6 A;  2Q2E B;  4GKJ E;  1S1X A;  1U1L A;  4LFB E;  2IJN A;  3TAQ A;  3CJR A;  3AHP A;  2FYX A;  2J6S A;  1S77 D;  4DR7 F;  4M5H A;  2V63 A;  2MJU A;  3SDE B;  2ZD1 A;  1VK3 A;  2QMW A;  4OYA A;  1CUL B;  4AD6 A;  3IR6 B;  4OLO A;  5LXY A;  2IVF B;  3BKT A;  3BQ1 A;  4C0O C;  4B3R J;  3ENQ A;  4MIW A;  2ZH4 A;  3WC2 A;  2OEL A;  4F4W A;  2UVV A;  2XHW A;  3FBF A;  2SXL A;  3DGV A;  1VRU B;  1KQK A;  4CWB A;  2Y0B B;  4BDP A;  4OZ5 A;  4OX9 E;  2FHM A;  2GZO A;  3LNU A;  2BA0 G;  1RHR B;  2ATC B;  1FJC A;  4DR3 E;  2HHT A;  1FJG E;  3A3P B;  2C1E B;  3F0N A;  1EB0 A;  4FVM A;  2H1Y A;  4ZVP B;  4OZ0 A;  4TU9 A;  3Q6N A;  1QSS A;  4IFD C;  2DHX A;  3W5X A;  1QSY A;  4PUO B;  1SL2 A;  1JLC A;  1N56 A;  4CYU A;  1OY6 A;  2CKW A;  5DET A;  2VB6 A;  5RUB A;  3BM7 A;  3GTY X;  2RKI A;  2MKY A;  3QT8 A;  2NXJ A;  2ZH2 A;  3TEG A;  2AW0 A;  3PJ9 A;  4X64 E;  2VJU A;  3NGS A;  3CJS A;  2K8G A;  1WI8 A;  1H74 A;  3J7Z 5;  4DSJ A;  4NA2 A;  4P2S A;  4DR1 I;  1IBM F;  2Y1R I;  2HND B;  2ZH1 A;  1P8G A;  4AM3 A;  4H4O B;  1TL7 A;  1BQM B;  1UJ5 A;  3V4I A;  4RNN A;  1VS3 A;  4J91 A;  2VUG A;  2HVE A;  4ZIT A;  5C25 A;  1N88 A;  1KDN A;  2JJ4 D;  4G1Q B;  1M90 T;  2CPZ A;  2VQE F;  1HNX E;  3SFG A;  3PEJ A;  3K85 A;  4LF7 E;  2HQG A;  4CM0 A;  4RW7 B;  2L3M A;  3KMQ A;  3Q8U A;  3GJT B;  2AYE A;  3JSR A;  3EWG A;  1H6K X;  3WIV A;  5KTQ A;  3NS6 A;  3ZKB A;  4CLL A;  1N52 B;  4B3S E;  2BW2 A;  2E7W A;  4X4O A;  2XMW A;  4YHH I;  2HGM A;  2XYG B;  2VHG A;  5CYQ B;  1ZPV A;  1HHS A;  4L72 B;  3W5Z A;  3AFG A;  3IR5 B;  4RKU C;  4CNY A;  1UVM A;  3OR2 A;  2GVD A;  1FVQ A;  4I68 A;  2IAJ A;  2YKO A;  4LFC F;  4FS1 A;  4RWX A;  2VDH A;  5K36 F;  2ACY A;  3TZX A;  4K4T A;  5K36 C;  1UJ4 A;  1BQX A;  4A8S A;  3NBP B;  1Z5B A;  2WOM A;  4CLT A;  2Z2Y B;  2AEM A;  2FJE B;  2PNZ B;  1HBU B;  2FTR A;  4ZJL A;  4H54 A;  4XTJ A;  8ATC B;  4CI0 B;  3TA2 A;  4EFA C;  1ITP A;  2MHE A;  2C28 A;  1WEY A;  4ED1 A;  5J2Q B;  1RCO B;  3QMQ A;  9ATC B;  2YKA A;  2JE6 A;  2B51 A;  2B9X A;  5IT9 Y;  2LU1 A;  2J9D A;  3C46 A;  4ITS A;  4LFB I;  1YZ6 A;  5CQG A;  3Q6M A;  4MIB A;  2VZ9 A;  5DM6 Q;  3PW5 A;  3G86 A;  2Y1J A;  1I5O B;  2UVU A;  3P06 A;  4WFA Q;  3IWL A;  3H59 A;  2IYI A;  1U2C A;  1O5J A;  3F56 A;  1Q79 A;  3N6L A;  3V4M A;  1FKA F;  3O2I A;  2XMV A;  3RAX A;  2WON B;  2QG9 B;  4RUH A;  1XHK A;  4RNO A;  2VC1 A;  5MAO A;  4NPO A;  4OX9 I;  1Z0C A;  3QWU A;  1PBA A;  2KT3 A;  2KT5 A;  4DV4 F;  4DR3 I;  1NK6 A;  3DHX A;  2JX2 A;  3KJV B;  3LP2 B;  4OO1 D;  3QQC D;  4LIW A;  1AZS B;  1A9N B;  3EGV A;  3GG1 A;  3G8T A;  3JQM A;  3CME S;  2CXE A;  2J6U A;  2I38 A;  1S4E A;  1ZM2 A;  2UV8 G;  3MCM A;  2UUC F;  5M2R A;  1C0U B;  1N32 J;  2V6A A;  1Y5N B;  4RBT A;  4U95 A;  4X64 I;  2PMH A;  3M8Q A;  5BR8 E;  1S72 S;  1S6Q B;  3DM2 B;  4YP3 A;  3W2W B;  4UUW A;  4JI4 E;  3T41 A;  3NNC A;  2GFF A;  2ZJP Q;  3T5K A;  3NZK A;  2OPQ A;  3KFW X;  4HTJ A;  1U0H B;  3BBB A;  5KFO A;  3PKM A;  2BE2 A;  1UW9 A;  3G6V A;  2C2D A;  2DHA A;  3SFU A;  2EK1 A;  4EZ9 A;  1F5B A;  2JVO A;  3NS7 B;  1FRX A;  2RB7 A;  1HNX I;  4NYO A;  4M63 A;  2QGF B;  4WU2 A;  1HBN A;  1FKO A;  4LF7 I;  5KFY A;  1ZTT A;  1B7F A;  1LWF A;  4DR5 F;  4DV5 E;  1JJC B;  1H2V Z;  1RAE B;  3P3G A;  2BJE A;  4P71 A;  2WVE A;  2XI3 A;  4DL4 A;  4LRF A;  1I51 B;  4B3S I;  2YWW A;  1IJF B;  2KZZ A;  2PO4 A;  2F40 A;  1VOM A;  4OHV A;  1D6T A;  2DHG A;  4ZKA A;  4P72 A;  2B4V A;  2BOA A;  1T03 A;  1LNQ A;  2VES A;  4IFY A;  5DQH A;  1HL6 A;  3QAE A;  3M6U A;  5C7P A;  1VC6 A;  5KT2 A;  7FD1 A;  3QJP A;  3MR2 A;  4MAK A;  4F2S A;  1UVN A;  4DX8 H;  4YR3 A;  5IM0 A;  1CQN A;  3C2P A;  3CDI A;  5E33 A;  4FF4 A;  2IA0 A;  2GJF A;  5IS2 A;  1K0T A;  4QIW D;  2MQL A;  3MEC B;  1VQY A;  2D1C A;  5HMY A;  3U27 A;  4O44 B;  1IKX B;  3GSI A;  4ENO A;  4U9R A;  1E3P A;  5L8R C;  3T1Y F;  3IP0 A;  4QBU A;  2UU9 F;  4C3M A;  1DBD A;  1FNX H;  1KVJ A;  2F63 A;  4JI1 J;  2F65 A;  1CJK A;  3J7Y I;  4JI7 F;  2LA4 A;  5LL6 d;  1APS A;  4CO2 A;  3T1H E;  2MQ8 A;  5BYQ A;  4IO9 Q;  3VAI A;  1R6M A;  2XS5 A;  1K1S A;  2CPF A;  1XN9 A;  5HBM B;  2AYB A;  4FS2 A;  4ZJQ A;  1PJ6 A;  4B3T J;  2KTQ A;  2LXU A;  4ECU A;  2WTF A;  2XEX A;  1SB6 A;  5JEA A;  1KC8 T;  1FFW B;  1QAX A;  1U6F A;  3T6J A;  4AYB D;  2WK4 A;  3DCA A;  1TL1 B;  4KAI A;  4ED2 A;  3HSJ A;  1SI9 A;  4OIX A;  5GVQ A;  2ZM6 F;  4WE1 B;  3BR9 A;  3DN9 A;  3J81 U;  4LRE A;  4UQT A;  4TKT A;  2WRM A;  1KWM A;  2A0F B;  1GH8 A;  2I8E A;  3DLK A;  3CSK A;  2KG0 A;  4IZJ A;  2NS1 B;  4BWM A;  1WOP A;  3DRR A;  5EL9 A;  1XMB A;  5KOX A;  1LV5 A;  5CA5 A;  3I87 A;  2CJK A;  5IOL A;  1S6P B;  1TKT B;  3VWS A;  1HW9 A