3GONA

Streptococcus pneumoniae phosphomevalonate kinase in complex with phosphomevalonate and amppnp
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
329
structure length
329
Chain Sequence
MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphomevalonate kinase
publication title Structure of the ternary complex of phosphomevalonate kinase: the enzyme and its family
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 115
structure length 329
sequence length 329
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3gonA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3gonA01
4DR3I 1PVGA 4DPWA 2ZBKB 4DV5E 1XMOE 5A2QQ 1FI4A 4JI1E 3V2UC 4JI0E 2UU9E 1N33I 1FWKA 1XMQI 1FNMA 5BR8E 5FLXQ 5LMNE 1Z0BA 1U2RA 4LFAE 1N34E 4B3MI 4X65I 3T1HI 4YY3I 4UT4A 2X36A 4LF9E 2R3VA 4KHPI 4UTGA 4K0KE 4DR2I 4DXLA 4DV3I 1D6TA 2UUCE 2V2VA 3B8HA 2Q2EB 1ZXNA 4X64E 4DUYE 4MYUA 4AQYI 4DV7E 1XNRE 1J5EE 4LFCE 2EFGA 4FW9A 5FLXC 4JI4I 3D4JA 4DR7I 3J81Q 1Z5BA 2V2ZA 3WU3A 5LL6R 1XNQE 1Z0WA 3QT6A 1WUUA 3HULA 4X62I 5IWAI 4LF6E 3OTOI 4LFBE 4Z7CA 1MG7A 1N32E 1H74A 2VQEE 2UXDE 5IT9Q 4JI7E 3J7AG 2E5LI 2WW4A 4NXMI 2UUBI 1A6FA 1PKPA 2UUAI 1ELOA 4JYAI 1N32I 2VQEI 3LTOA 1QZRA 2DEIA 4DPYA 4DV0I 4DV6I 2VQFE 1ZM2A 4FN5A 4JI6E 1HNZI 2LJPA 5LMUI 1NHHA 4JI8E 3WU4A 3V5RA 1HNWI 3LPSA 4DV4I 4B3SI 1IBMI 1IBLE 4NXNI 1XHKA 2VF3A 2V8PA 1HNXI 3B82A 3JAMC 1B62A 2ZM6I 4PRVA 4LF5E 4DU7A 1Z0EA 4ED4A 3CWVA 1H73A 4HACB 1N0VC 4GKKE 2A2DA 4DUZI 4DR1E 4JI3I 2HHHI 4X66I 1N36I 1Z0VA 1EA6A 4YHHE 4B3RE 2UXBI 2CZ9A 5L3JA 3K17A 4DV5I 1KTVA 1XMOI 4JI1I 3ZZUA 2F4VE 1S4EA 4JI0I 2BM0A 2UU9I 4JV5E 5LMNI 5BR8I 3ZM7A 4JI5E 4R1FA 4Z7YA 4LFAI 1N34I 3T1YE 5A2QC 3ZKBA 1NHIA 4LF9I 2HKJA 4LF7E 4DV2E 4K0KI 1RREA 2UUCI 3PYFA 3GONA 4LF8E 4DR4E 4X64I 4DUYI 4DV7I 4WUBA 1FJGE 3WU6A 1XNRI 1J5EI 4LFCI 1IBKE 1I94E 1Z59A 3K1JA 4DV2I 1KIJA 1RR9A 2A2CA 3QT8A 4JI2E 4PU9A 4DV1E 1K47A 1XNQI 3Q1QA 1Z0CA 4HACA 3J7AM 2OI2A 3ZKDA 4LF6I 4LFBI 1ZM9A 3J81C 2UXCE 2J7KA 3WU5A 1FKAE 2UXDI 4DR5E 4JI7I 2HK3A 4GKJE 3QT7A 4HYMA 4XTJA 1KKHA 4USMA 1NHJA 2V2QA 4DU8A 1ZM4A 4FWHA 3J80Q 4LF4E 5IT9C 4I3HA 4OX9E 1HR0E 3PYDA 2ZITA 1ZM3A 2VQFI 4JI6I 1S16A 2BM1A 4DR6E 4DR3E 2E1RA 4JI8I 2DEJA 1MU5A 1MX0A 4JG4A 1IBLI 1N33E 4HXZA 1XMQE 1FWLA 2NPFA 4LF5I 4B3ME 4X65E 4GKKI 3T1HE 4YY3E 4DR1I 2BV3A 1UEKA 4PRXA 2AJ4A 4KHPE 4YHHI 4B3RI 4DR2E 4DV3E 4DPXA 4MYTA 2F4VI 4AQYE 2V34A 4JV5I 1N0UA 4P7AA 3ZZ0A 4JI4E 4JI5I 1ZXMA 3ZZTA 4DR7E 1Z0GA 1OJ4A 4M1KA 4P52A 4WUDA 3B78A 3H4LA 4EMDA 1KVKA 3T1YI 1EI1A 4FWDA 4X62E 5IWAE 3OTOE 4LF7I 5GMDA 1Z5CA 2E5LE 4NXME 2UUBE 4LF8I 4DR4I 2X7IA 5GMEA 3M6AA 1FJGI 4FWGA 1IBKI 4WUCA 2UUAE 4B3TE 1I94I 2R42A 1H72C 1Z0TA 4JYAE 2HFSA 4JI2I 4DV1I 1PIEA 2XEXA 1H7SA 4DPUA 4DV0E 4DV6E 4B3TI 2UXCI 1NZ0A 1HNZE 2UXBE 5LMUE 3JAMQ 4DR5I 4GKJI 2HK2A 4RPFA 2HFUA 1HNWE 3PYGA 3LNUA 4DV4E 4B3SE 1IBME 2HKEA 1DARA 3F0NA 4NXNE 1B63A 1Z5AA 1HNXE 3QT5A 4USKA 4LF4I 3PYEA 4KQVA 2ZM6E 4HY1A 4URLA 4OX9I 1HR0I 2GS8A 4DUZE 4JI3E 4ZVIA 4DPTA 1BKNA 2HHHE 4DR6I 4X66E 3J80C 1VISA 1N36E 1H7UA
chains in the Genus database with same CATH superfamily
4DR3I 2FC9A 2BA1G 1PVGA 5L9NA 1N56A 1HQ2A 2HAFA 2RF2A 2LECA 1WNEA 4CH0S 4LF7F 1FWKA 3ITHB 3HHDA 1Q79A 3H5UA 2J5AA 5DO2A 1C0TB 3O3LA 1YJUA 3SSRA 4KHPI 2BR2B 3G71S 1S6OA 2VICA 2N4DA 4OHZA 1E6YA 4LF6J 2VFTA 4G3IA 4X64E 1QE1B 2LEAA 2QN6B 2MPUA 1Z5BA 3KLIB 2AIRB 2V4JB 4J9MA 4I7FB 3PY8A 1Z0WA 4NL5A 4X62I 1TELA 2FB0A 1VYAA 5DQHA 5JUMA 2MSTA 1Y5IB 2E9TA 3K8VA 1LWFB 1U24A 3IWLA 3VGUA 1IBMJ 2FD2A 3ENQA 1UVIA 3ISND 2ZUGA 4RX6A 1QTMA 3WIUA 4MAKA 1X5PA 3VVUA 4C11A 3D0GE 4KPCA 4O4GB 4HH1A 2UUTA 3R5AA 4NCBA 3NS7B 2VQEI 1UW4A 3GILA 2IVMA 3TA1A 5FLXU 4NBQA 4LR7A 3FUYA 2CA9A 4WE1B 2BJ9A 2BMBA 2BR2A 3RU0A 2YH0A 2IBOA 1VLOA 2VPWB 4NI2A 3HKWA 3MFHA 1S1UB 4MU4A 4MKVA 3DD6A 1XJWB 3AD7C 3P06A 3R5JB 2VF3A 2YXLA 2XYGB 4DMZA 3HHLD 3JAMC 3GFHA 5IZHA 4I7FA 4DU7A 3O5TB 4UZBA 3I5AA 4NLUA 2XWXA 4YP3A 2GFFA 4FF4A 1LWFA 3CCUS 3TVKA 1ZAWA 5KFWA 5M2UA 1FO1A 1FK9B 2XS2A 1K9MT 2F4VE 5KFNA 4KJIA 3FZ2A 3I96A 4F25A 2AYBA 3OQ2A 4WTYA 3R2CJ 4QR1A 3H1CA 4LMZA 3CJ0A 2I6WA 4PAAA 3HHLB 1PJ7A 3MM9B 1C0UA 5SZTA 4PPDA 4H4OB 2Y0BB 3CC7S 4I69A 5D3GB 2ASJA 4WBFA 5C7PA 4ISAA 3ZZOA 3U1NA 2OSQA 4LSLB 3A4TA 1HIYA 1MW7A 4LF4F 1EKRA 5CCLA 2GMJA 4WJBA 3BV8A 1LOUA 2YQ0A 1U1KA 2VQFJ 1NK4A 1Z0CA 1YDLA 4B17A 4MU1A 1VC6A 4C97A 3C6UB 3M2VA 1SC3B 2LLZA 5AXMA 3OFGA 1TFWA 3R1LA 4O3RA 1N4LA 1R0BG 5LSRA 4NLPA 1WC1A 1PYSB 1YH8A 1EZZB 1FD8A 5T41A 4FW4A 4X65F 1XXEA 1XMOF 3FGVA 2YWGA 2HMIA 4ECVA 4G1PA 3MM9A 1J2VA 1S1XB 4LR8A 2ZHBA 2YKPA 4JI5J 4IR9A 5HP1A 3BN4A 4JI4F 1QLNA 4KGVB 3M30B 1EAYC 1RHKB 1Y7PA 3Q2SC 4F02A 3KFWX 3FDSA 4DR7J 4DR1I 3MM8A 2JLGA 2JEJA 3O44A 1APSA 1KQGB 4B3RI 2FZKB 1FJGJ 3K7RA 2BDPA 3CCMS 1S57A 1KOOA 2V34A 2NLWA 4Y2AA 3M7ND 3AJ2A 2HQFA 2XULA 1FVQA 2KXFA 1WC3A 3KHLA 1NKBA 2QYGA 3GV8B 4AD6A 4RW4B 3FNNA 1JLQB 5RUBA 1S1XA 3ZXWA 3VR1A 3BN7A 1VOMA 2HWHA 2DB1A 4DSKA 2DHSA 3W5XA 1WACA 3D0HE 3S8SA 2NZ4A 1W25A 3M30A 4P7VA 2PO0B 2GVDA 4NLGA 3CC4S 3MZIA 4OO1E 2XEXA 4OYIA 3M9OB 1QD1A 3DM2A 2ZH2A 4M5IA 4RKUC 3MPWA 3DRPA 4FXWA 4U7UK 4X4RA 1JXEA 7FD1A 5A8RB 2LA4A 3AA9A 5HI7A 3KK2B 2UU9F 1TKTA 2M8HA 3LP1A 4MKYA 2ZM6E 4Q45A 3O8WA 3G6ES 4U3BA 1GH8A 1HR0I 4OYOA 3OTCA 4DUZE 4JI3E 4USTA 1R8PA 2HSEB 3DLEB 4X66E 3CDJA 2N4CA 1H7UA 2B9EA 4DV7F 2ZBKB 4O3NA 4Y65A 4JI1E 4K0KJ 4ZP9A 1FNMA 5BR8E 4I6WA 3T9NA 3TZZA 1FTRA 3J7A1 4JV0A 1HHSA 1FJGF 3I87A 1Y00A 2QL5B 3KJVB 2LMIA 5HQLA 3P49B 3JS9A 3RR8A 3LP2B 4FW9A 5E3QA 3DMJA 3ENWA 3D4JA 3E3XA 4XDCA 2W2OP 1SV5B 2MKYA 3J7YU 1U1LA 4O4RA 2WP8A 1H2UX 1RTIB 3A3NB 4LF6E 2VBXA 4P2SA 1N6QB 1FKOB 4P9SA 4KO0B 1HNWJ 1KTQA 2R8GA 2GCFA 2O01C 3BGFA 1G3OA 1PKPA 5FLXY 1KSPA 2QO3A 4UQTA 3TAMB 2UUAI 5C25A 4F7VA 4BS2A 2HQ3A 4B08A 3W2VB 2CGEA 3CVKA 4KE5A 1S9GA 1RT3B 5G0RB 4LF2A 5JXSA 2LYVA 2FY8A 1NH7A 3I0SB 1YIJS 2BX6A 3QLHA 1F60B 3BZQA 4TY8B 4AFFA 3BQ1A 4Q44A 3VAMA 2C22A 2OJ3A 2V8DA 4M5NA 2Y0SD 1GMVA 1NM2A 4A4JA 4DSJA 1XHKA 4ES1A 5CA5A 1OYDA 1S6QA 1TKZB 3KK1B 1UA1A 4IOAQ 1O8BA 2ZH5A 3OXLA 1HQEB 2WCXA 1R31A 5ETQA 1EA6A 4OHWA 1PG5B 2MLXA 2FJEB 2CZ9A 2YWFA 4ZPTR 3TAMA 1NDPA 3KHGA 2AMCB 2HHPA 5MAOA 4JI2F 3W2VA 2J9DA 1RT3A 4LSZB 3SQGB 4Z7YA 2KI2A 3K58A 1XERA 3MCOA 1FHTA 4TNOA 2VPXB 2MQPA 1LFPA 4USHA 4N8OA 3R7SB 4DLGA 4LF9I 3BPSP 3I0SA 1I51B 3DGPB 2J9CA 2PD1A 3L7PA 1DZ5A 3C6TB 5LJ3Y 3P96A 4I2PA 1GX5A 1S1WA 1U0HB 5DG9A 2ZJQQ 3M8RA 4LFCI 5HN0A 1RTHB 2VH7A 4NZ6A 5A8WB 2KKHA 1S9EB 1SJ1A 1HNWF 3FSIA 3W65A 2KXHA 2CNOB 3SIPB 4ED7A 2MZRA 4WCEQ 3OL8A 3N5FA 4DQRA 4F0MA 1RAHB 2AU0A 4YQWA 1VQ7S 1TQLA 4GKJE 2DNMA 2AJ2A 1REGX 3HI9A 3CCLS 3AY0A 4QJVA 1F2HA 5CABA 2F40A 1PAUB 3D3BJ 2G0CA 4WK3A 3CE8A 4QYZJ 2I8EA 2BW7A 2J6SA 4J37A 2LEPA 2GA7A 3H4BA 4DR2F 2EK6A 1LV5A 3HKZD 2KT2A 4DQQA 4WFZA 5DZ7A 4X4UA 1CULA 1J5OB 4JI8I 1W2IA 1U0HA 2ZE2A 4WP9A 3GYXB 3BKFA 1U1RA 4QWAA 4MDTA 1HI1A 5CQGA 2MJNA 2Q6CA 1FWLA 2MY8A 1RLCL 1AROP 4J90A 3NNCA 4B3ME 4G1QB 1IVZA 4ZHRB 2ZJPQ 2P2CB 4KSEB 2M0GB 2ZOMA 3PO4A 4X4TA 4ED5A 3TANA 2CJYB 3DRSA 5KFCA 1IBKJ 2C3OA 4K4TA 4AQYE 3SFUA 1S97A 3Q8UA 4DR7E 1N32F 4NE9C 4WUDA 1FE4A 4DV0F 3DFEA 1EP4A 5HROB 3PO5A 2DGUA 1OIAA 4LBPA 4LF7I 3KJNB 4KB7A 5GMDA 3LP0A 1Y0HA 1G1XA 4LF8I 3TRGA 2XCAA 3LGMA 2R7WA 3X1LB 3MEEA 3NGRA 1SKSA 2GQ0A 2ZZMA 1H72C 4ZS6A 4B3SJ 4M5LA 4EZ6A 4ZHRA 1AUDA 4C2MA 4S0MA 4RUBA 2C38A 2PIIA 1FWPA 2WZ1A 1QDUB 3N6MA 1EIYB 4HDGA 1I5OB 2HK2A 3N28A 4XPEA 4RPFA 3C2PA 5L1KA 2R9LA 1UZHA 3PYGA 4DDFA 2ZD1B 2B0GA 4OYZA 2C1EB 1LQ9A 4W4MA 4KQVA 2C2EA 2GS8A 1RKJA 1YBAA 3K2YA 4RNOA 1XR6A 5GVQA 2OIHA 1WTFA 2GX8A 3H2LA 3I5BA 4X64F 1D9AA 3M6XA 5D4NA 3V2UC 2Z2ZA 3M85G 3N0VA 4DV2F 2ZBCA 1HNVB 5ETPA 2W24A 4C3KA 2K3IA 2RSQA 2BE7D 3GPAA 1SL2A 1V6HA 2VPYB 1IBKF 5DLFA 1TK8A 2JVRA 5K36F 5KFJA 1JB0C 4UTGA 2EBEA 4K0KE 1RHQB 4CLFA 1KNZA 5F8NA 2XTJP 4DSLA 3P3CA 1VQ4S 2LP4A 4LF1A 4DR5F 2Z0GA 3AOAA 1S7IA 2ZBRA 3TQ1A 1SC4B 2W2PP 1WUUA 3MCMA 3AB4B 1X31C 4Y34A 1IWGA 3GIMA 5HVGA 1CJTB 3X3UA 2HHUA 1VQNS 3SSQA 2VB6A 5GADI 1RWOB 3T6JA 5KFUA 2B6AA 2JEBB 5ETMA 4ED2A 3OVSA 3QIPB 2RDDA 2AZ3A 4DL7A 4L6V3 1OS5A 1YJVA 2B9WA 4CLYA 5DRPA 2CXEA 4FBTA 2CPYA 4MIAA 4JI6E 1AXQA 4I1TA 2RS2A 2YVSA 4PG7A 5EN1A 5ADZA 4KT0C 4KV8B 1U6FA 3FCWA 3SCJE 1G4CA 3M4XA 1IBMI 2IRUA 3FMWA 2AZ1A 2AD9A 4U3DA 2RHQB 1FCAA 4XK8C 4CO5A 2A0FB 1SJQA 3DOMA 2JFKA 1H73A 3DHWC 4Y6IA 4FZVA 4GKKE 1KVIA 4CTAA 1CJTA 1EETB 1ZYQA 1LWEA 3OLAA 1OY6A 1UDNA 1DFDA 3BO3A 4NCGB 3G6YA 3LWLA 1XMOI 4ID8A 4FW7A 5I42B 4C8NA 5JVGQ 3NS5A 1VMBA 2IC3B 4ECSA 3CO0P 4IOCQ 3UN5A 3CMES 5GAGI 1BE4A 5I3UB 2PNZB 2HIQA 4LRCA 4C9DA 1RWMB 3DI6B 2XZDB 2UZAA 1O0PA 1RAEB 3F73A 2OI2A 2H65B 3PCOB 2G0IA 1VRUB 2HG4A 2J7KA 1EETA 3HJCA 1DQAA 2HK3A 2ADCA 4LUBA 2QSWA 4CLPA 4XTJA 1N88A 1HW9A 4OLOA 2MY7A 1TV6B 2XMVA 5K8PA 1QSLA 4RNNA 1YI2S 2GAGC 1UPMB 2MGZA 4JV1A 3J81Y 3TJAA 2VQFI 2NXUA 2QA1A 4YR0A 3KUGA 3ZO7A 4DR6E 2E1CA 1EB0A 1TL1A 1GXUA 1F9EB 3MFIA 2Q3PA 4ZVSB 1FDDA 2C3UA 1SC1B 1X5OA 5KG4A 3T9ZA 2HAIA 3PXGa 3C46A 3DI6A 2CPFA 2XBPA 3M8SA 3QWPA 2JLFA 2CDRB 1KLMB 3J7ZT 1LKZA 2XMUA 3R6LB 4O3SA 3BKTA 3GSIA 4QBUA 1VR6A 3DU6A 4Y2IA 3QIDA 4JI5I 1TV6A 1WHVA 4OO1F 3AH6A 2IM2A 2BE2B 3RRHA 3IBCB 2JLEA 3LGHA 3POTA 2ASYA 3B4DA 4EK2A 2VG6A 4IFDB 4IFDC 1R3NA 4NXME 1GTEA 4AE5A 2CADA 3MOJB 5EL9A 1FJGI 3VV2B 2C2DA 4CLWA 2ZM6F 1X7VA 3KJQB 3KLVA 1TU0B 4ZK7M 1ZAVA 3GG0A 2V4QA 4DUZF 4JI3F 3F56A 1WG4A 1KLMA 4DQIA 3BQ2A 4B9LA 2N7YA 4DSEA 4LF5F 4KRWA 1NSQA 3D7SB 4ES2A 4C3MA 4FF1A 4B3SE 1R6VA 3F0NA 3M05A 3MAAA 4K4UA 4DX6A 3GJTB 1TKDA 5EWGA 1I6JA 2XHWA 2BE2A 1TR0A 1JJ2R 2WBMA 3G8QA 1R0AA 3A12A 4OYWA 4IFDA 2YWHA 5AXKA 2MKJA 4DPWA 5JMNA 1UJ6A 4P7TA 3PRYA 2CPZA 4FF3A 3LAMA 2IMWP 5DDRC 2JSXA 5F8MA 1VCTA 4LIRA 2EFQA 2QT7A 2BOAA 2V50A 3OTOJ 4LFAE 2UV8G 4K8RA 2Z57B 3ET6B 4UT4A 2VU5A 3NWRA 2E5LJ 4DOZA 2UUBJ 2WB4A 3AODA 4J7CA 1JWWA 3NCQA 4WIQA 2Q2EB 4ETZA 4JYAJ 2G2YA 4IYQA 1BHNA 2W4DA 1GEHA 3J81Q 1TVRB 4URGA 4P6QA 2LU1A 1TL7B 1UAWA 4HHJA 5F9LA 2B8QA 2D9OA 4L74A 2QEXS 2WVDA 5LMUJ 2ZBQA 2BXJA 5CZXA 3HZGA 1SQFA 2K3KA 3SYZA 2VPZB 2WW4A 3UCGA 4J91A 2RIJA 3CB4A 1BQMA 5D78A 1GXTA 4NA3A 4XAKA 5A76A 2Z5CA 5GAHU 4OI6A 4GO7X 1IQZA 1I3OB 4NA2A 3DDNA 4J9QA 2DEIA 5EWEA 1N36J 4ZVRB 2FHKA 1QUPA 5GMKa 4LSNB 2YKNB 2RQ4A 3UWTA 1NHHA 1WHYA 3T1HF 1HNWI 3CJTA 2COLA 1VQOS 2V69A 4HR2A 5H9EK 1MWQA 2R8IA 1UJ5A 4DBQA 4H4KC 2MYFA 2XMKA 3QSIA 4PRVA 2MQOA 2JVOA 2OLWA 2R2UA 2KB2A 2Y3YA 2UUCJ 3CDAA 2VBWA 1WORA 4DUYJ 2EG1A 4IZKB 3HVTA 2DPJA 3QWUA 2IAJA 2HEKA 3K5LA 2V8VA 4GC6A 5CYQB 5C24B 3A8JA 1UPPA 2XCPA 1TL4A 1WTBA 2E5LF 2YPZA 1BQNB 4M5HA 4LFBJ 4OZJA 1KQSR 5A2QC 4FYDA 2MMYA 4ER8A 4ELVA 2E5HA 4GKJF 1RREA 1NUEA 4FKXA 3D1OA 4DZDA 2DPIA 4DR4E 1IKYB 2FZCB 4WUBA 1C1CB 3WU6A 4KGZB 2JRSA 4H4KA 3L7ZB 3IN5A 5D8HB 1XEZA 3M6VA 4YR2A 3GB0A 1VS3A 5J1EB 3D1QA 1RDRA 4PYDA 5KFOA 2NN6D 2NREA 2W7PA 4ZOSA 4MTPA 3VGSA 5J1NA 3CWJA 4NLTA 5A0YB 5KT4A 4ZP6A 1VFJA 5F41A 1KQKA 1BQNA 4B3MF 4I3HA 2GQ2A 2R7RA 3T5KA 4B9SA 2CQGA 3MCNA 4LOMA 4USVA 3CDUA 1VK3A 2XHCA 2R7VA 2OPSB 3PHTA 2QC3A 1X0FA 3Q8YA 3OL6A 2ADBA 2VG5A 4F4KA 2BEFA 1SUQB 2K8GA 2DYAA 1T11A 2UUCF 3T1YJ 3DLGA 2NN6B 4DUTA 4TVAB 4ZCIA 4DUYF 2VC1A 5K8NA 3M6WA 1RA7A 2BV3A 4P2XA 2PO1B 1REVB 3MD3A 2FLOA 2R7OA 4DQPA 5J1EA 4TLQA 3KG4A 3KMQA 2MKSA 4HH0A 4F50A 2XO6A 5IWAJ 4NLDA 3PEHA 3S7RA 1I94J 5HVFA 4LFBF 3BM7A 1T3OA 2OFGX 5A0YA 2GJ2A 2ALYB 1L3VA 1PO6A 3ZZTA 2RDIA 5D4PA 1L3SA 4L72B 1GMWD 3UVJA 3IP0A 4FWDA 1WI8A 1VJWA 5ETSA 4W98A 4LCFA 1FF2A 4OYBA 1PAEX 2OPSA 1VHIA 2IYIA 1CJVB 3C15A 4MFBB 2CQHA 5KFVA 2F5GA 4R25A 4K4XA 4CO3A 3P8BB 5H9FK 1NZAA 2K1RA 1IBKI 3DNCA 3EGVA 3FRZA 1JLGB 3T19A 1HNIB 1DAXA 3V6DB 3BGOP 1UTAA 2HW3A 3CJQA 1EARA 4DV6E 1REVA 4EBEA 2R8KA 2FVRA 3UN3A 3W9HA 5E41A 2OPRB 1HWUA 3VTIA 4DR5I 2G1HA 2FJBB 4OV6A 1N33J 2LEBA 3LNUA 2KT5A 2YNFB 2E7VA 4NXNE 2UVRA 5AE2A 1ZOTA 5IQQA 4KH1B 2FVSA 4NYPA 3DLKA 4URLA 3KYLA 2C3PA 4A48A 1RA6A 1DY3A 1CJVA 4MFBA 4LT6A 3OL9A 4CH7A 1W26A 5D0RA 5AT1B 5AJ3F 1V9OA 1FI4A 1GNKA 3N4WA 1OO0B 2DNQA 2YBVA 1V3SA 1U1PA 2KZZA 4OZ0A 4RW8B 1M5KC 2MKKA 1LW0A 1D3WA 1I94F 4J9LA 2F9DA 4E8UA 1FXLA 3H4DA 3IR6B 1FJEB 1LNQA 3MXHP 2YNFA 1J27A 3BO4A 4YN3B 3CCVS 3SXLA 2GO9A 4C48A 3DLJA 2JEAA 4C6AA 3K5MA 3UDCA 2Z5EA 4OLPA 3OJUA 5L38A 3QT6A 3P5BP 2BA1D 4AT1B 2PC6A 3FQLA 4ZVOB 1HFEL 2M5YA 2VV5A 5DJBA 5KFLA 4OX9F 3GIJA 3MMCB 2IA0A 2RU3A 2V5HG 3TJ9A 3GV7B 4V19J 2HZAA 3MI7X 4RW8A 3RB0A 1SH3A 2ZWOA 4GKKF 5CHCB 1KHWA 1N33F 4LCGA 4F4YA 4KKOB 4YB1P 2YQ3A 2MZ1A 2PFFB 4EO8A 2W2MP 4ATNA 5D15A 2P5VA 1VI7A 2HZVA 2JX2A 2WRMA 1X4FA 4UF4A 1VRQC 1Z1ZA 2D3OR 5HK4A 4B9NA 2C2KB 1ZS6A 1IM4A 4YHHE 2EKNA 3D6MB 3HHNB 4ICLB 1TL3B 1XNRJ 3MMCA 7FDRA 2D74B 4FNHA 3RAXA 2ZNYA 4DI6A 3FVYA 4JV5E 1FFWB 1XNQJ 1JLEB 3KDNA 2BRLA 3I32A 3NG8A 5GAGU 4ZPCA 2KDOA 1RCOB 4ZPDA 2HFZA 4YOEA 1S1VA 3OHBA 4EBCA 3MUTP 3OJSA 3BREA 5HJXA 4TKTA 5L46A 4P73A 3ILOA 2GZOA 3HVRA 4GVBB 2M52A 1OPIA 4ZCMA 2LDIA 2IFXA 1Z59A 4PQUB 2YKOA 4DV1E 4BC7A 2OH2A 2D9PA 2C2RA 4HEA9 4QIFA 2FUG9 4M5GA 2DY1A 4DR6F 3BR9A 3TZWA 3JSRA 2PO2A 1T9VA 2KYZA 1T05B 2DJWA 3SCLE 2C3YA 4JBCA 3B4TA 3IS9B 5CYMB 3VALA 2MZQA 3NLCA 1CBKA 1S5ZA 4DV5F 1EKSA 5KT6A 5F8IA 3N01A 4B3OA 1HMVB 3ZC4A 1IKXB 3DCAA 4F4XA 4GVBA 2NSCA 3ADAC 4KHPJ 4AXIA 1XIQA 2XMTA 2PT0A 3CCTA 4ZCLA 4P71A 4LF5I 1OQ6A 5K8OA 1RCXB 3SDEA 2AX1A 3H5SA 3HHKA 4N8NA 1XNRF 3R1HA 1UFLA 5D6GA 4YY3E 4KTQA 2J9DE 4DV3E 1Y5NB 4YB6A 2ASDA 4X62J 2R4FA 3M32A 4F04B 3THPA 3G9CA 3OR2A 2IYGA 4U9RA 1N0UA 3IS9A 5CYMA 3DOKA 2EW9A 4FP9A 4NYZA 3NAHA 3KLGA 4PG4A 3NGTA 3JQKA 5IWAE 1IKXA 3NMAA 3TARA 1OWXA 5KTQA 4OZNA 2QGFB 1S9FA 4C4WA 2RU9A 5IXUA 2Q79A 3M6AA 5B0DA 1CSJA 3DXBA 4RNFA 2HBQB 2FY1A 5HMXA 2GC8A 1JLBA 1MLAA 3RR7A 2ZZTA 3H42A 4Y28C 2J9EA 1HBNA 3R5BA 4DCJB 2HS4A 2J0XA 3R27A 5L1IA 2FJWA 3Q22A 1XMQJ 4K7QA 4A8OA 2HFUA 1JLAB 3BR8A 3HO1A 3BO2A 1URRA 4O44A 4F26A 2FTRA 2YNHB 3PYEA 4LFAF 3N79A 4PXEA 2QMXA 5L8RC 2AV5A 3ZNJ1 4ZVIA 1Q0NA 3QJLA 4BDPA 3SMZA 2Y8YA 3IRXB 4IH6A 2NUHA 2DHXA 1D9DA 1AT1B 4C8LA 3CCSS 1JMTA 4GVLA 1CEZA 1Z0BA 3KLHB 3R5GA 1VQ9S 1H2VZ 4CRJA 2VC0A 3LAKA 3MMBA 4M5KA 3T1HI 4DPOA 3KUEA 3TP2A 2HS0A 1Y4SA 5F0WA 3KK3B 1VHFA 3QRRA 2R2TA 2UXCF 1J5EE 4Y2CA 1RBAA 2EFPA 2GO3A 2PGCA 5LL6R 2RVJA 3T41A 1T95A 3VGVA 1WEYA 1H0HB 5HVHA 4Y3CA 3WX4A 3OTOI 1IKVA 3EZ5A 3EMTA 4A8WA 1SJ3P 4DV4J 1TL5A 2AJ0A 5JEAC 1WD6A 2E5LI 2UUBI 1HNXJ 2HFVA 3TI0A 3UW1A 3AQPA 2RE1A 4OJGA 4N47A 2G2ZA 2DR5A 3P5TL 2I5JB 1FDAA 2FHJA 3KLHA 2WSFC 5A8KB 4JYAI 3W64A 1RT5B 1QZRA 1UVJA 5J2PA 1D0EA 2HHHJ 4FYVB 4Q0BB 3QRPA 2UXBJ 2ZH4A 1LWCB 1XMQF 1S99A 1RHMB 2OGUA 2OP5A 5LMUI 3LQVA 1HQUA 4JI0J 3N6LA 3KK3A 4FW5A 2ZHAA 2B7BB 3NOGA 1VIXA 3WBZA 3QZ8A 4EZ9A 1N34J 4WFXA 4LIWA 4RW7B 3U7JA 2GHWA 3M8PB 2WK4A 4WPAA 5I3PA 3MEGA 1N36I 1NAQA 2FJAB 3SV4A 1VQ6S 5JEAA 1V3RA 3W1YC 4DR4F 3R8YA 4NZ7A 2I5JA 3DYAA 3ZM7A 3JSYA 2E9ZA 1XMBA 4F36A 4URQU 4I67A 3TA2A 5T7LB 4IQMA 3NMRA 4B3TF 3Q6MA 4ZVTB 4PG8A 3PG9A 3FJ2A 2UUCI 2W4CA 3CJSA 3N5BA 3UCUP 3P3EA 3CD6S 4DCOB 4DUYI 1S6UA 3WC2A 5KFYA 1L3KA 3RGIA 5LOQA 3JTNA 3HZEA 5CCMA 1KHVA 1UKUA 2YX4A 4ES3A 3AJ1A 3DHXA 4IO9Q 5C0XC 5DRRA 1HNXF 4LFBI 4OJHA 1YJ9S 2V63A 1BD6A 1AUSL 1IBLJ 4ZVQB 4I2QA 1T03A 2XSJA 1PBUA 4IG0B 2UXBF 1UEUA 4ZPVR 1TK5A 2KG0A 5KFBA 5T7LA 3CUNA 2DNHA 2VODA 3A8IA 2XMJA 1RHRB 2RQKA 1AFIA 2LCWA 4DFPA 2W25A 4DR3E 4NOHA 4NCAA 1F3FA 3HSGA 1MX0A 2AJ1A 4J9VA 1HYSB 2D3UA 3NBPA 5IT9Y 2QYCA 3IXQA 3EICA 1RBOB 4ZDNA 3PVXA 2CQIA 4RNHA 1C2PA 3FC9A 5C0XA 1YJNS 4K5SA 3HVWA 2NYHA 4KHPE 2EG2A 4M5DB 4IH7A 1RYSA 2X1BA 4P75A 2ZH8A 3GJQB 4L75A 1WF0A 1OYEA 4O0IA 4PUOB 1HK7A 4U8VA 4WP8A 2C39B 2VOPA 4IG0A 1Z0GA 3PR5B 3PTWA 3GTYX 4USIA 1YZ6A 3NAIA 2X1AA 4DV6F 3T1YI 5ETRA 4X62E 2CPEA 2O1TA 1WG1A 3T6BA 2IRXA 1S7HA 2CJ9A 8AT1B 4XPCA 2MLYA 1PC4A 3MEDB 1RKIA 4E0DA 4KR0B 1RACB 1FXDA 1I94I 1NSPA 3L9ZA 1GT8A 2CVEA 2HGNA 5HJYA 4IRCA 2HNDA 2HVHA 3E8OA 1KBRA 2PI4A 2K7JA 4WU3A 5EDWA 2QL7B 3M2RB 3FSYA 4M5DA 2Z5BB 4ZVEA 1SJFA 1VQPS 3UCZP 4DL2A 3CDBA 1O5JA 1RWWB 2EC0A 3M7NG 3PRVA 2KRRA 5B0FA 2MJUA 2CYYA 3QT5A 2QA4G 1K73T 4QPXA 2JE6A 3HF5A 4OX9I 4ZLLA 3MWBA 1MU2B 1BKNA 3TO8A 1ZZNA 3UHMA 5K36C 5MLCV 1S6PA 4YB7A 3WIVA 4LF9J 4ZP8A 5DDPC 3VAIA 2O66A 3PACA 1N33I 2WSCC 5F8GA 3NP5A 2XNQA 2E44A 3CJ3A 3EWGA 2ATCB 2RNEA 2X3GA 4CP5A 3J7Z5 1HA1A 2FGOA 2NZCA 3M2RA 2PEBA 2YNIB 1RT6B 3ZZYA 3T5HA 1F9HA 2B4OA 3S01A 1N5TA 3FK4A 5DG7A 1R7IA 4IFVA 4DFMA 4KY3A 2CJKA 2XGQA 2G13A 3UD3P 4NLRA 2C2NA 1UCNA 3UD4P 1K1SA 5K36A 4IG3B 5KG2A 4BA1B 1USUA 3Q8PB 4QIWD 5IT9Q 1IR0A 4CLLA 3GIRA 4WKYA 3KXDA 4X2BA 1RT4A 3V6JA 2BJEA 2RKIB 3LGNA 3E01A 3CIZA 1XR7A 5LSLA 3Q8RB 1BXNA 3LTOA 3W9IA 2M70A 4BA2A 4DPYA 2Z8QA 1NEEA 1MROB 2DY9A 4X4OA 2YNIA 1RT6A 5KG6A 1UJ4A 3GV5B 2C2MB 2QV6A 1YVFA 2HHTA 4ZVGA 1GX6A 4N77A 4FS2A 4IFDE 3D3CJ 3CWVA 1NK7A 2Z2LA 3M8QB 4NRUA 2DGSA 4DR1E 3SCIE 4BA1A 4B3RE 1CPZA 2EC2A 2AW0A 2DHHA 5AE1A 4DV5I 5E5NA 4QW8A 2O1UA 3CJKA 2IRYA 2RKIA 3MAHA 1F0XA 2HNYA 3I55S 2XNRA 1JKHA 2OKQA 1YZ7A 5KFIA 2UXDJ 4JI7J 2VD3A 5K14A 1FA0A 2DIVA 2NN6F 4A8YA 4A8MP 2CQ1A 2BKNA 5J2MB 1Y3JA 3MEKA 1XNRI 3KNGA 1WC4A 4IFYA 4KH0B 1JXVA 4PU9A 2OPPA 1F5AA 4KQZA 1XNQI 5F9NA 1TAUA 4LVOP 2HPUA 1KD1T 1SL1A 4QIGA 2VESA 4F67A 2C37A 1RLDA 2FJXA 4OV1A 3TR5A 2J65A 5EHHA 3VWSA 1M90T 1HBOA 3MMAA 3BB5A 2AE8A 3I56S 4OO1D 4R0JA 2M8DB 2KN4A 1NHJA 4CYUB 1ZM4A 3UE2A 1OPZA 5KG5A 1U2FA 2WVFA 5HL7Q 1DLOA 4YY3F 3ZTSA 1HR0E 5E3RA 5LMNF 3DOLA 4U96A 2BM1A 4DV3F 1RT2A 5BJRA 3KMSA 5HLFB 2HHVA 3VZIA 2W1BA 3KJFB 1U8SA 3RZAA 2CQ4A 1RZMA 5KFSA 2IVYA 5IM0A 3TQEA 4CT9A 4ERDA 2RRBA 1L5UA 1UETA 4ECRA 4OO1B 3VHQA 3IC1A 2V94A 5FD1A 1RTDB 1N5YB 4PRXA 2AJ4A 4L3KA 4R5PB 4DPXA 3PW7A 3D0IE 2ZUAA 4CYUA 2AJFE 3BQ0A 2YNGB 1P9YA 1ZXMA 1U2CA 5JJBA 1R6YA 2UXDF 4JI7F 5KFAA 1SJRA 1EHWA 1RK8A 1NXIA 3JYTB 2FVCA 2W9BB 1EI1A 1DBDA 1NJWA 2ZKTA 3C19A 1FFSB 2RD5C 4H4MB 4ECTA 2YKMB 1FXRA 1NLKL 4DN9A 2L9WA 4EBDA 1XBWA 2FHMA 4LF4J 2GGPB 2UUAE 3HT0A 3PR4A 4WYLA 4PXCA 2VOOA 3QMQA 3M8WA 3TNVA 1QM9A 2FJVA 4WWSA 2C2ZB 1SIZA 5KOXA 4IZJD 1RTDA 5IT4A 2UXCI 3ITHA 3CGIA 2DNOA 2GIRA 2G9OA 2OTLS 4TLRA 2DKOB 1C0TA 2DK2A 1Q16B 3A1YG 3KG0A 4X65J 3ILLA 1PYOB 2XZWA 1XMOJ 1X9SA 3QSYB 2GMHA 3ZZPA 3TVYA 2OEMA 3PZPA 1QE1A 1VISA 3KLIA 1ZPVA 2V4JA 1S48A 3ISNC 4JI4J 4IZJB 1NJIT 2BR0A 1J5EF 1LK7A 5F3ZA 1XMQI 3EM1A 4WXOA 5F8HA 5LXYA 4KPYA 1RT1B 2HLTA 3QFWA 2MHEA 4YB5A 2W9CB 2QL9B 4LF9E 4O4GA 5L1LA 4NLQA 2J8AA 3HX9A 5BYQA 3ISZA 1BMQB 3IGNA 3LOUA 3WDOA 1JIHA 4WE1A 4LFCE 5FLXC 3VF0B 2DH9A 3HHLC 2FVQA 2FQQB 2VA3A 1HD1A 1U0SA 2HGMA 3VVTA 3MGJA 4ELUA 2VIHA 2VFUA 1S1UA 3T5JA 1PILA 2DGWA 4ANEA 4KFBB 1XTZA 2C2OB 3AXKA 1UWBB 1B0PA 2RRNA 3MMJA 1NU4A 3WHIA 1NHKL 5EUHA 2ZVIA 1VBKA 1S0MA 4OZLA 1L3TA 3IAM9 4RU2A 5CYJA 4NEZA 2ZH9A 2QLXA 4ZVPB 2P8IA 1FK9A 2CQCA 5DDOC 5AXNA 3BGUA 2QLWA 1VQMS 2R8JA 1WF2A 4AUKA 4JI8E 3WU4A 2UU9J 5IV3A 4DV4I 1U1OA 3T5LA 1N54B 2Y1LB 4ED6A 3HHLA 1HNXI 3FFIB 1P42A 4RUAA 1OYSA 1FJ7A 2E7WA 2KYXA 4H4OA 4RUCA 3MUVP 2DNNA 4DZ6A 5D3GA 4DG1B 2PMHA 4XTTA 4LSLA 2GO8A 2HBZB 2AQ4A 2FDNA 2MQ8A 1JLFB 2HHHI 1Z0VA 2HHWA 2PA8D 2UXBI 4DV7J 2WONB 2H5JB 3PJWA 3G4SS 2L9DA 2Z4PA 4JI0I 4K5RA 2JFDA 3H20A 3C6UA 1Z2ZA 3G2XA 2APOA 5LL6d 3HKMA 1VQLS 2XMAA 1N34I 3BF4A 3Q8QB 1DRZA 1Q78A 1JJ4A 4LF7E 4CLZA 3HSDA 2J6TA 8ATCB 1YITS 1IKWB 1QSSA 5ETVA 3MCSA 4LF8E 2JJ4D 4B9TA 2G2OA 4PG6A 1YJRA 3FFIA 2BA9A 1TP7A 2OPQB 1RR9A 3FBBA 2NUUG 2D7SA 2N3OA 2VKRA 4X84A 3B6BA 1NPRA 3IR7B 1XN9A 3NKYA 1HHTP 1B4SA 2CZ4A 6FDRA 1A6LA 2DR9A 4OZ1A 1SIWB 2E66A 2A1BA 3HD2A 1E6VB 5K8MA 4ED8A 2QE5A 2RQCA 5D0HA 1Y3KA 2V2QA 4F0KA 1SBRA 3C14B 2KFYA 3NY0A 2QRRA 1TUGB 1WJ9A 2DR6A 3M8ZA 2DTJA 2BQ3A 2U1AA 2B3TB 3IR5B 3QZ7A 2VL1A 3BJYA 3AB2B 1IJFB 5KG7A 4JUZA 1PCAA 1IKWA 4QR0A 4OHYA 3UR3C 2UVUA 1VQYA 1ROFA 1WHWA 2DEJA 4ZLJA 5BYSA 4RW4A 4TYAA 1JLQA 1IBLI 1JNZB 3TEHB 2V9KA 4ZJQA 3NL0A 3VQSA 3G96A 1HBMB 1FRXA 2O67A 4NWBA 2CG4A 4U7UD 2E1MC 2PO0A 2IY5B 2IIHA 1BQXA 3PHEA 2BBEA 9RUBA 3I4HX 4JI2J 3FRYA 1LW2B 4AIMA 3C14A 2VQEF 2VZ9A 2EXUA 3D68A 1MMNA 5A8RA 2BOPA 4F4WA 4TU8A 4KC5A 4NPOA 3KK2A 2HFNA 5CD4H 3NEKA 4C0BA 1HI8A 3K5OA 4EEYA 4P72A 1B64A 1EQMA 4G65A 3FQKA 1F3VA 1CC7A 3DLEA 2Z58B 2MHNA 3TZYA 1HBMA 4M63A 3V81B 2WVBA 2QIFA 3U1MA 1U25A 4Z2XA 1TUWA 2BJ8A 1E3PA 1IBME 3KJVA 2PN6A 3RB3A 2MZSA 5GAHI 2R7XA 4N7TA 1OMSA 4DR2J 1C1BB 2CQDA 3LP2A 2O1PA 4J9RA 1O6XA 3AT1B 1SV5A 3OVBA 4Q2LA 1HWJA 3U1LA 1RT7B 3EJMA 1XMOE 1RTIA 5G4DA 1N6QA 1FKOA 2AP6A 4KO0A 4N3OA 1MWYA 4WF9Q 2E5JA 2IBKA 3DRXA 1WKJA 3PIPQ 1H38A 2VDIA 4K2JA 5G0RA 2KU7A 1UEVA 2V2VA 1KQFB 3FEYB 1Z2LA 2RILA 5DGAA 4X4QA 4MYUA 3QQCD 1KFSA 2HHXA 1QTNB 1N32J 1YHCA 1PSDA 2W01A 2EFGA 4WK1A 3R6GB 4TQRA 2LXUA 5KG1A 3DKDA 4DV0J 2MKIA 4ANCA 3DU5A 4TY8A 1CJUB 5IOLA 3GIKA 4WYWA 1HNZJ 1C1BA 4DL4A 1RTJB 5B09A 3H7HB 5KFRA 1TKZA 3KK1A 1H74A 4RBUA 3OHAA 4LCHA 4X4SA 2O1WA 2F8HA 2RB7A 5KT3A 1S77D 1NHUA 3AAWB 5J2QB 1HQEA 2BJ7A 2QMUB 1FX2A 3ENAA 2DNZA 4QYZK 2DNLA 2EKYA 2OD4A 1ZH5A 3CT9A 4DR1F 1T94A 3RBZA 4EUVA 2VQFE 3GCXP 3HJVA 1YBUA 4FN5A 4A8QA 2LJPA 5EGYA 1E3HA 3OVAA 4DN0A 3SQGA 3NGSA 4J9KA 4ECQA 3D1HA 3W63A 1UZDA 2HQDA 3IMQJ 4ZPWR 4HLBA 2CAJA 4X4PA 2QMWA 3B82A 3PV8A 2VJUA 2ZHOA 4UOGA 3DGPA 1CJUA 3N6NA 3C6TA 3MM7B 3J81U 5B7WA 2Y1JA 4CLTA 3NNAA 1RTHA 2B4UA 4RBVA 4CO4A 5A8WA 4CNZA 4X64J 1DHMA 1H6KX 1S9EA 1Q82T 2GVZB 4DV2J 4FBUA 4A8XA 5LMNI 5I3QA 4JI5E 4DX7A 2YY3A 2PI5A 3CCWA 1VRTB 4O3OA 2RMLA 3OW2R 2Y9HA 3W61A 2J7WA 2QJ3A 4LQ9A 3R7BB 5ETKA 2HKJA 2BUNA 2D69A 2DGXA 3CD5A 4OZEA 4PQAA 1JLCB 3V6KA 1M1KT 1CS4B 2M2BA 1SJ4P 3MPDA 3FEXB 2AX0A 3W2WB 1FJGE 1HNZF 4DR5J 4F8RA 3W60A 4ECYA 1J5OA 3FSXA 3Q1QA 3J7AM 1SQGA 4JP8A 3CPWR 3V4IB 3J81C 4ILRA 5HBMB 4NLOA 1RI7A 1CJKB 2UXDI 1S49A 1AZSB 4JI7I 2CPHA 1QSYA 4G1QA 2N82B 1YJWS 1GTHA 2H51B 2EVZA 3DDKA 4OKGA 3H90A 2HVDA 2CJAA 4WFYA 4GMKA 3GSDA 3PYDA 1IQTA 3SV3A 1ZM3A 1W7WA 1PBAA 2KG1A 3ZZRA 1PJ5A 1JLCA 3GQCA 4P2FA 2WSEC 2B51A 4MQYA 3Q23A 5HROA 3W2WA 4BC9A 4MK8A 5SUHA 3J81j 3K89A 4ECZA 1QJHA 2NPFA 5H1SV 5JEAE 2HYIB 4ZIVA 2H54B 2DXEA 1Q8LA 1SI9A 3BDPA 2BKPA 3V4IA 2NR0A 5HBMA 2Z2YB 2DIUA 3TVZA 1CJKA 1Q8KA 3M9MB 4PWWA 2DNPA 1RQ0A 3GR0A 3QGPA 4HT5A 4HVZA 3JXOA 4OJ3A 2UUAF 4XO0A 1RE1B 2DT9A 2MXYA 3LWMA 3ZZ0A 4E98A 1V5VA 3EVWA 1N48A 2X51A 4OX6A 1XR5A 3GZ7A 2LQ5A 2ACMA 1HWIA 4CLUA 2ZD1A 5DROA 4DS5A 3THTA 4DHVA 3CXCR 1VQKS 3VAKA 3EX7B 3OTDA 2R42A 1Q1KA 1CG2A 1Z0TA 1FKPB 3Q86A 1KONA 4WZQA 1U49A 4EYIB 2ACYA 2BQUA 1X4GA 2XMWA 2QX0A 1S72S 1HNVA 3IG1B 1YBTA 2JEGA 5ETTA 4K59A 4ZLNA 1HNWE 4ECWA 2VBYA 2HKEA 4AYBD 2XB2D 3GWCA 4LF4I 3C3LA 2KVIA 3JQMA 1RAJA 2F4VF 2BA0D 3HD1A 5KT5A 1D9FA 4NASA 2LFVA 2DCUB 1FFGB 3K5PA 3KKFA 3EDQB 1FRIA 2POKA 2HWIA 2L3MA 2IJFA 5C0XE 1K8AT 2VHGA 2Y1RI 4OI0A 2PO4A 3TAQA 1FKPA 3TOQA 3CC2S 2HRYA 2QLJB 2JEFA 4QWCA 4CO1A 4X65I 2JEBA 3MUMP 2J0WA 4M8LA 3J80Y 1TUVA 1P1TA 3EYZA 3K8WA 3QIPA 4F2SA 2D41A 3IG1A 3R9LA 1D6TA 4JOUA 5BXIA 5T14A 3TJ8A 1QY7A 2RHSB 2IOPA 3BBFA 2ZVSA 4JI4I 1UP1A 3BPDA 3L3CA 4YS2A 3GFZA 2IA6A 1MN9A 4KV8A 3NWGA 2RF2B 2AEFA 3LPEA 2V2KA 1HWKA 4HTIA 3WQPA 1MG7A 4JI8F 1N32E 4NRTA 4UUXA 5DQGA 3ELHA 2YWKA 3HJFA 2ZM6J 1RUSA 2DISA 3HT3A 4OHXA 4DUZJ 4JI3J 1E6YB 4NCGA 4NX9A 2FZGB 5A6WA 1F2GA 4AL5A 5I42A 4PZVA 4LF5J 3QPIA 4KGMA 1HBUB 5BR8J 1CC8A 2BJDA 2IC3A 2GJFA 2CIMA 4ENOA 2VUGA 3EVOA 1YRUA 2P9CA 5KFEA 2KM8B 2KM8C 2ZH6A 1WWHA 2X1FA 3VAJA 5I3UA 2PNZA 1YX2A 4C11B 3ENVA 1TK0A 3G82B 4CCHA 4LF8F 3W7BA 5L3JA 3K17A 1IR2A 2UU9I 1ITPA 1VRUA 2DRBA 4OQJA 4RNMA 2HZCA 4NI2B 4M94A 3QRQA 2H4YB 3JAMU 2WB1D 4YFUA 3UD5A 3IM9A 1S79A 4DV2E 1Q7YT 1HBUA 1WC6A 3U1KA 3PYFA 3IRWP 4DV7I 2B43A 3TUIC 1IBKE 5K36E 1U09A 3IA0A 4OYMA 1GK8A 3ZTPA 3LPYA 5KFGA 3ETMA 3EZUA 3G82A 3GFYA 4C8YA 4KHMA 2GHVC 2I9SA 4DR5E 2KJVA 2D3O1 2YWWA 1YSJA 2K2PA 1FEHA 1GAOA 4O23A 4X66F 4PXDA 3OPKA 2DR8A 1C0UB 3J80Q 3PKMA 8RUCA 4K4SA 5C42B 3CCES 4JI1F 4R0EA 3GMEA 5BR8F 5KAKA 1S16A 4ID5B 3KNAA 4K4VA 2DGVA 1UL3A 2C3MA 2KRBA 3T1HJ 4MK7A 4UZCA 4W92B 5IV4A 4QQBA 1MU5A 3ICLA 2I1RA 2XMMA 4DF8A 1V5IB 1R8HA 2FPHX 1R0CB 3RBXA 3M2VB 3GCWP 1Q95G 2Z30B 2OEJA 2GNKA 3CCZA 2BJ1A 3AD9C 1NK6A 3P45B 4OMFG 3EUNA 5E33A 4M95A 3KG1A 3OL7A 1O51A 4LF6F 2HMIB 3EGWB 3SZ2A 3QAUA 3CMAS 5HQ8A 3P6YC 1R8AA 3FKBA 2KVQE 3F44A 5C42A 2CKWA 1KVKA 1AW0A 4LVNP 2ZH7A 4IS9A 4UY8T 1NNDA 5HP1B 4I6YA 4GKJJ 4ID5A 5KFFA 4PABA 4N76A 1B7FA 2HQIA 1ICEB 4WFBQ 3SCKE 1IBMF 3A13A 2AYGA 7AT1B 3MM8B 1ZTWA 3ZNUA 3JQJA 4OZ3A 4JI2I 4HDHA 5EX3A 3AXMA 1MSWD 1RADB 3TW0A 2B4PA 1NBEB 2BANB 3OSPA 5JVHQ 3PW2A 3IGVA 4PWUA 1ZETA 1AB8A 3A3OB 4JV2A 2B7CB 1H7XA 3ET6A 2V8HA 4PG5A 2KHCA 1P9QC 4B3MJ 3IFEA 3QYYA 1WSRA 4K4ZA 1ZZFA 1TVRA 4ZITA 3HXMA 1TL7A 4AQYJ 2GVDB 4QU6A 3UDLA 3CTRA 2IPOB 1U6ZA 1N8RT 3DM2B 2Q43A 4DWIA 2ILZA 4I68A 2EEYA 3DRPB 1BY9A 4NLYA 2XLJA 4OFZA 2AWZA 1D8ZA 3O2IA 2YQ1A 1TKTB 2BANA 2R3VA 2J0SD 3LP1B 3Q24A 3IBWA 1NJZA 4P2MA 4DR2I 3I0RB 1X0PA 1NSAA 1X4EA 4DCPB 5L39A 3B8HA 1B0VA 3HHEA 2IJRA 1FVSA 3HSJA 2ZKUA 1YLXA 3CJ2A 3QATA 1EX8A 4LSNA 5ELWA 2YKNA 4DX5A 1KRPA 2NQPA 4GC7A 2F65A 2FIUA 1WHXA 2H9ZA 5EKWA 2N7CA 2VQFF 5B0EA 3JB9k 4Z7CA 2XSFA 1VBXA 2YKQA 3CULA 4EO6A 4FPIA 1X4BA 1U1QA 4DLEA 4NA1A 1VGYA 4IO1A 5CXTA 2BABA 2DCLA 4IZKA 1N32I 2PNLA 3A3PB 5CYQA 3MM5B 5C24A 4DV0I 3I9V9 3DMJB 1HNZI 3GCMA 3I0RA 4QU7A 5F3TA 2P6TA 5K5MA 4ED1A 3CJ5A 2WP8B 4RO0A 3SFGA 4JI5F 3AQOA 3BBCA 3NXZA 3KDOA 1CLFA 3PRBA 3DLLQ 3G86A 1B62A 4LF5E 2JC0A 1U26A 1IKYA 4AQYF 1TMJA 2A2DA 1NKCA 1C1CA 2R7UA 4DR7F 1X9WA 5C25B 3VAGA 5HATA 2NXJA 4O3QA 2IJNA 1QAYA 2B4VA 3L7ZA 2GV1A 1S9GB 1F1BB 1WOPA 5AJ3J 3QJJA 2ZZNA 2NN6C 1H2TZ 4GRSA 4A8SA 3G8SA 3JAMY 2WBRA 5DZ6A 2CWXA 4WXWA 3D67A 3EE3A 1NZ8A 3QLHB 2A6MA 4ECXA 3MM5A 2C42A 1WSVA 2A3JA 1ZA2B 1R27B 3NGUA 2RT3A 1S6QB 1N52B 2PE8A 2X1GA 3GONA 2RS8A 4X64I 2XLIA 2DH7A 1QVFR 3E2EA 3PKYA 4I4BA 3RG6A 4DV2I 1JJHA 1B7YB 2Z56B 2CNLB 2RAQA 4EWTA 2F63A 4JI6J 5LSOA 1Y5LB 4OIXA 1ZBTA 3FCHA 5KFZA 2NXEA 1SUQA 1VC0A 3G87A 4OX9J 3WU5A 4NZ0A 4U7CA 2NN6A 3QT7A 2KH9A 1HL6A 1KC8T 4CZCA 1AYEA 1FNXH 1PKUA 2HQGA 1RXOB 2PO1A 3MOZA 3NRBA 3D6HB 5JEAF 1RWXB 4DU8A 3BH7B 4TXSA 4FWHA 4OZ5A 3WX8A 4GKKJ 1NDKA 3GFXA 1LFWA 2ZEJA 4C8MA 2O1VA 2DGOA 4I2PB 2KJWA 3UI3A 1S1WB 4QYRA 2ZC4A 2VKZG 5J1PA 5HMYA 1AFJA 4K50A 4NMXA 1SL0A 2ILYA 4J9NA 2AGPA 1LEOA 4K0KF 2GQQA 2FGCA 3UDVA 3T1HE 4ZVFA 1BWVA 4FF2A 3KUHA 4C3LA 3OTEA 1JLGA 2XWYA 1HNIA 3H98A 1PC5A 3V6DA 4ZJOA 1S0NA 3D2WA 1WDTA 2F4VI 2WAQD 1SC6A 4NMLA 1RAFB 3FBEA 4RWWA 2OPRA 3HFVA 2HLUA 2VFVA 2DNKA 2WVEA 1CULB 1GMWA 3GYNA 3ZZZA 1PYTA 2ZE2B 3OTOE 2OHDA 3SQOP 1M5OC 2AEJA 5B08A 2G1DA 2EWHA 2E5LE 1SH0A 2UUBE 1BLUA 2ZFHA 4RZRA 4JI6F 2FLLA 2DNRA 2SXLA 4OI3A 2HVIA 4JYAE 2HFSA 4ZIWA 3RRGA 1T8EA 1C4AA 3DRSB 4DR6J 1NB2A 2GAHC 2H1YA 4PEOA 5E2QA 5LMUE 3JAMQ 2JOQA 3HFZB 4IOBA 3GE9A 5C0XF 2YWEA 1EP4B 4DQSA 1S12A 1FNOA 3VQTA 3PS2A 4DL5A 1B63A 4J9OA 3OD2A 4MH8A 1VC5A 2HBYB 4DV5J 3Q8SB 3LP0B 2OFHX 2OD6A 3L7OA 3I82A 3W3SA 2KFZA 1UW9A 3CNQP 2X3DA 3MEEB 3S1TA 4CM0A 3GJRB 4CH1A 1N36E 2KHDA 1OSCA 3DRYA 2CQ3A 2HIYA 4P10A 3C8YA 4UOCA 4K4YA 4EFAC 1G6BA 2L9NA 1FX4A 2GO4A 2EI5A 4QIEA 2C38B 4FVMA 2DGTA 5FLXQ 2LXFA 2P9GA 3PX4A 1B99A 1X8DA 4Y00A 4B9VA 4HTJA 1NO8A 2LQ8A 1U1MA 3RBEA 4LJMA 2CG8A 1HHQA 2OEKA 5KT2A 1YRTA 1LXNA 3D54A 2EFVA 1NRKA 4NXMJ 2JC1A 3IBFB 4QOTA 2UUWA 1YGYA 2UUCE 3DXSX 4UOFA 3PW4A 1U4BA 1ZXNA 4DUYE 1S76D 4FXDA 2NYIA 4KKOA 3OXGA 4EI2A 1RJJA 3PX0A 1H3DA 2CQ2A 3UN2A 5CH7B 4YDXA 1DTQB 4I6AA 1QUVA 4QWBA 4USJC 3HK2A 2Q1LA 4LFBE 3UR0A 3H2UB 4RLEA 3PW5A 4L73A 2RUGA 1P8GA 4NEYA 1A6FA 2ROGA 3KTQA 3CDWA 2IHR1 3RW7A 4TY9A 4HI1A 4ICLA 1TL3A 5B0BA 1QVGR 1DTTB 2MQNA 4LREA 3OSNA 4RW9B 1JLEA 3L7UA 2CPJA 1M5PC 2MQMA 3C16B 2XYHB 1R89A 5HSPA 2RQMA 1KR4A 3PS3A 2HVEA 4ILMA 3EXYA 4LFAJ 2DNGA 3T1AA 2ZM6I 3MD1A 3K0JA 1Z0EA 1T9TA 4MIWA 1DTQA 2M88A 1KWMA 4IRDA 1N0VC 3AHPA 2B6AB 4HACB 1CQMA 4DUZI 4JI3I 4ZP7A 1A0OB 3JTOA 1Y60A 4J9PA 4X66I 4KGKA 4PQUA 2HQCA 5DG8A 2CG9A 3EDRB 2FC8A 2D3ZA 3GG1A 3D9BA 3ZZUA 3I5CA 5I4MA 4JI1I 5IT9U 2BM0A 2RUSA 5BR8I 2GIQA 1NKEA 1X5SA 5K20B 4EU0A 3U1YA 4NXMF 5ITHA 1T05A 1DTTA 3T1YE 2CPXA 2JHEA 3UFCX 4RW9A 2KL8A 4DFJA 3QGHA 5BYRA 4RU9A 3IWNC 3CDIA 2D1CA 3C16A 3TA0A 3MR7A 4UUWA 3QJPA 3DOMB 3BBBA 2UXCJ 1HMVA 1QAXA 4CTAB 1YJ7A 5DNLA 1I94E 3JSBA 2A2CA 1LWEB 3QT8A 1TMMA 4PPZA 3F41A 4HACA 4B3SF 4MKAA 1Q53A 4LF6I 2DD8S 2DHAA 1ZM9A 2BACA 2H5EA 2JDJA 4AIDA 3RAMA 4HYMA 3D6FB 4CM2A 3MURP 4K4WA 3PDNA 3B54A 4OX7A 5IT9C 4FXVA 5KFMA 3KLEB 2KO1A 1GQEA 4OX9E 2CJXB 4PXBA 4DL3A 3L4BC 1CQNA 2C28A 1RISA 2KFNA 3H5XA 2W8LA 2RH3A 2N3LA 1VQSA 2XZTB 1N33E 4HXZA 2RJZA 4WKRA 3EZOA 1NJXA 3PM9A 5DGBA 2W4PA 3FCVA 3R97A 4CLKA 5DS7A 4ZN1A 4DR4J 2QLBB 5E3AA 1WC0A 2WW8A 2MGZB 2L41A 2O5DA 1NJYA 4P7AA 2DBBA 1OJ4A 1OQ3A 1TL1B 4DX8H 2ZJRQ 2LQJA 5EWFA 3KLEA 3BSNA 2XYPB 3B78A 1DQ8A 4B3TJ 1JLAA 2DITA 2WHOA 4MKBA 4Q7AA 2YNHA 2NPIA 3BSAA 2R2RA 4WFNQ 1NMEB 2MKCA 5AXLA 4D3HA 3CJRA 4DFKA 4FWGA 4NLSA 4Y2MA 4QPTA 4OI1A 1FDNA 3IRXA 2XG8A 1S59A 2CQ0A 3R5CA 2ASLA 2HHSA 2F1DA 4F2RA 5C5JA 3LALA 2OSRA 2ZWPA 2UVVA 4GKJI 4ITSA 1ULRA 4DJBA 3D6TB 4KYZA 1L3UA 3POTB 5FIIA 4ZN3A 4DS4A 2VG6B 5E0OA 1V3ZA 3EVMA 2F3JA 1WOOA 3H25A 2M4MA 2HFOA 4CDIA 5DLGA 2XO7A 4YUDA 4IFDD 1C4CA 1ZA1B 4DV5E 2V0NA 4C8ZA 2QSFA 3VCDA 2F1FA 2W2NP 3AFGA 4TU7A 3Q89A 1FRMA 1U2RA 1TFYA 1NK8A 1D8YA 4B3MI 2OAUA 4IRKA 3EGZA 1DQ9A 1VLYA 3D5MA 3MAAB 5A8KA 2XGPA 4DXLA 3PNIA 4J9SA 1SKUB 3LANA 1RT5A 4Q0BA 4AQYI 1IUJA 1LWCA 1XNRE 4ECUA 4A8FA 1FT8A 4CO0A 4DR7I 3DLBA 4WTOB 1R0AB 4DV6J 2AYEA 4WU2A 1XNQE 4Z37A 5K9FA 4MU0A 1F5BA 3CJ4A 1CVJA 3GP9A 2PSZA 4CI0B 2V68A 2WOMB 4Q2MA 4RW7A 2JEIA 1D1UA 1FTCA 2XQCA 4NXNJ 3M8PA 2MZJA 4TQSA 3WC0A 1S0VA 3AOCA 4MK9A 4LBIA 2CDQA 3FBCA 1U7LA 3OUYB 1UWAA 1N5QA 3MPVA 1FEEA 1URNA 2V6AA 2OO4A 4M5JA 3OV7A 1OYRA 2XI2A 4HL9A 1Y11A 2I38A 4NLXA 1VQ8S 4C0OC 2O3DA 1OY9A 4O0NA 2VG7B 2EK1A 1IJEB 5DM7Q 1N5VA 1NHVA 5KFTA 4ZCKA 4DF4A 4B9MA 1UVNA 1BQMB 2CVIA 2Z5CB 1SKWA 3SEOA 2OELA 2WOMA 4FPRA 5KG0A 3H40A 2PEHA 1KTVA 4IUFA 4TU9A 1HD0A 5THWA 1QAJA 1UVKA 1PJ6A 3OUYA 4DL6A 3I6PA 2AGQA 3ZFVA 3CJ8A 5HAOA 2CFXA 3ZKBA 4DSIA 2BYCA 2VBZA 4MIBA 4K0KI 2W7AA 4U95A 1SB6A 5F8LA 3TUPA 1ZAXA 3NNHA 4PR6A 2VG7A 5D0GA 2K7KA 4M5MA 3I31A 2AJQA 3OLBA 3HPOA 4I56A 3Q6NA 1NDLA 1KIJA 1Q8BA 3HVTB 5EX0A 2ABYA 2IAJB 1HYSA 4NXNF 2FYXA 2GMLA 2UXCE 5A2QU 1K44A 2XM3A 4PCQA 2IM1A 3M7VA 3JTPA 3RJMB 4OHVA 4I0WA 3L09A 3MTKA 5F0UA 3M9NB 5ETOA 3OBIA 4QZVB 3SI8A 1KKHA 5DDQC 3C66A 3Q2TC 2CNNB 4IH5A 4CWBA 3GIIA 4DL0C 1HI0P 2FLNA 4PUOA 4N5SA 4YHHJ 2C39A 4JI6I 1SH2A 1F5CA 2E1RA 4G1IA 4JV5J 1SCJB 4V1Ak 1VJQA 4AL6A 4JG4A 1MWZA 1X9MA 3P76A 2CPDA 2BRKA 1XMQE 3G6VA 5H9EJ 4BBYA 5E3PA 3MEDA 3Q8VA 2UP1A 4GKKI 4UOHA 3OTOF 1NCLA 2M3DA 2XS7A 2E5GA 1FERA 3BDEA 2BJ3A 4B9UA 2R8HA 2UUBF 2E1AA 4RW6B 1KLNA 2HURA 3KHRA 2WNRB 3LH2S 2LU2A 4OI4A 4ZA1A 4DV1J 1T9WA 3TEGA 2DRDA 3ILIA 4JYAF 3NOCA 4M1KA 2Z5BA 3H4LA 1PGZA 4EMDA 1RAGB 2PNMA 2P6SA 4QIVA 2VG5B 5LMUF 1FRHA 4OZ2A 5LXRA 3RRKA 3DLGB 3AD8C 3BKUA 1RABB 2LQBA 1GMUA 4J5OA 2KZMA 4FYXB 5GAEI 5GMEA 4LBHA 1K1QA 1MU2A 1K0TA 1KS2A 4B3TE 2AEMA 4BWMA 4WZMA 3CEDA 3M85D 1H7SA 3ULHA 5KFKA 3K57A 1N36F 4LRAA 4RW6A 3UVJB 1NH8A 1M1GA 2WNRA 1NPKA 4DV4E 5B0CA 3AJDA 4YHHF 1Z5AA 1HNXE 4KIAA 2AGOA 2GQCA 4R8UB 3DRRB 4YY3J 3C15B 3LA0A 5A6PA 5LMNJ 1U47A 1NK9A 2ZNZA 4JV5F 2XI3A 2DVIA 2K1RB 4DV3J 5IS2A 1EQ0A 5E7OB 2HHHE 4DR6I 2IOQA 2UXBE 4G6VB 2L08A 1VK8A 2LXIA 3OXFA 2GJIA 5M2RA 1HLWA 4JI0E 2EPIA 2HVZA 3W62A 1FE0A 4IG3A 3OFEA 3HDSA 4IQXA 3OR1B 2CPIA 3S6EA 1N34E 1Q5VA 2X36A 4DV1F 2IMOA 2MB0B 3IWXA 5LT5A 3DLKB 3RAQA 2J0QD 1MROA 1XK8A 4GO5X 4U8YA 4CO2A 3HP6A 3KHHA 1RAOA 4R8UA 1R6MA 3DRRA 3QO9B 2H3EB 4ELTA 3WU3A 4UY85 2AT1B 1Y5YA 3IAS9 1JNRB 4O3PA 3TX0A 4LRDA 1KN6A 4WP3A 4USUA 4A47A 1MNEA 3J7AG 2CJBA 2DR7A 4NXMI 3AA8A 4Y0FA 3M8QA 2AYMA 1LW0B 3ONQA 3T3FA 5H9FJ 1ELOA 1P1LA 3QGGA 3NZKA 3OR1A 2BE9B 2YX1A 3W5ZA 1GFWB 2GHPA 2NCKL 3MR5A 1AA1B 2BW2A 2JEAB 3H0PA 2DRAA 4USWA 3JSMB 3LPSA 4B3SI 2JT2A 1Y6ZA 1IBLE 2IVFB 9ATCB 3KOAA 4A8KA 3QO9A 1U48A 3T1YF 5J2MA 3MPYA 5FWKA 4BCAA 1DJ0A 3G8TA 2W9AA 2IM0A 1J5EJ 1FRKA 4OO1C 1T9XA 5IWAF 4HI2A 2CZVC 4OI2A 4AXJA 3BGLA 3DN9A 1UMJA 2HRUA 5DETA 4QCLA 4LFAI 1FJCA 3RB6A 4FW6A 2ZOFA 3R5DA 1HARA 3TZXA 3MR2A 3LF0A 3NGDA 2B5JB 2HWTA 5CD4A 5GADU 4E2FB 1VDHA 1NB7A 1WKLA 3JSMA 1NSKL 2OMLA 4CLSA 1IWAA 1XWLA 4JB8B 1Y4ZB 3RTVA 3KRNA 1RWUA 1IXKA 2J76E 2V8GA 1K47A 5A2QY 5HLFA 3MR3A 3PJ9A 1HPZB 2GW8A 5FDLB 2OUGA 2PMZD 3PRDA 2MSSA 3HMJG 1FKAE 4OO1A 4ZKAA 3CCJS 4LR9A 2YKAA 4Q8EA 1S1VB 1N5YA 4USMA 2PDAA 3CD7A 2WTFA 1OSDA 1NPPA 3A8KA 2LKZA 2R7QA 1RAIB 2B8PA 3ZTRA 4R5PA 2R7TA 1RU2A 1JXLA 3ILJA 3DLHA 4URSA 4ZVUB 4C98A 5FJ4A 2B5JA 4C7QA 2YNGA 2FHOB 3TYTA 3BSCA 3W8GA 1RTZA 3CMQA 3JYTA 3BGRB 4XIUA 2W9BA 2YPYA 2AKWB 1Q86T 3GJSB 2CJQA 4MJKA 2XS5A 2OMOA 4H4MA 3EPGA 2YKMA 2PO2B 2YX7A 4U67Q 1HPZA 3OFFA 1Y9OA 3QBCA 3J7AN 5FDLA 2Y8WA 2GGPA 1UEKA 3BYRA 1HKAA 1JJCB 3MECB 4OX8A 3RYLA 3FEZA 1KDNA 1IBCB 5B0GA 5DQIA 5HANA 4MYTA 4B3OB 2EFNA 4BHQA 4GQUA 1R6LA 4NYOA 4AM3A 2JWNA 2CWKA 5L9XA 4P74A 1SPBP 4PYAA 1WKKA 4D3GA 5D4OA 2MQLA 4J3DA 3R7NB 3SDEB 5HMWA 3BGRA 4DR4I 3RBDA 3VZHA 4EYHB 1RAAB 1EJ7L 1FDBA 3MM6B 4YEAA 4WUCA 4QNJA 3O1LA 2ZH3A 1WG5A 2ZOGA 2NN6E 5DM6Q 4RUHA 3M32B 4IZJA 1NDCA 3OR2B 3D66A 4DR3J 1H7WA 1T0TV 3MECA 4DEZA 4B3TI 4HHUA 2WVCA 3DOKB 3UO0A 1HWLA 1RT1A 3K5NA 3KWMA 2GIFA 2HGLA 5KG3A 3KLGB 2W9CA 4OYAA 5C2CA 3HSZA 1S1TB 2FJDB 4LPFA 1YHQS 2J8SA 4HKQA 1U02A 1X4CA 1IN0A 2CRLA 3TUZC 4F4ZA 3GLJA 1RYRA 2NXCA 1WOSA 3TWZA 3V6HA 1RHJB 2BZ2A 4DPTA 2OTJS 2AHOB 1JLBB 4KHRA 1HBNB 1M1HA 5A2QQ 3MM6A 1T02A 3H59A 2MLZA 4KFBA 4RL1A 4FVCA 2HRTA 5LMNE 1UWBA 3UNGC 1XNQF 2HHQA 1Y4UA 2ROEA 1USVA 4MMOA 2CQBA 1YRXA 2DH8A 4O44B 2B9YA 2IDLA 4CIOA 2ZBIA 1NK5A 1S1TA 3BS9A 4Q8FA 1FRJA 2VQEJ 4QWDA 1DURA 4MU3A 2IERA 2V2ZA 1YKWA 2BA0G 4OL8A 3HFKA 2A10A 1M5SA 2F4FA 1U6BA 3HM9A 1LXJA 3MF5A 4NLWA 1IM6A 3HVAA 4KBIA 5DRKA 3EPIA 1Q81T 4ALZA 1RWKB 2UXDE 4JI7E 2W2QP 1ZTTA 3MMBB 2ALZA 4C8OA 2UV8A 4DG1A 3H5YA 3MAQA 1A7GE 2DNYA 5IFMA 4X4NA 1JLFA 4H54A 4Y2KA 2FHJD 4ZPBA 4DR3F 1FESA 1MN7A 1M5VC 1TKXB 1MMDA 1X4HA 2WONA 2XY7A 4UQGA 1X4AA 3H8YA 4DV6I 2KTQA 1T9UA 3M8YA 4BWJA 1K0VA 1G2EA 1UVLA 5KFHA 4W90B 2P9EA 1HW8A 3V5RA 5KFXA 1U8WA 4KHPF 1RWPB 2DGQA 1BWEA 4NXNI 1IKVB 2V4RA 2AF6A 1YWXA 3PIOQ 4ED4A 2QA4S 1I1GA 1TZ0A 2F7VA 1UDSA 3P4UB 1U1NA 2V67A 5CZVA 3FMBA 2OPQA 3U02A 5LM7E 2UVWA 5JEAD 5J2PB 4X62F 1S4EA 2ATLA 3CIMA 5KFQA 1TKXA 3GYGA 1HQUB 1E6VA 5HO4A 3IO1A 3CSKA 3PFOA 4K2XA 4IDKB 3TX8A 1NHIA 4F3QA 2BQRA 1X60A 2Q6BA 3PW0A 3NS6A 3W8PA 4ED0A 4L76A 2JH3A 4QR2A 3MPUB 2MDAA 2XY5A 3MEGB 2JNJA 3UQSA 3K1JA 4ZLPA 5JEAB 4OJ1A 1W2BR 1RHUB 1VBZA 2VFSA 2LQ9A 5D4LA 2QLFB 3ZKDA 2W8KA 1WEZA 3DYAB 3DDIA 1S10A 1BGXT 4IR1A 2IESA 3GLLA 2DHGA 2ERRA 1RSCA 2R7SA 2JL9A 3ZTQA 3Q83A 1BUXA 2MTLA 3OT9A 1RHYA 2M9KA 4LF4E 4DR1J 1P27B 2E29A 3V4MA 4KGXB 2R2SA 3HLUA 2A6OA 1UDQA 2PFDA 4B3RJ 4Q43A 4IDKA 3I9ZA 2Y1IA 1LW2A 2DO4A 1SXLA 3CCQS 2KXNB 3CDEA 5IQ6A 4RBTA 4YDDB 4IKAA 1XQIA 4TN2A 4X65E 4I2QB 4ZVHA 1XC9A 5C0XD 1T03B 1UDOA 2XSJB 2PMWA 3B4MA 4YHHI 1Q8IA 4ZMMA 1FRLA 2VONA 3V81A 2QFIA 1S4FA 4LQ3A 3W9JA 1A9NB 4JV5I 1WDDA 2XY6A 2EBGA 2CUYA 3MTJA 4JI4E 1D09B 5U47A 1NK0A 4P52A 5GAEU 4DSFA 2XC9A 2HNZB 2VA2A 3J80U 2ZC3A 3VAHA 3FBFA 2FVPA 3LW5C 3CW2C 3NBPB 1ACMB 1BC6A 4AL7A 2RRAA 4DV4F 2V9WA 5C0XB 4EGLA 1YQHA 2ZBPA 1HR0J 1OY8A 3A8EA 4DV1I 2I2YA 3PEJA 1RT7A 4ILLA 2J7UA 4LRFA 2B56A 3CO9A 2HHHF 1LWXA 1UFKA 1NZ0A 3P3DA 1IR1A 1SVDA 4IFDF 1RB0A 1UA0A 5IC4B 4JI0F 3CCRS 2MQQA 2KT3A 2YTCA 5KFDA 4B3RF 5IT0A 3AOBA 4C8KA 4QNKA 1TAQA 1N34F 4HY1A 2HNZA 2W7OA 3UPFA 4ETXA 1B0TA 1JX4A 4PWDB 2QTWA 3US5A 3D28A 2LA6A 3L95X 3J80C 2Q66A 1Z4UA 2HNDB 3M6UA 3RUBL 2VDHA 2IM3A 1RTJA 1RWNB 4FKYA 2UU9E 3CD0A 2MEWA 3NGKA 2ROPA 4U6PA 1KOHA 4XDDA 3VAFA 4HHHA 1YK9A 2H5IB 4YY3I 3N9UC 2LVWA 4YMEA 5J2QA 1YJTA 3PJXA 5D77A 3PS1A 5IC6B 4DV3I 3BH6B 4CQ1A 5DRQA 4J9UE 2JE6B 1X5TA 4I64A 2UUAJ 2I0XA 1M5HA 3GMGA 4F3OA 2LDYA 4DV7E 4TYBA 3G6XA 3MHYA 1KEKA 1S6PB 3ZTOA 3RB4A 4PWDA 1F6TA 1T3NA 2QFJA 3HULA 3NCRA 5IWAI 2VASA 1KP6A 4HYKA 2O3ZA 4PKDB 2A18A 4F4AA 5K36D 2DXFA 2VQEE 1OYPA 4ANDA 4QW9A 3R3TA 3MM7A 1HR0F 1RP5A 4FDFA 4YR3A 3J7YI 1JQGA 1IBLF 2ZH1A 2FLPA 4F0HA 4PRFA 3PFEA 3DGVA 1B70B 3GU0A 3HCXA 2YH1A 2GVZA 3K59A 1ZPWX 4RJVA 1VIOA 1ZM2A 3P3GA 3PX6A 4CT8A 2QA2A 4OYPA 4IFVB 4UW2A 1VRTA 2H48B 3EXCX 2K06A 4HT7A 4N56A 5ETNA 4C0HA 2F9JA 2BKOA 2V8PA 1RBLA 5F8JA 5K36B 3RW6A 2L48A 2NS1B 5D0EA 2F4VJ 1CS4A 4A46A 1TTHB 3MR6A 5HMZA 4L3NA 3OTBA 3UDEA 3Q0AA 1RT4B 3E01B 1FD2A 2Z2MA 2XLKA 1T9YA 2CNKB 2EFOA 2B9XA 4LFCJ 3TAPA 1QAIA 4BA2B 2QG9B 3CF5Q 3E51A 4Q5VA 4R1FA 3H2VE 1AZSA 3EGNA 1B3TA 5KFPA 1MMLA 4F3MA 3WZ0A 5HQMA 3M2UB 5ETLA 2PA3A 5J2NB 2JZ5A 3QNWB 3ETOA 1FKAF 4FYWB 3UNYA 3GR1A 2F8EX 2E1PA 3FZBA 1J5EI 3DC2A 3BYPA 2QZ8A 3VGTA 6FD1A 1RU1A 2DO0A 4JI2E 2RDJA 2HBRB 3BEGB 2VJVA 3CJKB 1JK9B 4JI8J 2HNYB 4CNYA 3KLFB 2E9RX 2HS3A 1S0OA 1JKHB 2DXDA 4ZJLA 1KFDA 3QAEA 4FYYB 3O6QA 5CAAA 3NCPA 1Q4RA 2IDEA 1P6TA 2NXNA 4MT1A 5K14B 1R8CA 3M1VB 2CQPA 3THVA 2MKHA 2M7SA 2ZITA 2E5IA 3M2UA 5J2NA 3TUJC 5KT7A 4IFYB 2MZTA 3W5YA 1WEXA 4RR5A 3QGIA 2E7XA 2OPPB 1SKRA 2J6UA 4X4VA 3QFHA 1UFWA 4LF9F 3LUYA 5C2GA 5AE3A 2C37B 1U45A 3MDFA 1X4DA 5LJ5Y 5KOWA 3SSSA 1HBOB 3MMAB 4LF7J 1F9FA 4QWEA 1Q5YA 4LFCF 1G7CB 3SBMA 1WELA 3KLFA 4WFAQ 4LF8J 1T7PA 1LK5A 4B02A 4DR2E 4KAIA 3W66A 1DLOB 2H4WB 4ED3A 5L1JA 1R8BA 2U2FA 3I4PA 3DOLB 2NSBA 4FNIA 1RT2B 3M1VA 1YTYA 1WI6A 4FW3A 2VFRA 4WIIA 1R43A 3K85A 1RGVA 5M2PA 5IM0B 1Z5CA 1VBYA 1YG0A 5B0AA 1H98A 3LO3A 3IM8A 2X7IA 1WC5A 3R2DJ 1VQ5S 4LRBA 1M0SA 2F8MA 4NLVA 1PIEA 1KVJA 1UVMA 3OFHA 4N41A 4DPUA 4DV0E 4FS1A 4RWXA 1HNZE 4OYXA 1Y10A 2BVZA 2G0JA 4X66J 1Q7LB 1DARA 3BSOA 2ZDPA 1RWVB 4USKA 2G4BA 4JI1J 4ZPAA 3U27A 1GXLA 4V19X 1N5SA 2ZDOA 4BLGA 1SQEA 5E3CA 6AT1B 5DNXA 1WF1A
chains in the Genus database with same CATH topology
4DR3I 1PVGA 4DPWA 2ZBKB 4DV5E 3PRYA 4IZJB 1XMOE 5A2QQ 1FI4A 4JI1E 3V2UC 4JI0E 2UU9E 1N33I 1FWKA 1XMQI 1FNMA 5BR8E 5FLXQ 5LMNE 1Z0BA 4N3OA 1U2RA 1Y4UA 4LFAE 1N34E 4B3MI 1USVA 4X65I 3T1HI 4YY3I 4UT4A 2X36A 4LF9E 2R3VA 4KHPI 4UTGA 4K0KE 4DR2I 4DXLA 4DV3I 1D6TA 2UUCE 1Y4SA 2V2VA 3B8HA 2Q2EB 1ZXNA 4X64E 4DUYE 4MYUA 4AQYI 4DV7E 2IOPA 1XNRE 1J5EE 4LFCE 2EFGA 4FW9A 5FLXC 4JI4I 3D4JA 4DR7I 3J81Q 1Z5BA 2V2ZA 3WU3A 5LL6R 2Z5EA 1XNQE 1Z0WA 3QT6A 1WUUA 3HULA 4X62I 5IWAI 4LF6E 3OTOI 4LFBE 4Z7CA 1MG7A 1N32E 1USUA 1H74A 2VQEE 2UXDE 5IT9Q 4JI7E 3J7AG 2E5LI 2WW4A 4NXMI 2UUBI 2O1WA 1A6FA 1PKPA 2Z5CA 2UUAI 1ELOA 4JYAI 2CGEA 4IZKA 1N32I 2PNLA 2VQEI 3LTOA 1QZRA 2DEIA 4DPYA 4DV0I 4DV6I 2VQFE 1ZM2A 4FN5A 4JI6E 1HNZI 2LJPA 5LMUI 1NHHA 4JI8E 3WU4A 3V5RA 1HNWI 3LPSA 4DV4I 4B3SI 1IBMI 1Y6ZA 1IBLE 4NXNI 3P06A 1XHKA 2VF3A 2V8PA 1HNXI 3B82A 3JAMC 1B62A 2ZM6I 4PRVA 4LF5E 4DU7A 1Z0EA 4ED4A 3CWVA 1H73A 4HACB 1N0VC 4GKKE 2A2DA 4DUZI 4DR1E 4JI3I 5FWKA 2Z5CB 2HHHI 4X66I 1N36I 1Z0VA 1EA6A 4YHHE 4B3RE 2UXBI 4IZKB 2CG9A 2CZ9A 5L3JA 3K17A 4DV5I 1KTVA 2O1UA 1XMOI 4JI1I 3ZZUA 2F4VE 1S4EA 4JI0I 2BM0A 2UU9I 4JV5E 5LMNI 5BR8I 3ZM7A 4JI5E 4R1FA 4Z7YA 4LFAI 1N34I 3T1YE 5A2QC 3ZKBA 1NHIA 3Q6MA 4LF9I 2HKJA 4LF7E 4DV2E 4K0KI 1RREA 2UUCI 3PYFA 3GONA 4LF8E 4DR4E 4X64I 4DUYI 4DV7I 4WUBA 1FJGE 3WU6A 1XNRI 1J5EI 4LFCI 1IBKE 1I94E 3Q6NA 1Z59A 3K1JA 4DV2I 1KIJA 1RR9A 2A2CA 3QT8A 4JI2E 4PU9A 4DV1E 1K47A 1XNQI 3Q1QA 1Z0CA 4HACA 3J7AM 2OI2A 3ZKDA 4LF6I 4LFBI 1ZM9A 3J81C 2UXCE 2J7KA 3WU5A 3HJCA 1FKAE 2UXDI 4DR5E 4JI7I 2HK3A 4GKJE 3QT7A 4HYMA 4XTJA 1KKHA 4USMA 1NHJA 2V2QA 4DU8A 1ZM4A 4FWHA 3J80Q 4LF4E 5IT9C 4I3HA 4OX9E 2O1VA 1HR0E 3PYDA 2ZITA 1ZM3A 2VQFI 4JI6I 1S16A 2BM1A 4DR6E 4DR3E 2E1RA 4JI8I 2DEJA 1MU5A 1MX0A 4JG4A 1IBLI 1N33E 4HXZA 1XMQE 1FWLA 2NPFA 4LF5I 4B3ME 4X65E 4GKKI 3T1HE 4YY3E 4DR1I 2BV3A 1UEKA 4PRXA 2AJ4A 4KHPE 4YHHI 4B3RI 4DR2E 4DV3E 4DPXA 4MYTA 2F4VI 1HK7A 4AQYE 2V34A 4JV5I 1N0UA 4P7AA 3ZZ0A 4JI4E 4JI5I 1ZXMA 3ZZTA 4DR7E 1Z0GA 1OJ4A 2Z5BA 4M1KA 4P52A 4WUDA 3B78A 3H4LA 4EMDA 1KVKA 3T1YI 3K85A 2PNMA 1EI1A 4FWDA 4X62E 2O1TA 5IWAE 3OTOE 4LF7I 5GMDA 1Z5CA 2E5LE 4NXME 2UUBE 4LF8I 4DR4I 2X7IA 5GMEA 3M6AA 1FJGI 4FWGA 1IBKI 4WUCA 2UUAE 4B3TE 1I94I 2GQ0A 2R42A 1H72C 1Z0TA 4JYAE 2HFSA 4JI2I 4DV1I 1PIEA 2XEXA 1H7SA 4IZJA 4DPUA 4DV0E 4IZJD 4DV6E 4B3TI 2UXCI 1NZ0A 1HNZE 2UXBE 5LMUE 3JAMQ 2Z5BB 4DR5I 4GKJI 2HK2A 4RPFA 2HFUA 1HNWE 3PYGA 3LNUA 4DV4E 4B3SE 1IBME 2HKEA 1DARA 3F0NA 4NXNE 1B63A 1Z5AA 1HNXE 3QT5A 4USKA 4LF4I 3PYEA 4KQVA 2ZM6E 4HY1A 4URLA 4OX9I 1HR0I 2GS8A 4DUZE 4JI3E 4ZVIA 4DPTA 1BKNA 2HHHE 4DR6I 4X66E 1N36E 1VISA 2IOQA 3J80C 1H7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 I;  1PVG A;  4DPW A;  2ZBK B;  4DV5 E;  1XMO E;  5A2Q Q;  1FI4 A;  4JI1 E;  3V2U C;  4JI0 E;  2UU9 E;  1N33 I;  1FWK A;  1XMQ I;  1FNM A;  5BR8 E;  5FLX Q;  5LMN E;  1Z0B A;  1U2R A;  4LFA E;  1N34 E;  4B3M I;  4X65 I;  3T1H I;  4YY3 I;  4UT4 A;  2X36 A;  4LF9 E;  2R3V A;  4KHP I;  4UTG A;  4K0K E;  4DR2 I;  4DXL A;  4DV3 I;  1D6T A;  2UUC E;  2V2V A;  3B8H A;  2Q2E B;  1ZXN A;  4X64 E;  4DUY E;  4MYU A;  4AQY I;  4DV7 E;  1XNR E;  1J5E E;  4LFC E;  2EFG A;  4FW9 A;  5FLX C;  4JI4 I;  3D4J A;  4DR7 I;  3J81 Q;  1Z5B A;  2V2Z A;  3WU3 A;  5LL6 R;  1XNQ E;  1Z0W A;  3QT6 A;  1WUU A;  3HUL A;  4X62 I;  5IWA I;  4LF6 E;  3OTO I;  4LFB E;  4Z7C A;  1MG7 A;  1N32 E;  1H74 A;  2VQE E;  2UXD E;  5IT9 Q;  4JI7 E;  3J7A G;  2E5L I;  2WW4 A;  4NXM I;  2UUB I;  1A6F A;  1PKP A;  2UUA I;  1ELO A;  4JYA I;  1N32 I;  2VQE I;  3LTO A;  1QZR A;  2DEI A;  4DPY A;  4DV0 I;  4DV6 I;  2VQF E;  1ZM2 A;  4FN5 A;  4JI6 E;  1HNZ I;  2LJP A;  5LMU I;  1NHH A;  4JI8 E;  3WU4 A;  3V5R A;  1HNW I;  3LPS A;  4DV4 I;  4B3S I;  1IBM I;  1IBL E;  4NXN I;  1XHK A;  2VF3 A;  2V8P A;  1HNX I;  3B82 A;  3JAM C;  1B62 A;  2ZM6 I;  4PRV A;  4LF5 E;  4DU7 A;  1Z0E A;  4ED4 A;  3CWV A;  1H73 A;  4HAC B;  1N0V C;  4GKK E;  2A2D A;  4DUZ I;  4DR1 E;  4JI3 I;  2HHH I;  4X66 I;  1N36 I;  1Z0V A;  1EA6 A;  4YHH E;  4B3R E;  2UXB I;  2CZ9 A;  5L3J A;  3K17 A;  4DV5 I;  1KTV A;  1XMO I;  4JI1 I;  3ZZU A;  2F4V E;  1S4E A;  4JI0 I;  2BM0 A;  2UU9 I;  4JV5 E;  5LMN I;  5BR8 I;  3ZM7 A;  4JI5 E;  4R1F A;  4Z7Y A;  4LFA I;  1N34 I;  3T1Y E;  5A2Q C;  3ZKB A;  1NHI A;  4LF9 I;  2HKJ A;  4LF7 E;  4DV2 E;  4K0K I;  1RRE A;  2UUC I;  3PYF A;  3GON A;  4LF8 E;  4DR4 E;  4X64 I;  4DUY I;  4DV7 I;  4WUB A;  1FJG E;  3WU6 A;  1XNR I;  1J5E I;  4LFC I;  1IBK E;  1I94 E;  1Z59 A;  3K1J A;  4DV2 I;  1KIJ A;  1RR9 A;  2A2C A;  3QT8 A;  4JI2 E;  4PU9 A;  4DV1 E;  1K47 A;  1XNQ I;  3Q1Q A;  1Z0C A;  4HAC A;  3J7A M;  2OI2 A;  3ZKD A;  4LF6 I;  4LFB I;  1ZM9 A;  3J81 C;  2UXC E;  2J7K A;  3WU5 A;  1FKA E;  2UXD I;  4DR5 E;  4JI7 I;  2HK3 A;  4GKJ E;  3QT7 A;  4HYM A;  4XTJ A;  1KKH A;  4USM A;  1NHJ A;  2V2Q A;  4DU8 A;  1ZM4 A;  4FWH A;  3J80 Q;  4LF4 E;  5IT9 C;  4I3H A;  4OX9 E;  1HR0 E;  3PYD A;  2ZIT A;  1ZM3 A;  2VQF I;  4JI6 I;  1S16 A;  2BM1 A;  4DR6 E;  4DR3 E;  2E1R A;  4JI8 I;  2DEJ A;  1MU5 A;  1MX0 A;  4JG4 A;  1IBL I;  1N33 E;  4HXZ A;  1XMQ E;  1FWL A;  2NPF A;  4LF5 I;  4B3M E;  4X65 E;  4GKK I;  3T1H E;  4YY3 E;  4DR1 I;  2BV3 A;  1UEK A;  4PRX A;  2AJ4 A;  4KHP E;  4YHH I;  4B3R I;  4DR2 E;  4DV3 E;  4DPX A;  4MYT A;  2F4V I;  4AQY E;  2V34 A;  4JV5 I;  1N0U A;  4P7A A;  3ZZ0 A;  4JI4 E;  4JI5 I;  1ZXM A;  3ZZT A;  4DR7 E;  1Z0G A;  1OJ4 A;  4M1K A;  4P52 A;  4WUD A;  3B78 A;  3H4L A;  4EMD A;  1KVK A;  3T1Y I;  1EI1 A;  4FWD A;  4X62 E;  5IWA E;  3OTO E;  4LF7 I;  5GMD A;  1Z5C A;  2E5L E;  4NXM E;  2UUB E;  4LF8 I;  4DR4 I;  2X7I A;  5GME A;  3M6A A;  1FJG I;  4FWG A;  1IBK I;  4WUC A;  2UUA E;  4B3T E;  1I94 I;  2R42 A;  1H72 C;  1Z0T A;  4JYA E;  2HFS A;  4JI2 I;  4DV1 I;  1PIE A;  2XEX A;  1H7S A;  4DPU A;  4DV0 E;  4DV6 E;  4B3T I;  2UXC I;  1NZ0 A;  1HNZ E;  2UXB E;  5LMU E;  3JAM Q;  4DR5 I;  4GKJ I;  2HK2 A;  4RPF A;  2HFU A;  1HNW E;  3PYG A;  3LNU A;  4DV4 E;  4B3S E;  1IBM E;  2HKE A;  1DAR A;  3F0N A;  4NXN E;  1B63 A;  1Z5A A;  1HNX E;  3QT5 A;  4USK A;  4LF4 I;  3PYE A;  4KQV A;  2ZM6 E;  4HY1 A;  4URL A;  4OX9 I;  1HR0 I;  2GS8 A;  4DUZ E;  4JI3 E;  4ZVI A;  4DPT A;  1BKN A;  2HHH E;  4DR6 I;  4X66 E;  3J80 C;  1VIS A;  1N36 E;  1H7U A; 
#chains in the Genus database with same CATH topology
 4DR3 I;  2FC9 A;  2BA1 G;  1PVG A;  5L9N A;  1N56 A;  1HQ2 A;  2HAF A;  2RF2 A;  2LEC A;  1WNE A;  4CH0 S;  4LF7 F;  1FWK A;  3ITH B;  3HHD A;  1Q79 A;  3H5U A;  2J5A A;  5DO2 A;  1C0T B;  3O3L A;  1YJU A;  3SSR A;  4KHP I;  2BR2 B;  3G71 S;  1S6O A;  2VIC A;  2N4D A;  4OHZ A;  1E6Y A;  4LF6 J;  2VFT A;  4G3I A;  4X64 E;  1QE1 B;  2LEA A;  2QN6 B;  2MPU A;  1Z5B A;  3KLI B;  2AIR B;  2V4J B;  4J9M A;  4I7F B;  3PY8 A;  1Z0W A;  4NL5 A;  4X62 I;  1TEL A;  2FB0 A;  1VYA A;  5DQH A;  5JUM A;  2MST A;  1Y5I B;  2E9T A;  3K8V A;  1LWF B;  1U24 A;  3IWL A;  3VGU A;  1IBM J;  2FD2 A;  3ENQ A;  1UVI A;  3ISN D;  2ZUG A;  4RX6 A;  1QTM A;  3WIU A;  4MAK A;  1X5P A;  3VVU A;  4C11 A;  3D0G E;  4KPC A;  4O4G B;  4HH1 A;  2UUT A;  3R5A A;  4NCB A;  3NS7 B;  2VQE I;  1UW4 A;  3GIL A;  2IVM A;  3TA1 A;  5FLX U;  4NBQ A;  4LR7 A;  3FUY A;  2CA9 A;  4WE1 B;  2BJ9 A;  2BMB A;  2BR2 A;  3RU0 A;  2YH0 A;  2IBO A;  1VLO A;  2VPW B;  4NI2 A;  3HKW A;  3MFH A;  1S1U B;  4MU4 A;  4MKV A;  3DD6 A;  1XJW B;  3AD7 C;  3P06 A;  3R5J B;  2VF3 A;  2YXL A;  2XYG B;  4DMZ A;  3HHL D;  3JAM C;  3GFH A;  5IZH A;  4I7F A;  4DU7 A;  3O5T B;  4UZB A;  3I5A A;  4NLU A;  2XWX A;  4YP3 A;  2GFF A;  4FF4 A;  1LWF A;  3CCU S;  3TVK A;  1ZAW A;  5KFW A;  5M2U A;  1FO1 A;  1FK9 B;  2XS2 A;  1K9M T;  2F4V E;  5KFN A;  4KJI A;  3FZ2 A;  3I96 A;  4F25 A;  2AYB A;  3OQ2 A;  4WTY A;  3R2C J;  4QR1 A;  3H1C A;  4LMZ A;  3CJ0 A;  2I6W A;  4PAA A;  3HHL B;  1PJ7 A;  3MM9 B;  1C0U A;  5SZT A;  4PPD A;  4H4O B;  2Y0B B;  3CC7 S;  4I69 A;  5D3G B;  2ASJ A;  4WBF A;  5C7P A;  4ISA A;  3ZZO A;  3U1N A;  2OSQ A;  4LSL B;  3A4T A;  1HIY A;  1MW7 A;  4LF4 F;  1EKR A;  5CCL A;  2GMJ A;  4WJB A;  3BV8 A;  1LOU A;  2YQ0 A;  1U1K A;  2VQF J;  1NK4 A;  1Z0C A;  1YDL A;  4B17 A;  4MU1 A;  1VC6 A;  4C97 A;  3C6U B;  3M2V A;  1SC3 B;  2LLZ A;  5AXM A;  3OFG A;  1TFW A;  3R1L A;  4O3R A;  1N4L A;  1R0B G;  5LSR A;  4NLP A;  1WC1 A;  1PYS B;  1YH8 A;  1EZZ B;  1FD8 A;  5T41 A;  4FW4 A;  4X65 F;  1XXE A;  1XMO F;  3FGV A;  2YWG A;  2HMI A;  4ECV A;  4G1P A;  3MM9 A;  1J2V A;  1S1X B;  4LR8 A;  2ZHB A;  2YKP A;  4JI5 J;  4IR9 A;  5HP1 A;  3BN4 A;  4JI4 F;  1QLN A;  4KGV B;  3M30 B;  1EAY C;  1RHK B;  1Y7P A;  3Q2S C;  4F02 A;  3KFW X;  3FDS A;  4DR7 J;  4DR1 I;  3MM8 A;  2JLG A;  2JEJ A;  3O44 A;  1APS A;  1KQG B;  4B3R I;  2FZK B;  1FJG J;  3K7R A;  2BDP A;  3CCM S;  1S57 A;  1KOO A;  2V34 A;  2NLW A;  4Y2A A;  3M7N D;  3AJ2 A;  2HQF A;  2XUL A;  1FVQ A;  2KXF A;  1WC3 A;  3KHL A;  1NKB A;  2QYG A;  3GV8 B;  4AD6 A;  4RW4 B;  3FNN A;  1JLQ B;  5RUB A;  1S1X A;  3ZXW A;  3VR1 A;  3BN7 A;  1VOM A;  2HWH A;  2DB1 A;  4DSK A;  2DHS A;  3W5X A;  1WAC A;  3D0H E;  3S8S A;  2NZ4 A;  1W25 A;  3M30 A;  4P7V A;  2PO0 B;  2GVD A;  4NLG A;  3CC4 S;  3MZI A;  4OO1 E;  2XEX A;  4OYI A;  3M9O B;  1QD1 A;  3DM2 A;  2ZH2 A;  4M5I A;  4RKU C;  3MPW A;  3DRP A;  4FXW A;  4U7U K;  4X4R A;  1JXE A;  7FD1 A;  5A8R B;  2LA4 A;  3AA9 A;  5HI7 A;  3KK2 B;  2UU9 F;  1TKT A;  2M8H A;  3LP1 A;  4MKY A;  2ZM6 E;  4Q45 A;  3O8W A;  3G6E S;  4U3B A;  1GH8 A;  1HR0 I;  4OYO A;  3OTC A;  4DUZ E;  4JI3 E;  4UST A;  1R8P A;  2HSE B;  3DLE B;  4X66 E;  3CDJ A;  2N4C A;  1H7U A;  2B9E A;  4DV7 F;  2ZBK B;  4O3N A;  4Y65 A;  4JI1 E;  4K0K J;  4ZP9 A;  1FNM A;  5BR8 E;  4I6W A;  3T9N A;  3TZZ A;  1FTR A;  3J7A 1;  4JV0 A;  1HHS A;  1FJG F;  3I87 A;  1Y00 A;  2QL5 B;  3KJV B;  2LMI A;  5HQL A;  3P49 B;  3JS9 A;  3RR8 A;  3LP2 B;  4FW9 A;  5E3Q A;  3DMJ A;  3ENW A;  3D4J A;  3E3X A;  4XDC A;  2W2O P;  1SV5 B;  2MKY A;  3J7Y U;  1U1L A;  4O4R A;  2WP8 A;  1H2U X;  1RTI B;  3A3N B;  4LF6 E;  2VBX A;  4P2S A;  1N6Q B;  1FKO B;  4P9S A;  4KO0 B;  1HNW J;  1KTQ A;  2R8G A;  2GCF A;  2O01 C;  3BGF A;  1G3O A;  1PKP A;  5FLX Y;  1KSP A;  2QO3 A;  4UQT A;  3TAM B;  2UUA I;  5C25 A;  4F7V A;  4BS2 A;  2HQ3 A;  4B08 A;  3W2V B;  2CGE A;  3CVK A;  4KE5 A;  1S9G A;  1RT3 B;  5G0R B;  4LF2 A;  5JXS A;  2LYV A;  2FY8 A;  1NH7 A;  3I0S B;  1YIJ S;  2BX6 A;  3QLH A;  1F60 B;  3BZQ A;  4TY8 B;  4AFF A;  3BQ1 A;  4Q44 A;  3VAM A;  2C22 A;  2OJ3 A;  2V8D A;  4M5N A;  2Y0S D;  1GMV A;  1NM2 A;  4A4J A;  4DSJ A;  1XHK A;  4ES1 A;  5CA5 A;  1OYD A;  1S6Q A;  1TKZ B;  3KK1 B;  1UA1 A;  4IOA Q;  1O8B A;  2ZH5 A;  3OXL A;  1HQE B;  2WCX A;  1R31 A;  5ETQ A;  1EA6 A;  4OHW A;  1PG5 B;  2MLX A;  2FJE B;  2CZ9 A;  2YWF A;  4ZPT R;  3TAM A;  1NDP A;  3KHG A;  2AMC B;  2HHP A;  5MAO A;  4JI2 F;  3W2V A;  2J9D A;  1RT3 A;  4LSZ B;  3SQG B;  4Z7Y A;  2KI2 A;  3K58 A;  1XER A;  3MCO A;  1FHT A;  4TNO A;  2VPX B;  2MQP A;  1LFP A;  4USH A;  4N8O A;  3R7S B;  4DLG A;  4LF9 I;  3BPS P;  3I0S A;  1I51 B;  3DGP B;  2J9C A;  2PD1 A;  3L7P A;  1DZ5 A;  3C6T B;  5LJ3 Y;  3P96 A;  4I2P A;  1GX5 A;  1S1W A;  1U0H B;  5DG9 A;  2ZJQ Q;  3M8R A;  4LFC I;  5HN0 A;  1RTH B;  2VH7 A;  4NZ6 A;  5A8W B;  2KKH A;  1S9E B;  1SJ1 A;  1HNW F;  3FSI A;  3W65 A;  2KXH A;  2CNO B;  3SIP B;  4ED7 A;  2MZR A;  4WCE Q;  3OL8 A;  3N5F A;  4DQR A;  4F0M A;  1RAH B;  2AU0 A;  4YQW A;  1VQ7 S;  1TQL A;  4GKJ E;  2DNM A;  2AJ2 A;  1REG X;  3HI9 A;  3CCL S;  3AY0 A;  4QJV A;  1F2H A;  5CAB A;  2F40 A;  1PAU B;  3D3B J;  2G0C A;  4WK3 A;  3CE8 A;  4QYZ J;  2I8E A;  2BW7 A;  2J6S A;  4J37 A;  2LEP A;  2GA7 A;  3H4B A;  4DR2 F;  2EK6 A;  1LV5 A;  3HKZ D;  2KT2 A;  4DQQ A;  4WFZ A;  5DZ7 A;  4X4U A;  1CUL A;  1J5O B;  4JI8 I;  1W2I A;  1U0H A;  2ZE2 A;  4WP9 A;  3GYX B;  3BKF A;  1U1R A;  4QWA A;  4MDT A;  1HI1 A;  5CQG A;  2MJN A;  2Q6C A;  1FWL A;  2MY8 A;  1RLC L;  1ARO P;  4J90 A;  3NNC A;  4B3M E;  4G1Q B;  1IVZ A;  4ZHR B;  2ZJP Q;  2P2C B;  4KSE B;  2M0G B;  2ZOM A;  3PO4 A;  4X4T A;  4ED5 A;  3TAN A;  2CJY B;  3DRS A;  5KFC A;  1IBK J;  2C3O A;  4K4T A;  4AQY E;  3SFU A;  1S97 A;  3Q8U A;  4DR7 E;  1N32 F;  4NE9 C;  4WUD A;  1FE4 A;  4DV0 F;  3DFE A;  1EP4 A;  5HRO B;  3PO5 A;  2DGU A;  1OIA A;  4LBP A;  4LF7 I;  3KJN B;  4KB7 A;  5GMD A;  3LP0 A;  1Y0H A;  1G1X A;  4LF8 I;  3TRG A;  2XCA A;  3LGM A;  2R7W A;  3X1L B;  3MEE A;  3NGR A;  1SKS A;  2GQ0 A;  2ZZM A;  1H72 C;  4ZS6 A;  4B3S J;  4M5L A;  4EZ6 A;  4ZHR A;  1AUD A;  4C2M A;  4S0M A;  4RUB A;  2C38 A;  2PII A;  1FWP A;  2WZ1 A;  1QDU B;  3N6M A;  1EIY B;  4HDG A;  1I5O B;  2HK2 A;  3N28 A;  4XPE A;  4RPF A;  3C2P A;  5L1K A;  2R9L A;  1UZH A;  3PYG A;  4DDF A;  2ZD1 B;  2B0G A;  4OYZ A;  2C1E B;  1LQ9 A;  4W4M A;  4KQV A;  2C2E A;  2GS8 A;  1RKJ A;  1YBA A;  3K2Y A;  4RNO A;  1XR6 A;  5GVQ A;  2OIH A;  1WTF A;  2GX8 A;  3H2L A;  3I5B A;  4X64 F;  1D9A A;  3M6X A;  5D4N A;  3V2U C;  2Z2Z A;  3M85 G;  3N0V A;  4DV2 F;  2ZBC A;  1HNV B;  5ETP A;  2W24 A;  4C3K A;  2K3I A;  2RSQ A;  2BE7 D;  3GPA A;  1SL2 A;  1V6H A;  2VPY B;  1IBK F;  5DLF A;  1TK8 A;  2JVR A;  5K36 F;  5KFJ A;  1JB0 C;  4UTG A;  2EBE A;  4K0K E;  1RHQ B;  4CLF A;  1KNZ A;  5F8N A;  2XTJ P;  4DSL A;  3P3C A;  1VQ4 S;  2LP4 A;  4LF1 A;  4DR5 F;  2Z0G A;  3AOA A;  1S7I A;  2ZBR A;  3TQ1 A;  1SC4 B;  2W2P P;  1WUU A;  3MCM A;  3AB4 B;  1X31 C;  4Y34 A;  1IWG A;  3GIM A;  5HVG A;  1CJT B;  3X3U A;  2HHU A;  1VQN S;  3SSQ A;  2VB6 A;  5GAD I;  1RWO B;  3T6J A;  5KFU A;  2B6A A;  2JEB B;  5ETM A;  4ED2 A;  3OVS A;  3QIP B;  2RDD A;  2AZ3 A;  4DL7 A;  4L6V 3;  1OS5 A;  1YJV A;  2B9W A;  4CLY A;  5DRP A;  2CXE A;  4FBT A;  2CPY A;  4MIA A;  4JI6 E;  1AXQ A;  4I1T A;  2RS2 A;  2YVS A;  4PG7 A;  5EN1 A;  5ADZ A;  4KT0 C;  4KV8 B;  1U6F A;  3FCW A;  3SCJ E;  1G4C A;  3M4X A;  1IBM I;  2IRU A;  3FMW A;  2AZ1 A;  2AD9 A;  4U3D A;  2RHQ B;  1FCA A;  4XK8 C;  4CO5 A;  2A0F B;  1SJQ A;  3DOM A;  2JFK A;  1H73 A;  3DHW C;  4Y6I A;  4FZV A;  4GKK E;  1KVI A;  4CTA A;  1CJT A;  1EET B;  1ZYQ A;  1LWE A;  3OLA A;  1OY6 A;  1UDN A;  1DFD A;  3BO3 A;  4NCG B;  3G6Y A;  3LWL A;  1XMO I;  4ID8 A;  4FW7 A;  5I42 B;  4C8N A;  5JVG Q;  3NS5 A;  1VMB A;  2IC3 B;  4ECS A;  3CO0 P;  4IOC Q;  3UN5 A;  3CME S;  5GAG I;  1BE4 A;  5I3U B;  2PNZ B;  2HIQ A;  4LRC A;  4C9D A;  1RWM B;  3DI6 B;  2XZD B;  2UZA A;  1O0P A;  1RAE B;  3F73 A;  2OI2 A;  2H65 B;  3PCO B;  2G0I A;  1VRU B;  2HG4 A;  2J7K A;  1EET A;  3HJC A;  1DQA A;  2HK3 A;  2ADC A;  4LUB A;  2QSW A;  4CLP A;  4XTJ A;  1N88 A;  1HW9 A;  4OLO A;  2MY7 A;  1TV6 B;  2XMV A;  5K8P A;  1QSL A;  4RNN A;  1YI2 S;  2GAG C;  1UPM B;  2MGZ A;  4JV1 A;  3J81 Y;  3TJA A;  2VQF I;  2NXU A;  2QA1 A;  4YR0 A;  3KUG A;  3ZO7 A;  4DR6 E;  2E1C A;  1EB0 A;  1TL1 A;  1GXU A;  1F9E B;  3MFI A;  2Q3P A;  4ZVS B;  1FDD A;  2C3U A;  1SC1 B;  1X5O A;  5KG4 A;  3T9Z A;  2HAI A;  3PXG a;  3C46 A;  3DI6 A;  2CPF A;  2XBP A;  3M8S A;  3QWP A;  2JLF A;  2CDR B;  1KLM B;  3J7Z T;  1LKZ A;  2XMU A;  3R6L B;  4O3S A;  3BKT A;  3GSI A;  4QBU A;  1VR6 A;  3DU6 A;  4Y2I A;  3QID A;  4JI5 I;  1TV6 A;  1WHV A;  4OO1 F;  3AH6 A;  2IM2 A;  2BE2 B;  3RRH A;  3IBC B;  2JLE A;  3LGH A;  3POT A;  2ASY A;  3B4D A;  4EK2 A;  2VG6 A;  4IFD B;  4IFD C;  1R3N A;  4NXM E;  1GTE A;  4AE5 A;  2CAD A;  3MOJ B;  5EL9 A;  1FJG I;  3VV2 B;  2C2D A;  4CLW A;  2ZM6 F;  1X7V A;  3KJQ B;  3KLV A;  1TU0 B;  4ZK7 M;  1ZAV A;  3GG0 A;  2V4Q A;  4DUZ F;  4JI3 F;  3F56 A;  1WG4 A;  1KLM A;  4DQI A;  3BQ2 A;  4B9L A;  2N7Y A;  4DSE A;  4LF5 F;  4KRW A;  1NSQ A;  3D7S B;  4ES2 A;  4C3M A;  4FF1 A;  4B3S E;  1R6V A;  3F0N A;  3M05 A;  3MAA A;  4K4U A;  4DX6 A;  3GJT B;  1TKD A;  5EWG A;  1I6J A;  2XHW A;  2BE2 A;  1TR0 A;  1JJ2 R;  2WBM A;  3G8Q A;  1R0A A;  3A12 A;  4OYW A;  4IFD A;  2YWH A;  5AXK A;  2MKJ A;  4DPW A;  5JMN A;  1UJ6 A;  4P7T A;  3PRY A;  2CPZ A;  4FF3 A;  3LAM A;  2IMW P;  5DDR C;  2JSX A;  5F8M A;  1VCT A;  4LIR A;  2EFQ A;  2QT7 A;  2BOA A;  2V50 A;  3OTO J;  4LFA E;  2UV8 G;  4K8R A;  2Z57 B;  3ET6 B;  4UT4 A;  2VU5 A;  3NWR A;  2E5L J;  4DOZ A;  2UUB J;  2WB4 A;  3AOD A;  4J7C A;  1JWW A;  3NCQ A;  4WIQ A;  2Q2E B;  4ETZ A;  4JYA J;  2G2Y A;  4IYQ A;  1BHN A;  2W4D A;  1GEH A;  3J81 Q;  1TVR B;  4URG A;  4P6Q A