2VQEE

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2vqeE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqeE02
4HXZA 1XNQI 2V2QA 4I3HA 1GQEA 1H7SA 4JI0E 2R42A 2DEIA 3ZZUA 4LFCE 1KKHA 1HNXI 1WHNA 2DEJA 3QT6A 3HULA 4DR4E 1J5EE 4Z7CA 2CPNA 5GMDA 4ZVIA 4YHHI 3T1YI 2YT4A 1MG7A 4HY1A 4DUZI 1Z0BA 4LFBI 2X36A 4LF5I 4R1FA 1IBMI 4B3SI 1XNQE 2V2ZA 3ADJA 4DV6E 2BM1A 2RS6A 1ZBTA 4X65I 1N0VC 2E1RA 2UUAI 4GKJE 3V2UC 1UEKA 4JV5I 4DR3I 4DR1I 1HNXE 3WU3A 4MYUA 1HR0I 1H73A 1S4EA 3ADGA 4JI1I 1NHIA 4YHHE 4RPFA 3T1YE 5A2QC 3ZZTA 4DV2I 2HHHI 4LFBE 1KIJA 4LF5E 2DB2A 2XEXA 1Z5AA 4WFTA 1IBME 2L3CA 4DV1I 4JI3E 4X65E 2L2NA 3V5RA 4M30A 4FN5A 4JV5E 4LF9I 4DR3E 4DR1E 2RSMA 1HR0E 2UXCI 1S16A 2HK2A 2R3VA 4LFAI 1YYKA 4DU7A 1STUA 3B8HA 2MDRA 3J7AG 2HFSA 2CZ9A 2HHHE 2A2CA 4OOGC 1EA6A 2BV3A 1X49A 2UU9E 4NXNI 1BKNA 4HACB 4DV1E 3VYYA 3C4TA 2B7TA 4M2ZA 4DR2I 2UXBI 4YY3I 3J7Yp 4DPYA 4DPUA 5IT9Q 4DV5I 1N34I 3PYDA 4LF9E 4GKKI 1I94I 3J80C 5LMNI 2UXCE 3ZZ0A 4XTJA 4LFAE 2NUFA 4DKKA 2B7VA 3CWVA 3J81Q 1K47A 1O0WA 5BR8I 1XMOI 3PYEA 2AJ4A 1PVGA 2WW4A 1FWKA 4MYTA 4P52A 4UT4A 4NXNE 1ZXNA 5LMUI 4JI7E 4NXMI 2NUGA 3LNUA 4KQVA 2HKJA 4DR7I 4WUBA 4DR2E 2UXBE 4YY3E 1N36I 1N34E 1DI2A 4GKKE 3ZKBA 4DR5I 4AQYI 2HKEA 2UXDI 4LF8I 2VQFE 2ZBKB 3QT7A 5BR8E 4Z7YA 2V8PA 4FW9A 1T4NA 4JI8I 2LBSB 4P7AA 1FWLA 1NZ0A 5LMUE 1D6TA 1QZRA 3PYGA 2LUQA 4NXME 5FLXQ 2VQEI 4X66I 1PKPA 1HNWI 4PRXA 2LJHA 1Z0EA 4UTGA 4DR5E 4AQYE 2Q2EB 1XNRI 1RC7A 2UXDE 4DUZE 4X62I 4LF8E 3P1XA 3JAMC 2UUCI 1WUUA 2NUEA 1IBKI 4B3SE 2E5LI 4JI2I 2RS7A 1RREA 1XHKA 3QT8A 4JI8E 2LJPA 2B3TB 4DPTA 3WU5A 4JYAI 2UUAE 1H7UA 2L33A 2UUBI 3H4LA 1XMQI 1FI4A 2ZITA 4K0KI 2VQEE 4JI6I 1HNWE 2L3JA 1Z5CA 1NHJA 4JI1E 4LF6I 4DV2E 3LPSA 3T1HI 3VYXA 1XNRE 1OJ4A 1N33I 4X62E 5GMEA 4ED4A 4DPWA 1T4OA 3ADLA 2ZM6I 4JI4I 1RR9A 4HACA 2UUCE 1ELOA 1IBKE 1IBLI 5IWAI 4JI5I 3J80Q 1YZ9A 4DV0I 4WYQB 1Z0TA 5CFFE 4WUCA 1PIEA 4DV4I 1MX0A 4K0KE 4DU8A 2IHR1 1T4LB 4JI6E 2LTRA 2J7KA 4JI0I 4OX9I 4LFCI 4LF6E 4X8WA 3T1HE 2HK3A 1N33E 4FWDA 2V2VA 1FJGI 1RQ0A 3ADIA 1U2RA 4JI4E 4B3RI 1YYWA 1Z0GA 1IBLE 5IWAE 4JI5E 3LTOA 5IT9C 4DV0E 4FWHA 4PRVA 2JVAA 1HNZI 4DV5E 4DV4E 4DUYI 1I94E 3Q1QA 1WHQA 3QT5A 4DV6I 5LMNE 3J81C 4M1KA 2LTSA 4DXLA 5LL6R 4PU9A 4OX9E 4LF4I 4GKJI 1X48A 1KTVA 2DMYA 1ZM4A 1XMOE 3OTOI 1ZM9A 3F0NA 2GS8A 2JY9A 1FJGE 1UHZA 4DV7I 4B3RE 1Z0CA 2DIXA 3PYFA 3WU6A 4KHPI 2KHXA 5A2QQ 1EI1A 4X64I 4DR7E 1DARA 1H72C 4LF7I 3JAMQ 1N36E 1HNZE 4DUYE 3GONA 2NA2A 3HTXA 5L3JA 4JI3I 2NPFA 2X7IA 1J26A 1ZM2A 1X47A 4DV3I 4LF4E 3B82A 2HFUA 2LRSA 1QU6A 2F4VI 3OTOE 4DV7E 4B3TI 3J7AM 1Z0VA 2N3HA 2OI2A 3WU4A 5FLXC 1N0UA 1FNMA 2VF3A 3K1JA 2EFGA 4KHPE 3D4JA 4WUDA 1UILA 4X64E 1ZXMA 1Z5BA 2EZ6A 2UU9I 4X66E 1VISA 1B63A 4LF7E 4B3MI 1NHHA 1B62A 3B78A 1KVKA 3ZM7A 4URLA 3C4BA 3ZKDA 4FWGA 4DV3E 1YYOA 1Z0WA 1Z59A 4USKA 2V34A 2E5LE 2F4VE 4JI2E 1N32I 2RTXA 2A2DA 4DR6I 4B3TE 4JYAE 4USMA 2L2MA 2N3GA 1H74A 3M6AA 2UUBE 1XMQE 4DPXA 4B3ME 4JG4A 3LLHA 4DR4I 1FKAE 1J5EI 4JI7I 1A6FA 2LUPB 3K17A 4EMDA 2BM0A 2ZM6E 1MU5A 2L2KB 1EKZA 1ZM3A 1N32E 4DR6E 4HYMA 2VQFI
chains in the Genus database with same CATH superfamily
5A6BD 2CVEA 5K36B 4HXZA 1IMUA 1GTKA 1XNQI 4HEIA 1OYSA 2CGEA 2PNZA 2V2QA 2Z5CA 4I3HA 2R76A 1A1JA 5C0XB 4M9VC 2Z5BB 2YU5A 2BA0G 2EOYA 4F2JC 2YTOA 2WNRA 1GQEA 2JWOA 1H7SA 2BR2B 2NN6F 4F9AB 4JI0E 2MC6A 2DEIA 1WRJA 2R42A 3ZZUA 4LFCE 1KKHA 2H36X 2E1MA 1HNXI 1WHNA 4BHCA 4GEQB 2DEJA 3F6HA 3HULA 3QT6A 4DR4E 2FGGA 1J5EE 4Z7CA 4ZYGA 2PO2A 2CPNA 5GMDA 1BBGA 2DGCA 2YRHA 4ZVIA 4MDTA 5KL7A 4OO1D 2LT7A 4MU4A 2VE7C 4YHHI 4GZNC 2JXPA 2YWQA 3QG5C 2ENHA 4LTYA 3T1YI 2YT4A 1X3CA 4R2SA 1MG7A 1PJSA 4Q35B 4HY1A 4TUGA 1PJQA 1E3HA 1Z0BA 3OMLA 3B4TA 4DUZI 4LFBI 5C0XC 2X36A 4LF5I 2RQLA 1YUJA 4R1FA 1IBMI 4B3SI 5KL2A 1XNQE 2V2ZA 3ADJA 2EMKA 2HJJA 3THNA 4DV6E 1DGCA 2BM1A 3GMEA 2RS6A 3Q6NA 1USUA 2EPKX 5K36E 1ZBTA 4X65I 5AASA 4R2CA 1N0VC 2E1RA 2UUAI 5C0XE 4GKJE 3V2UC 1UEKA 4JV5I 3IWDA 4DR3I 5ELWA 1HNXE 3WU3A 4MYUA 4AIMA 4DR1I 4GQUA 1HR0I 2GO4A 2LCEA 1H73A 2EN7A 1S4EA 3ADGA 2VF1A 3KRNA 2YU8A 2DLKA 4JI1I 1NHIA 4YHHE 4RPFA 4ZYHA 4O4KA 3T1YE 5A2QC 3ZZTA 4DV2I 2O1VA 5KL6A 2ODRC 3MHSC 4R2DA 3HXLA 2HHHI 4IS1C 4LFBE 3DD6A 2EPMX 2V86A 1KIJA 4LF5E 2DB2A 3BBGA 2XEXA 1Z5AA 2V87A 4WFTA 1YHCA 5K36F 1IBME 2L3CA 2ELZA 2ELYA 2ODRD 4DV1I 5C0XF 4O24A 3GCMA 4JI3E 2L8TA 4LCHA 4LCFA 4X65E 2L2NA 3V5RA 1PJTA 5LLQA 4WXCA 4M30A 4FN5A 4JV5E 2WBTA 4DR3E 4LF9I 4DR1E 2EL5A 4MQYA 2RSMA 1A1LA 1HR0E 2UXCI 1S16A 2V89A 2HK2A 2M9AA 2R3VA 1UBDC 4O5GA 1YYKA 5AE3A 2EE8A 4FW4A 3PS2A 4DU7A 2BBGA 4LFAI 1STUA 2JR1A 2C37A 3LMLA 4FK5C 1JK1A 2EPOA 3B8HA 2C39B 2MDRA 1YH8A 2JE6B 4LPFA 2EMFA 1QNTA 3J7AG 2ADRA 5A6KA 2HFSA 2JOXA 4RHBB 1IQOA 2HHHE 2LVHA 1R6LA 4OOGC 1EA6A 2A2CA 2BV3A 2VESA 1X49A 4J8ZA 2EM7A 2UU9E 2YZTA 4NXNI 3PRYA 2CTDA 1LLMC 5AE2A 2EMIA 4RH8A 2JEBB 1BKNA 2EPRA 4HACB 2EN2A 5AE1A 1BBOA 3L7ZA 5KL3A 4MLQA 4DV1E 2YTJA 3VYYA 3C4TA 4O43A 2B7TA 4M2ZA 1AAYA 1YSAC 4BA2B 3PS3A 4DR2I 2UXBI 2EMCA 2GPIA 2J7JA 2YTPA 1WXRA 3J7Yp 4FW7A 4DPYA 4DPUA 3PYDA 1ZR9A 4LF9E 2WP8A 4DV5I 5DNYA 1N34I 1I94I 3J80C 4GKKI 5LMNI 2EL6A 4HTGA 2UXCE 2EMAA 2WCC3 2EPAA 2EOOA 2JP9A 4M0VA 3ZZ0A 4XTJA 4LFAE 2NUFA 4DKKA 4IFDA 2B7VA 3CWVA 3J81Q 2EOMA 2IOQA 1K47A 4BA1B 1O0WA 3EQ1A 5BR8I 2EPPA 1NEIA 1XMOI 4IS9A 2EM2A 2HGHA 3PYEA 2CZ9A 2AJ4A 2EOEA 1PVGA 1FWKA 2WW4A 2Z5BA 4WUDA 2EMWA 4MYTA 3IWCA 4WXDA 4R03A 1A1FA 4P52A 4OO1C 4UT4A 4NXNE 4AM3A 1ZU1A 2EOIA 2EOHA 4ZYEA 2WBSA 4N4RB 2EOZA 1ZXNA 3GLLA 4IFDE 3JTZA 5LMUI 2C38B 2MDGA 3BF2A 3MSWA 3FIGA 3F6GA 3U1YA 4R2QA 4JI7E 5DNLA 4NXMI 2NUGA 3LNUA 2EPZA 1F2IG 4KQVA 2HKJA 4DR7I 1GZ6A 4WUBA 1EH8A 4DR2E 2UXBE 4BCAA 4YY3E 1N36I 5DROA 2K7IA 1N34E 4BS9A 2EORA 4GKKE 1DI2A 4ISAA 3ZKBA 2DSYA 5IV8B 4DR5I 4F9CB 2Z5CB 2PNZB 2HKEA 4AQYI 3M85G 2YTNA 3IWBA 5JEAA 2UXDI 2V8QB 5T6JA 2EQ0A 1NCSA 4LF8I 2EMXA 2VQFE 2DLQA 2ZBKB 2A25A 5BR8E 3QT7A 2EL4A 2EMZA 4NZVA 2NABA 4Z7YA 1HK7A 1EH6A 3Q6MA 4P78A 5FWKA 2V8PA 3KZYA 2PO2B 3D4JA 4FW9A 1T4NA 2EMYA 4JI8I 1UDNA 1G2DC 2LBSB 4I8OA 4QNJA 1PDAA 4R2PA 5EKWA 4P7AA 1FWLA 1NZ0A 5LMUE 1Y4UA 3HPZA 1KYQA 3ECRA 2VRDA 2GO3A 5DRPA 1D6TA 4BMJA 1QZRA 4R2EA 2LUQA 4NXME 3PYGA 5FLXQ 2O1UA 4X66I 2VQEI 1PKPA 4MU0A 4OZEA 4PRXA 1HNWI 2LJHA 2DMIA 4IFDD 1Z0EA 2PNMA 2YTIA 1X6HA 4ZYDA 2V88A 4UTGA 4DR5E 4AQYE 2Q2EB 1XNRI 1RC7A 3P06A 1A1GA 2UXDE 4DUZE 3M7ND 4X62I 2PO1A 2EN6A 4LF8E 2G7HA 2YRKA 3P1XA 4YY3I 1WJPA 3JAMC 5A6JA 2NN6A 2UUCI 1WUUA 2K4VA 1X6EA 2YTFA 3KZZA 3EPJA 2N8XA 2NUEA 4B3SE 1TF6A 4IZJA 4QNKA 2IERA 1IBKI 2PO0A 3H1CA 3P3CA 4BHBA 4JI2I 2DRPA 2RS7A 1RREA 4R2AA 1XHKA 3QT8A 2LV2A 4JI8E 2LJPA 5JEAC 2B3TB 2EOJA 4LOMA 4DPTA 3WU5A 4JYAI 2UUAE 4OO1E 1H7UA 2CT1A 2L33A 3P3EA 2UUBI 3H4LA 1XMQI 1DQ3A 1UDQA 3VK6A 3HPSA 4J3DA 1FI4A 2ZITA 3C6MA 4WSGA 4K0KI 2VQEE 2MKNA 5JEAD 1HNWE 2L3JA 1Z5CA 4JI6I 2L6MA 1NHJA 2EM5A 4WX9A 4JI1E 3EPHA 2C39A 2J65A 3M99B 2EPCA 2EWLA 4LF6I 5KL5A 4DV2E 3LPSA 3T1HI 3VYXA 1XNRE 1T39A 1OJ4A 2EOQA 2EJ4A 2WZOA 1SFEA 1N33I 4X62E 5GMEA 2I13A 4ED4A 4DPWA 1T4OA 2EN3A 2YSOA 4TUIA 3ADLA 3HQ1A 2R1FA 2WBUA 2BA1D 2ZM6I 4JI4I 2F8BA 2JEBA 1RR9A 4HACA 2UUCE 3U1KA 2JEAB 2RSIA 1ELOA 1XXEA 1IBKE 1X6FA 1IBLI 5IWAI 4JI5I 2EMGA 2V83A 1UDSA 4IZKA 2KOUA 3J80Q 4OO1B 2EM9A 1YZ9A 2EOFA 3DF6A 4DV0I 2BB8A 1YUIA 2C37B 4WYQB 1Z0TA 1X5WA 5CFFE 2JPAA 4WUCA 1PIEA 4DV4I 4KWYA 2EN4A 1MEYC 1MX0A 4NHRA 3PS1A 2M4IA 2YTDA 2BA0D 1A1IA 4K0KE 4DU8A 5DRQA 2IHR1 1T4LB 4JI6E 2LTRA 2J7KA 2O3ZA 2EMLA 2I9IA 5IXMB 4JI0I 4OX9I 2FTXB 4LFCI 5K36A 3AUZA 4LF6E 2NN6D 2B9DA 4X8WA 3T1HE 2KONA 5C0XA 2HK3A 4IZJD 1N33E 2V2VA 4FWDA 1FJGI 2EOSA 1RQ0A 3ADIA 1U2RA 4FW5A 2BR2A 3BIDA 4BC9A 2EM6A 4JI4E 4B3RI 1YYWA 2LJUA 2C38A 2IOPA 1Z0GA 2WP8B 4LCGA 1IBLE 2ENCA 4OKGA 2M7QA 5IWAE 4JI5E 2EM0A 4X9JA 3LTOA 2EPUA 2GHFA 5IT9C 4DV0E 1EH7A 5KL4A 1T38A 4FWHA 3L00A 2FV4B 2JVAA 4PRVA 4DV5E 1HNZI 4DV4E 2IESA 4DUYI 1SR9A 1I94E 1WHQA 3Q1QA 3QT5A 3MHHC 4DV6I 5LMNE 2CG9A 3J81C 5IT9Q 2EP3A 4M1KA 2LTSA 1P42A 4DXLA 5LL6R 4PU9A 1P47A 2YTGA 5AC5A 4OX9E 3H09A 4BBYA 2WNRB 3UK3C 4LF4I 4GKJI 2EPXA 1X48A 1USVA 1TN9A 1KTVA 2DMYA 4Q28A 1ZM4A 4F54A 5EL9A 1IQSA 3KWRA 1XMOE 1UDOA 1Y60A 2Q8UA 3OTOI 1ZM9A 3F0NA 3P3GA 3AV0A 1BB8A 2YSPA 2GS8A 2JY9A 1FJGE 4KZSA 1UHZA 2V85A 4DV7I 5DRRA 3K6QA 4N3OA 2PO1B 4B3RE 2EMHA 2DIXA 5ADZA 1Z0CA 2EN8A 3CDJA 4IFDC 2JYAA 3PYFA 2EMBA 5K36C 3HJCA 1YPNA 4WSPA 1G2FC 3WU6A 4KHPI 2KHXA 5JEAB 5A2QQ 1EI1A 4OO1F 4X64I 3DJWA 4DMIA 4DR7E 2GLIA 1DARA 1H72C 4LF7I 3JAMQ 3RMPA 2LE2A 1N36E 1HNZE 4BC7A 4DUYE 3C6KA 1ZAAC 1RHYA 2NA2A 1OYRA 3GONA 1TF3A 3HTXA 5K36D 1YFHA 5L3JA 4JI3I 2NPFA 2L92A 2X7IA 1J26A 5C0XD 5DNXA 4F6NA 1ZM2A 1X47A 1RMDA 4DV3I 4L5NC 1AH5A 4LF4E 3B82A 2HFUA 1Y6ZA 2LRSA 1QU6A 4L8NA 4R8OA 2JT2A 3EPLA 4MU3A 2F4VI 3OTOE 2E72A 4LU9A 1A1HA 2JOBA 2AE8A 3JU0A 2RPCA 3K85A 4DV7E 4B3TI 3J7AM 3BGHA 1Z0VA 2PRTA 2N3HA 3P76A 3HKMA 2OI2A 2EM8A 5FLXC 2EM4A 3WU4A 4AIDA 1N0UA 1FNMA 2YPNA 2VF3A 2EFGA 4IJDA 3K1JA 2EOXA 4KHPE 2M1SA 1A1KA 4WPYA 4P7DA 1L4SA 1UILA 1ZBQA 5A6BA 4X64E 1Z5BA 2EZ6A 4F6MA 1E3PA 4X66E 1ZXMA 2UU9I 4IFDF 2NN6B 2HC5A 1VISA 1R6MA 1VI7A 4NBQA 1B63A 4LF7E 5JEAE 4B3MI 1NHHA 2JE6A 2CSHA 1B62A 3B78A 4IZJB 2F1DA 2PO0B 4U3BA 1KVKA 3ZM7A 1N3GA 3M7NG 2YTEA 4URLA 4U3DA 3C4BA 2GQ0A 3ZKDA 4FWGA 4DV3E 2JEAA 4R2RA 1YYOA 1Z0WA 3UHMA 1Z59A 1Z1BA 4USKA 2V34A 1MGTA 1B69A 2E5LE 2F4VE 2Z5EA 4JI2E 3THOB 4OO1A 5A6AA 1Y4SA 1N32I 2RTXA 4F9BB 2A2DA 2EQ1A 4DR6I 4B3TE 4BA2A 2YRMA 2PNLA 4JYAE 2D9HA 2EN1A 1Y5YA 2NN6C 4USMA 2L2MA 3VHTB 5AC4A 2N3GA 1H74A 2YTQA 2E5LI 3M6AA 2O1TA 2UUBE 1XMQE 5JEAF 2EPNA 2LO3A 5TSEA 2MC5A 4DPXA 3ZOQB 3NZKA 2ENAA 2MKDA 3EPKA 4BA1A 3TQMA 4B3ME 4JG4A 4MU1A 3LLHA 2EQ3A 1OYPA 4DR4I 1FKAE 4MLVA 3L7ZB 2LMZA 2NN6E 4IZKB 1J5EI 4JI7I 1A6FA 2LUPB 1KJKA 2O1WA 3K17A 1JK2A 1UN6B 2BA1G 2BM0A 3CDIA 4EMDA 2EPLX 2EM3A 4FW3A 2ZM6E 1MU5A 2L2KB 4FW6A 1EKZA 1ZM3A 3M85D 5A69A 1N32E 4DR6E 4HYMA 5F3WA 2VQFI 4IFDB
chains in the Genus database with same CATH topology
4HXZA 1XNQI 2CGEA 2Z5CA 2V2QA 4I3HA 2Z5BB 1GQEA 2JWOA 1H7SA 4F9AB 4JI0E 2MC6A 2DEIA 2R42A 3ZZUA 4LFCE 1KKHA 2H36X 2E1MA 1HNXI 1WHNA 2DEJA 4GEQB 3QT6A 3F6HA 3HULA 4DR4E 2FGGA 1J5EE 4Z7CA 2CPNA 5GMDA 4ZVIA 2VE7C 4YHHI 4LTYA 3T1YI 2YT4A 1MG7A 4HY1A 4TUGA 1Z0BA 4DUZI 3OMLA 4LFBI 2X36A 4LF5I 4R1FA 1IBMI 4B3SI 1XNQE 2V2ZA 3ADJA 4DV6E 2BM1A 2RS6A 3Q6NA 1USUA 1ZBTA 4X65I 5AASA 1N0VC 2E1RA 2UUAI 4GKJE 3V2UC 1UEKA 4JV5I 3IWDA 4DR3I 4DR1I 1HNXE 3WU3A 4MYUA 1HR0I 1H73A 1S4EA 3ADGA 2VF1A 4JI1I 1NHIA 4YHHE 4RPFA 3T1YE 5A2QC 3ZZTA 4DV2I 2O1VA 2ODRC 3HXLA 2HHHI 4LFBE 2V86A 1KIJA 4LF5E 2DB2A 2XEXA 1Z5AA 2V87A 4WFTA 1IBME 2L3CA 2ODRD 4DV1I 4JI3E 2L8TA 4X65E 2L2NA 3V5RA 4M30A 4FN5A 4JV5E 4LF9I 4DR3E 4DR1E 2RSMA 1HR0E 2UXCI 1S16A 2V89A 2HK2A 2R3VA 4LFAI 1YYKA 5AE3A 4DU7A 1STUA 2JR1A 3LMLA 3B8HA 2MDRA 3J7AG 2HFSA 2JOXA 2CZ9A 2HHHE 2A2CA 4OOGC 1EA6A 2BV3A 1X49A 4J8ZA 2UU9E 4NXNI 2YZTA 3PRYA 5AE2A 1BKNA 4HACB 5AE1A 4DV1E 3VYYA 3C4TA 2B7TA 4M2ZA 4DR2I 2UXBI 4YY3I 3J7Yp 4DPYA 1WXRA 4DPUA 5IT9Q 4DV5I 1N34I 3PYDA 4LF9E 4GKKI 1I94I 5DNYA 3J80C 5LMNI 2UXCE 4M0VA 3ZZ0A 4XTJA 4LFAE 2NUFA 4DKKA 2B7VA 3CWVA 3J81Q 2IOQA 1K47A 1O0WA 5BR8I 1XMOI 3PYEA 2AJ4A 1PVGA 2WW4A 1FWKA 2Z5BA 4MYTA 3IWCA 4R03A 4P52A 4UT4A 4NXNE 1ZXNA 3JTZA 5LMUI 3MSWA 3FIGA 3F6GA 4JI7E 4NXMI 2NUGA 3LNUA 4KQVA 2HKJA 4DR7I 1GZ6A 4WUBA 4DR2E 2UXBE 4BCAA 4YY3E 1N36I 1N34E 4BS9A 1DI2A 4GKKE 3ZKBA 4DR5I 4AQYI 2DSYA 4F9CB 2Z5CB 2HKEA 3IWBA 2UXDI 2V8QB 5T6JA 4LF8I 2VQFE 2ZBKB 3QT7A 5BR8E 4Z7YA 1HK7A 3Q6MA 4P78A 5FWKA 2V8PA 4FW9A 1T4NA 4JI8I 2LBSB 4I8OA 4P7AA 1FWLA 1NZ0A 5LMUE 1Y4UA 3HPZA 1D6TA 4BMJA 1QZRA 3PYGA 2LUQA 4NXME 5FLXQ 2O1UA 4X66I 2VQEI 1PKPA 1HNWI 4PRXA 2LJHA 1Z0EA 2PNMA 2V88A 4UTGA 4DR5E 4AQYE 2Q2EB 1XNRI 1RC7A 3P06A 2UXDE 4DUZE 4X62I 4LF8E 2G7HA 3P1XA 3JAMC 2UUCI 1WUUA 2K4VA 4IZJA 2NUEA 1IBKI 4B3SE 2E5LI 4JI2I 2RS7A 1RREA 1XHKA 3QT8A 4JI8E 2LJPA 2B3TB 4DPTA 3WU5A 4JYAI 2UUAE 1H7UA 2L33A 2UUBI 3H4LA 1XMQI 1DQ3A 3VK6A 3HPSA 1FI4A 2ZITA 4K0KI 2VQEE 4JI6I 1HNWE 2L3JA 1Z5CA 2L6MA 1NHJA 4JI1E 2EWLA 4LF6I 4DV2E 3LPSA 3T1HI 3VYXA 1XNRE 1OJ4A 2WZOA 1N33I 4X62E 5GMEA 4ED4A 4DPWA 1T4OA 3ADLA 4TUIA 3HQ1A 2ZM6I 4JI4I 2F8BA 1RR9A 4HACA 2UUCE 1ELOA 1IBKE 1IBLI 5IWAI 4JI5I 4IZKA 2V83A 2KOUA 3J80Q 1YZ9A 3DF6A 4DV0I 4WYQB 1Z0TA 5CFFE 4WUCA 1PIEA 4DV4I 1MX0A 2M4IA 4K0KE 4DU8A 2IHR1 1T4LB 4JI6E 2LTRA 2J7KA 4JI0I 4OX9I 2FTXB 4LFCI 3AUZA 4LF6E 2B9DA 4X8WA 3T1HE 2KONA 2HK3A 4IZJD 1N33E 2V2VA 4FWDA 1FJGI 1RQ0A 3ADIA 1U2RA 4BC9A 4JI4E 4B3RI 1YYWA 2IOPA 1Z0GA 1IBLE 2M7QA 5IWAE 4JI5E 3LTOA 5IT9C 4DV0E 4FWHA 2FV4B 2JVAA 4PRVA 4DV5E 1HNZI 4DV4E 4DUYI 1SR9A 1I94E 1WHQA 3Q1QA 3QT5A 4DV6I 5LMNE 2CG9A 3J81C 4M1KA 2LTSA 4DXLA 5LL6R 4PU9A 4OX9E 3H09A 4BBYA 4LF4I 4GKJI 1X48A 1USVA 1KTVA 2DMYA 4Q28A 1ZM4A 4F54A 3KWRA 1XMOE 3OTOI 1ZM9A 3F0NA 3AV0A 2GS8A 2JY9A 1FJGE 4KZSA 1UHZA 2V85A 4DV7I 3K6QA 4N3OA 4B3RE 1Z0CA 5ADZA 2DIXA 3PYFA 3HJCA 4WSPA 3WU6A 4KHPI 2KHXA 5A2QQ 1EI1A 4X64I 3DJWA 4DMIA 4DR7E 1DARA 1H72C 4LF7I 3JAMQ 3RMPA 2LE2A 1N36E 1HNZE 4BC7A 4DUYE 3GONA 2NA2A 3HTXA 5L3JA 4JI3I 2NPFA 2L92A 2X7IA 1J26A 1ZM2A 1X47A 4DV3I 4L5NC 4LF4E 3B82A 2HFUA 1Y6ZA 2LRSA 1QU6A 4L8NA 4R8OA 2F4VI 3OTOE 4LU9A 2JOBA 3JU0A 3K85A 4DV7E 4B3TI 3J7AM 1Z0VA 2N3HA 2OI2A 3WU4A 5FLXC 1N0UA 1FNMA 2VF3A 3K1JA 2EFGA 4KHPE 2M1SA 3D4JA 4WPYA 4P7DA 4WUDA 1UILA 1ZBQA 4X64E 1Z5BA 1ZXMA 2EZ6A 2UU9I 4X66E 1VISA 1B63A 4LF7E 4B3MI 1NHHA 1B62A 3B78A 4IZJB 1KVKA 3ZM7A 4URLA 3C4BA 2GQ0A 3ZKDA 4FWGA 4DV3E 1YYOA 1Z0WA 1Z59A 4USKA 2V34A 2E5LE 2F4VE 2Z5EA 4JI2E 1Y4SA 1N32I 2RTXA 4F9BB 2A2DA 4DR6I 4B3TE 2PNLA 4JYAE 4USMA 2L2MA 2N3GA 1H74A 3M6AA 2O1TA 2UUBE 1XMQE 4DPXA 2MC5A 3ZOQB 4B3ME 4JG4A 3LLHA 4DR4I 1FKAE 4IZKB 2LMZA 1J5EI 4JI7I 1A6FA 2LUPB 2O1WA 3K17A 4EMDA 2BM0A 2ZM6E 1MU5A 2L2KB 1EKZA 1ZM3A 1N32E 4DR6E 4HYMA 5F3WA 2VQFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXZ A;  1XNQ I;  2V2Q A;  4I3H A;  1GQE A;  1H7S A;  4JI0 E;  2R42 A;  2DEI A;  3ZZU A;  4LFC E;  1KKH A;  1HNX I;  1WHN A;  2DEJ A;  3QT6 A;  3HUL A;  4DR4 E;  1J5E E;  4Z7C A;  2CPN A;  5GMD A;  4ZVI A;  4YHH I;  3T1Y I;  2YT4 A;  1MG7 A;  4HY1 A;  4DUZ I;  1Z0B A;  4LFB I;  2X36 A;  4LF5 I;  4R1F A;  1IBM I;  4B3S I;  1XNQ E;  2V2Z A;  3ADJ A;  4DV6 E;  2BM1 A;  2RS6 A;  1ZBT A;  4X65 I;  1N0V C;  2E1R A;  2UUA I;  4GKJ E;  3V2U C;  1UEK A;  4JV5 I;  4DR3 I;  4DR1 I;  1HNX E;  3WU3 A;  4MYU A;  1HR0 I;  1H73 A;  1S4E A;  3ADG A;  4JI1 I;  1NHI A;  4YHH E;  4RPF A;  3T1Y E;  5A2Q C;  3ZZT A;  4DV2 I;  2HHH I;  4LFB E;  1KIJ A;  4LF5 E;  2DB2 A;  2XEX A;  1Z5A A;  4WFT A;  1IBM E;  2L3C A;  4DV1 I;  4JI3 E;  4X65 E;  2L2N A;  3V5R A;  4M30 A;  4FN5 A;  4JV5 E;  4LF9 I;  4DR3 E;  4DR1 E;  2RSM A;  1HR0 E;  2UXC I;  1S16 A;  2HK2 A;  2R3V A;  4LFA I;  1YYK A;  4DU7 A;  1STU A;  3B8H A;  2MDR A;  3J7A G;  2HFS A;  2CZ9 A;  2HHH E;  2A2C A;  4OOG C;  1EA6 A;  2BV3 A;  1X49 A;  2UU9 E;  4NXN I;  1BKN A;  4HAC B;  4DV1 E;  3VYY A;  3C4T A;  2B7T A;  4M2Z A;  4DR2 I;  2UXB I;  4YY3 I;  3J7Y p;  4DPY A;  4DPU A;  5IT9 Q;  4DV5 I;  1N34 I;  3PYD A;  4LF9 E;  4GKK I;  1I94 I;  3J80 C;  5LMN I;  2UXC E;  3ZZ0 A;  4XTJ A;  4LFA E;  2NUF A;  4DKK A;  2B7V A;  3CWV A;  3J81 Q;  1K47 A;  1O0W A;  5BR8 I;  1XMO I;  3PYE A;  2AJ4 A;  1PVG A;  2WW4 A;  1FWK A;  4MYT A;  4P52 A;  4UT4 A;  4NXN E;  1ZXN A;  5LMU I;  4JI7 E;  4NXM I;  2NUG A;  3LNU A;  4KQV A;  2HKJ A;  4DR7 I;  4WUB A;  4DR2 E;  2UXB E;  4YY3 E;  1N36 I;  1N34 E;  1DI2 A;  4GKK E;  3ZKB A;  4DR5 I;  4AQY I;  2HKE A;  2UXD I;  4LF8 I;  2VQF E;  2ZBK B;  3QT7 A;  5BR8 E;  4Z7Y A;  2V8P A;  4FW9 A;  1T4N A;  4JI8 I;  2LBS B;  4P7A A;  1FWL A;  1NZ0 A;  5LMU E;  1D6T A;  1QZR A;  3PYG A;  2LUQ A;  4NXM E;  5FLX Q;  2VQE I;  4X66 I;  1PKP A;  1HNW I;  4PRX A;  2LJH A;  1Z0E A;  4UTG A;  4DR5 E;  4AQY E;  2Q2E B;  1XNR I;  1RC7 A;  2UXD E;  4DUZ E;  4X62 I;  4LF8 E;  3P1X A;  3JAM C;  2UUC I;  1WUU A;  2NUE A;  1IBK I;  4B3S E;  2E5L I;  4JI2 I;  2RS7 A;  1RRE A;  1XHK A;  3QT8 A;  4JI8 E;  2LJP A;  2B3T B;  4DPT A;  3WU5 A;  4JYA I;  2UUA E;  1H7U A;  2L33 A;  2UUB I;  3H4L A;  1XMQ I;  1FI4 A;  2ZIT A;  4K0K I;  2VQE E;  4JI6 I;  1HNW E;  2L3J A;  1Z5C A;  1NHJ A;  4JI1 E;  4LF6 I;  4DV2 E;  3LPS A;  3T1H I;  3VYX A;  1XNR E;  1OJ4 A;  1N33 I;  4X62 E;  5GME A;  4ED4 A;  4DPW A;  1T4O A;  3ADL A;  2ZM6 I;  4JI4 I;  1RR9 A;  4HAC A;  2UUC E;  1ELO A;  1IBK E;  1IBL I;  5IWA I;  4JI5 I;  3J80 Q;  1YZ9 A;  4DV0 I;  4WYQ B;  1Z0T A;  5CFF E;  4WUC A;  1PIE A;  4DV4 I;  1MX0 A;  4K0K E;  4DU8 A;  2IHR 1;  1T4L B;  4JI6 E;  2LTR A;  2J7K A;  4JI0 I;  4OX9 I;  4LFC I;  4LF6 E;  4X8W A;  3T1H E;  2HK3 A;  1N33 E;  4FWD A;  2V2V A;  1FJG I;  1RQ0 A;  3ADI A;  1U2R A;  4JI4 E;  4B3R I;  1YYW A;  1Z0G A;  1IBL E;  5IWA E;  4JI5 E;  3LTO A;  5IT9 C;  4DV0 E;  4FWH A;  4PRV A;  2JVA A;  1HNZ I;  4DV5 E;  4DV4 E;  4DUY I;  1I94 E;  3Q1Q A;  1WHQ A;  3QT5 A;  4DV6 I;  5LMN E;  3J81 C;  4M1K A;  2LTS A;  4DXL A;  5LL6 R;  4PU9 A;  4OX9 E;  4LF4 I;  4GKJ I;  1X48 A;  1KTV A;  2DMY A;  1ZM4 A;  1XMO E;  3OTO I;  1ZM9 A;  3F0N A;  2GS8 A;  2JY9 A;  1FJG E;  1UHZ A;  4DV7 I;  4B3R E;  1Z0C A;  2DIX A;  3PYF A;  3WU6 A;  4KHP I;  2KHX A;  5A2Q Q;  1EI1 A;  4X64 I;  4DR7 E;  1DAR A;  1H72 C;  4LF7 I;  3JAM Q;  1N36 E;  1HNZ E;  4DUY E;  3GON A;  2NA2 A;  3HTX A;  5L3J A;  4JI3 I;  2NPF A;  2X7I A;  1J26 A;  1ZM2 A;  1X47 A;  4DV3 I;  4LF4 E;  3B82 A;  2HFU A;  2LRS A;  1QU6 A;  2F4V I;  3OTO E;  4DV7 E;  4B3T I;  3J7A M;  1Z0V A;  2N3H A;  2OI2 A;  3WU4 A;  5FLX C;  1N0U A;  1FNM A;  2VF3 A;  3K1J A;  2EFG A;  4KHP E;  3D4J A;  4WUD A;  1UIL A;  4X64 E;  1ZXM A;  1Z5B A;  2EZ6 A;  2UU9 I;  4X66 E;  1VIS A;  1B63 A;  4LF7 E;  4B3M I;  1NHH A;  1B62 A;  3B78 A;  1KVK A;  3ZM7 A;  4URL A;  3C4B A;  3ZKD A;  4FWG A;  4DV3 E;  1YYO A;  1Z0W A;  1Z59 A;  4USK A;  2V34 A;  2E5L E;  2F4V E;  4JI2 E;  1N32 I;  2RTX A;  2A2D A;  4DR6 I;  4B3T E;  4JYA E;  4USM A;  2L2M A;  2N3G A;  1H74 A;  3M6A A;  2UUB E;  1XMQ E;  4DPX A;  4B3M E;  4JG4 A;  3LLH A;  4DR4 I;  1FKA E;  1J5E I;  4JI7 I;  1A6F A;  2LUP B;  3K17 A;  4EMD A;  2BM0 A;  2ZM6 E;  1MU5 A;  2L2K B;  1EKZ A;  1ZM3 A;  1N32 E;  4DR6 E;  4HYM A;  2VQF I; 
#chains in the Genus database with same CATH topology
 5A6B D;  2CVE A;  5K36 B;  4HXZ A;  1IMU A;  1GTK A;  1XNQ I;  4HEI A;  1OYS A;  2CGE A;  2PNZ A;  2V2Q A;  2Z5C A;  4I3H A;  2R76 A;  1A1J A;  5C0X B;  4M9V C;  2Z5B B;  2YU5 A;  2BA0 G;  2EOY A;  4F2J C;  2YTO A;  2WNR A;  1GQE A;  2JWO A;  1H7S A;  2BR2 B;  2NN6 F;  4F9A B;  4JI0 E;  2MC6 A;  2DEI A;  1WRJ A;  2R42 A;  3ZZU A;  4LFC E;  1KKH A;  2H36 X;  2E1M A;  1HNX I;  1WHN A;  4BHC A;  4GEQ B;  2DEJ A;  3F6H A;  3HUL A;  3QT6 A;  4DR4 E;  2FGG A;  1J5E E;  4Z7C A;  4ZYG A;  2PO2 A;  2CPN A;  5GMD A;  1BBG A;  2DGC A;  2YRH A;  4ZVI A;  4MDT A;  5KL7 A;  4OO1 D;  2LT7 A;  4MU4 A;  2VE7 C;  4YHH I;  4GZN C;  2JXP A;  2YWQ A;  3QG5 C;  2ENH A;  4LTY A;  3T1Y I;  2YT4 A;  1X3C A;  4R2S A;  1MG7 A;  1PJS A;  4Q35 B;  4HY1 A;  4TUG A;  1PJQ A;  1E3H A;  1Z0B A;  3OML A;  3B4T A;  4DUZ I;  4LFB I;  5C0X C;  2X36 A;  4LF5 I;  2RQL A;  1YUJ A;  4R1F A;  1IBM I;  4B3S I;  5KL2 A;  1XNQ E;  2V2Z A;  3ADJ A;  2EMK A;  2HJJ A;  3THN A;  4DV6 E;  1DGC A;  2BM1 A;  3GME A;  2RS6 A;  3Q6N A;  1USU A;  2EPK X;  5K36 E;  1ZBT A;  4X65 I;  5AAS A;  4R2C A;  1N0V C;  2E1R A;  2UUA I;  5C0X E;  4GKJ E;  3V2U C;  1UEK A;  4JV5 I;  3IWD A;  4DR3 I;  5ELW A;  1HNX E;  3WU3 A;  4MYU A;  4AIM A;  4DR1 I;  4GQU A;  1HR0 I;  2GO4 A;  2LCE A;  1H73 A;  2EN7 A;  1S4E A;  3ADG A;  2VF1 A;  3KRN A;  2YU8 A;  2DLK A;  4JI1 I;  1NHI A;  4YHH E;  4RPF A;  4ZYH A;  4O4K A;  3T1Y E;  5A2Q C;  3ZZT A;  4DV2 I;  2O1V A;  5KL6 A;  2ODR C;  3MHS C;  4R2D A;  3HXL A;  2HHH I;  4IS1 C;  4LFB E;  3DD6 A;  2EPM X;  2V86 A;  1KIJ A;  4LF5 E;  2DB2 A;  3BBG A;  2XEX A;  1Z5A A;  2V87 A;  4WFT A;  1YHC A;  5K36 F;  1IBM E;  2L3C A;  2ELZ A;  2ELY A;  2ODR D;  4DV1 I;  5C0X F;  4O24 A;  3GCM A;  4JI3 E;  2L8T A;  4LCH A;  4LCF A;  4X65 E;  2L2N A;  3V5R A;  1PJT A;  5LLQ A;  4WXC A;  4M30 A;  4FN5 A;  4JV5 E;  2WBT A;  4DR3 E;  4LF9 I;  4DR1 E;  2EL5 A;  4MQY A;  2RSM A;  1A1L A;  1HR0 E;  2UXC I;  1S16 A;  2V89 A;  2HK2 A;  2M9A A;  2R3V A;  1UBD C;  4O5G A;  1YYK A;  5AE3 A;  2EE8 A;  4FW4 A;  3PS2 A;  4DU7 A;  2BBG A;  4LFA I;  1STU A;  2JR1 A;  2C37 A;  3LML A;  4FK5 C;  1JK1 A;  2EPO A;  3B8H A;  2C39 B;  2MDR A;  1YH8 A;  2JE6 B;  4LPF A;  2EMF A;  1QNT A;  3J7A G;  2ADR A;  5A6K A;  2HFS A;  2JOX A;  4RHB B;  1IQO A;  2HHH E;  2LVH A;  1R6L A;  4OOG C;  1EA6 A;  2A2C A;  2BV3 A;  2VES A;  1X49 A;  4J8Z A;  2EM7 A;  2UU9 E;  2YZT A;  4NXN I;  3PRY A;  2CTD A;  1LLM C;  5AE2 A;  2EMI A;  4RH8 A;  2JEB B;  1BKN A;  2EPR A;  4HAC B;  2EN2 A;  5AE1 A;  1BBO A;  3L7Z A;  5KL3 A;  4MLQ A;  4DV1 E;  2YTJ A;  3VYY A;  3C4T A;  4O43 A;  2B7T A;  4M2Z A;  1AAY A;  1YSA C;  4BA2 B;  3PS3 A;  4DR2 I;  2UXB I;  2EMC A;  2GPI A;  2J7J A;  2YTP A;  1WXR A;  3J7Y p;  4FW7 A;  4DPY A;  4DPU A;  3PYD A;  1ZR9 A;  4LF9 E;  2WP8 A;  4DV5 I;  5DNY A;  1N34 I;  1I94 I;  3J80 C;  4GKK I;  5LMN I;  2EL6 A;  4HTG A;  2UXC E;  2EMA A;  2WCC 3;  2EPA A;  2EOO A;  2JP9 A;  4M0V A;  3ZZ0 A;  4XTJ A;  4LFA E;  2NUF A;  4DKK A;  4IFD A;  2B7V A;  3CWV A;  3J81 Q;  2EOM A;  2IOQ A;  1K47 A;  4BA1 B;  1O0W A;  3EQ1 A;  5BR8 I;  2EPP A;  1NEI A;  1XMO I;  4IS9 A;  2EM2 A;  2HGH A;  3PYE A;  2CZ9 A;  2AJ4 A;  2EOE A;  1PVG A;  1FWK A;  2WW4 A;  2Z5B A;  4WUD A;  2EMW A;  4MYT A;  3IWC A;  4WXD A;  4R03 A;  1A1F A;  4P52 A;  4OO1 C;  4UT4 A;  4NXN E;  4AM3 A;  1ZU1 A;  2EOI A;  2EOH A;  4ZYE A;  2WBS A;  4N4R B;  2EOZ A;  1ZXN A;  3GLL A;  4IFD E;  3JTZ A;  5LMU I;  2C38 B;  2MDG A;  3BF2 A;  3MSW A;  3FIG A;  3F6G A;  3U1Y A;  4R2Q A;  4JI7 E;  5DNL A;  4NXM I;  2NUG A;  3LNU A;  2EPZ A;  1F2I G;  4KQV A;  2HKJ A;  4DR7 I;  1GZ6 A;  4WUB A;  1EH8 A;  4DR2 E;  2UXB E;  4BCA A;  4YY3 E;  1N36 I;  5DRO A;  2K7I A;  1N34 E;  4BS9 A;  2EOR A;  4GKK E;  1DI2 A;  4ISA A;  3ZKB A;  2DSY A;  5IV8 B;  4DR5 I;  4F9C B;  2Z5C B;  2PNZ B;  2HKE A;  4AQY I;  3M85 G;  2YTN A;  3IWB A;  5JEA A;  2UXD I;  2V8Q B;  5T6J A;  2EQ0 A;  1NCS A;  4LF8 I;  2EMX A;  2VQF E;  2DLQ A;  2ZBK B;  2A25 A;  5BR8 E;  3QT7 A;  2EL4 A;  2EMZ A;  4NZV A;  2NAB A;  4Z7Y A;  1HK7 A;  1EH6 A;  3Q6M A;  4P78 A;  5FWK A;  2V8P A;  3KZY A;  2PO2 B;  3D4J A;  4FW9 A;  1T4N A;  2EMY A;  4JI8 I;  1UDN A;  1G2D C;  2LBS B;  4I8O A;  4QNJ A;  1PDA A;  4R2P A;  5EKW A;  4P7A A;  1FWL A;  1NZ0 A;  5LMU E;  1Y4U A;  3HPZ A;  1KYQ A;  3ECR A;  2VRD A;  2GO3 A;  5DRP A;  1D6T A;  4BMJ A;  1QZR A;  4R2E A;  2LUQ A;  4NXM E;  3PYG A;  5FLX Q;  2O1U A;  4X66 I;  2VQE I;  1PKP A;  4MU0 A;  4OZE A;  4PRX A;  1HNW I;  2LJH A;  2DMI A;  4IFD D;  1Z0E A;  2PNM A;  2YTI A;  1X6H A;  4ZYD A;  2V88 A;  4UTG A;  4DR5 E;  4AQY E;  2Q2E B;  1XNR I;  1RC7 A;  3P06 A;  1A1G A;  2UXD E;  4DUZ E;  3M7N D;  4X62 I;  2PO1 A;  2EN6 A;  4LF8 E;  2G7H A;  2YRK A;  3P1X A;  4YY3 I;  1WJP A;  3JAM C;  5A6J A;  2NN6 A;  2UUC I;  1WUU A;  2K4V A;  1X6E A;  2YTF A;  3KZZ A;  3EPJ A;  2N8X A;  2NUE A;  4B3S E;  1TF6 A;  4IZJ A;  4QNK A;  2IER A;  1IBK I;  2PO0 A;  3H1C A;  3P3C A;  4BHB A;  4JI2 I;  2DRP A;  2RS7 A;  1RRE A;  4R2A A;  1XHK A;  3QT8 A;  2LV2 A;  4JI8 E;  2LJP A;  5JEA C;  2B3T B;  2EOJ A;  4LOM A;  4DPT A;  3WU5 A;  4JYA I;  2UUA E;  4OO1 E;  1H7U A;  2CT1 A;  2L33 A;  3P3E A;  2UUB I;  3H4L A;  1XMQ I;  1DQ3 A;  1UDQ A;  3VK6 A;  3HPS A;  4J3D A;  1FI4 A;  2ZIT A;  3C6M A;  4WSG A;  4K0K I;  2VQE E;  2MKN A;  5JEA D;  1HNW E;  2L3J A;  1Z5C A;  4JI6 I;  2L6M A;  1NHJ A;  2EM5 A;  4WX9 A;  4JI1 E;  3EPH A;  2C39 A;  2J65 A;  3M99 B;  2EPC A;  2EWL A;  4LF6 I;  5KL5 A;  4DV2 E;  3LPS A;  3T1H I;  3VYX A;  1XNR E;  1T39 A;  1OJ4 A;  2EOQ A;  2EJ4 A;  2WZO A;  1SFE A;  1N33 I;  4X62 E;  5GME A;  2I13 A;  4ED4 A;  4DPW A;  1T4O A;  2EN3 A;  2YSO A;  4TUI A;  3ADL A;  3HQ1 A;  2R1F A;  2WBU A;  2BA1 D;  2ZM6 I;  4JI4 I;  2F8B A;  2JEB A;  1RR9 A;  4HAC A;  2UUC E;  3U1K A;  2JEA B;  2RSI A;  1ELO A;  1XXE A;  1IBK E;  1X6F A;  1IBL I;  5IWA I;  4JI5 I;  2EMG A;  2V83 A;  1UDS A;  4IZK A;  2KOU A;  3J80 Q;  4OO1 B;  2EM9 A;  1YZ9 A;  2EOF A;  3DF6 A;  4DV0 I;  2BB8 A;  1YUI A;  2C37 B;  4WYQ B;  1Z0T A;  1X5W A;  5CFF E;  2JPA A;  4WUC A;  1PIE A;  4DV4 I;  4KWY A;  2EN4 A;  1MEY C;  1MX0 A;  4NHR A;  3PS1 A;  2M4I A;  2YTD A;  2BA0 D;  1A1I A;  4K0K E;  4DU8 A;  5DRQ A;  2IHR 1;  1T4L B;  4JI6 E;  2LTR A;  2J7K A;  2O3Z A;  2EML A;  2I9I A;  5IXM B;  4JI0 I;  4OX9 I;  2FTX B;  4LFC I;  5K36 A;  3AUZ A;  4LF6 E;  2NN6 D;  2B9D A;  4X8W A;  3T1H E;  2KON A;  5C0X A;  2HK3 A;  4IZJ D;  1N33 E;  2V2V A;  4FWD A;  1FJG I;  2EOS A;  1RQ0 A;  3ADI A;  1U2R A;  4FW5 A;  2BR2 A;  3BID A;  4BC9 A;  2EM6 A;  4JI4 E;  4B3R I;  1YYW A;  2LJU A;  2C38 A;  2IOP A;  1Z0G A;  2WP8 B;  4LCG A;  1IBL E;  2ENC A;  4OKG A;  2M7Q A;  5IWA E;  4JI5 E;  2EM0 A;  4X9J A;  3LTO A;  2EPU A;  2GHF A;  5IT9 C;  4DV0 E;  1EH7 A;  5KL4 A;  1T38 A;  4FWH A;  3L00 A;  2FV4 B;  2JVA A;  4PRV A;  4DV5 E;  1HNZ I;  4DV4 E;  2IES A;  4DUY I;  1SR9 A;  1I94 E;  1WHQ A;  3Q1Q A;  3QT5 A;  3MHH C;  4DV6 I;  5LMN E;  2CG9 A;  3J81 C;  5IT9 Q;  2EP3 A;  4M1K A;  2LTS A;  1P42 A;  4DXL A;  5LL6 R;  4PU9 A;  1P47 A;  2YTG A;  5AC5 A;  4OX9 E;  3H09 A;  4BBY A;  2WNR B;  3UK3 C;  4LF4 I;  4GKJ I;  2EPX A;  1X48 A;  1USV A;  1TN9 A;  1KTV A;  2DMY A;  4Q28 A;  1ZM4 A;  4F54 A;  5EL9 A;  1IQS A;  3KWR A;  1XMO E;  1UDO A;  1Y60 A;  2Q8U A;  3OTO I;  1ZM9 A;  3F0N A;  3P3G A;  3AV0 A;  1BB8 A;  2YSP A;  2GS8 A;  2JY9 A;  1FJG E;  4KZS A;  1UHZ A;  2V85 A;  4DV7 I;  5DRR A;  3K6Q A;  4N3O A;  2PO1 B;  4B3R E;  2EMH A;  2DIX A;  5ADZ A;  1Z0C A;  2EN8 A;  3CDJ A;  4IFD C;  2JYA A;  3PYF A;  2EMB A;  5K36 C;  3HJC A;  1YPN A;  4WSP A;  1G2F C;  3WU6 A;  4KHP I;  2KHX A;  5JEA B;  5A2Q Q;  1EI1 A;  4OO1 F;  4X64 I;  3DJW A;  4DMI A;  4DR7 E;  2GLI A;  1DAR A;  1H72 C;  4LF7 I;  3JAM Q;  3RMP A;  2LE2 A;  1N36 E;  1HNZ E;  4BC7 A;  4DUY E;  3C6K A;  1ZAA C;  1RHY A;  2NA2 A;  1OYR A;  3GON A;  1TF3 A;  3HTX A;  5K36 D;  1YFH A;  5L3J A;  4JI3 I;  2NPF A;  2L92 A;  2X7I A;  1J26 A;  5C0X D;  5DNX A;  4F6N A;  1ZM2 A;  1X47 A;  1RMD A;  4DV3 I;  4L5N C;  1AH5 A;  4LF4 E;  3B82 A;  2HFU A;  1Y6Z A;  2LRS A;  1QU6 A;  4L8N A;  4R8O A;  2JT2 A;  3EPL A;  4MU3 A;  2F4V I;  3OTO E;  2E72 A;  4LU9 A;  1A1H A;  2JOB A;  2AE8 A;  3JU0 A;  2RPC A;  3K85 A;  4DV7 E;  4B3T I;  3J7A M;  3BGH A;  1Z0V A;  2PRT A;  2N3H A;  3P76 A;  3HKM A;  2OI2 A;  2EM8 A;  5FLX C;  2EM4 A;  3WU4 A;  4AID A;  1N0U A;  1FNM A;  2YPN A;  2VF3 A;  2EFG A;  4IJD A;  3K1J A;  2EOX A;  4KHP E;  2M1S A;  1A1K A;  4WPY A;  4P7D A;  1L4S A;  1UIL A;  1ZBQ A;  5A6B A;  4X64 E;  1Z5B A;  2EZ6 A;  4F6M A;  1E3P A;  4X66 E;  1ZXM A;  2UU9 I;  4IFD F;  2NN6 B;  2HC5 A;  1VIS A;  1R6M A;  1VI7 A;  4NBQ A;  1B63 A;  4LF7 E;  5JEA E;  4B3M I;  1NHH A;  2JE6 A;  2CSH A;  1B62 A;  3B78 A;  4IZJ B;  2F1D A;  2PO0 B;  4U3B A;  1KVK A;  3ZM7 A;  1N3G A;  3M7N G;  2YTE A;  4URL A;  4U3D A;  3C4B A;  2GQ0 A;  3ZKD A;  4FWG A;  4DV3 E;  2JEA A;  4R2R A;  1YYO A;  1Z0W A;  3UHM A;  1Z59 A;  1Z1B A;  4USK A;  2V34 A;  1MGT A;  1B69 A;  2E5L E;  2F4V E;  2Z5E A;  4JI2 E;  3THO B;  4OO1 A;  5A6A A;  1Y4S A;  1N32 I;  2RTX A;  4F9B B;  2A2D A;  2EQ1 A;  4DR6 I;  4B3T E;  4BA2 A;  2YRM A;  2PNL A;  4JYA E;  2D9H A;  2EN1 A;  1Y5Y A;  2NN6 C;  4USM A;  2L2M A;  3VHT B;  5AC4 A;  2N3G A;  1H74 A;  2YTQ A;  2E5L I;  3M6A A;  2O1T A;  2UUB E;  1XMQ E;  5JEA F;  2EPN A;  2LO3 A;  5TSE A;  2MC5 A;  4DPX A;  3ZOQ B;  3NZK A;  2ENA A;  2MKD A;  3EPK A;  4BA1 A;  3TQM A;  4B3M E;  4JG4 A;  4MU1 A;  3LLH A;  2EQ3 A;  1OYP A;  4DR4 I;  1FKA E;  4MLV A;  3L7Z B;  2LMZ A;  2NN6 E;  4IZK B;  1J5E I;  4JI7 I;  1A6F A;  2LUP B;  1KJK A;  2O1W A;  3K17 A;  1JK2 A;  1UN6 B;  2BA1 G;  2BM0 A;  3CDI A;  4EMD A;  2EPL X;  2EM3 A;  4FW3 A;  2ZM6 E;  1MU5 A;  2L2K B;  4FW6 A;  1EKZ A;  1ZM3 A;  3M85 D;  5A69 A;  1N32 E;  4DR6 E;  4HYM A;  5F3W A;  2VQF I;  4IFD B; 
#chains in the Genus database with same CATH homology
 4HXZ A;  1XNQ I;  2CGE A;  2Z5C A;  2V2Q A;  4I3H A;  2Z5B B;  1GQE A;  2JWO A;  1H7S A;  4F9A B;  4JI0 E;  2MC6 A;  2DEI A;  2R42 A;  3ZZU A;  4LFC E;  1KKH A;  2H36 X;  2E1M A;  1HNX I;  1WHN A;  2DEJ A;  4GEQ B;  3QT6 A;  3F6H A;  3HUL A;  4DR4 E;  2FGG A;  1J5E E;  4Z7C A;  2CPN A;  5GMD A;  4ZVI A;  2VE7 C;  4YHH I;  4LTY A;  3T1Y I;  2YT4 A;  1MG7 A;  4HY1 A;  4TUG A;  1Z0B A;  4DUZ I;  3OML A;  4LFB I;  2X36 A;  4LF5 I;  4R1F A;  1IBM I;  4B3S I;  1XNQ E;  2V2Z A;  3ADJ A;  4DV6 E;  2BM1 A;  2RS6 A;  3Q6N A;  1USU A;  1ZBT A;  4X65 I;  5AAS A;  1N0V C;  2E1R A;  2UUA I;  4GKJ E;  3V2U C;  1UEK A;  4JV5 I;  3IWD A;  4DR3 I;  4DR1 I;  1HNX E;  3WU3 A;  4MYU A;  1HR0 I;  1H73 A;  1S4E A;  3ADG A;  2VF1 A;  4JI1 I;  1NHI A;  4YHH E;  4RPF A;  3T1Y E;  5A2Q C;  3ZZT A;  4DV2 I;  2O1V A;  2ODR C;  3HXL A;  2HHH I;  4LFB E;  2V86 A;  1KIJ A;  4LF5 E;  2DB2 A;  2XEX A;  1Z5A A;  2V87 A;  4WFT A;  1IBM E;  2L3C A;  2ODR D;  4DV1 I;  4JI3 E;  2L8T A;  4X65 E;  2L2N A;  3V5R A;  4M30 A;  4FN5 A;  4JV5 E;  4LF9 I;  4DR3 E;  4DR1 E;  2RSM A;  1HR0 E;  2UXC I;  1S16 A;  2V89 A;  2HK2 A;  2R3V A;  4LFA I;  1YYK A;  5AE3 A;  4DU7 A;  1STU A;  2JR1 A;  3LML A;  3B8H A;  2MDR A;  3J7A G;  2HFS A;  2JOX A;  2CZ9 A;  2HHH E;  2A2C A;  4OOG C;  1EA6 A;  2BV3 A;  1X49 A;  4J8Z A;  2UU9 E;  4NXN I;  2YZT A;  3PRY A;  5AE2 A;  1BKN A;  4HAC B;  5AE1 A;  4DV1 E;  3VYY A;  3C4T A;  2B7T A;  4M2Z A;  4DR2 I;  2UXB I;  4YY3 I;  3J7Y p;  4DPY A;  1WXR A;  4DPU A;  5IT9 Q;  4DV5 I;  1N34 I;  3PYD A;  4LF9 E;  4GKK I;  1I94 I;  5DNY A;  3J80 C;  5LMN I;  2UXC E;  4M0V A;  3ZZ0 A;  4XTJ A;  4LFA E;  2NUF A;  4DKK A;  2B7V A;  3CWV A;  3J81 Q;  2IOQ A;  1K47 A;  1O0W A;  5BR8 I;  1XMO I;  3PYE A;  2AJ4 A;  1PVG A;  2WW4 A;  1FWK A;  2Z5B A;  4MYT A;  3IWC A;  4R03 A;  4P52 A;  4UT4 A;  4NXN E;  1ZXN A;  3JTZ A;  5LMU I;  3MSW A;  3FIG A;  3F6G A;  4JI7 E;  4NXM I;  2NUG A;  3LNU A;  4KQV A;  2HKJ A;  4DR7 I;  1GZ6 A;  4WUB A;  4DR2 E;  2UXB E;  4BCA A;  4YY3 E;  1N36 I;  1N34 E;  4BS9 A;  1DI2 A;  4GKK E;  3ZKB A;  4DR5 I;  4AQY I;  2DSY A;  4F9C B;  2Z5C B;  2HKE A;  3IWB A;  2UXD I;  2V8Q B;  5T6J A;  4LF8 I;  2VQF E;  2ZBK B;  3QT7 A;  5BR8 E;  4Z7Y A;  1HK7 A;  3Q6M A;  4P78 A;  5FWK A;  2V8P A;  4FW9 A;  1T4N A;  4JI8 I;  2LBS B;  4I8O A;  4P7A A;  1FWL A;  1NZ0 A;  5LMU E;  1Y4U A;  3HPZ A;  1D6T A;  4BMJ A;  1QZR A;  3PYG A;  2LUQ A;  4NXM E;  5FLX Q;  2O1U A;  4X66 I;  2VQE I;  1PKP A;  1HNW I;  4PRX A;  2LJH A;  1Z0E A;  2PNM A;  2V88 A;  4UTG A;  4DR5 E;  4AQY E;  2Q2E B;  1XNR I;  1RC7 A;  3P06 A;  2UXD E;  4DUZ E;  4X62 I;  4LF8 E;  2G7H A;  3P1X A;  3JAM C;  2UUC I;  1WUU A;  2K4V A;  4IZJ A;  2NUE A;  1IBK I;  4B3S E;  2E5L I;  4JI2 I;  2RS7 A;  1RRE A;  1XHK A;  3QT8 A;  4JI8 E;  2LJP A;  2B3T B;  4DPT A;  3WU5 A;  4JYA I;  2UUA E;  1H7U A;  2L33 A;  2UUB I;  3H4L A;  1XMQ I;  1DQ3 A;  3VK6 A;  3HPS A;  1FI4 A;  2ZIT A;  4K0K I;  2VQE E;  4JI6 I;  1HNW E;  2L3J A;  1Z5C A;  2L6M A;  1NHJ A;  4JI1 E;  2EWL A;  4LF6 I;  4DV2 E;  3LPS A;  3T1H I;  3VYX A;  1XNR E;  1OJ4 A;  2WZO A;  1N33 I;  4X62 E;  5GME A;  4ED4 A;  4DPW A;  1T4O A;  3ADL A;  4TUI A;  3HQ1 A;  2ZM6 I;  4JI4 I;  2F8B A;  1RR9 A;  4HAC A;  2UUC E;  1ELO A;  1IBK E;  1IBL I;  5IWA I;  4JI5 I;  4IZK A;  2V83 A;  2KOU A;  3J80 Q;  1YZ9 A;  3DF6 A;  4DV0 I;  4WYQ B;  1Z0T A;  5CFF E;  4WUC A;  1PIE A;  4DV4 I;  1MX0 A;  2M4I A;  4K0K E;  4DU8 A;  2IHR 1;  1T4L B;  4JI6 E;  2LTR A;  2J7K A;  4JI0 I;  4OX9 I;  2FTX B;  4LFC I;  3AUZ A;  4LF6 E;  2B9D A;  4X8W A;  3T1H E;  2KON A;  2HK3 A;  4IZJ D;  1N33 E;  2V2V A;  4FWD A;  1FJG I;  1RQ0 A;  3ADI A;  1U2R A;  4BC9 A;  4JI4 E;  4B3R I;  1YYW A;  2IOP A;  1Z0G A;  1IBL E;  2M7Q A;  5IWA E;  4JI5 E;  3LTO A;  5IT9 C;  4DV0 E;  4FWH A;  2FV4 B;  2JVA A;  4PRV A;  4DV5 E;  1HNZ I;  4DV4 E;  4DUY I;  1SR9 A;  1I94 E;  1WHQ A;  3Q1Q A;  3QT5 A;  4DV6 I;  5LMN E;  2CG9 A;  3J81 C;  4M1K A;  2LTS A;  4DXL A;  5LL6 R;  4PU9 A;  4OX9 E;  3H09 A;  4BBY A;  4LF4 I;  4GKJ I;  1X48 A;  1USV A;  1KTV A;  2DMY A;  4Q28 A;  1ZM4 A;  4F54 A;  3KWR A;  1XMO E;  3OTO I;  1ZM9 A;  3F0N A;  3AV0 A;  2GS8 A;  2JY9 A;  1FJG E;  4KZS A;  1UHZ A;  2V85 A;  4DV7 I;  3K6Q A;  4N3O A;  4B3R E;  1Z0C A;  5ADZ A;  2DIX A;  3PYF A;  3HJC A;  4WSP A;  3WU6 A;  4KHP I;  2KHX A;  5A2Q Q;  1EI1 A;  4X64 I;  3DJW A;  4DMI A;  4DR7 E;  1DAR A;  1H72 C;  4LF7 I;  3JAM Q;  3RMP A;  2LE2 A;  1N36 E;  1HNZ E;  4BC7 A;  4DUY E;  3GON A;  2NA2 A;  3HTX A;  5L3J A;  4JI3 I;  2NPF A;  2L92 A;  2X7I A;  1J26 A;  1ZM2 A;  1X47 A;  4DV3 I;  4L5N C;  4LF4 E;  3B82 A;  2HFU A;  1Y6Z A;  2LRS A;  1QU6 A;  4L8N A;  4R8O A;  2F4V I;  3OTO E;  4LU9 A;  2JOB A;  3JU0 A;  3K85 A;  4DV7 E;  4B3T I;  3J7A M;  1Z0V A;  2N3H A;  2OI2 A;  3WU4 A;  5FLX C;  1N0U A;  1FNM A;  2VF3 A;  3K1J A;  2EFG A;  4KHP E;  2M1S A;  3D4J A;  4WPY A;  4P7D A;  4WUD A;  1UIL A;  1ZBQ A;  4X64 E;  1Z5B A;  1ZXM A;  2EZ6 A;  2UU9 I;  4X66 E;  1VIS A;  1B63 A;  4LF7 E;  4B3M I;  1NHH A;  1B62 A;  3B78 A;  4IZJ B;  1KVK A;  3ZM7 A;  4URL A;  3C4B A;  2GQ0 A;  3ZKD A;  4FWG A;  4DV3 E;  1YYO A;  1Z0W A;  1Z59 A;  4USK A;  2V34 A;  2E5L E;  2F4V E;  2Z5E A;  4JI2 E;  1Y4S A;  1N32 I;  2RTX A;  4F9B B;  2A2D A;  4DR6 I;  4B3T E;  2PNL A;  4JYA E;  4USM A;  2L2M A;  2N3G A;  1H74 A;  3M6A A;  2O1T A;  2UUB E;  1XMQ E;  4DPX A;  2MC5 A;  3ZOQ B;  4B3M E;  4JG4 A;  3LLH A;  4DR4 I;  1FKA E;  4IZK B;  2LMZ A;  1J5E I;  4JI7 I;  1A6F A;  2LUP B;  2O1W A;  3K17 A;  4EMD A;  2BM0 A;  2ZM6 E;  1MU5 A;  2L2K B;  1EKZ A;  1ZM3 A;  1N32 E;  4DR6 E;  4HYM A;  5F3W A;  2VQF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...