2VQEE

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2vqeE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqeE02
5IWAE 4K0KE 1T4NA 4X64I 1NHIA 4X65E 4EMDA 1Z5CA 4DV2E 1VISA 2A2CA 2OI2A 4K0KI 1X47A 4DV5I 3ZKBA 4X65I 4DV2I 1HNZE 4LFCE 2VQEE 2R42A 3WU5A 2RS6A 4RPFA 2HKJA 1HNZI 4LFCI 2VQEI 4LFBI 1KKHA 1HNXE 4DKKA 1FJGE 2HFUA 1B62A 1YZ9A 2VF3A 1HNXI 4PU9A 1N36E 1FJGI 4FW9A 2NA2A 2L2MA 1Z0EA 1MU5A 3HULA 2V2ZA 4I3HA 4DV7E 1N36I 1T4LB 1N0VC 1FWLA 1K47A 4OX9E 1RREA 4DV7I 5A2QQ 1NHJA 4WFTA 1XNQI 2LTSA 4OX9I 4B3SE 1I94E 2LBSB 4WYQB 4B3SI 1I94I 4HY1A 4DPYA 2A2DA 3B82A 3PYFA 2HK3A 1PVGA 3H4LA 1D6TA 4DR5I 2EZ6A 1EI1A 1UHZA 4JI1E 1NZ0A 2X7IA 2JVAA 3LPSA 1B63A 4DUZE 3PYGA 4LF5E 4URLA 5A2QC 2RSMA 5GMEA 3WU4A 4JYAE 1KTVA 2DEIA 4DUZI 4LF5I 1STUA 4LF8E 4JI3E 4JYAI 3LLHA 4JI5E 2NUEA 4YY3E 4R1FA 1ZBTA 3ADGA 1Z0TA 4JI0E 1FNMA 4JI3I 4JI5I 4YY3I 4JI0I 4KQVA 1X49A 1ELOA 4OOGC 4DV4E 4X62I 2CPNA 2V8PA 1J26A 3ADJA 4DV4I 2JY9A 4JI7E 2UUCE 3P1XA 3GONA 2HHHE 4JI7I 4JG4A 4DPTA 4DR6E 1QZRA 2UUCI 3D4JA 4JI2E 3ZZTA 2HHHI 4LF9I 2LUPB 4DR6I 2RS7A 5FLXQ 4HYMA 4UTGA 1KVKA 4JI2I 2BM1A 4LFAE 1MG7A 2E1RA 3QT7A 1YYWA 4DV5E 1U2RA 2VQFE 4UT4A 3PYDA 4DV6E 2HKEA 1H73A 4LFAI 2VQFI 2B7TA 4DV1E 1H72C 4DV6I 1GQEA 4LFBE 2UXDE 2XEXA 4FWGA 1PIEA 2L2KB 4DR7I 4DV1I 3QT6A 4LF6E 3J7AG 2UXDI 1NHHA 2ZITA 5BR8E 4LF6I 3T1HE 4Z7CA 2CZ9A 1XHKA 5BR8I 3T1HI 2L3JA 5FLXC 4HACB 3ZKDA 1J5EI 1YYOA 2R3VA 3ADLA 1WHNA 1XNQE 1RR9A 4DPWA 4DV3E 4B3RE 1Z59A 1Z0VA 1QU6A 3J7AM 2ZBKB 4DV3I 4B3RI 3QT8A 1IBLE 1N33E 2V2QA 2X36A 2BV3A 4WUCA 3VYYA 1Z5BA 1IBLI 4DR5E 2GS8A 1N33I 4WUBA 4NXME 1XNRE 2LJHA 4DR4E 4DPXA 2UXBE 4KHPE 5L3JA 3WU3A 4NXMI 3J80Q 1XNRI 1UILA 3LNUA 4DR4I 4DR2E 1H74A 4MYUA 2UXBI 4M30A 4KHPI 1X48A 4X66E 1XMOI 2KHXA 1FWKA 4DR2I 5IT9Q 4HXZA 4X66I 4LF7E 4DUYI 1FKAE 3T1YE 4LF7I 4YHHE 1RC7A 3T1YI 3JAMQ 4DR3I 4X8WA 4DPUA 4YHHI 2UU9I 3F0NA 2DMYA 4X62E 1RQ0A 4FN5A 1N34E 1EA6A 4Z7YA 3J80C 2UUAE 4USKA 3ZZ0A 1N34I 2AJ4A 2UUAI 5IT9C 1H7UA 1UEKA 4LF4E 1H7SA 4DU7A 4LF4I 4USMA 4LF9E 1BKNA 4M2ZA 3JAMC 1ZXNA 3V5RA 1ZM2A 4GKJE 2LRSA 2Q2EB 2F4VE 1S16A 3J7Yp 4GKJI 1Z5AA 2BM0A 4JI6E 4B3ME 2F4VI 3HTXA 2DB2A 4GKKE 1KIJA 4PRVA 1Z0BA 4JI6I 4DR7E 4B3MI 1ZM3A 1YYKA 2L33A 2UUBE 1N0UA 4P52A 4FWHA 4GKKI 2L2NA 4NXNE 2HK2A 2UUBI 3VYXA 2YT4A 4NXNI 1T4OA 1ZXMA 4HACA 4P7AA 1J5EE 5IWAI 4JI8E 1PKPA 3LTOA 2ZM6E 2J7KA 2LTRA 4JV5E 4JI8I 3ZZUA 2ZM6I 2DIXA 5LMUE 5LMNE 4JV5I 1WHQA 3QT5A 5LMUI 4DU8A 5LMNI 4FWDA 4DXLA 1IBME 2N3GA 5LL6R 4DV0E 3K17A 1IBMI 1XMQE 2EFGA 4DV0I 1A6FA 4M1KA 2MDRA 4DR1E 2NUFA 1XMQI 1HNWE 2RTXA 3K1JA 1XMOE 4ED4A 1S4EA 4DR1I 1HNWI 1Z0GA 2LUQA 4DUYE 1N32E 5CFFE 1HR0E 3V2UC 1OJ4A 2LJPA 1N32I 2V2VA 1ZM9A 3WU6A 4DR3E 1EKZA 1HR0I 4MYTA 4B3TE 2UU9E 1IBKE 3M6AA 2IHR1 2WW4A 2HFSA 4XTJA 2NUGA 4JI1I 4B3TI 2B7VA 1IBKI 1DARA 3ZM7A 4JI4E 3Q1QA 2V34A 4JI4I 3J81Q 4LF8I 2E5LE 3OTOE 4AQYE 2NPFA 1O0WA 2E5LI 3OTOI 4AQYI 1FI4A 4WUDA 2L3CA 4ZVIA 3B78A 1DI2A 3B8HA 3C4BA 1Z0CA 2B3TB 1ZM4A 3ADIA 4PRXA 2N3HA 2UXCE 3J81C 2DEJA 3PYEA 1Z0WA 2UXCI 1MX0A 5GMDA 4X64E 1WUUA 3CWVA 3C4TA
chains in the Genus database with same CATH superfamily
1A1IA 5ELWA 5IWAE 4K0KE 3L00A 1T4NA 2EPOA 3IWCA 4X64I 5C0XC 1NHIA 2DSYA 4P7DA 4X65E 4EMDA 3ZOQB 1XXEA 1Z5CA 5DRRA 4DV2E 5K36C 1IMUA 5K36F 1VISA 2A2CA 2OI2A 4K0KI 2MC5A 1X47A 4DV5I 4OO1C 3ZKBA 4X65I 1UDSA 4OO1F 2EM5A 4DV2I 1HNZE 2EL6A 2CTDA 4LFCE 1USVA 1Y5YA 2VQEE 2V8QB 2YRMA 2R42A 2RS6A 3WU5A 4RPFA 2EJ4A 5ADZA 2HKJA 5JEAA 1HNZI 4BCAA 4LFCI 2VQEI 4LFBI 2EMYA 4R2DA 1KKHA 2PNMA 4TUGA 4ISAA 4IFDB 2EE8A 1HNXE 3IWDA 1NEIA 4DKKA 1FJGE 2PNZA 2GO3A 1T38A 2HFUA 5AC5A 1B62A 2EPUA 1YZ9A 2VF3A 2CSHA 2O1TA 2VESA 2M4IA 3RMPA 1HNXI 4PU9A 1N36E 1FJGI 4FW9A 2NA2A 2L2MA 4BBYA 2EOMA 2DLQA 1P47A 1Z0EA 4HTGA 1MU5A 2CG9A 3HULA 2V2ZA 4WPYA 2WBUA 4IZKA 4LOMA 4LU9A 4I3HA 2K7IA 4DV7E 3THOB 1N36I 1T4LB 2EM6A 4WSPA 2ELYA 1YHCA 1N0VC 1FWLA 1K47A 2LT7A 4OX9E 1RREA 4FW3A 3P3CA 4DV7I 5A2QQ 1NHJA 4WFTA 2EMCA 1XNQI 5K36D 3PS2A 2LO3A 2LTSA 4OX9I 4B3SE 2CGEA 1I94E 2PO2B 4MQYA 2IERA 2HJJA 2LBSB 1PJTA 5DNXA 4WYQB 2EPAA 5JEAD 4IFDE 5DNLA 2PO0A 2C39B 4B3SI 3GCMA 4AIMA 4AM3A 2ENCA 1I94I 2D9HA 1WJPA 1Z1BA 4HY1A 2VF1A 4DPYA 4L5NC 2A2DA 3B82A 3PYFA 1EH6A 2YTNA 4NZVA 1VI7A 2HK3A 2EPKX 1PVGA 3H4LA 1D6TA 3BIDA 4DR5I 2EZ6A 1EI1A 1UHZA 4JI1E 1NZ0A 2CVEA 2B9DA 2X7IA 2JVAA 3Q6MA 3VHTB 2BA1D 3LPSA 1KYQA 2EOIA 1B63A 5A6JA 1ZU1A 3L7ZB 4DUZE 1A1JA 2BA0G 3PYGA 5DNYA 4LF5E 4URLA 3EQ1A 5A2QC 2RSMA 2JEAB 4WX9A 5GMEA 3WU4A 2EN2A 2YTGA 4MU3A 4JYAE 1KTVA 2DEIA 2GHFA 1R6LA 2GQ0A 2K4VA 4DUZI 2EOSA 2KOUA 5AC4A 4LF5I 1STUA 4LF8E 1MGTA 2EMWA 4IZJB 4BA2A 2RPCA 1DGCA 2MDGA 4JI3E 4JYAI 3LLHA 4JI5E 2EP3A 2NUEA 3AV0A 2Z5EA 4YY3E 5K36E 1A1HA 5KL3A 3HKMA 4MU0A 1ZBTA 4R1FA 3ADGA 1Z0TA 4JI0E 1FNMA 2ENAA 4JI3I 2RQLA 2EWLA 2LMZA 4BHBA 4OO1E 1EH7A 4ZYEA 3P3EA 4JI5I 2RSIA 2YTPA 4YY3I 2PO1B 3MHSC 3Q6NA 2Z5BB 4BA1A 4JI0I 2EQ0A 2KONA 5DROA 4KQVA 1X49A 1ZBQA 4IFDC 1ELOA 2I9IA 3OMLA 2EPCA 5KL6A 4OOGC 4IFDF 4DV4E 3UHMA 4F9CB 4O4KA 4OZEA 2CPNA 4X62I 3M85D 2WNRA 3P06A 2V8PA 2R76A 1J26A 3ADJA 3FIGA 5C0XA 4DV4I 1G2DC 2JEBA 2R1FA 5A69A 4O5GA 1Y4SA 4FK5C 4FW7A 1QNTA 2JY9A 2EPRA 4RH8A 4JI7E 1IQSA 3U1KA 3M7NG 2NN6A 2UUCE 4AIDA 3P1XA 3CDIA 3GONA 2HHHE 4JI7I 4JG4A 4DPTA 4DR6E 4I8OA 1QZRA 2O3ZA 2UUCI 3D4JA 1YH8A 1ZR9A 4JI2E 3ZZTA 2HHHI 3PS1A 2LUPB 4LF9I 2LCEA 4DR6I 2RS7A 5FLXQ 4BC7A 4HYMA 4UTGA 2EOZA 1YUIA 1KVKA 1N3GA 4JI2I 2BM1A 4X9JA 5LLQA 4R2CA 4LFAE 1MG7A 2E1RA 3QT7A 1YYWA 1NCSA 2YPNA 4WXDA 2VQFE 4DV5E 4R2SA 1U2RA 4UT4A 3BF2A 2YU8A 3PYDA 4DV6E 2ENHA 2HKEA 1H73A 4LFAI 4P78A 1GZ6A 2VQFI 2B7TA 2ODRC 3EPKA 4DV1E 2YTOA 5C0XD 2ELZA 1H72C 4DV6I 5A6BA 3PS3A 1GQEA 4LFBE 2UXDE 1AAYA 2XEXA 4FWGA 2YTDA 1PIEA 2L2KB 1UDQA 4DR7I 4DV1I 3QT6A 3JU0A 4GZNC 4LF6E 2NN6D 3J7AG 2UXDI 1NHHA 2ZITA 2EQ3A 2EOXA 2EOOA 5BR8E 2HGHA 1ZAAC 4LF6I 1YSAC 3T1HE 1Y60A 2YU5A 4GQUA 2CZ9A 2EM2A 1XHKA 3CWVA 2JE6A 4Z7CA 2M7QA 4J3DA 5BR8I 5KL5A 1UDOA 3T1HI 2L3JA 5FLXC 3EPHA 2DGCA 1IQOA 4HACB 1WRJA 1YPNA 5AE2A 3HJCA 3ZKDA 1J5EI 1YYOA 2R3VA 2JP9A 3ADLA 1WHNA 1XNQE 1G2FC 1BBOA 1E3PA 2YRKA 1T39A 1RR9A 4DPWA 2EN3A 2EMGA 2A25A 2LV2A 4DV3E 4U3BA 2EOFA 4B3RE 1Z59A 4O43A 1Z0VA 5JEAB 2PO2A 1QU6A 2ADRA 2EPLX 3HPSA 3J7AM 4ZYGA 2ZBKB 2WBTA 4DV3I 5A6BD 4B3RI 4NHRA 2C39A 3QT8A 1DQ3A 2EPZA 1IBLE 4R2AA 1UBDC 4F9BB 1B69A 5FWKA 1N33E 2V2QA 2CT1A 2X36A 2BR2B 2BV3A 4WUCA 2DMIA 2EN1A 4R2EA 3VYYA 1Z5BA 2IESA 2EMHA 1IBLI 4DR5E 1PJQA 2GS8A 4WUBA 1N33I 2EMIA 2BBGA 3M99B 2AE8A 4NXME 1XNRE 2E72A 1UDNA 2EM8A 4KZSA 2LJHA 4DR4E 1USUA 4IZKB 4DPXA 5JEAC 2NABA 2UXBE 4KHPE 1OYPA 5JEAF 2J65A 4WSGA 2LE2A 5L3JA 3WU3A 3H09A 3J80Q 4NXMI 1XNRI 1UILA 4WXCA 3LNUA 4DR2E 4TUIA 3L7ZA 1H74A 4DR4I 3DD6A 4MYUA 4L8NA 2UXBI 2HC5A 2MC6A 4M30A 2WP8A 4LCHA 4KHPI 1X48A 4X66E 1PJSA 1XMOI 2KHXA 1FWKA 4DR2I 4N3OA 3KRNA 5IT9Q 3HXLA 4RHBB 4F6MA 4HXZA 4X66I 4LF7E 4IZJA 2PO0B 4DUYI 1FKAE 3P3GA 1X6FA 1X6EA 3T1YE 2F1DA 2JWOA 4Q35B 2C37A 4LF7I 3ECRA 4BMJA 4YHHE 2FGGA 1RC7A 1YUJA 3T1YI 4IS9A 2PO1A 3JAMQ 4DR3I 4M0VA 2Z5BA 4X8WA 4DPUA 4YHHI 2EM3A 2YSPA 2O1VA 2UU9I 2EN6A 2DMYA 3BGHA 4IJDA 1X5WA 1A1FA 2EN4A 3LMLA 1RQ0A 2L92A 5KL2A 4X62E 3F6GA 4FN5A 3K85A 2YTIA 5EKWA 2BA0D 1N34E 4Q28A 3J80C 1EA6A 4Z7YA 2UUAE 2EMBA 4USKA 5T6JA 1GTKA 2F8BA 2EOHA 2EM4A 2EL5A 3ZZ0A 2EPPA 4MLVA 2EMFA 1N34I 2AJ4A 2UUAI 2EPNA 4F6NA 2JXPA 5IT9C 2V87A 2JPAA 1H7UA 1UEKA 5K36A 2Z5CA 4LF4E 1X6HA 4DMIA 2C38B 2O1UA 3B4TA 3HQ1A 2E1MA 4OO1A 1H7SA 4DU7A 1EH8A 2EORA 5IV8B 4LF4I 4USMA 4OKGA 4LF9E 1BKNA 4M2ZA 3JAMC 3F6HA 2VE7C 2PRTA 1ZXNA 5DRQA 1ZM2A 2DLKA 4O24A 4GKJE 1OYRA 3V5RA 2N8XA 5KL4A 1L4SA 2EOQA 1X3CA 2LRSA 3EPJA 2Q2EB 2VRDA 2EM0A 4LCFA 2F4VE 2WNRB 1S16A 3J7Yp 4GKJI 1Z5AA 2BM0A 4JI6E 4ZYHA 4MLQA 5IXMB 2EMLA 4B3ME 3C6KA 2F4VI 3HTXA 2DB2A 4ZYDA 4GKKE 1Y4UA 1KIJA 1TN9A 1Z0BA 4PRVA 4JI6I 4DR7E 3M7ND 4B3MI 4R2RA 1YYKA 1ZM3A 2NN6B 1TF3A 2L33A 2UUBE 1N0UA 4P52A 4FWHA 4GKKI 2V85A 2EN7A 2M1SA 3KZZA 3QG5C 3AUZA 2L2NA 1MEYC 4NXNE 1BB8A 5JEAE 2HK2A 2UUBI 1A1KA 4OO1D 2BB8A 2EPMX 2YTQA 3VYXA 4BC9A 2EMKA 2YT4A 1OYSA 4NXNI 1T4OA 1ZXMA 1JK2A 2IOQA 3IWBA 1SFEA 2JOXA 5C0XF 2JT2A 4NBQA 4HACA 4P7AA 1J5EE 4FW4A 5IWAI 3MSWA 2PNLA 4JI8E 1PKPA 1LLMC 3LTOA 2NN6C 2ZM6E 2J7KA 2L8TA 2NN6F 3F0NA 2LTRA 4JV5E 4JI8I 3ZZUA 2ZM6I 2LJUA 2DIXA 5LMUE 5LMNE 4JV5I 1WHQA 2G7HA 5A6KA 4FW6A 2JR1A 3QT5A 5KL7A 5LMUI 2DRPA 4DU8A 2BR2A 4N4RB 4FWDA 5LMNI 4LCGA 4DXLA 2GO4A 4IS1C 3GLLA 1IBME 2PNZB 2N3GA 3BBGA 5LL6R 4DV0E 4GEQB 5EL9A 3K17A 2JE6B 1Y6ZA 1AH5A 1IBMI 2V83A 3MHHC 1XMQE 1P42A 2EFGA 3THNA 2WBSA 4DV0I 2MKDA 1A6FA 2YTJA 1KJKA 2JOBA 3P76A 2MDRA 4DR1E 4M1KA 2NUFA 4QNKA 1HNWE 2RTXA 1XMQI 2BA1G 3K1JA 4LTYA 1XMOE 3EPLA 4U3DA 4ED4A 1S4EA 2M9AA 4DR1I 1HNWI 2FV4B 3K6QA 2GLIA 4J8ZA 4KWYA 4R2PA 4F2JC 1Z0GA 2JEAA 2EOEA 1RMDA 2JYAA 2LUQA 4DUYE 3DF6A 1JK1A 4IFDA 1N32E 5CFFE 3KZYA 5F3WA 1HR0E 2EN8A 3V2UC 1WXRA 1OJ4A 4F54A 4HEIA 2LJPA 2O1WA 2V2VA 1N32I 2YZTA 4M9VC 2EL4A 2H36X 1ZM9A 3WU6A 4DR3E 1EKZA 3CDJA 1HR0I 2J7JA 4MYTA 3TQMA 4B3TE 3DJWA 2UU9E 1IBKE 1TF6A 3M6AA 3JTZA 2IHR1 3KWRA 4R03A 2FTXB 1RHYA 2HFSA 2WW4A 4MU4A 4XTJA 2L6MA 2NUGA 4JI1I 4B3TI 2B7VA 1IBKI 2EQ1A 2EMZA 2WP8B 2WCC3 2EOYA 4LPFA 1DARA 3M85G 2GPIA 1HK7A 2EM9A 2YTFA 5A6AA 1YFHA 4BS9A 4JI4E 3PRYA 3ZM7A 3U1YA 3Q1QA 2EM7A 2C38A 5C0XE 2V34A 3C6MA 4JI4I 4IFDD 3J81Q 2LVHA 2EPXA 2C37B 3VK6A 2MKNA 4BA2B 4LF8I 5AASA 2E5LE 2EOJA 2V86A 3OTOE 4IZJD 4AQYE 2NN6E 1BBGA 2YWQA 2NPFA 1O0WA 2YSOA 1SR9A 4MU1A 3UK3C 3OTOI 2E5LI 4AQYI 1FI4A 2V89A 4MDTA 4BA1B 5AE3A 1E3HA 4BHCA 3NZKA 1R6MA 4FW5A 2V88A 4WUDA 2L3CA 4ZVIA 3B78A 4F9AB 1UN6B 1A1GA 2EMXA 1DI2A 3B8HA 4QNJA 3C4BA 1Z0CA 4R2QA 5C0XB 5AE1A 2JEBB 2B3TB 1A1LA 5K36B 2Z5CB 1F2IG 1ZM4A 2YRHA 2IOPA 5DRPA 4R8OA 3ADIA 4PRXA 2Q8UA 4OO1B 2N3HA 2UXCE 3J81C 2YTEA 2DEJA 1PDAA 3HPZA 2I13A 3H1CA 1Z0WA 3PYEA 2UXCI 1MX0A 3GMEA 5GMDA 5TSEA 4X64E 2ODRD 1WUUA 2WZOA 2EMAA 3C4TA
chains in the Genus database with same CATH topology
5IWAE 4K0KE 1T4NA 3IWCA 4X64I 1NHIA 2DSYA 4P7DA 4X65E 4EMDA 3ZOQB 1Z5CA 4DV2E 1VISA 2A2CA 2OI2A 4K0KI 2MC5A 1X47A 4DV5I 3ZKBA 4X65I 4DV2I 1HNZE 4LFCE 1USVA 2VQEE 2V8QB 2R42A 3WU5A 2RS6A 4RPFA 5ADZA 2HKJA 1HNZI 4BCAA 4LFCI 2VQEI 4LFBI 1KKHA 2PNMA 4TUGA 1HNXE 3IWDA 4DKKA 1FJGE 2HFUA 1B62A 1YZ9A 2VF3A 2O1TA 1HNXI 2M4IA 3RMPA 4PU9A 1N36E 1FJGI 4FW9A 2NA2A 2L2MA 4BBYA 1Z0EA 1MU5A 2CG9A 3HULA 2V2ZA 4WPYA 4IZKA 4I3HA 4LU9A 4DV7E 1N36I 1T4LB 4WSPA 1N0VC 1FWLA 1K47A 4OX9E 1RREA 4DV7I 5A2QQ 1NHJA 4WFTA 1XNQI 2LTSA 4OX9I 4B3SE 2CGEA 1I94E 2LBSB 4WYQB 4B3SI 1I94I 4HY1A 2VF1A 4DPYA 4L5NC 2A2DA 3B82A 3PYFA 2HK3A 1PVGA 3H4LA 1D6TA 4DR5I 2EZ6A 1EI1A 1UHZA 4JI1E 1NZ0A 2B9DA 2X7IA 2JVAA 3Q6MA 3LPSA 1B63A 4DUZE 3PYGA 5DNYA 4LF5E 4URLA 5A2QC 2RSMA 5GMEA 3WU4A 4JYAE 1KTVA 2DEIA 2GQ0A 4DUZI 2K4VA 4LF5I 2KOUA 1STUA 4LF8E 4IZJB 4JI3E 4JYAI 3LLHA 4JI5E 2NUEA 3AV0A 2Z5EA 4YY3E 4R1FA 1ZBTA 3ADGA 1Z0TA 4JI0E 1FNMA 4JI3I 2EWLA 2LMZA 4JI5I 4YY3I 3Q6NA 2Z5BB 4JI0I 2KONA 4KQVA 1X49A 1ZBQA 1ELOA 3OMLA 4OOGC 4DV4E 4X62I 4F9CB 2CPNA 3P06A 2V8PA 1J26A 3ADJA 3FIGA 4DV4I 1Y4SA 2JY9A 4JI7E 2UUCE 3P1XA 3GONA 2HHHE 4JI7I 4JG4A 4DPTA 4DR6E 4I8OA 1QZRA 2UUCI 3D4JA 4JI2E 3ZZTA 2HHHI 4LF9I 2LUPB 4DR6I 2RS7A 5FLXQ 4BC7A 4HYMA 4UTGA 1KVKA 4JI2I 2BM1A 4LFAE 1MG7A 2E1RA 3QT7A 1YYWA 4DV5E 1U2RA 2VQFE 4UT4A 3PYDA 4DV6E 2HKEA 1H73A 4LFAI 4P78A 1GZ6A 2VQFI 2B7TA 2ODRC 4DV1E 1H72C 4DV6I 1GQEA 4LFBE 2UXDE 2XEXA 4FWGA 1PIEA 2L2KB 4DR7I 4DV1I 3QT6A 3JU0A 4LF6E 3J7AG 2UXDI 1NHHA 2ZITA 5BR8E 4LF6I 3T1HE 4Z7CA 2CZ9A 1XHKA 3CWVA 2M7QA 5BR8I 3T1HI 2L3JA 5FLXC 4HACB 3ZKDA 5AE2A 3HJCA 1J5EI 1YYOA 2R3VA 3ADLA 1WHNA 1XNQE 1RR9A 4DPWA 4DV3E 4B3RE 1Z59A 1Z0VA 1QU6A 3HPSA 3J7AM 2ZBKB 4DV3I 4B3RI 3QT8A 1DQ3A 1IBLE 5FWKA 4F9BB 1N33E 2V2QA 2X36A 2BV3A 4WUCA 3VYYA 1Z5BA 1IBLI 4DR5E 2GS8A 1N33I 4WUBA 4NXME 1XNRE 4IZKB 4KZSA 2LJHA 4DR4E 1USUA 4DPXA 2UXBE 4KHPE 2LE2A 5L3JA 3WU3A 3H09A 3J80Q 4NXMI 1XNRI 1UILA 3LNUA 4DR4I 4DR2E 4TUIA 1H74A 4MYUA 4L8NA 2UXBI 2MC6A 4M30A 4KHPI 1X48A 4X66E 1XMOI 2KHXA 1FWKA 4DR2I 4N3OA 5IT9Q 3HXLA 4HXZA 4X66I 4LF7E 4IZJA 4DUYI 1FKAE 3T1YE 2JWOA 4LF7I 4BMJA 4YHHE 2FGGA 1RC7A 3T1YI 3JAMQ 4DR3I 4M0VA 2Z5BA 4X8WA 4DPUA 4YHHI 2O1VA 2UU9I 3F0NA 2DMYA 3LMLA 4X62E 1RQ0A 2L92A 3F6GA 4FN5A 3K85A 1EA6A 1N34E 4Q28A 3J80C 4Z7YA 2UUAE 4USKA 5T6JA 2F8BA 3ZZ0A 1N34I 2AJ4A 2UUAI 5IT9C 1H7UA 2V87A 1UEKA 2Z5CA 4LF4E 4DMIA 2O1UA 3HQ1A 2E1MA 1H7SA 4DU7A 4LF4I 4USMA 4LF9E 1BKNA 4M2ZA 3JAMC 3F6HA 2VE7C 1ZXNA 3V5RA 1ZM2A 4GKJE 2LRSA 2Q2EB 2F4VE 1S16A 3J7Yp 4GKJI 1Z5AA 2BM0A 4JI6E 4B3ME 2F4VI 3HTXA 2DB2A 4GKKE 1Y4UA 1KIJA 4PRVA 1Z0BA 4JI6I 4DR7E 4B3MI 1YYKA 1ZM3A 2L33A 2UUBE 1N0UA 4P52A 4FWHA 4GKKI 2V85A 2M1SA 3AUZA 2L2NA 4NXNE 2HK2A 2UUBI 3VYXA 4BC9A 2YT4A 4NXNI 1T4OA 1ZXMA 2IOQA 3IWBA 2JOXA 4HACA 4P7AA 1J5EE 5IWAI 3MSWA 2PNLA 4JI8E 1PKPA 3LTOA 2ZM6E 2J7KA 2L8TA 2LTRA 4JV5E 4JI8I 3ZZUA 2ZM6I 2DIXA 5LMUE 5LMNE 4JV5I 1WHQA 2G7HA 2JR1A 3QT5A 5LMUI 4DU8A 5LMNI 4FWDA 4DXLA 1IBME 2N3GA 5LL6R 4DV0E 4GEQB 3K17A 1Y6ZA 1IBMI 2V83A 1XMQE 2EFGA 4DV0I 1A6FA 2JOBA 4M1KA 2MDRA 4DR1E 2NUFA 1XMQI 1HNWE 2RTXA 3K1JA 4LTYA 1XMOE 4ED4A 1S4EA 4DR1I 1HNWI 2FV4B 3K6QA 4J8ZA 1Z0GA 2LUQA 4DUYE 3DF6A 1N32E 5CFFE 5F3WA 1HR0E 3V2UC 1WXRA 1OJ4A 4F54A 2LJPA 2O1WA 2V2VA 1N32I 2YZTA 1ZM9A 2H36X 3WU6A 4DR3E 1EKZA 1HR0I 4MYTA 4B3TE 3DJWA 2UU9E 1IBKE 3M6AA 3JTZA 2IHR1 3KWRA 4R03A 2FTXB 2WW4A 2HFSA 4XTJA 2L6MA 2NUGA 4JI1I 4B3TI 2B7VA 1IBKI 1DARA 1HK7A 3PRYA 3ZM7A 4BS9A 4JI4E 3Q1QA 2V34A 4JI4I 3J81Q 3VK6A 4LF8I 5AASA 2E5LE 2V86A 3OTOE 4IZJD 4AQYE 2NPFA 1O0WA 2E5LI 1SR9A 3OTOI 4AQYI 1FI4A 2V89A 5AE3A 4WUDA 2V88A 2L3CA 4ZVIA 3B78A 4F9AB 1DI2A 3B8HA 3C4BA 1Z0CA 5AE1A 2B3TB 2Z5CB 1ZM4A 2IOPA 4R8OA 3ADIA 4PRXA 2N3HA 2UXCE 3J81C 2DEJA 3HPZA 3PYEA 1Z0WA 2UXCI 1MX0A 5GMDA 4X64E 1WUUA 2ODRD 2WZOA 3C4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA E;  4K0K E;  1T4N A;  4X64 I;  1NHI A;  4X65 E;  4EMD A;  1Z5C A;  4DV2 E;  1VIS A;  2A2C A;  2OI2 A;  4K0K I;  1X47 A;  4DV5 I;  3ZKB A;  4X65 I;  4DV2 I;  1HNZ E;  4LFC E;  2VQE E;  2R42 A;  3WU5 A;  2RS6 A;  4RPF A;  2HKJ A;  1HNZ I;  4LFC I;  2VQE I;  4LFB I;  1KKH A;  1HNX E;  4DKK A;  1FJG E;  2HFU A;  1B62 A;  1YZ9 A;  2VF3 A;  1HNX I;  4PU9 A;  1N36 E;  1FJG I;  4FW9 A;  2NA2 A;  2L2M A;  1Z0E A;  1MU5 A;  3HUL A;  2V2Z A;  4I3H A;  4DV7 E;  1N36 I;  1T4L B;  1N0V C;  1FWL A;  1K47 A;  4OX9 E;  1RRE A;  4DV7 I;  5A2Q Q;  1NHJ A;  4WFT A;  1XNQ I;  2LTS A;  4OX9 I;  4B3S E;  1I94 E;  2LBS B;  4WYQ B;  4B3S I;  1I94 I;  4HY1 A;  4DPY A;  2A2D A;  3B82 A;  3PYF A;  2HK3 A;  1PVG A;  3H4L A;  1D6T A;  4DR5 I;  2EZ6 A;  1EI1 A;  1UHZ A;  4JI1 E;  1NZ0 A;  2X7I A;  2JVA A;  3LPS A;  1B63 A;  4DUZ E;  3PYG A;  4LF5 E;  4URL A;  5A2Q C;  2RSM A;  5GME A;  3WU4 A;  4JYA E;  1KTV A;  2DEI A;  4DUZ I;  4LF5 I;  1STU A;  4LF8 E;  4JI3 E;  4JYA I;  3LLH A;  4JI5 E;  2NUE A;  4YY3 E;  4R1F A;  1ZBT A;  3ADG A;  1Z0T A;  4JI0 E;  1FNM A;  4JI3 I;  4JI5 I;  4YY3 I;  4JI0 I;  4KQV A;  1X49 A;  1ELO A;  4OOG C;  4DV4 E;  4X62 I;  2CPN A;  2V8P A;  1J26 A;  3ADJ A;  4DV4 I;  2JY9 A;  4JI7 E;  2UUC E;  3P1X A;  3GON A;  2HHH E;  4JI7 I;  4JG4 A;  4DPT A;  4DR6 E;  1QZR A;  2UUC I;  3D4J A;  4JI2 E;  3ZZT A;  2HHH I;  4LF9 I;  2LUP B;  4DR6 I;  2RS7 A;  5FLX Q;  4HYM A;  4UTG A;  1KVK A;  4JI2 I;  2BM1 A;  4LFA E;  1MG7 A;  2E1R A;  3QT7 A;  1YYW A;  4DV5 E;  1U2R A;  2VQF E;  4UT4 A;  3PYD A;  4DV6 E;  2HKE A;  1H73 A;  4LFA I;  2VQF I;  2B7T A;  4DV1 E;  1H72 C;  4DV6 I;  1GQE A;  4LFB E;  2UXD E;  2XEX A;  4FWG A;  1PIE A;  2L2K B;  4DR7 I;  4DV1 I;  3QT6 A;  4LF6 E;  3J7A G;  2UXD I;  1NHH A;  2ZIT A;  5BR8 E;  4LF6 I;  3T1H E;  4Z7C A;  2CZ9 A;  1XHK A;  5BR8 I;  3T1H I;  2L3J A;  5FLX C;  4HAC B;  3ZKD A;  1J5E I;  1YYO A;  2R3V A;  3ADL A;  1WHN A;  1XNQ E;  1RR9 A;  4DPW A;  4DV3 E;  4B3R E;  1Z59 A;  1Z0V A;  1QU6 A;  3J7A M;  2ZBK B;  4DV3 I;  4B3R I;  3QT8 A;  1IBL E;  1N33 E;  2V2Q A;  2X36 A;  2BV3 A;  4WUC A;  3VYY A;  1Z5B A;  1IBL I;  4DR5 E;  2GS8 A;  1N33 I;  4WUB A;  4NXM E;  1XNR E;  2LJH A;  4DR4 E;  4DPX A;  2UXB E;  4KHP E;  5L3J A;  3WU3 A;  4NXM I;  3J80 Q;  1XNR I;  1UIL A;  3LNU A;  4DR4 I;  4DR2 E;  1H74 A;  4MYU A;  2UXB I;  4M30 A;  4KHP I;  1X48 A;  4X66 E;  1XMO I;  2KHX A;  1FWK A;  4DR2 I;  5IT9 Q;  4HXZ A;  4X66 I;  4LF7 E;  4DUY I;  1FKA E;  3T1Y E;  4LF7 I;  4YHH E;  1RC7 A;  3T1Y I;  3JAM Q;  4DR3 I;  4X8W A;  4DPU A;  4YHH I;  2UU9 I;  3F0N A;  2DMY A;  4X62 E;  1RQ0 A;  4FN5 A;  1N34 E;  1EA6 A;  4Z7Y A;  3J80 C;  2UUA E;  4USK A;  3ZZ0 A;  1N34 I;  2AJ4 A;  2UUA I;  5IT9 C;  1H7U A;  1UEK A;  4LF4 E;  1H7S A;  4DU7 A;  4LF4 I;  4USM A;  4LF9 E;  1BKN A;  4M2Z A;  3JAM C;  1ZXN A;  3V5R A;  1ZM2 A;  4GKJ E;  2LRS A;  2Q2E B;  2F4V E;  1S16 A;  3J7Y p;  4GKJ I;  1Z5A A;  2BM0 A;  4JI6 E;  4B3M E;  2F4V I;  3HTX A;  2DB2 A;  4GKK E;  1KIJ A;  4PRV A;  1Z0B A;  4JI6 I;  4DR7 E;  4B3M I;  1ZM3 A;  1YYK A;  2L33 A;  2UUB E;  1N0U A;  4P52 A;  4FWH A;  4GKK I;  2L2N A;  4NXN E;  2HK2 A;  2UUB I;  3VYX A;  2YT4 A;  4NXN I;  1T4O A;  1ZXM A;  4HAC A;  4P7A A;  1J5E E;  5IWA I;  4JI8 E;  1PKP A;  3LTO A;  2ZM6 E;  2J7K A;  2LTR A;  4JV5 E;  4JI8 I;  3ZZU A;  2ZM6 I;  2DIX A;  5LMU E;  5LMN E;  4JV5 I;  1WHQ A;  3QT5 A;  5LMU I;  4DU8 A;  5LMN I;  4FWD A;  4DXL A;  1IBM E;  2N3G A;  5LL6 R;  4DV0 E;  3K17 A;  1IBM I;  1XMQ E;  2EFG A;  4DV0 I;  1A6F A;  4M1K A;  2MDR A;  4DR1 E;  2NUF A;  1XMQ I;  1HNW E;  2RTX A;  3K1J A;  1XMO E;  4ED4 A;  1S4E A;  4DR1 I;  1HNW I;  1Z0G A;  2LUQ A;  4DUY E;  1N32 E;  5CFF E;  1HR0 E;  3V2U C;  1OJ4 A;  2LJP A;  1N32 I;  2V2V A;  1ZM9 A;  3WU6 A;  4DR3 E;  1EKZ A;  1HR0 I;  4MYT A;  4B3T E;  2UU9 E;  1IBK E;  3M6A A;  2IHR 1;  2WW4 A;  2HFS A;  4XTJ A;  2NUG A;  4JI1 I;  4B3T I;  2B7V A;  1IBK I;  1DAR A;  3ZM7 A;  4JI4 E;  3Q1Q A;  2V34 A;  4JI4 I;  3J81 Q;  4LF8 I;  2E5L E;  3OTO E;  4AQY E;  2NPF A;  1O0W A;  2E5L I;  3OTO I;  4AQY I;  1FI4 A;  4WUD A;  2L3C A;  4ZVI A;  3B78 A;  1DI2 A;  3B8H A;  3C4B A;  1Z0C A;  2B3T B;  1ZM4 A;  3ADI A;  4PRX A;  2N3H A;  2UXC E;  3J81 C;  2DEJ A;  3PYE A;  1Z0W A;  2UXC I;  1MX0 A;  5GMD A;  4X64 E;  1WUU A;  3CWV A;  3C4T A; 
#chains in the Genus database with same CATH topology
 1A1I A;  5ELW A;  5IWA E;  4K0K E;  3L00 A;  1T4N A;  2EPO A;  3IWC A;  4X64 I;  5C0X C;  1NHI A;  2DSY A;  4P7D A;  4X65 E;  4EMD A;  3ZOQ B;  1XXE A;  1Z5C A;  5DRR A;  4DV2 E;  5K36 C;  1IMU A;  5K36 F;  1VIS A;  2A2C A;  2OI2 A;  4K0K I;  2MC5 A;  1X47 A;  4DV5 I;  4OO1 C;  3ZKB A;  4X65 I;  1UDS A;  4OO1 F;  2EM5 A;  4DV2 I;  1HNZ E;  2EL6 A;  2CTD A;  4LFC E;  1USV A;  1Y5Y A;  2VQE E;  2V8Q B;  2YRM A;  2R42 A;  2RS6 A;  3WU5 A;  4RPF A;  2EJ4 A;  5ADZ A;  2HKJ A;  5JEA A;  1HNZ I;  4BCA A;  4LFC I;  2VQE I;  4LFB I;  2EMY A;  4R2D A;  1KKH A;  2PNM A;  4TUG A;  4ISA A;  4IFD B;  2EE8 A;  1HNX E;  3IWD A;  1NEI A;  4DKK A;  1FJG E;  2PNZ A;  2GO3 A;  1T38 A;  2HFU A;  5AC5 A;  1B62 A;  2EPU A;  1YZ9 A;  2VF3 A;  2CSH A;  2O1T A;  2VES A;  2M4I A;  3RMP A;  1HNX I;  4PU9 A;  1N36 E;  1FJG I;  4FW9 A;  2NA2 A;  2L2M A;  4BBY A;  2EOM A;  2DLQ A;  1P47 A;  1Z0E A;  4HTG A;  1MU5 A;  2CG9 A;  3HUL A;  2V2Z A;  4WPY A;  2WBU A;  4IZK A;  4LOM A;  4LU9 A;  4I3H A;  2K7I A;  4DV7 E;  3THO B;  1N36 I;  1T4L B;  2EM6 A;  4WSP A;  2ELY A;  1YHC A;  1N0V C;  1FWL A;  1K47 A;  2LT7 A;  4OX9 E;  1RRE A;  4FW3 A;  3P3C A;  4DV7 I;  5A2Q Q;  1NHJ A;  4WFT A;  2EMC A;  1XNQ I;  5K36 D;  3PS2 A;  2LO3 A;  2LTS A;  4OX9 I;  4B3S E;  2CGE A;  1I94 E;  2PO2 B;  4MQY A;  2IER A;  2HJJ A;  2LBS B;  1PJT A;  5DNX A;  4WYQ B;  2EPA A;  5JEA D;  4IFD E;  5DNL A;  2PO0 A;  2C39 B;  4B3S I;  3GCM A;  4AIM A;  4AM3 A;  2ENC A;  1I94 I;  2D9H A;  1WJP A;  1Z1B A;  4HY1 A;  2VF1 A;  4DPY A;  4L5N C;  2A2D A;  3B82 A;  3PYF A;  1EH6 A;  2YTN A;  4NZV A;  1VI7 A;  2HK3 A;  2EPK X;  1PVG A;  3H4L A;  1D6T A;  3BID A;  4DR5 I;  2EZ6 A;  1EI1 A;  1UHZ A;  4JI1 E;  1NZ0 A;  2CVE A;  2B9D A;  2X7I A;  2JVA A;  3Q6M A;  3VHT B;  2BA1 D;  3LPS A;  1KYQ A;  2EOI A;  1B63 A;  5A6J A;  1ZU1 A;  3L7Z B;  4DUZ E;  1A1J A;  2BA0 G;  3PYG A;  5DNY A;  4LF5 E;  4URL A;  3EQ1 A;  5A2Q C;  2RSM A;  2JEA B;  4WX9 A;  5GME A;  3WU4 A;  2EN2 A;  2YTG A;  4MU3 A;  4JYA E;  1KTV A;  2DEI A;  2GHF A;  1R6L A;  2GQ0 A;  2K4V A;  4DUZ I;  2EOS A;  2KOU A;  5AC4 A;  4LF5 I;  1STU A;  4LF8 E;  1MGT A;  2EMW A;  4IZJ B;  4BA2 A;  2RPC A;  1DGC A;  2MDG A;  4JI3 E;  4JYA I;  3LLH A;  4JI5 E;  2EP3 A;  2NUE A;  3AV0 A;  2Z5E A;  4YY3 E;  5K36 E;  1A1H A;  5KL3 A;  3HKM A;  4MU0 A;  1ZBT A;  4R1F A;  3ADG A;  1Z0T A;  4JI0 E;  1FNM A;  2ENA A;  4JI3 I;  2RQL A;  2EWL A;  2LMZ A;  4BHB A;  4OO1 E;  1EH7 A;  4ZYE A;  3P3E A;  4JI5 I;  2RSI A;  2YTP A;  4YY3 I;  2PO1 B;  3MHS C;  3Q6N A;  2Z5B B;  4BA1 A;  4JI0 I;  2EQ0 A;  2KON A;  5DRO A;  4KQV A;  1X49 A;  1ZBQ A;  4IFD C;  1ELO A;  2I9I A;  3OML A;  2EPC A;  5KL6 A;  4OOG C;  4IFD F;  4DV4 E;  3UHM A;  4F9C B;  4O4K A;  4OZE A;  2CPN A;  4X62 I;  3M85 D;  2WNR A;  3P06 A;  2V8P A;  2R76 A;  1J26 A;  3ADJ A;  3FIG A;  5C0X A;  4DV4 I;  1G2D C;  2JEB A;  2R1F A;  5A69 A;  4O5G A;  1Y4S A;  4FK5 C;  4FW7 A;  1QNT A;  2JY9 A;  2EPR A;  4RH8 A;  4JI7 E;  1IQS A;  3U1K A;  3M7N G;  2NN6 A;  2UUC E;  4AID A;  3P1X A;  3CDI A;  3GON A;  2HHH E;  4JI7 I;  4JG4 A;  4DPT A;  4DR6 E;  4I8O A;  1QZR A;  2O3Z A;  2UUC I;  3D4J A;  1YH8 A;  1ZR9 A;  4JI2 E;  3ZZT A;  2HHH I;  3PS1 A;  2LUP B;  4LF9 I;  2LCE A;  4DR6 I;  2RS7 A;  5FLX Q;  4BC7 A;  4HYM A;  4UTG A;  2EOZ A;  1YUI A;  1KVK A;  1N3G A;  4JI2 I;  2BM1 A;  4X9J A;  5LLQ A;  4R2C A;  4LFA E;  1MG7 A;  2E1R A;  3QT7 A;  1YYW A;  1NCS A;  2YPN A;  4WXD A;  2VQF E;  4DV5 E;  4R2S A;  1U2R A;  4UT4 A;  3BF2 A;  2YU8 A;  3PYD A;  4DV6 E;  2ENH A;  2HKE A;  1H73 A;  4LFA I;  4P78 A;  1GZ6 A;  2VQF I;  2B7T A;  2ODR C;  3EPK A;  4DV1 E;  2YTO A;  5C0X D;  2ELZ A;  1H72 C;  4DV6 I;  5A6B A;  3PS3 A;  1GQE A;  4LFB E;  2UXD E;  1AAY A;  2XEX A;  4FWG A;  2YTD A;  1PIE A;  2L2K B;  1UDQ A;  4DR7 I;  4DV1 I;  3QT6 A;  3JU0 A;  4GZN C;  4LF6 E;  2NN6 D;  3J7A G;  2UXD I;  1NHH A;  2ZIT A;  2EQ3 A;  2EOX A;  2EOO A;  5BR8 E;  2HGH A;  1ZAA C;  4LF6 I;  1YSA C;  3T1H E;  1Y60 A;  2YU5 A;  4GQU A;  2CZ9 A;  2EM2 A;  1XHK A;  3CWV A;  2JE6 A;  4Z7C A;  2M7Q A;  4J3D A;  5BR8 I;  5KL5 A;  1UDO A;  3T1H I;  2L3J A;  5FLX C;  3EPH A;  2DGC A;  1IQO A;  4HAC B;  1WRJ A;  1YPN A;  5AE2 A;  3HJC A;  3ZKD A;  1J5E I;  1YYO A;  2R3V A;  2JP9 A;  3ADL A;  1WHN A;  1XNQ E;  1G2F C;  1BBO A;  1E3P A;  2YRK A;  1T39 A;  1RR9 A;  4DPW A;  2EN3 A;  2EMG A;  2A25 A;  2LV2 A;  4DV3 E;  4U3B A;  2EOF A;  4B3R E;  1Z59 A;  4O43 A;  1Z0V A;  5JEA B;  2PO2 A;  1QU6 A;  2ADR A;  2EPL X;  3HPS A;  3J7A M;  4ZYG A;  2ZBK B;  2WBT A;  4DV3 I;  5A6B D;  4B3R I;  4NHR A;  2C39 A;  3QT8 A;  1DQ3 A;  2EPZ A;  1IBL E;  4R2A A;  1UBD C;  4F9B B;  1B69 A;  5FWK A;  1N33 E;  2V2Q A;  2CT1 A;  2X36 A;  2BR2 B;  2BV3 A;  4WUC A;  2DMI A;  2EN1 A;  4R2E A;  3VYY A;  1Z5B A;  2IES A;  2EMH A;  1IBL I;  4DR5 E;  1PJQ A;  2GS8 A;  4WUB A;  1N33 I;  2EMI A;  2BBG A;  3M99 B;  2AE8 A;  4NXM E;  1XNR E;  2E72 A;  1UDN A;  2EM8 A;  4KZS A;  2LJH A;  4DR4 E;  1USU A;  4IZK B;  4DPX A;  5JEA C;  2NAB A;  2UXB E;  4KHP E;  1OYP A;  5JEA F;  2J65 A;  4WSG A;  2LE2 A;  5L3J A;  3WU3 A;  3H09 A;  3J80 Q;  4NXM I;  1XNR I;  1UIL A;  4WXC A;  3LNU A;  4DR2 E;  4TUI A;  3L7Z A;  1H74 A;  4DR4 I;  3DD6 A;  4MYU A;  4L8N A;  2UXB I;  2HC5 A;  2MC6 A;  4M30 A;  2WP8 A;  4LCH A;  4KHP I;  1X48 A;  4X66 E;  1PJS A;  1XMO I;  2KHX A;  1FWK A;  4DR2 I;  4N3O A;  3KRN A;  5IT9 Q;  3HXL A;  4RHB B;  4F6M A;  4HXZ A;  4X66 I;  4LF7 E;  4IZJ A;  2PO0 B;  4DUY I;  1FKA E;  3P3G A;  1X6F A;  1X6E A;  3T1Y E;  2F1D A;  2JWO A;  4Q35 B;  2C37 A;  4LF7 I;  3ECR A;  4BMJ A;  4YHH E;  2FGG A;  1RC7 A;  1YUJ A;  3T1Y I;  4IS9 A;  2PO1 A;  3JAM Q;  4DR3 I;  4M0V A;  2Z5B A;  4X8W A;  4DPU A;  4YHH I;  2EM3 A;  2YSP A;  2O1V A;  2UU9 I;  2EN6 A;  2DMY A;  3BGH A;  4IJD A;  1X5W A;  1A1F A;  2EN4 A;  3LML A;  1RQ0 A;  2L92 A;  5KL2 A;  4X62 E;  3F6G A;  4FN5 A;  3K85 A;  2YTI A;  5EKW A;  2BA0 D;  1N34 E;  4Q28 A;  3J80 C;  1EA6 A;  4Z7Y A;  2UUA E;  2EMB A;  4USK A;  5T6J A;  1GTK A;  2F8B A;  2EOH A;  2EM4 A;  2EL5 A;  3ZZ0 A;  2EPP A;  4MLV A;  2EMF A;  1N34 I;  2AJ4 A;  2UUA I;  2EPN A;  4F6N A;  2JXP A;  5IT9 C;  2V87 A;  2JPA A;  1H7U A;  1UEK A;  5K36 A;  2Z5C A;  4LF4 E;  1X6H A;  4DMI A;  2C38 B;  2O1U A;  3B4T A;  3HQ1 A;  2E1M A;  4OO1 A;  1H7S A;  4DU7 A;  1EH8 A;  2EOR A;  5IV8 B;  4LF4 I;  4USM A;  4OKG A;  4LF9 E;  1BKN A;  4M2Z A;  3JAM C;  3F6H A;  2VE7 C;  2PRT A;  1ZXN A;  5DRQ A;  1ZM2 A;  2DLK A;  4O24 A;  4GKJ E;  1OYR A;  3V5R A;  2N8X A;  5KL4 A;  1L4S A;  2EOQ A;  1X3C A;  2LRS A;  3EPJ A;  2Q2E B;  2VRD A;  2EM0 A;  4LCF A;  2F4V E;  2WNR B;  1S16 A;  3J7Y p;  4GKJ I;  1Z5A A;  2BM0 A;  4JI6 E;  4ZYH A;  4MLQ A;  5IXM B;  2EML A;  4B3M E;  3C6K A;  2F4V I;  3HTX A;  2DB2 A;  4ZYD A;  4GKK E;  1Y4U A;  1KIJ A;  1TN9 A;  1Z0B A;  4PRV A;  4JI6 I;  4DR7 E;  3M7N D;  4B3M I;  4R2R A;  1YYK A;  1ZM3 A;  2NN6 B;  1TF3 A;  2L33 A;  2UUB E;  1N0U A;  4P52 A;  4FWH A;  4GKK I;  2V85 A;  2EN7 A;  2M1S A;  3KZZ A;  3QG5 C;  3AUZ A;  2L2N A;  1MEY C;  4NXN E;  1BB8 A;  5JEA E;  2HK2 A;  2UUB I;  1A1K A;  4OO1 D;  2BB8 A;  2EPM X;  2YTQ A;  3VYX A;  4BC9 A;  2EMK A;  2YT4 A;  1OYS A;  4NXN I;  1T4O A;  1ZXM A;  1JK2 A;  2IOQ A;  3IWB A;  1SFE A;  2JOX A;  5C0X F;  2JT2 A;  4NBQ A;  4HAC A;  4P7A A;  1J5E E;  4FW4 A;  5IWA I;  3MSW A;  2PNL A;  4JI8 E;  1PKP A;  1LLM C;  3LTO A;  2NN6 C;  2ZM6 E;  2J7K A;  2L8T A;  2NN6 F;  3F0N A;  2LTR A;  4JV5 E;  4JI8 I;  3ZZU A;  2ZM6 I;  2LJU A;  2DIX A;  5LMU E;  5LMN E;  4JV5 I;  1WHQ A;  2G7H A;  5A6K A;  4FW6 A;  2JR1 A;  3QT5 A;  5KL7 A;  5LMU I;  2DRP A;  4DU8 A;  2BR2 A;  4N4R B;  4FWD A;  5LMN I;  4LCG A;  4DXL A;  2GO4 A;  4IS1 C;  3GLL A;  1IBM E;  2PNZ B;  2N3G A;  3BBG A;  5LL6 R;  4DV0 E;  4GEQ B;  5EL9 A;  3K17 A;  2JE6 B;  1Y6Z A;  1AH5 A;  1IBM I;  2V83 A;  3MHH C;  1XMQ E;  1P42 A;  2EFG A;  3THN A;  2WBS A;  4DV0 I;  2MKD A;  1A6F A;  2YTJ A;  1KJK A;  2JOB A;  3P76 A;  2MDR A;  4DR1 E;  4M1K A;  2NUF A;  4QNK A;  1HNW E;  2RTX A;  1XMQ I;  2BA1 G;  3K1J A;  4LTY A;  1XMO E;  3EPL A;  4U3D A;  4ED4 A;  1S4E A;  2M9A A;  4DR1 I;  1HNW I;  2FV4 B;  3K6Q A;  2GLI A;  4J8Z A;  4KWY A;  4R2P A;  4F2J C;  1Z0G A;  2JEA A;  2EOE A;  1RMD A;  2JYA A;  2LUQ A;  4DUY E;  3DF6 A;  1JK1 A;  4IFD A;  1N32 E;  5CFF E;  3KZY A;  5F3W A;  1HR0 E;  2EN8 A;  3V2U C;  1WXR A;  1OJ4 A;  4F54 A;  4HEI A;  2LJP A;  2O1W A;  2V2V A;  1N32 I;  2YZT A;  4M9V C;  2EL4 A;  2H36 X;  1ZM9 A;  3WU6 A;  4DR3 E;  1EKZ A;  3CDJ A;  1HR0 I;  2J7J A;  4MYT A;  3TQM A;  4B3T E;  3DJW A;  2UU9 E;  1IBK E;  1TF6 A;  3M6A A;  3JTZ A;  2IHR 1;  3KWR A;  4R03 A;  2FTX B;  1RHY A;  2HFS A;  2WW4 A;  4MU4 A;  4XTJ A;  2L6M A;  2NUG A;  4JI1 I;  4B3T I;  2B7V A;  1IBK I;  2EQ1 A;  2EMZ A;  2WP8 B;  2WCC 3;  2EOY A;  4LPF A;  1DAR A;  3M85 G;  2GPI A;  1HK7 A;  2EM9 A;  2YTF A;  5A6A A;  1YFH A;  4BS9 A;  4JI4 E;  3PRY A;  3ZM7 A;  3U1Y A;  3Q1Q A;  2EM7 A;  2C38 A;  5C0X E;  2V34 A;  3C6M A;  4JI4 I;  4IFD D;  3J81 Q;  2LVH A;  2EPX A;  2C37 B;  3VK6 A;  2MKN A;  4BA2 B;  4LF8 I;  5AAS A;  2E5L E;  2EOJ A;  2V86 A;  3OTO E;  4IZJ D;  4AQY E;  2NN6 E;  1BBG A;  2YWQ A;  2NPF A;  1O0W A;  2YSO A;  1SR9 A;  4MU1 A;  3UK3 C;  3OTO I;  2E5L I;  4AQY I;  1FI4 A;  2V89 A;  4MDT A;  4BA1 B;  5AE3 A;  1E3H A;  4BHC A;  3NZK A;  1R6M A;  4FW5 A;  2V88 A;  4WUD A;  2L3C A;  4ZVI A;  3B78 A;  4F9A B;  1UN6 B;  1A1G A;  2EMX A;  1DI2 A;  3B8H A;  4QNJ A;  3C4B A;  1Z0C A;  4R2Q A;  5C0X B;  5AE1 A;  2JEB B;  2B3T B;  1A1L A;  5K36 B;  2Z5C B;  1F2I G;  1ZM4 A;  2YRH A;  2IOP A;  5DRP A;  4R8O A;  3ADI A;  4PRX A;  2Q8U A;  4OO1 B;  2N3H A;  2UXC E;  3J81 C;  2YTE A;  2DEJ A;  1PDA A;  3HPZ A;  2I13 A;  3H1C A;  1Z0W A;  3PYE A;  2UXC I;  1MX0 A;  3GME A;  5GMD A;  5TSE A;  4X64 E;  2ODR D;  1WUU A;  2WZO A;  2EMA A;  3C4T A; 
#chains in the Genus database with same CATH homology
 5IWA E;  4K0K E;  1T4N A;  3IWC A;  4X64 I;  1NHI A;  2DSY A;  4P7D A;  4X65 E;  4EMD A;  3ZOQ B;  1Z5C A;  4DV2 E;  1VIS A;  2A2C A;  2OI2 A;  4K0K I;  2MC5 A;  1X47 A;  4DV5 I;  3ZKB A;  4X65 I;  4DV2 I;  1HNZ E;  4LFC E;  1USV A;  2VQE E;  2V8Q B;  2R42 A;  3WU5 A;  2RS6 A;  4RPF A;  5ADZ A;  2HKJ A;  1HNZ I;  4BCA A;  4LFC I;  2VQE I;  4LFB I;  1KKH A;  2PNM A;  4TUG A;  1HNX E;  3IWD A;  4DKK A;  1FJG E;  2HFU A;  1B62 A;  1YZ9 A;  2VF3 A;  2O1T A;  1HNX I;  2M4I A;  3RMP A;  4PU9 A;  1N36 E;  1FJG I;  4FW9 A;  2NA2 A;  2L2M A;  4BBY A;  1Z0E A;  1MU5 A;  2CG9 A;  3HUL A;  2V2Z A;  4WPY A;  4IZK A;  4I3H A;  4LU9 A;  4DV7 E;  1N36 I;  1T4L B;  4WSP A;  1N0V C;  1FWL A;  1K47 A;  4OX9 E;  1RRE A;  4DV7 I;  5A2Q Q;  1NHJ A;  4WFT A;  1XNQ I;  2LTS A;  4OX9 I;  4B3S E;  2CGE A;  1I94 E;  2LBS B;  4WYQ B;  4B3S I;  1I94 I;  4HY1 A;  2VF1 A;  4DPY A;  4L5N C;  2A2D A;  3B82 A;  3PYF A;  2HK3 A;  1PVG A;  3H4L A;  1D6T A;  4DR5 I;  2EZ6 A;  1EI1 A;  1UHZ A;  4JI1 E;  1NZ0 A;  2B9D A;  2X7I A;  2JVA A;  3Q6M A;  3LPS A;  1B63 A;  4DUZ E;  3PYG A;  5DNY A;  4LF5 E;  4URL A;  5A2Q C;  2RSM A;  5GME A;  3WU4 A;  4JYA E;  1KTV A;  2DEI A;  2GQ0 A;  4DUZ I;  2K4V A;  4LF5 I;  2KOU A;  1STU A;  4LF8 E;  4IZJ B;  4JI3 E;  4JYA I;  3LLH A;  4JI5 E;  2NUE A;  3AV0 A;  2Z5E A;  4YY3 E;  4R1F A;  1ZBT A;  3ADG A;  1Z0T A;  4JI0 E;  1FNM A;  4JI3 I;  2EWL A;  2LMZ A;  4JI5 I;  4YY3 I;  3Q6N A;  2Z5B B;  4JI0 I;  2KON A;  4KQV A;  1X49 A;  1ZBQ A;  1ELO A;  3OML A;  4OOG C;  4DV4 E;  4X62 I;  4F9C B;  2CPN A;  3P06 A;  2V8P A;  1J26 A;  3ADJ A;  3FIG A;  4DV4 I;  1Y4S A;  2JY9 A;  4JI7 E;  2UUC E;  3P1X A;  3GON A;  2HHH E;  4JI7 I;  4JG4 A;  4DPT A;  4DR6 E;  4I8O A;  1QZR A;  2UUC I;  3D4J A;  4JI2 E;  3ZZT A;  2HHH I;  4LF9 I;  2LUP B;  4DR6 I;  2RS7 A;  5FLX Q;  4BC7 A;  4HYM A;  4UTG A;  1KVK A;  4JI2 I;  2BM1 A;  4LFA E;  1MG7 A;  2E1R A;  3QT7 A;  1YYW A;  4DV5 E;  1U2R A;  2VQF E;  4UT4 A;  3PYD A;  4DV6 E;  2HKE A;  1H73 A;  4LFA I;  4P78 A;  1GZ6 A;  2VQF I;  2B7T A;  2ODR C;  4DV1 E;  1H72 C;  4DV6 I;  1GQE A;  4LFB E;  2UXD E;  2XEX A;  4FWG A;  1PIE A;  2L2K B;  4DR7 I;  4DV1 I;  3QT6 A;  3JU0 A;  4LF6 E;  3J7A G;  2UXD I;  1NHH A;  2ZIT A;  5BR8 E;  4LF6 I;  3T1H E;  4Z7C A;  2CZ9 A;  1XHK A;  3CWV A;  2M7Q A;  5BR8 I;  3T1H I;  2L3J A;  5FLX C;  4HAC B;  3ZKD A;  5AE2 A;  3HJC A;  1J5E I;  1YYO A;  2R3V A;  3ADL A;  1WHN A;  1XNQ E;  1RR9 A;  4DPW A;  4DV3 E;  4B3R E;  1Z59 A;  1Z0V A;  1QU6 A;  3HPS A;  3J7A M;  2ZBK B;  4DV3 I;  4B3R I;  3QT8 A;  1DQ3 A;  1IBL E;  5FWK A;  4F9B B;  1N33 E;  2V2Q A;  2X36 A;  2BV3 A;  4WUC A;  3VYY A;  1Z5B A;  1IBL I;  4DR5 E;  2GS8 A;  1N33 I;  4WUB A;  4NXM E;  1XNR E;  4IZK B;  4KZS A;  2LJH A;  4DR4 E;  1USU A;  4DPX A;  2UXB E;  4KHP E;  2LE2 A;  5L3J A;  3WU3 A;  3H09 A;  3J80 Q;  4NXM I;  1XNR I;  1UIL A;  3LNU A;  4DR4 I;  4DR2 E;  4TUI A;  1H74 A;  4MYU A;  4L8N A;  2UXB I;  2MC6 A;  4M30 A;  4KHP I;  1X48 A;  4X66 E;  1XMO I;  2KHX A;  1FWK A;  4DR2 I;  4N3O A;  5IT9 Q;  3HXL A;  4HXZ A;  4X66 I;  4LF7 E;  4IZJ A;  4DUY I;  1FKA E;  3T1Y E;  2JWO A;  4LF7 I;  4BMJ A;  4YHH E;  2FGG A;  1RC7 A;  3T1Y I;  3JAM Q;  4DR3 I;  4M0V A;  2Z5B A;  4X8W A;  4DPU A;  4YHH I;  2O1V A;  2UU9 I;  3F0N A;  2DMY A;  3LML A;  4X62 E;  1RQ0 A;  2L92 A;  3F6G A;  4FN5 A;  3K85 A;  1EA6 A;  1N34 E;  4Q28 A;  3J80 C;  4Z7Y A;  2UUA E;  4USK A;  5T6J A;  2F8B A;  3ZZ0 A;  1N34 I;  2AJ4 A;  2UUA I;  5IT9 C;  1H7U A;  2V87 A;  1UEK A;  2Z5C A;  4LF4 E;  4DMI A;  2O1U A;  3HQ1 A;  2E1M A;  1H7S A;  4DU7 A;  4LF4 I;  4USM A;  4LF9 E;  1BKN A;  4M2Z A;  3JAM C;  3F6H A;  2VE7 C;  1ZXN A;  3V5R A;  1ZM2 A;  4GKJ E;  2LRS A;  2Q2E B;  2F4V E;  1S16 A;  3J7Y p;  4GKJ I;  1Z5A A;  2BM0 A;  4JI6 E;  4B3M E;  2F4V I;  3HTX A;  2DB2 A;  4GKK E;  1Y4U A;  1KIJ A;  4PRV A;  1Z0B A;  4JI6 I;  4DR7 E;  4B3M I;  1YYK A;  1ZM3 A;  2L33 A;  2UUB E;  1N0U A;  4P52 A;  4FWH A;  4GKK I;  2V85 A;  2M1S A;  3AUZ A;  2L2N A;  4NXN E;  2HK2 A;  2UUB I;  3VYX A;  4BC9 A;  2YT4 A;  4NXN I;  1T4O A;  1ZXM A;  2IOQ A;  3IWB A;  2JOX A;  4HAC A;  4P7A A;  1J5E E;  5IWA I;  3MSW A;  2PNL A;  4JI8 E;  1PKP A;  3LTO A;  2ZM6 E;  2J7K A;  2L8T A;  2LTR A;  4JV5 E;  4JI8 I;  3ZZU A;  2ZM6 I;  2DIX A;  5LMU E;  5LMN E;  4JV5 I;  1WHQ A;  2G7H A;  2JR1 A;  3QT5 A;  5LMU I;  4DU8 A;  5LMN I;  4FWD A;  4DXL A;  1IBM E;  2N3G A;  5LL6 R;  4DV0 E;  4GEQ B;  3K17 A;  1Y6Z A;  1IBM I;  2V83 A;  1XMQ E;  2EFG A;  4DV0 I;  1A6F A;  2JOB A;  4M1K A;  2MDR A;  4DR1 E;  2NUF A;  1XMQ I;  1HNW E;  2RTX A;  3K1J A;  4LTY A;  1XMO E;  4ED4 A;  1S4E A;  4DR1 I;  1HNW I;  2FV4 B;  3K6Q A;  4J8Z A;  1Z0G A;  2LUQ A;  4DUY E;  3DF6 A;  1N32 E;  5CFF E;  5F3W A;  1HR0 E;  3V2U C;  1WXR A;  1OJ4 A;  4F54 A;  2LJP A;  2O1W A;  2V2V A;  1N32 I;  2YZT A;  1ZM9 A;  2H36 X;  3WU6 A;  4DR3 E;  1EKZ A;  1HR0 I;  4MYT A;  4B3T E;  3DJW A;  2UU9 E;  1IBK E;  3M6A A;  3JTZ A;  2IHR 1;  3KWR A;  4R03 A;  2FTX B;  2WW4 A;  2HFS A;  4XTJ A;  2L6M A;  2NUG A;  4JI1 I;  4B3T I;  2B7V A;  1IBK I;  1DAR A;  1HK7 A;  3PRY A;  3ZM7 A;  4BS9 A;  4JI4 E;  3Q1Q A;  2V34 A;  4JI4 I;  3J81 Q;  3VK6 A;  4LF8 I;  5AAS A;  2E5L E;  2V86 A;  3OTO E;  4IZJ D;  4AQY E;  2NPF A;  1O0W A;  2E5L I;  1SR9 A;  3OTO I;  4AQY I;  1FI4 A;  2V89 A;  5AE3 A;  4WUD A;  2V88 A;  2L3C A;  4ZVI A;  3B78 A;  4F9A B;  1DI2 A;  3B8H A;  3C4B A;  1Z0C A;  5AE1 A;  2B3T B;  2Z5C B;  1ZM4 A;  2IOP A;  4R8O A;  3ADI A;  4PRX A;  2N3H A;  2UXC E;  3J81 C;  2DEJ A;  3HPZ A;  3PYE A;  1Z0W A;  2UXC I;  1MX0 A;  5GMD A;  4X64 E;  1WUU A;  2ODR D;  2WZO A;  3C4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...