2VQEE

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2vqeE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqeE02
4JV5I 3CWVA 2VQFI 4DV6E 1HNXI 4JI6E 1N33I 1IBLE 4P7AA 4XTJA 1FNMA 2RS6A 1Z0GA 4DV6I 4X8WA 2BV3A 4LF7E 1YYKA 3JAMQ 4AQYE 1HNZE 2A2DA 4ZVIA 1RC7A 4M30A 3VYYA 5LMNI 4NXMI 1ZBTA 1H73A 2LRSA 1XNRE 3B78A 1PKPA 2L3CA 4USKA 1HR0I 4GKJI 4Z7YA 1IBMI 3T1YI 3LPSA 4DV0E 4LF4I 3T1HI 4JI8E 4JI3I 4DPUA 4DR2E 4DU7A 2UUBI 3GONA 4M1KA 3D4JA 3K1JA 4JI4I 2B7VA 3PYDA 2LTRA 4DR3I 2LTSA 5LL6R 2ZBKB 4B3TE 2LJPA 3HULA 4LF8E 2LUQA 1H72C 4LFAI 5CFFE 1WUUA 3PYGA 2RTXA 1UILA 4B3SE 4JI2E 1ELOA 4KHPE 1MU5A 4JI0E 2V8PA 4FN5A 2B3TB 1ZXNA 4JG4A 4WUCA 3ZZUA 5IWAE 1H74A 3V5RA 2LUPB 2UUBE 4LFAE 1XMQE 3PYEA 1KTVA 2RS7A 2VQEE 2BM1A 4DV3I 2E5LE 1FJGE 4JI7I 3B8HA 5L3JA 5A2QC 2UUCE 2EZ6A 3P1XA 1N32E 4MYUA 4JI5I 2KHXA 2R3VA 2UU9I 2DIXA 1N0VC 4DKKA 3QT5A 4UT4A 2VF3A 4YHHE 1ZM4A 4DR7E 2UXDE 4JI3E 1VISA 1XMOE 2F4VE 3J81C 3T1HE 5BR8E 3J81Q 4DPTA 4X66E 1H7SA 4DV5I 2E5LI 3C4BA 4DUYE 3ZZTA 4NXME 4YHHI 1YYWA 1RREA 2DEJA 4URLA 2NUEA 3ZKBA 2GS8A 3QT6A 4WUDA 4X62E 3H4LA 3ADJA 2HHHE 3WU5A 2NUGA 1BKNA 2HKJA 1HNXE 4FWGA 4FW9A 1IBKI 4DR4I 2VQFE 4JI2I 3J7AG 2NA2A 4DPWA 4B3SI 2V2ZA 2CPNA 3Q1QA 4DR1I 1DI2A 3M6AA 4ED4A 4B3TI 2HFUA 4DR3E 4YY3I 1ZM9A 4K0KE 2IHR1 2V2QA 1EKZA 2X7IA 2L2MA 1O0WA 4DR5I 4DR2I 4DUZI 1J5EI 1H7UA 4P52A 1Z0WA 1ZM2A 4HY1A 1RQ0A 1IBME 3C4TA 1XNQI 1HNWI 2ZITA 2ZM6I 2EFGA 1FWLA 4LF5E 2V2VA 2ZM6E 1HNWE 4JI4E 1XHKA 1GQEA 1Z0BA 1FI4A 2CZ9A 3J7Yp 4DR5E 1KVKA 3T1YE 3VYXA 1EI1A 4LF7I 4LF9I 2RSMA 2UUAE 1IBKE 1MG7A 5IT9Q 3F0NA 4KQVA 4JV5E 4R1FA 4DV2E 1STUA 3B82A 4DR1E 4B3RI 4HACB 1NHIA 4LFBE 2UXCI 1S16A 4DV7I 4HXZA 1T4LB 1UEKA 5FLXQ 4HYMA 1PVGA 4DV5E 1B62A 1S4EA 1WHQA 4X66I 2JVAA 2UUAI 1FWKA 2JY9A 4LFBI 2F4VI 1XMOI 1K47A 4X64I 1Z0VA 3ZZ0A 4DR7I 2YT4A 4DV1E 4OX9I 1QZRA 3ADIA 1Z5BA 1OJ4A 3QT8A 1Z0CA 4JI5E 2UXBE 4PU9A 2L3JA 4OOGC 1I94I 5BR8I 1YYOA 1XMQI 3ADLA 5FLXC 2HK2A 4JYAE 2UU9E 2NPFA 2X36A 3OTOI 1N34E 4JI0I 4JI7E 1KKHA 4X65I 5GMDA 2A2CA 1ZXMA 1NZ0A 5LMUI 2LBSB 4DR4E 5IWAI 1J26A 4YY3E 4FWHA 4LF8I 2V34A 2BM0A 5IT9C 4LFCI 4KHPI 1X47A 2J7KA 2HKEA 2R42A 5LMUE 1N0UA 4LF6E 4JI1I 4WFTA 3ADGA 4B3ME 4NXNE 1U2RA 1KIJA 4JI8I 4MYTA 4DUYI 4X65E 4X62I 3LNUA 4GKJE 5GMEA 4I3HA 2N3GA 3ZKDA 5A2QQ 1Z59A 4DPXA 3WU4A 4DV4I 1XNRI 3K17A 3WU3A 2UXDI 4DR6I 4OX9E 2DMYA 1HNZI 2E1RA 2MDRA 4DV0I 1UHZA 4UTGA 2L33A 2UUCI 2NUFA 4DPYA 1D6TA 4DV3E 2VQEI 4JI6I 4DU8A 5LMNE 4EMDA 1Z5CA 4DR6E 2L2KB 4X64E 1Z5AA 1DARA 4PRVA 4USMA 4DV4E 1T4OA 1N32I 4DV2I 4FWDA 1FKAE 3ZM7A 3J80C 1FJGI 1IBLI 3J80Q 4GKKE 3JAMC 4HACA 4NXNI 4B3MI 3QT7A 4JI1E 4LF6I 1Z0EA 4Z7CA 4B3RE 1T4NA 4WUBA 3LLHA 3PYFA 4LFCE 1N34I 2DB2A 2HK3A 4LF5I 1N36E 2N3HA 1ZM3A 4JYAI 4LF9E 1XNQE 4RPFA 1NHHA 3LTOA 3V2UC 2HFSA 1I94E 1WHNA 3OTOE 1HR0E 4PRXA 4K0KI 1X48A 1A6FA 3WU6A 4DXLA 2XEXA 3J7AM 1YZ9A 2AJ4A 1QU6A 1RR9A 1Z0TA 4WYQB 4DV1I 1J5EE 4DUZE 1X49A 2B7TA 4AQYI 4LF4E 3HTXA 2LJHA 1EA6A 2UXBI 1N36I 4GKKI 1B63A 1NHJA 1PIEA 2HHHI 2L2NA 1N33E 2DEIA 2WW4A 4DV7E 2Q2EB 2OI2A 2UXCE 1MX0A 4M2ZA
chains in the Genus database with same CATH superfamily
2WNRA 2EPOA 3PS1A 3M99B 4JV5I 3CWVA 2VQFI 4DV6E 1HNXI 2EJ4A 4JI6E 1N33I 2EOJA 1IBLE 2JOBA 4P7AA 4XTJA 1FNMA 2RS6A 1Z0GA 2PO2A 2VESA 2IERA 4DV6I 4X8WA 2BV3A 2ELZA 4LF7E 2EPUA 1YYKA 3NZKA 3JAMQ 2YTJA 4AQYE 2JWOA 4OO1A 4R03A 4FW4A 5C0XE 1HNZE 2A2DA 3C6KA 4ZVIA 1RC7A 2M1SA 2ADRA 4M30A 1UBDC 3VYYA 1X6EA 3IWCA 5LMNI 4GZNC 4NXMI 1ZBTA 1H73A 2LRSA 1XNRE 5K36F 2Z5CB 3B78A 1PKPA 3HKMA 3Q6MA 4BMJA 1L4SA 4LPFA 2L3CA 2EMWA 2VF1A 4USKA 1HR0I 3P3CA 2ENHA 2Q8UA 1TF6A 1Y6ZA 4Z7YA 5DNLA 4GKJI 1IBMI 4F6MA 2K4VA 3T1YI 3C6MA 4DV0E 3LPSA 4LF4I 1PDAA 3T1HI 1A1HA 4JI8E 2EE8A 4BA1B 4JI3I 2EN2A 4DPUA 1YH8A 4DR2E 2JT2A 4DU7A 2NN6F 2EPNA 2UUBI 4IZJA 1RHYA 5DRRA 3GONA 5IXMB 4LCFA 2PNLA 4M1KA 4J8ZA 3D4JA 5T6JA 3F6HA 5KL7A 3K1JA 4JI4I 2C39B 2EMBA 2B7VA 3PYDA 2LTRA 3M7ND 2WP8A 4DR3I 2YTGA 2A25A 2LTSA 5LL6R 4IZKA 2CSHA 2ZBKB 4OO1E 3MHSC 4B3TE 2LJPA 3HULA 4N3OA 2EN3A 4LF8E 1OYSA 2EM4A 2LUQA 3IWDA 1H72C 1MEYC 3THOB 4LFAI 5CFFE 4WSPA 1WUUA 3PYGA 2RTXA 2VE7C 1UILA 4B3SE 1IQOA 3P3EA 3JU0A 1R6MA 4JI2E 4P7DA 2F1DA 2RSIA 2NN6A 3HPSA 4R2QA 1ELOA 2CG9A 4KHPE 1JK2A 4JI0E 2EPCA 2EOZA 1MU5A 4FW7A 2EOMA 2V8PA 4FN5A 4BA2B 1VI7A 2B3TB 1ZXNA 2Z5EA 4JG4A 4WUCA 3ZZUA 2DLKA 3FIGA 1UDOA 5IWAE 1H74A 2EQ3A 2LMZA 3V5RA 1YSAC 2LUPB 3DF6A 1DQ3A 4F54A 2V85A 2UUBE 2EL4A 4LFAE 5A6BA 1T39A 2O1WA 1XMQE 1SFEA 3PYEA 4MU0A 1KTVA 4M9VC 2RS7A 2VQEE 2YRMA 2BM1A 2ZM6I 1WXRA 3M85G 4DV3I 2E5LE 1FJGE 4JI7I 3B8HA 4OO1F 4MU4A 5A2QC 5L3JA 2B9DA 2CT1A 3GLLA 2JR1A 2YTNA 3CDJA 2UUCE 4LCGA 2V8QB 2EZ6A 2LV2A 3P1XA 1N32E 1E3PA 4MYUA 4OKGA 4JI5I 5DRQA 2KHXA 4Q35B 5A69A 5DNYA 1A1KA 2R3VA 3KZYA 2UU9I 2DIXA 2YSOA 2LVHA 1N0VC 4DKKA 3QT5A 4UT4A 4GQUA 2VF3A 4YHHE 1ZM4A 4DR7E 3CDIA 2EMCA 2YRKA 2UXDE 4JI3E 1VISA 1Y4SA 1XMOE 4U3DA 4NZVA 2F4VE 3J81C 3T1HE 5BR8E 2BA0D 2EOEA 3J81Q 4DPTA 2ODRD 2JE6B 3PS2A 2JEAA 4X66E 3EPLA 3PS3A 5DRPA 2EM8A 2YTOA 2K7IA 2E1MA 1H7SA 3GCMA 2MC6A 4BA1A 2YTQA 4DV5I 3C4BA 4DUYE 2E5LI 1UDSA 3ZZTA 5K36B 2RPCA 3U1YA 2EOIA 4MLQA 4NXME 1AH5A 2EMHA 4YHHI 4IFDF 1YYWA 1RREA 2JEBA 2DEJA 4MLVA 1P42A 4URLA 4R2AA 1YUJA 3M7NG 1F2IG 2CTDA 1IMUA 2HGHA 5A6AA 2NUEA 3ZKBA 3KZZA 3VHTB 2GS8A 4IFDB 5K36C 1T38A 3QT6A 4WUDA 2H36X 4X62E 3H4LA 1EH7A 3ADJA 2HHHE 3WU5A 2NUGA 1BKNA 2HKJA 3BIDA 1HNXE 2EMFA 4FWGA 4FW9A 2VQFE 1IBKI 4DR4I 1ZAAC 3J7AG 4JI2I 2LCEA 2NA2A 4AIMA 2EN8A 4L5NC 2O1TA 2V2ZA 4DPWA 4B3SI 2CPNA 3EQ1A 1A1FA 3Q1QA 4TUGA 4DR1I 1LLMC 2L6MA 1DI2A 4OO1C 3M6AA 2PO1A 2I13A 2EQ0A 1TN9A 4ED4A 1KYQA 5C0XF 2EM5A 4B3TI 2YTDA 4R8OA 2YRHA 2F8BA 4Q28A 1A1JA 1R6LA 1USUA 2HFUA 3QG5C 4DR3E 4F9CB 4YY3I 5JEAD 5K36E 1ZM9A 4OO1B 4K0KE 2I9IA 2IHR1 4OO1D 2V2QA 2KONA 1EKZA 2X7IA 3LMLA 2L2MA 1Y60A 1UDNA 1O0WA 2BA1D 4DR5I 4DR2I 2WBUA 2O1VA 1YFHA 4DUZI 1J5EI 1TF3A 2EOYA 1Y5YA 2Z5CA 5ELWA 2JOXA 1H7UA 4P52A 1Z0WA 4BBYA 4QNJA 1ZM2A 2L8TA 4HY1A 1RQ0A 5C0XC 1IBME 3C4TA 1XNQI 2RQLA 4BC9A 2WNRB 4MU3A 1HNWI 1X6HA 2EMIA 4R2RA 2EFGA 1FWLA 2NN6D 5F3WA 4LF5E 5AE1A 2IOPA 1ZU1A 2ZM6E 2V2VA 1HNWE 2CVEA 2V83A 4JI4E 2EMAA 2ENCA 2V88A 1XHKA 4ISAA 4O24A 1GQEA 3KWRA 1Z0BA 1UN6B 2EM0A 5C0XB 3AV0A 4F9AB 1FI4A 2CZ9A 3J7Yp 4DR5E 4J3DA 2EOFA 4OZEA 2EMGA 2GLIA 3T1YE 1KVKA 3VYXA 2J7JA 1EI1A 2EPXA 3MSWA 1PJQA 4O43A 2RSMA 2EN1A 5TSEA 4LF7I 1P47A 2UUAE 3U1KA 2GPIA 4LF9I 4ZYEA 1IBKE 4R2EA 3H1CA 2PRTA 1MG7A 5IT9Q 4LU9A 1DGCA 4BHBA 2NN6C 2DGCA 2O3ZA 2NABA 2WZOA 3F0NA 1ZR9A 3MHHC 4JV5E 4KQVA 3H09A 4X9JA 2E72A 4DV2E 4R1FA 5JEAB 5KL5A 1STUA 2GO4A 4DR1E 3B82A 5AC4A 3TQMA 4HACB 4B3RI 3Q6NA 1NHIA 5DROA 4LFBE 2EWLA 1GZ6A 1HK7A 2UXCI 2EORA 2V87A 4LTYA 1S16A 3K85A 2JPAA 4KWYA 4AIDA 4DV7I 4HXZA 1T4LB 1UEKA 2M4IA 3THNA 4U3BA 5FLXQ 2O1UA 4HYMA 2EMYA 1WRJA 1PVGA 2EOSA 4DV5E 2BA1G 1B62A 1S4EA 1WHQA 4X66I 2JVAA 2UUAI 1G2FC 1FWKA 3K6QA 2JY9A 4LFBI 5KL4A 2PNZA 2F4VI 2BB8A 2EPLX 3P3GA 1XMOI 1K47A 4X64I 2C39A 1Z0VA 3ZZ0A 4DR7I 2YT4A 4DV1E 2Z5BA 4OX9I 1QZRA 3ADIA 1Z5BA 2EOQA 1OJ4A 2GQ0A 3QT8A 4FW3A 1Z0CA 3P76A 4N4RB 4JI5E 2NN6B 2DRPA 2UXBE 4BHCA 4FW6A 2EL5A 2C37A 4PU9A 4WXDA 3L7ZA 2L3JA 4OOGC 1I94I 4I8OA 5BR8I 2EPAA 3HXLA 2MKNA 1YYOA 1A1IA 4HTGA 2FGGA 1WJPA 2L92A 3EPKA 1XMQI 3DJWA 3ADLA 2YTFA 1UDQA 5FLXC 4BCAA 4F2JC 2HK2A 4IFDE 4JYAE 2UU9E 1IQSA 3GMEA 2EOXA 4DMIA 2EMLA 2GHFA 2X36A 2NPFA 4WSGA 2BR2B 5JEAC 3AUZA 5KL6A 1YHCA 1EH6A 3OTOI 1N34E 2DSYA 4JI0I 4JI7E 1KKHA 4X65I 5GMDA 4M0VA 1PJSA 5AC5A 4AM3A 2WCC3 2YSPA 2V89A 2YTEA 2A2CA 2C38B 1PJTA 1BBGA 2FTXB 2M9AA 2VRDA 2EM7A 1NZ0A 1ZXMA 5LMUI 2LBSB 2EN7A 2PO0B 4DR4E 1OYRA 2BA0G 2LJUA 5IWAI 1J26A 4YY3E 2R1FA 4IFDC 2ENAA 3ZOQB 4FWHA 4P78A 4LF8I 2AE8A 2EM3A 2V34A 4BC7A 5IT9C 2BM0A 3UHMA 5JEAA 4R2DA 2EPRA 4LFCI 3OMLA 1NCSA 3HQ1A 4RH8A 1B69A 1MGTA 4KHPI 1X47A 2J7KA 2HKEA 2PO2B 2R42A 4IS1C 5LMUE 4KZSA 1N0UA 2EMXA 4LF6E 4JI1I 4MQYA 2EM9A 2EQ1A 4WFTA 4WPYA 3ADGA 1NEIA 4B3ME 4NXNE 1U2RA 5JEAE 4LCHA 5AE3A 1KIJA 2WP8B 2EOOA 2G7HA 4JI8I 4MYTA 3M85D 4DUYI 2MC5A 4X65E 2JP9A 4X62I 3LNUA 4MDTA 4GKJE 2LO3A 5GMEA 1SR9A 2V86A 4I3HA 2N3GA 3ZKDA 5A2QQ 1Z59A 2YU5A 4WX9A 4DPXA 3WU4A 4DV4I 1XNRI 3HJCA 3K17A 3WU3A 2UXDI 4DR6I 4OX9E 2DMYA 2JXPA 2E1RA 4R2CA 1HNZI 2MDRA 2MKDA 4DV0I 4BA2A 2YZTA 1UHZA 4UTGA 3ECRA 3L7ZB 4IJDA 5IV8B 5LLQA 2PNMA 5JEAF 1Y4UA 2L33A 2UUCI 3B4TA 2IOQA 2NUFA 1AAYA 4F9BB 2IESA 4DPYA 2EPKX 1YUIA 5FWKA 1D6TA 2KOUA 5KL2A 4IZKB 5KL3A 2LE2A 4DV3E 1BB8A 1USVA 5C0XD 2VQEI 4JI6I 4DU8A 5LMNE 4EMDA 2MDGA 4NBQA 5AASA 2PO1B 4HEIA 4DR6E 2L2KB 1Z5CA 4R2PA 3L00A 1ZBQA 4X64E 4FK5C 1DARA 1Z5AA 1A1LA 4PRVA 4DV4E 4USMA 1T4OA 5A6JA 1N32I 4DV2I 4FWDA 4ZYDA 2JYAA 4BS9A 1FKAE 3ZM7A 2YU8A 3J80C 2YWQA 5K36D 2EM2A 2WBTA 2C38A 1IBLI 3J80Q 1FJGI 4O5GA 4GKKE 3JAMC 4HACA 1N3GA 3BBGA 4NXNI 5AE2A 4B3MI 4F6NA 2M7QA 1YPNA 3QT7A 2PO0A 4JI1E 1A1GA 4LF6I 1Z0EA 2EPMX 5K36A 2BBGA 4Z7CA 4B3RE 1T4NA 2N8XA 3F6GA 3IWBA 3LLHA 4WUBA 2JEAB 3PYFA 2J65A 5EKWA 4LFCE 2JEBB 3DD6A 3RMPA 1N34I 4QNKA 2YPNA 1E3HA 1OYPA 2DB2A 2HK3A 4IS9A 1X5WA 2GO3A 1QNTA 2YTIA 4LF5I 2EM6A 5ADZA 1N36E 3UK3C 2PNZB 5C0XA 2N3HA 3PRYA 1JK1A 4RHBB 1ZM3A 4R2SA 4IFDA 4LF9E 4JYAI 4ZYGA 1XNQE 5DNXA 5EL9A 4RPFA 2EN6A 2D9HA 2EL6A 1NHHA 1G2DC 3LTOA 3V2UC 2HFSA 2HJJA 3HPZA 1I94E 4NHRA 1WHNA 1BBOA 3BF2A 3OTOE 4IZJB 1HR0E 2HC5A 4PRXA 4K0KI 1X48A 1A6FA 3WU6A 4DXLA 5A6KA 2XEXA 3J7AM 2EN4A 2ODRC 2R76A 1EH8A 3JTZA 4IZJD 2FV4B 1YZ9A 2JE6A 4IFDD 2AJ4A 1X3CA 4O4KA 1RMDA 1QU6A 1RR9A 2DMIA 1Z0TA 2NN6E 3BGHA 3EPJA 4WYQB 4DV1I 5A6BD 2EMKA 2ELYA 2WBSA 1J5EE 4L8NA 1X49A 4DUZE 4LOMA 2B7TA 2BR2A 4AQYI 4TUIA 4LF4E 3KRNA 4M2ZA 3HTXA 2LJHA 2Z5BB 4MU1A 1KJKA 1EA6A 2EP3A 4ZYHA 2UXBI 1N36I 4GKKI 1B63A 2YTPA 1NHJA 1PIEA 2HHHI 2EPPA 2L2NA 1X6FA 4WXCA 3EPHA 1N33E 2EOHA 2EMZA 4FW5A 2LT7A 4GEQB 3P06A 2DEIA 2WW4A 2EPZA 2CGEA 4DV7E 2Q2EB 2OI2A 2C37B 2UXCE 2ZITA 1MX0A 1XXEA 1GTKA 3VK6A 1Z1BA 2DLQA
chains in the Genus database with same CATH topology
4JV5I 3CWVA 2VQFI 4DV6E 1HNXI 4JI6E 1N33I 1IBLE 2JOBA 4P7AA 4XTJA 1FNMA 2RS6A 1Z0GA 4DV6I 4X8WA 2BV3A 4LF7E 1YYKA 3JAMQ 4AQYE 2JWOA 4R03A 1HNZE 2A2DA 4ZVIA 1RC7A 2M1SA 4M30A 3VYYA 3IWCA 5LMNI 4NXMI 1ZBTA 1H73A 2LRSA 1XNRE 2Z5CB 3B78A 1PKPA 3Q6MA 4BMJA 2L3CA 2VF1A 4USKA 1HR0I 4GKJI 1Y6ZA 4Z7YA 1IBMI 2K4VA 3T1YI 3LPSA 4DV0E 4LF4I 3T1HI 4JI8E 4JI3I 4DPUA 4DR2E 4DU7A 2UUBI 4IZJA 3GONA 2PNLA 4M1KA 4J8ZA 3D4JA 5T6JA 3F6HA 3K1JA 4JI4I 2B7VA 3PYDA 2LTRA 4DR3I 2LTSA 4IZKA 5LL6R 2ZBKB 4B3TE 2LJPA 3HULA 4N3OA 4LF8E 2LUQA 3IWDA 1H72C 4LFAI 5CFFE 4WSPA 1WUUA 3PYGA 2RTXA 2VE7C 1UILA 4B3SE 3JU0A 4JI2E 4P7DA 3HPSA 1ELOA 2CG9A 4KHPE 1MU5A 4JI0E 2V8PA 4FN5A 2B3TB 1ZXNA 2Z5EA 4JG4A 4WUCA 3ZZUA 3FIGA 5IWAE 1H74A 2LMZA 3V5RA 2LUPB 3DF6A 1DQ3A 4F54A 2V85A 4LFAE 2UUBE 2O1WA 1XMQE 3PYEA 1KTVA 2RS7A 2VQEE 2BM1A 4DV3I 1WXRA 2E5LE 1FJGE 4JI7I 3B8HA 5L3JA 5A2QC 2B9DA 2JR1A 2UUCE 2V8QB 2EZ6A 3P1XA 1N32E 4MYUA 4JI5I 2KHXA 2R3VA 5DNYA 2UU9I 2DIXA 1N0VC 4DKKA 3QT5A 4UT4A 2VF3A 4YHHE 1ZM4A 4DR7E 2UXDE 4JI3E 1VISA 1Y4SA 1XMOE 2F4VE 3J81C 3T1HE 5BR8E 3J81Q 4DPTA 2ODRD 4X66E 1H7SA 2E1MA 4DV5I 2MC6A 2E5LI 3C4BA 4DUYE 3ZZTA 4NXME 4YHHI 1YYWA 1RREA 2DEJA 4URLA 2NUEA 3ZKBA 2GS8A 3QT6A 4WUDA 2H36X 4X62E 3H4LA 3ADJA 2HHHE 3WU5A 2NUGA 1BKNA 2HKJA 1HNXE 4FWGA 4FW9A 1IBKI 4DR4I 2VQFE 3J7AG 4JI2I 2NA2A 4L5NC 2O1TA 4DPWA 2V2ZA 4B3SI 2CPNA 3Q1QA 4TUGA 4DR1I 2L6MA 1DI2A 3M6AA 4ED4A 4B3TI 4R8OA 2F8BA 4Q28A 1USUA 2HFUA 4DR3E 4F9CB 4YY3I 1ZM9A 4K0KE 2IHR1 2V2QA 2KONA 1EKZA 2X7IA 3LMLA 2L2MA 1O0WA 4DR5I 4DR2I 2O1VA 4DUZI 1J5EI 2Z5CA 2JOXA 1H7UA 4P52A 1Z0WA 4BBYA 1ZM2A 2L8TA 4HY1A 1RQ0A 1IBME 3C4TA 1XNQI 4BC9A 1HNWI 2ZITA 4IZJD 2EFGA 1FWLA 2ZM6I 5F3WA 4LF5E 5AE1A 2IOPA 2ZM6E 2V2VA 1HNWE 2V83A 4JI4E 2V88A 1XHKA 1GQEA 3KWRA 1Z0BA 3AV0A 4F9AB 1FI4A 2CZ9A 3J7Yp 4DR5E 1KVKA 3T1YE 3VYXA 1EI1A 3MSWA 4LF7I 4LF9I 2RSMA 2UUAE 1IBKE 1MG7A 5IT9Q 4LU9A 2WZOA 3F0NA 4KQVA 4JV5E 3H09A 4R1FA 4DV2E 1STUA 3B82A 4DR1E 4B3RI 4HACB 3Q6NA 1NHIA 4LFBE 2EWLA 1GZ6A 1HK7A 2UXCI 2V87A 4LTYA 1S16A 3K85A 4DV7I 4HXZA 1T4LB 1UEKA 2M4IA 5FLXQ 2O1UA 4HYMA 1PVGA 4DV5E 1B62A 1S4EA 1WHQA 4X66I 2JVAA 2UUAI 1FWKA 3K6QA 2JY9A 4LFBI 2F4VI 1XMOI 1K47A 4X64I 1Z0VA 3ZZ0A 4DR7I 2YT4A 4DV1E 2Z5BA 4OX9I 1QZRA 3ADIA 1Z5BA 1OJ4A 2GQ0A 3QT8A 1Z0CA 4JI5E 2UXBE 4PU9A 2L3JA 4OOGC 1I94I 4I8OA 5BR8I 3HXLA 1YYOA 2FGGA 2L92A 1XMQI 3DJWA 3ADLA 5FLXC 4BCAA 2HK2A 4JYAE 2UU9E 4DMIA 2NPFA 2X36A 3AUZA 3OTOI 1N34E 2DSYA 4JI0I 4JI7E 1KKHA 4X65I 5GMDA 4M0VA 2V89A 2A2CA 2FTXB 1ZXMA 1NZ0A 5LMUI 2LBSB 4DR4E 5IWAI 1J26A 4YY3E 3ZOQB 4FWHA 4P78A 4LF8I 2V34A 4BC7A 5IT9C 2BM0A 4LFCI 3OMLA 3HQ1A 4KHPI 1X47A 2J7KA 2HKEA 2R42A 5LMUE 4KZSA 1N0UA 4LF6E 4JI1I 4WFTA 4WPYA 3ADGA 4B3ME 4NXNE 1U2RA 5AE3A 1KIJA 2G7HA 4JI8I 4MYTA 4DUYI 2MC5A 4X65E 4X62I 3LNUA 4GKJE 5GMEA 1SR9A 2V86A 4I3HA 2N3GA 3ZKDA 5A2QQ 1Z59A 4DPXA 3WU4A 4DV4I 1XNRI 3HJCA 3K17A 3WU3A 2UXDI 4DR6I 4OX9E 2DMYA 1HNZI 2E1RA 2MDRA 4DV0I 2YZTA 1UHZA 4UTGA 2PNMA 1Y4UA 2L33A 2UUCI 2IOQA 2NUFA 4F9BB 4DPYA 5FWKA 1D6TA 2KOUA 4IZKB 4DV3E 2LE2A 2VQEI 1USVA 4JI6I 4DU8A 5LMNE 4EMDA 5AASA 1Z5CA 4DR6E 2L2KB 1ZBQA 4X64E 1Z5AA 1DARA 4PRVA 4USMA 4DV4E 1T4OA 1N32I 4DV2I 4FWDA 4BS9A 1FKAE 3ZM7A 3J80C 1FJGI 1IBLI 3J80Q 4GKKE 3JAMC 4HACA 4NXNI 5AE2A 4B3MI 2M7QA 3QT7A 4JI1E 4LF6I 1Z0EA 4Z7CA 4B3RE 1T4NA 4WUBA 3F6GA 3IWBA 3LLHA 3PYFA 4LFCE 3RMPA 1N34I 2DB2A 2HK3A 4LF5I 5ADZA 1N36E 2N3HA 3PRYA 1ZM3A 4JYAI 4LF9E 1XNQE 4RPFA 1NHHA 3LTOA 3V2UC 2HFSA 3HPZA 1I94E 1WHNA 3OTOE 4IZJB 1HR0E 4PRXA 4K0KI 1X48A 1A6FA 3WU6A 4DXLA 2XEXA 3J7AM 2ODRC 3JTZA 2FV4B 1YZ9A 2AJ4A 1QU6A 1RR9A 1Z0TA 4WYQB 4DV1I 1J5EE 4DUZE 1X49A 4L8NA 2B7TA 4AQYI 4TUIA 4LF4E 4M2ZA 3HTXA 2LJHA 2Z5BB 1EA6A 2UXBI 1N36I 4GKKI 1B63A 1NHJA 1PIEA 2HHHI 2L2NA 1N33E 4GEQB 3P06A 2DEIA 2WW4A 2CGEA 4DV7E 2Q2EB 2OI2A 2UXCE 1MX0A 3VK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 I;  3CWV A;  2VQF I;  4DV6 E;  1HNX I;  4JI6 E;  1N33 I;  1IBL E;  4P7A A;  4XTJ A;  1FNM A;  2RS6 A;  1Z0G A;  4DV6 I;  4X8W A;  2BV3 A;  4LF7 E;  1YYK A;  3JAM Q;  4AQY E;  1HNZ E;  2A2D A;  4ZVI A;  1RC7 A;  4M30 A;  3VYY A;  5LMN I;  4NXM I;  1ZBT A;  1H73 A;  2LRS A;  1XNR E;  3B78 A;  1PKP A;  2L3C A;  4USK A;  1HR0 I;  4GKJ I;  4Z7Y A;  1IBM I;  3T1Y I;  3LPS A;  4DV0 E;  4LF4 I;  3T1H I;  4JI8 E;  4JI3 I;  4DPU A;  4DR2 E;  4DU7 A;  2UUB I;  3GON A;  4M1K A;  3D4J A;  3K1J A;  4JI4 I;  2B7V A;  3PYD A;  2LTR A;  4DR3 I;  2LTS A;  5LL6 R;  2ZBK B;  4B3T E;  2LJP A;  3HUL A;  4LF8 E;  2LUQ A;  1H72 C;  4LFA I;  5CFF E;  1WUU A;  3PYG A;  2RTX A;  1UIL A;  4B3S E;  4JI2 E;  1ELO A;  4KHP E;  1MU5 A;  4JI0 E;  2V8P A;  4FN5 A;  2B3T B;  1ZXN A;  4JG4 A;  4WUC A;  3ZZU A;  5IWA E;  1H74 A;  3V5R A;  2LUP B;  2UUB E;  4LFA E;  1XMQ E;  3PYE A;  1KTV A;  2RS7 A;  2VQE E;  2BM1 A;  4DV3 I;  2E5L E;  1FJG E;  4JI7 I;  3B8H A;  5L3J A;  5A2Q C;  2UUC E;  2EZ6 A;  3P1X A;  1N32 E;  4MYU A;  4JI5 I;  2KHX A;  2R3V A;  2UU9 I;  2DIX A;  1N0V C;  4DKK A;  3QT5 A;  4UT4 A;  2VF3 A;  4YHH E;  1ZM4 A;  4DR7 E;  2UXD E;  4JI3 E;  1VIS A;  1XMO E;  2F4V E;  3J81 C;  3T1H E;  5BR8 E;  3J81 Q;  4DPT A;  4X66 E;  1H7S A;  4DV5 I;  2E5L I;  3C4B A;  4DUY E;  3ZZT A;  4NXM E;  4YHH I;  1YYW A;  1RRE A;  2DEJ A;  4URL A;  2NUE A;  3ZKB A;  2GS8 A;  3QT6 A;  4WUD A;  4X62 E;  3H4L A;  3ADJ A;  2HHH E;  3WU5 A;  2NUG A;  1BKN A;  2HKJ A;  1HNX E;  4FWG A;  4FW9 A;  1IBK I;  4DR4 I;  2VQF E;  4JI2 I;  3J7A G;  2NA2 A;  4DPW A;  4B3S I;  2V2Z A;  2CPN A;  3Q1Q A;  4DR1 I;  1DI2 A;  3M6A A;  4ED4 A;  4B3T I;  2HFU A;  4DR3 E;  4YY3 I;  1ZM9 A;  4K0K E;  2IHR 1;  2V2Q A;  1EKZ A;  2X7I A;  2L2M A;  1O0W A;  4DR5 I;  4DR2 I;  4DUZ I;  1J5E I;  1H7U A;  4P52 A;  1Z0W A;  1ZM2 A;  4HY1 A;  1RQ0 A;  1IBM E;  3C4T A;  1XNQ I;  1HNW I;  2ZIT A;  2ZM6 I;  2EFG A;  1FWL A;  4LF5 E;  2V2V A;  2ZM6 E;  1HNW E;  4JI4 E;  1XHK A;  1GQE A;  1Z0B A;  1FI4 A;  2CZ9 A;  3J7Y p;  4DR5 E;  1KVK A;  3T1Y E;  3VYX A;  1EI1 A;  4LF7 I;  4LF9 I;  2RSM A;  2UUA E;  1IBK E;  1MG7 A;  5IT9 Q;  3F0N A;  4KQV A;  4JV5 E;  4R1F A;  4DV2 E;  1STU A;  3B82 A;  4DR1 E;  4B3R I;  4HAC B;  1NHI A;  4LFB E;  2UXC I;  1S16 A;  4DV7 I;  4HXZ A;  1T4L B;  1UEK A;  5FLX Q;  4HYM A;  1PVG A;  4DV5 E;  1B62 A;  1S4E A;  1WHQ A;  4X66 I;  2JVA A;  2UUA I;  1FWK A;  2JY9 A;  4LFB I;  2F4V I;  1XMO I;  1K47 A;  4X64 I;  1Z0V A;  3ZZ0 A;  4DR7 I;  2YT4 A;  4DV1 E;  4OX9 I;  1QZR A;  3ADI A;  1Z5B A;  1OJ4 A;  3QT8 A;  1Z0C A;  4JI5 E;  2UXB E;  4PU9 A;  2L3J A;  4OOG C;  1I94 I;  5BR8 I;  1YYO A;  1XMQ I;  3ADL A;  5FLX C;  2HK2 A;  4JYA E;  2UU9 E;  2NPF A;  2X36 A;  3OTO I;  1N34 E;  4JI0 I;  4JI7 E;  1KKH A;  4X65 I;  5GMD A;  2A2C A;  1ZXM A;  1NZ0 A;  5LMU I;  2LBS B;  4DR4 E;  5IWA I;  1J26 A;  4YY3 E;  4FWH A;  4LF8 I;  2V34 A;  2BM0 A;  5IT9 C;  4LFC I;  4KHP I;  1X47 A;  2J7K A;  2HKE A;  2R42 A;  5LMU E;  1N0U A;  4LF6 E;  4JI1 I;  4WFT A;  3ADG A;  4B3M E;  4NXN E;  1U2R A;  1KIJ A;  4JI8 I;  4MYT A;  4DUY I;  4X65 E;  4X62 I;  3LNU A;  4GKJ E;  5GME A;  4I3H A;  2N3G A;  3ZKD A;  5A2Q Q;  1Z59 A;  4DPX A;  3WU4 A;  4DV4 I;  1XNR I;  3K17 A;  3WU3 A;  2UXD I;  4DR6 I;  4OX9 E;  2DMY A;  1HNZ I;  2E1R A;  2MDR A;  4DV0 I;  1UHZ A;  4UTG A;  2L33 A;  2UUC I;  2NUF A;  4DPY A;  1D6T A;  4DV3 E;  2VQE I;  4JI6 I;  4DU8 A;  5LMN E;  4EMD A;  1Z5C A;  4DR6 E;  2L2K B;  4X64 E;  1Z5A A;  1DAR A;  4PRV A;  4USM A;  4DV4 E;  1T4O A;  1N32 I;  4DV2 I;  4FWD A;  1FKA E;  3ZM7 A;  3J80 C;  1FJG I;  1IBL I;  3J80 Q;  4GKK E;  3JAM C;  4HAC A;  4NXN I;  4B3M I;  3QT7 A;  4JI1 E;  4LF6 I;  1Z0E A;  4Z7C A;  4B3R E;  1T4N A;  4WUB A;  3LLH A;  3PYF A;  4LFC E;  1N34 I;  2DB2 A;  2HK3 A;  4LF5 I;  1N36 E;  2N3H A;  1ZM3 A;  4JYA I;  4LF9 E;  1XNQ E;  4RPF A;  1NHH A;  3LTO A;  3V2U C;  2HFS A;  1I94 E;  1WHN A;  3OTO E;  1HR0 E;  4PRX A;  4K0K I;  1X48 A;  1A6F A;  3WU6 A;  4DXL A;  2XEX A;  3J7A M;  1YZ9 A;  2AJ4 A;  1QU6 A;  1RR9 A;  1Z0T A;  4WYQ B;  4DV1 I;  1J5E E;  4DUZ E;  1X49 A;  2B7T A;  4AQY I;  4LF4 E;  3HTX A;  2LJH A;  1EA6 A;  2UXB I;  1N36 I;  4GKK I;  1B63 A;  1NHJ A;  1PIE A;  2HHH I;  2L2N A;  1N33 E;  2DEI A;  2WW4 A;  4DV7 E;  2Q2E B;  2OI2 A;  2UXC E;  1MX0 A;  4M2Z A; 
#chains in the Genus database with same CATH topology
 2WNR A;  2EPO A;  3PS1 A;  3M99 B;  4JV5 I;  3CWV A;  2VQF I;  4DV6 E;  1HNX I;  2EJ4 A;  4JI6 E;  1N33 I;  2EOJ A;  1IBL E;  2JOB A;  4P7A A;  4XTJ A;  1FNM A;  2RS6 A;  1Z0G A;  2PO2 A;  2VES A;  2IER A;  4DV6 I;  4X8W A;  2BV3 A;  2ELZ A;  4LF7 E;  2EPU A;  1YYK A;  3NZK A;  3JAM Q;  2YTJ A;  4AQY E;  2JWO A;  4OO1 A;  4R03 A;  4FW4 A;  5C0X E;  1HNZ E;  2A2D A;  3C6K A;  4ZVI A;  1RC7 A;  2M1S A;  2ADR A;  4M30 A;  1UBD C;  3VYY A;  1X6E A;  3IWC A;  5LMN I;  4GZN C;  4NXM I;  1ZBT A;  1H73 A;  2LRS A;  1XNR E;  5K36 F;  2Z5C B;  3B78 A;  1PKP A;  3HKM A;  3Q6M A;  4BMJ A;  1L4S A;  4LPF A;  2L3C A;  2EMW A;  2VF1 A;  4USK A;  1HR0 I;  3P3C A;  2ENH A;  2Q8U A;  1TF6 A;  1Y6Z A;  4Z7Y A;  5DNL A;  4GKJ I;  1IBM I;  4F6M A;  2K4V A;  3T1Y I;  3C6M A;  4DV0 E;  3LPS A;  4LF4 I;  1PDA A;  3T1H I;  1A1H A;  4JI8 E;  2EE8 A;  4BA1 B;  4JI3 I;  2EN2 A;  4DPU A;  1YH8 A;  4DR2 E;  2JT2 A;  4DU7 A;  2NN6 F;  2EPN A;  2UUB I;  4IZJ A;  1RHY A;  5DRR A;  3GON A;  5IXM B;  4LCF A;  2PNL A;  4M1K A;  4J8Z A;  3D4J A;  5T6J A;  3F6H A;  5KL7 A;  3K1J A;  4JI4 I;  2C39 B;  2EMB A;  2B7V A;  3PYD A;  2LTR A;  3M7N D;  2WP8 A;  4DR3 I;  2YTG A;  2A25 A;  2LTS A;  5LL6 R;  4IZK A;  2CSH A;  2ZBK B;  4OO1 E;  3MHS C;  4B3T E;  2LJP A;  3HUL A;  4N3O A;  2EN3 A;  4LF8 E;  1OYS A;  2EM4 A;  2LUQ A;  3IWD A;  1H72 C;  1MEY C;  3THO B;  4LFA I;  5CFF E;  4WSP A;  1WUU A;  3PYG A;  2RTX A;  2VE7 C;  1UIL A;  4B3S E;  1IQO A;  3P3E A;  3JU0 A;  1R6M A;  4JI2 E;  4P7D A;  2F1D A;  2RSI A;  2NN6 A;  3HPS A;  4R2Q A;  1ELO A;  2CG9 A;  4KHP E;  1JK2 A;  4JI0 E;  2EPC A;  2EOZ A;  1MU5 A;  4FW7 A;  2EOM A;  2V8P A;  4FN5 A;  4BA2 B;  1VI7 A;  2B3T B;  1ZXN A;  2Z5E A;  4JG4 A;  4WUC A;  3ZZU A;  2DLK A;  3FIG A;  1UDO A;  5IWA E;  1H74 A;  2EQ3 A;  2LMZ A;  3V5R A;  1YSA C;  2LUP B;  3DF6 A;  1DQ3 A;  4F54 A;  2V85 A;  2UUB E;  2EL4 A;  4LFA E;  5A6B A;  1T39 A;  2O1W A;  1XMQ E;  1SFE A;  3PYE A;  4MU0 A;  1KTV A;  4M9V C;  2RS7 A;  2VQE E;  2YRM A;  2BM1 A;  2ZM6 I;  1WXR A;  3M85 G;  4DV3 I;  2E5L E;  1FJG E;  4JI7 I;  3B8H A;  4OO1 F;  4MU4 A;  5A2Q C;  5L3J A;  2B9D A;  2CT1 A;  3GLL A;  2JR1 A;  2YTN A;  3CDJ A;  2UUC E;  4LCG A;  2V8Q B;  2EZ6 A;  2LV2 A;  3P1X A;  1N32 E;  1E3P A;  4MYU A;  4OKG A;  4JI5 I;  5DRQ A;  2KHX A;  4Q35 B;  5A69 A;  5DNY A;  1A1K A;  2R3V A;  3KZY A;  2UU9 I;  2DIX A;  2YSO A;  2LVH A;  1N0V C;  4DKK A;  3QT5 A;  4UT4 A;  4GQU A;  2VF3 A;  4YHH E;  1ZM4 A;  4DR7 E;  3CDI A;  2EMC A;  2YRK A;  2UXD E;  4JI3 E;  1VIS A;  1Y4S A;  1XMO E;  4U3D A;  4NZV A;  2F4V E;  3J81 C;  3T1H E;  5BR8 E;  2BA0 D;  2EOE A;  3J81 Q;  4DPT A;  2ODR D;  2JE6 B;  3PS2 A;  2JEA A;  4X66 E;  3EPL A;  3PS3 A;  5DRP A;  2EM8 A;  2YTO A;  2K7I A;  2E1M A;  1H7S A;  3GCM A;  2MC6 A;  4BA1 A;  2YTQ A;  4DV5 I;  3C4B A;  4DUY E;  2E5L I;  1UDS A;  3ZZT A;  5K36 B;  2RPC A;  3U1Y A;  2EOI A;  4MLQ A;  4NXM E;  1AH5 A;  2EMH A;  4YHH I;  4IFD F;  1YYW A;  1RRE A;  2JEB A;  2DEJ A;  4MLV A;  1P42 A;  4URL A;  4R2A A;  1YUJ A;  3M7N G;  1F2I G;  2CTD A;  1IMU A;  2HGH A;  5A6A A;  2NUE A;  3ZKB A;  3KZZ A;  3VHT B;  2GS8 A;  4IFD B;  5K36 C;  1T38 A;  3QT6 A;  4WUD A;  2H36 X;  4X62 E;  3H4L A;  1EH7 A;  3ADJ A;  2HHH E;  3WU5 A;  2NUG A;  1BKN A;  2HKJ A;  3BID A;  1HNX E;  2EMF A;  4FWG A;  4FW9 A;  2VQF E;  1IBK I;  4DR4 I;  1ZAA C;  3J7A G;  4JI2 I;  2LCE A;  2NA2 A;  4AIM A;  2EN8 A;  4L5N C;  2O1T A;  2V2Z A;  4DPW A;  4B3S I;  2CPN A;  3EQ1 A;  1A1F A;  3Q1Q A;  4TUG A;  4DR1 I;  1LLM C;  2L6M A;  1DI2 A;  4OO1 C;  3M6A A;  2PO1 A;  2I13 A;  2EQ0 A;  1TN9 A;  4ED4 A;  1KYQ A;  5C0X F;  2EM5 A;  4B3T I;  2YTD A;  4R8O A;  2YRH A;  2F8B A;  4Q28 A;  1A1J A;  1R6L A;  1USU A;  2HFU A;  3QG5 C;  4DR3 E;  4F9C B;  4YY3 I;  5JEA D;  5K36 E;  1ZM9 A;  4OO1 B;  4K0K E;  2I9I A;  2IHR 1;  4OO1 D;  2V2Q A;  2KON A;  1EKZ A;  2X7I A;  3LML A;  2L2M A;  1Y60 A;  1UDN A;  1O0W A;  2BA1 D;  4DR5 I;  4DR2 I;  2WBU A;  2O1V A;  1YFH A;  4DUZ I;  1J5E I;  1TF3 A;  2EOY A;  1Y5Y A;  2Z5C A;  5ELW A;  2JOX A;  1H7U A;  4P52 A;  1Z0W A;  4BBY A;  4QNJ A;  1ZM2 A;  2L8T A;  4HY1 A;  1RQ0 A;  5C0X C;  1IBM E;  3C4T A;  1XNQ I;  2RQL A;  4BC9 A;  2WNR B;  4MU3 A;  1HNW I;  1X6H A;  2EMI A;  4R2R A;  2EFG A;  1FWL A;  2NN6 D;  5F3W A;  4LF5 E;  5AE1 A;  2IOP A;  1ZU1 A;  2ZM6 E;  2V2V A;  1HNW E;  2CVE A;  2V83 A;  4JI4 E;  2EMA A;  2ENC A;  2V88 A;  1XHK A;  4ISA A;  4O24 A;  1GQE A;  3KWR A;  1Z0B A;  1UN6 B;  2EM0 A;  5C0X B;  3AV0 A;  4F9A B;  1FI4 A;  2CZ9 A;  3J7Y p;  4DR5 E;  4J3D A;  2EOF A;  4OZE A;  2EMG A;  2GLI A;  3T1Y E;  1KVK A;  3VYX A;  2J7J A;  1EI1 A;  2EPX A;  3MSW A;  1PJQ A;  4O43 A;  2RSM A;  2EN1 A;  5TSE A;  4LF7 I;  1P47 A;  2UUA E;  3U1K A;  2GPI A;  4LF9 I;  4ZYE A;  1IBK E;  4R2E A;  3H1C A;  2PRT A;  1MG7 A;  5IT9 Q;  4LU9 A;  1DGC A;  4BHB A;  2NN6 C;  2DGC A;  2O3Z A;  2NAB A;  2WZO A;  3F0N A;  1ZR9 A;  3MHH C;  4JV5 E;  4KQV A;  3H09 A;  4X9J A;  2E72 A;  4DV2 E;  4R1F A;  5JEA B;  5KL5 A;  1STU A;  2GO4 A;  4DR1 E;  3B82 A;  5AC4 A;  3TQM A;  4HAC B;  4B3R I;  3Q6N A;  1NHI A;  5DRO A;  4LFB E;  2EWL A;  1GZ6 A;  1HK7 A;  2UXC I;  2EOR A;  2V87 A;  4LTY A;  1S16 A;  3K85 A;  2JPA A;  4KWY A;  4AID A;  4DV7 I;  4HXZ A;  1T4L B;  1UEK A;  2M4I A;  3THN A;  4U3B A;  5FLX Q;  2O1U A;  4HYM A;  2EMY A;  1WRJ A;  1PVG A;  2EOS A;  4DV5 E;  2BA1 G;  1B62 A;  1S4E A;  1WHQ A;  4X66 I;  2JVA A;  2UUA I;  1G2F C;  1FWK A;  3K6Q A;  2JY9 A;  4LFB I;  5KL4 A;  2PNZ A;  2F4V I;  2BB8 A;  2EPL X;  3P3G A;  1XMO I;  1K47 A;  4X64 I;  2C39 A;  1Z0V A;  3ZZ0 A;  4DR7 I;  2YT4 A;  4DV1 E;  2Z5B A;  4OX9 I;  1QZR A;  3ADI A;  1Z5B A;  2EOQ A;  1OJ4 A;  2GQ0 A;  3QT8 A;  4FW3 A;  1Z0C A;  3P76 A;  4N4R B;  4JI5 E;  2NN6 B;  2DRP A;  2UXB E;  4BHC A;  4FW6 A;  2EL5 A;  2C37 A;  4PU9 A;  4WXD A;  3L7Z A;  2L3J A;  4OOG C;  1I94 I;  4I8O A;  5BR8 I;  2EPA A;  3HXL A;  2MKN A;  1YYO A;  1A1I A;  4HTG A;  2FGG A;  1WJP A;  2L92 A;  3EPK A;  1XMQ I;  3DJW A;  3ADL A;  2YTF A;  1UDQ A;  5FLX C;  4BCA A;  4F2J C;  2HK2 A;  4IFD E;  4JYA E;  2UU9 E;  1IQS A;  3GME A;  2EOX A;  4DMI A;  2EML A;  2GHF A;  2X36 A;  2NPF A;  4WSG A;  2BR2 B;  5JEA C;  3AUZ A;  5KL6 A;  1YHC A;  1EH6 A;  3OTO I;  1N34 E;  2DSY A;  4JI0 I;  4JI7 E;  1KKH A;  4X65 I;  5GMD A;  4M0V A;  1PJS A;  5AC5 A;  4AM3 A;  2WCC 3;  2YSP A;  2V89 A;  2YTE A;  2A2C A;  2C38 B;  1PJT A;  1BBG A;  2FTX B;  2M9A A;  2VRD A;  2EM7 A;  1NZ0 A;  1ZXM A;  5LMU I;  2LBS B;  2EN7 A;  2PO0 B;  4DR4 E;  1OYR A;  2BA0 G;  2LJU A;  5IWA I;  1J26 A;  4YY3 E;  2R1F A;  4IFD C;  2ENA A;  3ZOQ B;  4FWH A;  4P78 A;  4LF8 I;  2AE8 A;  2EM3 A;  2V34 A;  4BC7 A;  5IT9 C;  2BM0 A;  3UHM A;  5JEA A;  4R2D A;  2EPR A;  4LFC I;  3OML A;  1NCS A;  3HQ1 A;  4RH8 A;  1B69 A;  1MGT A;  4KHP I;  1X47 A;  2J7K A;  2HKE A;  2PO2 B;  2R42 A;  4IS1 C;  5LMU E;  4KZS A;  1N0U A;  2EMX A;  4LF6 E;  4JI1 I;  4MQY A;  2EM9 A;  2EQ1 A;  4WFT A;  4WPY A;  3ADG A;  1NEI A;  4B3M E;  4NXN E;  1U2R A;  5JEA E;  4LCH A;  5AE3 A;  1KIJ A;  2WP8 B;  2EOO A;  2G7H A;  4JI8 I;  4MYT A;  3M85 D;  4DUY I;  2MC5 A;  4X65 E;  2JP9 A;  4X62 I;  3LNU A;  4MDT A;  4GKJ E;  2LO3 A;  5GME A;  1SR9 A;  2V86 A;  4I3H A;  2N3G A;  3ZKD A;  5A2Q Q;  1Z59 A;  2YU5 A;  4WX9 A;  4DPX A;  3WU4 A;  4DV4 I;  1XNR I;  3HJC A;  3K17 A;  3WU3 A;  2UXD I;  4DR6 I;  4OX9 E;  2DMY A;  2JXP A;  2E1R A;  4R2C A;  1HNZ I;  2MDR A;  2MKD A;  4DV0 I;  4BA2 A;  2YZT A;  1UHZ A;  4UTG A;  3ECR A;  3L7Z B;  4IJD A;  5IV8 B;  5LLQ A;  2PNM A;  5JEA F;  1Y4U A;  2L33 A;  2UUC I;  3B4T A;  2IOQ A;  2NUF A;  1AAY A;  4F9B B;  2IES A;  4DPY A;  2EPK X;  1YUI A;  5FWK A;  1D6T A;  2KOU A;  5KL2 A;  4IZK B;  5KL3 A;  2LE2 A;  4DV3 E;  1BB8 A;  1USV A;  5C0X D;  2VQE I;  4JI6 I;  4DU8 A;  5LMN E;  4EMD A;  2MDG A;  4NBQ A;  5AAS A;  2PO1 B;  4HEI A;  4DR6 E;  2L2K B;  1Z5C A;  4R2P A;  3L00 A;  1ZBQ A;  4X64 E;  4FK5 C;  1DAR A;  1Z5A A;  1A1L A;  4PRV A;  4DV4 E;  4USM A;  1T4O A;  5A6J A;  1N32 I;  4DV2 I;  4FWD A;  4ZYD A;  2JYA A;  4BS9 A;  1FKA E;  3ZM7 A;  2YU8 A;  3J80 C;  2YWQ A;  5K36 D;  2EM2 A;  2WBT A;  2C38 A;  1IBL I;  3J80 Q;  1FJG I;  4O5G A;  4GKK E;  3JAM C;  4HAC A;  1N3G A;  3BBG A;  4NXN I;  5AE2 A;  4B3M I;  4F6N A;  2M7Q A;  1YPN A;  3QT7 A;  2PO0 A;  4JI1 E;  1A1G A;  4LF6 I;  1Z0E A;  2EPM X;  5K36 A;  2BBG A;  4Z7C A;  4B3R E;  1T4N A;  2N8X A;  3F6G A;  3IWB A;  3LLH A;  4WUB A;  2JEA B;  3PYF A;  2J65 A;  5EKW A;  4LFC E;  2JEB B;  3DD6 A;  3RMP A;  1N34 I;  4QNK A;  2YPN A;  1E3H A;  1OYP A;  2DB2 A;  2HK3 A;  4IS9 A;  1X5W A;  2GO3 A;  1QNT A;  2YTI A;  4LF5 I;  2EM6 A;  5ADZ A;  1N36 E;  3UK3 C;  2PNZ B;  5C0X A;  2N3H A;  3PRY A;  1JK1 A;  4RHB B;  1ZM3 A;  4R2S A;  4IFD A;  4LF9 E;  4JYA I;  4ZYG A;  1XNQ E;  5DNX A;  5EL9 A;  4RPF A;  2EN6 A;  2D9H A;  2EL6 A;  1NHH A;  1G2D C;  3LTO A;  3V2U C;  2HFS A;  2HJJ A;  3HPZ A;  1I94 E;  4NHR A;  1WHN A;  1BBO A;  3BF2 A;  3OTO E;  4IZJ B;  1HR0 E;  2HC5 A;  4PRX A;  4K0K I;  1X48 A;  1A6F A;  3WU6 A;  4DXL A;  5A6K A;  2XEX A;  3J7A M;  2EN4 A;  2ODR C;  2R76 A;  1EH8 A;  3JTZ A;  4IZJ D;  2FV4 B;  1YZ9 A;  2JE6 A;  4IFD D;  2AJ4 A;  1X3C A;  4O4K A;  1RMD A;  1QU6 A;  1RR9 A;  2DMI A;  1Z0T A;  2NN6 E;  3BGH A;  3EPJ A;  4WYQ B;  4DV1 I;  5A6B D;  2EMK A;  2ELY A;  2WBS A;  1J5E E;  4L8N A;  1X49 A;  4DUZ E;  4LOM A;  2B7T A;  2BR2 A;  4AQY I;  4TUI A;  4LF4 E;  3KRN A;  4M2Z A;  3HTX A;  2LJH A;  2Z5B B;  4MU1 A;  1KJK A;  1EA6 A;  2EP3 A;  4ZYH A;  2UXB I;  1N36 I;  4GKK I;  1B63 A;  2YTP A;  1NHJ A;  1PIE A;  2HHH I;  2EPP A;  2L2N A;  1X6F A;  4WXC A;  3EPH A;  1N33 E;  2EOH A;  2EMZ A;  4FW5 A;  2LT7 A;  4GEQ B;  3P06 A;  2DEI A;  2WW4 A;  2EPZ A;  2CGE A;  4DV7 E;  2Q2E B;  2OI2 A;  2C37 B;  2UXC E;  2ZIT A;  1MX0 A;  1XXE A;  1GTK A;  3VK6 A;  1Z1B A;  2DLQ A; 
#chains in the Genus database with same CATH homology
 4JV5 I;  3CWV A;  2VQF I;  4DV6 E;  1HNX I;  4JI6 E;  1N33 I;  1IBL E;  2JOB A;  4P7A A;  4XTJ A;  1FNM A;  2RS6 A;  1Z0G A;  4DV6 I;  4X8W A;  2BV3 A;  4LF7 E;  1YYK A;  3JAM Q;  4AQY E;  2JWO A;  4R03 A;  1HNZ E;  2A2D A;  4ZVI A;  1RC7 A;  2M1S A;  4M30 A;  3VYY A;  3IWC A;  5LMN I;  4NXM I;  1ZBT A;  1H73 A;  2LRS A;  1XNR E;  2Z5C B;  3B78 A;  1PKP A;  3Q6M A;  4BMJ A;  2L3C A;  2VF1 A;  4USK A;  1HR0 I;  4GKJ I;  1Y6Z A;  4Z7Y A;  1IBM I;  2K4V A;  3T1Y I;  3LPS A;  4DV0 E;  4LF4 I;  3T1H I;  4JI8 E;  4JI3 I;  4DPU A;  4DR2 E;  4DU7 A;  2UUB I;  4IZJ A;  3GON A;  2PNL A;  4M1K A;  4J8Z A;  3D4J A;  5T6J A;  3F6H A;  3K1J A;  4JI4 I;  2B7V A;  3PYD A;  2LTR A;  4DR3 I;  2LTS A;  4IZK A;  5LL6 R;  2ZBK B;  4B3T E;  2LJP A;  3HUL A;  4N3O A;  4LF8 E;  2LUQ A;  3IWD A;  1H72 C;  4LFA I;  5CFF E;  4WSP A;  1WUU A;  3PYG A;  2RTX A;  2VE7 C;  1UIL A;  4B3S E;  3JU0 A;  4JI2 E;  4P7D A;  3HPS A;  1ELO A;  2CG9 A;  4KHP E;  1MU5 A;  4JI0 E;  2V8P A;  4FN5 A;  2B3T B;  1ZXN A;  2Z5E A;  4JG4 A;  4WUC A;  3ZZU A;  3FIG A;  5IWA E;  1H74 A;  2LMZ A;  3V5R A;  2LUP B;  3DF6 A;  1DQ3 A;  4F54 A;  2V85 A;  4LFA E;  2UUB E;  2O1W A;  1XMQ E;  3PYE A;  1KTV A;  2RS7 A;  2VQE E;  2BM1 A;  4DV3 I;  1WXR A;  2E5L E;  1FJG E;  4JI7 I;  3B8H A;  5L3J A;  5A2Q C;  2B9D A;  2JR1 A;  2UUC E;  2V8Q B;  2EZ6 A;  3P1X A;  1N32 E;  4MYU A;  4JI5 I;  2KHX A;  2R3V A;  5DNY A;  2UU9 I;  2DIX A;  1N0V C;  4DKK A;  3QT5 A;  4UT4 A;  2VF3 A;  4YHH E;  1ZM4 A;  4DR7 E;  2UXD E;  4JI3 E;  1VIS A;  1Y4S A;  1XMO E;  2F4V E;  3J81 C;  3T1H E;  5BR8 E;  3J81 Q;  4DPT A;  2ODR D;  4X66 E;  1H7S A;  2E1M A;  4DV5 I;  2MC6 A;  2E5L I;  3C4B A;  4DUY E;  3ZZT A;  4NXM E;  4YHH I;  1YYW A;  1RRE A;  2DEJ A;  4URL A;  2NUE A;  3ZKB A;  2GS8 A;  3QT6 A;  4WUD A;  2H36 X;  4X62 E;  3H4L A;  3ADJ A;  2HHH E;  3WU5 A;  2NUG A;  1BKN A;  2HKJ A;  1HNX E;  4FWG A;  4FW9 A;  1IBK I;  4DR4 I;  2VQF E;  3J7A G;  4JI2 I;  2NA2 A;  4L5N C;  2O1T A;  4DPW A;  2V2Z A;  4B3S I;  2CPN A;  3Q1Q A;  4TUG A;  4DR1 I;  2L6M A;  1DI2 A;  3M6A A;  4ED4 A;  4B3T I;  4R8O A;  2F8B A;  4Q28 A;  1USU A;  2HFU A;  4DR3 E;  4F9C B;  4YY3 I;  1ZM9 A;  4K0K E;  2IHR 1;  2V2Q A;  2KON A;  1EKZ A;  2X7I A;  3LML A;  2L2M A;  1O0W A;  4DR5 I;  4DR2 I;  2O1V A;  4DUZ I;  1J5E I;  2Z5C A;  2JOX A;  1H7U A;  4P52 A;  1Z0W A;  4BBY A;  1ZM2 A;  2L8T A;  4HY1 A;  1RQ0 A;  1IBM E;  3C4T A;  1XNQ I;  4BC9 A;  1HNW I;  2ZIT A;  4IZJ D;  2EFG A;  1FWL A;  2ZM6 I;  5F3W A;  4LF5 E;  5AE1 A;  2IOP A;  2ZM6 E;  2V2V A;  1HNW E;  2V83 A;  4JI4 E;  2V88 A;  1XHK A;  1GQE A;  3KWR A;  1Z0B A;  3AV0 A;  4F9A B;  1FI4 A;  2CZ9 A;  3J7Y p;  4DR5 E;  1KVK A;  3T1Y E;  3VYX A;  1EI1 A;  3MSW A;  4LF7 I;  4LF9 I;  2RSM A;  2UUA E;  1IBK E;  1MG7 A;  5IT9 Q;  4LU9 A;  2WZO A;  3F0N A;  4KQV A;  4JV5 E;  3H09 A;  4R1F A;  4DV2 E;  1STU A;  3B82 A;  4DR1 E;  4B3R I;  4HAC B;  3Q6N A;  1NHI A;  4LFB E;  2EWL A;  1GZ6 A;  1HK7 A;  2UXC I;  2V87 A;  4LTY A;  1S16 A;  3K85 A;  4DV7 I;  4HXZ A;  1T4L B;  1UEK A;  2M4I A;  5FLX Q;  2O1U A;  4HYM A;  1PVG A;  4DV5 E;  1B62 A;  1S4E A;  1WHQ A;  4X66 I;  2JVA A;  2UUA I;  1FWK A;  3K6Q A;  2JY9 A;  4LFB I;  2F4V I;  1XMO I;  1K47 A;  4X64 I;  1Z0V A;  3ZZ0 A;  4DR7 I;  2YT4 A;  4DV1 E;  2Z5B A;  4OX9 I;  1QZR A;  3ADI A;  1Z5B A;  1OJ4 A;  2GQ0 A;  3QT8 A;  1Z0C A;  4JI5 E;  2UXB E;  4PU9 A;  2L3J A;  4OOG C;  1I94 I;  4I8O A;  5BR8 I;  3HXL A;  1YYO A;  2FGG A;  2L92 A;  1XMQ I;  3DJW A;  3ADL A;  5FLX C;  4BCA A;  2HK2 A;  4JYA E;  2UU9 E;  4DMI A;  2NPF A;  2X36 A;  3AUZ A;  3OTO I;  1N34 E;  2DSY A;  4JI0 I;  4JI7 E;  1KKH A;  4X65 I;  5GMD A;  4M0V A;  2V89 A;  2A2C A;  2FTX B;  1ZXM A;  1NZ0 A;  5LMU I;  2LBS B;  4DR4 E;  5IWA I;  1J26 A;  4YY3 E;  3ZOQ B;  4FWH A;  4P78 A;  4LF8 I;  2V34 A;  4BC7 A;  5IT9 C;  2BM0 A;  4LFC I;  3OML A;  3HQ1 A;  4KHP I;  1X47 A;  2J7K A;  2HKE A;  2R42 A;  5LMU E;  4KZS A;  1N0U A;  4LF6 E;  4JI1 I;  4WFT A;  4WPY A;  3ADG A;  4B3M E;  4NXN E;  1U2R A;  5AE3 A;  1KIJ A;  2G7H A;  4JI8 I;  4MYT A;  4DUY I;  2MC5 A;  4X65 E;  4X62 I;  3LNU A;  4GKJ E;  5GME A;  1SR9 A;  2V86 A;  4I3H A;  2N3G A;  3ZKD A;  5A2Q Q;  1Z59 A;  4DPX A;  3WU4 A;  4DV4 I;  1XNR I;  3HJC A;  3K17 A;  3WU3 A;  2UXD I;  4DR6 I;  4OX9 E;  2DMY A;  1HNZ I;  2E1R A;  2MDR A;  4DV0 I;  2YZT A;  1UHZ A;  4UTG A;  2PNM A;  1Y4U A;  2L33 A;  2UUC I;  2IOQ A;  2NUF A;  4F9B B;  4DPY A;  5FWK A;  1D6T A;  2KOU A;  4IZK B;  4DV3 E;  2LE2 A;  2VQE I;  1USV A;  4JI6 I;  4DU8 A;  5LMN E;  4EMD A;  5AAS A;  1Z5C A;  4DR6 E;  2L2K B;  1ZBQ A;  4X64 E;  1Z5A A;  1DAR A;  4PRV A;  4USM A;  4DV4 E;  1T4O A;  1N32 I;  4DV2 I;  4FWD A;  4BS9 A;  1FKA E;  3ZM7 A;  3J80 C;  1FJG I;  1IBL I;  3J80 Q;  4GKK E;  3JAM C;  4HAC A;  4NXN I;  5AE2 A;  4B3M I;  2M7Q A;  3QT7 A;  4JI1 E;  4LF6 I;  1Z0E A;  4Z7C A;  4B3R E;  1T4N A;  4WUB A;  3F6G A;  3IWB A;  3LLH A;  3PYF A;  4LFC E;  3RMP A;  1N34 I;  2DB2 A;  2HK3 A;  4LF5 I;  5ADZ A;  1N36 E;  2N3H A;  3PRY A;  1ZM3 A;  4JYA I;  4LF9 E;  1XNQ E;  4RPF A;  1NHH A;  3LTO A;  3V2U C;  2HFS A;  3HPZ A;  1I94 E;  1WHN A;  3OTO E;  4IZJ B;  1HR0 E;  4PRX A;  4K0K I;  1X48 A;  1A6F A;  3WU6 A;  4DXL A;  2XEX A;  3J7A M;  2ODR C;  3JTZ A;  2FV4 B;  1YZ9 A;  2AJ4 A;  1QU6 A;  1RR9 A;  1Z0T A;  4WYQ B;  4DV1 I;  1J5E E;  4DUZ E;  1X49 A;  4L8N A;  2B7T A;  4AQY I;  4TUI A;  4LF4 E;  4M2Z A;  3HTX A;  2LJH A;  2Z5B B;  1EA6 A;  2UXB I;  1N36 I;  4GKK I;  1B63 A;  1NHJ A;  1PIE A;  2HHH I;  2L2N A;  1N33 E;  4GEQ B;  3P06 A;  2DEI A;  2WW4 A;  2CGE A;  4DV7 E;  2Q2E B;  2OI2 A;  2UXC E;  1MX0 A;  3VK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...