2VQEE

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2vqeE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqeE02
1EI1A 4JI8I 5BR8E 2UUBI 3PYEA 1N33E 4RPFA 2LTRA 4DV0E 1H74A 2RS7A 5IT9C 1ZBTA 3H4LA 2B7TA 4FWDA 2L2MA 1FKAE 1Z0EA 3B78A 2X36A 4DPXA 4LF7I 1Z0VA 2VF3A 1IBMI 1FJGI 3Q1QA 5IWAE 2YT4A 1Z59A 4JI3I 3LLHA 1XNRE 1N36E 1NHJA 5CFFE 4FN5A 1UILA 4DPUA 4DV7I 1H7UA 4YHHI 3LNUA 3JAMQ 4DUZI 3T1YE 2CZ9A 3ZKDA 4USMA 1XMQI 4P52A 3WU6A 5IT9Q 2NUFA 2L2KB 2UXBI 4K0KE 1N33I 1Z5CA 4LF5I 4HACA 4PU9A 2R42A 2ZITA 3OTOI 1A6FA 2UXCE 2NUEA 1Z0CA 2F4VE 2UU9E 4JV5I 4YY3E 3B82A 2DIXA 4X62E 2LTSA 1N36I 3M6AA 2NPFA 4LFCI 1KVKA 1UHZA 4M2ZA 4KQVA 1IBLI 4LF9I 3J80Q 2UUCI 2N3GA 1RQ0A 1IBKE 1N34I 4JV5E 1GQEA 3K1JA 4DR7E 4DR1I 4USKA 1XMOI 2RTXA 4JI2E 2L3CA 1ZM2A 1YYWA 4B3TI 2UXDI 2HK2A 2JY9A 4HACB 1KIJA 4DV3E 4EMDA 4WUBA 4DPWA 2DEJA 3J81C 1DARA 4X64E 3ADJA 2LBSB 2LRSA 3T1HI 1KTVA 2V2ZA 4KHPE 2A2CA 4Z7YA 1EA6A 4DV4E 1Z0BA 1T4OA 1HNXI 4B3SE 4LF4I 2VQEI 2E5LI 4DR3E 3T1HE 3V2UC 5GMEA 2LJPA 1WHQA 1D6TA 4B3ME 5A2QQ 4GKKE 2X7IA 4LFBE 1HNXE 1K47A 3K17A 4DR5I 1MU5A 2HFSA 2A2DA 3ZKBA 1EKZA 4AQYI 4DV2I 3V5RA 4LFAI 4NXMI 2E1RA 2BM1A 1QU6A 3ADLA 5LMNI 1NZ0A 4DU8A 5IWAI 4DV1I 2ZM6I 1XNRI 4JI5E 1H73A 1MG7A 2HFUA 1S16A 2EFGA 4M1KA 3PYDA 2DB2A 3QT7A 4B3TE 4JI4E 2UXDE 4JI3E 4JI2I 4DR1E 3HULA 4JI6E 2GS8A 2L3JA 2VQFE 4LF7E 2R3VA 2XEXA 1N32E 1ZM9A 1T4LB 4LF5E 2OI2A 4LF8I 4Z7CA 4I3HA 2DEIA 3ADGA 4JI7E 4LFCE 4LFAE 1IBLE 4LF9E 3QT5A 4FW9A 2HKJA 3J7AG 1PVGA 3ZZ0A 3J80C 2RS6A 4JI8E 2DMYA 2UUBE 1B62A 1Z0TA 2N3HA 4DV4I 4JI1E 2UXCI 4DV6I 1U2RA 1YZ9A 1B63A 3F0NA 3ZM7A 4GKKI 4OOGC 4DR4I 4OX9E 1WHNA 2HK3A 4X62I 1RREA 4AQYE 3C4TA 2V8PA 4YHHE 4MYTA 1XNQI 4M30A 4DXLA 1VISA 4MYUA 2NA2A 4X65E 1HR0E 1XMOE 4WFTA 2EZ6A 4B3RE 1FWKA 2LJHA 2LUQA 3WU4A 3J7Yp 2V2QA 1ZXMA 4DV3I 4LF4E 1FNMA 4PRXA 1BKNA 4PRVA 1XHKA 4YY3I 2AJ4A 1ZM4A 1H7SA 4LF6E 5BR8I 2HHHI 2MDRA 3ZZTA 2UUCE 1ZXNA 4X8WA 2J7KA 2UXBE 2L2NA 1N34E 2L33A 4URLA 4DV0I 1FI4A 2E5LE 2VQEE 4X65I 4DV2E 1H72C 1HR0I 4NXNE 1QZRA 4DPYA 4JI1I 3HTXA 4DV6E 3LTOA 5A2QC 4DV7E 4JI0I 4LFBI 3ADIA 4JI4I 4DUYE 2V2VA 4OX9I 2UUAE 2BV3A 2HKEA 4KHPI 4JYAE 4JG4A 1Z5AA 3QT6A 4UT4A 4X66I 4X64I 5LMUE 1HNWE 4LF6I 1XMQE 4HYMA 5GMDA 3PYGA 4ZVIA 1N32I 4DV5E 1J5EE 1PKPA 1XNQE 3OTOE 1FJGE 4P7AA 4WUDA 5LL6R 4DR7I 3GONA 2LUPB 2RSMA 4DR6I 4X66E 1IBME 2V34A 1STUA 3D4JA 3P1XA 1ELOA 2IHR1 3CWVA 4NXME 1YYOA 3JAMC 1FWLA 1NHIA 1ZM3A 4XTJA 1I94E 2BM0A 2ZM6E 5FLXQ 4DR2I 4K0KI 2WW4A 1HNZE 1NHHA 1KKHA 3J7AM 1X48A 1PIEA 4JI0E 2F4VI 5FLXC 1O0WA 2CPNA 4JI6I 5L3JA 3PYFA 1YYKA 3ZZUA 2KHXA 4DKKA 2B7VA 1T4NA 4JI7I 4DR2E 4DR3I 3C4BA 1IBKI 1HNZI 1HNWI 4DPTA 4LF8E 1WUUA 1Z0WA 3WU5A 3J81Q 3VYXA 4WUCA 4GKJE 2B3TB 3VYYA 2HHHE 4HXZA 4B3RI 1N0UA 2Q2EB 2VQFI 1J5EI 4DV5I 1X49A 1RR9A 4DR5E 4GKJI 3LPSA 4FWGA 1J26A 1RC7A 3WU3A 3B8HA 5LMNE 4DV1E 4DR4E 4ED4A 1Z5BA 4JYAI 4JI5I 4FWHA 1S4EA 4B3SI 4DU7A 1X47A 2NUGA 1Z0GA 2UU9I 2ZBKB 4R1FA 1MX0A 5LMUI 1DI2A 1UEKA 4B3MI 4NXNI 1N0VC 4WYQB 2JVAA 1OJ4A 1I94I 4HY1A 4DUYI 2UUAI 4DUZE 4DR6E 3T1YI 3QT8A 4UTGA
chains in the Genus database with same CATH superfamily
2YTGA 1A1GA 4WSGA 1EI1A 3P06A 5BR8E 4JI8I 2UUBI 5C0XB 3PYEA 1EH7A 2YTJA 5IV8B 1N33E 4BA1A 2NN6D 2LTRA 4RPFA 5C0XF 4AIMA 4DV0E 1H74A 3EPLA 2RS7A 2MDGA 2CGEA 2PO0B 5IT9C 4R2CA 1ZBTA 3H4LA 2B7TA 2CTDA 2JOXA 1UDOA 4FWDA 2L2MA 1FKAE 4IFDB 1Z0EA 3B78A 4LTYA 2NN6A 2ENAA 5AC4A 2X36A 4DPXA 4LF7I 2EN8A 1Z0VA 1UDQA 2VF3A 1IBMI 1FJGI 3Q1QA 2YTEA 2YT4A 5IWAE 1OYPA 1Z59A 4JI3I 1X6HA 3LLHA 1XNRE 1N36E 1YUJA 1NHJA 5CFFE 2ELZA 4FN5A 2L6MA 2CSHA 1UILA 2YPNA 2YTQA 4DPUA 1RHYA 1UBDC 4BA1B 5JEAE 4DV7I 2F8BA 1H7UA 1BBGA 4YHHI 3LNUA 3JAMQ 4DUZI 4L5NC 2GLIA 2EOMA 3Q6MA 3T1YE 2CZ9A 3ZKDA 1IQSA 5EL9A 2EPMX 4USMA 1XMQI 4P52A 3WU6A 5IT9Q 2V89A 3CDJA 4R2QA 2YZTA 2K7IA 2L2KB 2NUFA 3P76A 2UXBI 1UDNA 4K0KE 2EMHA 1N33I 2H36X 3JU0A 4F6NA 1Z5CA 4LF5I 4HACA 4PU9A 2R42A 2ZITA 2YTIA 3OTOI 1A6FA 2EOOA 2UXCE 4F9AB 3CDIA 4MLQA 3M85D 3M85G 2NUEA 1Z0CA 4R2SA 2F4VE 2V8QB 1HK7A 1VI7A 2UU9E 4JV5I 2EPCA 4Q28A 2JOBA 4YY3E 4GEQB 2EOJA 3EPJA 3B82A 2DIXA 3DF6A 4X62E 2N8XA 2LTSA 1TF6A 4LCGA 1N36I 2EOHA 3M6AA 1ZU1A 4LCFA 2NPFA 4LFCI 1KVKA 1UHZA 2V86A 4WPYA 4M2ZA 2BBGA 2NN6C 4KQVA 5A6JA 1IBLI 4LF9I 4WX9A 3J80Q 2UUCI 2N3GA 2EMAA 1RQ0A 1Y5YA 1IBKE 2PNZA 1XXEA 2WCC3 1N34I 1TN9A 4JV5E 2YTOA 1ZR9A 2G7HA 4MU0A 4BHBA 1GQEA 1UDSA 3K1JA 4DR7E 4DR1I 4USKA 1XMOI 2RTXA 4JI2E 4IZJD 2R1FA 2YSOA 1R6MA 5KL7A 2L3CA 2YWQA 1ZM2A 3C6MA 2E72A 1YYWA 4B3TI 2UXDI 2EN7A 1F2IG 2HK2A 2JWOA 3EQ1A 2JY9A 1LLMC 2VF1A 2EP3A 2EL4A 4IFDF 2EPRA 4HACB 1KIJA 4DV3E 4EMDA 4WUBA 3K6QA 2PO0A 4DPWA 2DEJA 4F9BB 2VE7C 3J81C 3U1KA 1DARA 4QNKA 4ISAA 4OKGA 1WJPA 3ADJA 4X64E 3UK3C 2LRSA 2LBSB 5DNYA 4L8NA 4BBYA 2MKNA 1KTVA 1P42A 2PO2A 3T1HI 2V2ZA 2EN2A 5KL2A 2VRDA 4KHPE 4IS1C 2A2CA 3KZYA 4Z7YA 5AC5A 3ECRA 1DGCA 3F6HA 1EA6A 2Z5CB 1KYQA 5JEAB 2EPZA 1WRJA 2EN6A 2EQ3A 4FK5C 1TF3A 4DV4E 2YTPA 1OYRA 4U3BA 5K36E 1YUIA 4Q35B 3PRYA 1Z0BA 1T4OA 2O1VA 3ZOQB 2EOFA 4R2RA 1HNXI 5LLQA 2PNZB 4B3SE 4P7DA 1T38A 3K85A 4LF4I 2C39A 2VQEI 2E5LI 4DR3E 3T1HE 2E1MA 4LOMA 3V2UC 4N4RB 1WXRA 5GMEA 2LJPA 1WHQA 2IERA 2JEBA 4B3ME 4HTGA 2O3ZA 1D6TA 2JE6B 2D9HA 2EPXA 1QNTA 3NZKA 5A2QQ 2EL5A 1MGTA 1Z1BA 4GKKE 2X7IA 4NBQA 4M9VC 2DGCA 4BS9A 4LFBE 2GO4A 1HNXE 2EORA 2EMKA 2EPUA 1K47A 3K17A 4DR5I 2C39B 4FW4A 1MU5A 1Y4UA 2HFSA 2A2DA 3ZKBA 5JEAF 4IFDC 2EE8A 1EKZA 4AQYI 4DV2I 2LCEA 3V5RA 4LFAI 4NXMI 4IFDE 2CVEA 2E1RA 5JEAC 1A1JA 1IMUA 2BM1A 1QU6A 3ADLA 5LMNI 1NZ0A 2NN6F 2EWLA 4F9CB 4DU8A 5IWAI 2ZM6I 3QG5C 4DV1I 1XNRI 4GZNC 4JI5E 4KWYA 1H73A 1MG7A 2HFUA 1S16A 5C0XA 2EFGA 2M7QA 3VK6A 2J7JA 1G2FC 2ENHA 2NABA 2C37A 4M1KA 2EPKX 5DNXA 2RPCA 2JYAA 1IQOA 2DB2A 3PYDA 4ZYGA 2DLQA 3QT7A 2K4VA 2RQLA 4B3TE 4JI4E 2UXDE 4BA2B 2WBSA 3GLLA 4RHBB 2WP8A 2YRKA 4JI3E 4JI2I 4DR1E 3HULA 4OZEA 2BA0D 4JI6E 2YTDA 5TSEA 2L3JA 2VQFE 4LF7E 1R6LA 2GS8A 2R3VA 2XEXA 1N32E 4IZKB 2EM4A 2YTNA 3MSWA 1ZM9A 1T4LB 1X3CA 2EM3A 2L92A 4LF5E 3H09A 1ZBQA 2OI2A 4LF8I 2FGGA 1E3HA 2JEAA 4OO1D 2Z5BB 1SFEA 2EOIA 2PRTA 4Z7CA 4I3HA 4FW6A 2DEIA 3ADGA 2VESA 4JI7E 2ADRA 4LFCE 2EN3A 4KZSA 2M1SA 1IBLE 4LF9E 4LFAE 3QT5A 2PO2B 3L7ZB 4FW9A 4GQUA 4MQYA 2HKJA 3J7AG 1DQ3A 1PVGA 2EOSA 2EOZA 2YU8A 2EPAA 3ZZ0A 3C6KA 3HXLA 2HJJA 3J80C 3THOB 2RS6A 4JI8E 2DMYA 5IXMB 2HGHA 5KL4A 2UUBE 2EQ0A 1B62A 1Z0TA 5AE2A 2N3HA 2O1WA 4DV4I 4JI1E 1A1IA 2UXCI 3BF2A 1U2RA 5F3WA 4ZYEA 4DV6I 1YZ9A 3HKMA 1YPNA 2LMZA 2MC5A 1Y6ZA 1YFHA 1B63A 1NCSA 5KL5A 3F0NA 4QNJA 3ZM7A 4GKKI 1NEIA 4OOGC 3AV0A 4DR4I 4R2AA 4OX9E 1N3GA 1WHNA 3RMPA 2HK3A 1AAYA 4X62I 4F54A 2I9IA 1MEYC 1A1LA 2JE6A 3EPHA 1UN6B 2DSYA 1RREA 4OO1E 4AQYE 3C4TA 2V8PA 3Q6NA 4YHHE 4MYTA 2WNRA 1XNQI 4M30A 5DRQA 4DXLA 1VISA 4MYUA 2NA2A 4O5GA 4X65E 2PO1A 2CG9A 1HR0E 1XMOE 4WFTA 2EZ6A 1T39A 4B3RE 1FWKA 2LJHA 2LUQA 1EH8A 3MHHC 3WU4A 2ENCA 2V87A 4R2PA 4NHRA 3KZZA 2DMIA 3J7Yp 2V2QA 2ELYA 1ZXMA 4DV3I 4BMJA 1GTKA 4MLVA 2EM7A 4LF4E 1FNMA 3P3EA 2IOQA 4PRXA 2EMLA 1A1KA 1BKNA 2V83A 2EOEA 4PRVA 1EH6A 4DMIA 5ADZA 5A69A 2NN6E 3PS2A 1XHKA 2EMXA 4IZJA 4YY3I 3DJWA 1USVA 4FW7A 4R03A 3UHMA 2PNMA 2AJ4A 5C0XC 1ZM4A 1X6EA 1H7SA 3GCMA 4LF6E 5BR8I 4MDTA 2MDRA 2HHHI 5A6BA 3ZZTA 5AE3A 1PJTA 2UUCE 3IWDA 1ZXNA 2JP9A 1JK2A 4X8WA 2LVHA 2EL6A 2J7KA 2UXBE 2L2NA 2EMIA 2L33A 2EOQA 1N34E 2NN6B 4R8OA 4URLA 2ODRD 5KL3A 2O1UA 3PS3A 2JEAB 3M99B 5A6BD 2Z5BA 4DV0I 2BA1G 2DLKA 1FI4A 2JXPA 2E5LE 2EPNA 2VQEE 4X65I 2YRMA 4IFDD 4DV2E 1E3PA 3KWRA 1H72C 1HR0I 4IZJB 2PO1B 2EN4A 4NXNE 1QZRA 4DPYA 4JI1I 3HTXA 4DV6E 2EPPA 2AE8A 5A2QC 3LTOA 4DV7E 2EM8A 4JI0I 4U3DA 3HQ1A 4LFBI 1ZAAC 3ADIA 4MU3A 4JI4I 2EN1A 2Q8UA 4DUYE 2V2VA 4OX9I 1JK1A 2C37B 2UUAE 2BV3A 2LT7A 2WBUA 1BBOA 2HKEA 5AE1A 5A6KA 2C38B 2GHFA 4JYAE 2GQ0A 4JG4A 4KHPI 1Z5AA 2GPIA 3QT6A 4UT4A 4X66I 2BA1D 4X64I 4O4KA 5T6JA 5LMUE 1HNWE 4LF6I 2MKDA 1XMQE 2LJUA 2WBTA 4HYMA 5GMDA 3PS1A 3PYGA 3P3GA 4ZVIA 1N32I 2LO3A 2IOPA 2JR1A 4DV5E 4LU9A 1PKPA 1J5EE 4ZYDA 4X9JA 4FW3A 3IWBA 5AASA 1XNQE 3OTOE 4TUIA 1FJGE 4P7AA 3H1CA 4ZYHA 4WUDA 5LL6R 3THNA 4DR7I 2MC6A 5DRRA 3GONA 2YTFA 2LUPB 3L7ZA 2EPLX 4MU1A 3M7NG 2EMYA 2RSMA 4DR6I 4X66E 1IBME 2BR2B 4WXCA 2V34A 3JTZA 4I8OA 1STUA 4IS9A 3D4JA 3P1XA 4IJDA 4NZVA 3DD6A 3U1YA 1ELOA 2I13A 2EM2A 4OO1B 4R2EA 2EQ1A 2EM6A 2Z5EA 2IHR1 4IFDA 3AUZA 2BB8A 2A25A 3CWVA 5ELWA 3F6GA 3P3CA 4OO1C 4NXME 2EOYA 3VHTB 1YYOA 1L4SA 3JAMC 1P47A 1FWLA 1NHIA 3M7ND 5A6AA 1ZM3A 2EMBA 4LCHA 4XTJA 5K36F 3L00A 1KJKA 3LMLA 4OO1A 3BBGA 2V85A 4TUGA 5K36B 1I94E 2BM0A 2ZM6E 5FLXQ 4DR2I 1X6FA 2YRHA 2WW4A 4BC9A 2HC5A 1HNZE 1NHHA 3GMEA 5EKWA 4K0KI 4BC7A 3IWCA 3HPZA 1GZ6A 1KKHA 4J3DA 3J7AM 1X48A 3BGHA 1PIEA 4JI0E 2B9DA 2ODRC 2F4VI 4OO1F 5JEAA 5FLXC 1O0WA 2CPNA 4JI6I 3BIDA 4BHCA 5DRPA 4BA2A 5K36A 2EMWA 5L3JA 3PYFA 2RSIA 1YYKA 2WP8B 1OYSA 3ZZUA 4P78A 1G2DC 5JEAD 4MU4A 4FW5A 2KHXA 2YSPA 2B7VA 4DKKA 5C0XD 1T4NA 4JI7I 2GO3A 4DR2E 4IZKA 4DR3I 3C4BA 1IBKI 1PJQA 3HPSA 1HNZI 4DPTA 1HNWI 1SR9A 4AIDA 2IESA 4LF8E 1WUUA 1Z0WA 2C38A 1YH8A 4N3OA 3WU5A 3J81Q 3VYXA 4WUCA 4GKJE 2B3TB 2EMGA 4RH8A 5DNLA 2O1TA 3VYYA 1B69A 2HHHE 4HXZA 1X5WA 4O43A 5DROA 2EM9A 4AM3A 4B3RI 1N0UA 2JPAA 5FWKA 3EPKA 3FIGA 2Q2EB 2VQFI 2V88A 2PNLA 3MHSC 2EM0A 1J5EI 4DV5I 1X49A 4LPFA 1RR9A 1A1FA 4DR5E 4GKJI 1A1HA 3LPSA 2F1DA 4M0VA 2JT2A 4FWGA 2KONA 1J26A 2L8TA 2FTXB 1RC7A 3WU3A 2EOXA 2YU5A 4F6MA 3B8HA 5C0XE 4O24A 5LMNE 2EMZA 4DV1E 4DR4E 4ED4A 2BR2A 1Z5BA 4JYAI 1YSAC 4FWHA 4JI5I 1S4EA 1PJSA 4B3SI 2EPOA 4DU7A 1USUA 4WSPA 1X47A 2EM5A 2FV4B 2KOUA 4HEIA 2NUGA 3B4TA 3KRNA 1Z0GA 1PDAA 2R76A 2JEBB 2WNRB 2ZBKB 2UU9I 2EMCA 1Y4SA 4R1FA 4BCAA 5K36D 1MX0A 2M4IA 2WZOA 5KL6A 1AH5A 2Z5CA 3TQMA 2LV2A 1DI2A 5LMUI 4R2DA 1UEKA 4B3MI 2M9AA 4NXNI 1N0VC 4WXDA 2DRPA 4WYQB 2JVAA 1OJ4A 1I94I 2LE2A 4HY1A 2EMFA 1BB8A 2CT1A 3HJCA 1YHCA 2BA0G 4DUYI 5K36C 2UUAI 4DUZE 3OMLA 4DR6E 1RMDA 4F2JC 2EJ4A 3T1YI 3QT8A 4UTGA 1Y60A 2J65A 4J8ZA
chains in the Genus database with same CATH topology
3P06A 1EI1A 4JI8I 5BR8E 2UUBI 3PYEA 1N33E 4RPFA 2LTRA 4DV0E 1H74A 2CGEA 2RS7A 5IT9C 1ZBTA 3H4LA 2B7TA 2JOXA 4FWDA 2L2MA 1FKAE 1Z0EA 3B78A 4LTYA 2X36A 4DPXA 4LF7I 1Z0VA 2VF3A 1IBMI 1FJGI 3Q1QA 5IWAE 2YT4A 1Z59A 4JI3I 3LLHA 1XNRE 1N36E 1NHJA 5CFFE 4FN5A 2L6MA 1UILA 4DPUA 4DV7I 2F8BA 1H7UA 4YHHI 3LNUA 3JAMQ 4DUZI 4L5NC 3Q6MA 3T1YE 2CZ9A 3ZKDA 4USMA 1XMQI 4P52A 3WU6A 5IT9Q 2V89A 2YZTA 2NUFA 2L2KB 2UXBI 4K0KE 1N33I 2H36X 3JU0A 1Z5CA 4LF5I 4HACA 4PU9A 2R42A 2ZITA 3OTOI 1A6FA 2UXCE 4F9AB 2NUEA 1Z0CA 2F4VE 2V8QB 1HK7A 2UU9E 4JV5I 4Q28A 2JOBA 4YY3E 4GEQB 3B82A 2DIXA 3DF6A 4X62E 2LTSA 1N36I 3M6AA 2NPFA 4LFCI 1KVKA 1UHZA 2V86A 4WPYA 4M2ZA 4KQVA 1IBLI 4LF9I 3J80Q 2UUCI 2N3GA 1RQ0A 1IBKE 1N34I 4JV5E 2G7HA 1GQEA 3K1JA 4DR7E 4DR1I 4USKA 1XMOI 2RTXA 4JI2E 4IZJD 2L3CA 1ZM2A 1YYWA 4B3TI 2UXDI 2HK2A 2JWOA 2JY9A 2VF1A 4HACB 1KIJA 4DV3E 4EMDA 4WUBA 3K6QA 4DPWA 2DEJA 4F9BB 2VE7C 3J81C 1DARA 4X64E 2LBSB 3ADJA 2LRSA 5DNYA 4L8NA 4BBYA 3T1HI 1KTVA 2V2ZA 4KHPE 2A2CA 4Z7YA 3F6HA 1EA6A 2Z5CB 4DV4E 3PRYA 1Z0BA 1T4OA 2O1VA 3ZOQB 1HNXI 4B3SE 4P7DA 4LF4I 3K85A 2VQEI 2E5LI 4DR3E 3T1HE 2E1MA 3V2UC 5GMEA 1WXRA 2LJPA 1WHQA 1D6TA 4B3ME 5A2QQ 4GKKE 2X7IA 4BS9A 4LFBE 1HNXE 1K47A 3K17A 4DR5I 1MU5A 1Y4UA 2HFSA 2A2DA 3ZKBA 1EKZA 4AQYI 4DV2I 3V5RA 4LFAI 4NXMI 2E1RA 2BM1A 1QU6A 3ADLA 5LMNI 1NZ0A 4DU8A 2EWLA 4F9CB 5IWAI 4DV1I 2ZM6I 1XNRI 4JI5E 1H73A 1MG7A 2HFUA 1S16A 2EFGA 2M7QA 3VK6A 4M1KA 3PYDA 2DB2A 3QT7A 2K4VA 4B3TE 4JI4E 2UXDE 4JI3E 4JI2I 4DR1E 3HULA 4JI6E 2GS8A 2L3JA 2VQFE 4LF7E 2R3VA 2XEXA 1N32E 4IZKB 3MSWA 1ZM9A 1T4LB 2L92A 4LF5E 3H09A 1ZBQA 2OI2A 4LF8I 2FGGA 2Z5BB 4Z7CA 4I3HA 2DEIA 3ADGA 4JI7E 4LFCE 4KZSA 2M1SA 1IBLE 4LF9E 4LFAE 3QT5A 4FW9A 2HKJA 3J7AG 1DQ3A 1PVGA 3ZZ0A 3HXLA 3J80C 2RS6A 4JI8E 2DMYA 2UUBE 1B62A 1Z0TA 5AE2A 2N3HA 2O1WA 4DV4I 4JI1E 2UXCI 4DV6I 1U2RA 5F3WA 1YZ9A 2LMZA 2MC5A 1Y6ZA 1B63A 3F0NA 3ZM7A 4GKKI 4OOGC 3AV0A 4DR4I 4OX9E 1WHNA 3RMPA 2HK3A 4X62I 4F54A 2DSYA 1RREA 4AQYE 3C4TA 2V8PA 3Q6NA 4YHHE 4MYTA 1XNQI 4M30A 4DXLA 1VISA 4MYUA 2NA2A 4X65E 2CG9A 1HR0E 1XMOE 4WFTA 2EZ6A 4B3RE 1FWKA 2LJHA 2LUQA 3WU4A 2V87A 3J7Yp 2V2QA 1ZXMA 4DV3I 4BMJA 4LF4E 1FNMA 4PRXA 2IOQA 1BKNA 2V83A 4PRVA 4DMIA 5ADZA 1XHKA 4IZJA 4YY3I 3DJWA 1USVA 4R03A 2PNMA 2AJ4A 1ZM4A 1H7SA 4LF6E 5BR8I 2HHHI 2MDRA 3ZZTA 5AE3A 2UUCE 3IWDA 1ZXNA 4X8WA 2J7KA 2UXBE 2L2NA 1N34E 2L33A 4URLA 4R8OA 2ODRD 2O1UA 2Z5BA 4DV0I 1FI4A 2E5LE 2VQEE 4X65I 4DV2E 3KWRA 1H72C 1HR0I 4IZJB 4NXNE 1QZRA 4DPYA 4JI1I 3HTXA 4DV6E 3LTOA 5A2QC 4DV7E 4JI0I 3HQ1A 4LFBI 3ADIA 4JI4I 4DUYE 2V2VA 4OX9I 2UUAE 2BV3A 2HKEA 5AE1A 4KHPI 4JYAE 4JG4A 2GQ0A 1Z5AA 3QT6A 4UT4A 4X66I 4X64I 5T6JA 5LMUE 1HNWE 4LF6I 1XMQE 4HYMA 5GMDA 3PYGA 4ZVIA 1N32I 2IOPA 2JR1A 4DV5E 4LU9A 1PKPA 1J5EE 3IWBA 5AASA 1XNQE 3OTOE 4TUIA 1FJGE 4P7AA 4WUDA 5LL6R 4DR7I 2MC6A 3GONA 2LUPB 2RSMA 4DR6I 4X66E 1IBME 2V34A 3JTZA 4I8OA 1STUA 3D4JA 3P1XA 1ELOA 2Z5EA 2IHR1 3AUZA 3CWVA 3F6GA 4NXME 1YYOA 3JAMC 1FWLA 1NHIA 1ZM3A 4XTJA 3LMLA 2V85A 4TUGA 1I94E 2BM0A 2ZM6E 5FLXQ 4DR2I 4K0KI 2WW4A 4BC9A 1HNZE 1NHHA 4BC7A 3IWCA 3HPZA 1GZ6A 1KKHA 3J7AM 1X48A 1PIEA 4JI0E 2B9DA 2ODRC 2F4VI 5FLXC 1O0WA 2CPNA 4JI6I 5L3JA 3PYFA 1YYKA 3ZZUA 4P78A 2KHXA 4DKKA 2B7VA 1T4NA 4JI7I 4DR2E 4IZKA 4DR3I 3C4BA 1IBKI 1HNZI 3HPSA 1HNWI 4DPTA 1SR9A 4LF8E 1WUUA 1Z0WA 4N3OA 3WU5A 3J81Q 3VYXA 4WUCA 4GKJE 2B3TB 2O1TA 3VYYA 2HHHE 4HXZA 4B3RI 1N0UA 5FWKA 3FIGA 2Q2EB 2VQFI 2V88A 2PNLA 1J5EI 4DV5I 1X49A 1RR9A 4DR5E 4GKJI 3LPSA 4M0VA 4FWGA 2KONA 1J26A 2L8TA 2FTXB 1RC7A 3WU3A 3B8HA 5LMNE 4DV1E 4DR4E 4ED4A 1Z5BA 4JYAI 4JI5I 4FWHA 1S4EA 4B3SI 4DU7A 1USUA 1X47A 4WSPA 2KOUA 2FV4B 2NUGA 1Z0GA 2UU9I 2ZBKB 1Y4SA 4R1FA 4BCAA 1MX0A 2M4IA 2WZOA 2Z5CA 5LMUI 1DI2A 1UEKA 4B3MI 4NXNI 1N0VC 4WYQB 2JVAA 1OJ4A 1I94I 2LE2A 4HY1A 3HJCA 4DUYI 2UUAI 4DUZE 3OMLA 4DR6E 3T1YI 3QT8A 4UTGA 4J8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI1 A;  4JI8 I;  5BR8 E;  2UUB I;  3PYE A;  1N33 E;  4RPF A;  2LTR A;  4DV0 E;  1H74 A;  2RS7 A;  5IT9 C;  1ZBT A;  3H4L A;  2B7T A;  4FWD A;  2L2M A;  1FKA E;  1Z0E A;  3B78 A;  2X36 A;  4DPX A;  4LF7 I;  1Z0V A;  2VF3 A;  1IBM I;  1FJG I;  3Q1Q A;  5IWA E;  2YT4 A;  1Z59 A;  4JI3 I;  3LLH A;  1XNR E;  1N36 E;  1NHJ A;  5CFF E;  4FN5 A;  1UIL A;  4DPU A;  4DV7 I;  1H7U A;  4YHH I;  3LNU A;  3JAM Q;  4DUZ I;  3T1Y E;  2CZ9 A;  3ZKD A;  4USM A;  1XMQ I;  4P52 A;  3WU6 A;  5IT9 Q;  2NUF A;  2L2K B;  2UXB I;  4K0K E;  1N33 I;  1Z5C A;  4LF5 I;  4HAC A;  4PU9 A;  2R42 A;  2ZIT A;  3OTO I;  1A6F A;  2UXC E;  2NUE A;  1Z0C A;  2F4V E;  2UU9 E;  4JV5 I;  4YY3 E;  3B82 A;  2DIX A;  4X62 E;  2LTS A;  1N36 I;  3M6A A;  2NPF A;  4LFC I;  1KVK A;  1UHZ A;  4M2Z A;  4KQV A;  1IBL I;  4LF9 I;  3J80 Q;  2UUC I;  2N3G A;  1RQ0 A;  1IBK E;  1N34 I;  4JV5 E;  1GQE A;  3K1J A;  4DR7 E;  4DR1 I;  4USK A;  1XMO I;  2RTX A;  4JI2 E;  2L3C A;  1ZM2 A;  1YYW A;  4B3T I;  2UXD I;  2HK2 A;  2JY9 A;  4HAC B;  1KIJ A;  4DV3 E;  4EMD A;  4WUB A;  4DPW A;  2DEJ A;  3J81 C;  1DAR A;  4X64 E;  3ADJ A;  2LBS B;  2LRS A;  3T1H I;  1KTV A;  2V2Z A;  4KHP E;  2A2C A;  4Z7Y A;  1EA6 A;  4DV4 E;  1Z0B A;  1T4O A;  1HNX I;  4B3S E;  4LF4 I;  2VQE I;  2E5L I;  4DR3 E;  3T1H E;  3V2U C;  5GME A;  2LJP A;  1WHQ A;  1D6T A;  4B3M E;  5A2Q Q;  4GKK E;  2X7I A;  4LFB E;  1HNX E;  1K47 A;  3K17 A;  4DR5 I;  1MU5 A;  2HFS A;  2A2D A;  3ZKB A;  1EKZ A;  4AQY I;  4DV2 I;  3V5R A;  4LFA I;  4NXM I;  2E1R A;  2BM1 A;  1QU6 A;  3ADL A;  5LMN I;  1NZ0 A;  4DU8 A;  5IWA I;  4DV1 I;  2ZM6 I;  1XNR I;  4JI5 E;  1H73 A;  1MG7 A;  2HFU A;  1S16 A;  2EFG A;  4M1K A;  3PYD A;  2DB2 A;  3QT7 A;  4B3T E;  4JI4 E;  2UXD E;  4JI3 E;  4JI2 I;  4DR1 E;  3HUL A;  4JI6 E;  2GS8 A;  2L3J A;  2VQF E;  4LF7 E;  2R3V A;  2XEX A;  1N32 E;  1ZM9 A;  1T4L B;  4LF5 E;  2OI2 A;  4LF8 I;  4Z7C A;  4I3H A;  2DEI A;  3ADG A;  4JI7 E;  4LFC E;  4LFA E;  1IBL E;  4LF9 E;  3QT5 A;  4FW9 A;  2HKJ A;  3J7A G;  1PVG A;  3ZZ0 A;  3J80 C;  2RS6 A;  4JI8 E;  2DMY A;  2UUB E;  1B62 A;  1Z0T A;  2N3H A;  4DV4 I;  4JI1 E;  2UXC I;  4DV6 I;  1U2R A;  1YZ9 A;  1B63 A;  3F0N A;  3ZM7 A;  4GKK I;  4OOG C;  4DR4 I;  4OX9 E;  1WHN A;  2HK3 A;  4X62 I;  1RRE A;  4AQY E;  3C4T A;  2V8P A;  4YHH E;  4MYT A;  1XNQ I;  4M30 A;  4DXL A;  1VIS A;  4MYU A;  2NA2 A;  4X65 E;  1HR0 E;  1XMO E;  4WFT A;  2EZ6 A;  4B3R E;  1FWK A;  2LJH A;  2LUQ A;  3WU4 A;  3J7Y p;  2V2Q A;  1ZXM A;  4DV3 I;  4LF4 E;  1FNM A;  4PRX A;  1BKN A;  4PRV A;  1XHK A;  4YY3 I;  2AJ4 A;  1ZM4 A;  1H7S A;  4LF6 E;  5BR8 I;  2HHH I;  2MDR A;  3ZZT A;  2UUC E;  1ZXN A;  4X8W A;  2J7K A;  2UXB E;  2L2N A;  1N34 E;  2L33 A;  4URL A;  4DV0 I;  1FI4 A;  2E5L E;  2VQE E;  4X65 I;  4DV2 E;  1H72 C;  1HR0 I;  4NXN E;  1QZR A;  4DPY A;  4JI1 I;  3HTX A;  4DV6 E;  3LTO A;  5A2Q C;  4DV7 E;  4JI0 I;  4LFB I;  3ADI A;  4JI4 I;  4DUY E;  2V2V A;  4OX9 I;  2UUA E;  2BV3 A;  2HKE A;  4KHP I;  4JYA E;  4JG4 A;  1Z5A A;  3QT6 A;  4UT4 A;  4X66 I;  4X64 I;  5LMU E;  1HNW E;  4LF6 I;  1XMQ E;  4HYM A;  5GMD A;  3PYG A;  4ZVI A;  1N32 I;  4DV5 E;  1J5E E;  1PKP A;  1XNQ E;  3OTO E;  1FJG E;  4P7A A;  4WUD A;  5LL6 R;  4DR7 I;  3GON A;  2LUP B;  2RSM A;  4DR6 I;  4X66 E;  1IBM E;  2V34 A;  1STU A;  3D4J A;  3P1X A;  1ELO A;  2IHR 1;  3CWV A;  4NXM E;  1YYO A;  3JAM C;  1FWL A;  1NHI A;  1ZM3 A;  4XTJ A;  1I94 E;  2BM0 A;  2ZM6 E;  5FLX Q;  4DR2 I;  4K0K I;  2WW4 A;  1HNZ E;  1NHH A;  1KKH A;  3J7A M;  1X48 A;  1PIE A;  4JI0 E;  2F4V I;  5FLX C;  1O0W A;  2CPN A;  4JI6 I;  5L3J A;  3PYF A;  1YYK A;  3ZZU A;  2KHX A;  4DKK A;  2B7V A;  1T4N A;  4JI7 I;  4DR2 E;  4DR3 I;  3C4B A;  1IBK I;  1HNZ I;  1HNW I;  4DPT A;  4LF8 E;  1WUU A;  1Z0W A;  3WU5 A;  3J81 Q;  3VYX A;  4WUC A;  4GKJ E;  2B3T B;  3VYY A;  2HHH E;  4HXZ A;  4B3R I;  1N0U A;  2Q2E B;  2VQF I;  1J5E I;  4DV5 I;  1X49 A;  1RR9 A;  4DR5 E;  4GKJ I;  3LPS A;  4FWG A;  1J26 A;  1RC7 A;  3WU3 A;  3B8H A;  5LMN E;  4DV1 E;  4DR4 E;  4ED4 A;  1Z5B A;  4JYA I;  4JI5 I;  4FWH A;  1S4E A;  4B3S I;  4DU7 A;  1X47 A;  2NUG A;  1Z0G A;  2UU9 I;  2ZBK B;  4R1F A;  1MX0 A;  5LMU I;  1DI2 A;  1UEK A;  4B3M I;  4NXN I;  1N0V C;  4WYQ B;  2JVA A;  1OJ4 A;  1I94 I;  4HY1 A;  4DUY I;  2UUA I;  4DUZ E;  4DR6 E;  3T1Y I;  3QT8 A;  4UTG A; 
#chains in the Genus database with same CATH topology
 2YTG A;  1A1G A;  4WSG A;  1EI1 A;  3P06 A;  5BR8 E;  4JI8 I;  2UUB I;  5C0X B;  3PYE A;  1EH7 A;  2YTJ A;  5IV8 B;  1N33 E;  4BA1 A;  2NN6 D;  2LTR A;  4RPF A;  5C0X F;  4AIM A;  4DV0 E;  1H74 A;  3EPL A;  2RS7 A;  2MDG A;  2CGE A;  2PO0 B;  5IT9 C;  4R2C A;  1ZBT A;  3H4L A;  2B7T A;  2CTD A;  2JOX A;  1UDO A;  4FWD A;  2L2M A;  1FKA E;  4IFD B;  1Z0E A;  3B78 A;  4LTY A;  2NN6 A;  2ENA A;  5AC4 A;  2X36 A;  4DPX A;  4LF7 I;  2EN8 A;  1Z0V A;  1UDQ A;  2VF3 A;  1IBM I;  1FJG I;  3Q1Q A;  2YTE A;  2YT4 A;  5IWA E;  1OYP A;  1Z59 A;  4JI3 I;  1X6H A;  3LLH A;  1XNR E;  1N36 E;  1YUJ A;  1NHJ A;  5CFF E;  2ELZ A;  4FN5 A;  2L6M A;  2CSH A;  1UIL A;  2YPN A;  2YTQ A;  4DPU A;  1RHY A;  1UBD C;  4BA1 B;  5JEA E;  4DV7 I;  2F8B A;  1H7U A;  1BBG A;  4YHH I;  3LNU A;  3JAM Q;  4DUZ I;  4L5N C;  2GLI A;  2EOM A;  3Q6M A;  3T1Y E;  2CZ9 A;  3ZKD A;  1IQS A;  5EL9 A;  2EPM X;  4USM A;  1XMQ I;  4P52 A;  3WU6 A;  5IT9 Q;  2V89 A;  3CDJ A;  4R2Q A;  2YZT A;  2K7I A;  2L2K B;  2NUF A;  3P76 A;  2UXB I;  1UDN A;  4K0K E;  2EMH A;  1N33 I;  2H36 X;  3JU0 A;  4F6N A;  1Z5C A;  4LF5 I;  4HAC A;  4PU9 A;  2R42 A;  2ZIT A;  2YTI A;  3OTO I;  1A6F A;  2EOO A;  2UXC E;  4F9A B;  3CDI A;  4MLQ A;  3M85 D;  3M85 G;  2NUE A;  1Z0C A;  4R2S A;  2F4V E;  2V8Q B;  1HK7 A;  1VI7 A;  2UU9 E;  4JV5 I;  2EPC A;  4Q28 A;  2JOB A;  4YY3 E;  4GEQ B;  2EOJ A;  3EPJ A;  3B82 A;  2DIX A;  3DF6 A;  4X62 E;  2N8X A;  2LTS A;  1TF6 A;  4LCG A;  1N36 I;  2EOH A;  3M6A A;  1ZU1 A;  4LCF A;  2NPF A;  4LFC I;  1KVK A;  1UHZ A;  2V86 A;  4WPY A;  4M2Z A;  2BBG A;  2NN6 C;  4KQV A;  5A6J A;  1IBL I;  4LF9 I;  4WX9 A;  3J80 Q;  2UUC I;  2N3G A;  2EMA A;  1RQ0 A;  1Y5Y A;  1IBK E;  2PNZ A;  1XXE A;  2WCC 3;  1N34 I;  1TN9 A;  4JV5 E;  2YTO A;  1ZR9 A;  2G7H A;  4MU0 A;  4BHB A;  1GQE A;  1UDS A;  3K1J A;  4DR7 E;  4DR1 I;  4USK A;  1XMO I;  2RTX A;  4JI2 E;  4IZJ D;  2R1F A;  2YSO A;  1R6M A;  5KL7 A;  2L3C A;  2YWQ A;  1ZM2 A;  3C6M A;  2E72 A;  1YYW A;  4B3T I;  2UXD I;  2EN7 A;  1F2I G;  2HK2 A;  2JWO A;  3EQ1 A;  2JY9 A;  1LLM C;  2VF1 A;  2EP3 A;  2EL4 A;  4IFD F;  2EPR A;  4HAC B;  1KIJ A;  4DV3 E;  4EMD A;  4WUB A;  3K6Q A;  2PO0 A;  4DPW A;  2DEJ A;  4F9B B;  2VE7 C;  3J81 C;  3U1K A;  1DAR A;  4QNK A;  4ISA A;  4OKG A;  1WJP A;  3ADJ A;  4X64 E;  3UK3 C;  2LRS A;  2LBS B;  5DNY A;  4L8N A;  4BBY A;  2MKN A;  1KTV A;  1P42 A;  2PO2 A;  3T1H I;  2V2Z A;  2EN2 A;  5KL2 A;  2VRD A;  4KHP E;  4IS1 C;  2A2C A;  3KZY A;  4Z7Y A;  5AC5 A;  3ECR A;  1DGC A;  3F6H A;  1EA6 A;  2Z5C B;  1KYQ A;  5JEA B;  2EPZ A;  1WRJ A;  2EN6 A;  2EQ3 A;  4FK5 C;  1TF3 A;  4DV4 E;  2YTP A;  1OYR A;  4U3B A;  5K36 E;  1YUI A;  4Q35 B;  3PRY A;  1Z0B A;  1T4O A;  2O1V A;  3ZOQ B;  2EOF A;  4R2R A;  1HNX I;  5LLQ A;  2PNZ B;  4B3S E;  4P7D A;  1T38 A;  3K85 A;  4LF4 I;  2C39 A;  2VQE I;  2E5L I;  4DR3 E;  3T1H E;  2E1M A;  4LOM A;  3V2U C;  4N4R B;  1WXR A;  5GME A;  2LJP A;  1WHQ A;  2IER A;  2JEB A;  4B3M E;  4HTG A;  2O3Z A;  1D6T A;  2JE6 B;  2D9H A;  2EPX A;  1QNT A;  3NZK A;  5A2Q Q;  2EL5 A;  1MGT A;  1Z1B A;  4GKK E;  2X7I A;  4NBQ A;  4M9V C;  2DGC A;  4BS9 A;  4LFB E;  2GO4 A;  1HNX E;  2EOR A;  2EMK A;  2EPU A;  1K47 A;  3K17 A;  4DR5 I;  2C39 B;  4FW4 A;  1MU5 A;  1Y4U A;  2HFS A;  2A2D A;  3ZKB A;  5JEA F;  4IFD C;  2EE8 A;  1EKZ A;  4AQY I;  4DV2 I;  2LCE A;  3V5R A;  4LFA I;  4NXM I;  4IFD E;  2CVE A;  2E1R A;  5JEA C;  1A1J A;  1IMU A;  2BM1 A;  1QU6 A;  3ADL A;  5LMN I;  1NZ0 A;  2NN6 F;  2EWL A;  4F9C B;  4DU8 A;  5IWA I;  2ZM6 I;  3QG5 C;  4DV1 I;  1XNR I;  4GZN C;  4JI5 E;  4KWY A;  1H73 A;  1MG7 A;  2HFU A;  1S16 A;  5C0X A;  2EFG A;  2M7Q A;  3VK6 A;  2J7J A;  1G2F C;  2ENH A;  2NAB A;  2C37 A;  4M1K A;  2EPK X;  5DNX A;  2RPC A;  2JYA A;  1IQO A;  2DB2 A;  3PYD A;  4ZYG A;  2DLQ A;  3QT7 A;  2K4V A;  2RQL A;  4B3T E;  4JI4 E;  2UXD E;  4BA2 B;  2WBS A;  3GLL A;  4RHB B;  2WP8 A;  2YRK A;  4JI3 E;  4JI2 I;  4DR1 E;  3HUL A;  4OZE A;  2BA0 D;  4JI6 E;  2YTD A;  5TSE A;  2L3J A;  2VQF E;  4LF7 E;  1R6L A;  2GS8 A;  2R3V A;  2XEX A;  1N32 E;  4IZK B;  2EM4 A;  2YTN A;  3MSW A;  1ZM9 A;  1T4L B;  1X3C A;  2EM3 A;  2L92 A;  4LF5 E;  3H09 A;  1ZBQ A;  2OI2 A;  4LF8 I;  2FGG A;  1E3H A;  2JEA A;  4OO1 D;  2Z5B B;  1SFE A;  2EOI A;  2PRT A;  4Z7C A;  4I3H A;  4FW6 A;  2DEI A;  3ADG A;  2VES A;  4JI7 E;  2ADR A;  4LFC E;  2EN3 A;  4KZS A;  2M1S A;  1IBL E;  4LF9 E;  4LFA E;  3QT5 A;  2PO2 B;  3L7Z B;  4FW9 A;  4GQU A;  4MQY A;  2HKJ A;  3J7A G;  1DQ3 A;  1PVG A;  2EOS A;  2EOZ A;  2YU8 A;  2EPA A;  3ZZ0 A;  3C6K A;  3HXL A;  2HJJ A;  3J80 C;  3THO B;  2RS6 A;  4JI8 E;  2DMY A;  5IXM B;  2HGH A;  5KL4 A;  2UUB E;  2EQ0 A;  1B62 A;  1Z0T A;  5AE2 A;  2N3H A;  2O1W A;  4DV4 I;  4JI1 E;  1A1I A;  2UXC I;  3BF2 A;  1U2R A;  5F3W A;  4ZYE A;  4DV6 I;  1YZ9 A;  3HKM A;  1YPN A;  2LMZ A;  2MC5 A;  1Y6Z A;  1YFH A;  1B63 A;  1NCS A;  5KL5 A;  3F0N A;  4QNJ A;  3ZM7 A;  4GKK I;  1NEI A;  4OOG C;  3AV0 A;  4DR4 I;  4R2A A;  4OX9 E;  1N3G A;  1WHN A;  3RMP A;  2HK3 A;  1AAY A;  4X62 I;  4F54 A;  2I9I A;  1MEY C;  1A1L A;  2JE6 A;  3EPH A;  1UN6 B;  2DSY A;  1RRE A;  4OO1 E;  4AQY E;  3C4T A;  2V8P A;  3Q6N A;  4YHH E;  4MYT A;  2WNR A;  1XNQ I;  4M30 A;  5DRQ A;  4DXL A;  1VIS A;  4MYU A;  2NA2 A;  4O5G A;  4X65 E;  2PO1 A;  2CG9 A;  1HR0 E;  1XMO E;  4WFT A;  2EZ6 A;  1T39 A;  4B3R E;  1FWK A;  2LJH A;  2LUQ A;  1EH8 A;  3MHH C;  3WU4 A;  2ENC A;  2V87 A;  4R2P A;  4NHR A;  3KZZ A;  2DMI A;  3J7Y p;  2V2Q A;  2ELY A;  1ZXM A;  4DV3 I;  4BMJ A;  1GTK A;  4MLV A;  2EM7 A;  4LF4 E;  1FNM A;  3P3E A;  2IOQ A;  4PRX A;  2EML A;  1A1K A;  1BKN A;  2V83 A;  2EOE A;  4PRV A;  1EH6 A;  4DMI A;  5ADZ A;  5A69 A;  2NN6 E;  3PS2 A;  1XHK A;  2EMX A;  4IZJ A;  4YY3 I;  3DJW A;  1USV A;  4FW7 A;  4R03 A;  3UHM A;  2PNM A;  2AJ4 A;  5C0X C;  1ZM4 A;  1X6E A;  1H7S A;  3GCM A;  4LF6 E;  5BR8 I;  4MDT A;  2MDR A;  2HHH I;  5A6B A;  3ZZT A;  5AE3 A;  1PJT A;  2UUC E;  3IWD A;  1ZXN A;  2JP9 A;  1JK2 A;  4X8W A;  2LVH A;  2EL6 A;  2J7K A;  2UXB E;  2L2N A;  2EMI A;  2L33 A;  2EOQ A;  1N34 E;  2NN6 B;  4R8O A;  4URL A;  2ODR D;  5KL3 A;  2O1U A;  3PS3 A;  2JEA B;  3M99 B;  5A6B D;  2Z5B A;  4DV0 I;  2BA1 G;  2DLK A;  1FI4 A;  2JXP A;  2E5L E;  2EPN A;  2VQE E;  4X65 I;  2YRM A;  4IFD D;  4DV2 E;  1E3P A;  3KWR A;  1H72 C;  1HR0 I;  4IZJ B;  2PO1 B;  2EN4 A;  4NXN E;  1QZR A;  4DPY A;  4JI1 I;  3HTX A;  4DV6 E;  2EPP A;  2AE8 A;  5A2Q C;  3LTO A;  4DV7 E;  2EM8 A;  4JI0 I;  4U3D A;  3HQ1 A;  4LFB I;  1ZAA C;  3ADI A;  4MU3 A;  4JI4 I;  2EN1 A;  2Q8U A;  4DUY E;  2V2V A;  4OX9 I;  1JK1 A;  2C37 B;  2UUA E;  2BV3 A;  2LT7 A;  2WBU A;  1BBO A;  2HKE A;  5AE1 A;  5A6K A;  2C38 B;  2GHF A;  4JYA E;  2GQ0 A;  4JG4 A;  4KHP I;  1Z5A A;  2GPI A;  3QT6 A;  4UT4 A;  4X66 I;  2BA1 D;  4X64 I;  4O4K A;  5T6J A;  5LMU E;  1HNW E;  4LF6 I;  2MKD A;  1XMQ E;  2LJU A;  2WBT A;  4HYM A;  5GMD A;  3PS1 A;  3PYG A;  3P3G A;  4ZVI A;  1N32 I;  2LO3 A;  2IOP A;  2JR1 A;  4DV5 E;  4LU9 A;  1PKP A;  1J5E E;  4ZYD A;  4X9J A;  4FW3 A;  3IWB A;  5AAS A;  1XNQ E;  3OTO E;  4TUI A;  1FJG E;  4P7A A;  3H1C A;  4ZYH A;  4WUD A;  5LL6 R;  3THN A;  4DR7 I;  2MC6 A;  5DRR A;  3GON A;  2YTF A;  2LUP B;  3L7Z A;  2EPL X;  4MU1 A;  3M7N G;  2EMY A;  2RSM A;  4DR6 I;  4X66 E;  1IBM E;  2BR2 B;  4WXC A;  2V34 A;  3JTZ A;  4I8O A;  1STU A;  4IS9 A;  3D4J A;  3P1X A;  4IJD A;  4NZV A;  3DD6 A;  3U1Y A;  1ELO A;  2I13 A;  2EM2 A;  4OO1 B;  4R2E A;  2EQ1 A;  2EM6 A;  2Z5E A;  2IHR 1;  4IFD A;  3AUZ A;  2BB8 A;  2A25 A;  3CWV A;  5ELW A;  3F6G A;  3P3C A;  4OO1 C;  4NXM E;  2EOY A;  3VHT B;  1YYO A;  1L4S A;  3JAM C;  1P47 A;  1FWL A;  1NHI A;  3M7N D;  5A6A A;  1ZM3 A;  2EMB A;  4LCH A;  4XTJ A;  5K36 F;  3L00 A;  1KJK A;  3LML A;  4OO1 A;  3BBG A;  2V85 A;  4TUG A;  5K36 B;  1I94 E;  2BM0 A;  2ZM6 E;  5FLX Q;  4DR2 I;  1X6F A;  2YRH A;  2WW4 A;  4BC9 A;  2HC5 A;  1HNZ E;  1NHH A;  3GME A;  5EKW A;  4K0K I;  4BC7 A;  3IWC A;  3HPZ A;  1GZ6 A;  1KKH A;  4J3D A;  3J7A M;  1X48 A;  3BGH A;  1PIE A;  4JI0 E;  2B9D A;  2ODR C;  2F4V I;  4OO1 F;  5JEA A;  5FLX C;  1O0W A;  2CPN A;  4JI6 I;  3BID A;  4BHC A;  5DRP A;  4BA2 A;  5K36 A;  2EMW A;  5L3J A;  3PYF A;  2RSI A;  1YYK A;  2WP8 B;  1OYS A;  3ZZU A;  4P78 A;  1G2D C;  5JEA D;  4MU4 A;  4FW5 A;  2KHX A;  2YSP A;  2B7V A;  4DKK A;  5C0X D;  1T4N A;  4JI7 I;  2GO3 A;  4DR2 E;  4IZK A;  4DR3 I;  3C4B A;  1IBK I;  1PJQ A;  3HPS A;  1HNZ I;  4DPT A;  1HNW I;  1SR9 A;  4AID A;  2IES A;  4LF8 E;  1WUU A;  1Z0W A;  2C38 A;  1YH8 A;  4N3O A;  3WU5 A;  3J81 Q;  3VYX A;  4WUC A;  4GKJ E;  2B3T B;  2EMG A;  4RH8 A;  5DNL A;  2O1T A;  3VYY A;  1B69 A;  2HHH E;  4HXZ A;  1X5W A;  4O43 A;  5DRO A;  2EM9 A;  4AM3 A;  4B3R I;  1N0U A;  2JPA A;  5FWK A;  3EPK A;  3FIG A;  2Q2E B;  2VQF I;  2V88 A;  2PNL A;  3MHS C;  2EM0 A;  1J5E I;  4DV5 I;  1X49 A;  4LPF A;  1RR9 A;  1A1F A;  4DR5 E;  4GKJ I;  1A1H A;  3LPS A;  2F1D A;  4M0V A;  2JT2 A;  4FWG A;  2KON A;  1J26 A;  2L8T A;  2FTX B;  1RC7 A;  3WU3 A;  2EOX A;  2YU5 A;  4F6M A;  3B8H A;  5C0X E;  4O24 A;  5LMN E;  2EMZ A;  4DV1 E;  4DR4 E;  4ED4 A;  2BR2 A;  1Z5B A;  4JYA I;  1YSA C;  4FWH A;  4JI5 I;  1S4E A;  1PJS A;  4B3S I;  2EPO A;  4DU7 A;  1USU A;  4WSP A;  1X47 A;  2EM5 A;  2FV4 B;  2KOU A;  4HEI A;  2NUG A;  3B4T A;  3KRN A;  1Z0G A;  1PDA A;  2R76 A;  2JEB B;  2WNR B;  2ZBK B;  2UU9 I;  2EMC A;  1Y4S A;  4R1F A;  4BCA A;  5K36 D;  1MX0 A;  2M4I A;  2WZO A;  5KL6 A;  1AH5 A;  2Z5C A;  3TQM A;  2LV2 A;  1DI2 A;  5LMU I;  4R2D A;  1UEK A;  4B3M I;  2M9A A;  4NXN I;  1N0V C;  4WXD A;  2DRP A;  4WYQ B;  2JVA A;  1OJ4 A;  1I94 I;  2LE2 A;  4HY1 A;  2EMF A;  1BB8 A;  2CT1 A;  3HJC A;  1YHC A;  2BA0 G;  4DUY I;  5K36 C;  2UUA I;  4DUZ E;  3OML A;  4DR6 E;  1RMD A;  4F2J C;  2EJ4 A;  3T1Y I;  3QT8 A;  4UTG A;  1Y60 A;  2J65 A;  4J8Z A; 
#chains in the Genus database with same CATH homology
 3P06 A;  1EI1 A;  4JI8 I;  5BR8 E;  2UUB I;  3PYE A;  1N33 E;  4RPF A;  2LTR A;  4DV0 E;  1H74 A;  2CGE A;  2RS7 A;  5IT9 C;  1ZBT A;  3H4L A;  2B7T A;  2JOX A;  4FWD A;  2L2M A;  1FKA E;  1Z0E A;  3B78 A;  4LTY A;  2X36 A;  4DPX A;  4LF7 I;  1Z0V A;  2VF3 A;  1IBM I;  1FJG I;  3Q1Q A;  5IWA E;  2YT4 A;  1Z59 A;  4JI3 I;  3LLH A;  1XNR E;  1N36 E;  1NHJ A;  5CFF E;  4FN5 A;  2L6M A;  1UIL A;  4DPU A;  4DV7 I;  2F8B A;  1H7U A;  4YHH I;  3LNU A;  3JAM Q;  4DUZ I;  4L5N C;  3Q6M A;  3T1Y E;  2CZ9 A;  3ZKD A;  4USM A;  1XMQ I;  4P52 A;  3WU6 A;  5IT9 Q;  2V89 A;  2YZT A;  2NUF A;  2L2K B;  2UXB I;  4K0K E;  1N33 I;  2H36 X;  3JU0 A;  1Z5C A;  4LF5 I;  4HAC A;  4PU9 A;  2R42 A;  2ZIT A;  3OTO I;  1A6F A;  2UXC E;  4F9A B;  2NUE A;  1Z0C A;  2F4V E;  2V8Q B;  1HK7 A;  2UU9 E;  4JV5 I;  4Q28 A;  2JOB A;  4YY3 E;  4GEQ B;  3B82 A;  2DIX A;  3DF6 A;  4X62 E;  2LTS A;  1N36 I;  3M6A A;  2NPF A;  4LFC I;  1KVK A;  1UHZ A;  2V86 A;  4WPY A;  4M2Z A;  4KQV A;  1IBL I;  4LF9 I;  3J80 Q;  2UUC I;  2N3G A;  1RQ0 A;  1IBK E;  1N34 I;  4JV5 E;  2G7H A;  1GQE A;  3K1J A;  4DR7 E;  4DR1 I;  4USK A;  1XMO I;  2RTX A;  4JI2 E;  4IZJ D;  2L3C A;  1ZM2 A;  1YYW A;  4B3T I;  2UXD I;  2HK2 A;  2JWO A;  2JY9 A;  2VF1 A;  4HAC B;  1KIJ A;  4DV3 E;  4EMD A;  4WUB A;  3K6Q A;  4DPW A;  2DEJ A;  4F9B B;  2VE7 C;  3J81 C;  1DAR A;  4X64 E;  2LBS B;  3ADJ A;  2LRS A;  5DNY A;  4L8N A;  4BBY A;  3T1H I;  1KTV A;  2V2Z A;  4KHP E;  2A2C A;  4Z7Y A;  3F6H A;  1EA6 A;  2Z5C B;  4DV4 E;  3PRY A;  1Z0B A;  1T4O A;  2O1V A;  3ZOQ B;  1HNX I;  4B3S E;  4P7D A;  4LF4 I;  3K85 A;  2VQE I;  2E5L I;  4DR3 E;  3T1H E;  2E1M A;  3V2U C;  5GME A;  1WXR A;  2LJP A;  1WHQ A;  1D6T A;  4B3M E;  5A2Q Q;  4GKK E;  2X7I A;  4BS9 A;  4LFB E;  1HNX E;  1K47 A;  3K17 A;  4DR5 I;  1MU5 A;  1Y4U A;  2HFS A;  2A2D A;  3ZKB A;  1EKZ A;  4AQY I;  4DV2 I;  3V5R A;  4LFA I;  4NXM I;  2E1R A;  2BM1 A;  1QU6 A;  3ADL A;  5LMN I;  1NZ0 A;  4DU8 A;  2EWL A;  4F9C B;  5IWA I;  4DV1 I;  2ZM6 I;  1XNR I;  4JI5 E;  1H73 A;  1MG7 A;  2HFU A;  1S16 A;  2EFG A;  2M7Q A;  3VK6 A;  4M1K A;  3PYD A;  2DB2 A;  3QT7 A;  2K4V A;  4B3T E;  4JI4 E;  2UXD E;  4JI3 E;  4JI2 I;  4DR1 E;  3HUL A;  4JI6 E;  2GS8 A;  2L3J A;  2VQF E;  4LF7 E;  2R3V A;  2XEX A;  1N32 E;  4IZK B;  3MSW A;  1ZM9 A;  1T4L B;  2L92 A;  4LF5 E;  3H09 A;  1ZBQ A;  2OI2 A;  4LF8 I;  2FGG A;  2Z5B B;  4Z7C A;  4I3H A;  2DEI A;  3ADG A;  4JI7 E;  4LFC E;  4KZS A;  2M1S A;  1IBL E;  4LF9 E;  4LFA E;  3QT5 A;  4FW9 A;  2HKJ A;  3J7A G;  1DQ3 A;  1PVG A;  3ZZ0 A;  3HXL A;  3J80 C;  2RS6 A;  4JI8 E;  2DMY A;  2UUB E;  1B62 A;  1Z0T A;  5AE2 A;  2N3H A;  2O1W A;  4DV4 I;  4JI1 E;  2UXC I;  4DV6 I;  1U2R A;  5F3W A;  1YZ9 A;  2LMZ A;  2MC5 A;  1Y6Z A;  1B63 A;  3F0N A;  3ZM7 A;  4GKK I;  4OOG C;  3AV0 A;  4DR4 I;  4OX9 E;  1WHN A;  3RMP A;  2HK3 A;  4X62 I;  4F54 A;  2DSY A;  1RRE A;  4AQY E;  3C4T A;  2V8P A;  3Q6N A;  4YHH E;  4MYT A;  1XNQ I;  4M30 A;  4DXL A;  1VIS A;  4MYU A;  2NA2 A;  4X65 E;  2CG9 A;  1HR0 E;  1XMO E;  4WFT A;  2EZ6 A;  4B3R E;  1FWK A;  2LJH A;  2LUQ A;  3WU4 A;  2V87 A;  3J7Y p;  2V2Q A;  1ZXM A;  4DV3 I;  4BMJ A;  4LF4 E;  1FNM A;  4PRX A;  2IOQ A;  1BKN A;  2V83 A;  4PRV A;  4DMI A;  5ADZ A;  1XHK A;  4IZJ A;  4YY3 I;  3DJW A;  1USV A;  4R03 A;  2PNM A;  2AJ4 A;  1ZM4 A;  1H7S A;  4LF6 E;  5BR8 I;  2HHH I;  2MDR A;  3ZZT A;  5AE3 A;  2UUC E;  3IWD A;  1ZXN A;  4X8W A;  2J7K A;  2UXB E;  2L2N A;  1N34 E;  2L33 A;  4URL A;  4R8O A;  2ODR D;  2O1U A;  2Z5B A;  4DV0 I;  1FI4 A;  2E5L E;  2VQE E;  4X65 I;  4DV2 E;  3KWR A;  1H72 C;  1HR0 I;  4IZJ B;  4NXN E;  1QZR A;  4DPY A;  4JI1 I;  3HTX A;  4DV6 E;  3LTO A;  5A2Q C;  4DV7 E;  4JI0 I;  3HQ1 A;  4LFB I;  3ADI A;  4JI4 I;  4DUY E;  2V2V A;  4OX9 I;  2UUA E;  2BV3 A;  2HKE A;  5AE1 A;  4KHP I;  4JYA E;  4JG4 A;  2GQ0 A;  1Z5A A;  3QT6 A;  4UT4 A;  4X66 I;  4X64 I;  5T6J A;  5LMU E;  1HNW E;  4LF6 I;  1XMQ E;  4HYM A;  5GMD A;  3PYG A;  4ZVI A;  1N32 I;  2IOP A;  2JR1 A;  4DV5 E;  4LU9 A;  1PKP A;  1J5E E;  3IWB A;  5AAS A;  1XNQ E;  3OTO E;  4TUI A;  1FJG E;  4P7A A;  4WUD A;  5LL6 R;  4DR7 I;  2MC6 A;  3GON A;  2LUP B;  2RSM A;  4DR6 I;  4X66 E;  1IBM E;  2V34 A;  3JTZ A;  4I8O A;  1STU A;  3D4J A;  3P1X A;  1ELO A;  2Z5E A;  2IHR 1;  3AUZ A;  3CWV A;  3F6G A;  4NXM E;  1YYO A;  3JAM C;  1FWL A;  1NHI A;  1ZM3 A;  4XTJ A;  3LML A;  2V85 A;  4TUG A;  1I94 E;  2BM0 A;  2ZM6 E;  5FLX Q;  4DR2 I;  4K0K I;  2WW4 A;  4BC9 A;  1HNZ E;  1NHH A;  4BC7 A;  3IWC A;  3HPZ A;  1GZ6 A;  1KKH A;  3J7A M;  1X48 A;  1PIE A;  4JI0 E;  2B9D A;  2ODR C;  2F4V I;  5FLX C;  1O0W A;  2CPN A;  4JI6 I;  5L3J A;  3PYF A;  1YYK A;  3ZZU A;  4P78 A;  2KHX A;  4DKK A;  2B7V A;  1T4N A;  4JI7 I;  4DR2 E;  4IZK A;  4DR3 I;  3C4B A;  1IBK I;  1HNZ I;  3HPS A;  1HNW I;  4DPT A;  1SR9 A;  4LF8 E;  1WUU A;  1Z0W A;  4N3O A;  3WU5 A;  3J81 Q;  3VYX A;  4WUC A;  4GKJ E;  2B3T B;  2O1T A;  3VYY A;  2HHH E;  4HXZ A;  4B3R I;  1N0U A;  5FWK A;  3FIG A;  2Q2E B;  2VQF I;  2V88 A;  2PNL A;  1J5E I;  4DV5 I;  1X49 A;  1RR9 A;  4DR5 E;  4GKJ I;  3LPS A;  4M0V A;  4FWG A;  2KON A;  1J26 A;  2L8T A;  2FTX B;  1RC7 A;  3WU3 A;  3B8H A;  5LMN E;  4DV1 E;  4DR4 E;  4ED4 A;  1Z5B A;  4JYA I;  4JI5 I;  4FWH A;  1S4E A;  4B3S I;  4DU7 A;  1USU A;  1X47 A;  4WSP A;  2KOU A;  2FV4 B;  2NUG A;  1Z0G A;  2UU9 I;  2ZBK B;  1Y4S A;  4R1F A;  4BCA A;  1MX0 A;  2M4I A;  2WZO A;  2Z5C A;  5LMU I;  1DI2 A;  1UEK A;  4B3M I;  4NXN I;  1N0V C;  4WYQ B;  2JVA A;  1OJ4 A;  1I94 I;  2LE2 A;  4HY1 A;  3HJC A;  4DUY I;  2UUA I;  4DUZ E;  3OML A;  4DR6 E;  3T1Y I;  3QT8 A;  4UTG A;  4J8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...