2VQEE

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2vqeE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqeE02
1Z0CA 1HR0E 2N3HA 1XNQI 2ZBKB 1FKAE 1WHNA 2NUEA 2RTXA 4DPTA 1Z0WA 4K0KI 2UXDI 4DKKA 4JI1I 4DR7E 1J5EE 1NHJA 5IT9Q 5BR8E 2L3CA 2NUFA 4JI6I 1H7UA 4X62E 4DV5I 2UUAI 2N3GA 3K17A 3PYDA 1N33I 2NUGA 2V8PA 1HNWI 3PYGA 5IWAI 1J26A 4R1FA 1EKZA 1H73A 2A2CA 4B3SE 4NXME 3HTXA 1Z0EA 1XNRI 1D6TA 3J81Q 3WU3A 3WU6A 4JI3E 1RREA 1WHQA 4X66I 1PKPA 2F4VI 4DV7I 1X48A 1HNXE 2DEJA 4LF6I 1B62A 3ZZTA 2RS6A 1S4EA 4DUZE 4P52A 2UUBI 4PRXA 3V2UC 1XMQI 4YHHI 4WUBA 1QZRA 1N0VC 2UUCI 1Z0GA 4NXNE 3B8HA 4RPFA 1N32I 4GKJE 3LTOA 2ZM6I 4FW9A 4PRVA 1Z0VA 1ZXNA 2EFGA 1K47A 1I94I 4JI4I 4DV3I 3CWVA 4LFAE 1KTVA 3PYFA 4AQYI 4DR2I 3V5RA 4M2ZA 4WUDA 4DV4I 2JY9A 3ZKBA 2UXDE 4M1KA 4JI1E 1DARA 4DR3E 2UXCI 2E5LE 4OX9I 4WFTA 4X65E 1DI2A 2B7TA 2IHR1 5LMUE 1N33E 3OTOI 5IWAE 4FWGA 5GMEA 4DR4I 1XNRE 1FI4A 1MX0A 3QT8A 2NPFA 3JAMQ 1NHHA 4X66E 4LF4I 2R3VA 1N36I 1PVGA 3J7Yp 2LJPA 1NZ0A 1NHIA 2B7VA 2E1RA 3ZM7A 2Q2EB 2V2ZA 1FJGI 1Z5CA 2VQFI 4UTGA 3LNUA 2DIXA 2J7KA 5GMDA 2UUBE 2HKEA 1FWKA 4LFBI 2VF3A 1UHZA 1WUUA 2L2KB 1KVKA 4JV5I 1Z0BA 4JI5I 4HY1A 4ZVIA 2L2NA 2V34A 2LUPB 1N32E 2ZM6E 1Z5AA 2LUQA 2LTSA 5IT9C 4LF5I 5LMNI 2XEXA 2CZ9A 1I94E 4JI4E 4FWHA 1XMOI 3ZKDA 1O0WA 4DV3E 4XTJA 4DUYI 4LFCE 1QU6A 4DR1E 1YYKA 5LL6R 2R42A 4JYAI 4DR2E 3VYXA 3J81C 1ZXMA 3P1XA 1STUA 4KQVA 1RQ0A 3WU4A 4JI8I 3ADJA 1Z0TA 3WU5A 2LJHA 4OX9E 4YY3I 3T1YI 2VQEI 4X64I 3F0NA 3T1HE 4DV6I 3OTOE 2KHXA 1ELOA 4MYUA 3HULA 4M30A 1Z59A 2UU9E 1N34E 2MDRA 4X8WA 4LF4E 4WYQB 2V2QA 1H74A 1MG7A 2YT4A 5FLXQ 2X36A 2LTRA 3QT5A 4DPWA 1U2RA 2EZ6A 4DV1E 1B63A 1PIEA 1N0UA 1J5EI 4DR7I 3ADLA 5A2QQ 4FWDA 1S16A 4DV0I 1RC7A 1FWLA 2HHHI 1XNQE 2VQFE 4MYTA 4JI0I 4K0KE 3LPSA 4LFBE 4B3SI 4USKA 2B3TB 3J7AM 1GQEA 4JI6E 2UUAE 4DV5E 1KIJA 1UILA 4DR5I 1HNWE 4HXZA 3H4LA 2NA2A 1HNXI 4LF5E 1HNZI 5LMNE 4LF8I 2DEIA 3ZZUA 4GKKI 2RSMA 3ADGA 1XMOE 2HK2A 1IBLI 4B3TI 5CFFE 4DUYE 2F4VE 1BKNA 1Z5BA 4DV7E 4OOGC 4LF6E 2BM1A 1FNMA 4LF7I 2V2VA 3JAMC 4JI8E 3ADIA 1IBKI 3J80Q 3Q1QA 2ZITA 2A2DA 2X7IA 4LF9I 4YY3E 2VQEE 4X64E 1ZM9A 1XMQE 4YHHE 4LFAI 2UUCE 3J80C 4Z7CA 1IBMI 1T4OA 4DV2I 4DU8A 2LRSA 1T4NA 4DU7A 4DR6I 2BV3A 3VYYA 1UEKA 4JI2I 4DR3I 4FN5A 4HACA 4DV0E 4HYMA 2E5LI 2HHHE 4KHPI 4X65I 4AQYE 1YZ9A 3GONA 2UXBI 5LMUI 4JI0E 4DV4E 4JI7I 1ZM3A 3QT7A 3PYEA 2DMYA 3B82A 2AJ4A 2DB2A 2UXCE 1H7SA 3B78A 4ED4A 4EMDA 4B3RI 3C4TA 1EI1A 3K1JA 4DR5E 4UT4A 1MU5A 2LBSB 1ZM4A 4B3MI 2RS7A 1HNZE 4LF8E 4DR4E 2WW4A 1X49A 1XHKA 1HR0I 1T4LB 4GKKE 4JG4A 1IBLE 1YYWA 4B3TE 1N36E 2HK3A 4DPUA 1RR9A 5BR8I 4LF7E 4X62I 4P7AA 1FJGE 2HFSA 4URLA 1X47A 5FLXC 1IBKE 4LF9E 5A2QC 4NXMI 3LLHA 2L33A 1H72C 4JV5E 3ZZ0A 4JI3I 4JI5E 4PU9A 1IBME 4LFCI 4WUCA 4DV2E 2HKJA 4DR1I 3M6AA 4Z7YA 2GS8A 4DR6E 4HACB 1YYOA 1EA6A 5L3JA 4JI2E 3QT6A 2L3JA 4DUZI 1ZM2A 1ZBTA 1KKHA 1OJ4A 4DXLA 4KHPE 3T1HI 4JYAE 2UXBE 2L2MA 4JI7E 2BM0A 1A6FA 3C4BA 2OI2A 3D4JA 2HFUA 1VISA 4NXNI 3J7AG 4GKJI 2JVAA 2UU9I 4I3HA 4B3RE 3T1YE 4DPXA 1N34I 4DV6E 4B3ME 2CPNA 4USMA 4DV1I 4DPYA
chains in the Genus database with same CATH superfamily
2EOMA 4NHRA 5DROA 1Z0CA 1HR0E 4KZSA 4P78A 2HJJA 2N3HA 1XNQI 4ZYDA 5A69A 2ZBKB 4N3OA 2EMCA 1FKAE 4GQUA 1WHNA 2D9HA 2BR2A 1NCSA 2NUEA 2RTXA 4BS9A 1YUJA 1Z0WA 4DPTA 4K0KI 1YH8A 2UXDI 2C39B 2YTNA 3TQMA 4DKKA 3RMPA 4JI1I 4DR7E 1J5EE 1NHJA 5F3WA 2NN6B 3C6KA 5AE3A 5IT9Q 1Z1BA 2DSYA 5BR8E 4R2SA 2Q8UA 2L3CA 2NUFA 1T39A 2EPAA 4JI6I 1H7UA 4X62E 4DV5I 2UUAI 2N3GA 1JK1A 3K17A 5ELWA 3PYDA 3EPJA 2EOZA 1N33I 1UDOA 5KL3A 2NUGA 2EORA 2V8PA 3QG5C 1HNWI 3PYGA 5IWAI 1J26A 4R1FA 4TUGA 1EKZA 2LV2A 4L8NA 1H73A 2A2CA 1XXEA 4B3SE 4NXME 1RMDA 2EMZA 3HTXA 1Z0EA 1XNRI 1D6TA 2WP8A 3J81Q 2WCC3 3WU3A 3WU6A 2EPUA 4TUIA 4JI3E 3P3CA 2LJUA 1RREA 2GLIA 1WHQA 4X66I 4P7DA 1PKPA 2F4VI 1ZU1A 2EE8A 4DV7I 1X48A 5A6BA 5K36B 2GO3A 2EOHA 4M9VC 1HNXE 2KONA 4F6MA 2ELYA 2DEJA 4LF6I 5K36C 1B62A 2PO0A 3PS2A 3ZZTA 4MQYA 2R1FA 3NZKA 2LCEA 4FW5A 2VF1A 4IFDF 1KYQA 2JP9A 1F2IG 5DNXA 2BBGA 2RS6A 4OO1B 1S4EA 3M85G 4DUZE 4BA1A 5JEAC 2PNLA 2EMIA 1YSAC 4LOMA 4LPFA 2EPOA 4P52A 2UUBI 4IFDA 4OO1C 5AC5A 2JE6B 5A6KA 2F1DA 2IOPA 4QNKA 4PRXA 3THOB 3V2UC 2EOOA 1XMQI 4YHHI 4WUBA 4IZJB 1QZRA 2PO2B 1N0VC 4U3BA 2UUCI 1Z0GA 2EOYA 4NXNE 4F9BB 3B8HA 4LCFA 4RPFA 1N32I 4GKJE 3LTOA 1UDNA 2ZM6I 1PDAA 1DGCA 4FW9A 4MU4A 4PRVA 1L4SA 2EOEA 1Z0VA 2EN6A 1BBOA 1BB8A 1A1GA 1ZXNA 2EFGA 2GPIA 3IWBA 1K47A 1I94I 1AH5A 4IFDE 4JI4I 3P06A 2EPKX 5JEAD 2YRMA 4BBYA 1LLMC 1UDSA 2BR2B 4DV3I 3CWVA 4LFAE 4ZYEA 2ODRD 4AIDA 2YZTA 1KTVA 1PJSA 2E1MA 4MU3A 5KL7A 3PYFA 4ZYHA 2GHFA 4AQYI 2YTGA 4DR2I 5C0XF 3V5RA 4M2ZA 4WUDA 1E3PA 2VE7C 4DV4I 4L5NC 3VHTB 2O3ZA 2EMBA 2JY9A 3ZKBA 2UXDE 4AM3A 3UK3C 4M1KA 4JI1E 2J65A 1DARA 4DR3E 2VRDA 2JEBA 2UXCI 1IQOA 1UN6B 1EH7A 5LLQA 5JEAF 2NN6F 2E5LE 4OX9I 4WXCA 2PNMA 4WFTA 4X65E 5IV8B 5EL9A 1DI2A 2B7TA 2EMXA 2IHR1 5LMUE 1N33E 4FW4A 3OTOI 5IWAE 4FWGA 5GMEA 2EN1A 1ZBQA 4DR4I 1XNRE 2F8BA 1ZR9A 1FI4A 1X6HA 4GZNC 2WBSA 2WBUA 1MX0A 3Q6NA 3QT8A 3EQ1A 2MDGA 5C0XE 2EM6A 2NPFA 2BA0D 3JAMQ 1NHHA 2PO0B 1X3CA 1G2DC 4X66E 2K7IA 4OO1F 4LF4I 2R3VA 1UDQA 1N36I 1PVGA 1R6MA 3J7Yp 4F6NA 1P47A 3GLLA 4GEQB 1A1LA 2M4IA 1NEIA 2EM5A 2LJPA 1NZ0A 4BA1B 5DNYA 1NHIA 5JEAE 2B7VA 2YRHA 2E1RA 4MU0A 3ZM7A 2M1SA 2Q2EB 2V2ZA 1GTKA 1FJGI 1Z5CA 2VQFI 5KL5A 4UTGA 3M7ND 2DGCA 3LNUA 3HJCA 3K6QA 2HC5A 3L7ZA 2DIXA 2J7KA 1VI7A 5EKWA 2UUBE 2HKEA 3HQ1A 1FWKA 2YTPA 5GMDA 4O4KA 3HPSA 4LFBI 2I9IA 2DMIA 2VF3A 1UHZA 3DF6A 1Y5YA 1WUUA 2L2KB 1KVKA 3DD6A 2J7JA 1Z0BA 3OMLA 4JV5I 4M0VA 4HY1A 4ZVIA 4JI5I 4IS1C 2L2NA 4BC9A 2V34A 2EPPA 2EN7A 2YU8A 2M7QA 2LUPB 2HGHA 2JEAA 1P42A 4Q35B 4RH8A 4WSGA 5TSEA 1N32E 2ZM6E 1Z5AA 2EQ0A 2CSHA 2EPXA 2LTSA 2LUQA 5IT9C 4LF5I 5LMNI 3PS3A 1WRJA 4IFDD 2XEXA 1E3HA 1Y6ZA 4FK5C 2LMZA 2CZ9A 5ADZA 1I94E 4JI4E 4FWHA 1XMOI 3ZKDA 2IESA 1IQSA 2EM8A 1O0WA 4HEIA 3K85A 4DV3E 1WJPA 4F9CB 5KL4A 4XTJA 4LFCE 4DUYI 2K4VA 2JT2A 2PO1B 1QU6A 4DR1E 5LL6R 1YYKA 3LMLA 2R42A 2ADRA 1KJKA 4JYAI 4DR2E 3VYXA 3J81C 2JEBB 2EQ3A 3F6GA 1ZXMA 2KOUA 3P1XA 2MC5A 1A1HA 1STUA 4KQVA 3KWRA 4F2JC 1RQ0A 2CVEA 3WU4A 2O1UA 4JI8I 3ADJA 4R2QA 1OYPA 1Z0TA 3WU5A 4IZKA 2DLKA 2DRPA 2V85A 2LJHA 1JK2A 4OX9E 4YY3I 3T1YI 2VQEI 3VK6A 1Y60A 3F0NA 4X64I 3T1HE 1YFHA 1AAYA 2C38A 4DV6I 1X6EA 3OTOE 2O1TA 2KHXA 5AE1A 1ELOA 4MYUA 3THNA 3MSWA 2EM7A 2EMKA 3HULA 4M30A 5A6AA 1USVA 1Y4UA 4MDTA 5C0XD 4R03A 3EPKA 3ECRA 3EPHA 1G2FC 1Z59A 2C37A 2EOJA 2UU9E 2EMFA 2CG9A 1N34E 2MDRA 4X8WA 2EL6A 4F54A 5DRPA 2YRKA 4LF4E 4WYQB 2IOQA 2V2QA 2JXPA 1H74A 1MG7A 2YT4A 5FLXQ 4ZYGA 2NN6D 1PJTA 2LTRA 2VESA 2X36A 3QT5A 2B9DA 1U2RA 2EZ6A 4DV1E 1B63A 1PIEA 1N0UA 2YPNA 1J5EI 4DR7I 2Z5EA 3L7ZB 2I13A 3ADLA 5A2QQ 3H09A 5FWKA 4FWDA 2RSIA 1S16A 4DV0I 1RC7A 1FWLA 2HHHI 2YSPA 1XNQE 2L92A 3JU0A 2WZOA 2VQFE 1HK7A 4MYTA 4O43A 4JI0I 5JEAA 2L8TA 4K0KE 3LPSA 2YTFA 2EPNA 2PO1A 4R2DA 2O1VA 4LFBE 4B3SI 2JEAB 4USKA 1ZAAC 2B3TB 3J7AM 1GQEA 2CTDA 2ENHA 4BHBA 4JI6E 2UUAE 4DV5E 4J3DA 2YWQA 4DMIA 1KIJA 1UILA 4DR5I 1HNWE 4HXZA 2LE2A 5K36D 1YHCA 2H36X 3H4LA 3CDIA 2EPCA 3ZOQB 2NA2A 1UBDC 2JPAA 1HNXI 2LO3A 4LF5E 2GO4A 5LMNE 1HNZI 4LF8I 2DEIA 2EMWA 1USUA 4IFDB 2BA0G 4QNJA 3BF2A 4BHCA 3HKMA 3ZZUA 4GKKI 1A1JA 2EM3A 2RSMA 3ADGA 1XMOE 2HK2A 1GZ6A 3Q6MA 3P3EA 2E72A 1IBLI 4IFDC 4OO1D 4B3TI 5CFFE 3F6HA 2BA1G 4DUYE 1IMUA 2GQ0A 2F4VE 3KRNA 2EQ1A 1BKNA 1Z5BA 4LU9A 4DV7E 2V8QB 4OOGC 3CDJA 3P76A 2BA1D 4LF6E 4IZKB 3MHHC 5K36F 4IZJD 2BM1A 2R76A 2NN6E 1FNMA 2V89A 2FTXB 3M7NG 4LF7I 4O5GA 4HTGA 2V2VA 3JAMC 2ENAA 4OKGA 2C38B 4Q28A 4R2RA 3U1KA 4JI8E 3AUZA 3KZZA 3ADIA 2Z5CA 3MHSC 3IWDA 3J80Q 1IBKI 4MU1A 2ZITA 2A2DA 2X7IA 4LF9I 3Q1QA 1YPNA 2EOFA 4YY3E 2VQEE 4X64E 2N8XA 2EPLX 3JTZA 2EM0A 4WPYA 1ZM9A 2MKDA 4R2EA 4DPWA 1TF6A 4R8OA 2C37B 1XMQE 4YHHE 3DJWA 1A1IA 4OZEA 2CT1A 2EOQA 2EPMX 2YTDA 4LFAI 2UUCE 3J80C 4Z7CA 1IBMI 1T4OA 2EM9A 4DV2I 2LVHA 5C0XB 4DU8A 3EPLA 3L00A 3HXLA 2LRSA 2EM2A 1T4NA 2EN2A 5K36E 4DU7A 5C0XC 1SFEA 4I8OA 3PRYA 4DR6I 1MGTA 2BV3A 2EP3A 1T38A 2RQLA 2V86A 4KWYA 3VYYA 1UEKA 2EWLA 5JEAB 4JI2I 4DR3I 4BA2A 4FN5A 2PRTA 4OO1E 4O24A 4BMJA 4HACA 4DV0E 1TN9A 3AV0A 1EH8A 2V88A 2HHHE 2NN6C 3P3GA 4HYMA 2E5LI 4NZVA 1QNTA 4KHPI 2BB8A 4AQYE 1YZ9A 2ODRC 3GONA 4X65I 2UXBI 4WSPA 5LMUI 2EOSA 4JI0E 4DV4E 1OYSA 4JI7I 4WX9A 1R6LA 2YTIA 1ZM3A 2CGEA 3QT7A 3PYEA 3FIGA 2DMYA 2EMLA 4AIMA 3B82A 2AJ4A 5A6BD 2DB2A 2JR1A 2UXCE 1H7SA 5KL2A 3B78A 4X9JA 4ED4A 2FGGA 4EMDA 4B3RI 3BBGA 3HPZA 3C4TA 2PNZB 1EI1A 3K1JA 4DR5E 4UT4A 1SR9A 4RHBB 1MU5A 2EMAA 2LBSB 1ZM4A 1DQ3A 1RHYA 2AE8A 3H1CA 4LCHA 4B3MI 2EPZA 3GMEA 2RS7A 1HNZE 4LF8E 2EMHA 4DR4E 2WW4A 2WNRB 2ENCA 4IS9A 1X49A 5IXMB 1XHKA 2Z5BB 1HR0I 1WXRA 1T4LB 4GKKE 4J8ZA 4JG4A 1IBLE 1YYWA 2MC6A 4NBQA 4B3TE 1Y4SA 1N3GA 2EN3A 2IERA 1N36E 2HK3A 3IWCA 5DRRA 2FV4B 1EH6A 2EJ4A 5C0XA 4DPUA 3M85D 2JWOA 2A25A 2RPCA 1TF3A 1RR9A 2Z5CB 5BR8I 2EL5A 2G7HA 2EOIA 4LF7E 2EPRA 4U3DA 3U1YA 2YU5A 4X62I 4P7AA 1FJGE 2C39A 2HFSA 4URLA 2EMGA 1X47A 2NN6A 5FLXC 1A1FA 1IBKE 4R2AA 4LF9E 3M99B 5A6JA 5A2QC 4BC7A 4NXMI 3LLHA 4WXDA 2L33A 4F9AB 1H72C 3BIDA 4JV5E 2JOBA 2JOXA 2MKNA 2EN4A 4FW6A 4JI5E 3ZZ0A 4JI3I 5AE2A 1OYRA 4PU9A 1IBME 4LFCI 4WUCA 2YSOA 2DLQA 1BBGA 4DV2E 2HKJA 4DR1I 2YTOA 3M6AA 4R2PA 5DNLA 2L6MA 4BA2B 3KZYA 1X5WA 2GS8A 4Z7YA 4DR6E 4HACB 2EMYA 3UHMA 4MLQA 2PNZA 1YYOA 3GCMA 5K36A 2YTQA 1EA6A 2YTJA 5L3JA 4JI2E 4N4RB 3QT6A 1MEYC 2L3JA 4DUZI 1ZM2A 3PS1A 2WNRA 1ZBTA 1KKHA 2Z5BA 1OJ4A 4DXLA 5T6JA 4KHPE 3T1HI 3BGHA 4JYAE 1B69A 2WP8B 5AC4A 2UXBE 2L2MA 1PJQA 2LT7A 2JYAA 4OO1A 2YTEA 1X6FA 1A1KA 4JI7E 2EN8A 2V87A 2BM0A 1A6FA 2EOXA 3C4BA 2OI2A 2EL4A 5DRQA 3D4JA 4BCAA 4R2CA 2EM4A 2WBTA 4MLVA 2HFUA 2JE6A 1VISA 2ELZA 1YUIA 4NXNI 4IJDA 3J7AG 4GKJI 2JVAA 2UU9I 3C6MA 4I3HA 4FW3A 4IZJA 4B3RE 3T1YE 4DPXA 1N34I 2PO2A 2O1WA 4ISAA 4DV6E 5AASA 4FW7A 2M9AA 3B4TA 4B3ME 2CPNA 4USMA 5KL6A 2NABA 2V83A 4LTYA 4DV1I 4DPYA 4LCGA
chains in the Genus database with same CATH topology
1Z0CA 1HR0E 4KZSA 4P78A 2N3HA 1XNQI 2ZBKB 4N3OA 1FKAE 1WHNA 2NUEA 2RTXA 4BS9A 1Z0WA 4DPTA 4K0KI 2UXDI 4DKKA 3RMPA 4JI1I 4DR7E 1J5EE 1NHJA 5F3WA 5IT9Q 5AE3A 2DSYA 5BR8E 2L3CA 2NUFA 4JI6I 1H7UA 4X62E 4DV5I 2UUAI 2N3GA 3K17A 3PYDA 1N33I 2NUGA 2V8PA 1HNWI 3PYGA 5IWAI 1J26A 4R1FA 4TUGA 1EKZA 4L8NA 1H73A 2A2CA 4B3SE 4NXME 3HTXA 1Z0EA 1XNRI 1D6TA 3J81Q 3WU3A 3WU6A 4TUIA 4JI3E 1RREA 1WHQA 4X66I 4P7DA 1PKPA 2F4VI 4DV7I 1X48A 1HNXE 2KONA 2DEJA 4LF6I 1B62A 3ZZTA 2VF1A 2RS6A 1S4EA 4DUZE 2PNLA 4P52A 2UUBI 2IOPA 4PRXA 3V2UC 1XMQI 4YHHI 4WUBA 4IZJB 1QZRA 1N0VC 2UUCI 1Z0GA 4NXNE 4F9BB 3B8HA 4RPFA 1N32I 4GKJE 3LTOA 2ZM6I 4FW9A 4PRVA 1Z0VA 1ZXNA 2EFGA 3IWBA 1K47A 1I94I 4JI4I 3P06A 4BBYA 4DV3I 3CWVA 4LFAE 2ODRD 2YZTA 1KTVA 2E1MA 3PYFA 4AQYI 4DR2I 3V5RA 4M2ZA 4WUDA 2VE7C 4DV4I 4L5NC 2JY9A 3ZKBA 2UXDE 4M1KA 4JI1E 1DARA 4DR3E 2UXCI 2E5LE 4OX9I 2PNMA 4WFTA 4X65E 1DI2A 2B7TA 2IHR1 5LMUE 1N33E 3OTOI 5IWAE 4FWGA 5GMEA 1ZBQA 4DR4I 1XNRE 2F8BA 1FI4A 3Q6NA 1MX0A 3QT8A 2NPFA 3JAMQ 1NHHA 4X66E 4LF4I 2R3VA 1N36I 1PVGA 3J7Yp 4GEQB 2M4IA 2LJPA 1NZ0A 5DNYA 1NHIA 2B7VA 2E1RA 3ZM7A 2M1SA 2Q2EB 2V2ZA 1FJGI 1Z5CA 2VQFI 4UTGA 3LNUA 3HJCA 3K6QA 2DIXA 2J7KA 5GMDA 2UUBE 2HKEA 3HQ1A 1FWKA 4LFBI 3HPSA 2VF3A 1UHZA 3DF6A 1WUUA 2L2KB 1KVKA 4JV5I 1Z0BA 3OMLA 4M0VA 4HY1A 4ZVIA 4JI5I 2L2NA 4BC9A 2V34A 2M7QA 2LUPB 1N32E 2ZM6E 1Z5AA 2LUQA 2LTSA 5IT9C 4LF5I 5LMNI 2XEXA 1Y6ZA 2LMZA 2CZ9A 5ADZA 1I94E 4JI4E 4FWHA 1XMOI 3ZKDA 1O0WA 3K85A 4DV3E 4F9CB 4XTJA 4DUYI 4LFCE 2K4VA 1QU6A 4DR1E 5LL6R 1YYKA 3LMLA 2R42A 4JYAI 4DR2E 3VYXA 3J81C 3F6GA 1ZXMA 2KOUA 3P1XA 2MC5A 1STUA 4KQVA 3KWRA 1RQ0A 3WU4A 2O1UA 4JI8I 3ADJA 1Z0TA 3WU5A 4IZKA 2V85A 2LJHA 4OX9E 4YY3I 3T1YI 2VQEI 3VK6A 4X64I 3F0NA 3T1HE 4DV6I 3OTOE 2O1TA 2KHXA 5AE1A 1ELOA 4MYUA 3MSWA 3HULA 4M30A 1USVA 1Y4UA 4R03A 1Z59A 2UU9E 2CG9A 1N34E 2MDRA 4X8WA 4F54A 4LF4E 4WYQB 2IOQA 2V2QA 1H74A 1MG7A 2YT4A 5FLXQ 2X36A 2LTRA 3QT5A 4DPWA 2B9DA 1U2RA 2EZ6A 4DV1E 1B63A 1PIEA 1N0UA 1J5EI 4DR7I 2Z5EA 3ADLA 5A2QQ 3H09A 5FWKA 4FWDA 1S16A 4DV0I 1RC7A 1FWLA 2HHHI 1XNQE 2L92A 3JU0A 2WZOA 2VQFE 1HK7A 4MYTA 4JI0I 2L8TA 4K0KE 3LPSA 2O1VA 4LFBE 4B3SI 4USKA 2B3TB 3J7AM 1GQEA 4JI6E 2UUAE 4DV5E 4DMIA 1KIJA 1UILA 4DR5I 1HNWE 4HXZA 2LE2A 2H36X 3H4LA 3ZOQB 2NA2A 1HNXI 4LF5E 1HNZI 5LMNE 4LF8I 2DEIA 1USUA 3ZZUA 4GKKI 3Q6MA 2RSMA 3ADGA 1XMOE 2HK2A 1GZ6A 1IBLI 4B3TI 5CFFE 3F6HA 4DUYE 2GQ0A 2F4VE 1BKNA 1Z5BA 4LU9A 4DV7E 2V8QB 4OOGC 4LF6E 4IZKB 4IZJD 2BM1A 1FNMA 2V89A 2FTXB 4LF7I 2V2VA 3JAMC 4Q28A 4JI8E 3AUZA 3ADIA 2Z5CA 1IBKI 3IWDA 3J80Q 3Q1QA 2ZITA 2A2DA 2X7IA 4LF9I 4YY3E 2VQEE 4X64E 1ZM9A 3JTZA 4WPYA 4R8OA 1XMQE 4YHHE 3DJWA 4LFAI 2UUCE 3J80C 4Z7CA 1IBMI 1T4OA 4DV2I 4DU8A 2LRSA 3HXLA 1T4NA 4DU7A 4DR6I 4I8OA 3PRYA 2BV3A 2V86A 3VYYA 1UEKA 2EWLA 4JI2I 4DR3I 4FN5A 4BMJA 4HACA 4DV0E 4HYMA 3AV0A 2HHHE 2V88A 2E5LI 4KHPI 4X65I 4AQYE 1YZ9A 2ODRC 3GONA 2UXBI 4WSPA 5LMUI 4JI0E 4DV4E 4JI7I 2CGEA 1ZM3A 3QT7A 3PYEA 3FIGA 2DMYA 3B82A 2AJ4A 2DB2A 2JR1A 2UXCE 1H7SA 3B78A 4ED4A 2FGGA 4EMDA 4B3RI 3HPZA 3C4TA 1EI1A 3K1JA 4DR5E 4UT4A 1SR9A 1MU5A 2LBSB 1ZM4A 1DQ3A 4B3MI 2RS7A 1HNZE 4LF8E 4DR4E 2WW4A 1X49A 1XHKA 2Z5BB 1HR0I 1WXRA 1T4LB 4GKKE 4J8ZA 4JG4A 1IBLE 1YYWA 2MC6A 4B3TE 1Y4SA 1N36E 2HK3A 3IWCA 2FV4B 4DPUA 2JWOA 1RR9A 2Z5CB 5BR8I 2G7HA 4LF7E 4X62I 4P7AA 1FJGE 2HFSA 4URLA 1X47A 5FLXC 1IBKE 4LF9E 5A2QC 4BC7A 4NXMI 3LLHA 2L33A 4F9AB 1H72C 4JV5E 2JOBA 2JOXA 3ZZ0A 4JI3I 4JI5E 5AE2A 4PU9A 1IBME 4LFCI 4WUCA 4DV2E 2HKJA 4DR1I 3M6AA 2L6MA 4Z7YA 2GS8A 4DR6E 4HACB 1YYOA 1EA6A 5L3JA 4JI2E 3QT6A 2L3JA 4DUZI 1ZM2A 1ZBTA 1KKHA 2Z5BA 1OJ4A 4DXLA 5T6JA 4KHPE 3T1HI 4JYAE 2UXBE 2L2MA 4JI7E 2V87A 2BM0A 1A6FA 3C4BA 2OI2A 3D4JA 4BCAA 2HFUA 1VISA 4NXNI 3J7AG 4GKJI 2JVAA 2UU9I 4I3HA 4IZJA 4B3RE 3T1YE 4DPXA 1N34I 2O1WA 4DV6E 5AASA 4B3ME 2CPNA 4USMA 2V83A 4LTYA 4DV1I 4DPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0C A;  1HR0 E;  2N3H A;  1XNQ I;  2ZBK B;  1FKA E;  1WHN A;  2NUE A;  2RTX A;  4DPT A;  1Z0W A;  4K0K I;  2UXD I;  4DKK A;  4JI1 I;  4DR7 E;  1J5E E;  1NHJ A;  5IT9 Q;  5BR8 E;  2L3C A;  2NUF A;  4JI6 I;  1H7U A;  4X62 E;  4DV5 I;  2UUA I;  2N3G A;  3K17 A;  3PYD A;  1N33 I;  2NUG A;  2V8P A;  1HNW I;  3PYG A;  5IWA I;  1J26 A;  4R1F A;  1EKZ A;  1H73 A;  2A2C A;  4B3S E;  4NXM E;  3HTX A;  1Z0E A;  1XNR I;  1D6T A;  3J81 Q;  3WU3 A;  3WU6 A;  4JI3 E;  1RRE A;  1WHQ A;  4X66 I;  1PKP A;  2F4V I;  4DV7 I;  1X48 A;  1HNX E;  2DEJ A;  4LF6 I;  1B62 A;  3ZZT A;  2RS6 A;  1S4E A;  4DUZ E;  4P52 A;  2UUB I;  4PRX A;  3V2U C;  1XMQ I;  4YHH I;  4WUB A;  1QZR A;  1N0V C;  2UUC I;  1Z0G A;  4NXN E;  3B8H A;  4RPF A;  1N32 I;  4GKJ E;  3LTO A;  2ZM6 I;  4FW9 A;  4PRV A;  1Z0V A;  1ZXN A;  2EFG A;  1K47 A;  1I94 I;  4JI4 I;  4DV3 I;  3CWV A;  4LFA E;  1KTV A;  3PYF A;  4AQY I;  4DR2 I;  3V5R A;  4M2Z A;  4WUD A;  4DV4 I;  2JY9 A;  3ZKB A;  2UXD E;  4M1K A;  4JI1 E;  1DAR A;  4DR3 E;  2UXC I;  2E5L E;  4OX9 I;  4WFT A;  4X65 E;  1DI2 A;  2B7T A;  2IHR 1;  5LMU E;  1N33 E;  3OTO I;  5IWA E;  4FWG A;  5GME A;  4DR4 I;  1XNR E;  1FI4 A;  1MX0 A;  3QT8 A;  2NPF A;  3JAM Q;  1NHH A;  4X66 E;  4LF4 I;  2R3V A;  1N36 I;  1PVG A;  3J7Y p;  2LJP A;  1NZ0 A;  1NHI A;  2B7V A;  2E1R A;  3ZM7 A;  2Q2E B;  2V2Z A;  1FJG I;  1Z5C A;  2VQF I;  4UTG A;  3LNU A;  2DIX A;  2J7K A;  5GMD A;  2UUB E;  2HKE A;  1FWK A;  4LFB I;  2VF3 A;  1UHZ A;  1WUU A;  2L2K B;  1KVK A;  4JV5 I;  1Z0B A;  4JI5 I;  4HY1 A;  4ZVI A;  2L2N A;  2V34 A;  2LUP B;  1N32 E;  2ZM6 E;  1Z5A A;  2LUQ A;  2LTS A;  5IT9 C;  4LF5 I;  5LMN I;  2XEX A;  2CZ9 A;  1I94 E;  4JI4 E;  4FWH A;  1XMO I;  3ZKD A;  1O0W A;  4DV3 E;  4XTJ A;  4DUY I;  4LFC E;  1QU6 A;  4DR1 E;  1YYK A;  5LL6 R;  2R42 A;  4JYA I;  4DR2 E;  3VYX A;  3J81 C;  1ZXM A;  3P1X A;  1STU A;  4KQV A;  1RQ0 A;  3WU4 A;  4JI8 I;  3ADJ A;  1Z0T A;  3WU5 A;  2LJH A;  4OX9 E;  4YY3 I;  3T1Y I;  2VQE I;  4X64 I;  3F0N A;  3T1H E;  4DV6 I;  3OTO E;  2KHX A;  1ELO A;  4MYU A;  3HUL A;  4M30 A;  1Z59 A;  2UU9 E;  1N34 E;  2MDR A;  4X8W A;  4LF4 E;  4WYQ B;  2V2Q A;  1H74 A;  1MG7 A;  2YT4 A;  5FLX Q;  2X36 A;  2LTR A;  3QT5 A;  4DPW A;  1U2R A;  2EZ6 A;  4DV1 E;  1B63 A;  1PIE A;  1N0U A;  1J5E I;  4DR7 I;  3ADL A;  5A2Q Q;  4FWD A;  1S16 A;  4DV0 I;  1RC7 A;  1FWL A;  2HHH I;  1XNQ E;  2VQF E;  4MYT A;  4JI0 I;  4K0K E;  3LPS A;  4LFB E;  4B3S I;  4USK A;  2B3T B;  3J7A M;  1GQE A;  4JI6 E;  2UUA E;  4DV5 E;  1KIJ A;  1UIL A;  4DR5 I;  1HNW E;  4HXZ A;  3H4L A;  2NA2 A;  1HNX I;  4LF5 E;  1HNZ I;  5LMN E;  4LF8 I;  2DEI A;  3ZZU A;  4GKK I;  2RSM A;  3ADG A;  1XMO E;  2HK2 A;  1IBL I;  4B3T I;  5CFF E;  4DUY E;  2F4V E;  1BKN A;  1Z5B A;  4DV7 E;  4OOG C;  4LF6 E;  2BM1 A;  1FNM A;  4LF7 I;  2V2V A;  3JAM C;  4JI8 E;  3ADI A;  1IBK I;  3J80 Q;  3Q1Q A;  2ZIT A;  2A2D A;  2X7I A;  4LF9 I;  4YY3 E;  2VQE E;  4X64 E;  1ZM9 A;  1XMQ E;  4YHH E;  4LFA I;  2UUC E;  3J80 C;  4Z7C A;  1IBM I;  1T4O A;  4DV2 I;  4DU8 A;  2LRS A;  1T4N A;  4DU7 A;  4DR6 I;  2BV3 A;  3VYY A;  1UEK A;  4JI2 I;  4DR3 I;  4FN5 A;  4HAC A;  4DV0 E;  4HYM A;  2E5L I;  2HHH E;  4KHP I;  4X65 I;  4AQY E;  1YZ9 A;  3GON A;  2UXB I;  5LMU I;  4JI0 E;  4DV4 E;  4JI7 I;  1ZM3 A;  3QT7 A;  3PYE A;  2DMY A;  3B82 A;  2AJ4 A;  2DB2 A;  2UXC E;  1H7S A;  3B78 A;  4ED4 A;  4EMD A;  4B3R I;  3C4T A;  1EI1 A;  3K1J A;  4DR5 E;  4UT4 A;  1MU5 A;  2LBS B;  1ZM4 A;  4B3M I;  2RS7 A;  1HNZ E;  4LF8 E;  4DR4 E;  2WW4 A;  1X49 A;  1XHK A;  1HR0 I;  1T4L B;  4GKK E;  4JG4 A;  1IBL E;  1YYW A;  4B3T E;  1N36 E;  2HK3 A;  4DPU A;  1RR9 A;  5BR8 I;  4LF7 E;  4X62 I;  4P7A A;  1FJG E;  2HFS A;  4URL A;  1X47 A;  5FLX C;  1IBK E;  4LF9 E;  5A2Q C;  4NXM I;  3LLH A;  2L33 A;  1H72 C;  4JV5 E;  3ZZ0 A;  4JI3 I;  4JI5 E;  4PU9 A;  1IBM E;  4LFC I;  4WUC A;  4DV2 E;  2HKJ A;  4DR1 I;  3M6A A;  4Z7Y A;  2GS8 A;  4DR6 E;  4HAC B;  1YYO A;  1EA6 A;  5L3J A;  4JI2 E;  3QT6 A;  2L3J A;  4DUZ I;  1ZM2 A;  1ZBT A;  1KKH A;  1OJ4 A;  4DXL A;  4KHP E;  3T1H I;  4JYA E;  2UXB E;  2L2M A;  4JI7 E;  2BM0 A;  1A6F A;  3C4B A;  2OI2 A;  3D4J A;  2HFU A;  1VIS A;  4NXN I;  3J7A G;  4GKJ I;  2JVA A;  2UU9 I;  4I3H A;  4B3R E;  3T1Y E;  4DPX A;  1N34 I;  4DV6 E;  4B3M E;  2CPN A;  4USM A;  4DV1 I;  4DPY A; 
#chains in the Genus database with same CATH topology
 2EOM A;  4NHR A;  5DRO A;  1Z0C A;  1HR0 E;  4KZS A;  4P78 A;  2HJJ A;  2N3H A;  1XNQ I;  4ZYD A;  5A69 A;  2ZBK B;  4N3O A;  2EMC A;  1FKA E;  4GQU A;  1WHN A;  2D9H A;  2BR2 A;  1NCS A;  2NUE A;  2RTX A;  4BS9 A;  1YUJ A;  1Z0W A;  4DPT A;  4K0K I;  1YH8 A;  2UXD I;  2C39 B;  2YTN A;  3TQM A;  4DKK A;  3RMP A;  4JI1 I;  4DR7 E;  1J5E E;  1NHJ A;  5F3W A;  2NN6 B;  3C6K A;  5AE3 A;  5IT9 Q;  1Z1B A;  2DSY A;  5BR8 E;  4R2S A;  2Q8U A;  2L3C A;  2NUF A;  1T39 A;  2EPA A;  4JI6 I;  1H7U A;  4X62 E;  4DV5 I;  2UUA I;  2N3G A;  1JK1 A;  3K17 A;  5ELW A;  3PYD A;  3EPJ A;  2EOZ A;  1N33 I;  1UDO A;  5KL3 A;  2NUG A;  2EOR A;  2V8P A;  3QG5 C;  1HNW I;  3PYG A;  5IWA I;  1J26 A;  4R1F A;  4TUG A;  1EKZ A;  2LV2 A;  4L8N A;  1H73 A;  2A2C A;  1XXE A;  4B3S E;  4NXM E;  1RMD A;  2EMZ A;  3HTX A;  1Z0E A;  1XNR I;  1D6T A;  2WP8 A;  3J81 Q;  2WCC 3;  3WU3 A;  3WU6 A;  2EPU A;  4TUI A;  4JI3 E;  3P3C A;  2LJU A;  1RRE A;  2GLI A;  1WHQ A;  4X66 I;  4P7D A;  1PKP A;  2F4V I;  1ZU1 A;  2EE8 A;  4DV7 I;  1X48 A;  5A6B A;  5K36 B;  2GO3 A;  2EOH A;  4M9V C;  1HNX E;  2KON A;  4F6M A;  2ELY A;  2DEJ A;  4LF6 I;  5K36 C;  1B62 A;  2PO0 A;  3PS2 A;  3ZZT A;  4MQY A;  2R1F A;  3NZK A;  2LCE A;  4FW5 A;  2VF1 A;  4IFD F;  1KYQ A;  2JP9 A;  1F2I G;  5DNX A;  2BBG A;  2RS6 A;  4OO1 B;  1S4E A;  3M85 G;  4DUZ E;  4BA1 A;  5JEA C;  2PNL A;  2EMI A;  1YSA C;  4LOM A;  4LPF A;  2EPO A;  4P52 A;  2UUB I;  4IFD A;  4OO1 C;  5AC5 A;  2JE6 B;  5A6K A;  2F1D A;  2IOP A;  4QNK A;  4PRX A;  3THO B;  3V2U C;  2EOO A;  1XMQ I;  4YHH I;  4WUB A;  4IZJ B;  1QZR A;  2PO2 B;  1N0V C;  4U3B A;  2UUC I;  1Z0G A;  2EOY A;  4NXN E;  4F9B B;  3B8H A;  4LCF A;  4RPF A;  1N32 I;  4GKJ E;  3LTO A;  1UDN A;  2ZM6 I;  1PDA A;  1DGC A;  4FW9 A;  4MU4 A;  4PRV A;  1L4S A;  2EOE A;  1Z0V A;  2EN6 A;  1BBO A;  1BB8 A;  1A1G A;  1ZXN A;  2EFG A;  2GPI A;  3IWB A;  1K47 A;  1I94 I;  1AH5 A;  4IFD E;  4JI4 I;  3P06 A;  2EPK X;  5JEA D;  2YRM A;  4BBY A;  1LLM C;  1UDS A;  2BR2 B;  4DV3 I;  3CWV A;  4LFA E;  4ZYE A;  2ODR D;  4AID A;  2YZT A;  1KTV A;  1PJS A;  2E1M A;  4MU3 A;  5KL7 A;  3PYF A;  4ZYH A;  2GHF A;  4AQY I;  2YTG A;  4DR2 I;  5C0X F;  3V5R A;  4M2Z A;  4WUD A;  1E3P A;  2VE7 C;  4DV4 I;  4L5N C;  3VHT B;  2O3Z A;  2EMB A;  2JY9 A;  3ZKB A;  2UXD E;  4AM3 A;  3UK3 C;  4M1K A;  4JI1 E;  2J65 A;  1DAR A;  4DR3 E;  2VRD A;  2JEB A;  2UXC I;  1IQO A;  1UN6 B;  1EH7 A;  5LLQ A;  5JEA F;  2NN6 F;  2E5L E;  4OX9 I;  4WXC A;  2PNM A;  4WFT A;  4X65 E;  5IV8 B;  5EL9 A;  1DI2 A;  2B7T A;  2EMX A;  2IHR 1;  5LMU E;  1N33 E;  4FW4 A;  3OTO I;  5IWA E;  4FWG A;  5GME A;  2EN1 A;  1ZBQ A;  4DR4 I;  1XNR E;  2F8B A;  1ZR9 A;  1FI4 A;  1X6H A;  4GZN C;  2WBS A;  2WBU A;  1MX0 A;  3Q6N A;  3QT8 A;  3EQ1 A;  2MDG A;  5C0X E;  2EM6 A;  2NPF A;  2BA0 D;  3JAM Q;  1NHH A;  2PO0 B;  1X3C A;  1G2D C;  4X66 E;  2K7I A;  4OO1 F;  4LF4 I;  2R3V A;  1UDQ A;  1N36 I;  1PVG A;  1R6M A;  3J7Y p;  4F6N A;  1P47 A;  3GLL A;  4GEQ B;  1A1L A;  2M4I A;  1NEI A;  2EM5 A;  2LJP A;  1NZ0 A;  4BA1 B;  5DNY A;  1NHI A;  5JEA E;  2B7V A;  2YRH A;  2E1R A;  4MU0 A;  3ZM7 A;  2M1S A;  2Q2E B;  2V2Z A;  1GTK A;  1FJG I;  1Z5C A;  2VQF I;  5KL5 A;  4UTG A;  3M7N D;  2DGC A;  3LNU A;  3HJC A;  3K6Q A;  2HC5 A;  3L7Z A;  2DIX A;  2J7K A;  1VI7 A;  5EKW A;  2UUB E;  2HKE A;  3HQ1 A;  1FWK A;  2YTP A;  5GMD A;  4O4K A;  3HPS A;  4LFB I;  2I9I A;  2DMI A;  2VF3 A;  1UHZ A;  3DF6 A;  1Y5Y A;  1WUU A;  2L2K B;  1KVK A;  3DD6 A;  2J7J A;  1Z0B A;  3OML A;  4JV5 I;  4M0V A;  4HY1 A;  4ZVI A;  4JI5 I;  4IS1 C;  2L2N A;  4BC9 A;  2V34 A;  2EPP A;  2EN7 A;  2YU8 A;  2M7Q A;  2LUP B;  2HGH A;  2JEA A;  1P42 A;  4Q35 B;  4RH8 A;  4WSG A;  5TSE A;  1N32 E;  2ZM6 E;  1Z5A A;  2EQ0 A;  2CSH A;  2EPX A;  2LTS A;  2LUQ A;  5IT9 C;  4LF5 I;  5LMN I;  3PS3 A;  1WRJ A;  4IFD D;  2XEX A;  1E3H A;  1Y6Z A;  4FK5 C;  2LMZ A;  2CZ9 A;  5ADZ A;  1I94 E;  4JI4 E;  4FWH A;  1XMO I;  3ZKD A;  2IES A;  1IQS A;  2EM8 A;  1O0W A;  4HEI A;  3K85 A;  4DV3 E;  1WJP A;  4F9C B;  5KL4 A;  4XTJ A;  4LFC E;  4DUY I;  2K4V A;  2JT2 A;  2PO1 B;  1QU6 A;  4DR1 E;  5LL6 R;  1YYK A;  3LML A;  2R42 A;  2ADR A;  1KJK A;  4JYA I;  4DR2 E;  3VYX A;  3J81 C;  2JEB B;  2EQ3 A;  3F6G A;  1ZXM A;  2KOU A;  3P1X A;  2MC5 A;  1A1H A;  1STU A;  4KQV A;  3KWR A;  4F2J C;  1RQ0 A;  2CVE A;  3WU4 A;  2O1U A;  4JI8 I;  3ADJ A;  4R2Q A;  1OYP A;  1Z0T A;  3WU5 A;  4IZK A;  2DLK A;  2DRP A;  2V85 A;  2LJH A;  1JK2 A;  4OX9 E;  4YY3 I;  3T1Y I;  2VQE I;  3VK6 A;  1Y60 A;  3F0N A;  4X64 I;  3T1H E;  1YFH A;  1AAY A;  2C38 A;  4DV6 I;  1X6E A;  3OTO E;  2O1T A;  2KHX A;  5AE1 A;  1ELO A;  4MYU A;  3THN A;  3MSW A;  2EM7 A;  2EMK A;  3HUL A;  4M30 A;  5A6A A;  1USV A;  1Y4U A;  4MDT A;  5C0X D;  4R03 A;  3EPK A;  3ECR A;  3EPH A;  1G2F C;  1Z59 A;  2C37 A;  2EOJ A;  2UU9 E;  2EMF A;  2CG9 A;  1N34 E;  2MDR A;  4X8W A;  2EL6 A;  4F54 A;  5DRP A;  2YRK A;  4LF4 E;  4WYQ B;  2IOQ A;  2V2Q A;  2JXP A;  1H74 A;  1MG7 A;  2YT4 A;  5FLX Q;  4ZYG A;  2NN6 D;  1PJT A;  2LTR A;  2VES A;  2X36 A;  3QT5 A;  2B9D A;  1U2R A;  2EZ6 A;  4DV1 E;  1B63 A;  1PIE A;  1N0U A;  2YPN A;  1J5E I;  4DR7 I;  2Z5E A;  3L7Z B;  2I13 A;  3ADL A;  5A2Q Q;  3H09 A;  5FWK A;  4FWD A;  2RSI A;  1S16 A;  4DV0 I;  1RC7 A;  1FWL A;  2HHH I;  2YSP A;  1XNQ E;  2L92 A;  3JU0 A;  2WZO A;  2VQF E;  1HK7 A;  4MYT A;  4O43 A;  4JI0 I;  5JEA A;  2L8T A;  4K0K E;  3LPS A;  2YTF A;  2EPN A;  2PO1 A;  4R2D A;  2O1V A;  4LFB E;  4B3S I;  2JEA B;  4USK A;  1ZAA C;  2B3T B;  3J7A M;  1GQE A;  2CTD A;  2ENH A;  4BHB A;  4JI6 E;  2UUA E;  4DV5 E;  4J3D A;  2YWQ A;  4DMI A;  1KIJ A;  1UIL A;  4DR5 I;  1HNW E;  4HXZ A;  2LE2 A;  5K36 D;  1YHC A;  2H36 X;  3H4L A;  3CDI A;  2EPC A;  3ZOQ B;  2NA2 A;  1UBD C;  2JPA A;  1HNX I;  2LO3 A;  4LF5 E;  2GO4 A;  5LMN E;  1HNZ I;  4LF8 I;  2DEI A;  2EMW A;  1USU A;  4IFD B;  2BA0 G;  4QNJ A;  3BF2 A;  4BHC A;  3HKM A;  3ZZU A;  4GKK I;  1A1J A;  2EM3 A;  2RSM A;  3ADG A;  1XMO E;  2HK2 A;  1GZ6 A;  3Q6M A;  3P3E A;  2E72 A;  1IBL I;  4IFD C;  4OO1 D;  4B3T I;  5CFF E;  3F6H A;  2BA1 G;  4DUY E;  1IMU A;  2GQ0 A;  2F4V E;  3KRN A;  2EQ1 A;  1BKN A;  1Z5B A;  4LU9 A;  4DV7 E;  2V8Q B;  4OOG C;  3CDJ A;  3P76 A;  2BA1 D;  4LF6 E;  4IZK B;  3MHH C;  5K36 F;  4IZJ D;  2BM1 A;  2R76 A;  2NN6 E;  1FNM A;  2V89 A;  2FTX B;  3M7N G;  4LF7 I;  4O5G A;  4HTG A;  2V2V A;  3JAM C;  2ENA A;  4OKG A;  2C38 B;  4Q28 A;  4R2R A;  3U1K A;  4JI8 E;  3AUZ A;  3KZZ A;  3ADI A;  2Z5C A;  3MHS C;  3IWD A;  3J80 Q;  1IBK I;  4MU1 A;  2ZIT A;  2A2D A;  2X7I A;  4LF9 I;  3Q1Q A;  1YPN A;  2EOF A;  4YY3 E;  2VQE E;  4X64 E;  2N8X A;  2EPL X;  3JTZ A;  2EM0 A;  4WPY A;  1ZM9 A;  2MKD A;  4R2E A;  4DPW A;  1TF6 A;  4R8O A;  2C37 B;  1XMQ E;  4YHH E;  3DJW A;  1A1I A;  4OZE A;  2CT1 A;  2EOQ A;  2EPM X;  2YTD A;  4LFA I;  2UUC E;  3J80 C;  4Z7C A;  1IBM I;  1T4O A;  2EM9 A;  4DV2 I;  2LVH A;  5C0X B;  4DU8 A;  3EPL A;  3L00 A;  3HXL A;  2LRS A;  2EM2 A;  1T4N A;  2EN2 A;  5K36 E;  4DU7 A;  5C0X C;  1SFE A;  4I8O A;  3PRY A;  4DR6 I;  1MGT A;  2BV3 A;  2EP3 A;  1T38 A;  2RQL A;  2V86 A;  4KWY A;  3VYY A;  1UEK A;  2EWL A;  5JEA B;  4JI2 I;  4DR3 I;  4BA2 A;  4FN5 A;  2PRT A;  4OO1 E;  4O24 A;  4BMJ A;  4HAC A;  4DV0 E;  1TN9 A;  3AV0 A;  1EH8 A;  2V88 A;  2HHH E;  2NN6 C;  3P3G A;  4HYM A;  2E5L I;  4NZV A;  1QNT A;  4KHP I;  2BB8 A;  4AQY E;  1YZ9 A;  2ODR C;  3GON A;  4X65 I;  2UXB I;  4WSP A;  5LMU I;  2EOS A;  4JI0 E;  4DV4 E;  1OYS A;  4JI7 I;  4WX9 A;  1R6L A;  2YTI A;  1ZM3 A;  2CGE A;  3QT7 A;  3PYE A;  3FIG A;  2DMY A;  2EML A;  4AIM A;  3B82 A;  2AJ4 A;  5A6B D;  2DB2 A;  2JR1 A;  2UXC E;  1H7S A;  5KL2 A;  3B78 A;  4X9J A;  4ED4 A;  2FGG A;  4EMD A;  4B3R I;  3BBG A;  3HPZ A;  3C4T A;  2PNZ B;  1EI1 A;  3K1J A;  4DR5 E;  4UT4 A;  1SR9 A;  4RHB B;  1MU5 A;  2EMA A;  2LBS B;  1ZM4 A;  1DQ3 A;  1RHY A;  2AE8 A;  3H1C A;  4LCH A;  4B3M I;  2EPZ A;  3GME A;  2RS7 A;  1HNZ E;  4LF8 E;  2EMH A;  4DR4 E;  2WW4 A;  2WNR B;  2ENC A;  4IS9 A;  1X49 A;  5IXM B;  1XHK A;  2Z5B B;  1HR0 I;  1WXR A;  1T4L B;  4GKK E;  4J8Z A;  4JG4 A;  1IBL E;  1YYW A;  2MC6 A;  4NBQ A;  4B3T E;  1Y4S A;  1N3G A;  2EN3 A;  2IER A;  1N36 E;  2HK3 A;  3IWC A;  5DRR A;  2FV4 B;  1EH6 A;  2EJ4 A;  5C0X A;  4DPU A;  3M85 D;  2JWO A;  2A25 A;  2RPC A;  1TF3 A;  1RR9 A;  2Z5C B;  5BR8 I;  2EL5 A;  2G7H A;  2EOI A;  4LF7 E;  2EPR A;  4U3D A;  3U1Y A;  2YU5 A;  4X62 I;  4P7A A;  1FJG E;  2C39 A;  2HFS A;  4URL A;  2EMG A;  1X47 A;  2NN6 A;  5FLX C;  1A1F A;  1IBK E;  4R2A A;  4LF9 E;  3M99 B;  5A6J A;  5A2Q C;  4BC7 A;  4NXM I;  3LLH A;  4WXD A;  2L33 A;  4F9A B;  1H72 C;  3BID A;  4JV5 E;  2JOB A;  2JOX A;  2MKN A;  2EN4 A;  4FW6 A;  4JI5 E;  3ZZ0 A;  4JI3 I;  5AE2 A;  1OYR A;  4PU9 A;  1IBM E;  4LFC I;  4WUC A;  2YSO A;  2DLQ A;  1BBG A;  4DV2 E;  2HKJ A;  4DR1 I;  2YTO A;  3M6A A;  4R2P A;  5DNL A;  2L6M A;  4BA2 B;  3KZY A;  1X5W A;  2GS8 A;  4Z7Y A;  4DR6 E;  4HAC B;  2EMY A;  3UHM A;  4MLQ A;  2PNZ A;  1YYO A;  3GCM A;  5K36 A;  2YTQ A;  1EA6 A;  2YTJ A;  5L3J A;  4JI2 E;  4N4R B;  3QT6 A;  1MEY C;  2L3J A;  4DUZ I;  1ZM2 A;  3PS1 A;  2WNR A;  1ZBT A;  1KKH A;  2Z5B A;  1OJ4 A;  4DXL A;  5T6J A;  4KHP E;  3T1H I;  3BGH A;  4JYA E;  1B69 A;  2WP8 B;  5AC4 A;  2UXB E;  2L2M A;  1PJQ A;  2LT7 A;  2JYA A;  4OO1 A;  2YTE A;  1X6F A;  1A1K A;  4JI7 E;  2EN8 A;  2V87 A;  2BM0 A;  1A6F A;  2EOX A;  3C4B A;  2OI2 A;  2EL4 A;  5DRQ A;  3D4J A;  4BCA A;  4R2C A;  2EM4 A;  2WBT A;  4MLV A;  2HFU A;  2JE6 A;  1VIS A;  2ELZ A;  1YUI A;  4NXN I;  4IJD A;  3J7A G;  4GKJ I;  2JVA A;  2UU9 I;  3C6M A;  4I3H A;  4FW3 A;  4IZJ A;  4B3R E;  3T1Y E;  4DPX A;  1N34 I;  2PO2 A;  2O1W A;  4ISA A;  4DV6 E;  5AAS A;  4FW7 A;  2M9A A;  3B4T A;  4B3M E;  2CPN A;  4USM A;  5KL6 A;  2NAB A;  2V83 A;  4LTY A;  4DV1 I;  4DPY A;  4LCG A; 
#chains in the Genus database with same CATH homology
 1Z0C A;  1HR0 E;  4KZS A;  4P78 A;  2N3H A;  1XNQ I;  2ZBK B;  4N3O A;  1FKA E;  1WHN A;  2NUE A;  2RTX A;  4BS9 A;  1Z0W A;  4DPT A;  4K0K I;  2UXD I;  4DKK A;  3RMP A;  4JI1 I;  4DR7 E;  1J5E E;  1NHJ A;  5F3W A;  5IT9 Q;  5AE3 A;  2DSY A;  5BR8 E;  2L3C A;  2NUF A;  4JI6 I;  1H7U A;  4X62 E;  4DV5 I;  2UUA I;  2N3G A;  3K17 A;  3PYD A;  1N33 I;  2NUG A;  2V8P A;  1HNW I;  3PYG A;  5IWA I;  1J26 A;  4R1F A;  4TUG A;  1EKZ A;  4L8N A;  1H73 A;  2A2C A;  4B3S E;  4NXM E;  3HTX A;  1Z0E A;  1XNR I;  1D6T A;  3J81 Q;  3WU3 A;  3WU6 A;  4TUI A;  4JI3 E;  1RRE A;  1WHQ A;  4X66 I;  4P7D A;  1PKP A;  2F4V I;  4DV7 I;  1X48 A;  1HNX E;  2KON A;  2DEJ A;  4LF6 I;  1B62 A;  3ZZT A;  2VF1 A;  2RS6 A;  1S4E A;  4DUZ E;  2PNL A;  4P52 A;  2UUB I;  2IOP A;  4PRX A;  3V2U C;  1XMQ I;  4YHH I;  4WUB A;  4IZJ B;  1QZR A;  1N0V C;  2UUC I;  1Z0G A;  4NXN E;  4F9B B;  3B8H A;  4RPF A;  1N32 I;  4GKJ E;  3LTO A;  2ZM6 I;  4FW9 A;  4PRV A;  1Z0V A;  1ZXN A;  2EFG A;  3IWB A;  1K47 A;  1I94 I;  4JI4 I;  3P06 A;  4BBY A;  4DV3 I;  3CWV A;  4LFA E;  2ODR D;  2YZT A;  1KTV A;  2E1M A;  3PYF A;  4AQY I;  4DR2 I;  3V5R A;  4M2Z A;  4WUD A;  2VE7 C;  4DV4 I;  4L5N C;  2JY9 A;  3ZKB A;  2UXD E;  4M1K A;  4JI1 E;  1DAR A;  4DR3 E;  2UXC I;  2E5L E;  4OX9 I;  2PNM A;  4WFT A;  4X65 E;  1DI2 A;  2B7T A;  2IHR 1;  5LMU E;  1N33 E;  3OTO I;  5IWA E;  4FWG A;  5GME A;  1ZBQ A;  4DR4 I;  1XNR E;  2F8B A;  1FI4 A;  3Q6N A;  1MX0 A;  3QT8 A;  2NPF A;  3JAM Q;  1NHH A;  4X66 E;  4LF4 I;  2R3V A;  1N36 I;  1PVG A;  3J7Y p;  4GEQ B;  2M4I A;  2LJP A;  1NZ0 A;  5DNY A;  1NHI A;  2B7V A;  2E1R A;  3ZM7 A;  2M1S A;  2Q2E B;  2V2Z A;  1FJG I;  1Z5C A;  2VQF I;  4UTG A;  3LNU A;  3HJC A;  3K6Q A;  2DIX A;  2J7K A;  5GMD A;  2UUB E;  2HKE A;  3HQ1 A;  1FWK A;  4LFB I;  3HPS A;  2VF3 A;  1UHZ A;  3DF6 A;  1WUU A;  2L2K B;  1KVK A;  4JV5 I;  1Z0B A;  3OML A;  4M0V A;  4HY1 A;  4ZVI A;  4JI5 I;  2L2N A;  4BC9 A;  2V34 A;  2M7Q A;  2LUP B;  1N32 E;  2ZM6 E;  1Z5A A;  2LUQ A;  2LTS A;  5IT9 C;  4LF5 I;  5LMN I;  2XEX A;  1Y6Z A;  2LMZ A;  2CZ9 A;  5ADZ A;  1I94 E;  4JI4 E;  4FWH A;  1XMO I;  3ZKD A;  1O0W A;  3K85 A;  4DV3 E;  4F9C B;  4XTJ A;  4DUY I;  4LFC E;  2K4V A;  1QU6 A;  4DR1 E;  5LL6 R;  1YYK A;  3LML A;  2R42 A;  4JYA I;  4DR2 E;  3VYX A;  3J81 C;  3F6G A;  1ZXM A;  2KOU A;  3P1X A;  2MC5 A;  1STU A;  4KQV A;  3KWR A;  1RQ0 A;  3WU4 A;  2O1U A;  4JI8 I;  3ADJ A;  1Z0T A;  3WU5 A;  4IZK A;  2V85 A;  2LJH A;  4OX9 E;  4YY3 I;  3T1Y I;  2VQE I;  3VK6 A;  4X64 I;  3F0N A;  3T1H E;  4DV6 I;  3OTO E;  2O1T A;  2KHX A;  5AE1 A;  1ELO A;  4MYU A;  3MSW A;  3HUL A;  4M30 A;  1USV A;  1Y4U A;  4R03 A;  1Z59 A;  2UU9 E;  2CG9 A;  1N34 E;  2MDR A;  4X8W A;  4F54 A;  4LF4 E;  4WYQ B;  2IOQ A;  2V2Q A;  1H74 A;  1MG7 A;  2YT4 A;  5FLX Q;  2X36 A;  2LTR A;  3QT5 A;  4DPW A;  2B9D A;  1U2R A;  2EZ6 A;  4DV1 E;  1B63 A;  1PIE A;  1N0U A;  1J5E I;  4DR7 I;  2Z5E A;  3ADL A;  5A2Q Q;  3H09 A;  5FWK A;  4FWD A;  1S16 A;  4DV0 I;  1RC7 A;  1FWL A;  2HHH I;  1XNQ E;  2L92 A;  3JU0 A;  2WZO A;  2VQF E;  1HK7 A;  4MYT A;  4JI0 I;  2L8T A;  4K0K E;  3LPS A;  2O1V A;  4LFB E;  4B3S I;  4USK A;  2B3T B;  3J7A M;  1GQE A;  4JI6 E;  2UUA E;  4DV5 E;  4DMI A;  1KIJ A;  1UIL A;  4DR5 I;  1HNW E;  4HXZ A;  2LE2 A;  2H36 X;  3H4L A;  3ZOQ B;  2NA2 A;  1HNX I;  4LF5 E;  1HNZ I;  5LMN E;  4LF8 I;  2DEI A;  1USU A;  3ZZU A;  4GKK I;  3Q6M A;  2RSM A;  3ADG A;  1XMO E;  2HK2 A;  1GZ6 A;  1IBL I;  4B3T I;  5CFF E;  3F6H A;  4DUY E;  2GQ0 A;  2F4V E;  1BKN A;  1Z5B A;  4LU9 A;  4DV7 E;  2V8Q B;  4OOG C;  4LF6 E;  4IZK B;  4IZJ D;  2BM1 A;  1FNM A;  2V89 A;  2FTX B;  4LF7 I;  2V2V A;  3JAM C;  4Q28 A;  4JI8 E;  3AUZ A;  3ADI A;  2Z5C A;  1IBK I;  3IWD A;  3J80 Q;  3Q1Q A;  2ZIT A;  2A2D A;  2X7I A;  4LF9 I;  4YY3 E;  2VQE E;  4X64 E;  1ZM9 A;  3JTZ A;  4WPY A;  4R8O A;  1XMQ E;  4YHH E;  3DJW A;  4LFA I;  2UUC E;  3J80 C;  4Z7C A;  1IBM I;  1T4O A;  4DV2 I;  4DU8 A;  2LRS A;  3HXL A;  1T4N A;  4DU7 A;  4DR6 I;  4I8O A;  3PRY A;  2BV3 A;  2V86 A;  3VYY A;  1UEK A;  2EWL A;  4JI2 I;  4DR3 I;  4FN5 A;  4BMJ A;  4HAC A;  4DV0 E;  4HYM A;  3AV0 A;  2HHH E;  2V88 A;  2E5L I;  4KHP I;  4X65 I;  4AQY E;  1YZ9 A;  2ODR C;  3GON A;  2UXB I;  4WSP A;  5LMU I;  4JI0 E;  4DV4 E;  4JI7 I;  2CGE A;  1ZM3 A;  3QT7 A;  3PYE A;  3FIG A;  2DMY A;  3B82 A;  2AJ4 A;  2DB2 A;  2JR1 A;  2UXC E;  1H7S A;  3B78 A;  4ED4 A;  2FGG A;  4EMD A;  4B3R I;  3HPZ A;  3C4T A;  1EI1 A;  3K1J A;  4DR5 E;  4UT4 A;  1SR9 A;  1MU5 A;  2LBS B;  1ZM4 A;  1DQ3 A;  4B3M I;  2RS7 A;  1HNZ E;  4LF8 E;  4DR4 E;  2WW4 A;  1X49 A;  1XHK A;  2Z5B B;  1HR0 I;  1WXR A;  1T4L B;  4GKK E;  4J8Z A;  4JG4 A;  1IBL E;  1YYW A;  2MC6 A;  4B3T E;  1Y4S A;  1N36 E;  2HK3 A;  3IWC A;  2FV4 B;  4DPU A;  2JWO A;  1RR9 A;  2Z5C B;  5BR8 I;  2G7H A;  4LF7 E;  4X62 I;  4P7A A;  1FJG E;  2HFS A;  4URL A;  1X47 A;  5FLX C;  1IBK E;  4LF9 E;  5A2Q C;  4BC7 A;  4NXM I;  3LLH A;  2L33 A;  4F9A B;  1H72 C;  4JV5 E;  2JOB A;  2JOX A;  3ZZ0 A;  4JI3 I;  4JI5 E;  5AE2 A;  4PU9 A;  1IBM E;  4LFC I;  4WUC A;  4DV2 E;  2HKJ A;  4DR1 I;  3M6A A;  2L6M A;  4Z7Y A;  2GS8 A;  4DR6 E;  4HAC B;  1YYO A;  1EA6 A;  5L3J A;  4JI2 E;  3QT6 A;  2L3J A;  4DUZ I;  1ZM2 A;  1ZBT A;  1KKH A;  2Z5B A;  1OJ4 A;  4DXL A;  5T6J A;  4KHP E;  3T1H I;  4JYA E;  2UXB E;  2L2M A;  4JI7 E;  2V87 A;  2BM0 A;  1A6F A;  3C4B A;  2OI2 A;  3D4J A;  4BCA A;  2HFU A;  1VIS A;  4NXN I;  3J7A G;  4GKJ I;  2JVA A;  2UU9 I;  4I3H A;  4IZJ A;  4B3R E;  3T1Y E;  4DPX A;  1N34 I;  2O1W A;  4DV6 E;  5AAS A;  4B3M E;  2CPN A;  4USM A;  2V83 A;  4LTY A;  4DV1 I;  4DPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...