4YHHI

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yhhI00
3PYFA 4DXLA 2X36A 4DU8A 3J7AM 1XNRI 4LF6I 1B63A 3WU3A 3K17A 2X7IA 1FNMA 3CWVA 3QT8A 3ZKBA 1XMQE 2UU9E 4LF7E 1UEKA 3PYGA 4ED4A 1IBLE 1Z0VA 4NXNI 1S16A 4LF8E 1H74A 2ZBKB 3T1YI 1XHKA 4JI6E 3V5RA 4NXME 1K47A 4DR3E 4GKKE 4DR5I 4DR1I 1MU5A 3ZM7A 2ZM6E 2BM0A 1Z5CA 4DV1E 4LFBI 5LMUE 2HK2A 2UXBI 1DARA 4DV7E 4B3RI 2UUCE 1Z59A 1HR0E 5BR8E 4DR6I 3V2UC 4JI2E 1NZ0A 2VQFI 3T1HI 3H4LA 2HKJA 4FWHA 4YY3E 4KHPE 1A6FA 1VISA 4LF4E 4JI7E 2UUBE 1ZM3A 4X65I 4B3TI 4LFAE 2E1RA 4PU9A 4XTJA 1N33I 4X62I 4X64E 4WUBA 5LL6R 2V34A 1Z0BA 4LFCE 2WW4A 4Z7CA 4DV4E 3J7AG 4PRXA 2UXDI 4B3ME 3J81Q 3JAMQ 3J80C 2LJPA 1ZM4A 2E5LE 3ZZUA 2BM1A 4JI4E 5L3JA 2EFGA 4I3HA 4JI8E 5IT9C 1NHJA 4JYAI 3ZKDA 1QZRA 1KIJA 2BV3A 1HNWE 1FI4A 1XMQI 2UU9I 4LF7I 1EA6A 1IBLI 2HHHE 2NPFA 2R3VA 3ZZTA 4LF8I 4YHHE 4JI6I 2UUAE 4NXMI 5A2QC 2HFSA 4DR3I 1S4EA 1KTVA 1BKNA 1RREA 4USMA 4OX9I 3PYDA 2AJ4A 2ZM6I 3PYEA 2F4VE 2VQEE 5LMUI 1WUUA 4DV2E 2HKEA 1N34E 1RR9A 1MG7A 4DUYE 3QT6A 4Z7YA 2CZ9A 4DV6I 4DV7I 2A2DA 2UUCI 3OTOE 1HR0I 5BR8I 4LF9E 1IBKE 4EMDA 4JI2I 4LF4I 4JI7I 3M6AA 2UUBI 3F0NA 4DV0E 4DPYA 1XMOE 4GKJE 3WU4A 1IBMI 2V2ZA 3D4JA 1H73A 2XEXA 2ZITA 4DR4E 2V8PA 4DUZE 2HFUA 2A2CA 2HK3A 4X64I 2VF3A 4DV3E 4JI3E 2GS8A 2DEJA 4LFCI 4B3SE 4DV4I 1ZM2A 2Q2EB 4LF5E 1I94I 4JI0E 4HXZA 4RPFA 4X66E 1N32I 4AQYE 4DV5E 4P52A 3B8HA 4JV5E 4M1KA 1H72C 2E5LI 4MYTA 4PRVA 1Z0CA 4JI1E 4JI8I 4DPXA 3J80Q 1N36E 2OI2A 1J5EE 1B62A 4DR6E 1MX0A 4R1FA 5IT9Q 2HHHI 3HULA 4YHHI 4UTGA 4HACB 2UUAI 1N0VC 5FLXC 1FJGE 5IWAE 1FWLA 5A2QQ 2F4VI 3Q1QA 4X62E 1N0UA 1PVGA 1Z0EA 4DPWA 1N34I 1HNXE 4WUCA 4JI5E 1HNZE 4GKKI 4HY1A 1OJ4A 3LPSA 3OTOI 5GMDA 4LF9I 1PIEA 1Z5AA 4FWDA 1IBKI 2V2VA 4DPTA 1ZXMA 4MYUA 5LMNE 1H7SA 1XNQE 4DV1I 4DR2E 2UXCE 5GMEA 1ZM9A 2J7KA 4URLA 4JYAE 4DV0I 1XMOI 4DR7E 4K0KE 1KVKA 4GKJI 1ZXNA 3B82A 4KQVA 4DR4I 4DUZI 4FN5A 3QT5A 1XNRE 4LF6E 4DU7A 4DV3I 4JI3I 4YY3I 3WU6A 4KHPI 4B3SI 1U2RA 4OX9E 2V2QA 4HYMA 4LFAI 4LF5I 4JI0I 4X66I 3QT7A 2DEIA 1Z0WA 1ELOA 4ZVIA 4DV5I 4AQYI 4JV5I 4NXNE 3T1YE 3WU5A 2R42A 4JI1I 4DV6E 1FKAE 4HACA 4DR5E 4DR1E 4FW9A 1N36I 4B3MI 4DPUA 1J5EI 1NHHA 4WUDA 4LFBE 1Z0TA 1FWKA 1H7UA 2UXBE 1Z5BA 4JI4I 1D6TA 4FWGA 4B3RE 1HNWI 1FJGI 5IWAI 1IBME 4P7AA 1PKPA 3LTOA 1EI1A 2VQFE 3T1HE 5FLXQ 1Z0GA 1NHIA 1HNXI 4UT4A 4JI5I 3B78A 1HNZI 4X65E 4B3TE 3LNUA 1I94E 4JG4A 3GONA 1N32E 1N33E 5LMNI 3ZZ0A 1XNQI 4DR2I 2VQEI 4USKA 2UXCI 3J81C 4DV2I 3JAMC 3K1JA 4DUYI 1KKHA 4DR7I 4K0KI 2UXDE
chains in the Genus database with same CATH superfamily
3PYFA 4DXLA 2X36A 4OZEA 4DU8A 3KRNA 4FW6A 3PRYA 2O1VA 4FW7A 3J7AM 1XNRI 4LF6I 2PO2A 1B63A 3WU3A 3K17A 4LCGA 2X7IA 1FNMA 3CWVA 3QT8A 3ZKBA 2JEAB 4MU0A 2JEBA 3HKMA 1XMQE 3PS2A 2UU9E 1UEKA 3PYGA 4LF7E 4OO1F 4ED4A 1IBLE 5C0XD 1Z0VA 4NXNI 1S16A 2Z5EA 4LF8E 1H74A 2ZBKB 3T1YI 1XHKA 4JI6E 3V5RA 4NXME 1K47A 2NN6B 4DR3E 3B4TA 4GKKE 4DR5I 2O1UA 4DR1I 5C0XF 4IZJB 1MU5A 2JE6B 3ZM7A 2ZM6E 4LCHA 1USUA 2BM0A 1Z5CA 4DV1E 4LFBI 5LMUE 4MU3A 5C0XC 1UDOA 2HK2A 2UXBI 5JEAD 2BA1D 2IERA 1DARA 4DV7E 2PNZA 4B3RI 2UUCE 1Z59A 1HR0E 1YHCA 3Q6MA 5BR8E 2GO3A 2J65A 2Z5BB 4LPFA 4GQUA 5C0XE 5JEAF 4DR6I 2BR2A 3V2UC 4JI2E 1NZ0A 2VQFI 3T1HI 1USVA 3H4LA 2HKJA 4FWHA 4YY3E 4KHPE 1A6FA 1Y4SA 2PO1A 1VISA 2WP8B 4LF4E 4JI7E 2UUBE 1ZM3A 4OO1B 4X65I 4IZKA 5JEAC 4B3TI 2Z5CB 4LFAE 2E1RA 4PU9A 4XTJA 4BA1B 4ISAA 2O3ZA 4IFDF 4LCFA 1N33I 4X62I 3P3GA 4X64E 3NZKA 4WUBA 5JEAE 5K36D 5LL6R 2V34A 4LOMA 1Z0BA 4LFCE 4IFDC 2WW4A 4Z7CA 4DV4E 3J7AG 4PRXA 2UXDI 5K36A 4B3ME 3J81Q 3JAMQ 2C38B 2JEAA 3J80C 2IESA 2LJPA 1ZM4A 2E5LE 4IFDE 3ZZUA 2BM1A 4U3DA 4IZJD 4JI4E 5L3JA 2EFGA 4I3HA 5ELWA 4JI8E 5IT9C 5K36C 1NHJA 4JYAI 3ZKDA 1QZRA 1KIJA 2BV3A 4IZJA 2GQ0A 1HNWE 1FI4A 1XMQI 2UU9I 4LF7I 1EA6A 1IBLI 2HHHE 2NPFA 4QNJA 2R3VA 3ZZTA 5DRQA 5K36E 4LF8I 4YHHE 3GMEA 4OKGA 4JI6I 2UUAE 4NXMI 1OYSA 5A2QC 2HFSA 4DR3I 1S4EA 1KTVA 1BKNA 1RREA 4USMA 4OX9I 3CDIA 1XXEA 3L7ZA 3PYDA 1RHYA 3P3CA 2AJ4A 2ZM6I 3PYEA 2F4VE 5EKWA 1R6MA 2VQEE 5LMUI 2IOQA 1WUUA 4DV2E 2HKEA 1N34E 1RR9A 1MG7A 4DUYE 3QT6A 4Z7YA 2CZ9A 4DV6I 3M85D 4DV7I 2WP8A 2A2DA 2UUCI 3OTOE 1Y60A 1HR0I 5BR8I 4LF9E 4BA1A 1IBKE 4EMDA 4JI2I 3M7ND 4LF4I 4JI7I 3M6AA 2UUBI 4AM3A 2C37B 3F0NA 4DV0E 4DPYA 1XMOE 4MQYA 2BA0D 4GKJE 3WU4A 1IBMI 2V2ZA 3K85A 3D4JA 1H73A 2O1WA 2XEXA 2C38A 2ZITA 4DR4E 2V8PA 4DUZE 2HFUA 2A2CA 2HK3A 4X64I 2VF3A 2GO4A 4DV3E 3P76A 4JI3E 5DNLA 2GS8A 2DEJA 4AIMA 4LFCI 4B3SE 4DV4I 1ZM2A 2Q2EB 5DRRA 4LF5E 1I94I 4JI0E 4HXZA 4RPFA 4X66E 1N32I 1OYPA 4AQYE 4DV5E 4P52A 3B8HA 3P06A 4M1KA 4JV5E 4MU1A 1H72C 3H1CA 5DNXA 2BA1G 2E5LI 4MYTA 4PRVA 5C0XB 1Z0CA 2JT2A 4JI1E 1VI7A 2BA0G 2VESA 4JI8I 4DPXA 3J80Q 1E3PA 1N36E 2OI2A 5DRPA 1J5EE 1B62A 5K36F 4DR6E 1MX0A 2C39B 4R1FA 5IT9Q 2HHHI 2PNLA 4MU4A 2NN6D 3HULA 4YHHI 4UTGA 4HACB 2UUAI 1UDNA 2NN6A 5JEAB 1N0VC 4IS9A 5FLXC 1FJGE 5IWAE 3PS3A 1FWLA 2JE6A 3GLLA 4MDTA 5A2QQ 2F4VI 4FW5A 3Q1QA 5FWKA 1N0UA 4X62E 1PVGA 1R6LA 1Z0EA 4DPWA 1N34I 1HNXE 4WUCA 4JI5E 4IZKB 1HNZE 4NBQA 4GKKI 4IFDB 4HY1A 1OJ4A 3LPSA 3OTOI 5GMDA 4LF9I 3DD6A 1PIEA 1Z5AA 4FWDA 4U3BA 2WNRB 1IBKI 2V2VA 2Z5BA 4DPTA 1ZXMA 4MYUA 5LMNE 1H7SA 1XNQE 4DV1I 4DR2E 2CG9A 2NN6E 4BA2B 2UXCE 2CVEA 5GMEA 4OO1D 1ZM9A 3U1KA 2J7KA 3Q6NA 2PO0B 4URLA 4AIDA 4JYAE 4DV0I 5K36B 1XMOI 4DR7E 4K0KE 1KVKA 4OO1A 4GKJI 1ZXNA 2Z5CA 3B82A 2IOPA 4KQVA 1HK7A 4DR4I 4DUZI 4FN5A 4QNKA 3QT5A 5EL9A 1XNRE 4LF6E 4DU7A 4DV3I 4JI3I 4YY3I 3CDJA 3U1YA 3WU6A 4KHPI 5C0XA 4B3SI 4OO1C 1U2RA 4J3DA 4OX9E 2V2QA 4HYMA 4LFAI 4LF5I 1Y6ZA 4JI0I 3UHMA 3GCMA 3QT7A 4X66I 2DEIA 3PS1A 1Z0WA 1ELOA 4ZVIA 4DV5I 4AQYI 4JV5I 2C39A 4NXNE 4OO1E 3T1YE 2O1TA 2PO2B 3WU5A 3M85G 2R42A 4JI1I 1UDSA 4DV6E 1FKAE 4HACA 4DR5E 4DR1E 3L7ZB 2F1DA 4FW9A 2JEBB 1N36I 4B3MI 4DPUA 5JEAA 1J5EI 3M7NG 1NHHA 4WUDA 4LFBE 1Z0TA 1E3HA 1FWKA 4FW3A 1H7UA 4IFDD 2UXBE 1Z5BA 4JI4I 1D6TA 3P3EA 4FW4A 4FWGA 5DROA 4B3RE 2CGEA 3HJCA 4IFDA 1HNWI 1FJGI 5IWAI 1IBME 4P7AA 1YH8A 1PKPA 1P42A 3LTOA 2WNRA 1EI1A 2VQFE 1UDQA 3T1HE 4BA2A 5FLXQ 1Z0GA 1Y4UA 1NHIA 1HNXI 4UT4A 4JI5I 2PNZB 4N3OA 3B78A 1HNZI 2PO0A 4X65E 4B3TE 3LNUA 1I94E 4JG4A 2NN6F 3GONA 2BR2B 1N32E 1N33E 5LMNI 3ZZ0A 1XNQI 4DR2I 2VQEI 4USKA 2PNMA 2UXCI 2PO1B 3J81C 4DV2I 3JAMC 3K1JA 2AE8A 2NN6C 4DUYI 1Y5YA 1KKHA 1OYRA 4DR7I 4K0KI 2UXDE 2C37A
chains in the Genus database with same CATH topology
3PYFA 4DXLA 2X36A 4DU8A 3PRYA 2O1VA 3J7AM 1XNRI 4LF6I 1B63A 3WU3A 3K17A 2X7IA 1FNMA 3CWVA 3QT8A 3ZKBA 1XMQE 2UU9E 4LF7E 1UEKA 3PYGA 4ED4A 1IBLE 1Z0VA 4NXNI 1S16A 2Z5EA 4LF8E 1H74A 2ZBKB 3T1YI 1XHKA 4JI6E 3V5RA 4NXME 1K47A 4DR3E 4GKKE 4DR5I 2O1UA 4DR1I 4IZJB 1MU5A 3ZM7A 2ZM6E 1USUA 2BM0A 1Z5CA 4DV1E 4LFBI 5LMUE 2HK2A 2UXBI 1DARA 4DV7E 4B3RI 2UUCE 1Z59A 1HR0E 3Q6MA 5BR8E 2Z5BB 4DR6I 3V2UC 4JI2E 1NZ0A 2VQFI 3T1HI 1USVA 3H4LA 2HKJA 4FWHA 4YY3E 4KHPE 1A6FA 1Y4SA 1VISA 4LF4E 4JI7E 2UUBE 1ZM3A 4X65I 4IZKA 4B3TI 2Z5CB 4LFAE 2E1RA 4PU9A 4XTJA 1N33I 4X62I 4X64E 4WUBA 5LL6R 2V34A 1Z0BA 4LFCE 2WW4A 4Z7CA 4DV4E 3J7AG 4PRXA 2UXDI 4B3ME 3J81Q 3JAMQ 3J80C 2LJPA 1ZM4A 2E5LE 3ZZUA 2BM1A 4IZJD 4JI4E 5L3JA 2EFGA 4I3HA 4JI8E 5IT9C 1NHJA 4JYAI 3ZKDA 1QZRA 1KIJA 2BV3A 4IZJA 2GQ0A 1HNWE 1FI4A 1XMQI 2UU9I 4LF7I 1EA6A 1IBLI 2HHHE 2NPFA 2R3VA 3ZZTA 4LF8I 4YHHE 4JI6I 2UUAE 4NXMI 5A2QC 2HFSA 4DR3I 1S4EA 1KTVA 1BKNA 1RREA 4USMA 4OX9I 3PYDA 2AJ4A 2ZM6I 3PYEA 2F4VE 2VQEE 5LMUI 2IOQA 1WUUA 4DV2E 2HKEA 1N34E 1RR9A 1MG7A 4DUYE 3QT6A 4Z7YA 2CZ9A 4DV6I 4DV7I 2A2DA 2UUCI 3OTOE 1HR0I 5BR8I 4LF9E 1IBKE 4EMDA 4JI2I 4LF4I 4JI7I 3M6AA 2UUBI 3F0NA 4DV0E 4DPYA 1XMOE 4GKJE 3WU4A 1IBMI 2V2ZA 3K85A 3D4JA 1H73A 2O1WA 2XEXA 2ZITA 4DR4E 2V8PA 4DUZE 2HFUA 2A2CA 2HK3A 4X64I 2VF3A 4DV3E 4JI3E 2GS8A 2DEJA 4LFCI 4B3SE 4DV4I 1ZM2A 2Q2EB 4LF5E 1I94I 4JI0E 4HXZA 4RPFA 4X66E 1N32I 4AQYE 4DV5E 4P52A 3B8HA 3P06A 4M1KA 4JV5E 1H72C 2E5LI 4MYTA 4PRVA 1Z0CA 4JI1E 4JI8I 4DPXA 3J80Q 1N36E 2OI2A 1J5EE 1B62A 4DR6E 1MX0A 4R1FA 5IT9Q 2HHHI 2PNLA 3HULA 4YHHI 4UTGA 4HACB 2UUAI 1N0VC 5FLXC 1FJGE 5IWAE 1FWLA 5A2QQ 2F4VI 3Q1QA 5FWKA 1N0UA 4X62E 1PVGA 1Z0EA 4DPWA 1N34I 1HNXE 4WUCA 4JI5E 4IZKB 1HNZE 4GKKI 4HY1A 1OJ4A 3LPSA 3OTOI 5GMDA 4LF9I 1PIEA 1Z5AA 4FWDA 1IBKI 2V2VA 2Z5BA 4DPTA 1ZXMA 4MYUA 5LMNE 1H7SA 1XNQE 4DV1I 4DR2E 2CG9A 2UXCE 5GMEA 1ZM9A 2J7KA 3Q6NA 4URLA 4JYAE 4DV0I 1XMOI 4DR7E 4K0KE 1KVKA 4GKJI 1ZXNA 2Z5CA 3B82A 2IOPA 4KQVA 1HK7A 4DR4I 4DUZI 4FN5A 3QT5A 1XNRE 4LF6E 4DU7A 4DV3I 4JI3I 4YY3I 3WU6A 4KHPI 4B3SI 1U2RA 4OX9E 2V2QA 4HYMA 4LFAI 4LF5I 1Y6ZA 4JI0I 4X66I 3QT7A 2DEIA 1Z0WA 1ELOA 4ZVIA 4DV5I 4AQYI 4JV5I 4NXNE 3T1YE 2O1TA 3WU5A 2R42A 4JI1I 4DV6E 1FKAE 4HACA 4DR5E 4DR1E 4FW9A 1N36I 4B3MI 4DPUA 1J5EI 1NHHA 4WUDA 4LFBE 1Z0TA 1FWKA 1H7UA 2UXBE 1Z5BA 4JI4I 1D6TA 4FWGA 4B3RE 2CGEA 3HJCA 1HNWI 1FJGI 5IWAI 1IBME 4P7AA 1PKPA 3LTOA 1EI1A 2VQFE 3T1HE 5FLXQ 1Z0GA 1NHIA 1Y4UA 1HNXI 4UT4A 4JI5I 4N3OA 3B78A 1HNZI 4X65E 4B3TE 3LNUA 1I94E 4JG4A 3GONA 1N32E 1N33E 5LMNI 3ZZ0A 1XNQI 4DR2I 2VQEI 4USKA 2PNMA 2UXCI 3J81C 4DV2I 3JAMC 3K1JA 4DUYI 1KKHA 4DR7I 4K0KI 2UXDE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYF A;  4DXL A;  2X36 A;  4DU8 A;  3J7A M;  1XNR I;  4LF6 I;  1B63 A;  3WU3 A;  3K17 A;  2X7I A;  1FNM A;  3CWV A;  3QT8 A;  3ZKB A;  1XMQ E;  2UU9 E;  4LF7 E;  1UEK A;  3PYG A;  4ED4 A;  1IBL E;  1Z0V A;  4NXN I;  1S16 A;  4LF8 E;  1H74 A;  2ZBK B;  3T1Y I;  1XHK A;  4JI6 E;  3V5R A;  4NXM E;  1K47 A;  4DR3 E;  4GKK E;  4DR5 I;  4DR1 I;  1MU5 A;  3ZM7 A;  2ZM6 E;  2BM0 A;  1Z5C A;  4DV1 E;  4LFB I;  5LMU E;  2HK2 A;  2UXB I;  1DAR A;  4DV7 E;  4B3R I;  2UUC E;  1Z59 A;  1HR0 E;  5BR8 E;  4DR6 I;  3V2U C;  4JI2 E;  1NZ0 A;  2VQF I;  3T1H I;  3H4L A;  2HKJ A;  4FWH A;  4YY3 E;  4KHP E;  1A6F A;  1VIS A;  4LF4 E;  4JI7 E;  2UUB E;  1ZM3 A;  4X65 I;  4B3T I;  4LFA E;  2E1R A;  4PU9 A;  4XTJ A;  1N33 I;  4X62 I;  4X64 E;  4WUB A;  5LL6 R;  2V34 A;  1Z0B A;  4LFC E;  2WW4 A;  4Z7C A;  4DV4 E;  3J7A G;  4PRX A;  2UXD I;  4B3M E;  3J81 Q;  3JAM Q;  3J80 C;  2LJP A;  1ZM4 A;  2E5L E;  3ZZU A;  2BM1 A;  4JI4 E;  5L3J A;  2EFG A;  4I3H A;  4JI8 E;  5IT9 C;  1NHJ A;  4JYA I;  3ZKD A;  1QZR A;  1KIJ A;  2BV3 A;  1HNW E;  1FI4 A;  1XMQ I;  2UU9 I;  4LF7 I;  1EA6 A;  1IBL I;  2HHH E;  2NPF A;  2R3V A;  3ZZT A;  4LF8 I;  4YHH E;  4JI6 I;  2UUA E;  4NXM I;  5A2Q C;  2HFS A;  4DR3 I;  1S4E A;  1KTV A;  1BKN A;  1RRE A;  4USM A;  4OX9 I;  3PYD A;  2AJ4 A;  2ZM6 I;  3PYE A;  2F4V E;  2VQE E;  5LMU I;  1WUU A;  4DV2 E;  2HKE A;  1N34 E;  1RR9 A;  1MG7 A;  4DUY E;  3QT6 A;  4Z7Y A;  2CZ9 A;  4DV6 I;  4DV7 I;  2A2D A;  2UUC I;  3OTO E;  1HR0 I;  5BR8 I;  4LF9 E;  1IBK E;  4EMD A;  4JI2 I;  4LF4 I;  4JI7 I;  3M6A A;  2UUB I;  3F0N A;  4DV0 E;  4DPY A;  1XMO E;  4GKJ E;  3WU4 A;  1IBM I;  2V2Z A;  3D4J A;  1H73 A;  2XEX A;  2ZIT A;  4DR4 E;  2V8P A;  4DUZ E;  2HFU A;  2A2C A;  2HK3 A;  4X64 I;  2VF3 A;  4DV3 E;  4JI3 E;  2GS8 A;  2DEJ A;  4LFC I;  4B3S E;  4DV4 I;  1ZM2 A;  2Q2E B;  4LF5 E;  1I94 I;  4JI0 E;  4HXZ A;  4RPF A;  4X66 E;  1N32 I;  4AQY E;  4DV5 E;  4P52 A;  3B8H A;  4JV5 E;  4M1K A;  1H72 C;  2E5L I;  4MYT A;  4PRV A;  1Z0C A;  4JI1 E;  4JI8 I;  4DPX A;  3J80 Q;  1N36 E;  2OI2 A;  1J5E E;  1B62 A;  4DR6 E;  1MX0 A;  4R1F A;  5IT9 Q;  2HHH I;  3HUL A;  4YHH I;  4UTG A;  4HAC B;  2UUA I;  1N0V C;  5FLX C;  1FJG E;  5IWA E;  1FWL A;  5A2Q Q;  2F4V I;  3Q1Q A;  4X62 E;  1N0U A;  1PVG A;  1Z0E A;  4DPW A;  1N34 I;  1HNX E;  4WUC A;  4JI5 E;  1HNZ E;  4GKK I;  4HY1 A;  1OJ4 A;  3LPS A;  3OTO I;  5GMD A;  4LF9 I;  1PIE A;  1Z5A A;  4FWD A;  1IBK I;  2V2V A;  4DPT A;  1ZXM A;  4MYU A;  5LMN E;  1H7S A;  1XNQ E;  4DV1 I;  4DR2 E;  2UXC E;  5GME A;  1ZM9 A;  2J7K A;  4URL A;  4JYA E;  4DV0 I;  1XMO I;  4DR7 E;  4K0K E;  1KVK A;  4GKJ I;  1ZXN A;  3B82 A;  4KQV A;  4DR4 I;  4DUZ I;  4FN5 A;  3QT5 A;  1XNR E;  4LF6 E;  4DU7 A;  4DV3 I;  4JI3 I;  4YY3 I;  3WU6 A;  4KHP I;  4B3S I;  1U2R A;  4OX9 E;  2V2Q A;  4HYM A;  4LFA I;  4LF5 I;  4JI0 I;  4X66 I;  3QT7 A;  2DEI A;  1Z0W A;  1ELO A;  4ZVI A;  4DV5 I;  4AQY I;  4JV5 I;  4NXN E;  3T1Y E;  3WU5 A;  2R42 A;  4JI1 I;  4DV6 E;  1FKA E;  4HAC A;  4DR5 E;  4DR1 E;  4FW9 A;  1N36 I;  4B3M I;  4DPU A;  1J5E I;  1NHH A;  4WUD A;  4LFB E;  1Z0T A;  1FWK A;  1H7U A;  2UXB E;  1Z5B A;  4JI4 I;  1D6T A;  4FWG A;  4B3R E;  1HNW I;  1FJG I;  5IWA I;  1IBM E;  4P7A A;  1PKP A;  3LTO A;  1EI1 A;  2VQF E;  3T1H E;  5FLX Q;  1Z0G A;  1NHI A;  1HNX I;  4UT4 A;  4JI5 I;  3B78 A;  1HNZ I;  4X65 E;  4B3T E;  3LNU A;  1I94 E;  4JG4 A;  3GON A;  1N32 E;  1N33 E;  5LMN I;  3ZZ0 A;  1XNQ I;  4DR2 I;  2VQE I;  4USK A;  2UXC I;  3J81 C;  4DV2 I;  3JAM C;  3K1J A;  4DUY I;  1KKH A;  4DR7 I;  4K0K I;  2UXD E; 
#chains in the Genus database with same CATH topology
 3PYF A;  4DXL A;  2X36 A;  4OZE A;  4DU8 A;  3KRN A;  4FW6 A;  3PRY A;  2O1V A;  4FW7 A;  3J7A M;  1XNR I;  4LF6 I;  2PO2 A;  1B63 A;  3WU3 A;  3K17 A;  4LCG A;  2X7I A;  1FNM A;  3CWV A;  3QT8 A;  3ZKB A;  2JEA B;  4MU0 A;  2JEB A;  3HKM A;  1XMQ E;  3PS2 A;  2UU9 E;  1UEK A;  3PYG A;  4LF7 E;  4OO1 F;  4ED4 A;  1IBL E;  5C0X D;  1Z0V A;  4NXN I;  1S16 A;  2Z5E A;  4LF8 E;  1H74 A;  2ZBK B;  3T1Y I;  1XHK A;  4JI6 E;  3V5R A;  4NXM E;  1K47 A;  2NN6 B;  4DR3 E;  3B4T A;  4GKK E;  4DR5 I;  2O1U A;  4DR1 I;  5C0X F;  4IZJ B;  1MU5 A;  2JE6 B;  3ZM7 A;  2ZM6 E;  4LCH A;  1USU A;  2BM0 A;  1Z5C A;  4DV1 E;  4LFB I;  5LMU E;  4MU3 A;  5C0X C;  1UDO A;  2HK2 A;  2UXB I;  5JEA D;  2BA1 D;  2IER A;  1DAR A;  4DV7 E;  2PNZ A;  4B3R I;  2UUC E;  1Z59 A;  1HR0 E;  1YHC A;  3Q6M A;  5BR8 E;  2GO3 A;  2J65 A;  2Z5B B;  4LPF A;  4GQU A;  5C0X E;  5JEA F;  4DR6 I;  2BR2 A;  3V2U C;  4JI2 E;  1NZ0 A;  2VQF I;  3T1H I;  1USV A;  3H4L A;  2HKJ A;  4FWH A;  4YY3 E;  4KHP E;  1A6F A;  1Y4S A;  2PO1 A;  1VIS A;  2WP8 B;  4LF4 E;  4JI7 E;  2UUB E;  1ZM3 A;  4OO1 B;  4X65 I;  4IZK A;  5JEA C;  4B3T I;  2Z5C B;  4LFA E;  2E1R A;  4PU9 A;  4XTJ A;  4BA1 B;  4ISA A;  2O3Z A;  4IFD F;  4LCF A;  1N33 I;  4X62 I;  3P3G A;  4X64 E;  3NZK A;  4WUB A;  5JEA E;  5K36 D;  5LL6 R;  2V34 A;  4LOM A;  1Z0B A;  4LFC E;  4IFD C;  2WW4 A;  4Z7C A;  4DV4 E;  3J7A G;  4PRX A;  2UXD I;  5K36 A;  4B3M E;  3J81 Q;  3JAM Q;  2C38 B;  2JEA A;  3J80 C;  2IES A;  2LJP A;  1ZM4 A;  2E5L E;  4IFD E;  3ZZU A;  2BM1 A;  4U3D A;  4IZJ D;  4JI4 E;  5L3J A;  2EFG A;  4I3H A;  5ELW A;  4JI8 E;  5IT9 C;  5K36 C;  1NHJ A;  4JYA I;  3ZKD A;  1QZR A;  1KIJ A;  2BV3 A;  4IZJ A;  2GQ0 A;  1HNW E;  1FI4 A;  1XMQ I;  2UU9 I;  4LF7 I;  1EA6 A;  1IBL I;  2HHH E;  2NPF A;  4QNJ A;  2R3V A;  3ZZT A;  5DRQ A;  5K36 E;  4LF8 I;  4YHH E;  3GME A;  4OKG A;  4JI6 I;  2UUA E;  4NXM I;  1OYS A;  5A2Q C;  2HFS A;  4DR3 I;  1S4E A;  1KTV A;  1BKN A;  1RRE A;  4USM A;  4OX9 I;  3CDI A;  1XXE A;  3L7Z A;  3PYD A;  1RHY A;  3P3C A;  2AJ4 A;  2ZM6 I;  3PYE A;  2F4V E;  5EKW A;  1R6M A;  2VQE E;  5LMU I;  2IOQ A;  1WUU A;  4DV2 E;  2HKE A;  1N34 E;  1RR9 A;  1MG7 A;  4DUY E;  3QT6 A;  4Z7Y A;  2CZ9 A;  4DV6 I;  3M85 D;  4DV7 I;  2WP8 A;  2A2D A;  2UUC I;  3OTO E;  1Y60 A;  1HR0 I;  5BR8 I;  4LF9 E;  4BA1 A;  1IBK E;  4EMD A;  4JI2 I;  3M7N D;  4LF4 I;  4JI7 I;  3M6A A;  2UUB I;  4AM3 A;  2C37 B;  3F0N A;  4DV0 E;  4DPY A;  1XMO E;  4MQY A;  2BA0 D;  4GKJ E;  3WU4 A;  1IBM I;  2V2Z A;  3K85 A;  3D4J A;  1H73 A;  2O1W A;  2XEX A;  2C38 A;  2ZIT A;  4DR4 E;  2V8P A;  4DUZ E;  2HFU A;  2A2C A;  2HK3 A;  4X64 I;  2VF3 A;  2GO4 A;  4DV3 E;  3P76 A;  4JI3 E;  5DNL A;  2GS8 A;  2DEJ A;  4AIM A;  4LFC I;  4B3S E;  4DV4 I;  1ZM2 A;  2Q2E B;  5DRR A;  4LF5 E;  1I94 I;  4JI0 E;  4HXZ A;  4RPF A;  4X66 E;  1N32 I;  1OYP A;  4AQY E;  4DV5 E;  4P52 A;  3B8H A;  3P06 A;  4M1K A;  4JV5 E;  4MU1 A;  1H72 C;  3H1C A;  5DNX A;  2BA1 G;  2E5L I;  4MYT A;  4PRV A;  5C0X B;  1Z0C A;  2JT2 A;  4JI1 E;  1VI7 A;  2BA0 G;  2VES A;  4JI8 I;  4DPX A;  3J80 Q;  1E3P A;  1N36 E;  2OI2 A;  5DRP A;  1J5E E;  1B62 A;  5K36 F;  4DR6 E;  1MX0 A;  2C39 B;  4R1F A;  5IT9 Q;  2HHH I;  2PNL A;  4MU4 A;  2NN6 D;  3HUL A;  4YHH I;  4UTG A;  4HAC B;  2UUA I;  1UDN A;  2NN6 A;  5JEA B;  1N0V C;  4IS9 A;  5FLX C;  1FJG E;  5IWA E;  3PS3 A;  1FWL A;  2JE6 A;  3GLL A;  4MDT A;  5A2Q Q;  2F4V I;  4FW5 A;  3Q1Q A;  5FWK A;  1N0U A;  4X62 E;  1PVG A;  1R6L A;  1Z0E A;  4DPW A;  1N34 I;  1HNX E;  4WUC A;  4JI5 E;  4IZK B;  1HNZ E;  4NBQ A;  4GKK I;  4IFD B;  4HY1 A;  1OJ4 A;  3LPS A;  3OTO I;  5GMD A;  4LF9 I;  3DD6 A;  1PIE A;  1Z5A A;  4FWD A;  4U3B A;  2WNR B;  1IBK I;  2V2V A;  2Z5B A;  4DPT A;  1ZXM A;  4MYU A;  5LMN E;  1H7S A;  1XNQ E;  4DV1 I;  4DR2 E;  2CG9 A;  2NN6 E;  4BA2 B;  2UXC E;  2CVE A;  5GME A;  4OO1 D;  1ZM9 A;  3U1K A;  2J7K A;  3Q6N A;  2PO0 B;  4URL A;  4AID A;  4JYA E;  4DV0 I;  5K36 B;  1XMO I;  4DR7 E;  4K0K E;  1KVK A;  4OO1 A;  4GKJ I;  1ZXN A;  2Z5C A;  3B82 A;  2IOP A;  4KQV A;  1HK7 A;  4DR4 I;  4DUZ I;  4FN5 A;  4QNK A;  3QT5 A;  5EL9 A;  1XNR E;  4LF6 E;  4DU7 A;  4DV3 I;  4JI3 I;  4YY3 I;  3CDJ A;  3U1Y A;  3WU6 A;  4KHP I;  5C0X A;  4B3S I;  4OO1 C;  1U2R A;  4J3D A;  4OX9 E;  2V2Q A;  4HYM A;  4LFA I;  4LF5 I;  1Y6Z A;  4JI0 I;  3UHM A;  3GCM A;  3QT7 A;  4X66 I;  2DEI A;  3PS1 A;  1Z0W A;  1ELO A;  4ZVI A;  4DV5 I;  4AQY I;  4JV5 I;  2C39 A;  4NXN E;  4OO1 E;  3T1Y E;  2O1T A;  2PO2 B;  3WU5 A;  3M85 G;  2R42 A;  4JI1 I;  1UDS A;  4DV6 E;  1FKA E;  4HAC A;  4DR5 E;  4DR1 E;  3L7Z B;  2F1D A;  4FW9 A;  2JEB B;  1N36 I;  4B3M I;  4DPU A;  5JEA A;  1J5E I;  3M7N G;  1NHH A;  4WUD A;  4LFB E;  1Z0T A;  1E3H A;  1FWK A;  4FW3 A;  1H7U A;  4IFD D;  2UXB E;  1Z5B A;  4JI4 I;  1D6T A;  3P3E A;  4FW4 A;  4FWG A;  5DRO A;  4B3R E;  2CGE A;  3HJC A;  4IFD A;  1HNW I;  1FJG I;  5IWA I;  1IBM E;  4P7A A;  1YH8 A;  1PKP A;  1P42 A;  3LTO A;  2WNR A;  1EI1 A;  2VQF E;  1UDQ A;  3T1H E;  4BA2 A;  5FLX Q;  1Z0G A;  1Y4U A;  1NHI A;  1HNX I;  4UT4 A;  4JI5 I;  2PNZ B;  4N3O A;  3B78 A;  1HNZ I;  2PO0 A;  4X65 E;  4B3T E;  3LNU A;  1I94 E;  4JG4 A;  2NN6 F;  3GON A;  2BR2 B;  1N32 E;  1N33 E;  5LMN I;  3ZZ0 A;  1XNQ I;  4DR2 I;  2VQE I;  4USK A;  2PNM A;  2UXC I;  2PO1 B;  3J81 C;  4DV2 I;  3JAM C;  3K1J A;  2AE8 A;  2NN6 C;  4DUY I;  1Y5Y A;  1KKH A;  1OYR A;  4DR7 I;  4K0K I;  2UXD E;  2C37 A; 
#chains in the Genus database with same CATH homology
 3PYF A;  4DXL A;  2X36 A;  4DU8 A;  3PRY A;  2O1V A;  3J7A M;  1XNR I;  4LF6 I;  1B63 A;  3WU3 A;  3K17 A;  2X7I A;  1FNM A;  3CWV A;  3QT8 A;  3ZKB A;  1XMQ E;  2UU9 E;  4LF7 E;  1UEK A;  3PYG A;  4ED4 A;  1IBL E;  1Z0V A;  4NXN I;  1S16 A;  2Z5E A;  4LF8 E;  1H74 A;  2ZBK B;  3T1Y I;  1XHK A;  4JI6 E;  3V5R A;  4NXM E;  1K47 A;  4DR3 E;  4GKK E;  4DR5 I;  2O1U A;  4DR1 I;  4IZJ B;  1MU5 A;  3ZM7 A;  2ZM6 E;  1USU A;  2BM0 A;  1Z5C A;  4DV1 E;  4LFB I;  5LMU E;  2HK2 A;  2UXB I;  1DAR A;  4DV7 E;  4B3R I;  2UUC E;  1Z59 A;  1HR0 E;  3Q6M A;  5BR8 E;  2Z5B B;  4DR6 I;  3V2U C;  4JI2 E;  1NZ0 A;  2VQF I;  3T1H I;  1USV A;  3H4L A;  2HKJ A;  4FWH A;  4YY3 E;  4KHP E;  1A6F A;  1Y4S A;  1VIS A;  4LF4 E;  4JI7 E;  2UUB E;  1ZM3 A;  4X65 I;  4IZK A;  4B3T I;  2Z5C B;  4LFA E;  2E1R A;  4PU9 A;  4XTJ A;  1N33 I;  4X62 I;  4X64 E;  4WUB A;  5LL6 R;  2V34 A;  1Z0B A;  4LFC E;  2WW4 A;  4Z7C A;  4DV4 E;  3J7A G;  4PRX A;  2UXD I;  4B3M E;  3J81 Q;  3JAM Q;  3J80 C;  2LJP A;  1ZM4 A;  2E5L E;  3ZZU A;  2BM1 A;  4IZJ D;  4JI4 E;  5L3J A;  2EFG A;  4I3H A;  4JI8 E;  5IT9 C;  1NHJ A;  4JYA I;  3ZKD A;  1QZR A;  1KIJ A;  2BV3 A;  4IZJ A;  2GQ0 A;  1HNW E;  1FI4 A;  1XMQ I;  2UU9 I;  4LF7 I;  1EA6 A;  1IBL I;  2HHH E;  2NPF A;  2R3V A;  3ZZT A;  4LF8 I;  4YHH E;  4JI6 I;  2UUA E;  4NXM I;  5A2Q C;  2HFS A;  4DR3 I;  1S4E A;  1KTV A;  1BKN A;  1RRE A;  4USM A;  4OX9 I;  3PYD A;  2AJ4 A;  2ZM6 I;  3PYE A;  2F4V E;  2VQE E;  5LMU I;  2IOQ A;  1WUU A;  4DV2 E;  2HKE A;  1N34 E;  1RR9 A;  1MG7 A;  4DUY E;  3QT6 A;  4Z7Y A;  2CZ9 A;  4DV6 I;  4DV7 I;  2A2D A;  2UUC I;  3OTO E;  1HR0 I;  5BR8 I;  4LF9 E;  1IBK E;  4EMD A;  4JI2 I;  4LF4 I;  4JI7 I;  3M6A A;  2UUB I;  3F0N A;  4DV0 E;  4DPY A;  1XMO E;  4GKJ E;  3WU4 A;  1IBM I;  2V2Z A;  3K85 A;  3D4J A;  1H73 A;  2O1W A;  2XEX A;  2ZIT A;  4DR4 E;  2V8P A;  4DUZ E;  2HFU A;  2A2C A;  2HK3 A;  4X64 I;  2VF3 A;  4DV3 E;  4JI3 E;  2GS8 A;  2DEJ A;  4LFC I;  4B3S E;  4DV4 I;  1ZM2 A;  2Q2E B;  4LF5 E;  1I94 I;  4JI0 E;  4HXZ A;  4RPF A;  4X66 E;  1N32 I;  4AQY E;  4DV5 E;  4P52 A;  3B8H A;  3P06 A;  4M1K A;  4JV5 E;  1H72 C;  2E5L I;  4MYT A;  4PRV A;  1Z0C A;  4JI1 E;  4JI8 I;  4DPX A;  3J80 Q;  1N36 E;  2OI2 A;  1J5E E;  1B62 A;  4DR6 E;  1MX0 A;  4R1F A;  5IT9 Q;  2HHH I;  2PNL A;  3HUL A;  4YHH I;  4UTG A;  4HAC B;  2UUA I;  1N0V C;  5FLX C;  1FJG E;  5IWA E;  1FWL A;  5A2Q Q;  2F4V I;  3Q1Q A;  5FWK A;  1N0U A;  4X62 E;  1PVG A;  1Z0E A;  4DPW A;  1N34 I;  1HNX E;  4WUC A;  4JI5 E;  4IZK B;  1HNZ E;  4GKK I;  4HY1 A;  1OJ4 A;  3LPS A;  3OTO I;  5GMD A;  4LF9 I;  1PIE A;  1Z5A A;  4FWD A;  1IBK I;  2V2V A;  2Z5B A;  4DPT A;  1ZXM A;  4MYU A;  5LMN E;  1H7S A;  1XNQ E;  4DV1 I;  4DR2 E;  2CG9 A;  2UXC E;  5GME A;  1ZM9 A;  2J7K A;  3Q6N A;  4URL A;  4JYA E;  4DV0 I;  1XMO I;  4DR7 E;  4K0K E;  1KVK A;  4GKJ I;  1ZXN A;  2Z5C A;  3B82 A;  2IOP A;  4KQV A;  1HK7 A;  4DR4 I;  4DUZ I;  4FN5 A;  3QT5 A;  1XNR E;  4LF6 E;  4DU7 A;  4DV3 I;  4JI3 I;  4YY3 I;  3WU6 A;  4KHP I;  4B3S I;  1U2R A;  4OX9 E;  2V2Q A;  4HYM A;  4LFA I;  4LF5 I;  1Y6Z A;  4JI0 I;  4X66 I;  3QT7 A;  2DEI A;  1Z0W A;  1ELO A;  4ZVI A;  4DV5 I;  4AQY I;  4JV5 I;  4NXN E;  3T1Y E;  2O1T A;  3WU5 A;  2R42 A;  4JI1 I;  4DV6 E;  1FKA E;  4HAC A;  4DR5 E;  4DR1 E;  4FW9 A;  1N36 I;  4B3M I;  4DPU A;  1J5E I;  1NHH A;  4WUD A;  4LFB E;  1Z0T A;  1FWK A;  1H7U A;  2UXB E;  1Z5B A;  4JI4 I;  1D6T A;  4FWG A;  4B3R E;  2CGE A;  3HJC A;  1HNW I;  1FJG I;  5IWA I;  1IBM E;  4P7A A;  1PKP A;  3LTO A;  1EI1 A;  2VQF E;  3T1H E;  5FLX Q;  1Z0G A;  1NHI A;  1Y4U A;  1HNX I;  4UT4 A;  4JI5 I;  4N3O A;  3B78 A;  1HNZ I;  4X65 E;  4B3T E;  3LNU A;  1I94 E;  4JG4 A;  3GON A;  1N32 E;  1N33 E;  5LMN I;  3ZZ0 A;  1XNQ I;  4DR2 I;  2VQE I;  4USK A;  2PNM A;  2UXC I;  3J81 C;  4DV2 I;  3JAM C;  3K1J A;  4DUY I;  1KKH A;  4DR7 I;  4K0K I;  2UXD E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...