4YHHI

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yhhI00
4DU7A 1BKNA 4I3HA 4DUYI 4HXZA 5FLXC 4DUZE 3LNUA 4HYMA 5IT9C 1Z0BA 4GKJI 2X7IA 3ZKDA 1IBMI 1IBLI 1H73A 4JI8I 1N32I 4LFBI 1XMQE 5LMNE 1Z5BA 4JI5E 4DR4E 4K0KE 2UU9I 4DV7E 4LF8I 2R42A 1PKPA 4YY3E 4JI3E 4DV3I 1N0UA 4USMA 1HNWE 4DR1I 3HULA 1ZXNA 4B3ME 1ZM4A 4B3SI 2E5LE 2WW4A 4WUBA 1N34E 4WUCA 4ZVIA 4JV5E 4KHPI 4LF7E 1MU5A 3LPSA 2J7KA 5LL6R 4JI6E 3T1YE 4PU9A 4NXNI 1Z0CA 2UUCI 4LFCE 1N33I 1NZ0A 3LTOA 3H4LA 3WU6A 3OTOI 2VQFE 2UUAE 4X65I 4USKA 1HR0E 4MYUA 2CZ9A 1FWKA 1FKAE 4X66I 3QT7A 1S16A 4LF9E 4B3RI 3J80Q 3K17A 4DR6I 3QT8A 4GKKE 3B8HA 4R1FA 4FWHA 1D6TA 1NHIA 5IWAI 1H7SA 4JI1I 2E1RA 2UXDE 4EMDA 3T1HI 1QZRA 1A6FA 2XEXA 2ZM6I 1IBKI 1KKHA 1Z0VA 2Q2EB 2UUBI 3F0NA 1ZM2A 4AQYE 4HACA 1N36E 4DR5E 2V2QA 4DUZI 2A2DA 2F4VE 3J80C 3J7AG 4X62E 2HK2A 2NPFA 4DPTA 2UXBE 4NXME 3J7AM 3PYEA 5LMNI 1XMQI 3Q1QA 5A2QC 1FNMA 4JI0E 2OI2A 4JI5I 4JI7E 4DR4I 4K0KI 4DV0E 1EI1A 1HNXI 1XNQE 4DV7I 1Z0TA 4Z7YA 1HNXE 1FWLA 1ZM9A 4LF6E 4YY3I 2UXCE 4JI3I 3QT5A 1I94E 3WU4A 1PVGA 4DV4E 4FW9A 3V2UC 3WU3A 1HNWI 4WUDA 4B3TE 1Z0WA 4DPXA 4JI2E 1J5EE 4B3MI 2VF3A 1Z5AA 4KQVA 2E5LI 2HKEA 4MYTA 1N34I 1XHKA 4JV5I 1ELOA 4LF7I 1KVKA 4JI6I 4DR7E 1XNRE 3T1YI 4LF4E 4LFCI 1H72C 1U2RA 3JAMQ 1B63A 2VQFI 2UUAI 4DV5E 2DEJA 1HR0I 2AJ4A 1ZM3A 4YHHE 4LF9I 5BR8E 4DPYA 1XMOE 2VQEE 2HFUA 4FN5A 2GS8A 2LJPA 2V2VA 3ZZTA 3V5RA 4JI4E 3QT6A 1MG7A 3J81Q 4GKKI 2A2CA 3B78A 4OX9E 4Z7CA 1VISA 4X64E 3M6AA 4DPWA 3PYDA 2UXDI 1KIJA 2HHHE 4LF5E 4LFAE 3CWVA 1NHJA 4FWDA 3ZZUA 3JAMC 2ZBKB 4AQYI 1N36I 2V34A 2X36A 4DR5I 2ZITA 1HNZI 4DR3E 2F4VI 4X62I 4DR2E 1HNZE 1Z0GA 4DV6E 2UXBI 4NXMI 4P7AA 1ZXMA 1UEKA 2DEIA 4JI0I 2V8PA 4JI7I 4DV0I 5LMUE 1XNQI 1RREA 3GONA 1FI4A 4DV2E 4LF6I 4URLA 1FJGE 4PRXA 2UXCI 4DUYE 1I94I 1WUUA 3D4JA 3K1JA 4DV4I 4ED4A 4GKJE 1IBME 3ZKBA 1IBLE 4B3TI 4JI8E 1N32E 4HY1A 4RPFA 3PYGA 4JI2I 2HKJA 1J5EI 4LFBE 2BV3A 1PIEA 2UU9E 4UTGA 4LF8E 4DR7I 1XNRI 4JYAI 4LF4I 4JYAE 1N0VC 4DV5I 1KTVA 1EA6A 1Z0EA 1MX0A 4DV3E 1H7UA 2R3VA 4YHHI 5BR8I 1XMOI 4DR1E 2VQEI 4DU8A 1NHHA 1OJ4A 2V2ZA 2BM1A 4JI4I 4B3SE 4DV1I 4OX9I 4KHPE 4DV1E 4UT4A 4NXNE 4X64I 2UUCE 1N33E 1B62A 4DXLA 3OTOE 1RR9A 4X65E 4FWGA 4M1KA 2HHHI 4LF5I 4LFAI 1K47A 2HK3A 4X66E 2HFSA 5FLXQ 4B3RE 5IT9Q 4DR6E 5A2QQ 1DARA 3PYFA 3WU5A 3ZZ0A 4DR3I 3ZM7A 5IWAE 2BM0A 4DR2I 4P52A 4PRVA 4DV6I 5GMEA 4XTJA 4JI1E 3B82A 4JG4A 1H74A 3T1HE 3J81C 5LMUI 2ZM6E 1S4EA 1IBKE 2UUBE 5L3JA 2EFGA 4DV2I 4HACB 1Z59A 4DPUA 1Z5CA 5GMDA 1FJGI
chains in the Genus database with same CATH superfamily
4DU7A 1BKNA 4I3HA 4DUYI 4HXZA 2PO0A 5FLXC 4DUZE 3LNUA 4HYMA 1R6LA 5IT9C 1Z0BA 4GKJI 2X7IA 3ZKDA 1IBMI 1IBLI 1H73A 4JI8I 1N32I 4LFBI 1XMQE 5LMNE 1Z5BA 3K85A 4JI5E 4DR4E 4K0KE 5EKWA 4GQUA 2UU9I 4DV7E 4LF8I 5JEAD 2R42A 4IZJA 2IOQA 1PKPA 4LPFA 4U3BA 4YY3E 4JI3E 4MU4A 4DV3I 3GLLA 1N0UA 4USMA 4BA1A 1HNWE 4DR1I 2VESA 3HULA 1OYPA 1ZXNA 4IFDD 5DRRA 2C37B 4OO1F 4B3ME 1ZM4A 4B3SI 2E5LE 2Z5CA 2WW4A 5K36F 4WUBA 1N34E 4WUCA 4ZVIA 4JV5E 1UDOA 4KHPI 4LF7E 1MU5A 3LPSA 3P3EA 3L7ZA 2J7KA 5LL6R 1YH8A 3L7ZB 4JI6E 3T1YE 4PU9A 2PNZB 2NN6C 1Z0CA 4NXNI 2UUCI 4LFCE 1N33I 1NZ0A 3LTOA 3H4LA 3WU6A 5DNLA 3OTOI 2VQFE 2UUAE 4X65I 1R6MA 2J65A 4USKA 1HR0E 3H1CA 4MU0A 4MYUA 2CZ9A 1FWKA 1FKAE 4X66I 2C39A 3QT7A 1S16A 4LF9E 4B3RI 3J80Q 3K17A 4DR6I 3QT8A 1HK7A 4GKKE 3Q6NA 3B8HA 5JEAC 4R1FA 4FWHA 1D6TA 1NHIA 3CDIA 5IWAI 4OO1E 2JEBB 1UDNA 2O1WA 1H7SA 5K36E 2JE6A 4JI1I 2E1RA 2UXDE 1Y5YA 4EMDA 4FW7A 3T1HI 1QZRA 1A6FA 2XEXA 2ZM6I 1P42A 3P3CA 1IBKI 1KKHA 1Z0VA 2Q2EB 4U3DA 2UUBI 5C0XA 3F0NA 5C0XB 4OZEA 2O1UA 1ZM2A 4AQYE 2JEAB 4HACA 1N36E 2BA0G 2GO4A 1USUA 3M85G 4DR5E 2V2QA 4OO1D 3DD6A 2CGEA 2IOPA 4DUZI 2PNLA 5K36D 1E3PA 2A2DA 2F4VE 4FW3A 3J80C 3J7AG 4X62E 2HK2A 2CVEA 2NPFA 4DPTA 2PNMA 1Y6ZA 2UXBE 4NXME 2AE8A 2BR2B 3J7AM 3PYEA 5LMNI 1XMQI 3Q1QA 5A2QC 2GQ0A 1FNMA 4QNKA 4JI0E 2OI2A 4JI5I 4JI7E 4AM3A 4DR4I 5JEAB 4K0KI 3B4TA 4QNJA 4DV0E 1EI1A 1HNXI 1XNQE 4DV7I 2WNRB 1Z0TA 3NZKA 4Z7YA 1HNXE 1FWLA 1ZM9A 4LF6E 1VI7A 4YY3I 2UXCE 1USVA 4AIDA 4JI3I 2Z5EA 3QT5A 1I94E 3WU4A 1PVGA 2JT2A 4DV4E 4FW9A 3V2UC 3WU3A 4IFDB 1HNWI 4WUDA 4B3TE 1Y4UA 1Z0WA 4DPXA 4LCFA 4JI2E 1J5EE 4B3MI 2VF3A 1Z5AA 4KQVA 2E5LI 2C37A 2HKEA 4MYTA 1N34I 4NBQA 1XHKA 4JV5I 1UDQA 1ELOA 2PO2B 5DRPA 4LF7I 1KVKA 4JI6I 4DR7E 1XNRE 3T1YI 4LF4E 4LFCI 1H72C 4IZJD 2F1DA 1U2RA 2O3ZA 3JAMQ 2PNZA 4AIMA 2Z5BB 4OO1C 1B63A 2BA1D 2VQFI 2UUAI 2PO1B 4DV5E 2DEJA 5K36C 1HR0I 2AJ4A 3M7ND 5C0XF 1ZM3A 4MU1A 4YHHE 4LF9I 5BR8E 4DPYA 1XMOE 4J3DA 2VQEE 2HFUA 4FN5A 2GS8A 2LJPA 2V2VA 3ZZTA 5ELWA 3V5RA 4JI4E 3QT6A 1MG7A 3J81Q 4GKKI 2A2CA 4LCHA 3B78A 4OX9E 3P76A 4Z7CA 1VISA 4X64E 4BA2B 3M6AA 5DROA 2JEBA 4DPWA 2C38B 3PYDA 2UXDI 1KIJA 2HHHE 4LF5E 4LFAE 1OYSA 3CWVA 1NHJA 1Y4SA 4FWDA 3HKMA 2WP8A 2ZBKB 3GCMA 4IZKB 2WP8B 3ZZUA 3JAMC 4AQYI 2NN6B 4OO1B 1N36I 2V34A 5C0XE 2X36A 2JEAA 5DRQA 3Q6MA 4DR5I 4IFDF 2ZITA 1HNZI 4DR3E 2F4VI 4X62I 4DR2E 1HNZE 1Z0GA 4DV6E 3U1YA 2UXBI 4NXMI 4P7AA 1ZXMA 1UEKA 2DEIA 2BR2A 4N3OA 4JI0I 2V8PA 4JI7I 4MU3A 4DV0I 4OKGA 3PS3A 5LMUE 3PS1A 1XNQI 2CG9A 1RREA 5JEAA 3GONA 1FI4A 3KRNA 4DV2E 1Y60A 5C0XD 2WNRA 4LF6I 4URLA 1FJGE 4PRXA 2UXCI 2PO0B 4DUYE 3P3GA 2O1TA 1I94I 1WUUA 3D4JA 3K1JA 4DV4I 4IS9A 4MQYA 4ED4A 4GKJE 1IBME 3ZKBA 1IBLE 4B3TI 4JI8E 1N32E 4IFDA 4HY1A 4RPFA 5FWKA 3PYGA 4JI2I 2HKJA 1J5EI 4LFBE 1XXEA 4IFDE 2BV3A 1RHYA 1PIEA 2UU9E 4UTGA 3U1KA 4IZJB 4LF8E 4DR7I 1XNRI 2PO2A 4JYAI 4LF4I 1YHCA 4JYAE 1N0VC 4DV5I 1KTVA 2Z5BA 3PRYA 2PO1A 1EA6A 1Z0EA 1MX0A 4BA1B 3CDJA 4DV3E 1H7UA 1OYRA 2R3VA 4YHHI 5BR8I 1XMOI 4DR1E 2VQEI 4DU8A 2NN6F 1NHHA 1OJ4A 2V2ZA 2BM1A 2Z5CB 4JI4I 4B3SE 2IESA 2O1VA 4DV1I 4OX9I 4KHPE 2IERA 5C0XC 4FW5A 4DV1E 4UT4A 4NXNE 4X64I 2UUCE 1N33E 1B62A 3GMEA 3P06A 4DXLA 3OTOE 1RR9A 4X65E 4BA2A 4FWGA 4M1KA 1E3HA 2C39B 2HHHI 2C38A 5JEAF 4LF5I 4LFAI 2BA0D 3M85D 1K47A 2HK3A 4X66E 2HFSA 5FLXQ 4B3RE 2GO3A 3UHMA 5DNXA 2BA1G 5IT9Q 4FW6A 3HJCA 4DR6E 4FW4A 5A2QQ 4IZKA 1DARA 3PYFA 3M7NG 3WU5A 3ZZ0A 2NN6A 4OO1A 2NN6E 5K36A 4ISAA 5K36B 4DR3I 3ZM7A 5IWAE 2JE6B 2BM0A 4DR2I 4P52A 4PRVA 4DV6I 5GMEA 4XTJA 4JI1E 3B82A 4JG4A 4LCGA 5EL9A 1H74A 3T1HE 4MDTA 4IFDC 3J81C 4LOMA 5LMUI 2ZM6E 1UDSA 1S4EA 1IBKE 2UUBE 5L3JA 2EFGA 4DV2I 4HACB 1Z59A 4DPUA 1Z5CA 3PS2A 5GMDA 5JEAE 1FJGI 2NN6D
chains in the Genus database with same CATH topology
4DU7A 1BKNA 4I3HA 4DUYI 4HXZA 5FLXC 4DUZE 3LNUA 4HYMA 5IT9C 1Z0BA 4GKJI 2X7IA 3ZKDA 1IBMI 1IBLI 1H73A 4JI8I 1N32I 4LFBI 1XMQE 5LMNE 1Z5BA 3K85A 4JI5E 4DR4E 4K0KE 2UU9I 4DV7E 4LF8I 2R42A 4IZJA 2IOQA 1PKPA 4YY3E 4JI3E 4DV3I 1N0UA 4USMA 1HNWE 4DR1I 3HULA 1ZXNA 4B3ME 1ZM4A 4B3SI 2E5LE 2Z5CA 2WW4A 4WUBA 1N34E 4WUCA 4ZVIA 4JV5E 4KHPI 4LF7E 1MU5A 3LPSA 2J7KA 5LL6R 4JI6E 3T1YE 4PU9A 4NXNI 1Z0CA 2UUCI 4LFCE 1N33I 1NZ0A 3LTOA 3H4LA 3WU6A 3OTOI 2VQFE 2UUAE 4X65I 4USKA 1HR0E 4MYUA 2CZ9A 1FWKA 1FKAE 4X66I 3QT7A 1S16A 4LF9E 4B3RI 3J80Q 3K17A 4DR6I 3QT8A 1HK7A 4GKKE 3Q6NA 3B8HA 4R1FA 4FWHA 1D6TA 1NHIA 5IWAI 2O1WA 1H7SA 4JI1I 2E1RA 2UXDE 4EMDA 3T1HI 1QZRA 1A6FA 2XEXA 2ZM6I 1IBKI 1KKHA 1Z0VA 2Q2EB 2UUBI 3F0NA 2O1UA 1ZM2A 4AQYE 4HACA 1N36E 1USUA 4DR5E 2V2QA 2CGEA 2IOPA 4DUZI 2PNLA 2A2DA 2F4VE 3J80C 3J7AG 4X62E 2HK2A 2NPFA 4DPTA 2PNMA 1Y6ZA 2UXBE 4NXME 3J7AM 1XMQI 3PYEA 5LMNI 3Q1QA 5A2QC 2GQ0A 1FNMA 4JI0E 2OI2A 4JI5I 4JI7E 4DR4I 4K0KI 4DV0E 1EI1A 1HNXI 1XNQE 4DV7I 1Z0TA 4Z7YA 1HNXE 1FWLA 1ZM9A 4LF6E 4YY3I 2UXCE 1USVA 4JI3I 2Z5EA 3QT5A 1I94E 3WU4A 1PVGA 4DV4E 4FW9A 3V2UC 3WU3A 1HNWI 4WUDA 4B3TE 1Y4UA 1Z0WA 4DPXA 4JI2E 1J5EE 4B3MI 2VF3A 1Z5AA 4KQVA 2E5LI 2HKEA 4MYTA 1N34I 1XHKA 4JV5I 1ELOA 4LF7I 1KVKA 4JI6I 4DR7E 1XNRE 3T1YI 4LF4E 4LFCI 1H72C 4IZJD 1U2RA 3JAMQ 2Z5BB 1B63A 2VQFI 2UUAI 4DV5E 2DEJA 1HR0I 2AJ4A 1ZM3A 4YHHE 4LF9I 5BR8E 4DPYA 1XMOE 2VQEE 2HFUA 4FN5A 2GS8A 2LJPA 2V2VA 3ZZTA 3V5RA 4JI4E 3QT6A 1MG7A 3J81Q 4GKKI 2A2CA 3B78A 4OX9E 4Z7CA 1VISA 4X64E 3M6AA 4DPWA 3PYDA 2UXDI 1KIJA 2HHHE 4LF5E 4LFAE 3CWVA 1NHJA 1Y4SA 4FWDA 3ZZUA 4IZKB 2ZBKB 3JAMC 4AQYI 1N36I 2V34A 2X36A 3Q6MA 4DR5I 2ZITA 1HNZI 4DR3E 2F4VI 4X62I 4DR2E 1HNZE 1Z0GA 4DV6E 2UXBI 4NXMI 4P7AA 1ZXMA 1UEKA 2DEIA 4JI0I 4N3OA 2V8PA 4JI7I 4DV0I 5LMUE 1XNQI 2CG9A 1RREA 3GONA 1FI4A 4DV2E 4LF6I 4URLA 1FJGE 4PRXA 2UXCI 4DUYE 2O1TA 1I94I 1WUUA 3D4JA 3K1JA 4DV4I 4ED4A 4GKJE 1IBME 3ZKBA 1IBLE 4B3TI 4JI8E 1N32E 4HY1A 4RPFA 5FWKA 3PYGA 4JI2I 2HKJA 1J5EI 4LFBE 2BV3A 1PIEA 2UU9E 4UTGA 4IZJB 4LF8E 4DR7I 1XNRI 4JYAI 4LF4I 4JYAE 1N0VC 4DV5I 1KTVA 2Z5BA 3PRYA 1EA6A 1Z0EA 1MX0A 4DV3E 1H7UA 2R3VA 4YHHI 5BR8I 1XMOI 4DR1E 2VQEI 4DU8A 1NHHA 1OJ4A 2V2ZA 2BM1A 2Z5CB 4JI4I 4B3SE 2O1VA 4DV1I 4OX9I 4KHPE 4DV1E 4UT4A 4NXNE 4X64I 2UUCE 1N33E 1B62A 3P06A 4DXLA 3OTOE 1RR9A 4X65E 4FWGA 4M1KA 2HHHI 4LF5I 4LFAI 1K47A 2HK3A 4X66E 2HFSA 5FLXQ 4B3RE 5IT9Q 3HJCA 4DR6E 5A2QQ 4IZKA 1DARA 3PYFA 3WU5A 3ZZ0A 4DR3I 3ZM7A 5IWAE 2BM0A 4DR2I 4P52A 4PRVA 4DV6I 5GMEA 4XTJA 4JI1E 3B82A 4JG4A 1H74A 3T1HE 3J81C 5LMUI 2ZM6E 1S4EA 1IBKE 2UUBE 5L3JA 2EFGA 4DV2I 4HACB 1Z59A 4DPUA 1Z5CA 5GMDA 1FJGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DU7 A;  1BKN A;  4I3H A;  4DUY I;  4HXZ A;  5FLX C;  4DUZ E;  3LNU A;  4HYM A;  5IT9 C;  1Z0B A;  4GKJ I;  2X7I A;  3ZKD A;  1IBM I;  1IBL I;  1H73 A;  4JI8 I;  1N32 I;  4LFB I;  1XMQ E;  5LMN E;  1Z5B A;  4JI5 E;  4DR4 E;  4K0K E;  2UU9 I;  4DV7 E;  4LF8 I;  2R42 A;  1PKP A;  4YY3 E;  4JI3 E;  4DV3 I;  1N0U A;  4USM A;  1HNW E;  4DR1 I;  3HUL A;  1ZXN A;  4B3M E;  1ZM4 A;  4B3S I;  2E5L E;  2WW4 A;  4WUB A;  1N34 E;  4WUC A;  4ZVI A;  4JV5 E;  4KHP I;  4LF7 E;  1MU5 A;  3LPS A;  2J7K A;  5LL6 R;  4JI6 E;  3T1Y E;  4PU9 A;  4NXN I;  1Z0C A;  2UUC I;  4LFC E;  1N33 I;  1NZ0 A;  3LTO A;  3H4L A;  3WU6 A;  3OTO I;  2VQF E;  2UUA E;  4X65 I;  4USK A;  1HR0 E;  4MYU A;  2CZ9 A;  1FWK A;  1FKA E;  4X66 I;  3QT7 A;  1S16 A;  4LF9 E;  4B3R I;  3J80 Q;  3K17 A;  4DR6 I;  3QT8 A;  4GKK E;  3B8H A;  4R1F A;  4FWH A;  1D6T A;  1NHI A;  5IWA I;  1H7S A;  4JI1 I;  2E1R A;  2UXD E;  4EMD A;  3T1H I;  1QZR A;  1A6F A;  2XEX A;  2ZM6 I;  1IBK I;  1KKH A;  1Z0V A;  2Q2E B;  2UUB I;  3F0N A;  1ZM2 A;  4AQY E;  4HAC A;  1N36 E;  4DR5 E;  2V2Q A;  4DUZ I;  2A2D A;  2F4V E;  3J80 C;  3J7A G;  4X62 E;  2HK2 A;  2NPF A;  4DPT A;  2UXB E;  4NXM E;  3J7A M;  3PYE A;  5LMN I;  1XMQ I;  3Q1Q A;  5A2Q C;  1FNM A;  4JI0 E;  2OI2 A;  4JI5 I;  4JI7 E;  4DR4 I;  4K0K I;  4DV0 E;  1EI1 A;  1HNX I;  1XNQ E;  4DV7 I;  1Z0T A;  4Z7Y A;  1HNX E;  1FWL A;  1ZM9 A;  4LF6 E;  4YY3 I;  2UXC E;  4JI3 I;  3QT5 A;  1I94 E;  3WU4 A;  1PVG A;  4DV4 E;  4FW9 A;  3V2U C;  3WU3 A;  1HNW I;  4WUD A;  4B3T E;  1Z0W A;  4DPX A;  4JI2 E;  1J5E E;  4B3M I;  2VF3 A;  1Z5A A;  4KQV A;  2E5L I;  2HKE A;  4MYT A;  1N34 I;  1XHK A;  4JV5 I;  1ELO A;  4LF7 I;  1KVK A;  4JI6 I;  4DR7 E;  1XNR E;  3T1Y I;  4LF4 E;  4LFC I;  1H72 C;  1U2R A;  3JAM Q;  1B63 A;  2VQF I;  2UUA I;  4DV5 E;  2DEJ A;  1HR0 I;  2AJ4 A;  1ZM3 A;  4YHH E;  4LF9 I;  5BR8 E;  4DPY A;  1XMO E;  2VQE E;  2HFU A;  4FN5 A;  2GS8 A;  2LJP A;  2V2V A;  3ZZT A;  3V5R A;  4JI4 E;  3QT6 A;  1MG7 A;  3J81 Q;  4GKK I;  2A2C A;  3B78 A;  4OX9 E;  4Z7C A;  1VIS A;  4X64 E;  3M6A A;  4DPW A;  3PYD A;  2UXD I;  1KIJ A;  2HHH E;  4LF5 E;  4LFA E;  3CWV A;  1NHJ A;  4FWD A;  3ZZU A;  3JAM C;  2ZBK B;  4AQY I;  1N36 I;  2V34 A;  2X36 A;  4DR5 I;  2ZIT A;  1HNZ I;  4DR3 E;  2F4V I;  4X62 I;  4DR2 E;  1HNZ E;  1Z0G A;  4DV6 E;  2UXB I;  4NXM I;  4P7A A;  1ZXM A;  1UEK A;  2DEI A;  4JI0 I;  2V8P A;  4JI7 I;  4DV0 I;  5LMU E;  1XNQ I;  1RRE A;  3GON A;  1FI4 A;  4DV2 E;  4LF6 I;  4URL A;  1FJG E;  4PRX A;  2UXC I;  4DUY E;  1I94 I;  1WUU A;  3D4J A;  3K1J A;  4DV4 I;  4ED4 A;  4GKJ E;  1IBM E;  3ZKB A;  1IBL E;  4B3T I;  4JI8 E;  1N32 E;  4HY1 A;  4RPF A;  3PYG A;  4JI2 I;  2HKJ A;  1J5E I;  4LFB E;  2BV3 A;  1PIE A;  2UU9 E;  4UTG A;  4LF8 E;  4DR7 I;  1XNR I;  4JYA I;  4LF4 I;  4JYA E;  1N0V C;  4DV5 I;  1KTV A;  1EA6 A;  1Z0E A;  1MX0 A;  4DV3 E;  1H7U A;  2R3V A;  4YHH I;  5BR8 I;  1XMO I;  4DR1 E;  2VQE I;  4DU8 A;  1NHH A;  1OJ4 A;  2V2Z A;  2BM1 A;  4JI4 I;  4B3S E;  4DV1 I;  4OX9 I;  4KHP E;  4DV1 E;  4UT4 A;  4NXN E;  4X64 I;  2UUC E;  1N33 E;  1B62 A;  4DXL A;  3OTO E;  1RR9 A;  4X65 E;  4FWG A;  4M1K A;  2HHH I;  4LF5 I;  4LFA I;  1K47 A;  2HK3 A;  4X66 E;  2HFS A;  5FLX Q;  4B3R E;  5IT9 Q;  4DR6 E;  5A2Q Q;  1DAR A;  3PYF A;  3WU5 A;  3ZZ0 A;  4DR3 I;  3ZM7 A;  5IWA E;  2BM0 A;  4DR2 I;  4P52 A;  4PRV A;  4DV6 I;  5GME A;  4XTJ A;  4JI1 E;  3B82 A;  4JG4 A;  1H74 A;  3T1H E;  3J81 C;  5LMU I;  2ZM6 E;  1S4E A;  1IBK E;  2UUB E;  5L3J A;  2EFG A;  4DV2 I;  4HAC B;  1Z59 A;  4DPU A;  1Z5C A;  5GMD A;  1FJG I; 
#chains in the Genus database with same CATH topology
 4DU7 A;  1BKN A;  4I3H A;  4DUY I;  4HXZ A;  2PO0 A;  5FLX C;  4DUZ E;  3LNU A;  4HYM A;  1R6L A;  5IT9 C;  1Z0B A;  4GKJ I;  2X7I A;  3ZKD A;  1IBM I;  1IBL I;  1H73 A;  4JI8 I;  1N32 I;  4LFB I;  1XMQ E;  5LMN E;  1Z5B A;  3K85 A;  4JI5 E;  4DR4 E;  4K0K E;  5EKW A;  4GQU A;  2UU9 I;  4DV7 E;  4LF8 I;  5JEA D;  2R42 A;  4IZJ A;  2IOQ A;  1PKP A;  4LPF A;  4U3B A;  4YY3 E;  4JI3 E;  4MU4 A;  4DV3 I;  3GLL A;  1N0U A;  4USM A;  4BA1 A;  1HNW E;  4DR1 I;  2VES A;  3HUL A;  1OYP A;  1ZXN A;  4IFD D;  5DRR A;  2C37 B;  4OO1 F;  4B3M E;  1ZM4 A;  4B3S I;  2E5L E;  2Z5C A;  2WW4 A;  5K36 F;  4WUB A;  1N34 E;  4WUC A;  4ZVI A;  4JV5 E;  1UDO A;  4KHP I;  4LF7 E;  1MU5 A;  3LPS A;  3P3E A;  3L7Z A;  2J7K A;  5LL6 R;  1YH8 A;  3L7Z B;  4JI6 E;  3T1Y E;  4PU9 A;  2PNZ B;  2NN6 C;  1Z0C A;  4NXN I;  2UUC I;  4LFC E;  1N33 I;  1NZ0 A;  3LTO A;  3H4L A;  3WU6 A;  5DNL A;  3OTO I;  2VQF E;  2UUA E;  4X65 I;  1R6M A;  2J65 A;  4USK A;  1HR0 E;  3H1C A;  4MU0 A;  4MYU A;  2CZ9 A;  1FWK A;  1FKA E;  4X66 I;  2C39 A;  3QT7 A;  1S16 A;  4LF9 E;  4B3R I;  3J80 Q;  3K17 A;  4DR6 I;  3QT8 A;  1HK7 A;  4GKK E;  3Q6N A;  3B8H A;  5JEA C;  4R1F A;  4FWH A;  1D6T A;  1NHI A;  3CDI A;  5IWA I;  4OO1 E;  2JEB B;  1UDN A;  2O1W A;  1H7S A;  5K36 E;  2JE6 A;  4JI1 I;  2E1R A;  2UXD E;  1Y5Y A;  4EMD A;  4FW7 A;  3T1H I;  1QZR A;  1A6F A;  2XEX A;  2ZM6 I;  1P42 A;  3P3C A;  1IBK I;  1KKH A;  1Z0V A;  2Q2E B;  4U3D A;  2UUB I;  5C0X A;  3F0N A;  5C0X B;  4OZE A;  2O1U A;  1ZM2 A;  4AQY E;  2JEA B;  4HAC A;  1N36 E;  2BA0 G;  2GO4 A;  1USU A;  3M85 G;  4DR5 E;  2V2Q A;  4OO1 D;  3DD6 A;  2CGE A;  2IOP A;  4DUZ I;  2PNL A;  5K36 D;  1E3P A;  2A2D A;  2F4V E;  4FW3 A;  3J80 C;  3J7A G;  4X62 E;  2HK2 A;  2CVE A;  2NPF A;  4DPT A;  2PNM A;  1Y6Z A;  2UXB E;  4NXM E;  2AE8 A;  2BR2 B;  3J7A M;  3PYE A;  5LMN I;  1XMQ I;  3Q1Q A;  5A2Q C;  2GQ0 A;  1FNM A;  4QNK A;  4JI0 E;  2OI2 A;  4JI5 I;  4JI7 E;  4AM3 A;  4DR4 I;  5JEA B;  4K0K I;  3B4T A;  4QNJ A;  4DV0 E;  1EI1 A;  1HNX I;  1XNQ E;  4DV7 I;  2WNR B;  1Z0T A;  3NZK A;  4Z7Y A;  1HNX E;  1FWL A;  1ZM9 A;  4LF6 E;  1VI7 A;  4YY3 I;  2UXC E;  1USV A;  4AID A;  4JI3 I;  2Z5E A;  3QT5 A;  1I94 E;  3WU4 A;  1PVG A;  2JT2 A;  4DV4 E;  4FW9 A;  3V2U C;  3WU3 A;  4IFD B;  1HNW I;  4WUD A;  4B3T E;  1Y4U A;  1Z0W A;  4DPX A;  4LCF A;  4JI2 E;  1J5E E;  4B3M I;  2VF3 A;  1Z5A A;  4KQV A;  2E5L I;  2C37 A;  2HKE A;  4MYT A;  1N34 I;  4NBQ A;  1XHK A;  4JV5 I;  1UDQ A;  1ELO A;  2PO2 B;  5DRP A;  4LF7 I;  1KVK A;  4JI6 I;  4DR7 E;  1XNR E;  3T1Y I;  4LF4 E;  4LFC I;  1H72 C;  4IZJ D;  2F1D A;  1U2R A;  2O3Z A;  3JAM Q;  2PNZ A;  4AIM A;  2Z5B B;  4OO1 C;  1B63 A;  2BA1 D;  2VQF I;  2UUA I;  2PO1 B;  4DV5 E;  2DEJ A;  5K36 C;  1HR0 I;  2AJ4 A;  3M7N D;  5C0X F;  1ZM3 A;  4MU1 A;  4YHH E;  4LF9 I;  5BR8 E;  4DPY A;  1XMO E;  4J3D A;  2VQE E;  2HFU A;  4FN5 A;  2GS8 A;  2LJP A;  2V2V A;  3ZZT A;  5ELW A;  3V5R A;  4JI4 E;  3QT6 A;  1MG7 A;  3J81 Q;  4GKK I;  2A2C A;  4LCH A;  3B78 A;  4OX9 E;  3P76 A;  4Z7C A;  1VIS A;  4X64 E;  4BA2 B;  3M6A A;  5DRO A;  2JEB A;  4DPW A;  2C38 B;  3PYD A;  2UXD I;  1KIJ A;  2HHH E;  4LF5 E;  4LFA E;  1OYS A;  3CWV A;  1NHJ A;  1Y4S A;  4FWD A;  3HKM A;  2WP8 A;  2ZBK B;  3GCM A;  4IZK B;  2WP8 B;  3ZZU A;  3JAM C;  4AQY I;  2NN6 B;  4OO1 B;  1N36 I;  2V34 A;  5C0X E;  2X36 A;  2JEA A;  5DRQ A;  3Q6M A;  4DR5 I;  4IFD F;  2ZIT A;  1HNZ I;  4DR3 E;  2F4V I;  4X62 I;  4DR2 E;  1HNZ E;  1Z0G A;  4DV6 E;  3U1Y A;  2UXB I;  4NXM I;  4P7A A;  1ZXM A;  1UEK A;  2DEI A;  2BR2 A;  4N3O A;  4JI0 I;  2V8P A;  4JI7 I;  4MU3 A;  4DV0 I;  4OKG A;  3PS3 A;  5LMU E;  3PS1 A;  1XNQ I;  2CG9 A;  1RRE A;  5JEA A;  3GON A;  1FI4 A;  3KRN A;  4DV2 E;  1Y60 A;  5C0X D;  2WNR A;  4LF6 I;  4URL A;  1FJG E;  4PRX A;  2UXC I;  2PO0 B;  4DUY E;  3P3G A;  2O1T A;  1I94 I;  1WUU A;  3D4J A;  3K1J A;  4DV4 I;  4IS9 A;  4MQY A;  4ED4 A;  4GKJ E;  1IBM E;  3ZKB A;  1IBL E;  4B3T I;  4JI8 E;  1N32 E;  4IFD A;  4HY1 A;  4RPF A;  5FWK A;  3PYG A;  4JI2 I;  2HKJ A;  1J5E I;  4LFB E;  1XXE A;  4IFD E;  2BV3 A;  1RHY A;  1PIE A;  2UU9 E;  4UTG A;  3U1K A;  4IZJ B;  4LF8 E;  4DR7 I;  1XNR I;  2PO2 A;  4JYA I;  4LF4 I;  1YHC A;  4JYA E;  1N0V C;  4DV5 I;  1KTV A;  2Z5B A;  3PRY A;  2PO1 A;  1EA6 A;  1Z0E A;  1MX0 A;  4BA1 B;  3CDJ A;  4DV3 E;  1H7U A;  1OYR A;  2R3V A;  4YHH I;  5BR8 I;  1XMO I;  4DR1 E;  2VQE I;  4DU8 A;  2NN6 F;  1NHH A;  1OJ4 A;  2V2Z A;  2BM1 A;  2Z5C B;  4JI4 I;  4B3S E;  2IES A;  2O1V A;  4DV1 I;  4OX9 I;  4KHP E;  2IER A;  5C0X C;  4FW5 A;  4DV1 E;  4UT4 A;  4NXN E;  4X64 I;  2UUC E;  1N33 E;  1B62 A;  3GME A;  3P06 A;  4DXL A;  3OTO E;  1RR9 A;  4X65 E;  4BA2 A;  4FWG A;  4M1K A;  1E3H A;  2C39 B;  2HHH I;  2C38 A;  5JEA F;  4LF5 I;  4LFA I;  2BA0 D;  3M85 D;  1K47 A;  2HK3 A;  4X66 E;  2HFS A;  5FLX Q;  4B3R E;  2GO3 A;  3UHM A;  5DNX A;  2BA1 G;  5IT9 Q;  4FW6 A;  3HJC A;  4DR6 E;  4FW4 A;  5A2Q Q;  4IZK A;  1DAR A;  3PYF A;  3M7N G;  3WU5 A;  3ZZ0 A;  2NN6 A;  4OO1 A;  2NN6 E;  5K36 A;  4ISA A;  5K36 B;  4DR3 I;  3ZM7 A;  5IWA E;  2JE6 B;  2BM0 A;  4DR2 I;  4P52 A;  4PRV A;  4DV6 I;  5GME A;  4XTJ A;  4JI1 E;  3B82 A;  4JG4 A;  4LCG A;  5EL9 A;  1H74 A;  3T1H E;  4MDT A;  4IFD C;  3J81 C;  4LOM A;  5LMU I;  2ZM6 E;  1UDS A;  1S4E A;  1IBK E;  2UUB E;  5L3J A;  2EFG A;  4DV2 I;  4HAC B;  1Z59 A;  4DPU A;  1Z5C A;  3PS2 A;  5GMD A;  5JEA E;  1FJG I;  2NN6 D; 
#chains in the Genus database with same CATH homology
 4DU7 A;  1BKN A;  4I3H A;  4DUY I;  4HXZ A;  5FLX C;  4DUZ E;  3LNU A;  4HYM A;  5IT9 C;  1Z0B A;  4GKJ I;  2X7I A;  3ZKD A;  1IBM I;  1IBL I;  1H73 A;  4JI8 I;  1N32 I;  4LFB I;  1XMQ E;  5LMN E;  1Z5B A;  3K85 A;  4JI5 E;  4DR4 E;  4K0K E;  2UU9 I;  4DV7 E;  4LF8 I;  2R42 A;  4IZJ A;  2IOQ A;  1PKP A;  4YY3 E;  4JI3 E;  4DV3 I;  1N0U A;  4USM A;  1HNW E;  4DR1 I;  3HUL A;  1ZXN A;  4B3M E;  1ZM4 A;  4B3S I;  2E5L E;  2Z5C A;  2WW4 A;  4WUB A;  1N34 E;  4WUC A;  4ZVI A;  4JV5 E;  4KHP I;  4LF7 E;  1MU5 A;  3LPS A;  2J7K A;  5LL6 R;  4JI6 E;  3T1Y E;  4PU9 A;  4NXN I;  1Z0C A;  2UUC I;  4LFC E;  1N33 I;  1NZ0 A;  3LTO A;  3H4L A;  3WU6 A;  3OTO I;  2VQF E;  2UUA E;  4X65 I;  4USK A;  1HR0 E;  4MYU A;  2CZ9 A;  1FWK A;  1FKA E;  4X66 I;  3QT7 A;  1S16 A;  4LF9 E;  4B3R I;  3J80 Q;  3K17 A;  4DR6 I;  3QT8 A;  1HK7 A;  4GKK E;  3Q6N A;  3B8H A;  4R1F A;  4FWH A;  1D6T A;  1NHI A;  5IWA I;  2O1W A;  1H7S A;  4JI1 I;  2E1R A;  2UXD E;  4EMD A;  3T1H I;  1QZR A;  1A6F A;  2XEX A;  2ZM6 I;  1IBK I;  1KKH A;  1Z0V A;  2Q2E B;  2UUB I;  3F0N A;  2O1U A;  1ZM2 A;  4AQY E;  4HAC A;  1N36 E;  1USU A;  4DR5 E;  2V2Q A;  2CGE A;  2IOP A;  4DUZ I;  2PNL A;  2A2D A;  2F4V E;  3J80 C;  3J7A G;  4X62 E;  2HK2 A;  2NPF A;  4DPT A;  2PNM A;  1Y6Z A;  2UXB E;  4NXM E;  3J7A M;  1XMQ I;  3PYE A;  5LMN I;  3Q1Q A;  5A2Q C;  2GQ0 A;  1FNM A;  4JI0 E;  2OI2 A;  4JI5 I;  4JI7 E;  4DR4 I;  4K0K I;  4DV0 E;  1EI1 A;  1HNX I;  1XNQ E;  4DV7 I;  1Z0T A;  4Z7Y A;  1HNX E;  1FWL A;  1ZM9 A;  4LF6 E;  4YY3 I;  2UXC E;  1USV A;  4JI3 I;  2Z5E A;  3QT5 A;  1I94 E;  3WU4 A;  1PVG A;  4DV4 E;  4FW9 A;  3V2U C;  3WU3 A;  1HNW I;  4WUD A;  4B3T E;  1Y4U A;  1Z0W A;  4DPX A;  4JI2 E;  1J5E E;  4B3M I;  2VF3 A;  1Z5A A;  4KQV A;  2E5L I;  2HKE A;  4MYT A;  1N34 I;  1XHK A;  4JV5 I;  1ELO A;  4LF7 I;  1KVK A;  4JI6 I;  4DR7 E;  1XNR E;  3T1Y I;  4LF4 E;  4LFC I;  1H72 C;  4IZJ D;  1U2R A;  3JAM Q;  2Z5B B;  1B63 A;  2VQF I;  2UUA I;  4DV5 E;  2DEJ A;  1HR0 I;  2AJ4 A;  1ZM3 A;  4YHH E;  4LF9 I;  5BR8 E;  4DPY A;  1XMO E;  2VQE E;  2HFU A;  4FN5 A;  2GS8 A;  2LJP A;  2V2V A;  3ZZT A;  3V5R A;  4JI4 E;  3QT6 A;  1MG7 A;  3J81 Q;  4GKK I;  2A2C A;  3B78 A;  4OX9 E;  4Z7C A;  1VIS A;  4X64 E;  3M6A A;  4DPW A;  3PYD A;  2UXD I;  1KIJ A;  2HHH E;  4LF5 E;  4LFA E;  3CWV A;  1NHJ A;  1Y4S A;  4FWD A;  3ZZU A;  4IZK B;  2ZBK B;  3JAM C;  4AQY I;  1N36 I;  2V34 A;  2X36 A;  3Q6M A;  4DR5 I;  2ZIT A;  1HNZ I;  4DR3 E;  2F4V I;  4X62 I;  4DR2 E;  1HNZ E;  1Z0G A;  4DV6 E;  2UXB I;  4NXM I;  4P7A A;  1ZXM A;  1UEK A;  2DEI A;  4JI0 I;  4N3O A;  2V8P A;  4JI7 I;  4DV0 I;  5LMU E;  1XNQ I;  2CG9 A;  1RRE A;  3GON A;  1FI4 A;  4DV2 E;  4LF6 I;  4URL A;  1FJG E;  4PRX A;  2UXC I;  4DUY E;  2O1T A;  1I94 I;  1WUU A;  3D4J A;  3K1J A;  4DV4 I;  4ED4 A;  4GKJ E;  1IBM E;  3ZKB A;  1IBL E;  4B3T I;  4JI8 E;  1N32 E;  4HY1 A;  4RPF A;  5FWK A;  3PYG A;  4JI2 I;  2HKJ A;  1J5E I;  4LFB E;  2BV3 A;  1PIE A;  2UU9 E;  4UTG A;  4IZJ B;  4LF8 E;  4DR7 I;  1XNR I;  4JYA I;  4LF4 I;  4JYA E;  1N0V C;  4DV5 I;  1KTV A;  2Z5B A;  3PRY A;  1EA6 A;  1Z0E A;  1MX0 A;  4DV3 E;  1H7U A;  2R3V A;  4YHH I;  5BR8 I;  1XMO I;  4DR1 E;  2VQE I;  4DU8 A;  1NHH A;  1OJ4 A;  2V2Z A;  2BM1 A;  2Z5C B;  4JI4 I;  4B3S E;  2O1V A;  4DV1 I;  4OX9 I;  4KHP E;  4DV1 E;  4UT4 A;  4NXN E;  4X64 I;  2UUC E;  1N33 E;  1B62 A;  3P06 A;  4DXL A;  3OTO E;  1RR9 A;  4X65 E;  4FWG A;  4M1K A;  2HHH I;  4LF5 I;  4LFA I;  1K47 A;  2HK3 A;  4X66 E;  2HFS A;  5FLX Q;  4B3R E;  5IT9 Q;  3HJC A;  4DR6 E;  5A2Q Q;  4IZK A;  1DAR A;  3PYF A;  3WU5 A;  3ZZ0 A;  4DR3 I;  3ZM7 A;  5IWA E;  2BM0 A;  4DR2 I;  4P52 A;  4PRV A;  4DV6 I;  5GME A;  4XTJ A;  4JI1 E;  3B82 A;  4JG4 A;  1H74 A;  3T1H E;  3J81 C;  5LMU I;  2ZM6 E;  1S4E A;  1IBK E;  2UUB E;  5L3J A;  2EFG A;  4DV2 I;  4HAC B;  1Z59 A;  4DPU A;  1Z5C A;  5GMD A;  1FJG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...