4JI8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8I00
4DXLA 2UU9E 1K47A 2ZM6I 4JI8I 4JYAI 4HXZA 1Z0WA 4WUDA 3WU6A 4KQVA 1N0VC 2UUBE 1IBLI 1N32I 2XEXA 4DV6I 3T1HE 1Z5BA 4Z7CA 4LFAE 4LF4E 4B3MI 4URLA 1Z0BA 3J7AM 4JI1E 5GMEA 2VQEE 4JI2I 4DUYI 3PYDA 4GKJE 1ELOA 1Z0CA 5FLXQ 2AJ4A 1HNWI 4JI4E 4LF8I 4LF5E 1KKHA 4GKKI 1ZM4A 5A2QQ 2ZM6E 5BR8I 5IWAI 3B78A 4LFBI 1N36I 5LMUE 1NZ0A 2V2QA 1RR9A 4PRXA 1XMQE 3ZZTA 4DU7A 2UUCI 5IT9C 1NHJA 2VQFI 1RREA 4PRVA 4K0KE 1B63A 4JI0I 4DV5I 1I94E 4B3TI 1IBLE 1N32E 2V2VA 4DV0I 2HK3A 4DV4I 4DPXA 4ZVIA 4OX9I 2Q2EB 2A2CA 1IBME 4B3ME 3T1YE 4DV2I 1HR0I 4DPTA 3K1JA 5A2QC 4JI2E 4KHPE 2GS8A 1Z0TA 4R1FA 3WU4A 4LFCI 1Z5AA 4I3HA 4DR7I 2DEJA 4DV1I 2UXBE 2BM0A 2CZ9A 1HNXE 1S4EA 4JI3I 4RPFA 5IWAE 2E5LE 4LF6E 1NHIA 1N36E 3B8HA 4DPWA 2X7IA 2HKEA 1XMOI 2HHHI 1Z59A 2F4VE 2UUCE 1FJGE 3LPSA 4DUZI 2X36A 2VQFE 4ED4A 1Z5CA 3LNUA 4LF7I 4AQYI 4JI0E 2BM1A 4JV5E 4B3SI 3OTOI 2WW4A 3CWVA 4DU8A 4DV4E 4DV7I 4DV3I 4OX9E 1A6FA 1FNMA 2DEIA 2OI2A 1J5EE 4DR2I 4DR3I 4P52A 1Z0GA 4LF9I 1UEKA 4X64E 4LFCE 3M6AA 5LL6R 5IT9Q 4DR7E 3ZM7A 1HNZE 2NPFA 4YY3I 2EFGA 4Z7YA 1NHHA 4JI5I 1H7UA 1XHKA 3K17A 2HK2A 4FW9A 2HHHE 2V8PA 4NXNI 4MYUA 1BKNA 4JI8E 1KVKA 1N34I 4B3RI 1H72C 3GONA 3J80C 3PYGA 3OTOE 4WUCA 4X66I 4JYAE 4X65I 3WU3A 4WUBA 1ZM2A 1VISA 3JAMQ 4JI7I 4DV3E 2ZITA 2UUAI 2V2ZA 4DV6E 4X62I 4HY1A 5LMNI 1H73A 1OJ4A 2ZBKB 4YHHI 4DR6I 4HYMA 1Z0VA 4DR3E 3QT5A 4DPYA 2UU9I 1FKAE 2E1RA 1EI1A 4YY3E 4DUYE 4XTJA 4FN5A 4FWDA 4DR5I 1HNWE 1ZM9A 3JAMC 4LF8E 1H74A 4GKKE 3Q1QA 1MX0A 3PYEA 3ZZ0A 4FWHA 4UT4A 2UUBI 5GMDA 3V5RA 3T1HI 4NXNE 5BR8E 3H4LA 2HFUA 4USKA 4JI6I 1EA6A 4LFBE 4LFAI 1IBKI 4LF4I 4B3RE 3QT8A 4X65E 1KTVA 5L3JA 3ZKBA 2VQEI 1DARA 4PU9A 4JI7E 4HACA 1B62A 4DV5E 4B3TE 4GKJI 1XNQI 3WU5A 5LMNE 4DV0E 4JI4I 1ZXNA 4YHHE 4LF5I 3HULA 1U2RA 4DV2E 3F0NA 1HR0E 2J7KA 1N33I 5LMUI 4USMA 2UXCI 4DR4I 3J80Q 1XMQI 1PKPA 4DR5E 3PYFA 4K0KI 1I94I 4DV1E 1XNRI 1Z0EA 1QZRA 3J81Q 4DR1I 4JI3E 1FI4A 4EMDA 4JI6E 3J7AG 1IBKE 1IBMI 3T1YI 1XMOE 1FWLA 3D4JA 3QT6A 1MG7A 2HFSA 4DUZE 2UXDI 1N0UA 4M1KA 4LF7E 4AQYE 4NXMI 4KHPI 4B3SE 4JG4A 1XNQE 1WUUA 4DPUA 4DV7E 1FWKA 1D6TA 2UXBI 1HNXI 1H7SA 1ZXMA 3J81C 3ZKDA 2E5LI 4LF6I 1N33E 1KIJA 2UXCE 4DR4E 4DR2E 4LF9E 1PVGA 2F4VI 3V2UC 1FJGI 2BV3A 1ZM3A 2A2DA 1XNRE 4JV5I 5FLXC 4DR1E 4JI5E 1S16A 4HACB 2UXDE 4UTGA 1J5EI 1N34E 4NXME 2HKJA 4JI1I 4X66E 4X64I 1PIEA 3LTOA 4MYTA 1HNZI 4P7AA 2UUAE 2R3VA 4X62E 2V34A 3B82A 3QT7A 2VF3A 4FWGA 2R42A 4DR6E 2LJPA 3ZZUA 1MU5A
chains in the Genus database with same CATH superfamily
4DXLA 2UU9E 1K47A 3P3CA 2ZM6I 2IESA 4JI8I 4IS9A 4MU0A 4JYAI 4HXZA 1OYSA 1Z0WA 4OKGA 2CVEA 4WUDA 5JEAB 3WU6A 4KQVA 1N0VC 2C37A 2VESA 4OO1A 2UUBE 1IBLI 1N32I 2XEXA 4DV6I 3T1HE 2J65A 1Z5BA 4Z7CA 5K36E 4LFAE 2NN6A 2IOPA 4LF4E 2WNRA 4B3MI 4URLA 1Z0BA 5ELWA 3J7AM 4JI1E 5GMEA 5C0XE 2BA1D 2VQEE 1USUA 3U1KA 5DROA 2PNZB 4AIDA 4BA1B 4JI2I 3L7ZB 4DUYI 3PYDA 4GKJE 1RHYA 1ELOA 1Z0CA 4LCGA 5FLXQ 2AJ4A 5JEAF 1HNWI 4JI4E 4LF8I 1UDQA 4LF5E 1KKHA 4GKKI 2JE6A 3M7ND 1ZM4A 2Z5CB 4FW4A 5A2QQ 2ZM6E 5BR8I 5IWAI 4BA2A 3B78A 2BR2B 4LFBI 1N36I 2PNMA 5LMUE 1NZ0A 2V2QA 1RR9A 4PRXA 1XMQE 3ZZTA 4DU7A 2UUCI 2PNLA 2PO2B 5IT9C 1NHJA 2GO3A 1YH8A 2VQFI 1RREA 4PRVA 4K0KE 1B63A 4JI0I 4DV5I 1I94E 4B3TI 1Y5YA 1IBLE 1N32E 2O1UA 4AIMA 2V2VA 4DV0I 2HK3A 4DV4I 4DPXA 2O1TA 4ZVIA 4OX9I 2Q2EB 2A2CA 2Z5BA 1IBME 3T1YE 4B3ME 4DV2I 1OYPA 3GCMA 1HR0I 4DPTA 3K1JA 5A2QC 1Y60A 4JI2E 4KHPE 1HK7A 2GS8A 3U1YA 1Z0TA 3P76A 4R1FA 3WU4A 1Y4SA 4LFCI 1Z5AA 4I3HA 4IZJA 4DR7I 1R6MA 2DEJA 4DV1I 2UXBE 1OYRA 2JEBB 2BM0A 2CZ9A 1HNXE 1S4EA 4JI3I 4RPFA 5IWAE 3KRNA 2E5LE 4LF6E 1NHIA 4GQUA 1N36E 3B8HA 4DPWA 4IFDA 2X7IA 2HKEA 4N3OA 5K36D 1XMOI 2C37B 2HHHI 1Z59A 3GLLA 5DNLA 3Q6NA 2F4VE 2UUCE 2O1WA 1FJGE 3LPSA 4DUZI 2X36A 2VQFE 4ED4A 1Z5CA 3LNUA 5C0XD 1XXEA 1YHCA 4LF7I 4OO1C 4AQYI 4QNJA 4JI0E 2BM1A 4JV5E 2Z5EA 4B3SI 3OTOI 2WW4A 3HKMA 4IZKB 3CWVA 4DU8A 5K36F 2NN6C 4DV4E 4DV7I 4DV3I 4OX9E 2CG9A 5DNXA 1A6FA 5C0XF 2PO0A 1FNMA 2C39B 2DEIA 5DRRA 2JEAA 2OI2A 3P06A 1UDOA 5JEAD 1J5EE 3H1CA 1E3HA 4DR2I 4DR3I 4P52A 1Z0GA 4LF9I 4FW7A 1UEKA 4X64E 4LFCE 3M6AA 3M85D 5DRQA 5LL6R 5IT9Q 4DR7E 2O1VA 3ZM7A 1HNZE 2NPFA 4YY3I 5FWKA 4OZEA 3M85G 4OO1E 2EFGA 4Z7YA 4LCHA 1NHHA 4JI5I 1H7UA 1XHKA 2NN6E 3K17A 2HK2A 4FW9A 2HHHE 5JEAA 2V8PA 4NXNI 4MQYA 4MU4A 4MYUA 5EL9A 1BKNA 2F1DA 4JI8E 2PO1B 2IOQA 1KVKA 1N34I 4B3RI 1H72C 2BA0G 3B4TA 3UHMA 3GONA 2Z5BB 3J80C 3PYGA 4WUCA 3PS3A 3OTOE 4X66I 4JYAE 4X65I 3WU3A 4WUBA 1ZM2A 1VISA 2O3ZA 3JAMQ 4JI7I 4J3DA 4FW6A 2WP8B 4DV3E 3DD6A 2ZITA 2UUAI 2V2ZA 4DV6E 4X62I 4HY1A 4QNKA 5LMNI 1H73A 1OJ4A 2ZBKB 4YHHI 2PNZA 4DR6I 4HYMA 1Z0VA 4DR3E 2GO4A 3QT5A 4DPYA 2UU9I 1FKAE 1UDNA 2E1RA 4LPFA 2Z5CA 1EI1A 4IFDB 4YY3E 4DUYE 4XTJA 4FN5A 4MU3A 2BR2A 4FWDA 4DR5I 1HNWE 1ZM9A 3JAMC 4IFDC 4LF8E 1H74A 4NBQA 4GKKE 3Q1QA 1MX0A 3PYEA 3ZZ0A 4FWHA 4UT4A 2UUBI 5GMDA 2IERA 3V5RA 3T1HI 2GQ0A 3K85A 4NXNE 5BR8E 3H4LA 2HFUA 4USKA 4JI6I 1EA6A 4LFBE 4LFAI 1IBKI 4LF4I 4B3RE 3HJCA 4OO1B 3QT8A 4X65E 1KTVA 5L3JA 3ZKBA 2VQEI 1DARA 4PU9A 4JI7E 2C38A 4HACA 3P3EA 1B62A 4DV5E 4B3TE 4GKJI 2NN6B 2WNRB 1XNQI 4FW5A 3WU5A 5LMNE 4DV0E 4JI4I 1ZXNA 4YHHE 4AM3A 3NZKA 4LF5I 3HULA 4IFDE 1U2RA 4DV2E 3F0NA 2NN6D 1HR0E 5K36A 2J7KA 3CDJA 1N33I 5LMUI 4USMA 2UXCI 2JEBA 4DR4I 3J80Q 4OO1F 1XMQI 2JE6B 1R6LA 1PKPA 5C0XA 4DR5E 3PYFA 4BA2B 4K0KI 2NN6F 1I94I 4U3BA 4DV1E 1XNRI 1Z0EA 1QZRA 5JEAC 3J81Q 4DR1I 4JI3E 1FI4A 1UDSA 4EMDA 4JI6E 3J7AG 3CDIA 1IBKE 4FW3A 1IBMI 3T1YI 1XMOE 1FWLA 3D4JA 4IZKA 2BA0D 1MG7A 3QT6A 2AE8A 2HFSA 4DUZE 2UXDI 4LOMA 2JT2A 1N0UA 4M1KA 4LF7E 4AQYE 4NXMI 3PS1A 2BA1G 4KHPI 4B3SE 4JG4A 1XNQE 2C39A 1Y4UA 1WUUA 4U3DA 1Y6ZA 4DPUA 1E3PA 4DV7E 4MU1A 2CGEA 1FWKA 1D6TA 2UXBI 3Q6MA 1HNXI 1H7SA 1ZXMA 3J81C 3ZKDA 5JEAE 2E5LI 4LF6I 3M7NG 3PS2A 4BA1A 1N33E 1KIJA 3L7ZA 4IZJB 2UXCE 4DR4E 3GMEA 4DR2E 4LF9E 1PVGA 2F4VI 3V2UC 1FJGI 2BV3A 1ZM3A 5EKWA 2A2DA 1XNRE 4JV5I 4IZJD 5FLXC 4DR1E 2PO1A 3P3GA 4JI5E 5DRPA 2C38B 1S16A 4HACB 4MDTA 4IFDD 2PO2A 2WP8A 2UXDE 1P42A 4UTGA 4ISAA 1J5EI 1N34E 4NXME 2HKJA 4JI1I 4X66E 3PRYA 4LCFA 1VI7A 4X64I 1PIEA 2PO0B 3LTOA 4MYTA 5K36B 2JEAB 1HNZI 4IFDF 4P7AA 2UUAE 2R3VA 5K36C 4X62E 5C0XB 2V34A 4OO1D 3B82A 3QT7A 2VF3A 4FWGA 2R42A 1USVA 4DR6E 2LJPA 3ZZUA 5C0XC 1MU5A
chains in the Genus database with same CATH topology
4DXLA 2UU9E 1K47A 2ZM6I 4JI8I 4JYAI 4HXZA 1Z0WA 4WUDA 3WU6A 4KQVA 1N0VC 2UUBE 1IBLI 1N32I 2XEXA 4DV6I 3T1HE 1Z5BA 4Z7CA 4LFAE 2IOPA 4LF4E 4B3MI 4URLA 1Z0BA 3J7AM 4JI1E 5GMEA 2VQEE 1USUA 4JI2I 4DUYI 3PYDA 4GKJE 1ELOA 1Z0CA 5FLXQ 2AJ4A 1HNWI 4JI4E 4LF8I 4LF5E 1KKHA 4GKKI 1ZM4A 2Z5CB 5A2QQ 2ZM6E 5BR8I 5IWAI 3B78A 4LFBI 1N36I 2PNMA 5LMUE 1NZ0A 2V2QA 1RR9A 4PRXA 1XMQE 3ZZTA 4DU7A 2UUCI 2PNLA 5IT9C 1NHJA 2VQFI 1RREA 4PRVA 4K0KE 1B63A 4JI0I 4DV5I 1I94E 4B3TI 1IBLE 1N32E 2O1UA 2V2VA 4DV0I 2HK3A 4DV4I 4DPXA 2O1TA 4ZVIA 4OX9I 2Q2EB 2A2CA 2Z5BA 1IBME 3T1YE 4B3ME 4DV2I 1HR0I 4DPTA 3K1JA 5A2QC 4JI2E 4KHPE 1HK7A 2GS8A 1Z0TA 4R1FA 3WU4A 1Y4SA 4LFCI 1Z5AA 4I3HA 4IZJA 4DR7I 2DEJA 4DV1I 2UXBE 2BM0A 2CZ9A 1HNXE 1S4EA 4JI3I 4RPFA 5IWAE 2E5LE 4LF6E 1NHIA 1N36E 3B8HA 4DPWA 2X7IA 2HKEA 4N3OA 1XMOI 2HHHI 1Z59A 3Q6NA 2F4VE 2UUCE 2O1WA 1FJGE 3LPSA 4DUZI 2X36A 2VQFE 4ED4A 1Z5CA 3LNUA 4LF7I 4AQYI 4JI0E 2BM1A 4JV5E 2Z5EA 4B3SI 3OTOI 2WW4A 4IZKB 3CWVA 4DU8A 4DV4E 4DV7I 4DV3I 4OX9E 2CG9A 1A6FA 1FNMA 2DEIA 2OI2A 3P06A 1J5EE 4DR2I 4DR3I 4P52A 1Z0GA 4LF9I 1UEKA 4X64E 4LFCE 3M6AA 5LL6R 5IT9Q 4DR7E 2O1VA 3ZM7A 1HNZE 2NPFA 4YY3I 5FWKA 2EFGA 4Z7YA 1NHHA 4JI5I 1H7UA 1XHKA 3K17A 2HK2A 4FW9A 2HHHE 2V8PA 4NXNI 4MYUA 1BKNA 4JI8E 2IOQA 1KVKA 1N34I 4B3RI 1H72C 3GONA 3J80C 2Z5BB 3PYGA 3OTOE 4WUCA 4X66I 4JYAE 4X65I 3WU3A 4WUBA 1ZM2A 1VISA 3JAMQ 4JI7I 4DV3E 2ZITA 2UUAI 2V2ZA 4DV6E 4X62I 4HY1A 5LMNI 1H73A 1OJ4A 2ZBKB 4YHHI 4DR6I 4HYMA 1Z0VA 4DR3E 3QT5A 4DPYA 2UU9I 1FKAE 2E1RA 2Z5CA 1EI1A 4YY3E 4DUYE 4XTJA 4FN5A 4FWDA 4DR5I 1HNWE 1ZM9A 3JAMC 4LF8E 1H74A 4GKKE 3Q1QA 1MX0A 3PYEA 3ZZ0A 4FWHA 4UT4A 2UUBI 5GMDA 3V5RA 3T1HI 2GQ0A 3K85A 4NXNE 5BR8E 3H4LA 2HFUA 4USKA 4JI6I 1EA6A 4LFBE 4LFAI 1IBKI 4LF4I 4B3RE 3HJCA 3QT8A 4X65E 1KTVA 5L3JA 3ZKBA 2VQEI 1DARA 4PU9A 4JI7E 4HACA 1B62A 4DV5E 4B3TE 4GKJI 1XNQI 3WU5A 5LMNE 4DV0E 4JI4I 1ZXNA 4YHHE 4LF5I 3HULA 1U2RA 4DV2E 3F0NA 1HR0E 2J7KA 1N33I 5LMUI 4USMA 2UXCI 4DR4I 3J80Q 1XMQI 1PKPA 4DR5E 3PYFA 4K0KI 1I94I 4DV1E 1XNRI 1Z0EA 1QZRA 3J81Q 4DR1I 4JI3E 1FI4A 4EMDA 4JI6E 3J7AG 1IBKE 1IBMI 3T1YI 1XMOE 1FWLA 3D4JA 4IZKA 3QT6A 1MG7A 2HFSA 4DUZE 2UXDI 1N0UA 4M1KA 4LF7E 4AQYE 4NXMI 4KHPI 4B3SE 4JG4A 1XNQE 1Y4UA 1WUUA 1Y6ZA 4DPUA 4DV7E 2CGEA 1FWKA 1D6TA 2UXBI 3Q6MA 1HNXI 1H7SA 1ZXMA 3J81C 3ZKDA 2E5LI 4LF6I 1N33E 1KIJA 2UXCE 4IZJB 4DR4E 4DR2E 4LF9E 1PVGA 2F4VI 3V2UC 1FJGI 2BV3A 1ZM3A 2A2DA 1XNRE 4JV5I 4IZJD 5FLXC 4DR1E 4JI5E 1S16A 4HACB 2UXDE 4UTGA 1J5EI 1N34E 4NXME 2HKJA 4JI1I 4X66E 3PRYA 4X64I 1PIEA 3LTOA 4MYTA 1HNZI 4P7AA 2UUAE 2R3VA 4X62E 2V34A 3B82A 3QT7A 2VF3A 4FWGA 2R42A 1USVA 4DR6E 2LJPA 3ZZUA 1MU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXL A;  2UU9 E;  1K47 A;  2ZM6 I;  4JI8 I;  4JYA I;  4HXZ A;  1Z0W A;  4WUD A;  3WU6 A;  4KQV A;  1N0V C;  2UUB E;  1IBL I;  1N32 I;  2XEX A;  4DV6 I;  3T1H E;  1Z5B A;  4Z7C A;  4LFA E;  4LF4 E;  4B3M I;  4URL A;  1Z0B A;  3J7A M;  4JI1 E;  5GME A;  2VQE E;  4JI2 I;  4DUY I;  3PYD A;  4GKJ E;  1ELO A;  1Z0C A;  5FLX Q;  2AJ4 A;  1HNW I;  4JI4 E;  4LF8 I;  4LF5 E;  1KKH A;  4GKK I;  1ZM4 A;  5A2Q Q;  2ZM6 E;  5BR8 I;  5IWA I;  3B78 A;  4LFB I;  1N36 I;  5LMU E;  1NZ0 A;  2V2Q A;  1RR9 A;  4PRX A;  1XMQ E;  3ZZT A;  4DU7 A;  2UUC I;  5IT9 C;  1NHJ A;  2VQF I;  1RRE A;  4PRV A;  4K0K E;  1B63 A;  4JI0 I;  4DV5 I;  1I94 E;  4B3T I;  1IBL E;  1N32 E;  2V2V A;  4DV0 I;  2HK3 A;  4DV4 I;  4DPX A;  4ZVI A;  4OX9 I;  2Q2E B;  2A2C A;  1IBM E;  4B3M E;  3T1Y E;  4DV2 I;  1HR0 I;  4DPT A;  3K1J A;  5A2Q C;  4JI2 E;  4KHP E;  2GS8 A;  1Z0T A;  4R1F A;  3WU4 A;  4LFC I;  1Z5A A;  4I3H A;  4DR7 I;  2DEJ A;  4DV1 I;  2UXB E;  2BM0 A;  2CZ9 A;  1HNX E;  1S4E A;  4JI3 I;  4RPF A;  5IWA E;  2E5L E;  4LF6 E;  1NHI A;  1N36 E;  3B8H A;  4DPW A;  2X7I A;  2HKE A;  1XMO I;  2HHH I;  1Z59 A;  2F4V E;  2UUC E;  1FJG E;  3LPS A;  4DUZ I;  2X36 A;  2VQF E;  4ED4 A;  1Z5C A;  3LNU A;  4LF7 I;  4AQY I;  4JI0 E;  2BM1 A;  4JV5 E;  4B3S I;  3OTO I;  2WW4 A;  3CWV A;  4DU8 A;  4DV4 E;  4DV7 I;  4DV3 I;  4OX9 E;  1A6F A;  1FNM A;  2DEI A;  2OI2 A;  1J5E E;  4DR2 I;  4DR3 I;  4P52 A;  1Z0G A;  4LF9 I;  1UEK A;  4X64 E;  4LFC E;  3M6A A;  5LL6 R;  5IT9 Q;  4DR7 E;  3ZM7 A;  1HNZ E;  2NPF A;  4YY3 I;  2EFG A;  4Z7Y A;  1NHH A;  4JI5 I;  1H7U A;  1XHK A;  3K17 A;  2HK2 A;  4FW9 A;  2HHH E;  2V8P A;  4NXN I;  4MYU A;  1BKN A;  4JI8 E;  1KVK A;  1N34 I;  4B3R I;  1H72 C;  3GON A;  3J80 C;  3PYG A;  3OTO E;  4WUC A;  4X66 I;  4JYA E;  4X65 I;  3WU3 A;  4WUB A;  1ZM2 A;  1VIS A;  3JAM Q;  4JI7 I;  4DV3 E;  2ZIT A;  2UUA I;  2V2Z A;  4DV6 E;  4X62 I;  4HY1 A;  5LMN I;  1H73 A;  1OJ4 A;  2ZBK B;  4YHH I;  4DR6 I;  4HYM A;  1Z0V A;  4DR3 E;  3QT5 A;  4DPY A;  2UU9 I;  1FKA E;  2E1R A;  1EI1 A;  4YY3 E;  4DUY E;  4XTJ A;  4FN5 A;  4FWD A;  4DR5 I;  1HNW E;  1ZM9 A;  3JAM C;  4LF8 E;  1H74 A;  4GKK E;  3Q1Q A;  1MX0 A;  3PYE A;  3ZZ0 A;  4FWH A;  4UT4 A;  2UUB I;  5GMD A;  3V5R A;  3T1H I;  4NXN E;  5BR8 E;  3H4L A;  2HFU A;  4USK A;  4JI6 I;  1EA6 A;  4LFB E;  4LFA I;  1IBK I;  4LF4 I;  4B3R E;  3QT8 A;  4X65 E;  1KTV A;  5L3J A;  3ZKB A;  2VQE I;  1DAR A;  4PU9 A;  4JI7 E;  4HAC A;  1B62 A;  4DV5 E;  4B3T E;  4GKJ I;  1XNQ I;  3WU5 A;  5LMN E;  4DV0 E;  4JI4 I;  1ZXN A;  4YHH E;  4LF5 I;  3HUL A;  1U2R A;  4DV2 E;  3F0N A;  1HR0 E;  2J7K A;  1N33 I;  5LMU I;  4USM A;  2UXC I;  4DR4 I;  3J80 Q;  1XMQ I;  1PKP A;  4DR5 E;  3PYF A;  4K0K I;  1I94 I;  4DV1 E;  1XNR I;  1Z0E A;  1QZR A;  3J81 Q;  4DR1 I;  4JI3 E;  1FI4 A;  4EMD A;  4JI6 E;  3J7A G;  1IBK E;  1IBM I;  3T1Y I;  1XMO E;  1FWL A;  3D4J A;  3QT6 A;  1MG7 A;  2HFS A;  4DUZ E;  2UXD I;  1N0U A;  4M1K A;  4LF7 E;  4AQY E;  4NXM I;  4KHP I;  4B3S E;  4JG4 A;  1XNQ E;  1WUU A;  4DPU A;  4DV7 E;  1FWK A;  1D6T A;  2UXB I;  1HNX I;  1H7S A;  1ZXM A;  3J81 C;  3ZKD A;  2E5L I;  4LF6 I;  1N33 E;  1KIJ A;  2UXC E;  4DR4 E;  4DR2 E;  4LF9 E;  1PVG A;  2F4V I;  3V2U C;  1FJG I;  2BV3 A;  1ZM3 A;  2A2D A;  1XNR E;  4JV5 I;  5FLX C;  4DR1 E;  4JI5 E;  1S16 A;  4HAC B;  2UXD E;  4UTG A;  1J5E I;  1N34 E;  4NXM E;  2HKJ A;  4JI1 I;  4X66 E;  4X64 I;  1PIE A;  3LTO A;  4MYT A;  1HNZ I;  4P7A A;  2UUA E;  2R3V A;  4X62 E;  2V34 A;  3B82 A;  3QT7 A;  2VF3 A;  4FWG A;  2R42 A;  4DR6 E;  2LJP A;  3ZZU A;  1MU5 A; 
#chains in the Genus database with same CATH topology
 4DXL A;  2UU9 E;  1K47 A;  3P3C A;  2ZM6 I;  2IES A;  4JI8 I;  4IS9 A;  4MU0 A;  4JYA I;  4HXZ A;  1OYS A;  1Z0W A;  4OKG A;  2CVE A;  4WUD A;  5JEA B;  3WU6 A;  4KQV A;  1N0V C;  2C37 A;  2VES A;  4OO1 A;  2UUB E;  1IBL I;  1N32 I;  2XEX A;  4DV6 I;  3T1H E;  2J65 A;  1Z5B A;  4Z7C A;  5K36 E;  4LFA E;  2NN6 A;  2IOP A;  4LF4 E;  2WNR A;  4B3M I;  4URL A;  1Z0B A;  5ELW A;  3J7A M;  4JI1 E;  5GME A;  5C0X E;  2BA1 D;  2VQE E;  1USU A;  3U1K A;  5DRO A;  2PNZ B;  4AID A;  4BA1 B;  4JI2 I;  3L7Z B;  4DUY I;  3PYD A;  4GKJ E;  1RHY A;  1ELO A;  1Z0C A;  4LCG A;  5FLX Q;  2AJ4 A;  5JEA F;  1HNW I;  4JI4 E;  4LF8 I;  1UDQ A;  4LF5 E;  1KKH A;  4GKK I;  2JE6 A;  3M7N D;  1ZM4 A;  2Z5C B;  4FW4 A;  5A2Q Q;  2ZM6 E;  5BR8 I;  5IWA I;  4BA2 A;  3B78 A;  2BR2 B;  4LFB I;  1N36 I;  2PNM A;  5LMU E;  1NZ0 A;  2V2Q A;  1RR9 A;  4PRX A;  1XMQ E;  3ZZT A;  4DU7 A;  2UUC I;  2PNL A;  2PO2 B;  5IT9 C;  1NHJ A;  2GO3 A;  1YH8 A;  2VQF I;  1RRE A;  4PRV A;  4K0K E;  1B63 A;  4JI0 I;  4DV5 I;  1I94 E;  4B3T I;  1Y5Y A;  1IBL E;  1N32 E;  2O1U A;  4AIM A;  2V2V A;  4DV0 I;  2HK3 A;  4DV4 I;  4DPX A;  2O1T A;  4ZVI A;  4OX9 I;  2Q2E B;  2A2C A;  2Z5B A;  1IBM E;  3T1Y E;  4B3M E;  4DV2 I;  1OYP A;  3GCM A;  1HR0 I;  4DPT A;  3K1J A;  5A2Q C;  1Y60 A;  4JI2 E;  4KHP E;  1HK7 A;  2GS8 A;  3U1Y A;  1Z0T A;  3P76 A;  4R1F A;  3WU4 A;  1Y4S A;  4LFC I;  1Z5A A;  4I3H A;  4IZJ A;  4DR7 I;  1R6M A;  2DEJ A;  4DV1 I;  2UXB E;  1OYR A;  2JEB B;  2BM0 A;  2CZ9 A;  1HNX E;  1S4E A;  4JI3 I;  4RPF A;  5IWA E;  3KRN A;  2E5L E;  4LF6 E;  1NHI A;  4GQU A;  1N36 E;  3B8H A;  4DPW A;  4IFD A;  2X7I A;  2HKE A;  4N3O A;  5K36 D;  1XMO I;  2C37 B;  2HHH I;  1Z59 A;  3GLL A;  5DNL A;  3Q6N A;  2F4V E;  2UUC E;  2O1W A;  1FJG E;  3LPS A;  4DUZ I;  2X36 A;  2VQF E;  4ED4 A;  1Z5C A;  3LNU A;  5C0X D;  1XXE A;  1YHC A;  4LF7 I;  4OO1 C;  4AQY I;  4QNJ A;  4JI0 E;  2BM1 A;  4JV5 E;  2Z5E A;  4B3S I;  3OTO I;  2WW4 A;  3HKM A;  4IZK B;  3CWV A;  4DU8 A;  5K36 F;  2NN6 C;  4DV4 E;  4DV7 I;  4DV3 I;  4OX9 E;  2CG9 A;  5DNX A;  1A6F A;  5C0X F;  2PO0 A;  1FNM A;  2C39 B;  2DEI A;  5DRR A;  2JEA A;  2OI2 A;  3P06 A;  1UDO A;  5JEA D;  1J5E E;  3H1C A;  1E3H A;  4DR2 I;  4DR3 I;  4P52 A;  1Z0G A;  4LF9 I;  4FW7 A;  1UEK A;  4X64 E;  4LFC E;  3M6A A;  3M85 D;  5DRQ A;  5LL6 R;  5IT9 Q;  4DR7 E;  2O1V A;  3ZM7 A;  1HNZ E;  2NPF A;  4YY3 I;  5FWK A;  4OZE A;  3M85 G;  4OO1 E;  2EFG A;  4Z7Y A;  4LCH A;  1NHH A;  4JI5 I;  1H7U A;  1XHK A;  2NN6 E;  3K17 A;  2HK2 A;  4FW9 A;  2HHH E;  5JEA A;  2V8P A;  4NXN I;  4MQY A;  4MU4 A;  4MYU A;  5EL9 A;  1BKN A;  2F1D A;  4JI8 E;  2PO1 B;  2IOQ A;  1KVK A;  1N34 I;  4B3R I;  1H72 C;  2BA0 G;  3B4T A;  3UHM A;  3GON A;  2Z5B B;  3J80 C;  3PYG A;  4WUC A;  3PS3 A;  3OTO E;  4X66 I;  4JYA E;  4X65 I;  3WU3 A;  4WUB A;  1ZM2 A;  1VIS A;  2O3Z A;  3JAM Q;  4JI7 I;  4J3D A;  4FW6 A;  2WP8 B;  4DV3 E;  3DD6 A;  2ZIT A;  2UUA I;  2V2Z A;  4DV6 E;  4X62 I;  4HY1 A;  4QNK A;  5LMN I;  1H73 A;  1OJ4 A;  2ZBK B;  4YHH I;  2PNZ A;  4DR6 I;  4HYM A;  1Z0V A;  4DR3 E;  2GO4 A;  3QT5 A;  4DPY A;  2UU9 I;  1FKA E;  1UDN A;  2E1R A;  4LPF A;  2Z5C A;  1EI1 A;  4IFD B;  4YY3 E;  4DUY E;  4XTJ A;  4FN5 A;  4MU3 A;  2BR2 A;  4FWD A;  4DR5 I;  1HNW E;  1ZM9 A;  3JAM C;  4IFD C;  4LF8 E;  1H74 A;  4NBQ A;  4GKK E;  3Q1Q A;  1MX0 A;  3PYE A;  3ZZ0 A;  4FWH A;  4UT4 A;  2UUB I;  5GMD A;  2IER A;  3V5R A;  3T1H I;  2GQ0 A;  3K85 A;  4NXN E;  5BR8 E;  3H4L A;  2HFU A;  4USK A;  4JI6 I;  1EA6 A;  4LFB E;  4LFA I;  1IBK I;  4LF4 I;  4B3R E;  3HJC A;  4OO1 B;  3QT8 A;  4X65 E;  1KTV A;  5L3J A;  3ZKB A;  2VQE I;  1DAR A;  4PU9 A;  4JI7 E;  2C38 A;  4HAC A;  3P3E A;  1B62 A;  4DV5 E;  4B3T E;  4GKJ I;  2NN6 B;  2WNR B;  1XNQ I;  4FW5 A;  3WU5 A;  5LMN E;  4DV0 E;  4JI4 I;  1ZXN A;  4YHH E;  4AM3 A;  3NZK A;  4LF5 I;  3HUL A;  4IFD E;  1U2R A;  4DV2 E;  3F0N A;  2NN6 D;  1HR0 E;  5K36 A;  2J7K A;  3CDJ A;  1N33 I;  5LMU I;  4USM A;  2UXC I;  2JEB A;  4DR4 I;  3J80 Q;  4OO1 F;  1XMQ I;  2JE6 B;  1R6L A;  1PKP A;  5C0X A;  4DR5 E;  3PYF A;  4BA2 B;  4K0K I;  2NN6 F;  1I94 I;  4U3B A;  4DV1 E;  1XNR I;  1Z0E A;  1QZR A;  5JEA C;  3J81 Q;  4DR1 I;  4JI3 E;  1FI4 A;  1UDS A;  4EMD A;  4JI6 E;  3J7A G;  3CDI A;  1IBK E;  4FW3 A;  1IBM I;  3T1Y I;  1XMO E;  1FWL A;  3D4J A;  4IZK A;  2BA0 D;  1MG7 A;  3QT6 A;  2AE8 A;  2HFS A;  4DUZ E;  2UXD I;  4LOM A;  2JT2 A;  1N0U A;  4M1K A;  4LF7 E;  4AQY E;  4NXM I;  3PS1 A;  2BA1 G;  4KHP I;  4B3S E;  4JG4 A;  1XNQ E;  2C39 A;  1Y4U A;  1WUU A;  4U3D A;  1Y6Z A;  4DPU A;  1E3P A;  4DV7 E;  4MU1 A;  2CGE A;  1FWK A;  1D6T A;  2UXB I;  3Q6M A;  1HNX I;  1H7S A;  1ZXM A;  3J81 C;  3ZKD A;  5JEA E;  2E5L I;  4LF6 I;  3M7N G;  3PS2 A;  4BA1 A;  1N33 E;  1KIJ A;  3L7Z A;  4IZJ B;  2UXC E;  4DR4 E;  3GME A;  4DR2 E;  4LF9 E;  1PVG A;  2F4V I;  3V2U C;  1FJG I;  2BV3 A;  1ZM3 A;  5EKW A;  2A2D A;  1XNR E;  4JV5 I;  4IZJ D;  5FLX C;  4DR1 E;  2PO1 A;  3P3G A;  4JI5 E;  5DRP A;  2C38 B;  1S16 A;  4HAC B;  4MDT A;  4IFD D;  2PO2 A;  2WP8 A;  2UXD E;  1P42 A;  4UTG A;  4ISA A;  1J5E I;  1N34 E;  4NXM E;  2HKJ A;  4JI1 I;  4X66 E;  3PRY A;  4LCF A;  1VI7 A;  4X64 I;  1PIE A;  2PO0 B;  3LTO A;  4MYT A;  5K36 B;  2JEA B;  1HNZ I;  4IFD F;  4P7A A;  2UUA E;  2R3V A;  5K36 C;  4X62 E;  5C0X B;  2V34 A;  4OO1 D;  3B82 A;  3QT7 A;  2VF3 A;  4FWG A;  2R42 A;  1USV A;  4DR6 E;  2LJP A;  3ZZU A;  5C0X C;  1MU5 A; 
#chains in the Genus database with same CATH homology
 4DXL A;  2UU9 E;  1K47 A;  2ZM6 I;  4JI8 I;  4JYA I;  4HXZ A;  1Z0W A;  4WUD A;  3WU6 A;  4KQV A;  1N0V C;  2UUB E;  1IBL I;  1N32 I;  2XEX A;  4DV6 I;  3T1H E;  1Z5B A;  4Z7C A;  4LFA E;  2IOP A;  4LF4 E;  4B3M I;  4URL A;  1Z0B A;  3J7A M;  4JI1 E;  5GME A;  2VQE E;  1USU A;  4JI2 I;  4DUY I;  3PYD A;  4GKJ E;  1ELO A;  1Z0C A;  5FLX Q;  2AJ4 A;  1HNW I;  4JI4 E;  4LF8 I;  4LF5 E;  1KKH A;  4GKK I;  1ZM4 A;  2Z5C B;  5A2Q Q;  2ZM6 E;  5BR8 I;  5IWA I;  3B78 A;  4LFB I;  1N36 I;  2PNM A;  5LMU E;  1NZ0 A;  2V2Q A;  1RR9 A;  4PRX A;  1XMQ E;  3ZZT A;  4DU7 A;  2UUC I;  2PNL A;  5IT9 C;  1NHJ A;  2VQF I;  1RRE A;  4PRV A;  4K0K E;  1B63 A;  4JI0 I;  4DV5 I;  1I94 E;  4B3T I;  1IBL E;  1N32 E;  2O1U A;  2V2V A;  4DV0 I;  2HK3 A;  4DV4 I;  4DPX A;  2O1T A;  4ZVI A;  4OX9 I;  2Q2E B;  2A2C A;  2Z5B A;  1IBM E;  3T1Y E;  4B3M E;  4DV2 I;  1HR0 I;  4DPT A;  3K1J A;  5A2Q C;  4JI2 E;  4KHP E;  1HK7 A;  2GS8 A;  1Z0T A;  4R1F A;  3WU4 A;  1Y4S A;  4LFC I;  1Z5A A;  4I3H A;  4IZJ A;  4DR7 I;  2DEJ A;  4DV1 I;  2UXB E;  2BM0 A;  2CZ9 A;  1HNX E;  1S4E A;  4JI3 I;  4RPF A;  5IWA E;  2E5L E;  4LF6 E;  1NHI A;  1N36 E;  3B8H A;  4DPW A;  2X7I A;  2HKE A;  4N3O A;  1XMO I;  2HHH I;  1Z59 A;  3Q6N A;  2F4V E;  2UUC E;  2O1W A;  1FJG E;  3LPS A;  4DUZ I;  2X36 A;  2VQF E;  4ED4 A;  1Z5C A;  3LNU A;  4LF7 I;  4AQY I;  4JI0 E;  2BM1 A;  4JV5 E;  2Z5E A;  4B3S I;  3OTO I;  2WW4 A;  4IZK B;  3CWV A;  4DU8 A;  4DV4 E;  4DV7 I;  4DV3 I;  4OX9 E;  2CG9 A;  1A6F A;  1FNM A;  2DEI A;  2OI2 A;  3P06 A;  1J5E E;  4DR2 I;  4DR3 I;  4P52 A;  1Z0G A;  4LF9 I;  1UEK A;  4X64 E;  4LFC E;  3M6A A;  5LL6 R;  5IT9 Q;  4DR7 E;  2O1V A;  3ZM7 A;  1HNZ E;  2NPF A;  4YY3 I;  5FWK A;  2EFG A;  4Z7Y A;  1NHH A;  4JI5 I;  1H7U A;  1XHK A;  3K17 A;  2HK2 A;  4FW9 A;  2HHH E;  2V8P A;  4NXN I;  4MYU A;  1BKN A;  4JI8 E;  2IOQ A;  1KVK A;  1N34 I;  4B3R I;  1H72 C;  3GON A;  3J80 C;  2Z5B B;  3PYG A;  3OTO E;  4WUC A;  4X66 I;  4JYA E;  4X65 I;  3WU3 A;  4WUB A;  1ZM2 A;  1VIS A;  3JAM Q;  4JI7 I;  4DV3 E;  2ZIT A;  2UUA I;  2V2Z A;  4DV6 E;  4X62 I;  4HY1 A;  5LMN I;  1H73 A;  1OJ4 A;  2ZBK B;  4YHH I;  4DR6 I;  4HYM A;  1Z0V A;  4DR3 E;  3QT5 A;  4DPY A;  2UU9 I;  1FKA E;  2E1R A;  2Z5C A;  1EI1 A;  4YY3 E;  4DUY E;  4XTJ A;  4FN5 A;  4FWD A;  4DR5 I;  1HNW E;  1ZM9 A;  3JAM C;  4LF8 E;  1H74 A;  4GKK E;  3Q1Q A;  1MX0 A;  3PYE A;  3ZZ0 A;  4FWH A;  4UT4 A;  2UUB I;  5GMD A;  3V5R A;  3T1H I;  2GQ0 A;  3K85 A;  4NXN E;  5BR8 E;  3H4L A;  2HFU A;  4USK A;  4JI6 I;  1EA6 A;  4LFB E;  4LFA I;  1IBK I;  4LF4 I;  4B3R E;  3HJC A;  3QT8 A;  4X65 E;  1KTV A;  5L3J A;  3ZKB A;  2VQE I;  1DAR A;  4PU9 A;  4JI7 E;  4HAC A;  1B62 A;  4DV5 E;  4B3T E;  4GKJ I;  1XNQ I;  3WU5 A;  5LMN E;  4DV0 E;  4JI4 I;  1ZXN A;  4YHH E;  4LF5 I;  3HUL A;  1U2R A;  4DV2 E;  3F0N A;  1HR0 E;  2J7K A;  1N33 I;  5LMU I;  4USM A;  2UXC I;  4DR4 I;  3J80 Q;  1XMQ I;  1PKP A;  4DR5 E;  3PYF A;  4K0K I;  1I94 I;  4DV1 E;  1XNR I;  1Z0E A;  1QZR A;  3J81 Q;  4DR1 I;  4JI3 E;  1FI4 A;  4EMD A;  4JI6 E;  3J7A G;  1IBK E;  1IBM I;  3T1Y I;  1XMO E;  1FWL A;  3D4J A;  4IZK A;  3QT6 A;  1MG7 A;  2HFS A;  4DUZ E;  2UXD I;  1N0U A;  4M1K A;  4LF7 E;  4AQY E;  4NXM I;  4KHP I;  4B3S E;  4JG4 A;  1XNQ E;  1Y4U A;  1WUU A;  1Y6Z A;  4DPU A;  4DV7 E;  2CGE A;  1FWK A;  1D6T A;  2UXB I;  3Q6M A;  1HNX I;  1H7S A;  1ZXM A;  3J81 C;  3ZKD A;  2E5L I;  4LF6 I;  1N33 E;  1KIJ A;  2UXC E;  4IZJ B;  4DR4 E;  4DR2 E;  4LF9 E;  1PVG A;  2F4V I;  3V2U C;  1FJG I;  2BV3 A;  1ZM3 A;  2A2D A;  1XNR E;  4JV5 I;  4IZJ D;  5FLX C;  4DR1 E;  4JI5 E;  1S16 A;  4HAC B;  2UXD E;  4UTG A;  1J5E I;  1N34 E;  4NXM E;  2HKJ A;  4JI1 I;  4X66 E;  3PRY A;  4X64 I;  1PIE A;  3LTO A;  4MYT A;  1HNZ I;  4P7A A;  2UUA E;  2R3V A;  4X62 E;  2V34 A;  3B82 A;  3QT7 A;  2VF3 A;  4FWG A;  2R42 A;  1USV A;  4DR6 E;  2LJP A;  3ZZU A;  1MU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...