4JI8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8I00
3T1YI 3GONA 1H72C 1FI4A 4JV5E 3PYFA 4JI0E 4HXZA 4B3RI 4JI1I 1N33E 2BM1A 3WU4A 2HFSA 3QT6A 4GKKE 2V2QA 1Z5AA 5GMDA 4NXME 2VQEE 2F4VI 1B62A 2R42A 1J5EE 3B78A 1XMOI 2BV3A 1XMQE 4JYAE 1Z0TA 1NHIA 2HFUA 2OI2A 4JI8I 1B63A 4ZVIA 3QT8A 4DV4E 5FLXC 2R3VA 4LFAE 5IWAI 4DUZI 3H4LA 2E5LI 4YY3I 4LFBE 4DR6I 5LMUE 1N34I 4YHHE 4DV6E 3ZZUA 1KKHA 4YY3E 3T1HI 3V5RA 4DU7A 2HK3A 3QT5A 4FWGA 4RPFA 4AQYI 2V8PA 1N36I 5GMEA 2DEJA 4JYAI 5BR8I 4DPUA 4DV0E 2VF3A 4DU8A 4DR3E 4DV5I 3WU5A 1I94I 3J7AM 4DPTA 4WUBA 4DV0I 4DUYI 1EI1A 2E5LE 1K47A 1S16A 4P52A 1HNWI 1N0VC 2UXBI 4LF9E 1HNXE 4UT4A 4DR3I 1XNQI 4P7AA 1N34E 3JAMC 1N32E 4DV7E 1FKAE 1HNZI 4DV2I 2NPFA 2DEIA 4X62I 4DR2E 4JI4E 5IT9Q 4B3RE 4JI2E 2VQFI 3QT7A 4DR1E 4DR2I 4B3ME 2AJ4A 1NZ0A 1H73A 2F4VE 2VQEI 4LF6E 1PIEA 1OJ4A 2UU9I 1FJGI 3V2UC 4DR4E 4LFAI 4JI7I 4DV3E 4K0KE 3Q1QA 4JI0I 1H7SA 2UXDI 4JI7E 4MYUA 4DPWA 3T1HE 1FWKA 2WW4A 5LL6R 2V2VA 1HNXI 1U2RA 1KIJA 5A2QC 2HHHI 4FN5A 2UXCE 1ZM9A 4USMA 1UEKA 4B3SE 4JI5E 1Z59A 1RREA 1A6FA 2A2CA 1NHJA 2X7IA 3JAMQ 3LPSA 1HNZE 1H7UA 1MX0A 1DARA 2CZ9A 3K1JA 1XNQE 3ZKDA 4JI6I 2HK2A 2UXBE 1WUUA 2UXDE 4X64I 4LF8E 1MG7A 4DR5E 1Z5BA 1N33I 3B82A 4B3SI 2VQFE 2ZITA 4DR5I 1FJGE 3T1YE 1N32I 4JI6E 3WU6A 4WUCA 1IBKE 5BR8E 4DPXA 4URLA 3WU3A 1RR9A 4JI2I 1KTVA 3PYDA 4JI4I 1Z0VA 2V34A 2X36A 4X62E 1ZM4A 4LF8I 1J5EI 1ZM2A 4FWDA 4WUDA 4GKJE 4LF4I 5LMUI 4GKKI 3J7AG 1VISA 4DUZE 3PYGA 4JI5I 1QZRA 1PVGA 4EMDA 5FLXQ 1IBLE 2UUBE 4MYTA 4AQYE 5A2QQ 4HACB 2UUCI 4JG4A 4LFCE 1BKNA 4PU9A 4LF6I 2J7KA 3ZZTA 4PRVA 4X66I 1H74A 4LF7E 4LFBI 4KQVA 1NHHA 4Z7YA 4KHPE 2XEXA 3J80Q 4DV1E 1XHKA 4JV5I 1XNRE 5L3JA 3OTOI 1EA6A 3B8HA 4DV7I 4NXNE 1PKPA 4DR6E 1N0UA 4HY1A 4X65I 3ZM7A 4B3TI 4NXNI 4JI3I 3PYEA 1ELOA 5IT9C 1KVKA 1N36E 4K0KI 1HR0I 3J81C 4JI8E 4JI3E 4KHPI 2UXCI 2A2DA 2ZM6E 2UUAE 4LF5E 4HACA 4DR7E 1IBME 4DPYA 4YHHI 3ZKBA 2UUAI 4Z7CA 3CWVA 1HNWE 4I3HA 3ZZ0A 1FWLA 2GS8A 1Z0WA 2HKJA 4DV3I 2HKEA 4DV2E 4X64E 4ED4A 2BM0A 1D6TA 2UU9E 4UTGA 1Z0EA 4NXMI 4DV6I 1Z5CA 4LF9I 4LFCI 2UUCE 2ZBKB 4R1FA 2V2ZA 5IWAE 4JI1E 4DR1I 4XTJA 4FW9A 1HR0E 4DUYE 2HHHE 3M6AA 4GKJI 4HYMA 4OX9E 4DV5E 1I94E 3F0NA 1S4EA 4DR7I 4X66E 5LMNE 2E1RA 4DXLA 1ZXMA 1XNRI 1IBLI 1FNMA 2UUBI 3K17A 1Z0BA 4M1KA 3LNUA 2EFGA 1IBKI 4B3TE 4LF7I 3D4JA 1ZM3A 1ZXNA 4USKA 1IBMI 2ZM6I 4LF5I 4FWHA 3J80C 4B3MI 3J81Q 3OTOE 4DV4I 1Z0CA 4DV1I 2Q2EB 3HULA 5LMNI 1XMOE 1Z0GA 1XMQI 4DR4I 4X65E 2LJPA 4LF4E 4PRXA 4OX9I 3LTOA 1MU5A
chains in the Genus database with same CATH superfamily
3T1YI 3GONA 2BA1D 1H72C 1FI4A 4JV5E 3PYFA 4JI0E 4HXZA 2O1VA 4B3RI 4JI1I 1N33E 2PO2B 4IZKB 1R6LA 2BM1A 3WU4A 2HFSA 2PNZA 3QT6A 4GKKE 4GQUA 4U3BA 2V2QA 2WP8A 5C0XE 2J65A 1Z5AA 5GMDA 4NXME 2VQEE 2F4VI 4ISAA 1B62A 5JEAA 2PNZB 1HK7A 3GLLA 2JEAB 2R42A 1J5EE 3B78A 1XMOI 2BV3A 1XMQE 4JYAE 5K36B 2JEAA 2BA1G 4FW5A 1Z0TA 1NHIA 2HFUA 2OI2A 4JI8I 1B63A 1R6MA 4ZVIA 3QT8A 4MU3A 2Z5BB 4DV4E 5FLXC 2R3VA 3L7ZB 4J3DA 4LFAE 2AE8A 5IWAI 4DUZI 3H4LA 2E5LI 2BR2B 1Y6ZA 4YY3I 4OO1E 4LFBE 4DR6I 5LMUE 2JE6B 4YHHE 1N34I 4DV6E 3ZZUA 1KKHA 4YY3E 3T1HI 3V5RA 5FWKA 1Y4UA 4DU7A 2HK3A 3QT5A 4FWGA 4RPFA 5C0XA 4AQYI 2V8PA 1N36I 5GMEA 2DEJA 1YHCA 4JYAI 5BR8I 4DPUA 4LCFA 2GO3A 4DV0E 2VF3A 4DU8A 2PNLA 4DR3E 4DV5I 3HKMA 3WU5A 1I94I 3P3GA 3J7AM 4DPTA 4WUBA 4DV0I 4DUYI 1EI1A 2E5LE 1RHYA 1E3PA 3KRNA 1OYSA 5JEAD 1K47A 1S16A 4P52A 5K36E 1HNWI 4OKGA 1N0VC 3NZKA 1USUA 2F1DA 2UXBI 4LF9E 1HNXE 4UT4A 4DR3I 1XNQI 4P7AA 1N34E 4OO1B 3JAMC 1N32E 2NN6F 4DV7E 1FKAE 3GCMA 1HNZI 4DV2I 2WP8B 2NPFA 2DEIA 4X62I 4DR2E 3Q6MA 5DNLA 4JI4E 5IT9Q 4B3RE 2C39B 4JI2E 2VQFI 2PO1A 2NN6E 3M85G 4IFDB 3QT7A 4DR1E 4DR2I 4B3ME 2C37A 3M7NG 5C0XF 4BA2A 2AJ4A 1NZ0A 1H73A 2F4VE 4BA2B 2O3ZA 2VQEI 4IZJB 4LF6E 2C37B 1PIEA 1OJ4A 2UU9I 1FJGI 3V2UC 4DR4E 4LFAI 4JI7I 1VI7A 2Z5EA 4DV3E 2BA0D 2NN6A 4K0KE 3Q1QA 4JI0I 1H7SA 3K85A 2UXDI 4JI7E 4MYUA 5EKWA 4DPWA 2C38A 3T1HE 1FWKA 3CDJA 2WW4A 5LL6R 2V2VA 3PS1A 1HNXI 1U2RA 1KIJA 5A2QC 2HHHI 4FN5A 2JT2A 2IESA 2UXCE 1ZM9A 2BR2A 4USMA 1UEKA 3P76A 4B3SE 4JI5E 1Z59A 2VESA 1RREA 1A6FA 3UHMA 3B4TA 1UDNA 2A2CA 4U3DA 3PRYA 1NHJA 2X7IA 4LPFA 3JAMQ 3LPSA 4AIDA 2Z5CB 1HNZE 1H7UA 1MX0A 1DARA 2NN6B 2CZ9A 3K1JA 1Y4SA 1XNQE 3ZKDA 4JI6I 2HK2A 2UXBE 1WUUA 4IZJD 2UXDE 4X64I 4IZJA 4LF8E 1MG7A 5ELWA 4DR5E 1Z5BA 1N33I 4AIMA 4MU1A 3B82A 4B3SI 2VQFE 2ZITA 2NN6C 3U1YA 2CGEA 4DR5I 1FJGE 3T1YE 2GQ0A 3P3CA 2PO1B 1N32I 4JI6E 4OO1C 4FW3A 3WU6A 4MU0A 4WUCA 4FW6A 1IBKE 5BR8E 4BA1B 4DPXA 4URLA 5DNXA 3WU3A 4LOMA 5C0XD 1RR9A 1UDOA 2IERA 4JI2I 2PO2A 4OZEA 1KTVA 3PYDA 2PNMA 4JI4I 1Z0VA 2V34A 2X36A 4X62E 1ZM4A 4LF8I 1J5EI 4IZKA 1ZM2A 4FWDA 2NN6D 4WUDA 4GKJE 4LF4I 5LMUI 4GKKI 3J7AG 2WNRB 1VISA 4DUZE 3PYGA 4LCHA 4OO1D 3GMEA 5DRRA 2CG9A 4JI5I 1QZRA 1PVGA 4IS9A 4EMDA 5FLXQ 1IBLE 2UUBE 4MYTA 1OYRA 4AQYE 5A2QQ 4HACB 5JEAF 3L7ZA 2O1UA 3P06A 4JG4A 2UUCI 4LFCE 1BKNA 4PU9A 4LF6I 2J7KA 3ZZTA 4FW4A 4PRVA 4X66I 1UDSA 1H74A 4LF7E 4LFBI 4KQVA 1NHHA 4Z7YA 2JEBB 2PO0A 4KHPE 5DRQA 2XEXA 3J80Q 3PS2A 4IFDD 4DV1E 1XHKA 5C0XB 1XNRE 5L3JA 4JV5I 4AM3A 3OTOI 1EA6A 3B8HA 2O1WA 4DV7I 2CVEA 4NXNE 2WNRA 4IFDE 4MQYA 1PKPA 5EL9A 4DR6E 1N0UA 4HY1A 4NBQA 4X65I 3ZM7A 4B3TI 4QNKA 4NXNI 5K36F 4JI3I 3PYEA 1ELOA 5IT9C 1KVKA 5C0XC 1N36E 4K0KI 1HR0I 3J81C 4JI8E 4MDTA 4JI3E 4KHPI 2UXCI 2A2DA 5JEAB 2ZM6E 2UUAE 4LF5E 4HACA 4DR7E 1IBME 4DPYA 5JEAE 4YHHI 5K36D 2BA0G 3ZKBA 2UUAI 4Z7CA 3CWVA 4QNJA 5DRPA 1HNWE 2GO4A 4I3HA 3ZZ0A 1FWLA 3P3EA 2GS8A 1Z0WA 4MU4A 5JEAC 2HKJA 2IOPA 4DV3I 2HKEA 4DV2E 4X64E 4ED4A 2BM0A 3M85D 1D6TA 2UU9E 4UTGA 3CDIA 5DROA 1E3HA 4BA1A 1Z0EA 4NXMI 4DV6I 1Z5CA 4LF9I 4LFCI 4FW7A 2UUCE 1Y60A 4R1FA 2ZBKB 2V2ZA 5IWAE 2Z5CA 4JI1E 4DR1I 4XTJA 4FW9A 3Q6NA 1HR0E 1UDQA 1Y5YA 4LCGA 2O1TA 4DUYE 2HHHE 4OO1F 3M6AA 4GKJI 4HYMA 3DD6A 4OX9E 4DV5E 1I94E 3F0NA 1S4EA 4DR7I 4X66E 4IFDA 2C39A 5LMNE 2E1RA 4DXLA 4IFDF 3H1CA 1ZXMA 4N3OA 2JE6A 1XNRI 1IBLI 1FNMA 2UUBI 1XXEA 3K17A 1P42A 1Z0BA 4M1KA 3LNUA 2EFGA 1IBKI 4B3TE 3PS3A 1USVA 4LF7I 4IFDC 3D4JA 1ZM3A 5K36C 1ZXNA 4USKA 1IBMI 2ZM6I 4LF5I 4FWHA 1OYPA 3J80C 3U1KA 4B3MI 2C38B 3J81Q 3OTOE 2Z5BA 4DV4I 1Z0CA 4OO1A 4DV1I 2Q2EB 2JEBA 2PO0B 3HULA 5K36A 5LMNI 1XMOE 1Z0GA 1XMQI 2IOQA 3M7ND 4DR4I 4X65E 3HJCA 2LJPA 4LF4E 4PRXA 4OX9I 1YH8A 3LTOA 1MU5A
chains in the Genus database with same CATH topology
3T1YI 3GONA 1H72C 1FI4A 4JV5E 3PYFA 4JI0E 4HXZA 2O1VA 4B3RI 4JI1I 1N33E 4IZKB 2BM1A 3WU4A 2HFSA 3QT6A 4GKKE 2V2QA 1Z5AA 5GMDA 4NXME 2VQEE 2F4VI 1B62A 1HK7A 2R42A 1J5EE 3B78A 1XMOI 2BV3A 1XMQE 4JYAE 1Z0TA 1NHIA 2HFUA 2OI2A 4JI8I 1B63A 4ZVIA 3QT8A 2Z5BB 4DV4E 5FLXC 2R3VA 4LFAE 5IWAI 4DUZI 3H4LA 2E5LI 1Y6ZA 4YY3I 4LFBE 4DR6I 5LMUE 1N34I 4YHHE 4DV6E 3ZZUA 1KKHA 4YY3E 3T1HI 3V5RA 5FWKA 1Y4UA 4DU7A 2HK3A 3QT5A 4FWGA 4RPFA 4AQYI 2V8PA 1N36I 5GMEA 2DEJA 4JYAI 5BR8I 4DPUA 4DV0E 2VF3A 4DU8A 2PNLA 4DR3E 4DV5I 3WU5A 1I94I 3J7AM 4DPTA 4WUBA 4DV0I 4DUYI 1EI1A 2E5LE 1K47A 1S16A 4P52A 1HNWI 1N0VC 1USUA 2UXBI 4LF9E 1HNXE 4UT4A 4DR3I 1XNQI 4P7AA 1N34E 3JAMC 1N32E 4DV7E 1FKAE 1HNZI 4DV2I 2NPFA 2DEIA 4X62I 4DR2E 3Q6MA 4JI4E 5IT9Q 4B3RE 4JI2E 2VQFI 3QT7A 4DR1E 4DR2I 4B3ME 2AJ4A 1NZ0A 1H73A 2F4VE 2VQEI 4IZJB 4LF6E 1PIEA 1OJ4A 2UU9I 1FJGI 3V2UC 4DR4E 4LFAI 4JI7I 2Z5EA 4DV3E 4K0KE 3Q1QA 4JI0I 1H7SA 3K85A 2UXDI 4JI7E 4MYUA 4DPWA 3T1HE 1FWKA 2WW4A 5LL6R 2V2VA 1HNXI 1U2RA 1KIJA 5A2QC 2HHHI 4FN5A 2UXCE 1ZM9A 4USMA 1UEKA 4B3SE 4JI5E 1Z59A 1RREA 1A6FA 2A2CA 3PRYA 1NHJA 2X7IA 3JAMQ 3LPSA 2Z5CB 1HNZE 1H7UA 1MX0A 1DARA 2CZ9A 3K1JA 1Y4SA 1XNQE 3ZKDA 4JI6I 2HK2A 2UXBE 1WUUA 4IZJD 2UXDE 4X64I 4IZJA 4LF8E 1MG7A 4DR5E 1Z5BA 1N33I 3B82A 4B3SI 2VQFE 2ZITA 2CGEA 4DR5I 1FJGE 3T1YE 2GQ0A 1N32I 4JI6E 3WU6A 4WUCA 1IBKE 5BR8E 4DPXA 4URLA 3WU3A 1RR9A 4JI2I 1KTVA 3PYDA 2PNMA 4JI4I 1Z0VA 2V34A 2X36A 4X62E 1ZM4A 4LF8I 1J5EI 4IZKA 1ZM2A 4FWDA 4WUDA 4GKJE 4LF4I 5LMUI 4GKKI 3J7AG 1VISA 4DUZE 3PYGA 4JI5I 2CG9A 1QZRA 1PVGA 4EMDA 5FLXQ 1IBLE 2UUBE 4MYTA 4AQYE 5A2QQ 4HACB 2O1UA 3P06A 4JG4A 2UUCI 4LFCE 1BKNA 4PU9A 4LF6I 2J7KA 3ZZTA 4PRVA 4X66I 1H74A 4LF7E 4LFBI 4KQVA 1NHHA 4Z7YA 4KHPE 2XEXA 3J80Q 4DV1E 1XHKA 4JV5I 1XNRE 5L3JA 3OTOI 1EA6A 3B8HA 2O1WA 4DV7I 4NXNE 1PKPA 4DR6E 1N0UA 4HY1A 4X65I 3ZM7A 4B3TI 4NXNI 4JI3I 3PYEA 1ELOA 5IT9C 1KVKA 1N36E 4K0KI 1HR0I 3J81C 4JI8E 4JI3E 4KHPI 2UXCI 2A2DA 2ZM6E 2UUAE 4LF5E 4HACA 4DR7E 1IBME 4DPYA 4YHHI 3ZKBA 2UUAI 4Z7CA 3CWVA 1HNWE 4I3HA 3ZZ0A 1FWLA 2GS8A 1Z0WA 2HKJA 2IOPA 4DV3I 2HKEA 4DV2E 4X64E 4ED4A 2BM0A 1D6TA 2UU9E 4UTGA 1Z0EA 4NXMI 4DV6I 1Z5CA 4LF9I 4LFCI 2UUCE 2ZBKB 4R1FA 2V2ZA 5IWAE 2Z5CA 4JI1E 4DR1I 4XTJA 4FW9A 3Q6NA 1HR0E 2O1TA 4DUYE 2HHHE 3M6AA 4GKJI 4HYMA 4OX9E 4DV5E 1I94E 3F0NA 1S4EA 4DR7I 4X66E 5LMNE 2E1RA 4DXLA 1ZXMA 4N3OA 1XNRI 1IBLI 1FNMA 2UUBI 3K17A 1Z0BA 4M1KA 3LNUA 2EFGA 1IBKI 4B3TE 1USVA 4LF7I 3D4JA 1ZM3A 1ZXNA 4USKA 1IBMI 2ZM6I 4LF5I 4FWHA 3J80C 4B3MI 3J81Q 3OTOE 2Z5BA 4DV4I 1Z0CA 4DV1I 2Q2EB 3HULA 5LMNI 1XMOE 1Z0GA 1XMQI 2IOQA 4DR4I 4X65E 3HJCA 2LJPA 4LF4E 4PRXA 4OX9I 3LTOA 1MU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y I;  3GON A;  1H72 C;  1FI4 A;  4JV5 E;  3PYF A;  4JI0 E;  4HXZ A;  4B3R I;  4JI1 I;  1N33 E;  2BM1 A;  3WU4 A;  2HFS A;  3QT6 A;  4GKK E;  2V2Q A;  1Z5A A;  5GMD A;  4NXM E;  2VQE E;  2F4V I;  1B62 A;  2R42 A;  1J5E E;  3B78 A;  1XMO I;  2BV3 A;  1XMQ E;  4JYA E;  1Z0T A;  1NHI A;  2HFU A;  2OI2 A;  4JI8 I;  1B63 A;  4ZVI A;  3QT8 A;  4DV4 E;  5FLX C;  2R3V A;  4LFA E;  5IWA I;  4DUZ I;  3H4L A;  2E5L I;  4YY3 I;  4LFB E;  4DR6 I;  5LMU E;  1N34 I;  4YHH E;  4DV6 E;  3ZZU A;  1KKH A;  4YY3 E;  3T1H I;  3V5R A;  4DU7 A;  2HK3 A;  3QT5 A;  4FWG A;  4RPF A;  4AQY I;  2V8P A;  1N36 I;  5GME A;  2DEJ A;  4JYA I;  5BR8 I;  4DPU A;  4DV0 E;  2VF3 A;  4DU8 A;  4DR3 E;  4DV5 I;  3WU5 A;  1I94 I;  3J7A M;  4DPT A;  4WUB A;  4DV0 I;  4DUY I;  1EI1 A;  2E5L E;  1K47 A;  1S16 A;  4P52 A;  1HNW I;  1N0V C;  2UXB I;  4LF9 E;  1HNX E;  4UT4 A;  4DR3 I;  1XNQ I;  4P7A A;  1N34 E;  3JAM C;  1N32 E;  4DV7 E;  1FKA E;  1HNZ I;  4DV2 I;  2NPF A;  2DEI A;  4X62 I;  4DR2 E;  4JI4 E;  5IT9 Q;  4B3R E;  4JI2 E;  2VQF I;  3QT7 A;  4DR1 E;  4DR2 I;  4B3M E;  2AJ4 A;  1NZ0 A;  1H73 A;  2F4V E;  2VQE I;  4LF6 E;  1PIE A;  1OJ4 A;  2UU9 I;  1FJG I;  3V2U C;  4DR4 E;  4LFA I;  4JI7 I;  4DV3 E;  4K0K E;  3Q1Q A;  4JI0 I;  1H7S A;  2UXD I;  4JI7 E;  4MYU A;  4DPW A;  3T1H E;  1FWK A;  2WW4 A;  5LL6 R;  2V2V A;  1HNX I;  1U2R A;  1KIJ A;  5A2Q C;  2HHH I;  4FN5 A;  2UXC E;  1ZM9 A;  4USM A;  1UEK A;  4B3S E;  4JI5 E;  1Z59 A;  1RRE A;  1A6F A;  2A2C A;  1NHJ A;  2X7I A;  3JAM Q;  3LPS A;  1HNZ E;  1H7U A;  1MX0 A;  1DAR A;  2CZ9 A;  3K1J A;  1XNQ E;  3ZKD A;  4JI6 I;  2HK2 A;  2UXB E;  1WUU A;  2UXD E;  4X64 I;  4LF8 E;  1MG7 A;  4DR5 E;  1Z5B A;  1N33 I;  3B82 A;  4B3S I;  2VQF E;  2ZIT A;  4DR5 I;  1FJG E;  3T1Y E;  1N32 I;  4JI6 E;  3WU6 A;  4WUC A;  1IBK E;  5BR8 E;  4DPX A;  4URL A;  3WU3 A;  1RR9 A;  4JI2 I;  1KTV A;  3PYD A;  4JI4 I;  1Z0V A;  2V34 A;  2X36 A;  4X62 E;  1ZM4 A;  4LF8 I;  1J5E I;  1ZM2 A;  4FWD A;  4WUD A;  4GKJ E;  4LF4 I;  5LMU I;  4GKK I;  3J7A G;  1VIS A;  4DUZ E;  3PYG A;  4JI5 I;  1QZR A;  1PVG A;  4EMD A;  5FLX Q;  1IBL E;  2UUB E;  4MYT A;  4AQY E;  5A2Q Q;  4HAC B;  2UUC I;  4JG4 A;  4LFC E;  1BKN A;  4PU9 A;  4LF6 I;  2J7K A;  3ZZT A;  4PRV A;  4X66 I;  1H74 A;  4LF7 E;  4LFB I;  4KQV A;  1NHH A;  4Z7Y A;  4KHP E;  2XEX A;  3J80 Q;  4DV1 E;  1XHK A;  4JV5 I;  1XNR E;  5L3J A;  3OTO I;  1EA6 A;  3B8H A;  4DV7 I;  4NXN E;  1PKP A;  4DR6 E;  1N0U A;  4HY1 A;  4X65 I;  3ZM7 A;  4B3T I;  4NXN I;  4JI3 I;  3PYE A;  1ELO A;  5IT9 C;  1KVK A;  1N36 E;  4K0K I;  1HR0 I;  3J81 C;  4JI8 E;  4JI3 E;  4KHP I;  2UXC I;  2A2D A;  2ZM6 E;  2UUA E;  4LF5 E;  4HAC A;  4DR7 E;  1IBM E;  4DPY A;  4YHH I;  3ZKB A;  2UUA I;  4Z7C A;  3CWV A;  1HNW E;  4I3H A;  3ZZ0 A;  1FWL A;  2GS8 A;  1Z0W A;  2HKJ A;  4DV3 I;  2HKE A;  4DV2 E;  4X64 E;  4ED4 A;  2BM0 A;  1D6T A;  2UU9 E;  4UTG A;  1Z0E A;  4NXM I;  4DV6 I;  1Z5C A;  4LF9 I;  4LFC I;  2UUC E;  2ZBK B;  4R1F A;  2V2Z A;  5IWA E;  4JI1 E;  4DR1 I;  4XTJ A;  4FW9 A;  1HR0 E;  4DUY E;  2HHH E;  3M6A A;  4GKJ I;  4HYM A;  4OX9 E;  4DV5 E;  1I94 E;  3F0N A;  1S4E A;  4DR7 I;  4X66 E;  5LMN E;  2E1R A;  4DXL A;  1ZXM A;  1XNR I;  1IBL I;  1FNM A;  2UUB I;  3K17 A;  1Z0B A;  4M1K A;  3LNU A;  2EFG A;  1IBK I;  4B3T E;  4LF7 I;  3D4J A;  1ZM3 A;  1ZXN A;  4USK A;  1IBM I;  2ZM6 I;  4LF5 I;  4FWH A;  3J80 C;  4B3M I;  3J81 Q;  3OTO E;  4DV4 I;  1Z0C A;  4DV1 I;  2Q2E B;  3HUL A;  5LMN I;  1XMO E;  1Z0G A;  1XMQ I;  4DR4 I;  4X65 E;  2LJP A;  4LF4 E;  4PRX A;  4OX9 I;  3LTO A;  1MU5 A; 
#chains in the Genus database with same CATH topology
 3T1Y I;  3GON A;  2BA1 D;  1H72 C;  1FI4 A;  4JV5 E;  3PYF A;  4JI0 E;  4HXZ A;  2O1V A;  4B3R I;  4JI1 I;  1N33 E;  2PO2 B;  4IZK B;  1R6L A;  2BM1 A;  3WU4 A;  2HFS A;  2PNZ A;  3QT6 A;  4GKK E;  4GQU A;  4U3B A;  2V2Q A;  2WP8 A;  5C0X E;  2J65 A;  1Z5A A;  5GMD A;  4NXM E;  2VQE E;  2F4V I;  4ISA A;  1B62 A;  5JEA A;  2PNZ B;  1HK7 A;  3GLL A;  2JEA B;  2R42 A;  1J5E E;  3B78 A;  1XMO I;  2BV3 A;  1XMQ E;  4JYA E;  5K36 B;  2JEA A;  2BA1 G;  4FW5 A;  1Z0T A;  1NHI A;  2HFU A;  2OI2 A;  4JI8 I;  1B63 A;  1R6M A;  4ZVI A;  3QT8 A;  4MU3 A;  2Z5B B;  4DV4 E;  5FLX C;  2R3V A;  3L7Z B;  4J3D A;  4LFA E;  2AE8 A;  5IWA I;  4DUZ I;  3H4L A;  2E5L I;  2BR2 B;  1Y6Z A;  4YY3 I;  4OO1 E;  4LFB E;  4DR6 I;  5LMU E;  2JE6 B;  4YHH E;  1N34 I;  4DV6 E;  3ZZU A;  1KKH A;  4YY3 E;  3T1H I;  3V5R A;  5FWK A;  1Y4U A;  4DU7 A;  2HK3 A;  3QT5 A;  4FWG A;  4RPF A;  5C0X A;  4AQY I;  2V8P A;  1N36 I;  5GME A;  2DEJ A;  1YHC A;  4JYA I;  5BR8 I;  4DPU A;  4LCF A;  2GO3 A;  4DV0 E;  2VF3 A;  4DU8 A;  2PNL A;  4DR3 E;  4DV5 I;  3HKM A;  3WU5 A;  1I94 I;  3P3G A;  3J7A M;  4DPT A;  4WUB A;  4DV0 I;  4DUY I;  1EI1 A;  2E5L E;  1RHY A;  1E3P A;  3KRN A;  1OYS A;  5JEA D;  1K47 A;  1S16 A;  4P52 A;  5K36 E;  1HNW I;  4OKG A;  1N0V C;  3NZK A;  1USU A;  2F1D A;  2UXB I;  4LF9 E;  1HNX E;  4UT4 A;  4DR3 I;  1XNQ I;  4P7A A;  1N34 E;  4OO1 B;  3JAM C;  1N32 E;  2NN6 F;  4DV7 E;  1FKA E;  3GCM A;  1HNZ I;  4DV2 I;  2WP8 B;  2NPF A;  2DEI A;  4X62 I;  4DR2 E;  3Q6M A;  5DNL A;  4JI4 E;  5IT9 Q;  4B3R E;  2C39 B;  4JI2 E;  2VQF I;  2PO1 A;  2NN6 E;  3M85 G;  4IFD B;  3QT7 A;  4DR1 E;  4DR2 I;  4B3M E;  2C37 A;  3M7N G;  5C0X F;  4BA2 A;  2AJ4 A;  1NZ0 A;  1H73 A;  2F4V E;  4BA2 B;  2O3Z A;  2VQE I;  4IZJ B;  4LF6 E;  2C37 B;  1PIE A;  1OJ4 A;  2UU9 I;  1FJG I;  3V2U C;  4DR4 E;  4LFA I;  4JI7 I;  1VI7 A;  2Z5E A;  4DV3 E;  2BA0 D;  2NN6 A;  4K0K E;  3Q1Q A;  4JI0 I;  1H7S A;  3K85 A;  2UXD I;  4JI7 E;  4MYU A;  5EKW A;  4DPW A;  2C38 A;  3T1H E;  1FWK A;  3CDJ A;  2WW4 A;  5LL6 R;  2V2V A;  3PS1 A;  1HNX I;  1U2R A;  1KIJ A;  5A2Q C;  2HHH I;  4FN5 A;  2JT2 A;  2IES A;  2UXC E;  1ZM9 A;  2BR2 A;  4USM A;  1UEK A;  3P76 A;  4B3S E;  4JI5 E;  1Z59 A;  2VES A;  1RRE A;  1A6F A;  3UHM A;  3B4T A;  1UDN A;  2A2C A;  4U3D A;  3PRY A;  1NHJ A;  2X7I A;  4LPF A;  3JAM Q;  3LPS A;  4AID A;  2Z5C B;  1HNZ E;  1H7U A;  1MX0 A;  1DAR A;  2NN6 B;  2CZ9 A;  3K1J A;  1Y4S A;  1XNQ E;  3ZKD A;  4JI6 I;  2HK2 A;  2UXB E;  1WUU A;  4IZJ D;  2UXD E;  4X64 I;  4IZJ A;  4LF8 E;  1MG7 A;  5ELW A;  4DR5 E;  1Z5B A;  1N33 I;  4AIM A;  4MU1 A;  3B82 A;  4B3S I;  2VQF E;  2ZIT A;  2NN6 C;  3U1Y A;  2CGE A;  4DR5 I;  1FJG E;  3T1Y E;  2GQ0 A;  3P3C A;  2PO1 B;  1N32 I;  4JI6 E;  4OO1 C;  4FW3 A;  3WU6 A;  4MU0 A;  4WUC A;  4FW6 A;  1IBK E;  5BR8 E;  4BA1 B;  4DPX A;  4URL A;  5DNX A;  3WU3 A;  4LOM A;  5C0X D;  1RR9 A;  1UDO A;  2IER A;  4JI2 I;  2PO2 A;  4OZE A;  1KTV A;  3PYD A;  2PNM A;  4JI4 I;  1Z0V A;  2V34 A;  2X36 A;  4X62 E;  1ZM4 A;  4LF8 I;  1J5E I;  4IZK A;  1ZM2 A;  4FWD A;  2NN6 D;  4WUD A;  4GKJ E;  4LF4 I;  5LMU I;  4GKK I;  3J7A G;  2WNR B;  1VIS A;  4DUZ E;  3PYG A;  4LCH A;  4OO1 D;  3GME A;  5DRR A;  2CG9 A;  4JI5 I;  1QZR A;  1PVG A;  4IS9 A;  4EMD A;  5FLX Q;  1IBL E;  2UUB E;  4MYT A;  1OYR A;  4AQY E;  5A2Q Q;  4HAC B;  5JEA F;  3L7Z A;  2O1U A;  3P06 A;  4JG4 A;  2UUC I;  4LFC E;  1BKN A;  4PU9 A;  4LF6 I;  2J7K A;  3ZZT A;  4FW4 A;  4PRV A;  4X66 I;  1UDS A;  1H74 A;  4LF7 E;  4LFB I;  4KQV A;  1NHH A;  4Z7Y A;  2JEB B;  2PO0 A;  4KHP E;  5DRQ A;  2XEX A;  3J80 Q;  3PS2 A;  4IFD D;  4DV1 E;  1XHK A;  5C0X B;  1XNR E;  5L3J A;  4JV5 I;  4AM3 A;  3OTO I;  1EA6 A;  3B8H A;  2O1W A;  4DV7 I;  2CVE A;  4NXN E;  2WNR A;  4IFD E;  4MQY A;  1PKP A;  5EL9 A;  4DR6 E;  1N0U A;  4HY1 A;  4NBQ A;  4X65 I;  3ZM7 A;  4B3T I;  4QNK A;  4NXN I;  5K36 F;  4JI3 I;  3PYE A;  1ELO A;  5IT9 C;  1KVK A;  5C0X C;  1N36 E;  4K0K I;  1HR0 I;  3J81 C;  4JI8 E;  4MDT A;  4JI3 E;  4KHP I;  2UXC I;  2A2D A;  5JEA B;  2ZM6 E;  2UUA E;  4LF5 E;  4HAC A;  4DR7 E;  1IBM E;  4DPY A;  5JEA E;  4YHH I;  5K36 D;  2BA0 G;  3ZKB A;  2UUA I;  4Z7C A;  3CWV A;  4QNJ A;  5DRP A;  1HNW E;  2GO4 A;  4I3H A;  3ZZ0 A;  1FWL A;  3P3E A;  2GS8 A;  1Z0W A;  4MU4 A;  5JEA C;  2HKJ A;  2IOP A;  4DV3 I;  2HKE A;  4DV2 E;  4X64 E;  4ED4 A;  2BM0 A;  3M85 D;  1D6T A;  2UU9 E;  4UTG A;  3CDI A;  5DRO A;  1E3H A;  4BA1 A;  1Z0E A;  4NXM I;  4DV6 I;  1Z5C A;  4LF9 I;  4LFC I;  4FW7 A;  2UUC E;  1Y60 A;  4R1F A;  2ZBK B;  2V2Z A;  5IWA E;  2Z5C A;  4JI1 E;  4DR1 I;  4XTJ A;  4FW9 A;  3Q6N A;  1HR0 E;  1UDQ A;  1Y5Y A;  4LCG A;  2O1T A;  4DUY E;  2HHH E;  4OO1 F;  3M6A A;  4GKJ I;  4HYM A;  3DD6 A;  4OX9 E;  4DV5 E;  1I94 E;  3F0N A;  1S4E A;  4DR7 I;  4X66 E;  4IFD A;  2C39 A;  5LMN E;  2E1R A;  4DXL A;  4IFD F;  3H1C A;  1ZXM A;  4N3O A;  2JE6 A;  1XNR I;  1IBL I;  1FNM A;  2UUB I;  1XXE A;  3K17 A;  1P42 A;  1Z0B A;  4M1K A;  3LNU A;  2EFG A;  1IBK I;  4B3T E;  3PS3 A;  1USV A;  4LF7 I;  4IFD C;  3D4J A;  1ZM3 A;  5K36 C;  1ZXN A;  4USK A;  1IBM I;  2ZM6 I;  4LF5 I;  4FWH A;  1OYP A;  3J80 C;  3U1K A;  4B3M I;  2C38 B;  3J81 Q;  3OTO E;  2Z5B A;  4DV4 I;  1Z0C A;  4OO1 A;  4DV1 I;  2Q2E B;  2JEB A;  2PO0 B;  3HUL A;  5K36 A;  5LMN I;  1XMO E;  1Z0G A;  1XMQ I;  2IOQ A;  3M7N D;  4DR4 I;  4X65 E;  3HJC A;  2LJP A;  4LF4 E;  4PRX A;  4OX9 I;  1YH8 A;  3LTO A;  1MU5 A; 
#chains in the Genus database with same CATH homology
 3T1Y I;  3GON A;  1H72 C;  1FI4 A;  4JV5 E;  3PYF A;  4JI0 E;  4HXZ A;  2O1V A;  4B3R I;  4JI1 I;  1N33 E;  4IZK B;  2BM1 A;  3WU4 A;  2HFS A;  3QT6 A;  4GKK E;  2V2Q A;  1Z5A A;  5GMD A;  4NXM E;  2VQE E;  2F4V I;  1B62 A;  1HK7 A;  2R42 A;  1J5E E;  3B78 A;  1XMO I;  2BV3 A;  1XMQ E;  4JYA E;  1Z0T A;  1NHI A;  2HFU A;  2OI2 A;  4JI8 I;  1B63 A;  4ZVI A;  3QT8 A;  2Z5B B;  4DV4 E;  5FLX C;  2R3V A;  4LFA E;  5IWA I;  4DUZ I;  3H4L A;  2E5L I;  1Y6Z A;  4YY3 I;  4LFB E;  4DR6 I;  5LMU E;  1N34 I;  4YHH E;  4DV6 E;  3ZZU A;  1KKH A;  4YY3 E;  3T1H I;  3V5R A;  5FWK A;  1Y4U A;  4DU7 A;  2HK3 A;  3QT5 A;  4FWG A;  4RPF A;  4AQY I;  2V8P A;  1N36 I;  5GME A;  2DEJ A;  4JYA I;  5BR8 I;  4DPU A;  4DV0 E;  2VF3 A;  4DU8 A;  2PNL A;  4DR3 E;  4DV5 I;  3WU5 A;  1I94 I;  3J7A M;  4DPT A;  4WUB A;  4DV0 I;  4DUY I;  1EI1 A;  2E5L E;  1K47 A;  1S16 A;  4P52 A;  1HNW I;  1N0V C;  1USU A;  2UXB I;  4LF9 E;  1HNX E;  4UT4 A;  4DR3 I;  1XNQ I;  4P7A A;  1N34 E;  3JAM C;  1N32 E;  4DV7 E;  1FKA E;  1HNZ I;  4DV2 I;  2NPF A;  2DEI A;  4X62 I;  4DR2 E;  3Q6M A;  4JI4 E;  5IT9 Q;  4B3R E;  4JI2 E;  2VQF I;  3QT7 A;  4DR1 E;  4DR2 I;  4B3M E;  2AJ4 A;  1NZ0 A;  1H73 A;  2F4V E;  2VQE I;  4IZJ B;  4LF6 E;  1PIE A;  1OJ4 A;  2UU9 I;  1FJG I;  3V2U C;  4DR4 E;  4LFA I;  4JI7 I;  2Z5E A;  4DV3 E;  4K0K E;  3Q1Q A;  4JI0 I;  1H7S A;  3K85 A;  2UXD I;  4JI7 E;  4MYU A;  4DPW A;  3T1H E;  1FWK A;  2WW4 A;  5LL6 R;  2V2V A;  1HNX I;  1U2R A;  1KIJ A;  5A2Q C;  2HHH I;  4FN5 A;  2UXC E;  1ZM9 A;  4USM A;  1UEK A;  4B3S E;  4JI5 E;  1Z59 A;  1RRE A;  1A6F A;  2A2C A;  3PRY A;  1NHJ A;  2X7I A;  3JAM Q;  3LPS A;  2Z5C B;  1HNZ E;  1H7U A;  1MX0 A;  1DAR A;  2CZ9 A;  3K1J A;  1Y4S A;  1XNQ E;  3ZKD A;  4JI6 I;  2HK2 A;  2UXB E;  1WUU A;  4IZJ D;  2UXD E;  4X64 I;  4IZJ A;  4LF8 E;  1MG7 A;  4DR5 E;  1Z5B A;  1N33 I;  3B82 A;  4B3S I;  2VQF E;  2ZIT A;  2CGE A;  4DR5 I;  1FJG E;  3T1Y E;  2GQ0 A;  1N32 I;  4JI6 E;  3WU6 A;  4WUC A;  1IBK E;  5BR8 E;  4DPX A;  4URL A;  3WU3 A;  1RR9 A;  4JI2 I;  1KTV A;  3PYD A;  2PNM A;  4JI4 I;  1Z0V A;  2V34 A;  2X36 A;  4X62 E;  1ZM4 A;  4LF8 I;  1J5E I;  4IZK A;  1ZM2 A;  4FWD A;  4WUD A;  4GKJ E;  4LF4 I;  5LMU I;  4GKK I;  3J7A G;  1VIS A;  4DUZ E;  3PYG A;  4JI5 I;  2CG9 A;  1QZR A;  1PVG A;  4EMD A;  5FLX Q;  1IBL E;  2UUB E;  4MYT A;  4AQY E;  5A2Q Q;  4HAC B;  2O1U A;  3P06 A;  4JG4 A;  2UUC I;  4LFC E;  1BKN A;  4PU9 A;  4LF6 I;  2J7K A;  3ZZT A;  4PRV A;  4X66 I;  1H74 A;  4LF7 E;  4LFB I;  4KQV A;  1NHH A;  4Z7Y A;  4KHP E;  2XEX A;  3J80 Q;  4DV1 E;  1XHK A;  4JV5 I;  1XNR E;  5L3J A;  3OTO I;  1EA6 A;  3B8H A;  2O1W A;  4DV7 I;  4NXN E;  1PKP A;  4DR6 E;  1N0U A;  4HY1 A;  4X65 I;  3ZM7 A;  4B3T I;  4NXN I;  4JI3 I;  3PYE A;  1ELO A;  5IT9 C;  1KVK A;  1N36 E;  4K0K I;  1HR0 I;  3J81 C;  4JI8 E;  4JI3 E;  4KHP I;  2UXC I;  2A2D A;  2ZM6 E;  2UUA E;  4LF5 E;  4HAC A;  4DR7 E;  1IBM E;  4DPY A;  4YHH I;  3ZKB A;  2UUA I;  4Z7C A;  3CWV A;  1HNW E;  4I3H A;  3ZZ0 A;  1FWL A;  2GS8 A;  1Z0W A;  2HKJ A;  2IOP A;  4DV3 I;  2HKE A;  4DV2 E;  4X64 E;  4ED4 A;  2BM0 A;  1D6T A;  2UU9 E;  4UTG A;  1Z0E A;  4NXM I;  4DV6 I;  1Z5C A;  4LF9 I;  4LFC I;  2UUC E;  2ZBK B;  4R1F A;  2V2Z A;  5IWA E;  2Z5C A;  4JI1 E;  4DR1 I;  4XTJ A;  4FW9 A;  3Q6N A;  1HR0 E;  2O1T A;  4DUY E;  2HHH E;  3M6A A;  4GKJ I;  4HYM A;  4OX9 E;  4DV5 E;  1I94 E;  3F0N A;  1S4E A;  4DR7 I;  4X66 E;  5LMN E;  2E1R A;  4DXL A;  1ZXM A;  4N3O A;  1XNR I;  1IBL I;  1FNM A;  2UUB I;  3K17 A;  1Z0B A;  4M1K A;  3LNU A;  2EFG A;  1IBK I;  4B3T E;  1USV A;  4LF7 I;  3D4J A;  1ZM3 A;  1ZXN A;  4USK A;  1IBM I;  2ZM6 I;  4LF5 I;  4FWH A;  3J80 C;  4B3M I;  3J81 Q;  3OTO E;  2Z5B A;  4DV4 I;  1Z0C A;  4DV1 I;  2Q2E B;  3HUL A;  5LMN I;  1XMO E;  1Z0G A;  1XMQ I;  2IOQ A;  4DR4 I;  4X65 E;  3HJC A;  2LJP A;  4LF4 E;  4PRX A;  4OX9 I;  3LTO A;  1MU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...