4JI8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8I00
3M6AA 1KKHA 2DEJA 1ZM9A 2Q2EB 1B63A 4DR7E 1S16A 4FWGA 4WUDA 4WUBA 4LF8I 1FKAE 3B8HA 4UTGA 4GKKI 4FN5A 4P7AA 2BV3A 4DR4I 4JI8E 3QT6A 3ZZ0A 1S4EA 1I94E 4RPFA 2UUCI 1D6TA 2UXCI 1N33E 4X66I 4JI2I 4DUZI 4KHPE 4JI4I 1N0UA 4NXME 1N0VC 2VQEE 2J7KA 2E5LI 4HACA 2V2QA 4DV4E 3T1HI 3ZZUA 1HNZI 1UEKA 4DV1E 1XNQE 4LFBE 5LMNI 1EI1A 1A6FA 1Z0VA 1U2RA 4DR5E 1HNWE 4R1FA 4DV2E 4DR7I 3LTOA 1N32E 4FWDA 4USMA 1XMOE 4B3RE 3H4LA 2UXBE 1FJGE 2WW4A 4DPXA 1BKNA 1I94I 2A2DA 4OX9I 4DV5E 1QZRA 4KQVA 4NXMI 4KHPI 1VISA 2VQEI 2AJ4A 4I3HA 1FWLA 4HXZA 4DV4I 4UT4A 2HK2A 4JI7E 2UUCE 4LFBI 4Z7CA 4X66E 4JI2E 3LPSA 1KTVA 1H7UA 3QT8A 4JG4A 4MYUA 3V2UC 4DR5I 4B3TE 2ZM6E 1HNWI 1N32I 2EFGA 3T1HE 1XMOI 4JI6E 1HNZE 4B3RI 4P52A 4YY3I 5LMNE 2UXBI 1FJGI 3T1YE 3F0NA 4HACB 3J7AG 1ZXMA 5GMDA 4DV5I 4LF4E 5LL6R 4DR3E 5BR8E 4JI0E 5LMUE 1ZXNA 4LFCE 1H7SA 4DU8A 4JI7I 1RREA 2F4VI 4LF5E 4OX9E 3LNUA 4ED4A 4B3TI 2ZM6I 1PVGA 4EMDA 2XEXA 2ZITA 4JI6I 1Z59A 2BM1A 3GONA 3CWVA 4PRVA 3T1YI 4PU9A 3V5RA 1WUUA 4DV3I 4JI3E 1K47A 2HFUA 4WUCA 4X64E 4LF4I 2ZBKB 1N34E 4DR3I 5BR8I 1PKPA 4NXNE 4JI5E 4YY3E 1FNMA 4LFAE 4JI0I 5LMUI 1Z0TA 2DEIA 3D4JA 4JV5I 4LFCI 2HHHE 1FWKA 4B3SE 4X62E 4LF5I 4MYTA 3B78A 4DV0E 4ZVIA 4B3MI 4JYAE 3ZKDA 3B82A 3WU5A 1OJ4A 1KVKA 4HY1A 1B62A 4K0KE 3PYDA 1FI4A 4JI3I 4YHHE 2OI2A 1H74A 4JI1I 4HYMA 2R3VA 4X64I 4LF9E 1NHHA 1Z0CA 1N34I 2UUBI 2VQFE 4NXNI 4DR2I 4JI5I 4LFAI 1Z0EA 4XTJA 3PYEA 4USKA 1IBME 4DV3E 2HHHI 2V2ZA 4B3SI 4X62I 5IT9Q 1RR9A 1N36E 2UUAE 1MX0A 5GMEA 4DV0I 4DV6E 4DR6E 2HFSA 3OTOE 2R42A 3ZM7A 5IT9C 4JYAI 1PIEA 2V8PA 2HK3A 3HULA 3WU4A 4GKJE 4JV5E 5IWAI 1DARA 4Z7YA 1Z5BA 1IBLE 4K0KI 2UXDE 2UU9E 2A2CA 2HKEA 4DPTA 4AQYE 4YHHI 4B3ME 1Z0WA 1Z0BA 3JAMQ 4LF9I 3J81Q 4LF6E 2V34A 1MU5A 1ZM3A 4DR1E 3K17A 2E1RA 3JAMC 2VQFI 1Z0GA 3J81C 1XNRE 1HR0E 3QT7A 1NHJA 1HNXE 3QT5A 3PYGA 3Q1QA 4DUYI 1IBMI 1MG7A 4JI1E 1N36I 2UUAI 1XMQE 4DV6I 4DR6I 3OTOI 1ZM4A 2UUBE 4DV7E 4DR2E 1KIJA 5A2QQ 4GKJI 1H72C 4DXLA 4FWHA 5A2QC 1J5EE 4LF7E 1NHIA 1IBKE 1IBLI 2UXDI 2UU9I 3J7AM 4X65E 4AQYI 4URLA 5L3JA 2F4VE 4LF6I 4JI8I 1H73A 1Z5AA 1NZ0A 4DR1I 2NPFA 5IWAE 1HR0I 4FW9A 1XNRI 1N33I 1HNXI 4PRXA 3K1JA 3ZKBA 4DPWA 5FLXQ 1ELOA 4LF8E 2VF3A 4DPYA 4GKKE 1ZM2A 5FLXC 3J80Q 4DR4E 1XMQI 2X7IA 4DV1I 1XNQI 4DV7I 3J80C 1XHKA 2UXCE 3WU6A 3PYFA 4DUZE 4DPUA 4DUYE 4JI4E 3WU3A 2GS8A 2E5LE 2V2VA 2HKJA 1J5EI 4DV2I 4LF7I 1IBKI 4M1KA 4X65I 2BM0A 2X36A 1Z5CA 4DU7A 1EA6A 2CZ9A 2LJPA 3ZZTA
chains in the Genus database with same CATH superfamily
3M6AA 4BA2B 3L7ZA 1KKHA 2DEJA 1ZM9A 2Q2EB 1B63A 3KRNA 4DR7E 1S16A 4FWGA 4WUDA 4MU0A 4WUBA 4LF8I 1FKAE 3B8HA 4OO1B 4UTGA 4GKKI 4FN5A 2CGEA 3PS3A 4P7AA 2BV3A 3CDIA 4QNKA 4JI8E 4DR4I 4FW4A 3QT6A 3ZZ0A 4IFDF 1S4EA 1I94E 4RPFA 2UUCI 1D6TA 2UXCI 2NN6C 1N33E 4X66I 4JI2I 4DUZI 4KHPE 4JI4I 1N0UA 4NXME 1N0VC 2VQEE 2J7KA 2E5LI 4HACA 5C0XA 2PO0B 2PNZB 2V2QA 3Q6NA 4DV4E 3T1HI 3ZZUA 5C0XE 1HNZI 2PO1B 3P06A 1UEKA 3GMEA 4DV1E 1XNQE 4N3OA 1Y6ZA 4LFBE 5LMNI 1OYPA 1EI1A 2O1UA 1A6FA 1Z0VA 4FW3A 3Q6MA 1U2RA 5K36A 1YH8A 4DR5E 1HNWE 2NN6F 4R1FA 4DV2E 4DR7I 3LTOA 5K36E 1N32E 4FWDA 3PS2A 4USMA 2JEBB 1XMOE 2GO4A 4B3RE 1UDSA 5JEAD 2C37B 2IOPA 2F1DA 3H4LA 2UXBE 2JEAB 1FJGE 2WW4A 4DPXA 1BKNA 1I94I 2A2DA 4OX9I 2C39B 4DV5E 1QZRA 4KQVA 2Z5BB 4NXMI 4KHPI 1VISA 3NZKA 2AJ4A 2VQEI 4I3HA 1FWLA 4HXZA 4DV4I 2JE6A 3L7ZB 1Y4UA 4LOMA 4UT4A 2HK2A 1Y5YA 4LPFA 4JI7E 2UUCE 4LFBI 5FWKA 4Z7CA 4X66E 4JI2E 2GQ0A 3LPSA 1KTVA 1H7UA 3QT8A 4JG4A 4MYUA 3V2UC 2O1WA 4DR5I 4B3TE 2ZM6E 1HNWI 2CG9A 1UDQA 1N32I 2EFGA 3T1HE 1XMOI 4JI6E 1HNZE 5K36D 4B3RI 3P3GA 4P52A 4YY3I 5LMNE 4OO1C 2UXBI 3U1KA 5ELWA 1FJGI 3T1YE 4MU3A 3F0NA 4HACB 1E3PA 3J7AG 5JEAA 3P76A 5C0XB 3P3CA 1ZXMA 3B4TA 4IS9A 2C38A 5GMDA 4DV5I 5EL9A 4LF4E 5LL6R 3M85D 5JEAE 1R6MA 3U1YA 4DR3E 5BR8E 4JI0E 5LMUE 1ZXNA 5K36B 1YHCA 4LFCE 1H7SA 4DU8A 4JI7I 4MQYA 2BA1G 1RREA 2F4VI 4LF5E 4OO1F 4OX9E 3LNUA 4ED4A 4B3TI 2ZM6I 1PVGA 4EMDA 2XEXA 2ZITA 4JI6I 2O1TA 1Z59A 2CVEA 2J65A 2BM1A 1RHYA 4NBQA 3GONA 2JT2A 3GLLA 4LCGA 3CWVA 4PRVA 1OYSA 3T1YI 4PU9A 3V5RA 1WUUA 4DV3I 4U3DA 2WP8A 4JI3E 5DRQA 4OKGA 1OYRA 4IFDA 1K47A 2HFUA 4WUCA 4X64E 4LF4I 2WNRA 2JE6B 2ZBKB 1N34E 4OZEA 4IFDE 4DR3I 5BR8I 3M85G 4BA1A 1PKPA 4AIMA 4NXNE 4JI5E 4QNJA 1FNMA 4YY3E 4LFAE 4JI0I 5LMUI 1Z0TA 2DEIA 3D4JA 4JV5I 4LFCI 2HHHE 1FWKA 4MU1A 4B3SE 4X62E 4LF5I 4MYTA 3B78A 3HKMA 4DV0E 4ZVIA 1USVA 4B3MI 4JYAE 4J3DA 3HJCA 3ZKDA 2NN6A 3B82A 2BA1D 3WU5A 1OJ4A 5JEAB 4FW7A 1KVKA 2NN6E 1USUA 4HY1A 1B62A 4K0KE 3PYDA 1FI4A 4JI3I 4YHHE 1UDOA 2OI2A 1H74A 4JI1I 4HYMA 2R3VA 2Z5EA 4X64I 4LF9E 1NHHA 1Z0CA 5C0XC 2O1VA 3GCMA 1N34I 1R6LA 2UUBI 2VQFE 2VESA 4NXNI 4DR2I 4JI5I 4IZKA 4IFDD 4LFAI 1Z0EA 2JEAA 4XTJA 3PYEA 4LCHA 4USKA 1IBME 4OO1D 2O3ZA 4DV3E 2HHHI 2V2ZA 4B3SI 4X62I 3PRYA 5DROA 2Z5BA 5K36C 5IT9Q 1RR9A 1N36E 2UUAE 1MX0A 5GMEA 2PNMA 5EKWA 4DV0I 4DV6E 4DR6E 2HFSA 2IERA 3OTOE 2R42A 3ZM7A 5IT9C 4JYAI 2Z5CA 1PIEA 2V8PA 2HK3A 5C0XF 3HULA 3WU4A 4GKJE 4JV5E 5IWAI 2WP8B 1DARA 1HK7A 4IFDB 3M7NG 4Z7YA 1Z5BA 1IBLE 4K0KI 2BA0G 2WNRB 4IZJA 2UU9E 2UXDE 2A2CA 2HKEA 4DPTA 2NN6D 4AQYE 4YHHI 3DD6A 4B3ME 1Z0WA 2PO2A 4BA1B 2BR2A 1Z0BA 3JAMQ 4LF9I 5K36F 3J81Q 4LF6E 2V34A 1MU5A 1ZM3A 4DR1E 3K17A 2E1RA 3JAMC 2VQFI 1Z0GA 3J81C 4FW5A 1XNRE 1HR0E 3QT7A 1NHJA 1HNXE 3QT5A 4BA2A 3PYGA 3K85A 3Q1QA 4DUYI 4FW6A 1IBMI 1XXEA 1MG7A 4JI1E 3P3EA 5DNLA 1N36I 2UUAI 2NN6B 4OO1A 4DV6I 1XMQE 4DR6I 3OTOI 1ZM4A 2UUBE 4DV7E 1VI7A 4DR2E 3ZZTA 1KIJA 5A2QQ 4OO1E 4GKJI 1H72C 4DXLA 4FWHA 2PNLA 1E3HA 5A2QC 1J5EE 4LCFA 4LF7E 1NHIA 1P42A 1IBKE 1IBLI 2UXDI 2UU9I 1Y4SA 3J7AM 4X65E 5JEAC 4AQYI 4URLA 2GO3A 2PO0A 2PNZA 5L3JA 1Y60A 4IZKB 2F4VE 4LF6I 3H1CA 4JI8I 4MDTA 1H73A 1Z5AA 3CDJA 1NZ0A 4IZJD 4U3BA 4DR1I 2NPFA 2PO1A 3M7ND 5IWAE 1HR0I 4FW9A 1XNRI 2BA0D 1N33I 2C38B 1HNXI 4PRXA 3K1JA 3ZKBA 4DPWA 4AIDA 5FLXQ 1ELOA 4GQUA 4LF8E 3PS1A 2VF3A 4DPYA 4GKKE 1UDNA 1ZM2A 5FLXC 2Z5CB 3J80Q 4DR4E 5JEAF 2JEBA 1XMQI 2X7IA 4DV1I 1XNQI 4DV7I 2IESA 5C0XD 3J80C 1XHKA 2C37A 2UXCE 3WU6A 3PYFA 4DUZE 4IZJB 4DPUA 4DUYE 5DNXA 4JI4E 3WU3A 2GS8A 2E5LE 4MU4A 2V2VA 2HKJA 1J5EI 3UHMA 2PO2B 4DV2I 2AE8A 4LF7I 2BR2B 5DRRA 2C39A 1IBKI 4M1KA 4X65I 2BM0A 2X36A 5DRPA 4IFDC 1Z5CA 4ISAA 4AM3A 4DU7A 1EA6A 2CZ9A 2LJPA 2IOQA
chains in the Genus database with same CATH topology
3M6AA 1KKHA 2DEJA 1ZM9A 2Q2EB 1B63A 4DR7E 1S16A 4FWGA 4WUDA 4WUBA 4LF8I 1FKAE 3B8HA 4UTGA 4GKKI 4FN5A 2CGEA 4P7AA 2BV3A 4DR4I 4JI8E 3QT6A 3ZZ0A 1S4EA 1I94E 4RPFA 2UUCI 1D6TA 2UXCI 1N33E 4X66I 4JI2I 4DUZI 4KHPE 4JI4I 1N0UA 4NXME 1N0VC 2VQEE 2J7KA 2E5LI 4HACA 2V2QA 3Q6NA 4DV4E 3T1HI 3ZZUA 1HNZI 3P06A 1UEKA 4DV1E 1XNQE 4N3OA 1Y6ZA 4LFBE 5LMNI 1EI1A 2O1UA 1A6FA 1Z0VA 3Q6MA 1U2RA 4DR5E 1HNWE 4R1FA 4DV2E 4DR7I 3LTOA 1N32E 4FWDA 4USMA 1XMOE 4B3RE 2IOPA 3H4LA 2UXBE 1FJGE 2WW4A 4DPXA 1BKNA 1I94I 2A2DA 4OX9I 4DV5E 1QZRA 2Z5BB 4KQVA 4NXMI 4KHPI 1VISA 2VQEI 2AJ4A 4I3HA 1FWLA 4HXZA 4DV4I 1Y4UA 4UT4A 2HK2A 4JI7E 2UUCE 4LFBI 5FWKA 4Z7CA 4X66E 4JI2E 2GQ0A 3LPSA 1KTVA 1H7UA 3QT8A 4JG4A 4MYUA 3V2UC 2O1WA 4DR5I 4B3TE 2ZM6E 1HNWI 2CG9A 1N32I 2EFGA 3T1HE 1XMOI 4JI6E 1HNZE 4B3RI 4P52A 4YY3I 5LMNE 2UXBI 1FJGI 3T1YE 3F0NA 4HACB 3J7AG 1ZXMA 5GMDA 4DV5I 4LF4E 5LL6R 4DR3E 5BR8E 4JI0E 5LMUE 1ZXNA 4LFCE 1H7SA 4DU8A 4JI7I 1RREA 2F4VI 4LF5E 4OX9E 3LNUA 4ED4A 4B3TI 2ZM6I 1PVGA 4EMDA 2XEXA 2ZITA 4JI6I 2O1TA 1Z59A 2BM1A 3GONA 3CWVA 4PRVA 3T1YI 4PU9A 3V5RA 1WUUA 4DV3I 4JI3E 1K47A 2HFUA 4WUCA 4X64E 4LF4I 2ZBKB 1N34E 4DR3I 5BR8I 1PKPA 4NXNE 4JI5E 4YY3E 1FNMA 4LFAE 4JI0I 5LMUI 1Z0TA 2DEIA 3D4JA 4JV5I 4LFCI 2HHHE 1FWKA 4B3SE 4X62E 4LF5I 4MYTA 3B78A 4DV0E 4ZVIA 1USVA 4B3MI 4JYAE 3HJCA 3ZKDA 3B82A 3WU5A 1OJ4A 1KVKA 1USUA 4HY1A 1B62A 4K0KE 3PYDA 1FI4A 4JI3I 4YHHE 2OI2A 1H74A 4JI1I 4HYMA 2R3VA 2Z5EA 4X64I 4LF9E 1NHHA 1Z0CA 2O1VA 1N34I 2UUBI 2VQFE 4NXNI 4DR2I 4JI5I 4IZKA 4LFAI 1Z0EA 4XTJA 3PYEA 4USKA 1IBME 4DV3E 2HHHI 2V2ZA 4B3SI 4X62I 3PRYA 2Z5BA 5IT9Q 1RR9A 1N36E 2UUAE 1MX0A 5GMEA 2PNMA 4DV0I 4DV6E 4DR6E 2HFSA 3OTOE 2R42A 3ZM7A 5IT9C 4JYAI 2Z5CA 1PIEA 2V8PA 2HK3A 3HULA 3WU4A 4GKJE 4JV5E 5IWAI 1DARA 1HK7A 4Z7YA 1Z5BA 1IBLE 4K0KI 2UXDE 4IZJA 2UU9E 2A2CA 2HKEA 4DPTA 4AQYE 4YHHI 4B3ME 1Z0WA 1Z0BA 3JAMQ 4LF9I 3J81Q 4LF6E 2V34A 1MU5A 1ZM3A 4DR1E 3K17A 2E1RA 3JAMC 2VQFI 1Z0GA 3J81C 1XNRE 1HR0E 3QT7A 1NHJA 1HNXE 3QT5A 3PYGA 3K85A 3Q1QA 4DUYI 1IBMI 1MG7A 4JI1E 1N36I 2UUAI 1XMQE 4DV6I 4DR6I 3OTOI 1ZM4A 2UUBE 4DV7E 4DR2E 2IOQA 1KIJA 5A2QQ 4GKJI 1H72C 4DXLA 4FWHA 2PNLA 5A2QC 1J5EE 4LF7E 1NHIA 1IBKE 1IBLI 2UXDI 2UU9I 1Y4SA 3J7AM 4X65E 4AQYI 4URLA 5L3JA 4IZKB 2F4VE 4LF6I 4JI8I 1H73A 1Z5AA 1NZ0A 4IZJD 4DR1I 2NPFA 5IWAE 1HR0I 4FW9A 1XNRI 1N33I 1HNXI 4PRXA 3K1JA 3ZKBA 4DPWA 5FLXQ 1ELOA 4LF8E 2VF3A 4DPYA 4GKKE 1ZM2A 5FLXC 2Z5CB 3J80Q 4DR4E 1XMQI 2X7IA 4DV1I 1XNQI 4DV7I 3J80C 1XHKA 2UXCE 3WU6A 3PYFA 4DUZE 4IZJB 4DPUA 4DUYE 4JI4E 3WU3A 2GS8A 2E5LE 2V2VA 2HKJA 1J5EI 4DV2I 4LF7I 1IBKI 4M1KA 4X65I 2BM0A 2X36A 1Z5CA 4DU7A 1EA6A 2CZ9A 2LJPA 3ZZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M6A A;  1KKH A;  2DEJ A;  1ZM9 A;  2Q2E B;  1B63 A;  4DR7 E;  1S16 A;  4FWG A;  4WUD A;  4WUB A;  4LF8 I;  1FKA E;  3B8H A;  4UTG A;  4GKK I;  4FN5 A;  4P7A A;  2BV3 A;  4DR4 I;  4JI8 E;  3QT6 A;  3ZZ0 A;  1S4E A;  1I94 E;  4RPF A;  2UUC I;  1D6T A;  2UXC I;  1N33 E;  4X66 I;  4JI2 I;  4DUZ I;  4KHP E;  4JI4 I;  1N0U A;  4NXM E;  1N0V C;  2VQE E;  2J7K A;  2E5L I;  4HAC A;  2V2Q A;  4DV4 E;  3T1H I;  3ZZU A;  1HNZ I;  1UEK A;  4DV1 E;  1XNQ E;  4LFB E;  5LMN I;  1EI1 A;  1A6F A;  1Z0V A;  1U2R A;  4DR5 E;  1HNW E;  4R1F A;  4DV2 E;  4DR7 I;  3LTO A;  1N32 E;  4FWD A;  4USM A;  1XMO E;  4B3R E;  3H4L A;  2UXB E;  1FJG E;  2WW4 A;  4DPX A;  1BKN A;  1I94 I;  2A2D A;  4OX9 I;  4DV5 E;  1QZR A;  4KQV A;  4NXM I;  4KHP I;  1VIS A;  2VQE I;  2AJ4 A;  4I3H A;  1FWL A;  4HXZ A;  4DV4 I;  4UT4 A;  2HK2 A;  4JI7 E;  2UUC E;  4LFB I;  4Z7C A;  4X66 E;  4JI2 E;  3LPS A;  1KTV A;  1H7U A;  3QT8 A;  4JG4 A;  4MYU A;  3V2U C;  4DR5 I;  4B3T E;  2ZM6 E;  1HNW I;  1N32 I;  2EFG A;  3T1H E;  1XMO I;  4JI6 E;  1HNZ E;  4B3R I;  4P52 A;  4YY3 I;  5LMN E;  2UXB I;  1FJG I;  3T1Y E;  3F0N A;  4HAC B;  3J7A G;  1ZXM A;  5GMD A;  4DV5 I;  4LF4 E;  5LL6 R;  4DR3 E;  5BR8 E;  4JI0 E;  5LMU E;  1ZXN A;  4LFC E;  1H7S A;  4DU8 A;  4JI7 I;  1RRE A;  2F4V I;  4LF5 E;  4OX9 E;  3LNU A;  4ED4 A;  4B3T I;  2ZM6 I;  1PVG A;  4EMD A;  2XEX A;  2ZIT A;  4JI6 I;  1Z59 A;  2BM1 A;  3GON A;  3CWV A;  4PRV A;  3T1Y I;  4PU9 A;  3V5R A;  1WUU A;  4DV3 I;  4JI3 E;  1K47 A;  2HFU A;  4WUC A;  4X64 E;  4LF4 I;  2ZBK B;  1N34 E;  4DR3 I;  5BR8 I;  1PKP A;  4NXN E;  4JI5 E;  4YY3 E;  1FNM A;  4LFA E;  4JI0 I;  5LMU I;  1Z0T A;  2DEI A;  3D4J A;  4JV5 I;  4LFC I;  2HHH E;  1FWK A;  4B3S E;  4X62 E;  4LF5 I;  4MYT A;  3B78 A;  4DV0 E;  4ZVI A;  4B3M I;  4JYA E;  3ZKD A;  3B82 A;  3WU5 A;  1OJ4 A;  1KVK A;  4HY1 A;  1B62 A;  4K0K E;  3PYD A;  1FI4 A;  4JI3 I;  4YHH E;  2OI2 A;  1H74 A;  4JI1 I;  4HYM A;  2R3V A;  4X64 I;  4LF9 E;  1NHH A;  1Z0C A;  1N34 I;  2UUB I;  2VQF E;  4NXN I;  4DR2 I;  4JI5 I;  4LFA I;  1Z0E A;  4XTJ A;  3PYE A;  4USK A;  1IBM E;  4DV3 E;  2HHH I;  2V2Z A;  4B3S I;  4X62 I;  5IT9 Q;  1RR9 A;  1N36 E;  2UUA E;  1MX0 A;  5GME A;  4DV0 I;  4DV6 E;  4DR6 E;  2HFS A;  3OTO E;  2R42 A;  3ZM7 A;  5IT9 C;  4JYA I;  1PIE A;  2V8P A;  2HK3 A;  3HUL A;  3WU4 A;  4GKJ E;  4JV5 E;  5IWA I;  1DAR A;  4Z7Y A;  1Z5B A;  1IBL E;  4K0K I;  2UXD E;  2UU9 E;  2A2C A;  2HKE A;  4DPT A;  4AQY E;  4YHH I;  4B3M E;  1Z0W A;  1Z0B A;  3JAM Q;  4LF9 I;  3J81 Q;  4LF6 E;  2V34 A;  1MU5 A;  1ZM3 A;  4DR1 E;  3K17 A;  2E1R A;  3JAM C;  2VQF I;  1Z0G A;  3J81 C;  1XNR E;  1HR0 E;  3QT7 A;  1NHJ A;  1HNX E;  3QT5 A;  3PYG A;  3Q1Q A;  4DUY I;  1IBM I;  1MG7 A;  4JI1 E;  1N36 I;  2UUA I;  1XMQ E;  4DV6 I;  4DR6 I;  3OTO I;  1ZM4 A;  2UUB E;  4DV7 E;  4DR2 E;  1KIJ A;  5A2Q Q;  4GKJ I;  1H72 C;  4DXL A;  4FWH A;  5A2Q C;  1J5E E;  4LF7 E;  1NHI A;  1IBK E;  1IBL I;  2UXD I;  2UU9 I;  3J7A M;  4X65 E;  4AQY I;  4URL A;  5L3J A;  2F4V E;  4LF6 I;  4JI8 I;  1H73 A;  1Z5A A;  1NZ0 A;  4DR1 I;  2NPF A;  5IWA E;  1HR0 I;  4FW9 A;  1XNR I;  1N33 I;  1HNX I;  4PRX A;  3K1J A;  3ZKB A;  4DPW A;  5FLX Q;  1ELO A;  4LF8 E;  2VF3 A;  4DPY A;  4GKK E;  1ZM2 A;  5FLX C;  3J80 Q;  4DR4 E;  1XMQ I;  2X7I A;  4DV1 I;  1XNQ I;  4DV7 I;  3J80 C;  1XHK A;  2UXC E;  3WU6 A;  3PYF A;  4DUZ E;  4DPU A;  4DUY E;  4JI4 E;  3WU3 A;  2GS8 A;  2E5L E;  2V2V A;  2HKJ A;  1J5E I;  4DV2 I;  4LF7 I;  1IBK I;  4M1K A;  4X65 I;  2BM0 A;  2X36 A;  1Z5C A;  4DU7 A;  1EA6 A;  2CZ9 A;  2LJP A;  3ZZT A; 
#chains in the Genus database with same CATH topology
 3M6A A;  4BA2 B;  3L7Z A;  1KKH A;  2DEJ A;  1ZM9 A;  2Q2E B;  1B63 A;  3KRN A;  4DR7 E;  1S16 A;  4FWG A;  4WUD A;  4MU0 A;  4WUB A;  4LF8 I;  1FKA E;  3B8H A;  4OO1 B;  4UTG A;  4GKK I;  4FN5 A;  2CGE A;  3PS3 A;  4P7A A;  2BV3 A;  3CDI A;  4QNK A;  4JI8 E;  4DR4 I;  4FW4 A;  3QT6 A;  3ZZ0 A;  4IFD F;  1S4E A;  1I94 E;  4RPF A;  2UUC I;  1D6T A;  2UXC I;  2NN6 C;  1N33 E;  4X66 I;  4JI2 I;  4DUZ I;  4KHP E;  4JI4 I;  1N0U A;  4NXM E;  1N0V C;  2VQE E;  2J7K A;  2E5L I;  4HAC A;  5C0X A;  2PO0 B;  2PNZ B;  2V2Q A;  3Q6N A;  4DV4 E;  3T1H I;  3ZZU A;  5C0X E;  1HNZ I;  2PO1 B;  3P06 A;  1UEK A;  3GME A;  4DV1 E;  1XNQ E;  4N3O A;  1Y6Z A;  4LFB E;  5LMN I;  1OYP A;  1EI1 A;  2O1U A;  1A6F A;  1Z0V A;  4FW3 A;  3Q6M A;  1U2R A;  5K36 A;  1YH8 A;  4DR5 E;  1HNW E;  2NN6 F;  4R1F A;  4DV2 E;  4DR7 I;  3LTO A;  5K36 E;  1N32 E;  4FWD A;  3PS2 A;  4USM A;  2JEB B;  1XMO E;  2GO4 A;  4B3R E;  1UDS A;  5JEA D;  2C37 B;  2IOP A;  2F1D A;  3H4L A;  2UXB E;  2JEA B;  1FJG E;  2WW4 A;  4DPX A;  1BKN A;  1I94 I;  2A2D A;  4OX9 I;  2C39 B;  4DV5 E;  1QZR A;  4KQV A;  2Z5B B;  4NXM I;  4KHP I;  1VIS A;  3NZK A;  2AJ4 A;  2VQE I;  4I3H A;  1FWL A;  4HXZ A;  4DV4 I;  2JE6 A;  3L7Z B;  1Y4U A;  4LOM A;  4UT4 A;  2HK2 A;  1Y5Y A;  4LPF A;  4JI7 E;  2UUC E;  4LFB I;  5FWK A;  4Z7C A;  4X66 E;  4JI2 E;  2GQ0 A;  3LPS A;  1KTV A;  1H7U A;  3QT8 A;  4JG4 A;  4MYU A;  3V2U C;  2O1W A;  4DR5 I;  4B3T E;  2ZM6 E;  1HNW I;  2CG9 A;  1UDQ A;  1N32 I;  2EFG A;  3T1H E;  1XMO I;  4JI6 E;  1HNZ E;  5K36 D;  4B3R I;  3P3G A;  4P52 A;  4YY3 I;  5LMN E;  4OO1 C;  2UXB I;  3U1K A;  5ELW A;  1FJG I;  3T1Y E;  4MU3 A;  3F0N A;  4HAC B;  1E3P A;  3J7A G;  5JEA A;  3P76 A;  5C0X B;  3P3C A;  1ZXM A;  3B4T A;  4IS9 A;  2C38 A;  5GMD A;  4DV5 I;  5EL9 A;  4LF4 E;  5LL6 R;  3M85 D;  5JEA E;  1R6M A;  3U1Y A;  4DR3 E;  5BR8 E;  4JI0 E;  5LMU E;  1ZXN A;  5K36 B;  1YHC A;  4LFC E;  1H7S A;  4DU8 A;  4JI7 I;  4MQY A;  2BA1 G;  1RRE A;  2F4V I;  4LF5 E;  4OO1 F;  4OX9 E;  3LNU A;  4ED4 A;  4B3T I;  2ZM6 I;  1PVG A;  4EMD A;  2XEX A;  2ZIT A;  4JI6 I;  2O1T A;  1Z59 A;  2CVE A;  2J65 A;  2BM1 A;  1RHY A;  4NBQ A;  3GON A;  2JT2 A;  3GLL A;  4LCG A;  3CWV A;  4PRV A;  1OYS A;  3T1Y I;  4PU9 A;  3V5R A;  1WUU A;  4DV3 I;  4U3D A;  2WP8 A;  4JI3 E;  5DRQ A;  4OKG A;  1OYR A;  4IFD A;  1K47 A;  2HFU A;  4WUC A;  4X64 E;  4LF4 I;  2WNR A;  2JE6 B;  2ZBK B;  1N34 E;  4OZE A;  4IFD E;  4DR3 I;  5BR8 I;  3M85 G;  4BA1 A;  1PKP A;  4AIM A;  4NXN E;  4JI5 E;  4QNJ A;  1FNM A;  4YY3 E;  4LFA E;  4JI0 I;  5LMU I;  1Z0T A;  2DEI A;  3D4J A;  4JV5 I;  4LFC I;  2HHH E;  1FWK A;  4MU1 A;  4B3S E;  4X62 E;  4LF5 I;  4MYT A;  3B78 A;  3HKM A;  4DV0 E;  4ZVI A;  1USV A;  4B3M I;  4JYA E;  4J3D A;  3HJC A;  3ZKD A;  2NN6 A;  3B82 A;  2BA1 D;  3WU5 A;  1OJ4 A;  5JEA B;  4FW7 A;  1KVK A;  2NN6 E;  1USU A;  4HY1 A;  1B62 A;  4K0K E;  3PYD A;  1FI4 A;  4JI3 I;  4YHH E;  1UDO A;  2OI2 A;  1H74 A;  4JI1 I;  4HYM A;  2R3V A;  2Z5E A;  4X64 I;  4LF9 E;  1NHH A;  1Z0C A;  5C0X C;  2O1V A;  3GCM A;  1N34 I;  1R6L A;  2UUB I;  2VQF E;  2VES A;  4NXN I;  4DR2 I;  4JI5 I;  4IZK A;  4IFD D;  4LFA I;  1Z0E A;  2JEA A;  4XTJ A;  3PYE A;  4LCH A;  4USK A;  1IBM E;  4OO1 D;  2O3Z A;  4DV3 E;  2HHH I;  2V2Z A;  4B3S I;  4X62 I;  3PRY A;  5DRO A;  2Z5B A;  5K36 C;  5IT9 Q;  1RR9 A;  1N36 E;  2UUA E;  1MX0 A;  5GME A;  2PNM A;  5EKW A;  4DV0 I;  4DV6 E;  4DR6 E;  2HFS A;  2IER A;  3OTO E;  2R42 A;  3ZM7 A;  5IT9 C;  4JYA I;  2Z5C A;  1PIE A;  2V8P A;  2HK3 A;  5C0X F;  3HUL A;  3WU4 A;  4GKJ E;  4JV5 E;  5IWA I;  2WP8 B;  1DAR A;  1HK7 A;  4IFD B;  3M7N G;  4Z7Y A;  1Z5B A;  1IBL E;  4K0K I;  2BA0 G;  2WNR B;  4IZJ A;  2UU9 E;  2UXD E;  2A2C A;  2HKE A;  4DPT A;  2NN6 D;  4AQY E;  4YHH I;  3DD6 A;  4B3M E;  1Z0W A;  2PO2 A;  4BA1 B;  2BR2 A;  1Z0B A;  3JAM Q;  4LF9 I;  5K36 F;  3J81 Q;  4LF6 E;  2V34 A;  1MU5 A;  1ZM3 A;  4DR1 E;  3K17 A;  2E1R A;  3JAM C;  2VQF I;  1Z0G A;  3J81 C;  4FW5 A;  1XNR E;  1HR0 E;  3QT7 A;  1NHJ A;  1HNX E;  3QT5 A;  4BA2 A;  3PYG A;  3K85 A;  3Q1Q A;  4DUY I;  4FW6 A;  1IBM I;  1XXE A;  1MG7 A;  4JI1 E;  3P3E A;  5DNL A;  1N36 I;  2UUA I;  2NN6 B;  4OO1 A;  4DV6 I;  1XMQ E;  4DR6 I;  3OTO I;  1ZM4 A;  2UUB E;  4DV7 E;  1VI7 A;  4DR2 E;  3ZZT A;  1KIJ A;  5A2Q Q;  4OO1 E;  4GKJ I;  1H72 C;  4DXL A;  4FWH A;  2PNL A;  1E3H A;  5A2Q C;  1J5E E;  4LCF A;  4LF7 E;  1NHI A;  1P42 A;  1IBK E;  1IBL I;  2UXD I;  2UU9 I;  1Y4S A;  3J7A M;  4X65 E;  5JEA C;  4AQY I;  4URL A;  2GO3 A;  2PO0 A;  2PNZ A;  5L3J A;  1Y60 A;  4IZK B;  2F4V E;  4LF6 I;  3H1C A;  4JI8 I;  4MDT A;  1H73 A;  1Z5A A;  3CDJ A;  1NZ0 A;  4IZJ D;  4U3B A;  4DR1 I;  2NPF A;  2PO1 A;  3M7N D;  5IWA E;  1HR0 I;  4FW9 A;  1XNR I;  2BA0 D;  1N33 I;  2C38 B;  1HNX I;  4PRX A;  3K1J A;  3ZKB A;  4DPW A;  4AID A;  5FLX Q;  1ELO A;  4GQU A;  4LF8 E;  3PS1 A;  2VF3 A;  4DPY A;  4GKK E;  1UDN A;  1ZM2 A;  5FLX C;  2Z5C B;  3J80 Q;  4DR4 E;  5JEA F;  2JEB A;  1XMQ I;  2X7I A;  4DV1 I;  1XNQ I;  4DV7 I;  2IES A;  5C0X D;  3J80 C;  1XHK A;  2C37 A;  2UXC E;  3WU6 A;  3PYF A;  4DUZ E;  4IZJ B;  4DPU A;  4DUY E;  5DNX A;  4JI4 E;  3WU3 A;  2GS8 A;  2E5L E;  4MU4 A;  2V2V A;  2HKJ A;  1J5E I;  3UHM A;  2PO2 B;  4DV2 I;  2AE8 A;  4LF7 I;  2BR2 B;  5DRR A;  2C39 A;  1IBK I;  4M1K A;  4X65 I;  2BM0 A;  2X36 A;  5DRP A;  4IFD C;  1Z5C A;  4ISA A;  4AM3 A;  4DU7 A;  1EA6 A;  2CZ9 A;  2LJP A;  2IOQ A; 
#chains in the Genus database with same CATH homology
 3M6A A;  1KKH A;  2DEJ A;  1ZM9 A;  2Q2E B;  1B63 A;  4DR7 E;  1S16 A;  4FWG A;  4WUD A;  4WUB A;  4LF8 I;  1FKA E;  3B8H A;  4UTG A;  4GKK I;  4FN5 A;  2CGE A;  4P7A A;  2BV3 A;  4DR4 I;  4JI8 E;  3QT6 A;  3ZZ0 A;  1S4E A;  1I94 E;  4RPF A;  2UUC I;  1D6T A;  2UXC I;  1N33 E;  4X66 I;  4JI2 I;  4DUZ I;  4KHP E;  4JI4 I;  1N0U A;  4NXM E;  1N0V C;  2VQE E;  2J7K A;  2E5L I;  4HAC A;  2V2Q A;  3Q6N A;  4DV4 E;  3T1H I;  3ZZU A;  1HNZ I;  3P06 A;  1UEK A;  4DV1 E;  1XNQ E;  4N3O A;  1Y6Z A;  4LFB E;  5LMN I;  1EI1 A;  2O1U A;  1A6F A;  1Z0V A;  3Q6M A;  1U2R A;  4DR5 E;  1HNW E;  4R1F A;  4DV2 E;  4DR7 I;  3LTO A;  1N32 E;  4FWD A;  4USM A;  1XMO E;  4B3R E;  2IOP A;  3H4L A;  2UXB E;  1FJG E;  2WW4 A;  4DPX A;  1BKN A;  1I94 I;  2A2D A;  4OX9 I;  4DV5 E;  1QZR A;  2Z5B B;  4KQV A;  4NXM I;  4KHP I;  1VIS A;  2VQE I;  2AJ4 A;  4I3H A;  1FWL A;  4HXZ A;  4DV4 I;  1Y4U A;  4UT4 A;  2HK2 A;  4JI7 E;  2UUC E;  4LFB I;  5FWK A;  4Z7C A;  4X66 E;  4JI2 E;  2GQ0 A;  3LPS A;  1KTV A;  1H7U A;  3QT8 A;  4JG4 A;  4MYU A;  3V2U C;  2O1W A;  4DR5 I;  4B3T E;  2ZM6 E;  1HNW I;  2CG9 A;  1N32 I;  2EFG A;  3T1H E;  1XMO I;  4JI6 E;  1HNZ E;  4B3R I;  4P52 A;  4YY3 I;  5LMN E;  2UXB I;  1FJG I;  3T1Y E;  3F0N A;  4HAC B;  3J7A G;  1ZXM A;  5GMD A;  4DV5 I;  4LF4 E;  5LL6 R;  4DR3 E;  5BR8 E;  4JI0 E;  5LMU E;  1ZXN A;  4LFC E;  1H7S A;  4DU8 A;  4JI7 I;  1RRE A;  2F4V I;  4LF5 E;  4OX9 E;  3LNU A;  4ED4 A;  4B3T I;  2ZM6 I;  1PVG A;  4EMD A;  2XEX A;  2ZIT A;  4JI6 I;  2O1T A;  1Z59 A;  2BM1 A;  3GON A;  3CWV A;  4PRV A;  3T1Y I;  4PU9 A;  3V5R A;  1WUU A;  4DV3 I;  4JI3 E;  1K47 A;  2HFU A;  4WUC A;  4X64 E;  4LF4 I;  2ZBK B;  1N34 E;  4DR3 I;  5BR8 I;  1PKP A;  4NXN E;  4JI5 E;  4YY3 E;  1FNM A;  4LFA E;  4JI0 I;  5LMU I;  1Z0T A;  2DEI A;  3D4J A;  4JV5 I;  4LFC I;  2HHH E;  1FWK A;  4B3S E;  4X62 E;  4LF5 I;  4MYT A;  3B78 A;  4DV0 E;  4ZVI A;  1USV A;  4B3M I;  4JYA E;  3HJC A;  3ZKD A;  3B82 A;  3WU5 A;  1OJ4 A;  1KVK A;  1USU A;  4HY1 A;  1B62 A;  4K0K E;  3PYD A;  1FI4 A;  4JI3 I;  4YHH E;  2OI2 A;  1H74 A;  4JI1 I;  4HYM A;  2R3V A;  2Z5E A;  4X64 I;  4LF9 E;  1NHH A;  1Z0C A;  2O1V A;  1N34 I;  2UUB I;  2VQF E;  4NXN I;  4DR2 I;  4JI5 I;  4IZK A;  4LFA I;  1Z0E A;  4XTJ A;  3PYE A;  4USK A;  1IBM E;  4DV3 E;  2HHH I;  2V2Z A;  4B3S I;  4X62 I;  3PRY A;  2Z5B A;  5IT9 Q;  1RR9 A;  1N36 E;  2UUA E;  1MX0 A;  5GME A;  2PNM A;  4DV0 I;  4DV6 E;  4DR6 E;  2HFS A;  3OTO E;  2R42 A;  3ZM7 A;  5IT9 C;  4JYA I;  2Z5C A;  1PIE A;  2V8P A;  2HK3 A;  3HUL A;  3WU4 A;  4GKJ E;  4JV5 E;  5IWA I;  1DAR A;  1HK7 A;  4Z7Y A;  1Z5B A;  1IBL E;  4K0K I;  2UXD E;  4IZJ A;  2UU9 E;  2A2C A;  2HKE A;  4DPT A;  4AQY E;  4YHH I;  4B3M E;  1Z0W A;  1Z0B A;  3JAM Q;  4LF9 I;  3J81 Q;  4LF6 E;  2V34 A;  1MU5 A;  1ZM3 A;  4DR1 E;  3K17 A;  2E1R A;  3JAM C;  2VQF I;  1Z0G A;  3J81 C;  1XNR E;  1HR0 E;  3QT7 A;  1NHJ A;  1HNX E;  3QT5 A;  3PYG A;  3K85 A;  3Q1Q A;  4DUY I;  1IBM I;  1MG7 A;  4JI1 E;  1N36 I;  2UUA I;  1XMQ E;  4DV6 I;  4DR6 I;  3OTO I;  1ZM4 A;  2UUB E;  4DV7 E;  4DR2 E;  2IOQ A;  1KIJ A;  5A2Q Q;  4GKJ I;  1H72 C;  4DXL A;  4FWH A;  2PNL A;  5A2Q C;  1J5E E;  4LF7 E;  1NHI A;  1IBK E;  1IBL I;  2UXD I;  2UU9 I;  1Y4S A;  3J7A M;  4X65 E;  4AQY I;  4URL A;  5L3J A;  4IZK B;  2F4V E;  4LF6 I;  4JI8 I;  1H73 A;  1Z5A A;  1NZ0 A;  4IZJ D;  4DR1 I;  2NPF A;  5IWA E;  1HR0 I;  4FW9 A;  1XNR I;  1N33 I;  1HNX I;  4PRX A;  3K1J A;  3ZKB A;  4DPW A;  5FLX Q;  1ELO A;  4LF8 E;  2VF3 A;  4DPY A;  4GKK E;  1ZM2 A;  5FLX C;  2Z5C B;  3J80 Q;  4DR4 E;  1XMQ I;  2X7I A;  4DV1 I;  1XNQ I;  4DV7 I;  3J80 C;  1XHK A;  2UXC E;  3WU6 A;  3PYF A;  4DUZ E;  4IZJ B;  4DPU A;  4DUY E;  4JI4 E;  3WU3 A;  2GS8 A;  2E5L E;  2V2V A;  2HKJ A;  1J5E I;  4DV2 I;  4LF7 I;  1IBK I;  4M1K A;  4X65 I;  2BM0 A;  2X36 A;  1Z5C A;  4DU7 A;  1EA6 A;  2CZ9 A;  2LJP A;  3ZZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...