4JI8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8I00
4MYTA 4DR5E 2V2QA 3OTOE 1FKAE 3T1YI 4DR3E 1N33E 4LFAI 1PKPA 4PU9A 3PYEA 4JYAI 1HNWE 4FWHA 1XNQI 2E5LE 1Z0EA 2CZ9A 3J81Q 4X66E 2UXDI 3QT5A 2LJPA 4DV4E 1K47A 4DV6I 5LMUI 1H73A 4PRVA 4YY3E 4DV0I 3T1YE 2A2DA 3PYGA 4DPUA 4B3SE 4LFAE 4DR2E 2HKEA 1WUUA 2UU9I 2V2ZA 4JYAE 4LF6I 3LPSA 4GKJI 2VQEI 2HFSA 3ZZTA 1RR9A 1XMQI 2HK3A 1NHHA 1NHIA 5IWAI 4HXZA 2HFUA 3K1JA 4JI7E 3JAMC 1MX0A 1Z0TA 4LFCE 5LMUE 3J7AM 3QT8A 4DV0E 1N36I 1IBKE 5FLXQ 4LFBI 1FI4A 3F0NA 1ZXMA 1HR0I 2UU9E 4JI2E 2J7KA 4X62I 3J80C 1XHKA 2XEXA 3JAMQ 4GKJE 3WU3A 4GKKI 2F4VI 1KIJA 1I94E 4DPYA 1N0VC 2Q2EB 3B8HA 4NXNI 1Z5AA 5A2QQ 5IWAE 4DR1E 4FWDA 3CWVA 4K0KI 1J5EE 3J80Q 4DPXA 3QT6A 4JI1I 4DV7I 3ZM7A 3ZZUA 5GMEA 2V34A 1H7UA 3B78A 1Z0BA 4X62E 1H72C 2UUCI 2WW4A 2F4VE 1VISA 4UT4A 3T1HE 4P52A 4HY1A 4B3RE 1N32I 3ZZ0A 1FJGI 4NXNE 1DARA 1B62A 4K0KE 4FN5A 3M6AA 4JI0I 5LMNE 1N34I 4DUZI 3GONA 2X7IA 4UTGA 4DUYE 3ZKBA 2NPFA 4FW9A 4JI1E 4DV7E 1KTVA 2ZM6E 4B3ME 4OX9I 1B63A 1XMOE 3QT7A 4DR4E 4DV5I 3WU6A 1Z0WA 4KHPI 3LTOA 4DXLA 1FWLA 4LF7I 1N0UA 1N34E 1XNQE 1UEKA 1Z59A 1Z0GA 4DV1I 2UXDE 1HNXI 1XNRI 3J7AG 4USMA 4NXMI 4JI6I 5LL6R 4USKA 4ZVIA 4OX9E 3V2UC 2VQFI 4JI4I 4DV6E 2HK2A 4Z7CA 1Z5BA 1ZM3A 5IT9C 1ZM2A 5L3JA 4MYUA 4LF6E 1ZXNA 4HACB 2HHHI 4JG4A 4KQVA 2VQEE 5BR8I 4EMDA 1XMQE 1XNRE 2BM0A 1MU5A 4JI6E 1S4EA 5GMDA 4DR6I 5IT9Q 1IBLI 2VQFE 1ELOA 2BM1A 4FWGA 3B82A 4JI4E 2HKJA 2X36A 4WUDA 2DEJA 1N36E 4JI3I 4I3HA 4LF4I 4JV5I 1BKNA 4PRXA 4LFBE 2UXBI 4DR5I 1HR0E 3OTOI 4XTJA 4M1KA 4DR3I 1H7SA 1N33I 2HHHE 4GKKE 1MG7A 1HNWI 1KVKA 4DR6E 1QZRA 1U2RA 4LF5I 1IBLE 4B3TI 1NHJA 4R1FA 4LF9I 1OJ4A 4LF4E 4JV5E 3H4LA 3J81C 2UXBE 4RPFA 4DPTA 4LF8I 1RREA 2UUAI 3Q1QA 4DPWA 3PYDA 4B3SI 1PVGA 3LNUA 4DR2I 2UUCE 4WUCA 1N32E 1FJGE 1Z0CA 4LF5E 1IBMI 4AQYI 4DU8A 4B3TE 1ZM4A 4JI0E 4DUZE 4LF9E 2ZBKB 4JI7I 4LFCI 4DU7A 2V2VA 4P7AA 2R3VA 4HYMA 4DV3I 4DR7I 1IBKI 4LF8E 4YHHI 1KKHA 3PYFA 3V5RA 2UUAE 4X65I 4JI8I 3HULA 2DEIA 2GS8A 4JI2I 2UXCI 3D4JA 3K17A 1EI1A 4DV5E 4KHPE 5FLXC 1I94I 1IBME 4LF7E 1NZ0A 1Z0VA 4AQYE 3WU4A 4DR1I 2OI2A 2VF3A 1PIEA 1J5EI 2R42A 1HNZI 4DV1E 4DV3E 1HNXE 4DR7E 4NXME 2A2CA 4YHHE 1EA6A 1D6TA 5A2QC 2UUBI 4X65E 4JI8E 4ED4A 2ZITA 4Z7YA 2AJ4A 4WUBA 4DV2I 2UXCE 4X64I 4JI5I 1ZM9A 3T1HI 2E1RA 4B3RI 3ZKDA 5BR8E 1HNZE 1H74A 5LMNI 4HACA 1S16A 4DUYI 2E5LI 2UUBE 2EFGA 3WU5A 4X66I 2ZM6I 1A6FA 1Z5CA 4URLA 4DV2E 2V8PA 4B3MI 4X64E 4JI5E 4DV4I 1XMOI 4JI3E 1FWKA 2BV3A 1FNMA 4DR4I 4YY3I
chains in the Genus database with same CATH superfamily
4MYTA 4DR5E 2V2QA 3OTOE 1FKAE 3T1YI 4DR3E 1OYRA 1N33E 4LFAI 3CDJA 1PKPA 4PU9A 3Q6NA 2J65A 3PYEA 4JYAI 1HNWE 4FWHA 2O1TA 1XNQI 2E5LE 2PO0B 2AE8A 3GCMA 1Z0EA 2CZ9A 3KRNA 3J81Q 4X66E 2UXDI 4N3OA 5C0XA 3QT5A 2LJPA 4QNJA 4DV4E 1K47A 4DV6I 1HK7A 5LMUI 1H73A 5EKWA 4PRVA 5K36B 3PS1A 4YY3E 4DV0I 2NN6A 2PNMA 2BR2B 3T1YE 2A2DA 2JEBB 3PYGA 5K36D 1UDNA 4DPUA 1YHCA 4B3SE 4LFAE 4DR2E 2HKEA 1WUUA 2UU9I 2V2ZA 4JYAE 2Z5BA 4LF6I 4AIDA 5JEAF 4IFDC 3LPSA 2WNRB 4GKJI 2VQEI 4OO1E 2HFSA 3ZZTA 1RR9A 1XMQI 1OYSA 4MU1A 2HK3A 1NHHA 3P3CA 1NHIA 5IWAI 4HXZA 4LCGA 2HFUA 5C0XE 3K1JA 4JI7E 3PS3A 1MX0A 1Z0TA 3JAMC 4LFCE 2PNZA 5LMUE 3J7AM 3QT8A 2O3ZA 4DV0E 1N36I 3L7ZB 1IBKE 5FLXQ 2JE6B 4LFBI 1FI4A 2IESA 2O1UA 1USUA 4MU4A 3F0NA 1ZXMA 2NN6E 1HR0I 3P06A 2UU9E 2JEAA 4JI2E 3NZKA 4BA2A 2J7KA 4X62I 3J80C 1XHKA 2XEXA 3JAMQ 4GKJE 4AIMA 3WU3A 4IZJB 4GKKI 1YH8A 2F4VI 1KIJA 1I94E 1Y4SA 4DPYA 1N0VC 4OKGA 3HJCA 2Q2EB 4IZJD 3B8HA 4NXNI 1OYPA 1Z5AA 5A2QQ 5IWAE 4DR1E 4FWDA 3CWVA 4K0KI 2IERA 1P42A 1RHYA 1J5EE 1Y60A 2Z5CB 2C37A 4LCHA 3J80Q 4DPXA 3QT6A 4JI1I 4DV7I 3ZM7A 3ZZUA 5GMEA 4BA1B 2V34A 1H7UA 3B78A 1Z0BA 4OO1B 4LCFA 4ISAA 4X62E 1H72C 2UUCI 2WW4A 4OO1F 2F4VE 4OO1D 1VISA 4UT4A 3T1HE 4P52A 4HY1A 4B3RE 1N32I 3ZZ0A 2O1VA 1E3PA 1FJGI 4NXNE 4OZEA 1DARA 1B62A 5DRQA 5EL9A 4K0KE 2IOQA 3H1CA 5C0XD 4FN5A 3Q6MA 3M6AA 4JI0I 5LMNE 1N34I 4DUZI 3GONA 2X7IA 4UTGA 4DUYE 3ZKBA 2NPFA 4FW9A 4JI1E 4DV7E 1KTVA 2ZM6E 2PO1A 4IFDE 2NN6D 4B3ME 4OX9I 5JEAC 1B63A 1XMOE 3QT7A 4DR4E 2CVEA 4DV5I 1R6MA 3WU6A 3U1KA 1Z0WA 2C39A 4IZKB 4KHPI 3LTOA 3B4TA 2PO2A 5K36F 4LPFA 4FW5A 4DXLA 1FWLA 3DD6A 4LF7I 1N0UA 3PS2A 5DRPA 1N34E 1XNQE 3P3EA 1UEKA 1Z59A 1Y4UA 1Z0GA 4DV1I 2UXDE 4QNKA 2GO3A 1HNXI 1XNRI 3J7AG 4USMA 4NXMI 4JI6I 5LL6R 4USKA 4ZVIA 4OX9E 5FWKA 3V2UC 2VQFI 3M7ND 4JI4I 4DV6E 2Z5EA 2HK2A 4MDTA 1UDSA 4Z7CA 4MU0A 1Z5BA 1ZM3A 5IT9C 4IS9A 2GO4A 1ZM2A 5L3JA 4U3BA 2PNLA 4MYUA 4LF6E 1ZXNA 2C37B 4HACB 2C38A 3K85A 2WP8B 5JEAA 2HHHI 4JG4A 4IFDB 4KQVA 2VQEE 5BR8I 3M85G 4EMDA 1XMQE 1XNRE 2WNRA 2BM0A 1XXEA 1MU5A 4IFDD 4JI6E 4U3DA 1S4EA 5GMDA 4DR6I 5IT9Q 3GLLA 4FW3A 1IBLI 2VQFE 1ELOA 2BM1A 4FWGA 3B82A 4OO1C 4JI4E 2HKJA 2X36A 2IOPA 2BA1D 4WUDA 2DEJA 5DROA 1N36E 4JI3I 4I3HA 4LF4I 4JV5I 1BKNA 4PRXA 4LFBE 2UXBI 4DR5I 3L7ZA 1HR0E 3OTOI 4XTJA 2JE6A 4FW7A 1R6LA 4M1KA 4DR3I 1H7SA 1N33I 2F1DA 2HHHE 4GKKE 1MG7A 1HNWI 1UDQA 3HKMA 1KVKA 5JEAE 5C0XB 4FW4A 4DR6E 1QZRA 1U2RA 3M85D 5C0XF 4LF5I 1IBLE 4B3TI 1NHJA 4GQUA 4R1FA 4LF9I 4FW6A 1OJ4A 2NN6B 4LF4E 2Z5CA 4JV5E 5K36C 3H4LA 3J81C 2UXBE 4RPFA 3M7NG 2NN6F 4DPTA 4LF8I 3CDIA 1RREA 3PRYA 2UUAI 4BA1A 2Z5BB 3Q1QA 3U1YA 4DPWA 3PYDA 4B3SI 1PVGA 3LNUA 4DR2I 2UUCE 4WUCA 4OO1A 4MQYA 1N32E 1FJGE 1Z0CA 4LF5E 1IBMI 4AQYI 4DU8A 4B3TE 1ZM4A 4JI0E 2PNZB 5ELWA 4DUZE 4LF9E 2ZBKB 5DRRA 4JI7I 4LFCI 4DU7A 2V2VA 4P7AA 2BA0G 2R3VA 3P3GA 4HYMA 4DV3I 4DR7I 2PO0A 1IBKI 3P76A 5DNXA 4LF8E 4YHHI 1KKHA 3PYFA 2BA1G 3V5RA 2UUAE 4X65I 4JI8I 2JEAB 3HULA 1USVA 4BA2B 2C38B 2DEIA 5JEAB 2GS8A 4JI2I 2UXCI 3D4JA 3K17A 1EI1A 4DV5E 5JEAD 4KHPE 5FLXC 1I94I 5K36A 1VI7A 1IBME 4LF7E 1NZ0A 4IZKA 1Z0VA 4AQYE 3WU4A 2BR2A 1UDOA 4DR1I 5DNLA 2JEBA 2OI2A 2VF3A 1PIEA 4LOMA 1J5EI 2R42A 1HNZI 4DV1E 4DV3E 1HNXE 4DR7E 4IFDF 4NXME 2A2CA 4YHHE 1EA6A 1D6TA 5A2QC 2UUBI 4X65E 4JI8E 2BA0D 4ED4A 2ZITA 2CGEA 4Z7YA 2VESA 2AJ4A 4WUBA 4DV2I 2UXCE 4X64I 4JI5I 1ZM9A 1Y5YA 5C0XC 3T1HI 2E1RA 4B3RI 4J3DA 2JT2A 5K36E 1E3HA 3UHMA 3ZKDA 5BR8E 2GQ0A 3GMEA 1HNZE 1H74A 5LMNI 4HACA 1S16A 4MU3A 2NN6C 2O1WA 2WP8A 4DUYI 2E5LI 4IZJA 4IFDA 2PO1B 2UUBE 2EFGA 3WU5A 4X66I 2ZM6I 1Y6ZA 1A6FA 1Z5CA 4URLA 4DV2E 2V8PA 4B3MI 4X64E 4NBQA 4JI5E 4DV4I 1XMOI 4JI3E 1FWKA 2BV3A 2C39B 1FNMA 4DR4I 2PO2B 4AM3A 2CG9A 4YY3I
chains in the Genus database with same CATH topology
4MYTA 4DR5E 2V2QA 3OTOE 1FKAE 3T1YI 4DR3E 1N33E 4LFAI 1PKPA 4PU9A 3Q6NA 3PYEA 4JYAI 1HNWE 4FWHA 2O1TA 1XNQI 2E5LE 1Z0EA 2CZ9A 3J81Q 4X66E 2UXDI 4N3OA 3QT5A 2LJPA 4DV4E 1K47A 4DV6I 1HK7A 5LMUI 1H73A 4PRVA 4YY3E 4DV0I 2PNMA 3T1YE 2A2DA 3PYGA 4DPUA 4B3SE 4LFAE 4DR2E 2HKEA 1WUUA 2UU9I 2V2ZA 4JYAE 2Z5BA 4LF6I 3LPSA 4GKJI 2VQEI 2HFSA 3ZZTA 1RR9A 1XMQI 2HK3A 1NHHA 1NHIA 5IWAI 4HXZA 2HFUA 3K1JA 4JI7E 3JAMC 1MX0A 1Z0TA 4LFCE 5LMUE 3J7AM 3QT8A 4DV0E 1N36I 1IBKE 5FLXQ 4LFBI 1FI4A 2O1UA 1USUA 3F0NA 1ZXMA 1HR0I 3P06A 2UU9E 4JI2E 2J7KA 4X62I 3J80C 1XHKA 2XEXA 3JAMQ 4GKJE 3WU3A 4IZJB 4GKKI 2F4VI 1KIJA 1I94E 1Y4SA 4DPYA 1N0VC 3HJCA 2Q2EB 4IZJD 3B8HA 4NXNI 1Z5AA 5A2QQ 5IWAE 4DR1E 4FWDA 3CWVA 4K0KI 1J5EE 2Z5CB 3J80Q 4DPXA 3QT6A 4JI1I 4DV7I 3ZM7A 3ZZUA 5GMEA 2V34A 1H7UA 3B78A 1Z0BA 4X62E 1H72C 2UUCI 2WW4A 2F4VE 1VISA 4UT4A 3T1HE 4P52A 4HY1A 4B3RE 1N32I 3ZZ0A 2O1VA 1FJGI 4NXNE 1DARA 1B62A 4K0KE 2IOQA 4FN5A 3Q6MA 3M6AA 4JI0I 5LMNE 1N34I 4DUZI 3GONA 2X7IA 4UTGA 4DUYE 3ZKBA 2NPFA 4FW9A 4JI1E 4DV7E 1KTVA 2ZM6E 4B3ME 4OX9I 1B63A 1XMOE 3QT7A 4DR4E 4DV5I 3WU6A 1Z0WA 4IZKB 4KHPI 3LTOA 4DXLA 1FWLA 4LF7I 1N0UA 1N34E 1XNQE 1UEKA 1Z59A 1Y4UA 1Z0GA 4DV1I 2UXDE 1HNXI 1XNRI 3J7AG 4USMA 4NXMI 4JI6I 5LL6R 4USKA 4ZVIA 4OX9E 5FWKA 3V2UC 2VQFI 4JI4I 4DV6E 2Z5EA 2HK2A 4Z7CA 1Z5BA 1ZM3A 5IT9C 1ZM2A 5L3JA 2PNLA 4MYUA 4LF6E 1ZXNA 4HACB 3K85A 2HHHI 4JG4A 4KQVA 2VQEE 5BR8I 4EMDA 1XMQE 1XNRE 2BM0A 1MU5A 4JI6E 1S4EA 5GMDA 4DR6I 5IT9Q 1IBLI 2VQFE 1ELOA 2BM1A 4FWGA 3B82A 4JI4E 2HKJA 2X36A 2IOPA 4WUDA 2DEJA 1N36E 4JI3I 4I3HA 4LF4I 4JV5I 1BKNA 4PRXA 4LFBE 2UXBI 4DR5I 1HR0E 3OTOI 4XTJA 4M1KA 4DR3I 1H7SA 1N33I 2HHHE 4GKKE 1MG7A 1HNWI 1KVKA 4DR6E 1QZRA 1U2RA 4LF5I 1IBLE 4B3TI 1NHJA 4R1FA 4LF9I 1OJ4A 4LF4E 2Z5CA 4JV5E 3H4LA 3J81C 2UXBE 4RPFA 4DPTA 4LF8I 1RREA 3PRYA 2UUAI 2Z5BB 3Q1QA 4DPWA 3PYDA 4B3SI 1PVGA 3LNUA 4DR2I 2UUCE 4WUCA 1N32E 1FJGE 1Z0CA 4LF5E 1IBMI 4AQYI 4DU8A 4B3TE 1ZM4A 4JI0E 4DUZE 4LF9E 2ZBKB 4JI7I 4LFCI 4DU7A 2V2VA 4P7AA 2R3VA 4HYMA 4DV3I 4DR7I 1IBKI 4LF8E 4YHHI 1KKHA 3PYFA 3V5RA 2UUAE 4X65I 4JI8I 3HULA 1USVA 2DEIA 2GS8A 4JI2I 2UXCI 3D4JA 3K17A 1EI1A 4DV5E 4KHPE 5FLXC 1I94I 1IBME 4LF7E 1NZ0A 4IZKA 1Z0VA 4AQYE 3WU4A 4DR1I 2OI2A 2VF3A 1PIEA 1J5EI 2R42A 1HNZI 4DV1E 4DV3E 1HNXE 4DR7E 4NXME 2A2CA 4YHHE 1EA6A 1D6TA 5A2QC 2UUBI 4X65E 4JI8E 4ED4A 2ZITA 2CGEA 4Z7YA 2AJ4A 4WUBA 4DV2I 2UXCE 4X64I 4JI5I 1ZM9A 3T1HI 2E1RA 4B3RI 3ZKDA 5BR8E 2GQ0A 1HNZE 1H74A 5LMNI 4HACA 1S16A 2O1WA 4DUYI 2E5LI 4IZJA 2UUBE 2EFGA 3WU5A 4X66I 2ZM6I 1Y6ZA 1A6FA 1Z5CA 4URLA 4DV2E 2V8PA 4B3MI 4X64E 4JI5E 1XMOI 4DV4I 4JI3E 1FWKA 2BV3A 1FNMA 4DR4I 2CG9A 4YY3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MYT A;  4DR5 E;  2V2Q A;  3OTO E;  1FKA E;  3T1Y I;  4DR3 E;  1N33 E;  4LFA I;  1PKP A;  4PU9 A;  3PYE A;  4JYA I;  1HNW E;  4FWH A;  1XNQ I;  2E5L E;  1Z0E A;  2CZ9 A;  3J81 Q;  4X66 E;  2UXD I;  3QT5 A;  2LJP A;  4DV4 E;  1K47 A;  4DV6 I;  5LMU I;  1H73 A;  4PRV A;  4YY3 E;  4DV0 I;  3T1Y E;  2A2D A;  3PYG A;  4DPU A;  4B3S E;  4LFA E;  4DR2 E;  2HKE A;  1WUU A;  2UU9 I;  2V2Z A;  4JYA E;  4LF6 I;  3LPS A;  4GKJ I;  2VQE I;  2HFS A;  3ZZT A;  1RR9 A;  1XMQ I;  2HK3 A;  1NHH A;  1NHI A;  5IWA I;  4HXZ A;  2HFU A;  3K1J A;  4JI7 E;  3JAM C;  1MX0 A;  1Z0T A;  4LFC E;  5LMU E;  3J7A M;  3QT8 A;  4DV0 E;  1N36 I;  1IBK E;  5FLX Q;  4LFB I;  1FI4 A;  3F0N A;  1ZXM A;  1HR0 I;  2UU9 E;  4JI2 E;  2J7K A;  4X62 I;  3J80 C;  1XHK A;  2XEX A;  3JAM Q;  4GKJ E;  3WU3 A;  4GKK I;  2F4V I;  1KIJ A;  1I94 E;  4DPY A;  1N0V C;  2Q2E B;  3B8H A;  4NXN I;  1Z5A A;  5A2Q Q;  5IWA E;  4DR1 E;  4FWD A;  3CWV A;  4K0K I;  1J5E E;  3J80 Q;  4DPX A;  3QT6 A;  4JI1 I;  4DV7 I;  3ZM7 A;  3ZZU A;  5GME A;  2V34 A;  1H7U A;  3B78 A;  1Z0B A;  4X62 E;  1H72 C;  2UUC I;  2WW4 A;  2F4V E;  1VIS A;  4UT4 A;  3T1H E;  4P52 A;  4HY1 A;  4B3R E;  1N32 I;  3ZZ0 A;  1FJG I;  4NXN E;  1DAR A;  1B62 A;  4K0K E;  4FN5 A;  3M6A A;  4JI0 I;  5LMN E;  1N34 I;  4DUZ I;  3GON A;  2X7I A;  4UTG A;  4DUY E;  3ZKB A;  2NPF A;  4FW9 A;  4JI1 E;  4DV7 E;  1KTV A;  2ZM6 E;  4B3M E;  4OX9 I;  1B63 A;  1XMO E;  3QT7 A;  4DR4 E;  4DV5 I;  3WU6 A;  1Z0W A;  4KHP I;  3LTO A;  4DXL A;  1FWL A;  4LF7 I;  1N0U A;  1N34 E;  1XNQ E;  1UEK A;  1Z59 A;  1Z0G A;  4DV1 I;  2UXD E;  1HNX I;  1XNR I;  3J7A G;  4USM A;  4NXM I;  4JI6 I;  5LL6 R;  4USK A;  4ZVI A;  4OX9 E;  3V2U C;  2VQF I;  4JI4 I;  4DV6 E;  2HK2 A;  4Z7C A;  1Z5B A;  1ZM3 A;  5IT9 C;  1ZM2 A;  5L3J A;  4MYU A;  4LF6 E;  1ZXN A;  4HAC B;  2HHH I;  4JG4 A;  4KQV A;  2VQE E;  5BR8 I;  4EMD A;  1XMQ E;  1XNR E;  2BM0 A;  1MU5 A;  4JI6 E;  1S4E A;  5GMD A;  4DR6 I;  5IT9 Q;  1IBL I;  2VQF E;  1ELO A;  2BM1 A;  4FWG A;  3B82 A;  4JI4 E;  2HKJ A;  2X36 A;  4WUD A;  2DEJ A;  1N36 E;  4JI3 I;  4I3H A;  4LF4 I;  4JV5 I;  1BKN A;  4PRX A;  4LFB E;  2UXB I;  4DR5 I;  1HR0 E;  3OTO I;  4XTJ A;  4M1K A;  4DR3 I;  1H7S A;  1N33 I;  2HHH E;  4GKK E;  1MG7 A;  1HNW I;  1KVK A;  4DR6 E;  1QZR A;  1U2R A;  4LF5 I;  1IBL E;  4B3T I;  1NHJ A;  4R1F A;  4LF9 I;  1OJ4 A;  4LF4 E;  4JV5 E;  3H4L A;  3J81 C;  2UXB E;  4RPF A;  4DPT A;  4LF8 I;  1RRE A;  2UUA I;  3Q1Q A;  4DPW A;  3PYD A;  4B3S I;  1PVG A;  3LNU A;  4DR2 I;  2UUC E;  4WUC A;  1N32 E;  1FJG E;  1Z0C A;  4LF5 E;  1IBM I;  4AQY I;  4DU8 A;  4B3T E;  1ZM4 A;  4JI0 E;  4DUZ E;  4LF9 E;  2ZBK B;  4JI7 I;  4LFC I;  4DU7 A;  2V2V A;  4P7A A;  2R3V A;  4HYM A;  4DV3 I;  4DR7 I;  1IBK I;  4LF8 E;  4YHH I;  1KKH A;  3PYF A;  3V5R A;  2UUA E;  4X65 I;  4JI8 I;  3HUL A;  2DEI A;  2GS8 A;  4JI2 I;  2UXC I;  3D4J A;  3K17 A;  1EI1 A;  4DV5 E;  4KHP E;  5FLX C;  1I94 I;  1IBM E;  4LF7 E;  1NZ0 A;  1Z0V A;  4AQY E;  3WU4 A;  4DR1 I;  2OI2 A;  2VF3 A;  1PIE A;  1J5E I;  2R42 A;  1HNZ I;  4DV1 E;  4DV3 E;  1HNX E;  4DR7 E;  4NXM E;  2A2C A;  4YHH E;  1EA6 A;  1D6T A;  5A2Q C;  2UUB I;  4X65 E;  4JI8 E;  4ED4 A;  2ZIT A;  4Z7Y A;  2AJ4 A;  4WUB A;  4DV2 I;  2UXC E;  4X64 I;  4JI5 I;  1ZM9 A;  3T1H I;  2E1R A;  4B3R I;  3ZKD A;  5BR8 E;  1HNZ E;  1H74 A;  5LMN I;  4HAC A;  1S16 A;  4DUY I;  2E5L I;  2UUB E;  2EFG A;  3WU5 A;  4X66 I;  2ZM6 I;  1A6F A;  1Z5C A;  4URL A;  4DV2 E;  2V8P A;  4B3M I;  4X64 E;  4JI5 E;  4DV4 I;  1XMO I;  4JI3 E;  1FWK A;  2BV3 A;  1FNM A;  4DR4 I;  4YY3 I; 
#chains in the Genus database with same CATH topology
 4MYT A;  4DR5 E;  2V2Q A;  3OTO E;  1FKA E;  3T1Y I;  4DR3 E;  1OYR A;  1N33 E;  4LFA I;  3CDJ A;  1PKP A;  4PU9 A;  3Q6N A;  2J65 A;  3PYE A;  4JYA I;  1HNW E;  4FWH A;  2O1T A;  1XNQ I;  2E5L E;  2PO0 B;  2AE8 A;  3GCM A;  1Z0E A;  2CZ9 A;  3KRN A;  3J81 Q;  4X66 E;  2UXD I;  4N3O A;  5C0X A;  3QT5 A;  2LJP A;  4QNJ A;  4DV4 E;  1K47 A;  4DV6 I;  1HK7 A;  5LMU I;  1H73 A;  5EKW A;  4PRV A;  5K36 B;  3PS1 A;  4YY3 E;  4DV0 I;  2NN6 A;  2PNM A;  2BR2 B;  3T1Y E;  2A2D A;  2JEB B;  3PYG A;  5K36 D;  1UDN A;  4DPU A;  1YHC A;  4B3S E;  4LFA E;  4DR2 E;  2HKE A;  1WUU A;  2UU9 I;  2V2Z A;  4JYA E;  2Z5B A;  4LF6 I;  4AID A;  5JEA F;  4IFD C;  3LPS A;  2WNR B;  4GKJ I;  2VQE I;  4OO1 E;  2HFS A;  3ZZT A;  1RR9 A;  1XMQ I;  1OYS A;  4MU1 A;  2HK3 A;  1NHH A;  3P3C A;  1NHI A;  5IWA I;  4HXZ A;  4LCG A;  2HFU A;  5C0X E;  3K1J A;  4JI7 E;  3PS3 A;  1MX0 A;  1Z0T A;  3JAM C;  4LFC E;  2PNZ A;  5LMU E;  3J7A M;  3QT8 A;  2O3Z A;  4DV0 E;  1N36 I;  3L7Z B;  1IBK E;  5FLX Q;  2JE6 B;  4LFB I;  1FI4 A;  2IES A;  2O1U A;  1USU A;  4MU4 A;  3F0N A;  1ZXM A;  2NN6 E;  1HR0 I;  3P06 A;  2UU9 E;  2JEA A;  4JI2 E;  3NZK A;  4BA2 A;  2J7K A;  4X62 I;  3J80 C;  1XHK A;  2XEX A;  3JAM Q;  4GKJ E;  4AIM A;  3WU3 A;  4IZJ B;  4GKK I;  1YH8 A;  2F4V I;  1KIJ A;  1I94 E;  1Y4S A;  4DPY A;  1N0V C;  4OKG A;  3HJC A;  2Q2E B;  4IZJ D;  3B8H A;  4NXN I;  1OYP A;  1Z5A A;  5A2Q Q;  5IWA E;  4DR1 E;  4FWD A;  3CWV A;  4K0K I;  2IER A;  1P42 A;  1RHY A;  1J5E E;  1Y60 A;  2Z5C B;  2C37 A;  4LCH A;  3J80 Q;  4DPX A;  3QT6 A;  4JI1 I;  4DV7 I;  3ZM7 A;  3ZZU A;  5GME A;  4BA1 B;  2V34 A;  1H7U A;  3B78 A;  1Z0B A;  4OO1 B;  4LCF A;  4ISA A;  4X62 E;  1H72 C;  2UUC I;  2WW4 A;  4OO1 F;  2F4V E;  4OO1 D;  1VIS A;  4UT4 A;  3T1H E;  4P52 A;  4HY1 A;  4B3R E;  1N32 I;  3ZZ0 A;  2O1V A;  1E3P A;  1FJG I;  4NXN E;  4OZE A;  1DAR A;  1B62 A;  5DRQ A;  5EL9 A;  4K0K E;  2IOQ A;  3H1C A;  5C0X D;  4FN5 A;  3Q6M A;  3M6A A;  4JI0 I;  5LMN E;  1N34 I;  4DUZ I;  3GON A;  2X7I A;  4UTG A;  4DUY E;  3ZKB A;  2NPF A;  4FW9 A;  4JI1 E;  4DV7 E;  1KTV A;  2ZM6 E;  2PO1 A;  4IFD E;  2NN6 D;  4B3M E;  4OX9 I;  5JEA C;  1B63 A;  1XMO E;  3QT7 A;  4DR4 E;  2CVE A;  4DV5 I;  1R6M A;  3WU6 A;  3U1K A;  1Z0W A;  2C39 A;  4IZK B;  4KHP I;  3LTO A;  3B4T A;  2PO2 A;  5K36 F;  4LPF A;  4FW5 A;  4DXL A;  1FWL A;  3DD6 A;  4LF7 I;  1N0U A;  3PS2 A;  5DRP A;  1N34 E;  1XNQ E;  3P3E A;  1UEK A;  1Z59 A;  1Y4U A;  1Z0G A;  4DV1 I;  2UXD E;  4QNK A;  2GO3 A;  1HNX I;  1XNR I;  3J7A G;  4USM A;  4NXM I;  4JI6 I;  5LL6 R;  4USK A;  4ZVI A;  4OX9 E;  5FWK A;  3V2U C;  2VQF I;  3M7N D;  4JI4 I;  4DV6 E;  2Z5E A;  2HK2 A;  4MDT A;  1UDS A;  4Z7C A;  4MU0 A;  1Z5B A;  1ZM3 A;  5IT9 C;  4IS9 A;  2GO4 A;  1ZM2 A;  5L3J A;  4U3B A;  2PNL A;  4MYU A;  4LF6 E;  1ZXN A;  2C37 B;  4HAC B;  2C38 A;  3K85 A;  2WP8 B;  5JEA A;  2HHH I;  4JG4 A;  4IFD B;  4KQV A;  2VQE E;  5BR8 I;  3M85 G;  4EMD A;  1XMQ E;  1XNR E;  2WNR A;  2BM0 A;  1XXE A;  1MU5 A;  4IFD D;  4JI6 E;  4U3D A;  1S4E A;  5GMD A;  4DR6 I;  5IT9 Q;  3GLL A;  4FW3 A;  1IBL I;  2VQF E;  1ELO A;  2BM1 A;  4FWG A;  3B82 A;  4OO1 C;  4JI4 E;  2HKJ A;  2X36 A;  2IOP A;  2BA1 D;  4WUD A;  2DEJ A;  5DRO A;  1N36 E;  4JI3 I;  4I3H A;  4LF4 I;  4JV5 I;  1BKN A;  4PRX A;  4LFB E;  2UXB I;  4DR5 I;  3L7Z A;  1HR0 E;  3OTO I;  4XTJ A;  2JE6 A;  4FW7 A;  1R6L A;  4M1K A;  4DR3 I;  1H7S A;  1N33 I;  2F1D A;  2HHH E;  4GKK E;  1MG7 A;  1HNW I;  1UDQ A;  3HKM A;  1KVK A;  5JEA E;  5C0X B;  4FW4 A;  4DR6 E;  1QZR A;  1U2R A;  3M85 D;  5C0X F;  4LF5 I;  1IBL E;  4B3T I;  1NHJ A;  4GQU A;  4R1F A;  4LF9 I;  4FW6 A;  1OJ4 A;  2NN6 B;  4LF4 E;  2Z5C A;  4JV5 E;  5K36 C;  3H4L A;  3J81 C;  2UXB E;  4RPF A;  3M7N G;  2NN6 F;  4DPT A;  4LF8 I;  3CDI A;  1RRE A;  3PRY A;  2UUA I;  4BA1 A;  2Z5B B;  3Q1Q A;  3U1Y A;  4DPW A;  3PYD A;  4B3S I;  1PVG A;  3LNU A;  4DR2 I;  2UUC E;  4WUC A;  4OO1 A;  4MQY A;  1N32 E;  1FJG E;  1Z0C A;  4LF5 E;  1IBM I;  4AQY I;  4DU8 A;  4B3T E;  1ZM4 A;  4JI0 E;  2PNZ B;  5ELW A;  4DUZ E;  4LF9 E;  2ZBK B;  5DRR A;  4JI7 I;  4LFC I;  4DU7 A;  2V2V A;  4P7A A;  2BA0 G;  2R3V A;  3P3G A;  4HYM A;  4DV3 I;  4DR7 I;  2PO0 A;  1IBK I;  3P76 A;  5DNX A;  4LF8 E;  4YHH I;  1KKH A;  3PYF A;  2BA1 G;  3V5R A;  2UUA E;  4X65 I;  4JI8 I;  2JEA B;  3HUL A;  1USV A;  4BA2 B;  2C38 B;  2DEI A;  5JEA B;  2GS8 A;  4JI2 I;  2UXC I;  3D4J A;  3K17 A;  1EI1 A;  4DV5 E;  5JEA D;  4KHP E;  5FLX C;  1I94 I;  5K36 A;  1VI7 A;  1IBM E;  4LF7 E;  1NZ0 A;  4IZK A;  1Z0V A;  4AQY E;  3WU4 A;  2BR2 A;  1UDO A;  4DR1 I;  5DNL A;  2JEB A;  2OI2 A;  2VF3 A;  1PIE A;  4LOM A;  1J5E I;  2R42 A;  1HNZ I;  4DV1 E;  4DV3 E;  1HNX E;  4DR7 E;  4IFD F;  4NXM E;  2A2C A;  4YHH E;  1EA6 A;  1D6T A;  5A2Q C;  2UUB I;  4X65 E;  4JI8 E;  2BA0 D;  4ED4 A;  2ZIT A;  2CGE A;  4Z7Y A;  2VES A;  2AJ4 A;  4WUB A;  4DV2 I;  2UXC E;  4X64 I;  4JI5 I;  1ZM9 A;  1Y5Y A;  5C0X C;  3T1H I;  2E1R A;  4B3R I;  4J3D A;  2JT2 A;  5K36 E;  1E3H A;  3UHM A;  3ZKD A;  5BR8 E;  2GQ0 A;  3GME A;  1HNZ E;  1H74 A;  5LMN I;  4HAC A;  1S16 A;  4MU3 A;  2NN6 C;  2O1W A;  2WP8 A;  4DUY I;  2E5L I;  4IZJ A;  4IFD A;  2PO1 B;  2UUB E;  2EFG A;  3WU5 A;  4X66 I;  2ZM6 I;  1Y6Z A;  1A6F A;  1Z5C A;  4URL A;  4DV2 E;  2V8P A;  4B3M I;  4X64 E;  4NBQ A;  4JI5 E;  4DV4 I;  1XMO I;  4JI3 E;  1FWK A;  2BV3 A;  2C39 B;  1FNM A;  4DR4 I;  2PO2 B;  4AM3 A;  2CG9 A;  4YY3 I; 
#chains in the Genus database with same CATH homology
 4MYT A;  4DR5 E;  2V2Q A;  3OTO E;  1FKA E;  3T1Y I;  4DR3 E;  1N33 E;  4LFA I;  1PKP A;  4PU9 A;  3Q6N A;  3PYE A;  4JYA I;  1HNW E;  4FWH A;  2O1T A;  1XNQ I;  2E5L E;  1Z0E A;  2CZ9 A;  3J81 Q;  4X66 E;  2UXD I;  4N3O A;  3QT5 A;  2LJP A;  4DV4 E;  1K47 A;  4DV6 I;  1HK7 A;  5LMU I;  1H73 A;  4PRV A;  4YY3 E;  4DV0 I;  2PNM A;  3T1Y E;  2A2D A;  3PYG A;  4DPU A;  4B3S E;  4LFA E;  4DR2 E;  2HKE A;  1WUU A;  2UU9 I;  2V2Z A;  4JYA E;  2Z5B A;  4LF6 I;  3LPS A;  4GKJ I;  2VQE I;  2HFS A;  3ZZT A;  1RR9 A;  1XMQ I;  2HK3 A;  1NHH A;  1NHI A;  5IWA I;  4HXZ A;  2HFU A;  3K1J A;  4JI7 E;  3JAM C;  1MX0 A;  1Z0T A;  4LFC E;  5LMU E;  3J7A M;  3QT8 A;  4DV0 E;  1N36 I;  1IBK E;  5FLX Q;  4LFB I;  1FI4 A;  2O1U A;  1USU A;  3F0N A;  1ZXM A;  1HR0 I;  3P06 A;  2UU9 E;  4JI2 E;  2J7K A;  4X62 I;  3J80 C;  1XHK A;  2XEX A;  3JAM Q;  4GKJ E;  3WU3 A;  4IZJ B;  4GKK I;  2F4V I;  1KIJ A;  1I94 E;  1Y4S A;  4DPY A;  1N0V C;  3HJC A;  2Q2E B;  4IZJ D;  3B8H A;  4NXN I;  1Z5A A;  5A2Q Q;  5IWA E;  4DR1 E;  4FWD A;  3CWV A;  4K0K I;  1J5E E;  2Z5C B;  3J80 Q;  4DPX A;  3QT6 A;  4JI1 I;  4DV7 I;  3ZM7 A;  3ZZU A;  5GME A;  2V34 A;  1H7U A;  3B78 A;  1Z0B A;  4X62 E;  1H72 C;  2UUC I;  2WW4 A;  2F4V E;  1VIS A;  4UT4 A;  3T1H E;  4P52 A;  4HY1 A;  4B3R E;  1N32 I;  3ZZ0 A;  2O1V A;  1FJG I;  4NXN E;  1DAR A;  1B62 A;  4K0K E;  2IOQ A;  4FN5 A;  3Q6M A;  3M6A A;  4JI0 I;  5LMN E;  1N34 I;  4DUZ I;  3GON A;  2X7I A;  4UTG A;  4DUY E;  3ZKB A;  2NPF A;  4FW9 A;  4JI1 E;  4DV7 E;  1KTV A;  2ZM6 E;  4B3M E;  4OX9 I;  1B63 A;  1XMO E;  3QT7 A;  4DR4 E;  4DV5 I;  3WU6 A;  1Z0W A;  4IZK B;  4KHP I;  3LTO A;  4DXL A;  1FWL A;  4LF7 I;  1N0U A;  1N34 E;  1XNQ E;  1UEK A;  1Z59 A;  1Y4U A;  1Z0G A;  4DV1 I;  2UXD E;  1HNX I;  1XNR I;  3J7A G;  4USM A;  4NXM I;  4JI6 I;  5LL6 R;  4USK A;  4ZVI A;  4OX9 E;  5FWK A;  3V2U C;  2VQF I;  4JI4 I;  4DV6 E;  2Z5E A;  2HK2 A;  4Z7C A;  1Z5B A;  1ZM3 A;  5IT9 C;  1ZM2 A;  5L3J A;  2PNL A;  4MYU A;  4LF6 E;  1ZXN A;  4HAC B;  3K85 A;  2HHH I;  4JG4 A;  4KQV A;  2VQE E;  5BR8 I;  4EMD A;  1XMQ E;  1XNR E;  2BM0 A;  1MU5 A;  4JI6 E;  1S4E A;  5GMD A;  4DR6 I;  5IT9 Q;  1IBL I;  2VQF E;  1ELO A;  2BM1 A;  4FWG A;  3B82 A;  4JI4 E;  2HKJ A;  2X36 A;  2IOP A;  4WUD A;  2DEJ A;  1N36 E;  4JI3 I;  4I3H A;  4LF4 I;  4JV5 I;  1BKN A;  4PRX A;  4LFB E;  2UXB I;  4DR5 I;  1HR0 E;  3OTO I;  4XTJ A;  4M1K A;  4DR3 I;  1H7S A;  1N33 I;  2HHH E;  4GKK E;  1MG7 A;  1HNW I;  1KVK A;  4DR6 E;  1QZR A;  1U2R A;  4LF5 I;  1IBL E;  4B3T I;  1NHJ A;  4R1F A;  4LF9 I;  1OJ4 A;  4LF4 E;  2Z5C A;  4JV5 E;  3H4L A;  3J81 C;  2UXB E;  4RPF A;  4DPT A;  4LF8 I;  1RRE A;  3PRY A;  2UUA I;  2Z5B B;  3Q1Q A;  4DPW A;  3PYD A;  4B3S I;  1PVG A;  3LNU A;  4DR2 I;  2UUC E;  4WUC A;  1N32 E;  1FJG E;  1Z0C A;  4LF5 E;  1IBM I;  4AQY I;  4DU8 A;  4B3T E;  1ZM4 A;  4JI0 E;  4DUZ E;  4LF9 E;  2ZBK B;  4JI7 I;  4LFC I;  4DU7 A;  2V2V A;  4P7A A;  2R3V A;  4HYM A;  4DV3 I;  4DR7 I;  1IBK I;  4LF8 E;  4YHH I;  1KKH A;  3PYF A;  3V5R A;  2UUA E;  4X65 I;  4JI8 I;  3HUL A;  1USV A;  2DEI A;  2GS8 A;  4JI2 I;  2UXC I;  3D4J A;  3K17 A;  1EI1 A;  4DV5 E;  4KHP E;  5FLX C;  1I94 I;  1IBM E;  4LF7 E;  1NZ0 A;  4IZK A;  1Z0V A;  4AQY E;  3WU4 A;  4DR1 I;  2OI2 A;  2VF3 A;  1PIE A;  1J5E I;  2R42 A;  1HNZ I;  4DV1 E;  4DV3 E;  1HNX E;  4DR7 E;  4NXM E;  2A2C A;  4YHH E;  1EA6 A;  1D6T A;  5A2Q C;  2UUB I;  4X65 E;  4JI8 E;  4ED4 A;  2ZIT A;  2CGE A;  4Z7Y A;  2AJ4 A;  4WUB A;  4DV2 I;  2UXC E;  4X64 I;  4JI5 I;  1ZM9 A;  3T1H I;  2E1R A;  4B3R I;  3ZKD A;  5BR8 E;  2GQ0 A;  1HNZ E;  1H74 A;  5LMN I;  4HAC A;  1S16 A;  2O1W A;  4DUY I;  2E5L I;  4IZJ A;  2UUB E;  2EFG A;  3WU5 A;  4X66 I;  2ZM6 I;  1Y6Z A;  1A6F A;  1Z5C A;  4URL A;  4DV2 E;  2V8P A;  4B3M I;  4X64 E;  4JI5 E;  1XMO I;  4DV4 I;  4JI3 E;  1FWK A;  2BV3 A;  1FNM A;  4DR4 I;  2CG9 A;  4YY3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...