1PKPA

The structure of ribosomal protein s5 reveals sites of interaction with 16s rrna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
INPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S5
publication title The structure of ribosomal protein S5 reveals sites of interaction with 16S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 1993-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1pkpA01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pkpA02
4JG4A 1K47A 1X48A 3CWVA 3PYGA 4LF6I 1Z0GA 4LF7E 3H4LA 1IBLE 4LF8I 1UEKA 3D4JA 3PYDA 4DPYA 2V34A 4AQYE 2B7TA 4JI4I 2E1RA 4KHPE 1A6FA 5A2QQ 2EFGA 4HACB 2RS6A 5IWAE 4LFAE 4B3RI 3GONA 3LPSA 3PYFA 1YZ9A 2A2CA 1QZRA 1FJGI 2IHR1 1EKZA 4JI0E 3J80Q 1FWKA 1Z0VA 1PVGA 1X47A 2BM1A 4HACA 4YHHI 3B82A 4WUDA 4LF4E 2HHHE 4HXZA 1YYKA 2HFUA 1MU5A 5LMUI 1HNZI 3J7AG 3LLHA 1RR9A 1XMOI 4JYAI 2LJHA 2DMYA 4P52A 2R3VA 4LFBE 4LF5I 3HULA 1J5EI 4Z7YA 1NHHA 3ZZ0A 3T1YI 4JI2I 1N33E 2L3CA 4B3SE 4DR3I 4JI6I 4JI3I 1EI1A 1D6TA 1WHQA 2L33A 3K1JA 4DV2I 2UXBI 4JI1E 4OX9E 2ZBKB 5GMEA 3F0NA 2RSMA 4GKJI 1Z0EA 1N36I 4USMA 4DUZI 1KVKA 3B78A 4UTGA 3ADGA 2LTRA 1I94E 2ZM6I 2WW4A 1FI4A 4YY3I 4DU8A 2UXCE 3Q1QA 4FW9A 4X62I 3J81C 2GS8A 1KIJA 1XMQE 2DEIA 1X49A 4M1KA 1WUUA 1ZM3A 4X66I 2V8PA 3ADLA 2UXDE 4EMDA 2VQFI 4DUYE 3K17A 2HKEA 3M6AA 1IBME 2UU9I 2UUAE 2F4VE 2VQEE 3WU5A 1GQEA 3QT7A 4AQYI 4DV1E 4KHPI 4NXNE 1HNWE 3WU4A 4WUBA 1NHIA 2HK2A 1B62A 1UHZA 1EA6A 1FNMA 4DV4E 5IWAI 4LFAI 3WU6A 3P1XA 4DR7E 2VF3A 4B3ME 4B3TE 2DB2A 2XEXA 4M30A 4JI0I 2UUCI 4HY1A 1ZXMA 3T1HE 4DV6E 4I3HA 3B8HA 2L2KB 2CZ9A 3QT6A 4DR1E 3J7Yp 3LTOA 4LF6E 4LF4I 2CPNA 3LNUA 4DV0I 3QT8A 4DV7E 1S4EA 4LF8E 2B3TB 1RREA 1Z0CA 2V2QA 2KHXA 2LTSA 5FLXC 3VYXA 1XNRI 1T4OA 2NUGA 1N34E 4JV5E 2ZITA 3QT5A 2N3GA 4LFBI 2JY9A 2JVAA 2L2MA 1FJGE 4DPUA 1N33I 1HR0I 4LFCE 4B3SI 1U2RA 4JI1I 4DV3I 4DV5E 5LL6R 1HNXE 1H73A 2HKJA 5IT9C 1N32I 1MG7A 1XNQE 4YHHE 4DR5I 3C4BA 1H74A 4DR4E 3ADJA 1I94I 1MX0A 4GKKE 3PYEA 1STUA 1Z0TA 1N0UA 2BM0A 2MDRA 5LMUE 1HNZE 2UXCI 4PU9A 1XMOE 1ZM9A 4LF9E 1H72C 4JI7I 2NPFA 4DXLA 3OTOE 1XMQI 2A2DA 1ZBTA 1O0WA 4DPTA 4DR2E 4JI5E 4PRVA 2LUQA 1YYOA 3T1YE 4HYMA 2UXDI 4MYTA 4DUYI 4JI2E 1VISA 2X7IA 4JI6E 1IBMI 2UUAI 2F4VI 2VQEI 3WU3A 4X64E 4DV2E 4DV1I 4FWHA 4GKJE 2UUBE 1QU6A 2NA2A 4LF7I 2RS7A 1IBLI 1H7UA 4K0KE 1T4LB 4DR6E 4DR7I 5CFFE 1ZM4A 1Z59A 1PKPA 4B3MI 3ZM7A 1XHKA 2X36A 5LMNE 4FWGA 4X62E 4B3TI 1T4NA 4M2ZA 2E5LE 2R42A 4OOGC 4NXME 4USKA 2LJPA 3T1HI 2B7VA 4DV6I 1ZM2A 1RC7A 1IBKE 4X65E 1BKNA 4DU7A 4DR1I 1NZ0A 1RQ0A 1ZXNA 2VQFE 1FWLA 2UU9E 5BR8E 4DV7I 1Z5CA 4JI8E 3J81Q 4DKKA 4P7AA 1B63A 3VYYA 1DI2A 1UILA 2Q2EB 3ADIA 1N34I 4DPWA 4JV5I 2HHHI 3JAMC 4Z7CA 4JI4E 4UT4A 2OI2A 1YYWA 3ZZUA 4B3RE 2UUCE 4LFCI 3V2UC 2NUFA 1Z5BA 3ZZTA 4DV5I 1HNXI 1S16A 1KTVA 4R1FA 4DPXA 1XNQI 4X8WA 2DEJA 2V2VA 4DR4I 1H7SA 4URLA 4OX9I 4MYUA 4DV0E 2LRSA 4GKKI 1OJ4A 4ZVIA 4RPFA 3C4TA 1Z0WA 4LF9I 1XNRE 1DARA 4X66E 3OTOI 3ZKDA 4ED4A 1Z0BA 4WYQB 4WFTA 2N3HA 2L2NA 4DR2I 4JYAE 1WHNA 4JI5I 3JAMQ 4FWDA 1HR0E 5FLXQ 4LF5E 2EZ6A 2BV3A 4FN5A 2DIXA 1NHJA 1J5EE 4X64I 4PRXA 4DV3E 1N0VC 4KQVA 2UUBI 4XTJA 1N32E 5A2QC 1ELOA 3ZKBA 4DR3E 4DR5E 4JI3E 4K0KI 2UXBE 4DR6I 4NXNI 1HNWI 1FKAE 1N36E 5LMNI 4DUZE 1KKHA 4JI7E 4DV4I 5GMDA 2AJ4A 2E5LI 3J7AM 3J80C 4NXMI 3HTXA 5IT9Q 2ZM6E 4YY3E 2RTXA 2LBSB 1PIEA 2V2ZA 4WUCA 1IBKI 2NUEA 1J26A 2J7KA 4X65I 2HK3A 3V5RA 5L3JA 5BR8I 2L3JA 1Z5AA 2LUPB 2YT4A 4JI8I 2HFSA
chains in the Genus database with same CATH superfamily
3ZOQB 2I13A 3EPHA 2ENAA 4JG4A 1K47A 5A6BD 1X48A 3CWVA 3M85G 5C0XB 3PYGA 5FWKA 4LF6I 1Z0GA 2V85A 4LF7E 3H4LA 1IBLE 1UDSA 2EM8A 4IFDD 4LF8I 3RMPA 1UEKA 3D4JA 3PYDA 4DPYA 5K36C 4WSGA 2NN6C 4AQYE 2V34A 2B7TA 4JI4I 2E1RA 1N3GA 4KHPE 1A6FA 2LE2A 2RQLA 5EL9A 5A2QQ 3BF2A 2EE8A 1YSAC 1JK2A 2JE6B 2EFGA 4HACB 2RS6A 2O1TA 2O1VA 2EQ0A 5IWAE 4LFAE 4B3RI 3GONA 2EOMA 3LPSA 3P3EA 2WCC3 4TUIA 2L8TA 3PYFA 2EP3A 2R76A 1YZ9A 2M1SA 1A1LA 5C0XE 2A2CA 1QZRA 1FJGI 2IHR1 5KL5A 3GCMA 2Z5BB 1A1HA 4RHBB 2EPMX 1EKZA 4JI0E 3J80Q 2G7HA 4LU9A 2Q8UA 1XXEA 4X9JA 2PRTA 4HTGA 5DNYA 2EPRA 3OMLA 3UK3C 1FWKA 1PVGA 1Z0VA 3GLLA 3PRYA 1X47A 2FGGA 4IFDB 2BM1A 4HACA 4F9BB 3CDIA 1TF6A 4LPFA 4MU4A 2KOUA 4YHHI 4L5NC 3B82A 2PO0B 2Z5CB 4NHRA 4WUDA 4LF4E 2JPAA 4KZSA 2EM2A 4IJDA 1Y4SA 4FW4A 2HHHE 1A1GA 2EZ6A 1YYKA 2O1UA 2J65A 2KONA 4HXZA 2HFUA 1MU5A 3J7AG 1AAYA 4YY3I 5LMUI 1HNZI 3LLHA 2LT7A 1RR9A 1XMOI 3IWDA 4JYAI 2LJHA 3F6GA 4FW6A 2CTDA 5IV8B 2DMYA 4R2SA 4P52A 1AH5A 4IFDE 2R3VA 1UDNA 2EPCA 2JYAA 4F9CB 2EM5A 4OO1D 2BR2A 5C0XF 4LFBE 3THNA 4LF5I 2L6MA 1YHCA 2EWLA 2JEBA 2PNLA 3HULA 4ISAA 1J5EI 1IQOA 2GO3A 4Z7YA 1B69A 2E1MA 1NHHA 4MU0A 2EOFA 3ZZ0A 2HJJA 2PO0A 3T1YI 2RSIA 4QNKA 1OYPA 2YTJA 4LCHA 1HK7A 2EN7A 3BBGA 1N33E 4JI2I 1WXRA 4MDTA 2L3CA 1MGTA 5AASA 3AV0A 4B3SE 4O43A 2C39A 1R6MA 4DR3I 2ADRA 5AC5A 1EI1A 1EH6A 3H1CA 1WHQA 4JI3I 2L33A 1D6TA 3K1JA 4DV2I 2UXBI 4JI1E 4OX9E 2ZBKB 5GMEA 3F0NA 2RSMA 4GKJI 4IZJA 5AE3A 4F6NA 1ZAAC 2EN6A 3P3CA 1Z0EA 1PJQA 2EMKA 1EH7A 1N36I 2EMFA 4MLQA 4USMA 4DUZI 1KVKA 1QNTA 2EMXA 3B78A 5ELWA 1USUA 4UTGA 2I9IA 2YTNA 3ADGA 2LTRA 5JEAC 1TF3A 1I94E 4P7DA 2BBGA 1BB8A 2LMZA 2EPNA 2ZM6I 3EPLA 2WW4A 1FI4A 1X6FA 2DMIA 2NN6D 3K85A 4OZEA 4IZKB 2EMGA 2YWQA 4DU8A 3M85D 4N4RB 2UXCE 4OO1B 2M7QA 3Q1QA 4FW9A 3CDJA 3M99B 4X62I 2E72A 3J81C 2DSYA 2FV4B 2GS8A 2IOPA 2EMAA 1KIJA 1XMQE 2DEIA 4IFDF 1X49A 2EMBA 2MDGA 2LO3A 2YU8A 4M1KA 4R2QA 5IXMB 1WUUA 2HGHA 1ZM3A 4X66I 3FIGA 2V8PA 5AE1A 3ADLA 2EM7A 2UXDE 4EMDA 4BHBA 2VQFI 1X6HA 4DUYE 3K17A 1UDQA 2HKEA 3M6AA 1IBME 2UU9I 3L00A 2UUAE 2VQEE 2F4VE 3WU5A 4OO1E 1GQEA 3QT7A 4AQYI 4DV1E 1E3HA 2EOHA 1X3CA 3VK6A 2V83A 1G2DC 4NXNE 1HNWE 4KHPI 3WU4A 4WUBA 1NHIA 2HK2A 1B62A 3C6KA 4ZYGA 2NN6B 4O24A 1UHZA 2EN4A 2O3ZA 5JEAF 2YPNA 2ODRD 1EA6A 1YPNA 4DV4E 1FNMA 4J3DA 5DROA 5IWAI 4LFAI 3WU6A 1GTKA 2GHFA 3P1XA 3DJWA 2YTDA 1DGCA 4DR7E 1OYRA 1L4SA 2VESA 3F6HA 2VF3A 4B3ME 3M7NG 2EPKX 4GEQB 3ECRA 4FW3A 5KL3A 4BHCA 2EOSA 4B3TE 2DB2A 4RH8A 4M30A 2XEXA 4M9VC 4JI0I 2UUCI 4HY1A 3B4TA 1P47A 1ZXMA 3T1HE 2YZTA 4BA2A 4DV6E 4IZJD 4KWYA 2EN8A 4I3HA 1Y4UA 3B8HA 3HKMA 1Y6ZA 5C0XC 2K4VA 2L2KB 2YTEA 2BA1G 2CZ9A 2NN6A 2EQ3A 3QT6A 5K36A 2EMWA 3MHSC 4DR1E 3TQMA 3J7Yp 3LTOA 1UBDC 4LF6E 2D9HA 4LF4I 2EOIA 2CPNA 3LNUA 1PJSA 2C38A 4DV0I 2GQ0A 3L7ZA 4O4KA 2O1WA 3QT8A 4DV7E 1S4EA 4LF8E 2B3TB 1RREA 1Z0CA 2BR2B 4OKGA 5DNLA 3U1YA 5KL4A 2JEBB 2GO4A 2DRPA 2V2QA 2KHXA 2LTSA 5FLXC 3VYXA 1XNRI 1LLMC 1T4OA 2NUGA 5DRQA 1YH8A 3LMLA 1N34E 4JV5E 2ZITA 4IZKA 2C39B 2F1DA 3EQ1A 2V87A 2C37A 3QT5A 2N3GA 2PO1B 4LFBI 2JY9A 3K6QA 4ZYEA 2JVAA 2MC6A 2L2MA 1ZBQA 5ADZA 1FJGE 3NZKA 4IZJB 4R2RA 2YTOA 2ELZA 4BBYA 1G2FC 4DPUA 2EORA 1Y5YA 2HC5A 2BA0G 2PO2B 1N33I 1HR0I 2GLIA 4LFCE 2YU5A 4B3SI 3IWCA 5A6KA 4IFDC 2F8BA 1A1IA 1PJTA 1U2RA 4BA1A 4LOMA 2M4IA 4LCGA 4JI1I 4DV3I 4DV5E 5LL6R 2N8XA 1F2IG 3EPJA 1HNXE 4BS9A 1H73A 2HKJA 2ENHA 2EMCA 2WZOA 2VE7C 4R2DA 1Y60A 2WP8A 1R6LA 2JR1A 5IT9C 1YFHA 3HXLA 1N32I 1MG7A 2BV3A 1XNQE 4YHHE 4DR5I 3C4BA 5A69A 2YTQA 3H09A 1H74A 4HEIA 4DR4E 2PO1A 2R1FA 3ADJA 3AUZA 3P06A 1WRJA 4R2PA 1MX0A 4GKKE 3PS1A 3PYEA 1I94I 1STUA 1Z0TA 1N0UA 4QNJA 2BM0A 2CVEA 4LTYA 2MDRA 5LMUE 1HNZE 2WNRA 2UXCI 4PU9A 3DF6A 1XMOE 1A1FA 1ZM9A 4LF9E 1H72C 2PO2A 4JI7I 2EN1A 2NPFA 2EMHA 4DXLA 3OTOE 1XMQI 2A2DA 1ZBTA 1PDAA 1YUIA 4F2JC 1O0WA 2JWOA 2V86A 3KWRA 5K36D 1UN6B 3JU0A 4DPTA 5AE2A 4DR2E 2PNMA 4JI5E 1P42A 2BB8A 4PRVA 2EM9A 2LUQA 4IS9A 3MHHC 3QG5C 1YYOA 4FW5A 3T1YE 3KRNA 3BIDA 4HYMA 2EMZA 2JOBA 2UXDI 4MYTA 2JEAA 4DUYI 4JI2E 1VISA 4WSPA 2X7IA 4JI6E 2J7JA 1IBMI 4O5GA 2UUAI 2F4VI 4F6MA 2VQEI 3WU3A 2MC5A 4X64E 4DV2E 2IERA 4Q28A 4MU1A 5JEAA 4NBQA 3M7ND 2EN2A 2MKDA 4DV1I 4FWHA 2V89A 4J8ZA 2UUBE 4GKJE 1RHYA 1QU6A 2EOOA 4I8OA 2EOJA 1WJPA 2NA2A 1SFEA 4LF7I 2RS7A 1E3PA 2YRKA 2Z5EA 1IBLI 4MQYA 1H7UA 5AC4A 4K0KE 4BC9A 4WX9A 4BA2B 1T4LB 4DR6E 4OO1C 4DR7I 5CFFE 1ZM4A 2BA1D 2LV2A 3P3GA 1Z59A 1PKPA 2CSHA 4B3MI 5K36B 2EPAA 3ZM7A 1XHKA 4MLVA 2X36A 5LMNE 4FWGA 2PNZA 4X62E 2JXPA 5EKWA 4B3TI 1T4NA 4M2ZA 2E5LE 2R42A 2EM6A 4OOGC 5KL2A 2L92A 4NXME 4USKA 2LJPA 3T1HI 2YRHA 4FW7A 3DD6A 2B7VA 2C38B 4DV6I 3L7ZB 1ZM2A 1RC7A 2EN3A 2VF1A 1T39A 1IBKE 3Q6MA 3PS2A 4U3DA 4BCAA 4X65E 1BKNA 1T38A 4DU7A 4L8NA 4DR1I 1NZ0A 1RQ0A 1ZXNA 1VI7A 2VQFE 5F3WA 2WBUA 2GPIA 3PS3A 4ZYDA 1FWLA 5K36E 2YTIA 2EOEA 2YRMA 2UU9E 5BR8E 2NN6E 2IESA 1BBGA 5DRRA 3HQ1A 1Z5CA 4JI8E 2C37B 4DKKA 3J81Q 4DV7I 4P7AA 4WXDA 4TUGA 1B63A 3VYYA 2DLKA 4AIMA 2A25A 2BA0D 1DI2A 1UILA 2Q2EB 3ADIA 1RMDA 5DNXA 4OO1F 1N34I 4DPWA 4JV5I 2HHHI 3JAMC 4BA1B 4Z7CA 1JK1A 2EMYA 4JI4E 2FTXB 4UT4A 1BBOA 1Z1BA 2EPLX 2WP8B 3GMEA 5C0XA 1SR9A 2EL5A 2OI2A 4IS1C 2EOZA 1YYWA 3ZZUA 2YSPA 2EPUA 4B3RE 2UUCE 4LFCI 2ELYA 2DLQA 2JT2A 4U3BA 5JEAD 2IOQA 2CT1A 1GZ6A 3V2UC 2YTGA 4WXCA 4GQUA 2NUFA 1Z5BA 4DMIA 3ZZTA 4DV5I 3HPSA 1HNXI 1S16A 2EM3A 2AE8A 2EQ1A 1X5WA 3THOB 1KTVA 2JE6A 2WNRB 4R1FA 2WBSA 4JI6I 4DPXA 5KL7A 4BC7A 2CGEA 1XNQI 3HPZA 2ODRC 4X8WA 2EM4A 1IMUA 4FK5C 2DEJA 2V2VA 4AM3A 4DR4I 2YTPA 1H7SA 2JP9A 2LVHA 4Q35B 2NN6F 4M0VA 4URLA 4MYUA 4OX9I 5K36F 4DV0E 2LRSA 4GKKI 2EPXA 1OJ4A 4R2EA 4ZVIA 4RPFA 4MU3A 2Z5BA 2H36X 3C4TA 1Z0WA 4LF9I 4WPYA 1XNRE 5LLQA 5A6BA 1DARA 3OTOI 3ZKDA 4ED4A 1Z0BA 4R03A 4WYQB 4WFTA 3JTZA 2N3HA 3HJCA 1OYSA 5KL6A 3BGHA 2LCEA 4IFDA 2L2NA 5JEAB 4DR2I 3KZYA 2EL6A 1WHNA 1A1JA 4JYAE 4JI5I 2EPPA 2JOXA 1YUJA 2Z5CA 3JAMQ 3IWBA 4R2AA 1DQ3A 4BMJA 1HR0E 4FWDA 4NZVA 5T6JA 4P78A 1ZU1A 5FLXQ 4LF5E 1IQSA 2EOQA 2NABA 2YSOA 2DIXA 5A6AA 1J5EE 3VHTB 2DGCA 1NHJA 1X6EA 4PRXA 4DV3E 4X64I 2EJ4A 2EPZA 4AIDA 2MKNA 1N0VC 4KQVA 1KJKA 2UUBI 2EL4A 1KYQA 4XTJA 5A2QC 1N32E 1NCSA 2PNZB 1ELOA 3ZKBA 4DR3E 2RPCA 2YTFA 4F9AB 4DR5E 4JI3E 5JEAE 4FN5A 2EM0A 4K0KI 2UXBE 1ZR9A 4DR6I 2EMIA 2V8QB 3C6MA 2B9DA 3EPKA 5C0XD 4NXNI 1HNWI 1FKAE 1USVA 1EH8A 2V88A 3KZZA 2JEAB 2EOXA 2VRDA 1N36E 5LMNI 5TSEA 4DUZE 2ENCA 4JI7E 1KKHA 4DV4I 5GMDA 2AJ4A 3U1KA 2E5LI 3J7AM 3J80C 4NXMI 3HTXA 1A1KA 2WBTA 5IT9Q 1NEIA 2ZM6E 4YY3E 2RTXA 2LBSB 1PIEA 2V2ZA 4WUCA 1IBKI 2HFSA 4N3OA 4ZYHA 2NUEA 1J26A 5A6JA 4LCFA 2LJUA 2M9AA 2J7KA 4X65I 3UHMA 4GZNC 2HK3A 4R8OA 2CG9A 3P76A 3V5RA 3Q6NA 1MEYC 2EMLA 5L3JA 2K7IA 2EPOA 5BR8I 4R2CA 2L3JA 1Z5AA 3MSWA 2EOYA 2YT4A 2LUPB 4F54A 4JI8I 5DRPA 1TN9A 1UDOA 4X66E 4OO1A
chains in the Genus database with same CATH topology
3ZOQB 4JG4A 1K47A 1X48A 3CWVA 3PYGA 5FWKA 4LF6I 1Z0GA 2V85A 4LF7E 3H4LA 1IBLE 4LF8I 3RMPA 1UEKA 3D4JA 3PYDA 4DPYA 2V34A 4AQYE 2B7TA 4JI4I 2E1RA 4KHPE 1A6FA 2LE2A 5A2QQ 2EFGA 4HACB 2RS6A 2O1TA 2O1VA 5IWAE 4LFAE 4B3RI 3GONA 3LPSA 4TUIA 2L8TA 3PYFA 1YZ9A 2M1SA 2A2CA 1QZRA 1FJGI 2IHR1 2Z5BB 1EKZA 4JI0E 3J80Q 2G7HA 4LU9A 5DNYA 1FWKA 3OMLA 1PVGA 1Z0VA 3PRYA 1X47A 2FGGA 2BM1A 4HACA 4F9BB 2KOUA 4YHHI 4L5NC 3B82A 2Z5CB 4WUDA 4LF4E 4KZSA 1Y4SA 2HHHE 2O1UA 4HXZA 1YYKA 2KONA 2HFUA 1MU5A 3J7AG 5LMUI 1HNZI 3LLHA 1RR9A 1XMOI 3IWDA 4JYAI 2LJHA 3F6GA 2DMYA 4P52A 2R3VA 4F9CB 4LFBE 4LF5I 2L6MA 2EWLA 2PNLA 3HULA 1J5EI 4Z7YA 2E1MA 1NHHA 3ZZ0A 3T1YI 1HK7A 4JI2I 1N33E 1WXRA 2L3CA 4B3SE 5AASA 3AV0A 4DR3I 4JI6I 4JI3I 1EI1A 1D6TA 1WHQA 2L33A 3K1JA 4DV2I 2UXBI 4JI1E 4OX9E 2ZBKB 5GMEA 3F0NA 2RSMA 4GKJI 4IZJA 5AE3A 1Z0EA 1N36I 4USMA 4DUZI 1KVKA 3B78A 1USUA 4UTGA 3ADGA 2LTRA 1I94E 4P7DA 2LMZA 2ZM6I 2WW4A 3K85A 1FI4A 4YY3I 4DU8A 4IZKB 2UXCE 2M7QA 3Q1QA 4FW9A 4X62I 3J81C 2DSYA 2FV4B 2GS8A 2IOPA 1KIJA 1XMQE 2DEIA 1X49A 4M1KA 1WUUA 1ZM3A 4X66I 3FIGA 2V8PA 5AE1A 3ADLA 2UXDE 4EMDA 2VQFI 4DUYE 3K17A 2HKEA 3M6AA 1IBME 2UU9I 2UUAE 2F4VE 2VQEE 3WU5A 1GQEA 3QT7A 4AQYI 4DV1E 3VK6A 2V83A 4NXNE 1HNWE 4KHPI 3WU4A 4WUBA 1NHIA 2HK2A 1B62A 1UHZA 1EA6A 2ODRD 1FNMA 4DV4E 5IWAI 4LFAI 3WU6A 3P1XA 3DJWA 4DR7E 3F6HA 2VF3A 4B3ME 4GEQB 4B3TE 2DB2A 2XEXA 4M30A 4JI0I 2UUCI 4HY1A 1ZXMA 3T1HE 2YZTA 4DV6E 4IZJD 4I3HA 1Y4UA 3B8HA 1Y6ZA 2K4VA 2L2KB 2CZ9A 3QT6A 4DR1E 3J7Yp 3LTOA 4LF6E 4LF4I 2CPNA 3LNUA 4DV0I 2GQ0A 2O1WA 3QT8A 4DV7E 1S4EA 4LF8E 2B3TB 1RREA 1Z0CA 2V2QA 2KHXA 2LTSA 5FLXC 3VYXA 1XNRI 1T4OA 2NUGA 3LMLA 1N34E 4JV5E 2ZITA 4IZKA 2V87A 3QT5A 2N3GA 4LFBI 2JY9A 3K6QA 2JVAA 2MC6A 2L2MA 1ZBQA 5ADZA 1FJGE 4IZJB 4BBYA 4DPUA 1N33I 1HR0I 4LFCE 4B3SI 3IWCA 2F8BA 1U2RA 2M4IA 4JI1I 4DV3I 4DV5E 5LL6R 1HNXE 4BS9A 1H73A 2HKJA 2WZOA 2VE7C 2JR1A 5IT9C 3HXLA 1N32I 1MG7A 1XNQE 4YHHE 4DR5I 3C4BA 3H09A 1H74A 4DR4E 3ADJA 3AUZA 3P06A 1I94I 1MX0A 4GKKE 3PYEA 1STUA 1Z0TA 1N0UA 2BM0A 4LTYA 2MDRA 5LMUE 1HNZE 2UXCI 4PU9A 3DF6A 1XMOE 1ZM9A 4LF9E 1H72C 4JI7I 2NPFA 4DXLA 3OTOE 1XMQI 2A2DA 1ZBTA 1O0WA 2V86A 2JWOA 3KWRA 3JU0A 4DPTA 5AE2A 4DR2E 2PNMA 4JI5E 4PRVA 2LUQA 1YYOA 3T1YE 4HYMA 2UXDI 2JOBA 4MYTA 4DUYI 4JI2E 1VISA 4WSPA 2X7IA 4JI6E 1IBMI 2UUAI 2F4VI 2VQEI 3WU3A 2MC5A 4X64E 4DV2E 4Q28A 4DV1I 4FWHA 2V89A 4J8ZA 2UUBE 4GKJE 1QU6A 4I8OA 2NA2A 4LF7I 2RS7A 1IBLI 2Z5EA 1H7UA 4K0KE 4BC9A 1T4LB 4DR6E 4DR7I 5CFFE 1ZM4A 1Z59A 1PKPA 4B3MI 3ZM7A 1XHKA 2X36A 5LMNE 4FWGA 4X62E 4B3TI 1T4NA 4M2ZA 2E5LE 2R42A 4OOGC 4NXME 2L92A 4USKA 2LJPA 3T1HI 2B7VA 4DV6I 1ZM2A 1RC7A 2VF1A 3Q6MA 1IBKE 4BCAA 4X65E 1BKNA 4DU7A 4L8NA 4DR1I 1NZ0A 1RQ0A 1ZXNA 2VQFE 5F3WA 1FWLA 2UU9E 5BR8E 4DV7I 3HQ1A 1Z5CA 4JI8E 3J81Q 4DKKA 4P7AA 4TUGA 1B63A 3VYYA 1DI2A 1UILA 2Q2EB 3ADIA 1N34I 4DPWA 4JV5I 2HHHI 3JAMC 4Z7CA 4JI4E 2FTXB 4UT4A 1SR9A 2OI2A 1YYWA 3ZZUA 4B3RE 2UUCE 4LFCI 2IOQA 1GZ6A 3V2UC 2NUFA 1Z5BA 4DMIA 3ZZTA 4DV5I 3HPSA 1HNXI 1S16A 1KTVA 4R1FA 4DPXA 4BC7A 2CGEA 1XNQI 3HPZA 2ODRC 4X8WA 2DEJA 2V2VA 4DR4I 1H7SA 4URLA 4OX9I 4M0VA 4MYUA 4DV0E 2LRSA 4GKKI 1OJ4A 4ZVIA 4RPFA 2Z5BA 2H36X 3C4TA 1Z0WA 4LF9I 4WPYA 1XNRE 1DARA 3OTOI 3ZKDA 4ED4A 1Z0BA 4R03A 4WYQB 4WFTA 3JTZA 2N3HA 3HJCA 2L2NA 4DR2I 4JYAE 1WHNA 4JI5I 2JOXA 2Z5CA 3JAMQ 3IWBA 1DQ3A 4BMJA 1HR0E 4FWDA 5T6JA 4P78A 5FLXQ 4LF5E 2EZ6A 2BV3A 4FN5A 2DIXA 1NHJA 1J5EE 4X64I 4PRXA 4DV3E 1N0VC 4KQVA 2UUBI 4XTJA 5A2QC 1N32E 1ELOA 3ZKBA 4DR3E 4DR5E 4F9AB 4JI3E 4K0KI 2UXBE 4DR6I 2V8QB 2B9DA 4NXNI 1HNWI 1FKAE 1USVA 2V88A 1N36E 5LMNI 4DUZE 1KKHA 4JI7E 4DV4I 5GMDA 2AJ4A 2E5LI 3J7AM 3J80C 4NXMI 3HTXA 5IT9Q 2ZM6E 4YY3E 2RTXA 2LBSB 1PIEA 2V2ZA 4WUCA 1IBKI 2HFSA 4N3OA 1J26A 2NUEA 2J7KA 4X65I 2HK3A 4R8OA 2CG9A 3V5RA 3Q6NA 5L3JA 5BR8I 2L3JA 1Z5AA 3MSWA 2YT4A 2LUPB 4JI8I 4F54A 4X66E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JG4 A;  1K47 A;  1X48 A;  3CWV A;  3PYG A;  4LF6 I;  1Z0G A;  4LF7 E;  3H4L A;  1IBL E;  4LF8 I;  1UEK A;  3D4J A;  3PYD A;  4DPY A;  2V34 A;  4AQY E;  2B7T A;  4JI4 I;  2E1R A;  4KHP E;  1A6F A;  5A2Q Q;  2EFG A;  4HAC B;  2RS6 A;  5IWA E;  4LFA E;  4B3R I;  3GON A;  3LPS A;  3PYF A;  1YZ9 A;  2A2C A;  1QZR A;  1FJG I;  2IHR 1;  1EKZ A;  4JI0 E;  3J80 Q;  1FWK A;  1Z0V A;  1PVG A;  1X47 A;  2BM1 A;  4HAC A;  4YHH I;  3B82 A;  4WUD A;  4LF4 E;  2HHH E;  4HXZ A;  1YYK A;  2HFU A;  1MU5 A;  5LMU I;  1HNZ I;  3J7A G;  3LLH A;  1RR9 A;  1XMO I;  4JYA I;  2LJH A;  2DMY A;  4P52 A;  2R3V A;  4LFB E;  4LF5 I;  3HUL A;  1J5E I;  4Z7Y A;  1NHH A;  3ZZ0 A;  3T1Y I;  4JI2 I;  1N33 E;  2L3C A;  4B3S E;  4DR3 I;  4JI6 I;  4JI3 I;  1EI1 A;  1D6T A;  1WHQ A;  2L33 A;  3K1J A;  4DV2 I;  2UXB I;  4JI1 E;  4OX9 E;  2ZBK B;  5GME A;  3F0N A;  2RSM A;  4GKJ I;  1Z0E A;  1N36 I;  4USM A;  4DUZ I;  1KVK A;  3B78 A;  4UTG A;  3ADG A;  2LTR A;  1I94 E;  2ZM6 I;  2WW4 A;  1FI4 A;  4YY3 I;  4DU8 A;  2UXC E;  3Q1Q A;  4FW9 A;  4X62 I;  3J81 C;  2GS8 A;  1KIJ A;  1XMQ E;  2DEI A;  1X49 A;  4M1K A;  1WUU A;  1ZM3 A;  4X66 I;  2V8P A;  3ADL A;  2UXD E;  4EMD A;  2VQF I;  4DUY E;  3K17 A;  2HKE A;  3M6A A;  1IBM E;  2UU9 I;  2UUA E;  2F4V E;  2VQE E;  3WU5 A;  1GQE A;  3QT7 A;  4AQY I;  4DV1 E;  4KHP I;  4NXN E;  1HNW E;  3WU4 A;  4WUB A;  1NHI A;  2HK2 A;  1B62 A;  1UHZ A;  1EA6 A;  1FNM A;  4DV4 E;  5IWA I;  4LFA I;  3WU6 A;  3P1X A;  4DR7 E;  2VF3 A;  4B3M E;  4B3T E;  2DB2 A;  2XEX A;  4M30 A;  4JI0 I;  2UUC I;  4HY1 A;  1ZXM A;  3T1H E;  4DV6 E;  4I3H A;  3B8H A;  2L2K B;  2CZ9 A;  3QT6 A;  4DR1 E;  3J7Y p;  3LTO A;  4LF6 E;  4LF4 I;  2CPN A;  3LNU A;  4DV0 I;  3QT8 A;  4DV7 E;  1S4E A;  4LF8 E;  2B3T B;  1RRE A;  1Z0C A;  2V2Q A;  2KHX A;  2LTS A;  5FLX C;  3VYX A;  1XNR I;  1T4O A;  2NUG A;  1N34 E;  4JV5 E;  2ZIT A;  3QT5 A;  2N3G A;  4LFB I;  2JY9 A;  2JVA A;  2L2M A;  1FJG E;  4DPU A;  1N33 I;  1HR0 I;  4LFC E;  4B3S I;  1U2R A;  4JI1 I;  4DV3 I;  4DV5 E;  5LL6 R;  1HNX E;  1H73 A;  2HKJ A;  5IT9 C;  1N32 I;  1MG7 A;  1XNQ E;  4YHH E;  4DR5 I;  3C4B A;  1H74 A;  4DR4 E;  3ADJ A;  1I94 I;  1MX0 A;  4GKK E;  3PYE A;  1STU A;  1Z0T A;  1N0U A;  2BM0 A;  2MDR A;  5LMU E;  1HNZ E;  2UXC I;  4PU9 A;  1XMO E;  1ZM9 A;  4LF9 E;  1H72 C;  4JI7 I;  2NPF A;  4DXL A;  3OTO E;  1XMQ I;  2A2D A;  1ZBT A;  1O0W A;  4DPT A;  4DR2 E;  4JI5 E;  4PRV A;  2LUQ A;  1YYO A;  3T1Y E;  4HYM A;  2UXD I;  4MYT A;  4DUY I;  4JI2 E;  1VIS A;  2X7I A;  4JI6 E;  1IBM I;  2UUA I;  2F4V I;  2VQE I;  3WU3 A;  4X64 E;  4DV2 E;  4DV1 I;  4FWH A;  4GKJ E;  2UUB E;  1QU6 A;  2NA2 A;  4LF7 I;  2RS7 A;  1IBL I;  1H7U A;  4K0K E;  1T4L B;  4DR6 E;  4DR7 I;  5CFF E;  1ZM4 A;  1Z59 A;  1PKP A;  4B3M I;  3ZM7 A;  1XHK A;  2X36 A;  5LMN E;  4FWG A;  4X62 E;  4B3T I;  1T4N A;  4M2Z A;  2E5L E;  2R42 A;  4OOG C;  4NXM E;  4USK A;  2LJP A;  3T1H I;  2B7V A;  4DV6 I;  1ZM2 A;  1RC7 A;  1IBK E;  4X65 E;  1BKN A;  4DU7 A;  4DR1 I;  1NZ0 A;  1RQ0 A;  1ZXN A;  2VQF E;  1FWL A;  2UU9 E;  5BR8 E;  4DV7 I;  1Z5C A;  4JI8 E;  3J81 Q;  4DKK A;  4P7A A;  1B63 A;  3VYY A;  1DI2 A;  1UIL A;  2Q2E B;  3ADI A;  1N34 I;  4DPW A;  4JV5 I;  2HHH I;  3JAM C;  4Z7C A;  4JI4 E;  4UT4 A;  2OI2 A;  1YYW A;  3ZZU A;  4B3R E;  2UUC E;  4LFC I;  3V2U C;  2NUF A;  1Z5B A;  3ZZT A;  4DV5 I;  1HNX I;  1S16 A;  1KTV A;  4R1F A;  4DPX A;  1XNQ I;  4X8W A;  2DEJ A;  2V2V A;  4DR4 I;  1H7S A;  4URL A;  4OX9 I;  4MYU A;  4DV0 E;  2LRS A;  4GKK I;  1OJ4 A;  4ZVI A;  4RPF A;  3C4T A;  1Z0W A;  4LF9 I;  1XNR E;  1DAR A;  4X66 E;  3OTO I;  3ZKD A;  4ED4 A;  1Z0B A;  4WYQ B;  4WFT A;  2N3H A;  2L2N A;  4DR2 I;  4JYA E;  1WHN A;  4JI5 I;  3JAM Q;  4FWD A;  1HR0 E;  5FLX Q;  4LF5 E;  2EZ6 A;  2BV3 A;  4FN5 A;  2DIX A;  1NHJ A;  1J5E E;  4X64 I;  4PRX A;  4DV3 E;  1N0V C;  4KQV A;  2UUB I;  4XTJ A;  1N32 E;  5A2Q C;  1ELO A;  3ZKB A;  4DR3 E;  4DR5 E;  4JI3 E;  4K0K I;  2UXB E;  4DR6 I;  4NXN I;  1HNW I;  1FKA E;  1N36 E;  5LMN I;  4DUZ E;  1KKH A;  4JI7 E;  4DV4 I;  5GMD A;  2AJ4 A;  2E5L I;  3J7A M;  3J80 C;  4NXM I;  3HTX A;  5IT9 Q;  2ZM6 E;  4YY3 E;  2RTX A;  2LBS B;  1PIE A;  2V2Z A;  4WUC A;  1IBK I;  2NUE A;  1J26 A;  2J7K A;  4X65 I;  2HK3 A;  3V5R A;  5L3J A;  5BR8 I;  2L3J A;  1Z5A A;  2LUP B;  2YT4 A;  4JI8 I;  2HFS A; 
#chains in the Genus database with same CATH topology
 3ZOQ B;  2I13 A;  3EPH A;  2ENA A;  4JG4 A;  1K47 A;  5A6B D;  1X48 A;  3CWV A;  3M85 G;  5C0X B;  3PYG A;  5FWK A;  4LF6 I;  1Z0G A;  2V85 A;  4LF7 E;  3H4L A;  1IBL E;  1UDS A;  2EM8 A;  4IFD D;  4LF8 I;  3RMP A;  1UEK A;  3D4J A;  3PYD A;  4DPY A;  5K36 C;  4WSG A;  2NN6 C;  4AQY E;  2V34 A;  2B7T A;  4JI4 I;  2E1R A;  1N3G A;  4KHP E;  1A6F A;  2LE2 A;  2RQL A;  5EL9 A;  5A2Q Q;  3BF2 A;  2EE8 A;  1YSA C;  1JK2 A;  2JE6 B;  2EFG A;  4HAC B;  2RS6 A;  2O1T A;  2O1V A;  2EQ0 A;  5IWA E;  4LFA E;  4B3R I;  3GON A;  2EOM A;  3LPS A;  3P3E A;  2WCC 3;  4TUI A;  2L8T A;  3PYF A;  2EP3 A;  2R76 A;  1YZ9 A;  2M1S A;  1A1L A;  5C0X E;  2A2C A;  1QZR A;  1FJG I;  2IHR 1;  5KL5 A;  3GCM A;  2Z5B B;  1A1H A;  4RHB B;  2EPM X;  1EKZ A;  4JI0 E;  3J80 Q;  2G7H A;  4LU9 A;  2Q8U A;  1XXE A;  4X9J A;  2PRT A;  4HTG A;  5DNY A;  2EPR A;  3OML A;  3UK3 C;  1FWK A;  1PVG A;  1Z0V A;  3GLL A;  3PRY A;  1X47 A;  2FGG A;  4IFD B;  2BM1 A;  4HAC A;  4F9B B;  3CDI A;  1TF6 A;  4LPF A;  4MU4 A;  2KOU A;  4YHH I;  4L5N C;  3B82 A;  2PO0 B;  2Z5C B;  4NHR A;  4WUD A;  4LF4 E;  2JPA A;  4KZS A;  2EM2 A;  4IJD A;  1Y4S A;  4FW4 A;  2HHH E;  1A1G A;  2EZ6 A;  1YYK A;  2O1U A;  2J65 A;  2KON A;  4HXZ A;  2HFU A;  1MU5 A;  3J7A G;  1AAY A;  4YY3 I;  5LMU I;  1HNZ I;  3LLH A;  2LT7 A;  1RR9 A;  1XMO I;  3IWD A;  4JYA I;  2LJH A;  3F6G A;  4FW6 A;  2CTD A;  5IV8 B;  2DMY A;  4R2S A;  4P52 A;  1AH5 A;  4IFD E;  2R3V A;  1UDN A;  2EPC A;  2JYA A;  4F9C B;  2EM5 A;  4OO1 D;  2BR2 A;  5C0X F;  4LFB E;  3THN A;  4LF5 I;  2L6M A;  1YHC A;  2EWL A;  2JEB A;  2PNL A;  3HUL A;  4ISA A;  1J5E I;  1IQO A;  2GO3 A;  4Z7Y A;  1B69 A;  2E1M A;  1NHH A;  4MU0 A;  2EOF A;  3ZZ0 A;  2HJJ A;  2PO0 A;  3T1Y I;  2RSI A;  4QNK A;  1OYP A;  2YTJ A;  4LCH A;  1HK7 A;  2EN7 A;  3BBG A;  1N33 E;  4JI2 I;  1WXR A;  4MDT A;  2L3C A;  1MGT A;  5AAS A;  3AV0 A;  4B3S E;  4O43 A;  2C39 A;  1R6M A;  4DR3 I;  2ADR A;  5AC5 A;  1EI1 A;  1EH6 A;  3H1C A;  1WHQ A;  4JI3 I;  2L33 A;  1D6T A;  3K1J A;  4DV2 I;  2UXB I;  4JI1 E;  4OX9 E;  2ZBK B;  5GME A;  3F0N A;  2RSM A;  4GKJ I;  4IZJ A;  5AE3 A;  4F6N A;  1ZAA C;  2EN6 A;  3P3C A;  1Z0E A;  1PJQ A;  2EMK A;  1EH7 A;  1N36 I;  2EMF A;  4MLQ A;  4USM A;  4DUZ I;  1KVK A;  1QNT A;  2EMX A;  3B78 A;  5ELW A;  1USU A;  4UTG A;  2I9I A;  2YTN A;  3ADG A;  2LTR A;  5JEA C;  1TF3 A;  1I94 E;  4P7D A;  2BBG A;  1BB8 A;  2LMZ A;  2EPN A;  2ZM6 I;  3EPL A;  2WW4 A;  1FI4 A;  1X6F A;  2DMI A;  2NN6 D;  3K85 A;  4OZE A;  4IZK B;  2EMG A;  2YWQ A;  4DU8 A;  3M85 D;  4N4R B;  2UXC E;  4OO1 B;  2M7Q A;  3Q1Q A;  4FW9 A;  3CDJ A;  3M99 B;  4X62 I;  2E72 A;  3J81 C;  2DSY A;  2FV4 B;  2GS8 A;  2IOP A;  2EMA A;  1KIJ A;  1XMQ E;  2DEI A;  4IFD F;  1X49 A;  2EMB A;  2MDG A;  2LO3 A;  2YU8 A;  4M1K A;  4R2Q A;  5IXM B;  1WUU A;  2HGH A;  1ZM3 A;  4X66 I;  3FIG A;  2V8P A;  5AE1 A;  3ADL A;  2EM7 A;  2UXD E;  4EMD A;  4BHB A;  2VQF I;  1X6H A;  4DUY E;  3K17 A;  1UDQ A;  2HKE A;  3M6A A;  1IBM E;  2UU9 I;  3L00 A;  2UUA E;  2VQE E;  2F4V E;  3WU5 A;  4OO1 E;  1GQE A;  3QT7 A;  4AQY I;  4DV1 E;  1E3H A;  2EOH A;  1X3C A;  3VK6 A;  2V83 A;  1G2D C;  4NXN E;  1HNW E;  4KHP I;  3WU4 A;  4WUB A;  1NHI A;  2HK2 A;  1B62 A;  3C6K A;  4ZYG A;  2NN6 B;  4O24 A;  1UHZ A;  2EN4 A;  2O3Z A;  5JEA F;  2YPN A;  2ODR D;  1EA6 A;  1YPN A;  4DV4 E;  1FNM A;  4J3D A;  5DRO A;  5IWA I;  4LFA I;  3WU6 A;  1GTK A;  2GHF A;  3P1X A;  3DJW A;  2YTD A;  1DGC A;  4DR7 E;  1OYR A;  1L4S A;  2VES A;  3F6H A;  2VF3 A;  4B3M E;  3M7N G;  2EPK X;  4GEQ B;  3ECR A;  4FW3 A;  5KL3 A;  4BHC A;  2EOS A;  4B3T E;  2DB2 A;  4RH8 A;  4M30 A;  2XEX A;  4M9V C;  4JI0 I;  2UUC I;  4HY1 A;  3B4T A;  1P47 A;  1ZXM A;  3T1H E;  2YZT A;  4BA2 A;  4DV6 E;  4IZJ D;  4KWY A;  2EN8 A;  4I3H A;  1Y4U A;  3B8H A;  3HKM A;  1Y6Z A;  5C0X C;  2K4V A;  2L2K B;  2YTE A;  2BA1 G;  2CZ9 A;  2NN6 A;  2EQ3 A;  3QT6 A;  5K36 A;  2EMW A;  3MHS C;  4DR1 E;  3TQM A;  3J7Y p;  3LTO A;  1UBD C;  4LF6 E;  2D9H A;  4LF4 I;  2EOI A;  2CPN A;  3LNU A;  1PJS A;  2C38 A;  4DV0 I;  2GQ0 A;  3L7Z A;  4O4K A;  2O1W A;  3QT8 A;  4DV7 E;  1S4E A;  4LF8 E;  2B3T B;  1RRE A;  1Z0C A;  2BR2 B;  4OKG A;  5DNL A;  3U1Y A;  5KL4 A;  2JEB B;  2GO4 A;  2DRP A;  2V2Q A;  2KHX A;  2LTS A;  5FLX C;  3VYX A;  1XNR I;  1LLM C;  1T4O A;  2NUG A;  5DRQ A;  1YH8 A;  3LML A;  1N34 E;  4JV5 E;  2ZIT A;  4IZK A;  2C39 B;  2F1D A;  3EQ1 A;  2V87 A;  2C37 A;  3QT5 A;  2N3G A;  2PO1 B;  4LFB I;  2JY9 A;  3K6Q A;  4ZYE A;  2JVA A;  2MC6 A;  2L2M A;  1ZBQ A;  5ADZ A;  1FJG E;  3NZK A;  4IZJ B;  4R2R A;  2YTO A;  2ELZ A;  4BBY A;  1G2F C;  4DPU A;  2EOR A;  1Y5Y A;  2HC5 A;  2BA0 G;  2PO2 B;  1N33 I;  1HR0 I;  2GLI A;  4LFC E;  2YU5 A;  4B3S I;  3IWC A;  5A6K A;  4IFD C;  2F8B A;  1A1I A;  1PJT A;  1U2R A;  4BA1 A;  4LOM A;  2M4I A;  4LCG A;  4JI1 I;  4DV3 I;  4DV5 E;  5LL6 R;  2N8X A;  1F2I G;  3EPJ A;  1HNX E;  4BS9 A;  1H73 A;  2HKJ A;  2ENH A;  2EMC A;  2WZO A;  2VE7 C;  4R2D A;  1Y60 A;  2WP8 A;  1R6L A;  2JR1 A;  5IT9 C;  1YFH A;  3HXL A;  1N32 I;  1MG7 A;  2BV3 A;  1XNQ E;  4YHH E;  4DR5 I;  3C4B A;  5A69 A;  2YTQ A;  3H09 A;  1H74 A;  4HEI A;  4DR4 E;  2PO1 A;  2R1F A;  3ADJ A;  3AUZ A;  3P06 A;  1WRJ A;  4R2P A;  1MX0 A;  4GKK E;  3PS1 A;  3PYE A;  1I94 I;  1STU A;  1Z0T A;  1N0U A;  4QNJ A;  2BM0 A;  2CVE A;  4LTY A;  2MDR A;  5LMU E;  1HNZ E;  2WNR A;  2UXC I;  4PU9 A;  3DF6 A;  1XMO E;  1A1F A;  1ZM9 A;  4LF9 E;  1H72 C;  2PO2 A;  4JI7 I;  2EN1 A;  2NPF A;  2EMH A;  4DXL A;  3OTO E;  1XMQ I;  2A2D A;  1ZBT A;  1PDA A;  1YUI A;  4F2J C;  1O0W A;  2JWO A;  2V86 A;  3KWR A;  5K36 D;  1UN6 B;  3JU0 A;  4DPT A;  5AE2 A;  4DR2 E;  2PNM A;  4JI5 E;  1P42 A;  2BB8 A;  4PRV A;  2EM9 A;  2LUQ A;  4IS9 A;  3MHH C;  3QG5 C;  1YYO A;  4FW5 A;  3T1Y E;  3KRN A;  3BID A;  4HYM A;  2EMZ A;  2JOB A;  2UXD I;  4MYT A;  2JEA A;  4DUY I;  4JI2 E;  1VIS A;  4WSP A;  2X7I A;  4JI6 E;  2J7J A;  1IBM I;  4O5G A;  2UUA I;  2F4V I;  4F6M A;  2VQE I;  3WU3 A;  2MC5 A;  4X64 E;  4DV2 E;  2IER A;  4Q28 A;  4MU1 A;  5JEA A;  4NBQ A;  3M7N D;  2EN2 A;  2MKD A;  4DV1 I;  4FWH A;  2V89 A;  4J8Z A;  2UUB E;  4GKJ E;  1RHY A;  1QU6 A;  2EOO A;  4I8O A;  2EOJ A;  1WJP A;  2NA2 A;  1SFE A;  4LF7 I;  2RS7 A;  1E3P A;  2YRK A;  2Z5E A;  1IBL I;  4MQY A;  1H7U A;  5AC4 A;  4K0K E;  4BC9 A;  4WX9 A;  4BA2 B;  1T4L B;  4DR6 E;  4OO1 C;  4DR7 I;  5CFF E;  1ZM4 A;  2BA1 D;  2LV2 A;  3P3G A;  1Z59 A;  1PKP A;  2CSH A;  4B3M I;  5K36 B;  2EPA A;  3ZM7 A;  1XHK A;  4MLV A;  2X36 A;  5LMN E;  4FWG A;  2PNZ A;  4X62 E;  2JXP A;  5EKW A;  4B3T I;  1T4N A;  4M2Z A;  2E5L E;  2R42 A;  2EM6 A;  4OOG C;  5KL2 A;  2L92 A;  4NXM E;  4USK A;  2LJP A;  3T1H I;  2YRH A;  4FW7 A;  3DD6 A;  2B7V A;  2C38 B;  4DV6 I;  3L7Z B;  1ZM2 A;  1RC7 A;  2EN3 A;  2VF1 A;  1T39 A;  1IBK E;  3Q6M A;  3PS2 A;  4U3D A;  4BCA A;  4X65 E;  1BKN A;  1T38 A;  4DU7 A;  4L8N A;  4DR1 I;  1NZ0 A;  1RQ0 A;  1ZXN A;  1VI7 A;  2VQF E;  5F3W A;  2WBU A;  2GPI A;  3PS3 A;  4ZYD A;  1FWL A;  5K36 E;  2YTI A;  2EOE A;  2YRM A;  2UU9 E;  5BR8 E;  2NN6 E;  2IES A;  1BBG A;  5DRR A;  3HQ1 A;  1Z5C A;  4JI8 E;  2C37 B;  4DKK A;  3J81 Q;  4DV7 I;  4P7A A;  4WXD A;  4TUG A;  1B63 A;  3VYY A;  2DLK A;  4AIM A;  2A25 A;  2BA0 D;  1DI2 A;  1UIL A;  2Q2E B;  3ADI A;  1RMD A;  5DNX A;  4OO1 F;  1N34 I;  4DPW A;  4JV5 I;  2HHH I;  3JAM C;  4BA1 B;  4Z7C A;  1JK1 A;  2EMY A;  4JI4 E;  2FTX B;  4UT4 A;  1BBO A;  1Z1B A;  2EPL X;  2WP8 B;  3GME A;  5C0X A;  1SR9 A;  2EL5 A;  2OI2 A;  4IS1 C;  2EOZ A;  1YYW A;  3ZZU A;  2YSP A;  2EPU A;  4B3R E;  2UUC E;  4LFC I;  2ELY A;  2DLQ A;  2JT2 A;  4U3B A;  5JEA D;  2IOQ A;  2CT1 A;  1GZ6 A;  3V2U C;  2YTG A;  4WXC A;  4GQU A;  2NUF A;  1Z5B A;  4DMI A;  3ZZT A;  4DV5 I;  3HPS A;  1HNX I;  1S16 A;  2EM3 A;  2AE8 A;  2EQ1 A;  1X5W A;  3THO B;  1KTV A;  2JE6 A;  2WNR B;  4R1F A;  2WBS A;  4JI6 I;  4DPX A;  5KL7 A;  4BC7 A;  2CGE A;  1XNQ I;  3HPZ A;  2ODR C;  4X8W A;  2EM4 A;  1IMU A;  4FK5 C;  2DEJ A;  2V2V A;  4AM3 A;  4DR4 I;  2YTP A;  1H7S A;  2JP9 A;  2LVH A;  4Q35 B;  2NN6 F;  4M0V A;  4URL A;  4MYU A;  4OX9 I;  5K36 F;  4DV0 E;  2LRS A;  4GKK I;  2EPX A;  1OJ4 A;  4R2E A;  4ZVI A;  4RPF A;  4MU3 A;  2Z5B A;  2H36 X;  3C4T A;  1Z0W A;  4LF9 I;  4WPY A;  1XNR E;  5LLQ A;  5A6B A;  1DAR A;  3OTO I;  3ZKD A;  4ED4 A;  1Z0B A;  4R03 A;  4WYQ B;  4WFT A;  3JTZ A;  2N3H A;  3HJC A;  1OYS A;  5KL6 A;  3BGH A;  2LCE A;  4IFD A;  2L2N A;  5JEA B;  4DR2 I;  3KZY A;  2EL6 A;  1WHN A;  1A1J A;  4JYA E;  4JI5 I;  2EPP A;  2JOX A;  1YUJ A;  2Z5C A;  3JAM Q;  3IWB A;  4R2A A;  1DQ3 A;  4BMJ A;  1HR0 E;  4FWD A;  4NZV A;  5T6J A;  4P78 A;  1ZU1 A;  5FLX Q;  4LF5 E;  1IQS A;  2EOQ A;  2NAB A;  2YSO A;  2DIX A;  5A6A A;  1J5E E;  3VHT B;  2DGC A;  1NHJ A;  1X6E A;  4PRX A;  4DV3 E;  4X64 I;  2EJ4 A;  2EPZ A;  4AID A;  2MKN A;  1N0V C;  4KQV A;  1KJK A;  2UUB I;  2EL4 A;  1KYQ A;  4XTJ A;  5A2Q C;  1N32 E;  1NCS A;  2PNZ B;  1ELO A;  3ZKB A;  4DR3 E;  2RPC A;  2YTF A;  4F9A B;  4DR5 E;  4JI3 E;  5JEA E;  4FN5 A;  2EM0 A;  4K0K I;  2UXB E;  1ZR9 A;  4DR6 I;  2EMI A;  2V8Q B;  3C6M A;  2B9D A;  3EPK A;  5C0X D;  4NXN I;  1HNW I;  1FKA E;  1USV A;  1EH8 A;  2V88 A;  3KZZ A;  2JEA B;  2EOX A;  2VRD A;  1N36 E;  5LMN I;  5TSE A;  4DUZ E;  2ENC A;  4JI7 E;  1KKH A;  4DV4 I;  5GMD A;  2AJ4 A;  3U1K A;  2E5L I;  3J7A M;  3J80 C;  4NXM I;  3HTX A;  1A1K A;  2WBT A;  5IT9 Q;  1NEI A;  2ZM6 E;  4YY3 E;  2RTX A;  2LBS B;  1PIE A;  2V2Z A;  4WUC A;  1IBK I;  2HFS A;  4N3O A;  4ZYH A;  2NUE A;  1J26 A;  5A6J A;  4LCF A;  2LJU A;  2M9A A;  2J7K A;  4X65 I;  3UHM A;  4GZN C;  2HK3 A;  4R8O A;  2CG9 A;  3P76 A;  3V5R A;  3Q6N A;  1MEY C;  2EML A;  5L3J A;  2K7I A;  2EPO A;  5BR8 I;  4R2C A;  2L3J A;  1Z5A A;  3MSW A;  2EOY A;  2YT4 A;  2LUP B;  4F54 A;  4JI8 I;  5DRP A;  1TN9 A;  1UDO A;  4X66 E;  4OO1 A; 
#chains in the Genus database with same CATH homology
 3ZOQ B;  4JG4 A;  1K47 A;  1X48 A;  3CWV A;  3PYG A;  5FWK A;  4LF6 I;  1Z0G A;  2V85 A;  4LF7 E;  3H4L A;  1IBL E;  4LF8 I;  3RMP A;  1UEK A;  3D4J A;  3PYD A;  4DPY A;  2V34 A;  4AQY E;  2B7T A;  4JI4 I;  2E1R A;  4KHP E;  1A6F A;  2LE2 A;  5A2Q Q;  2EFG A;  4HAC B;  2RS6 A;  2O1T A;  2O1V A;  5IWA E;  4LFA E;  4B3R I;  3GON A;  3LPS A;  4TUI A;  2L8T A;  3PYF A;  1YZ9 A;  2M1S A;  2A2C A;  1QZR A;  1FJG I;  2IHR 1;  2Z5B B;  1EKZ A;  4JI0 E;  3J80 Q;  2G7H A;  4LU9 A;  5DNY A;  1FWK A;  3OML A;  1PVG A;  1Z0V A;  3PRY A;  1X47 A;  2FGG A;  2BM1 A;  4HAC A;  4F9B B;  2KOU A;  4YHH I;  4L5N C;  3B82 A;  2Z5C B;  4WUD A;  4LF4 E;  4KZS A;  1Y4S A;  2HHH E;  2O1U A;  4HXZ A;  1YYK A;  2KON A;  2HFU A;  1MU5 A;  3J7A G;  5LMU I;  1HNZ I;  3LLH A;  1RR9 A;  1XMO I;  3IWD A;  4JYA I;  2LJH A;  3F6G A;  2DMY A;  4P52 A;  2R3V A;  4F9C B;  4LFB E;  4LF5 I;  2L6M A;  2EWL A;  2PNL A;  3HUL A;  1J5E I;  4Z7Y A;  2E1M A;  1NHH A;  3ZZ0 A;  3T1Y I;  1HK7 A;  4JI2 I;  1N33 E;  1WXR A;  2L3C A;  4B3S E;  5AAS A;  3AV0 A;  4DR3 I;  4JI6 I;  4JI3 I;  1EI1 A;  1D6T A;  1WHQ A;  2L33 A;  3K1J A;  4DV2 I;  2UXB I;  4JI1 E;  4OX9 E;  2ZBK B;  5GME A;  3F0N A;  2RSM A;  4GKJ I;  4IZJ A;  5AE3 A;  1Z0E A;  1N36 I;  4USM A;  4DUZ I;  1KVK A;  3B78 A;  1USU A;  4UTG A;  3ADG A;  2LTR A;  1I94 E;  4P7D A;  2LMZ A;  2ZM6 I;  2WW4 A;  3K85 A;  1FI4 A;  4YY3 I;  4DU8 A;  4IZK B;  2UXC E;  2M7Q A;  3Q1Q A;  4FW9 A;  4X62 I;  3J81 C;  2DSY A;  2FV4 B;  2GS8 A;  2IOP A;  1KIJ A;  1XMQ E;  2DEI A;  1X49 A;  4M1K A;  1WUU A;  1ZM3 A;  4X66 I;  3FIG A;  2V8P A;  5AE1 A;  3ADL A;  2UXD E;  4EMD A;  2VQF I;  4DUY E;  3K17 A;  2HKE A;  3M6A A;  1IBM E;  2UU9 I;  2UUA E;  2F4V E;  2VQE E;  3WU5 A;  1GQE A;  3QT7 A;  4AQY I;  4DV1 E;  3VK6 A;  2V83 A;  4NXN E;  1HNW E;  4KHP I;  3WU4 A;  4WUB A;  1NHI A;  2HK2 A;  1B62 A;  1UHZ A;  1EA6 A;  2ODR D;  1FNM A;  4DV4 E;  5IWA I;  4LFA I;  3WU6 A;  3P1X A;  3DJW A;  4DR7 E;  3F6H A;  2VF3 A;  4B3M E;  4GEQ B;  4B3T E;  2DB2 A;  2XEX A;  4M30 A;  4JI0 I;  2UUC I;  4HY1 A;  1ZXM A;  3T1H E;  2YZT A;  4DV6 E;  4IZJ D;  4I3H A;  1Y4U A;  3B8H A;  1Y6Z A;  2K4V A;  2L2K B;  2CZ9 A;  3QT6 A;  4DR1 E;  3J7Y p;  3LTO A;  4LF6 E;  4LF4 I;  2CPN A;  3LNU A;  4DV0 I;  2GQ0 A;  2O1W A;  3QT8 A;  4DV7 E;  1S4E A;  4LF8 E;  2B3T B;  1RRE A;  1Z0C A;  2V2Q A;  2KHX A;  2LTS A;  5FLX C;  3VYX A;  1XNR I;  1T4O A;  2NUG A;  3LML A;  1N34 E;  4JV5 E;  2ZIT A;  4IZK A;  2V87 A;  3QT5 A;  2N3G A;  4LFB I;  2JY9 A;  3K6Q A;  2JVA A;  2MC6 A;  2L2M A;  1ZBQ A;  5ADZ A;  1FJG E;  4IZJ B;  4BBY A;  4DPU A;  1N33 I;  1HR0 I;  4LFC E;  4B3S I;  3IWC A;  2F8B A;  1U2R A;  2M4I A;  4JI1 I;  4DV3 I;  4DV5 E;  5LL6 R;  1HNX E;  4BS9 A;  1H73 A;  2HKJ A;  2WZO A;  2VE7 C;  2JR1 A;  5IT9 C;  3HXL A;  1N32 I;  1MG7 A;  1XNQ E;  4YHH E;  4DR5 I;  3C4B A;  3H09 A;  1H74 A;  4DR4 E;  3ADJ A;  3AUZ A;  3P06 A;  1I94 I;  1MX0 A;  4GKK E;  3PYE A;  1STU A;  1Z0T A;  1N0U A;  2BM0 A;  4LTY A;  2MDR A;  5LMU E;  1HNZ E;  2UXC I;  4PU9 A;  3DF6 A;  1XMO E;  1ZM9 A;  4LF9 E;  1H72 C;  4JI7 I;  2NPF A;  4DXL A;  3OTO E;  1XMQ I;  2A2D A;  1ZBT A;  1O0W A;  2V86 A;  2JWO A;  3KWR A;  3JU0 A;  4DPT A;  5AE2 A;  4DR2 E;  2PNM A;  4JI5 E;  4PRV A;  2LUQ A;  1YYO A;  3T1Y E;  4HYM A;  2UXD I;  2JOB A;  4MYT A;  4DUY I;  4JI2 E;  1VIS A;  4WSP A;  2X7I A;  4JI6 E;  1IBM I;  2UUA I;  2F4V I;  2VQE I;  3WU3 A;  2MC5 A;  4X64 E;  4DV2 E;  4Q28 A;  4DV1 I;  4FWH A;  2V89 A;  4J8Z A;  2UUB E;  4GKJ E;  1QU6 A;  4I8O A;  2NA2 A;  4LF7 I;  2RS7 A;  1IBL I;  2Z5E A;  1H7U A;  4K0K E;  4BC9 A;  1T4L B;  4DR6 E;  4DR7 I;  5CFF E;  1ZM4 A;  1Z59 A;  1PKP A;  4B3M I;  3ZM7 A;  1XHK A;  2X36 A;  5LMN E;  4FWG A;  4X62 E;  4B3T I;  1T4N A;  4M2Z A;  2E5L E;  2R42 A;  4OOG C;  4NXM E;  2L92 A;  4USK A;  2LJP A;  3T1H I;  2B7V A;  4DV6 I;  1ZM2 A;  1RC7 A;  2VF1 A;  3Q6M A;  1IBK E;  4BCA A;  4X65 E;  1BKN A;  4DU7 A;  4L8N A;  4DR1 I;  1NZ0 A;  1RQ0 A;  1ZXN A;  2VQF E;  5F3W A;  1FWL A;  2UU9 E;  5BR8 E;  4DV7 I;  3HQ1 A;  1Z5C A;  4JI8 E;  3J81 Q;  4DKK A;  4P7A A;  4TUG A;  1B63 A;  3VYY A;  1DI2 A;  1UIL A;  2Q2E B;  3ADI A;  1N34 I;  4DPW A;  4JV5 I;  2HHH I;  3JAM C;  4Z7C A;  4JI4 E;  2FTX B;  4UT4 A;  1SR9 A;  2OI2 A;  1YYW A;  3ZZU A;  4B3R E;  2UUC E;  4LFC I;  2IOQ A;  1GZ6 A;  3V2U C;  2NUF A;  1Z5B A;  4DMI A;  3ZZT A;  4DV5 I;  3HPS A;  1HNX I;  1S16 A;  1KTV A;  4R1F A;  4DPX A;  4BC7 A;  2CGE A;  1XNQ I;  3HPZ A;  2ODR C;  4X8W A;  2DEJ A;  2V2V A;  4DR4 I;  1H7S A;  4URL A;  4OX9 I;  4M0V A;  4MYU A;  4DV0 E;  2LRS A;  4GKK I;  1OJ4 A;  4ZVI A;  4RPF A;  2Z5B A;  2H36 X;  3C4T A;  1Z0W A;  4LF9 I;  4WPY A;  1XNR E;  1DAR A;  3OTO I;  3ZKD A;  4ED4 A;  1Z0B A;  4R03 A;  4WYQ B;  4WFT A;  3JTZ A;  2N3H A;  3HJC A;  2L2N A;  4DR2 I;  4JYA E;  1WHN A;  4JI5 I;  2JOX A;  2Z5C A;  3JAM Q;  3IWB A;  1DQ3 A;  4BMJ A;  1HR0 E;  4FWD A;  5T6J A;  4P78 A;  5FLX Q;  4LF5 E;  2EZ6 A;  2BV3 A;  4FN5 A;  2DIX A;  1NHJ A;  1J5E E;  4X64 I;  4PRX A;  4DV3 E;  1N0V C;  4KQV A;  2UUB I;  4XTJ A;  5A2Q C;  1N32 E;  1ELO A;  3ZKB A;  4DR3 E;  4DR5 E;  4F9A B;  4JI3 E;  4K0K I;  2UXB E;  4DR6 I;  2V8Q B;  2B9D A;  4NXN I;  1HNW I;  1FKA E;  1USV A;  2V88 A;  1N36 E;  5LMN I;  4DUZ E;  1KKH A;  4JI7 E;  4DV4 I;  5GMD A;  2AJ4 A;  2E5L I;  3J7A M;  3J80 C;  4NXM I;  3HTX A;  5IT9 Q;  2ZM6 E;  4YY3 E;  2RTX A;  2LBS B;  1PIE A;  2V2Z A;  4WUC A;  1IBK I;  2HFS A;  4N3O A;  1J26 A;  2NUE A;  2J7K A;  4X65 I;  2HK3 A;  4R8O A;  2CG9 A;  3V5R A;  3Q6N A;  5L3J A;  5BR8 I;  2L3J A;  1Z5A A;  3MSW A;  2YT4 A;  2LUP B;  4JI8 I;  4F54 A;  4X66 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...