1PKPA

The structure of ribosomal protein s5 reveals sites of interaction with 16s rrna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
b'INPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S5
publication title The structure of ribosomal protein S5 reveals sites of interaction with 16S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 1993-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1pkpA01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pkpA02
1PIEA 3JAMQ 4DR5E 2LBSB 3J80C 4DPWA 2NUGA 3PYFA 2UUAI 2V8PA 3ADLA 2KHXA 1H7SA 2UXBE 1ZM2A 4DR5I 4AQYE 2AJ4A 1FJGE 4KHPI 2HK3A 2BV3A 1Z0VA 4LF7I 1N32E 1IBKI 2HKJA 2JY9A 4DR1E 4AQYI 4B3MI 4X8WA 3F0NA 4LFCI 2RTXA 1PKPA 1N32I 2DEIA 4MYUA 2B3TB 1XNQE 1XMOE 1Z5CA 5GMEA 3ADIA 4XTJA 2X7IA 2B7VA 3B78A 2RSMA 4URLA 1YYWA 1XMOI 3J7AM 4HY1A 1GQEA 3OTOI 1KKHA 4LFBE 2L33A 4DR4E 5FLXC 1FWLA 4LF9E 3J80Q 1UHZA 4K0KE 4M2ZA 3C4BA 2NA2A 4LFBI 4DR4I 2CZ9A 4LF5I 4R1FA 2E1RA 3LPSA 2HFUA 4FW9A 1STUA 1EKZA 4USKA 4DXLA 2EZ6A 3T1YE 1ELOA 1YZ9A 4JV5E 1IBLE 2L3CA 2V2VA 4JI1E 1ZXNA 4LF6I 2LUQA 1ZBTA 3V5RA 1HNZE 1O0WA 1YYKA 1DARA 1FWKA 1VISA 5L3JA 1HNWE 1IBLI 1RR9A 4Z7YA 4MYTA 4B3RI 4JI1I 4I3HA 1I94I 4EMDA 1HR0E 4X64I 1T4OA 2ZM6E 1A6FA 4DPTA 1ZXMA 3T1HE 1K47A 5FLXQ 4DUYE 3ZM7A 1HR0I 3Q1QA 3J7AG 3C4TA 2LUPB 2ZM6I 1BKNA 1XHKA 1Z0TA 5IWAI 4M30A 1WHNA 3T1HI 4HACB 3WU4A 5LMNE 4YY3I 3ZZUA 1WHQA 2UUCE 4JYAE 1QU6A 1MX0A 2VQEE 1X49A 2E5LE 4DV1E 2UUCI 4JYAI 2IHR1 2CPNA 4DV6E 4WUCA 4NXNE 2UXBI 3GONA 4JI8E 2VQEI 1N33E 1FJGI 3B8HA 4PU9A 4DV1I 1QZRA 1MG7A 4DR7E 5GMDA 2UXDE 2JVAA 4DV6I 4NXNI 3K17A 3LTOA 2L2KB 3WU6A 4JI6E 4DR1I 4LFAE 4PRVA 1H73A 4NXME 4JI5E 1N0UA 2R3VA 1H7UA 3ZKBA 2UXDI 1FKAE 2WW4A 1J5EE 4JI6I 1FI4A 2OI2A 4FN5A 4LFAI 1XNQI 2HHHE 1RC7A 4HXZA 4NXMI 4UT4A 2UU9E 4P7AA 1X48A 1XMQE 1FNMA 1N36E 1IBME 1EA6A 3WU5A 4DV2E 1J5EI 1NZ0A 3J81C 1U2RA 1UILA 2HHHI 3PYGA 2DIXA 4LF4E 5LMUE 1XNRE 1XMQI 4DU8A 1N36I 1IBMI 1UEKA 4DV2I 4LF9I 4DV7E 1NHJA 3M6AA 2LJHA 1N34E 4DV3E 1NHIA 4K0KI 5LMUI 1H74A 1XNRI 4B3TE 2L3JA 2ZITA 4KQVA 3HTXA 2BM0A 3LLHA 4FWDA 4DV7I 3JAMC 3J7Yp 5CFFE 4DR3E 4DV3I 2A2CA 1KVKA 3ZZTA 4YHHE 3PYDA 1S16A 3V2UC 3T1YI 2VF3A 4JV5I 2GS8A 4JI4E 1WUUA 1Z0WA 4FWHA 2EFGA 2LTRA 2LTSA 4WUDA 1ZM3A 4YHHI 4HYMA 2J7KA 1MU5A 4DR6E 2UUBE 1DI2A 2BM1A 2XEXA 3B82A 4RPFA 1HNZI 1EI1A 2NUFA 1HNWI 4UTGA 1KIJA 1X47A 4GKKE 1T4NA 4B3SE 4JI7E 3CWVA 3J81Q 4DR6I 2UUBI 4DUZE 3HULA 2NPFA 3VYYA 3K1JA 2L2MA 4JI0E 4DR2E 1OJ4A 3ADGA 4DUYI 2HK2A 1B63A 4X62E 4OX9E 1H72C 1KTVA 5LL6R 4GKKI 2V34A 4JI7I 2HKEA 1YYOA 4JI2E 4DUZI 4DPYA 4X66E 3QT7A 2NUEA 5LMNI 4DV5E 1S4EA 3QT6A 4X62I 4OX9I 2YT4A 3ZZ0A 4ED4A 4JI3E 2V2ZA 4JI2I 4KHPE 4X66I 5BR8E 2E5LI 4DV5I 4LF7E 1IBKE 4JI3I 3VYXA 2V2QA 4JI8I 4B3ME 5BR8I 1D6TA 1Z5AA 4DKKA 4LFCE 1Z0BA 1N33I 1Z0GA 5IT9C 4PRXA 4DR7I 3ADJA 2DB2A 2DMYA 4WYQB 2N3HA 2Q2EB 4JI5I 2LJPA 4USMA 3PYEA 3QT5A 2LRSA 4WUBA 3LNUA 3OTOE 1Z0EA 2MDRA 4DV4E 2HFSA 2R42A 1ZM9A 1Z0CA 5A2QC 2UU9I 2DEJA 1PVGA 4DV4I 2RS7A 3WU3A 4LF4I 4LF5E 2L2NA 4ZVIA 1ZM4A 2B7TA 4HACA 4DPXA 1N34I 2F4VE 4B3TI 2VQFE 4P52A 4M1KA 1Z59A 4X65E 2RS6A 4GKJE 1N0VC 4DV0E 5IT9Q 4DR3I 4LF6E 1HNXE 2F4VI 4DPUA 2X36A 1Z5BA 2VQFI 3D4JA 4WFTA 4FWGA 4Z7CA 4X65I 4GKJI 4DV0I 4JI4I 4B3RE 1I94E 1RQ0A 1NHHA 1HNXI 4X64E 1J26A 1RREA 3H4LA 2A2DA 1T4LB 3ZKDA 4LF8E 1B62A 4JG4A 4DU7A 3QT8A 2UXCE 5A2QQ 2N3GA 2ZBKB 5IWAE 4B3SI 4LF8I 4OOGC 4YY3E 4JI0I 4DR2I 2UUAE 2UXCI 3P1XA
chains in the Genus database with same CATH superfamily
5JEAF 2GHFA 1PIEA 3JAMQ 5F3WA 4DR5E 1PJQA 2YU8A 3J80C 2LBSB 2JEBA 3BBGA 4DPWA 4IFDE 2EOEA 2NUGA 4OO1A 2IOPA 1GTKA 3PYFA 2UUAI 2V8PA 2DSYA 5K36C 2EMYA 4BC9A 3ADLA 2KHXA 1H7SA 2UXBE 4KZSA 2I9IA 4ZYHA 1MGTA 1BBGA 1ZM2A 4DR5I 4AQYE 1Y60A 2C37A 3HPZA 1A1KA 1FJGE 1UDSA 2AJ4A 3KRNA 1PJSA 2DLKA 2HK3A 1NEIA 2BBGA 2BV3A 4L8NA 4KHPI 2EMLA 1Z0VA 2EN4A 2V88A 4P7DA 4LF7I 3EPLA 1N32E 1JK2A 1IBKI 2HKJA 3AUZA 4NHRA 2JY9A 3H09A 4DR1E 1YFHA 1G2FC 4AQYI 4IZKA 4B3MI 5T6JA 2F8BA 4ZYDA 3HJCA 3H1CA 4X8WA 3F0NA 4LFCI 1EH6A 1ZAAC 2EM4A 5C0XB 2M7QA 2MC5A 2RTXA 1PKPA 2MDGA 1R6LA 1N32I 4TUIA 4IFDB 2EOFA 2EMAA 2V86A 2DEIA 2EOOA 2B3TB 2LVHA 4R2AA 1XMOE 1XNQE 1E3PA 1Z5CA 5A6BD 4MYUA 5GMEA 1YUIA 5AC5A 2RPCA 2WNRA 2F1DA 2JE6B 2EPXA 3HPSA 2C39B 2YU5A 2ADRA 3CDIA 5LLQA 3ADIA 4XTJA 2X7IA 3JU0A 2B7VA 3B78A 2RSMA 4URLA 1UBDC 2L6MA 1TF3A 1YYWA 1XMOI 4IFDC 3J7AM 4HY1A 2EOZA 4AM3A 3KZZA 5EL9A 1GQEA 3MSWA 3THOB 3OTOI 3C6MA 4U3BA 1KKHA 5C0XD 5K36B 4LFBE 3P3CA 2L33A 4DR4E 2Q8UA 5FLXC 4R2DA 4M0VA 1FWLA 2M1SA 2YTGA 2PO1A 4LF9E 3J80Q 4KWYA 4BCAA 3RMPA 1UHZA 2JEAA 2EMXA 1YUJA 3P06A 5KL6A 4K0KE 2YWQA 4M2ZA 3C4BA 2NA2A 1RHYA 4LFBI 2EPOA 3VHTB 4DR4I 2YRMA 2ELYA 2JOBA 4LTYA 5TSEA 2PO2B 3C6KA 2CZ9A 4LF5I 1Y6ZA 3ECRA 2E1RA 4R1FA 2DLQA 3LPSA 1UDNA 2HFUA 1EH8A 2EP3A 4FW9A 2PNZA 4MU1A 5K36D 1STUA 1EKZA 4N3OA 4USKA 3L00A 2BA1D 4DXLA 2JP9A 1Y4UA 2NN6E 3U1KA 1XXEA 2EZ6A 3DJWA 5A6JA 2IERA 5JEAE 1X6HA 2JR1A 4F9BB 3T1YE 1ELOA 3NZKA 1YZ9A 2BA1G 5DNYA 1R6MA 4JV5E 1WRJA 4MQYA 1QNTA 1IBLE 3M7ND 2L3CA 2V2VA 2EWLA 4JI1E 1ZXNA 2LT7A 2FGGA 2EOYA 4LF6I 2B9DA 5DRRA 2CG9A 2HC5A 3CDJA 3HQ1A 1ZBTA 2LUQA 2IOQA 5DNXA 2V85A 2EOSA 1HNZE 2R76A 3V5RA 4BA2B 3AV0A 3OMLA 1AH5A 1O0WA 1YYKA 1DARA 1E3HA 1FWKA 1VISA 5L3JA 1HNWE 1IBLI 1HK7A 1ZBQA 1RR9A 3B4TA 4Z7YA 4MYTA 4B3RI 4JI1I 1DQ3A 4F9AB 1DGCA 4I3HA 4EMDA 1I94I 4R8OA 2YSOA 4I8OA 2EOIA 1HR0E 3P3GA 4X64I 1T4OA 4Q35B 2ZM6E 4Q28A 2EOQA 4O4KA 1A6FA 4DPTA 2EMIA 1ZR9A 1ZXMA 4IFDD 4LCFA 3T1HE 2O1VA 4F9CB 1K47A 3KWRA 1A1IA 5KL4A 5FLXQ 4DUYE 4LF9I 3EQ1A 2O1UA 2EPZA 3ZM7A 5C0XA 3K85A 3F6HA 4GEQB 2WBTA 3C4TA 5AC4A 2LUPB 3J7AG 3M85D 1BKNA 2ZM6I 1XHKA 1Z0TA 2EN2A 4M30A 5IWAI 1WHNA 2EMBA 4P78A 2EPUA 1YPNA 1X6FA 3PS1A 3PS3A 4HACB 3T1HI 3WU4A 2MKNA 4O5GA 5LMNE 2NN6C 4YY3I 2G7HA 2EN7A 1WHQA 2UUCE 4JYAE 2C39A 3ZZUA 5JEAC 3QG5C 2EPAA 4OO1F 3HKMA 1RMDA 1QU6A 2EMZA 2Z5EA 3F6GA 5IXMB 5KL2A 1MX0A 2J65A 2VQEE 2I13A 1X49A 1USUA 1PDAA 2E5LE 5K36A 1UDOA 4DV1E 2UUCI 4JYAI 2M9AA 2IHR1 2YTJA 1NCSA 4IZJA 1N3GA 2EMFA 2CPNA 4DV6E 4WUCA 2EORA 4NXNE 2UXBI 3M99B 3GONA 1MEYC 4JI8E 1IQSA 2CT1A 4DMIA 2VQEI 2FTXB 2JOXA 1N33E 2AE8A 4BHCA 1FJGI 3B8HA 4PU9A 2EMGA 4DV1I 2LE2A 1QZRA 1MG7A 4DR7E 5GMDA 2UXDE 2JVAA 4DV6I 2PNMA 4QNJA 2PO2A 4NXNI 3K17A 4O24A 1ZU1A 3LTOA 3IWDA 2L2KB 3L7ZB 5EKWA 2LO3A 4JI6E 3WU6A 4DR1I 4LFAE 4PRVA 1H73A 2J7JA 4NXME 4JI5E 1N0UA 4BS9A 4IJDA 2R3VA 1JK1A 1H7UA 1A1GA 2Z5BB 3ZKBA 2UXDI 3GLLA 1FKAE 2WW4A 1A1FA 4BMJA 2EN3A 1J5EE 2GLIA 4JI6I 3EPHA 1FI4A 2OI2A 4FN5A 4LFAI 2JT2A 2NN6B 1XNQI 2HHHE 1RC7A 4HXZA 4NXMI 5JEAB 4NBQA 4UT4A 1UN6B 2UU9E 4P7AA 1X48A 1XMQE 4F54A 2YTNA 1N36E 1FNMA 4F2JC 5A6AA 1IBME 1EA6A 3WU5A 2BA0D 4DV2E 4IFDA 2BR2B 1J5EI 2ODRC 1X3CA 1NZ0A 3J81C 1U2RA 1UILA 4BC7A 4BA2A 2HHHI 2V87A 2YRKA 2RSIA 3PYGA 2DIXA 3MHHC 4LF4E 5LMUE 1XNRE 4AIDA 1XMQI 1P42A 4DU8A 1N36I 2EMHA 1IQOA 1UEKA 3GMEA 1IBMI 2EQ0A 1UDQA 2JYAA 4ZYEA 2RQLA 4DV2I 4DV7E 3DD6A 5ADZA 5KL3A 1NHJA 2NN6D 3EPKA 3M6AA 5JEAD 1KYQA 2LJHA 2EMCA 1N34E 2K7IA 4DV3E 1NHIA 4ISAA 4K0KI 5LMUI 1H74A 2EM9A 1XNRI 4B3TE 5AASA 2EL5A 2L3JA 2ZITA 2EMWA 2YRHA 4F6NA 4KQVA 4IZKB 3HTXA 2BM0A 3LLHA 4FWDA 4AIMA 4DV7I 3JAMC 1YH8A 3J7Yp 1Y5YA 5CFFE 4DR3E 4F6MA 4DV3I 2LV2A 2A2CA 4OO1E 2LJUA 3THNA 1KVKA 2GO4A 3ZZTA 4R2QA 4WSPA 4YHHE 1BBOA 3PYDA 4WX9A 3BIDA 1S16A 2PO0B 2EOMA 4R2RA 3V2UC 3T1YI 2VF3A 4FW3A 3M7NG 2EM6A 2YZTA 2EOXA 4JV5I 2GS8A 2V89A 4JI4E 1WUUA 2O1WA 1Z0WA 2A25A 4WXCA 2EPLX 4FWHA 2EFGA 4FW7A 2LTRA 2LTSA 1USVA 1ZM3A 4WUDA 2M4IA 5A6BA 4LCHA 4YHHI 4HYMA 2KOUA 3DF6A 2J7KA 1MU5A 2MC6A 4DR6E 2UUBE 1DI2A 2BM1A 2XEXA 3B82A 4RPFA 1HNZI 2MKDA 1Y4SA 1EI1A 2EL6A 2NUFA 1HNWI 4M9VC 4ZYGA 4UTGA 1KIJA 4GZNC 4OZEA 1X47A 2CSHA 4GKKE 1T4NA 4B3SE 4LCGA 2EOHA 4JI7E 3CWVA 3J81Q 3IWBA 2UUBI 2VE7C 2EJ4A 4DR6I 4DUZE 3HULA 2WZOA 3L7ZA 4J3DA 1A1LA 5DROA 3VYYA 1WXRA 3K1JA 2NPFA 3Q1QA 3TQMA 2L2MA 4JI0E 4DR2E 2K4VA 1OJ4A 2VESA 3ADGA 3M85G 5AE2A 4DUYI 2HK2A 2ODRD 1B63A 2JE6A 5DNLA 4X62E 4OX9E 1H72C 5LL6R 1KTVA 2IESA 2Z5BA 2V34A 4JI7I 4GKKI 2HKEA 2HGHA 1Z1BA 1YSAC 1YYOA 1LLMC 4HEIA 4JI2E 4DUZI 4DPYA 5A69A 2EPPA 4X66E 2NN6A 3QT7A 2WP8B 1X6EA 2R1FA 2NUEA 4MDTA 5LMNI 2D9HA 4BA1B 4DV5E 5JEAA 4OO1C 1TF6A 3K6QA 3UK3C 1S4EA 3QT6A 4X62I 4OX9I 4RHBB 5AE1A 2EM5A 1SR9A 4QNKA 2YT4A 2DGCA 3ZZ0A 2O3ZA 4JI3E 2Z5CB 4ED4A 2V2ZA 4JI2I 5K36F 2GQ0A 2BR2A 4KHPE 4X66I 5BR8E 2O1TA 2YTPA 2VRDA 2EMKA 2PNLA 4FW6A 2E5LI 4MLVA 2EN1A 4DV5I 4LF7E 1IMUA 3FIGA 5KL7A 2EN6A 1IBKE 3U1YA 4R2CA 1PJTA 2YTIA 5AE3A 4JI3I 3VYXA 3Q6MA 2V2QA 4JI8I 4GQUA 4B3ME 5BR8I 1D6TA 1Z5AA 4DKKA 4LFCE 1Z0BA 1N33I 2EN8A 1Z0GA 2ENCA 5IT9C 1T38A 2C38B 3P3EA 4PRXA 4DR7I 2EQ3A 3ADJA 2DB2A 4TUGA 2DMYA 4WYQB 4WXDA 2N3HA 2Q2EB 1OYRA 2CVEA 3MHSC 4R2EA 4JI5I 2LJPA 3HXLA 4USMA 1X5WA 3IWCA 2N8XA 2PO0A 3PYEA 3QT5A 2LRSA 2ELZA 4WUBA 2JEBB 2EPNA 2HJJA 2FV4B 3LNUA 2YTEA 4BBYA 2WBSA 1VI7A 3OTOE 1Z0EA 2KONA 2MDRA 4OO1B 4DV4E 1BB8A 2HFSA 4IFDF 4IS1C 2R42A 3UHMA 4LOMA 2JPAA 4X9JA 1ZM9A 5A6KA 1A1HA 1Z0CA 2BA0G 5A2QC 1B69A 2UU9I 2DEJA 2ENAA 4OKGA 4MU4A 2EM8A 2PRTA 4MU3A 1KJKA 1PVGA 2BB8A 1P47A 4R03A 2C37B 2LMZA 3ZOQB 4DV4I 2H36X 3Q6NA 1GZ6A 5KL5A 4WPYA 2RS7A 1L4SA 3WU3A 4IZJB 2L92A 4LF4I 4LF5E 1G2DC 2YPNA 2L2NA 5C0XE 2CGEA 4ZVIA 4OO1D 2DRPA 2EPMX 1ZM4A 4R2SA 2B7TA 4HACA 4DPXA 3BGHA 1N34I 3JTZA 2F4VE 2EM7A 4B3TI 2VQFE 2GO3A 4P52A 1AAYA 2YSPA 2EE8A 1TN9A 3KZYA 4M1KA 2NABA 4X65E 1Z59A 2ENHA 2WBUA 2RS6A 5DRPA 4GKJE 2DMIA 3EPJA 4LPFA 1N0VC 4DV0E 1A1JA 5FWKA 1HR0I 2WNRB 5DRQA 1OYSA 2LCEA 4N4RB 4IZJD 1OYPA 5IT9Q 2V83A 4DR3I 1SFEA 2WP8A 4LF6E 1HNXE 2F4VI 5ELWA 4DPUA 2X36A 4BA1A 4O43A 2EM2A 1Z5BA 1EH7A 4MU0A 3D4JA 2VQFI 4WFTA 1T39A 4FWGA 4Z7CA 5K36E 4FK5C 2GPIA 2YTFA 4X65I 4R2PA 4GKJI 3LMLA 4DV0I 2Z5CA 2JWOA 2EPRA 2JXPA 4RH8A 4JI4I 4B3RE 2E1MA 5IV8B 1I94E 1RQ0A 2EM3A 1NHHA 5C0XF 1HNXI 4FW4A 2EL4A 2YTOA 4L5NC 2YTQA 4X64E 1J26A 1RREA 2VF1A 3H4LA 2PO1B 2WCC3 2YTDA 4LU9A 3BF2A 4BHBA 1T4LB 2A2DA 2EPCA 2EQ1A 4NZVA 3ZKDA 2JEAB 2EPKX 4LF8E 3VK6A 1B62A 3PS2A 4JG4A 4DU7A 3QT8A 2CTDA 1YHCA 2E72A 2UXCE 5A2QQ 1F2IG 2N3GA 2C38A 5C0XC 4IS9A 2ZBKB 2EM0A 4MLQA 5IWAE 3GCMA 4B3SI 2EOJA 2L8TA 2PNZB 4LF8I 3P76A 3PRYA 4WSGA 4OOGC 1WJPA 2V8QB 4YY3E 4JI0I 4HTGA 4DR2I 2UUAE 2UXCI 4J8ZA 2NN6F 3P1XA 4U3DA 4FW5A
chains in the Genus database with same CATH topology
1PIEA 3JAMQ 5F3WA 4DR5E 3J80C 2LBSB 4DPWA 2NUGA 2IOPA 3PYFA 2UUAI 2V8PA 2DSYA 4BC9A 3ADLA 2KHXA 1H7SA 2UXBE 4KZSA 1ZM2A 4DR5I 4AQYE 3HPZA 1FJGE 2AJ4A 4KHPI 2HK3A 2BV3A 4L8NA 1Z0VA 2V88A 4P7DA 4LF7I 1N32E 1IBKI 2HKJA 3AUZA 2JY9A 3H09A 4DR1E 4AQYI 4IZKA 4B3MI 5T6JA 2F8BA 3HJCA 4X8WA 3F0NA 4LFCI 2M7QA 2MC5A 2RTXA 1PKPA 1N32I 4TUIA 2V86A 2DEIA 4MYUA 2B3TB 1XNQE 1XMOE 1Z5CA 5GMEA 3HPSA 3ADIA 4XTJA 2X7IA 3JU0A 2B7VA 3B78A 2RSMA 4URLA 2L6MA 1YYWA 1XMOI 3J7AM 4HY1A 1GQEA 3MSWA 3OTOI 1KKHA 4LFBE 2L33A 4DR4E 5FLXC 4M0VA 1FWLA 2M1SA 4LF9E 3J80Q 4BCAA 3RMPA 1UHZA 3P06A 4K0KE 4M2ZA 3C4BA 2NA2A 4LFBI 4DR4I 2JOBA 4LTYA 2CZ9A 4LF5I 1Y6ZA 4R1FA 2E1RA 3LPSA 2HFUA 4FW9A 1STUA 1EKZA 4N3OA 4USKA 4DXLA 1Y4UA 2EZ6A 3DJWA 2JR1A 4F9BB 3T1YE 1ELOA 1YZ9A 5DNYA 4JV5E 1IBLE 2L3CA 2V2VA 2EWLA 4JI1E 1ZXNA 2FGGA 4LF6I 2B9DA 2CG9A 3HQ1A 1ZBTA 2LUQA 2IOQA 2V85A 3V5RA 1HNZE 3AV0A 3OMLA 1O0WA 1YYKA 1DARA 1FWKA 1VISA 5L3JA 1HNWE 1IBLI 1HK7A 1ZBQA 1RR9A 4Z7YA 4MYTA 4B3RI 4JI1I 1DQ3A 4F9AB 4I3HA 1I94I 4EMDA 4R8OA 4I8OA 1HR0E 4X64I 1T4OA 2ZM6E 4Q28A 1A6FA 4DPTA 1ZXMA 3T1HE 2O1VA 4F9CB 1K47A 3KWRA 5FLXQ 4DUYE 2O1UA 3ZM7A 1HR0I 3K85A 3F6HA 4GEQB 3J7AG 3C4TA 2LUPB 2ZM6I 3Q1QA 1BKNA 1XHKA 1Z0TA 5IWAI 4M30A 1WHNA 4P78A 3T1HI 4HACB 3WU4A 5LMNE 4YY3I 2G7HA 3ZZUA 1WHQA 2UUCE 4JYAE 1QU6A 2Z5EA 3F6GA 1MX0A 2VQEE 1X49A 1USUA 2E5LE 4DV1E 2UUCI 4JYAI 2IHR1 4IZJA 2CPNA 4DV6E 4WUCA 4NXNE 2UXBI 3GONA 4JI8E 4DMIA 2VQEI 2FTXB 2JOXA 1N33E 1FJGI 3B8HA 4PU9A 4DV1I 2LE2A 1QZRA 1MG7A 4DR7E 5GMDA 2UXDE 2JVAA 4DV6I 2PNMA 4NXNI 3K17A 3LTOA 3IWDA 2L2KB 3WU6A 4JI6E 4DR1I 4LFAE 4PRVA 1H73A 4NXME 4JI5E 1N0UA 4BS9A 2R3VA 1H7UA 2Z5BB 3ZKBA 2UXDI 1FKAE 2WW4A 4BMJA 1J5EE 4JI6I 1FI4A 2OI2A 4FN5A 4LFAI 1XNQI 2HHHE 1RC7A 4HXZA 4NXMI 4UT4A 2UU9E 4P7AA 1X48A 1XMQE 4F54A 1FNMA 1N36E 1IBME 1EA6A 3WU5A 4DV2E 1J5EI 2ODRC 1NZ0A 3J81C 1U2RA 1UILA 4BC7A 2HHHI 2V87A 3PYGA 2DIXA 4LF4E 5LMUE 1XNRE 1XMQI 4DU8A 1N36I 1IBMI 1UEKA 4DV2I 4LF9I 4DV7E 5ADZA 1NHJA 3M6AA 2LJHA 1N34E 4DV3E 1NHIA 4K0KI 5LMUI 1H74A 1XNRI 4B3TE 5AASA 2L3JA 2ZITA 4KQVA 4IZKB 3HTXA 2BM0A 3LLHA 4FWDA 4DV7I 3JAMC 3J7Yp 5CFFE 4DR3E 4DV3I 2A2CA 1KVKA 3ZZTA 4WSPA 4YHHE 3PYDA 1S16A 3V2UC 3T1YI 2VF3A 2YZTA 4JV5I 2GS8A 2V89A 4JI4E 1WUUA 2O1WA 1Z0WA 4FWHA 2EFGA 2LTRA 2LTSA 1USVA 1ZM3A 4WUDA 2M4IA 4YHHI 4HYMA 2KOUA 3DF6A 2J7KA 1MU5A 2MC6A 4DR6E 2UUBE 1DI2A 2BM1A 2XEXA 3B82A 4RPFA 1HNZI 1Y4SA 1EI1A 2NUFA 1HNWI 4UTGA 1KIJA 1X47A 4GKKE 1T4NA 4B3SE 4JI7E 3CWVA 3J81Q 3IWBA 2UUBI 2VE7C 4DR6I 4DUZE 3HULA 2WZOA 2NPFA 3VYYA 1WXRA 3K1JA 2L2MA 4JI0E 4DR2E 2K4VA 1OJ4A 3ADGA 5AE2A 4DUYI 2HK2A 2ODRD 1B63A 4X62E 4OX9E 1H72C 5LL6R 1KTVA 2Z5BA 4GKKI 2V34A 4JI7I 2HKEA 1YYOA 4JI2E 4DUZI 4DPYA 4X66E 3QT7A 2NUEA 5LMNI 4DV5E 3K6QA 1S4EA 3QT6A 4X62I 4OX9I 5AE1A 1SR9A 2YT4A 3ZZ0A 4ED4A 4JI3E 2Z5CB 2V2ZA 4JI2I 2GQ0A 4KHPE 4X66I 5BR8E 2O1TA 2PNLA 2E5LI 4DV5I 4LF7E 3FIGA 1IBKE 5AE3A 4JI3I 3VYXA 3Q6MA 2V2QA 4JI8I 4B3ME 5BR8I 1D6TA 1Z5AA 4DKKA 4LFCE 1Z0BA 1N33I 1Z0GA 5IT9C 4PRXA 4DR7I 3ADJA 4TUGA 2DB2A 2DMYA 4WYQB 2N3HA 2Q2EB 4JI5I 2LJPA 3HXLA 4USMA 3IWCA 3PYEA 3QT5A 2LRSA 4WUBA 2FV4B 3LNUA 4BBYA 3OTOE 1Z0EA 2KONA 2MDRA 4DV4E 2HFSA 2R42A 1ZM9A 1Z0CA 5A2QC 2UU9I 2DEJA 1PVGA 4R03A 2LMZA 3ZOQB 4DV4I 2H36X 3Q6NA 1GZ6A 4WPYA 2RS7A 3WU3A 4IZJB 2L92A 4LF4I 4LF5E 2L2NA 2CGEA 4ZVIA 1ZM4A 2B7TA 4HACA 4DPXA 1N34I 3JTZA 2F4VE 4B3TI 2VQFE 4P52A 4M1KA 1Z59A 4X65E 2RS6A 5FWKA 4GKJE 1N0VC 4DV0E 4IZJD 5IT9Q 2V83A 4DR3I 4LF6E 1HNXE 2F4VI 4DPUA 2X36A 1Z5BA 2VQFI 3D4JA 4WFTA 4FWGA 4Z7CA 4X65I 4GKJI 3LMLA 4DV0I 2Z5CA 2JWOA 4JI4I 4B3RE 2E1MA 1I94E 1RQ0A 1NHHA 1HNXI 4L5NC 4X64E 1J26A 1RREA 2VF1A 3H4LA 4LU9A 2A2DA 1T4LB 3ZKDA 4LF8E 3VK6A 1B62A 4JG4A 4DU7A 3QT8A 2UXCE 5A2QQ 2N3GA 2ZBKB 5IWAE 4B3SI 2L8TA 4LF8I 3PRYA 4OOGC 2V8QB 4YY3E 4JI0I 4DR2I 2UUAE 2UXCI 4J8ZA 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIE A;  3JAM Q;  4DR5 E;  2LBS B;  3J80 C;  4DPW A;  2NUG A;  3PYF A;  2UUA I;  2V8P A;  3ADL A;  2KHX A;  1H7S A;  2UXB E;  1ZM2 A;  4DR5 I;  4AQY E;  2AJ4 A;  1FJG E;  4KHP I;  2HK3 A;  2BV3 A;  1Z0V A;  4LF7 I;  1N32 E;  1IBK I;  2HKJ A;  2JY9 A;  4DR1 E;  4AQY I;  4B3M I;  4X8W A;  3F0N A;  4LFC I;  2RTX A;  1PKP A;  1N32 I;  2DEI A;  4MYU A;  2B3T B;  1XNQ E;  1XMO E;  1Z5C A;  5GME A;  3ADI A;  4XTJ A;  2X7I A;  2B7V A;  3B78 A;  2RSM A;  4URL A;  1YYW A;  1XMO I;  3J7A M;  4HY1 A;  1GQE A;  3OTO I;  1KKH A;  4LFB E;  2L33 A;  4DR4 E;  5FLX C;  1FWL A;  4LF9 E;  3J80 Q;  1UHZ A;  4K0K E;  4M2Z A;  3C4B A;  2NA2 A;  4LFB I;  4DR4 I;  2CZ9 A;  4LF5 I;  4R1F A;  2E1R A;  3LPS A;  2HFU A;  4FW9 A;  1STU A;  1EKZ A;  4USK A;  4DXL A;  2EZ6 A;  3T1Y E;  1ELO A;  1YZ9 A;  4JV5 E;  1IBL E;  2L3C A;  2V2V A;  4JI1 E;  1ZXN A;  4LF6 I;  2LUQ A;  1ZBT A;  3V5R A;  1HNZ E;  1O0W A;  1YYK A;  1DAR A;  1FWK A;  1VIS A;  5L3J A;  1HNW E;  1IBL I;  1RR9 A;  4Z7Y A;  4MYT A;  4B3R I;  4JI1 I;  4I3H A;  1I94 I;  4EMD A;  1HR0 E;  4X64 I;  1T4O A;  2ZM6 E;  1A6F A;  4DPT A;  1ZXM A;  3T1H E;  1K47 A;  5FLX Q;  4DUY E;  3ZM7 A;  1HR0 I;  3Q1Q A;  3J7A G;  3C4T A;  2LUP B;  2ZM6 I;  1BKN A;  1XHK A;  1Z0T A;  5IWA I;  4M30 A;  1WHN A;  3T1H I;  4HAC B;  3WU4 A;  5LMN E;  4YY3 I;  3ZZU A;  1WHQ A;  2UUC E;  4JYA E;  1QU6 A;  1MX0 A;  2VQE E;  1X49 A;  2E5L E;  4DV1 E;  2UUC I;  4JYA I;  2IHR 1;  2CPN A;  4DV6 E;  4WUC A;  4NXN E;  2UXB I;  3GON A;  4JI8 E;  2VQE I;  1N33 E;  1FJG I;  3B8H A;  4PU9 A;  4DV1 I;  1QZR A;  1MG7 A;  4DR7 E;  5GMD A;  2UXD E;  2JVA A;  4DV6 I;  4NXN I;  3K17 A;  3LTO A;  2L2K B;  3WU6 A;  4JI6 E;  4DR1 I;  4LFA E;  4PRV A;  1H73 A;  4NXM E;  4JI5 E;  1N0U A;  2R3V A;  1H7U A;  3ZKB A;  2UXD I;  1FKA E;  2WW4 A;  1J5E E;  4JI6 I;  1FI4 A;  2OI2 A;  4FN5 A;  4LFA I;  1XNQ I;  2HHH E;  1RC7 A;  4HXZ A;  4NXM I;  4UT4 A;  2UU9 E;  4P7A A;  1X48 A;  1XMQ E;  1FNM A;  1N36 E;  1IBM E;  1EA6 A;  3WU5 A;  4DV2 E;  1J5E I;  1NZ0 A;  3J81 C;  1U2R A;  1UIL A;  2HHH I;  3PYG A;  2DIX A;  4LF4 E;  5LMU E;  1XNR E;  1XMQ I;  4DU8 A;  1N36 I;  1IBM I;  1UEK A;  4DV2 I;  4LF9 I;  4DV7 E;  1NHJ A;  3M6A A;  2LJH A;  1N34 E;  4DV3 E;  1NHI A;  4K0K I;  5LMU I;  1H74 A;  1XNR I;  4B3T E;  2L3J A;  2ZIT A;  4KQV A;  3HTX A;  2BM0 A;  3LLH A;  4FWD A;  4DV7 I;  3JAM C;  3J7Y p;  5CFF E;  4DR3 E;  4DV3 I;  2A2C A;  1KVK A;  3ZZT A;  4YHH E;  3PYD A;  1S16 A;  3V2U C;  3T1Y I;  2VF3 A;  4JV5 I;  2GS8 A;  4JI4 E;  1WUU A;  1Z0W A;  4FWH A;  2EFG A;  2LTR A;  2LTS A;  4WUD A;  1ZM3 A;  4YHH I;  4HYM A;  2J7K A;  1MU5 A;  4DR6 E;  2UUB E;  1DI2 A;  2BM1 A;  2XEX A;  3B82 A;  4RPF A;  1HNZ I;  1EI1 A;  2NUF A;  1HNW I;  4UTG A;  1KIJ A;  1X47 A;  4GKK E;  1T4N A;  4B3S E;  4JI7 E;  3CWV A;  3J81 Q;  4DR6 I;  2UUB I;  4DUZ E;  3HUL A;  2NPF A;  3VYY A;  3K1J A;  2L2M A;  4JI0 E;  4DR2 E;  1OJ4 A;  3ADG A;  4DUY I;  2HK2 A;  1B63 A;  4X62 E;  4OX9 E;  1H72 C;  1KTV A;  5LL6 R;  4GKK I;  2V34 A;  4JI7 I;  2HKE A;  1YYO A;  4JI2 E;  4DUZ I;  4DPY A;  4X66 E;  3QT7 A;  2NUE A;  5LMN I;  4DV5 E;  1S4E A;  3QT6 A;  4X62 I;  4OX9 I;  2YT4 A;  3ZZ0 A;  4ED4 A;  4JI3 E;  2V2Z A;  4JI2 I;  4KHP E;  4X66 I;  5BR8 E;  2E5L I;  4DV5 I;  4LF7 E;  1IBK E;  4JI3 I;  3VYX A;  2V2Q A;  4JI8 I;  4B3M E;  5BR8 I;  1D6T A;  1Z5A A;  4DKK A;  4LFC E;  1Z0B A;  1N33 I;  1Z0G A;  5IT9 C;  4PRX A;  4DR7 I;  3ADJ A;  2DB2 A;  2DMY A;  4WYQ B;  2N3H A;  2Q2E B;  4JI5 I;  2LJP A;  4USM A;  3PYE A;  3QT5 A;  2LRS A;  4WUB A;  3LNU A;  3OTO E;  1Z0E A;  2MDR A;  4DV4 E;  2HFS A;  2R42 A;  1ZM9 A;  1Z0C A;  5A2Q C;  2UU9 I;  2DEJ A;  1PVG A;  4DV4 I;  2RS7 A;  3WU3 A;  4LF4 I;  4LF5 E;  2L2N A;  4ZVI A;  1ZM4 A;  2B7T A;  4HAC A;  4DPX A;  1N34 I;  2F4V E;  4B3T I;  2VQF E;  4P52 A;  4M1K A;  1Z59 A;  4X65 E;  2RS6 A;  4GKJ E;  1N0V C;  4DV0 E;  5IT9 Q;  4DR3 I;  4LF6 E;  1HNX E;  2F4V I;  4DPU A;  2X36 A;  1Z5B A;  2VQF I;  3D4J A;  4WFT A;  4FWG A;  4Z7C A;  4X65 I;  4GKJ I;  4DV0 I;  4JI4 I;  4B3R E;  1I94 E;  1RQ0 A;  1NHH A;  1HNX I;  4X64 E;  1J26 A;  1RRE A;  3H4L A;  2A2D A;  1T4L B;  3ZKD A;  4LF8 E;  1B62 A;  4JG4 A;  4DU7 A;  3QT8 A;  2UXC E;  5A2Q Q;  2N3G A;  2ZBK B;  5IWA E;  4B3S I;  4LF8 I;  4OOG C;  4YY3 E;  4JI0 I;  4DR2 I;  2UUA E;  2UXC I;  3P1X A; 
#chains in the Genus database with same CATH topology
 5JEA F;  2GHF A;  1PIE A;  3JAM Q;  5F3W A;  4DR5 E;  1PJQ A;  2YU8 A;  3J80 C;  2LBS B;  2JEB A;  3BBG A;  4DPW A;  4IFD E;  2EOE A;  2NUG A;  4OO1 A;  2IOP A;  1GTK A;  3PYF A;  2UUA I;  2V8P A;  2DSY A;  5K36 C;  2EMY A;  4BC9 A;  3ADL A;  2KHX A;  1H7S A;  2UXB E;  4KZS A;  2I9I A;  4ZYH A;  1MGT A;  1BBG A;  1ZM2 A;  4DR5 I;  4AQY E;  1Y60 A;  2C37 A;  3HPZ A;  1A1K A;  1FJG E;  1UDS A;  2AJ4 A;  3KRN A;  1PJS A;  2DLK A;  2HK3 A;  1NEI A;  2BBG A;  2BV3 A;  4L8N A;  4KHP I;  2EML A;  1Z0V A;  2EN4 A;  2V88 A;  4P7D A;  4LF7 I;  3EPL A;  1N32 E;  1JK2 A;  1IBK I;  2HKJ A;  3AUZ A;  4NHR A;  2JY9 A;  3H09 A;  4DR1 E;  1YFH A;  1G2F C;  4AQY I;  4IZK A;  4B3M I;  5T6J A;  2F8B A;  4ZYD A;  3HJC A;  3H1C A;  4X8W A;  3F0N A;  4LFC I;  1EH6 A;  1ZAA C;  2EM4 A;  5C0X B;  2M7Q A;  2MC5 A;  2RTX A;  1PKP A;  2MDG A;  1R6L A;  1N32 I;  4TUI A;  4IFD B;  2EOF A;  2EMA A;  2V86 A;  2DEI A;  2EOO A;  2B3T B;  2LVH A;  4R2A A;  1XMO E;  1XNQ E;  1E3P A;  1Z5C A;  5A6B D;  4MYU A;  5GME A;  1YUI A;  5AC5 A;  2RPC A;  2WNR A;  2F1D A;  2JE6 B;  2EPX A;  3HPS A;  2C39 B;  2YU5 A;  2ADR A;  3CDI A;  5LLQ A;  3ADI A;  4XTJ A;  2X7I A;  3JU0 A;  2B7V A;  3B78 A;  2RSM A;  4URL A;  1UBD C;  2L6M A;  1TF3 A;  1YYW A;  1XMO I;  4IFD C;  3J7A M;  4HY1 A;  2EOZ A;  4AM3 A;  3KZZ A;  5EL9 A;  1GQE A;  3MSW A;  3THO B;  3OTO I;  3C6M A;  4U3B A;  1KKH A;  5C0X D;  5K36 B;  4LFB E;  3P3C A;  2L33 A;  4DR4 E;  2Q8U A;  5FLX C;  4R2D A;  4M0V A;  1FWL A;  2M1S A;  2YTG A;  2PO1 A;  4LF9 E;  3J80 Q;  4KWY A;  4BCA A;  3RMP A;  1UHZ A;  2JEA A;  2EMX A;  1YUJ A;  3P06 A;  5KL6 A;  4K0K E;  2YWQ A;  4M2Z A;  3C4B A;  2NA2 A;  1RHY A;  4LFB I;  2EPO A;  3VHT B;  4DR4 I;  2YRM A;  2ELY A;  2JOB A;  4LTY A;  5TSE A;  2PO2 B;  3C6K A;  2CZ9 A;  4LF5 I;  1Y6Z A;  3ECR A;  2E1R A;  4R1F A;  2DLQ A;  3LPS A;  1UDN A;  2HFU A;  1EH8 A;  2EP3 A;  4FW9 A;  2PNZ A;  4MU1 A;  5K36 D;  1STU A;  1EKZ A;  4N3O A;  4USK A;  3L00 A;  2BA1 D;  4DXL A;  2JP9 A;  1Y4U A;  2NN6 E;  3U1K A;  1XXE A;  2EZ6 A;  3DJW A;  5A6J A;  2IER A;  5JEA E;  1X6H A;  2JR1 A;  4F9B B;  3T1Y E;  1ELO A;  3NZK A;  1YZ9 A;  2BA1 G;  5DNY A;  1R6M A;  4JV5 E;  1WRJ A;  4MQY A;  1QNT A;  1IBL E;  3M7N D;  2L3C A;  2V2V A;  2EWL A;  4JI1 E;  1ZXN A;  2LT7 A;  2FGG A;  2EOY A;  4LF6 I;  2B9D A;  5DRR A;  2CG9 A;  2HC5 A;  3CDJ A;  3HQ1 A;  1ZBT A;  2LUQ A;  2IOQ A;  5DNX A;  2V85 A;  2EOS A;  1HNZ E;  2R76 A;  3V5R A;  4BA2 B;  3AV0 A;  3OML A;  1AH5 A;  1O0W A;  1YYK A;  1DAR A;  1E3H A;  1FWK A;  1VIS A;  5L3J A;  1HNW E;  1IBL I;  1HK7 A;  1ZBQ A;  1RR9 A;  3B4T A;  4Z7Y A;  4MYT A;  4B3R I;  4JI1 I;  1DQ3 A;  4F9A B;  1DGC A;  4I3H A;  4EMD A;  1I94 I;  4R8O A;  2YSO A;  4I8O A;  2EOI A;  1HR0 E;  3P3G A;  4X64 I;  1T4O A;  4Q35 B;  2ZM6 E;  4Q28 A;  2EOQ A;  4O4K A;  1A6F A;  4DPT A;  2EMI A;  1ZR9 A;  1ZXM A;  4IFD D;  4LCF A;  3T1H E;  2O1V A;  4F9C B;  1K47 A;  3KWR A;  1A1I A;  5KL4 A;  5FLX Q;  4DUY E;  4LF9 I;  3EQ1 A;  2O1U A;  2EPZ A;  3ZM7 A;  5C0X A;  3K85 A;  3F6H A;  4GEQ B;  2WBT A;  3C4T A;  5AC4 A;  2LUP B;  3J7A G;  3M85 D;  1BKN A;  2ZM6 I;  1XHK A;  1Z0T A;  2EN2 A;  4M30 A;  5IWA I;  1WHN A;  2EMB A;  4P78 A;  2EPU A;  1YPN A;  1X6F A;  3PS1 A;  3PS3 A;  4HAC B;  3T1H I;  3WU4 A;  2MKN A;  4O5G A;  5LMN E;  2NN6 C;  4YY3 I;  2G7H A;  2EN7 A;  1WHQ A;  2UUC E;  4JYA E;  2C39 A;  3ZZU A;  5JEA C;  3QG5 C;  2EPA A;  4OO1 F;  3HKM A;  1RMD A;  1QU6 A;  2EMZ A;  2Z5E A;  3F6G A;  5IXM B;  5KL2 A;  1MX0 A;  2J65 A;  2VQE E;  2I13 A;  1X49 A;  1USU A;  1PDA A;  2E5L E;  5K36 A;  1UDO A;  4DV1 E;  2UUC I;  4JYA I;  2M9A A;  2IHR 1;  2YTJ A;  1NCS A;  4IZJ A;  1N3G A;  2EMF A;  2CPN A;  4DV6 E;  4WUC A;  2EOR A;  4NXN E;  2UXB I;  3M99 B;  3GON A;  1MEY C;  4JI8 E;  1IQS A;  2CT1 A;  4DMI A;  2VQE I;  2FTX B;  2JOX A;  1N33 E;  2AE8 A;  4BHC A;  1FJG I;  3B8H A;  4PU9 A;  2EMG A;  4DV1 I;  2LE2 A;  1QZR A;  1MG7 A;  4DR7 E;  5GMD A;  2UXD E;  2JVA A;  4DV6 I;  2PNM A;  4QNJ A;  2PO2 A;  4NXN I;  3K17 A;  4O24 A;  1ZU1 A;  3LTO A;  3IWD A;  2L2K B;  3L7Z B;  5EKW A;  2LO3 A;  4JI6 E;  3WU6 A;  4DR1 I;  4LFA E;  4PRV A;  1H73 A;  2J7J A;  4NXM E;  4JI5 E;  1N0U A;  4BS9 A;  4IJD A;  2R3V A;  1JK1 A;  1H7U A;  1A1G A;  2Z5B B;  3ZKB A;  2UXD I;  3GLL A;  1FKA E;  2WW4 A;  1A1F A;  4BMJ A;  2EN3 A;  1J5E E;  2GLI A;  4JI6 I;  3EPH A;  1FI4 A;  2OI2 A;  4FN5 A;  4LFA I;  2JT2 A;  2NN6 B;  1XNQ I;  2HHH E;  1RC7 A;  4HXZ A;  4NXM I;  5JEA B;  4NBQ A;  4UT4 A;  1UN6 B;  2UU9 E;  4P7A A;  1X48 A;  1XMQ E;  4F54 A;  2YTN A;  1N36 E;  1FNM A;  4F2J C;  5A6A A;  1IBM E;  1EA6 A;  3WU5 A;  2BA0 D;  4DV2 E;  4IFD A;  2BR2 B;  1J5E I;  2ODR C;  1X3C A;  1NZ0 A;  3J81 C;  1U2R A;  1UIL A;  4BC7 A;  4BA2 A;  2HHH I;  2V87 A;  2YRK A;  2RSI A;  3PYG A;  2DIX A;  3MHH C;  4LF4 E;  5LMU E;  1XNR E;  4AID A;  1XMQ I;  1P42 A;  4DU8 A;  1N36 I;  2EMH A;  1IQO A;  1UEK A;  3GME A;  1IBM I;  2EQ0 A;  1UDQ A;  2JYA A;  4ZYE A;  2RQL A;  4DV2 I;  4DV7 E;  3DD6 A;  5ADZ A;  5KL3 A;  1NHJ A;  2NN6 D;  3EPK A;  3M6A A;  5JEA D;  1KYQ A;  2LJH A;  2EMC A;  1N34 E;  2K7I A;  4DV3 E;  1NHI A;  4ISA A;  4K0K I;  5LMU I;  1H74 A;  2EM9 A;  1XNR I;  4B3T E;  5AAS A;  2EL5 A;  2L3J A;  2ZIT A;  2EMW A;  2YRH A;  4F6N A;  4KQV A;  4IZK B;  3HTX A;  2BM0 A;  3LLH A;  4FWD A;  4AIM A;  4DV7 I;  3JAM C;  1YH8 A;  3J7Y p;  1Y5Y A;  5CFF E;  4DR3 E;  4F6M A;  4DV3 I;  2LV2 A;  2A2C A;  4OO1 E;  2LJU A;  3THN A;  1KVK A;  2GO4 A;  3ZZT A;  4R2Q A;  4WSP A;  4YHH E;  1BBO A;  3PYD A;  4WX9 A;  3BID A;  1S16 A;  2PO0 B;  2EOM A;  4R2R A;  3V2U C;  3T1Y I;  2VF3 A;  4FW3 A;  3M7N G;  2EM6 A;  2YZT A;  2EOX A;  4JV5 I;  2GS8 A;  2V89 A;  4JI4 E;  1WUU A;  2O1W A;  1Z0W A;  2A25 A;  4WXC A;  2EPL X;  4FWH A;  2EFG A;  4FW7 A;  2LTR A;  2LTS A;  1USV A;  1ZM3 A;  4WUD A;  2M4I A;  5A6B A;  4LCH A;  4YHH I;  4HYM A;  2KOU A;  3DF6 A;  2J7K A;  1MU5 A;  2MC6 A;  4DR6 E;  2UUB E;  1DI2 A;  2BM1 A;  2XEX A;  3B82 A;  4RPF A;  1HNZ I;  2MKD A;  1Y4S A;  1EI1 A;  2EL6 A;  2NUF A;  1HNW I;  4M9V C;  4ZYG A;  4UTG A;  1KIJ A;  4GZN C;  4OZE A;  1X47 A;  2CSH A;  4GKK E;  1T4N A;  4B3S E;  4LCG A;  2EOH A;  4JI7 E;  3CWV A;  3J81 Q;  3IWB A;  2UUB I;  2VE7 C;  2EJ4 A;  4DR6 I;  4DUZ E;  3HUL A;  2WZO A;  3L7Z A;  4J3D A;  1A1L A;  5DRO A;  3VYY A;  1WXR A;  3K1J A;  2NPF A;  3Q1Q A;  3TQM A;  2L2M A;  4JI0 E;  4DR2 E;  2K4V A;  1OJ4 A;  2VES A;  3ADG A;  3M85 G;  5AE2 A;  4DUY I;  2HK2 A;  2ODR D;  1B63 A;  2JE6 A;  5DNL A;  4X62 E;  4OX9 E;  1H72 C;  5LL6 R;  1KTV A;  2IES A;  2Z5B A;  2V34 A;  4JI7 I;  4GKK I;  2HKE A;  2HGH A;  1Z1B A;  1YSA C;  1YYO A;  1LLM C;  4HEI A;  4JI2 E;  4DUZ I;  4DPY A;  5A69 A;  2EPP A;  4X66 E;  2NN6 A;  3QT7 A;  2WP8 B;  1X6E A;  2R1F A;  2NUE A;  4MDT A;  5LMN I;  2D9H A;  4BA1 B;  4DV5 E;  5JEA A;  4OO1 C;  1TF6 A;  3K6Q A;  3UK3 C;  1S4E A;  3QT6 A;  4X62 I;  4OX9 I;  4RHB B;  5AE1 A;  2EM5 A;  1SR9 A;  4QNK A;  2YT4 A;  2DGC A;  3ZZ0 A;  2O3Z A;  4JI3 E;  2Z5C B;  4ED4 A;  2V2Z A;  4JI2 I;  5K36 F;  2GQ0 A;  2BR2 A;  4KHP E;  4X66 I;  5BR8 E;  2O1T A;  2YTP A;  2VRD A;  2EMK A;  2PNL A;  4FW6 A;  2E5L I;  4MLV A;  2EN1 A;  4DV5 I;  4LF7 E;  1IMU A;  3FIG A;  5KL7 A;  2EN6 A;  1IBK E;  3U1Y A;  4R2C A;  1PJT A;  2YTI A;  5AE3 A;  4JI3 I;  3VYX A;  3Q6M A;  2V2Q A;  4JI8 I;  4GQU A;  4B3M E;  5BR8 I;  1D6T A;  1Z5A A;  4DKK A;  4LFC E;  1Z0B A;  1N33 I;  2EN8 A;  1Z0G A;  2ENC A;  5IT9 C;  1T38 A;  2C38 B;  3P3E A;  4PRX A;  4DR7 I;  2EQ3 A;  3ADJ A;  2DB2 A;  4TUG A;  2DMY A;  4WYQ B;  4WXD A;  2N3H A;  2Q2E B;  1OYR A;  2CVE A;  3MHS C;  4R2E A;  4JI5 I;  2LJP A;  3HXL A;  4USM A;  1X5W A;  3IWC A;  2N8X A;  2PO0 A;  3PYE A;  3QT5 A;  2LRS A;  2ELZ A;  4WUB A;  2JEB B;  2EPN A;  2HJJ A;  2FV4 B;  3LNU A;  2YTE A;  4BBY A;  2WBS A;  1VI7 A;  3OTO E;  1Z0E A;  2KON A;  2MDR A;  4OO1 B;  4DV4 E;  1BB8 A;  2HFS A;  4IFD F;  4IS1 C;  2R42 A;  3UHM A;  4LOM A;  2JPA A;  4X9J A;  1ZM9 A;  5A6K A;  1A1H A;  1Z0C A;  2BA0 G;  5A2Q C;  1B69 A;  2UU9 I;  2DEJ A;  2ENA A;  4OKG A;  4MU4 A;  2EM8 A;  2PRT A;  4MU3 A;  1KJK A;  1PVG A;  2BB8 A;  1P47 A;  4R03 A;  2C37 B;  2LMZ A;  3ZOQ B;  4DV4 I;  2H36 X;  3Q6N A;  1GZ6 A;  5KL5 A;  4WPY A;  2RS7 A;  1L4S A;  3WU3 A;  4IZJ B;  2L92 A;  4LF4 I;  4LF5 E;  1G2D C;  2YPN A;  2L2N A;  5C0X E;  2CGE A;  4ZVI A;  4OO1 D;  2DRP A;  2EPM X;  1ZM4 A;  4R2S A;  2B7T A;  4HAC A;  4DPX A;  3BGH A;  1N34 I;  3JTZ A;  2F4V E;  2EM7 A;  4B3T I;  2VQF E;  2GO3 A;  4P52 A;  1AAY A;  2YSP A;  2EE8 A;  1TN9 A;  3KZY A;  4M1K A;  2NAB A;  4X65 E;  1Z59 A;  2ENH A;  2WBU A;  2RS6 A;  5DRP A;  4GKJ E;  2DMI A;  3EPJ A;  4LPF A;  1N0V C;  4DV0 E;  1A1J A;  5FWK A;  1HR0 I;  2WNR B;  5DRQ A;  1OYS A;  2LCE A;  4N4R B;  4IZJ D;  1OYP A;  5IT9 Q;  2V83 A;  4DR3 I;  1SFE A;  2WP8 A;  4LF6 E;  1HNX E;  2F4V I;  5ELW A;  4DPU A;  2X36 A;  4BA1 A;  4O43 A;  2EM2 A;  1Z5B A;  1EH7 A;  4MU0 A;  3D4J A;  2VQF I;  4WFT A;  1T39 A;  4FWG A;  4Z7C A;  5K36 E;  4FK5 C;  2GPI A;  2YTF A;  4X65 I;  4R2P A;  4GKJ I;  3LML A;  4DV0 I;  2Z5C A;  2JWO A;  2EPR A;  2JXP A;  4RH8 A;  4JI4 I;  4B3R E;  2E1M A;  5IV8 B;  1I94 E;  1RQ0 A;  2EM3 A;  1NHH A;  5C0X F;  1HNX I;  4FW4 A;  2EL4 A;  2YTO A;  4L5N C;  2YTQ A;  4X64 E;  1J26 A;  1RRE A;  2VF1 A;  3H4L A;  2PO1 B;  2WCC 3;  2YTD A;  4LU9 A;  3BF2 A;  4BHB A;  1T4L B;  2A2D A;  2EPC A;  2EQ1 A;  4NZV A;  3ZKD A;  2JEA B;  2EPK X;  4LF8 E;  3VK6 A;  1B62 A;  3PS2 A;  4JG4 A;  4DU7 A;  3QT8 A;  2CTD A;  1YHC A;  2E72 A;  2UXC E;  5A2Q Q;  1F2I G;  2N3G A;  2C38 A;  5C0X C;  4IS9 A;  2ZBK B;  2EM0 A;  4MLQ A;  5IWA E;  3GCM A;  4B3S I;  2EOJ A;  2L8T A;  2PNZ B;  4LF8 I;  3P76 A;  3PRY A;  4WSG A;  4OOG C;  1WJP A;  2V8Q B;  4YY3 E;  4JI0 I;  4HTG A;  4DR2 I;  2UUA E;  2UXC I;  4J8Z A;  2NN6 F;  3P1X A;  4U3D A;  4FW5 A; 
#chains in the Genus database with same CATH homology
 1PIE A;  3JAM Q;  5F3W A;  4DR5 E;  3J80 C;  2LBS B;  4DPW A;  2NUG A;  2IOP A;  3PYF A;  2UUA I;  2V8P A;  2DSY A;  4BC9 A;  3ADL A;  2KHX A;  1H7S A;  2UXB E;  4KZS A;  1ZM2 A;  4DR5 I;  4AQY E;  3HPZ A;  1FJG E;  2AJ4 A;  4KHP I;  2HK3 A;  2BV3 A;  4L8N A;  1Z0V A;  2V88 A;  4P7D A;  4LF7 I;  1N32 E;  1IBK I;  2HKJ A;  3AUZ A;  2JY9 A;  3H09 A;  4DR1 E;  4AQY I;  4IZK A;  4B3M I;  5T6J A;  2F8B A;  3HJC A;  4X8W A;  3F0N A;  4LFC I;  2M7Q A;  2MC5 A;  2RTX A;  1PKP A;  1N32 I;  4TUI A;  2V86 A;  2DEI A;  4MYU A;  2B3T B;  1XNQ E;  1XMO E;  1Z5C A;  5GME A;  3HPS A;  3ADI A;  4XTJ A;  2X7I A;  3JU0 A;  2B7V A;  3B78 A;  2RSM A;  4URL A;  2L6M A;  1YYW A;  1XMO I;  3J7A M;  4HY1 A;  1GQE A;  3MSW A;  3OTO I;  1KKH A;  4LFB E;  2L33 A;  4DR4 E;  5FLX C;  4M0V A;  1FWL A;  2M1S A;  4LF9 E;  3J80 Q;  4BCA A;  3RMP A;  1UHZ A;  3P06 A;  4K0K E;  4M2Z A;  3C4B A;  2NA2 A;  4LFB I;  4DR4 I;  2JOB A;  4LTY A;  2CZ9 A;  4LF5 I;  1Y6Z A;  4R1F A;  2E1R A;  3LPS A;  2HFU A;  4FW9 A;  1STU A;  1EKZ A;  4N3O A;  4USK A;  4DXL A;  1Y4U A;  2EZ6 A;  3DJW A;  2JR1 A;  4F9B B;  3T1Y E;  1ELO A;  1YZ9 A;  5DNY A;  4JV5 E;  1IBL E;  2L3C A;  2V2V A;  2EWL A;  4JI1 E;  1ZXN A;  2FGG A;  4LF6 I;  2B9D A;  2CG9 A;  3HQ1 A;  1ZBT A;  2LUQ A;  2IOQ A;  2V85 A;  3V5R A;  1HNZ E;  3AV0 A;  3OML A;  1O0W A;  1YYK A;  1DAR A;  1FWK A;  1VIS A;  5L3J A;  1HNW E;  1IBL I;  1HK7 A;  1ZBQ A;  1RR9 A;  4Z7Y A;  4MYT A;  4B3R I;  4JI1 I;  1DQ3 A;  4F9A B;  4I3H A;  1I94 I;  4EMD A;  4R8O A;  4I8O A;  1HR0 E;  4X64 I;  1T4O A;  2ZM6 E;  4Q28 A;  1A6F A;  4DPT A;  1ZXM A;  3T1H E;  2O1V A;  4F9C B;  1K47 A;  3KWR A;  5FLX Q;  4DUY E;  2O1U A;  3ZM7 A;  1HR0 I;  3K85 A;  3F6H A;  4GEQ B;  3J7A G;  3C4T A;  2LUP B;  2ZM6 I;  3Q1Q A;  1BKN A;  1XHK A;  1Z0T A;  5IWA I;  4M30 A;  1WHN A;  4P78 A;  3T1H I;  4HAC B;  3WU4 A;  5LMN E;  4YY3 I;  2G7H A;  3ZZU A;  1WHQ A;  2UUC E;  4JYA E;  1QU6 A;  2Z5E A;  3F6G A;  1MX0 A;  2VQE E;  1X49 A;  1USU A;  2E5L E;  4DV1 E;  2UUC I;  4JYA I;  2IHR 1;  4IZJ A;  2CPN A;  4DV6 E;  4WUC A;  4NXN E;  2UXB I;  3GON A;  4JI8 E;  4DMI A;  2VQE I;  2FTX B;  2JOX A;  1N33 E;  1FJG I;  3B8H A;  4PU9 A;  4DV1 I;  2LE2 A;  1QZR A;  1MG7 A;  4DR7 E;  5GMD A;  2UXD E;  2JVA A;  4DV6 I;  2PNM A;  4NXN I;  3K17 A;  3LTO A;  3IWD A;  2L2K B;  3WU6 A;  4JI6 E;  4DR1 I;  4LFA E;  4PRV A;  1H73 A;  4NXM E;  4JI5 E;  1N0U A;  4BS9 A;  2R3V A;  1H7U A;  2Z5B B;  3ZKB A;  2UXD I;  1FKA E;  2WW4 A;  4BMJ A;  1J5E E;  4JI6 I;  1FI4 A;  2OI2 A;  4FN5 A;  4LFA I;  1XNQ I;  2HHH E;  1RC7 A;  4HXZ A;  4NXM I;  4UT4 A;  2UU9 E;  4P7A A;  1X48 A;  1XMQ E;  4F54 A;  1FNM A;  1N36 E;  1IBM E;  1EA6 A;  3WU5 A;  4DV2 E;  1J5E I;  2ODR C;  1NZ0 A;  3J81 C;  1U2R A;  1UIL A;  4BC7 A;  2HHH I;  2V87 A;  3PYG A;  2DIX A;  4LF4 E;  5LMU E;  1XNR E;  1XMQ I;  4DU8 A;  1N36 I;  1IBM I;  1UEK A;  4DV2 I;  4LF9 I;  4DV7 E;  5ADZ A;  1NHJ A;  3M6A A;  2LJH A;  1N34 E;  4DV3 E;  1NHI A;  4K0K I;  5LMU I;  1H74 A;  1XNR I;  4B3T E;  5AAS A;  2L3J A;  2ZIT A;  4KQV A;  4IZK B;  3HTX A;  2BM0 A;  3LLH A;  4FWD A;  4DV7 I;  3JAM C;  3J7Y p;  5CFF E;  4DR3 E;  4DV3 I;  2A2C A;  1KVK A;  3ZZT A;  4WSP A;  4YHH E;  3PYD A;  1S16 A;  3V2U C;  3T1Y I;  2VF3 A;  2YZT A;  4JV5 I;  2GS8 A;  2V89 A;  4JI4 E;  1WUU A;  2O1W A;  1Z0W A;  4FWH A;  2EFG A;  2LTR A;  2LTS A;  1USV A;  1ZM3 A;  4WUD A;  2M4I A;  4YHH I;  4HYM A;  2KOU A;  3DF6 A;  2J7K A;  1MU5 A;  2MC6 A;  4DR6 E;  2UUB E;  1DI2 A;  2BM1 A;  2XEX A;  3B82 A;  4RPF A;  1HNZ I;  1Y4S A;  1EI1 A;  2NUF A;  1HNW I;  4UTG A;  1KIJ A;  1X47 A;  4GKK E;  1T4N A;  4B3S E;  4JI7 E;  3CWV A;  3J81 Q;  3IWB A;  2UUB I;  2VE7 C;  4DR6 I;  4DUZ E;  3HUL A;  2WZO A;  2NPF A;  3VYY A;  1WXR A;  3K1J A;  2L2M A;  4JI0 E;  4DR2 E;  2K4V A;  1OJ4 A;  3ADG A;  5AE2 A;  4DUY I;  2HK2 A;  2ODR D;  1B63 A;  4X62 E;  4OX9 E;  1H72 C;  5LL6 R;  1KTV A;  2Z5B A;  4GKK I;  2V34 A;  4JI7 I;  2HKE A;  1YYO A;  4JI2 E;  4DUZ I;  4DPY A;  4X66 E;  3QT7 A;  2NUE A;  5LMN I;  4DV5 E;  3K6Q A;  1S4E A;  3QT6 A;  4X62 I;  4OX9 I;  5AE1 A;  1SR9 A;  2YT4 A;  3ZZ0 A;  4ED4 A;  4JI3 E;  2Z5C B;  2V2Z A;  4JI2 I;  2GQ0 A;  4KHP E;  4X66 I;  5BR8 E;  2O1T A;  2PNL A;  2E5L I;  4DV5 I;  4LF7 E;  3FIG A;  1IBK E;  5AE3 A;  4JI3 I;  3VYX A;  3Q6M A;  2V2Q A;  4JI8 I;  4B3M E;  5BR8 I;  1D6T A;  1Z5A A;  4DKK A;  4LFC E;  1Z0B A;  1N33 I;  1Z0G A;  5IT9 C;  4PRX A;  4DR7 I;  3ADJ A;  4TUG A;  2DB2 A;  2DMY A;  4WYQ B;  2N3H A;  2Q2E B;  4JI5 I;  2LJP A;  3HXL A;  4USM A;  3IWC A;  3PYE A;  3QT5 A;  2LRS A;  4WUB A;  2FV4 B;  3LNU A;  4BBY A;  3OTO E;  1Z0E A;  2KON A;  2MDR A;  4DV4 E;  2HFS A;  2R42 A;  1ZM9 A;  1Z0C A;  5A2Q C;  2UU9 I;  2DEJ A;  1PVG A;  4R03 A;  2LMZ A;  3ZOQ B;  4DV4 I;  2H36 X;  3Q6N A;  1GZ6 A;  4WPY A;  2RS7 A;  3WU3 A;  4IZJ B;  2L92 A;  4LF4 I;  4LF5 E;  2L2N A;  2CGE A;  4ZVI A;  1ZM4 A;  2B7T A;  4HAC A;  4DPX A;  1N34 I;  3JTZ A;  2F4V E;  4B3T I;  2VQF E;  4P52 A;  4M1K A;  1Z59 A;  4X65 E;  2RS6 A;  5FWK A;  4GKJ E;  1N0V C;  4DV0 E;  4IZJ D;  5IT9 Q;  2V83 A;  4DR3 I;  4LF6 E;  1HNX E;  2F4V I;  4DPU A;  2X36 A;  1Z5B A;  2VQF I;  3D4J A;  4WFT A;  4FWG A;  4Z7C A;  4X65 I;  4GKJ I;  3LML A;  4DV0 I;  2Z5C A;  2JWO A;  4JI4 I;  4B3R E;  2E1M A;  1I94 E;  1RQ0 A;  1NHH A;  1HNX I;  4L5N C;  4X64 E;  1J26 A;  1RRE A;  2VF1 A;  3H4L A;  4LU9 A;  2A2D A;  1T4L B;  3ZKD A;  4LF8 E;  3VK6 A;  1B62 A;  4JG4 A;  4DU7 A;  3QT8 A;  2UXC E;  5A2Q Q;  2N3G A;  2ZBK B;  5IWA E;  4B3S I;  2L8T A;  4LF8 I;  3PRY A;  4OOG C;  2V8Q B;  4YY3 E;  4JI0 I;  4DR2 I;  2UUA E;  2UXC I;  4J8Z A;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...