1PKPA

The structure of ribosomal protein s5 reveals sites of interaction with 16s rrna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
INPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S5
publication title The structure of ribosomal protein S5 reveals sites of interaction with 16S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 1993-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1pkpA01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pkpA02
2MDRA 3QT8A 4LFCI 3ZZ0A 4B3TI 2NA2A 1NZ0A 4DV5E 2JVAA 1ELOA 4JV5I 2YT4A 4DV7I 1H74A 1D6TA 4JI3E 1N0VC 4DV0E 1ZM3A 2HKEA 3LPSA 2RTXA 2UXCE 4DR4I 2LRSA 4FN5A 4DR5E 2ZM6E 1XHKA 2A2DA 1K47A 4ZVIA 2UXDE 1IBME 2UUAE 5A2QC 2DB2A 3T1HI 4KHPE 4DV5I 1N33E 1YYKA 1H7UA 4DV6E 4DV1I 2BM1A 1BKNA 4XTJA 2WW4A 4GKKE 2RS7A 4DPUA 3ZZTA 1X47A 1EKZA 2UXCI 4X8WA 4DR5I 1RQ0A 1Z5CA 1FWKA 2L3CA 1PVGA 2UXDI 4JI0E 1UILA 2LUPB 3ZM7A 3PYDA 3CWVA 1MG7A 1T4OA 4HACA 4JI4E 4P7AA 1VISA 4LFAE 4DV6I 1MX0A 4LFBI 1Z0EA 5FLXQ 2VQEE 4USKA 4FWDA 1EI1A 3J7Yp 4DUZE 3B8HA 1PKPA 1FJGI 2UUBE 1HNZI 4K0KE 2V2QA 2LTSA 4JI2E 4JI0I 4DUYI 4X64E 4PRXA 1KTVA 4WYQB 4JI5E 4JI4I 2IHR1 3C4TA 3HTXA 2VQEI 4DKKA 4KQVA 3LTOA 2OI2A 4DUZI 5LL6R 2HFUA 1ZM2A 1Z0WA 2UUBI 1RC7A 4UT4A 5LMNE 4JI2I 4X64I 3T1YE 2HK2A 1DARA 3V5RA 4EMDA 4JI5I 4JV5E 1X49A 4NXME 3ADGA 4HYMA 2XEXA 2CZ9A 4JG4A 3J80Q 2L2MA 4OOGC 2E1RA 1DI2A 4DR4E 2HKJA 1IBKE 1Z0TA 3JAMC 1QU6A 2DIXA 1U2RA 2N3HA 1XNRE 5LMNI 2ZBKB 3T1HE 3T1YI 4USMA 1Z0GA 3J81Q 4OX9E 4DV1E 3ADIA 4NXMI 1S16A 4X66E 4B3ME 4JI1I 3OTOE 1IBKI 5GMEA 2AJ4A 4X62E 1B62A 4LF6I 3PYGA 1XMOE 4NXNI 1XNRI 4B3SE 1XMQE 3VYXA 4DXLA 4GKJI 4Z7YA 5BR8I 4LFBE 4OX9I 5L3JA 4B3RI 1QZRA 2N3GA 2UXBI 4X66I 4B3MI 3OTOI 1Z5BA 1KKHA 1NHJA 1YYWA 5GMDA 1FJGE 2L2KB 4X62I 4AQYE 1HNZE 2DMYA 1XMOI 4DUYE 5IT9Q 4DPTA 4B3SI 1YZ9A 1XMQI 1KIJA 2UUCI 2LJPA 4LF5E 3QT6A 4PRVA 1ZXNA 3Q1QA 1J5EE 2B3TB 1N0UA 1N34E 4DR1E 4JI7E 4DV2E 4DR2E 3B78A 4JYAE 3ZZUA 4AQYI 4YHHE 3VYYA 1FKAE 1HNXE 2V2ZA 4UTGA 4LF5I 1IBLE 4FWHA 2DEJA 4DV3E 1J5EI 4DR3E 2LJHA 2EZ6A 4WFTA 2L2NA 1S4EA 3PYEA 2BM0A 1Z0BA 2B7VA 1N34I 4X65I 4DR1I 5LMUE 1HNWE 3K17A 2VQFE 5A2QQ 4JI7I 4DV2I 3PYFA 4DR2I 4JYAI 1ZM4A 4YHHI 2LTRA 4HACB 4RPFA 4ED4A 1HNXI 4JI6E 1IBLI 4DV3I 1N32I 3ADJA 2RSMA 4DR3I 2V8PA 4DR7I 1B63A 4FWGA 2LBSB 5LMUI 4JI1E 1HNWI 1O0WA 4WUDA 4LF4I 2VQFI 1MU5A 4LF6E 4DPYA 4NXNE 1KVKA 1Z5AA 2BV3A 3WU6A 1FWLA 3ADLA 2Q2EB 4GKJE 3WU4A 4JI6I 5BR8E 3P1XA 2ZITA 4R1FA 2NUEA 4B3RE 5FLXC 4DR6E 4DU8A 2UXBE 3F0NA 1HR0E 1ZXMA 3LNUA 4DPWA 1N36E 4M1KA 1RREA 4JI8E 1Z0VA 3B82A 1J26A 2UUCE 3QT5A 1XNQE 1PIEA 2NUFA 1I94I 4YY3I 1GQEA 1STUA 2KHXA 3H4LA 4DR6I 2A2CA 3V2UC 1Z0CA 1FI4A 2L33A 1HR0I 2J7KA 2UU9E 3M6AA 1N36I 4M30A 2EFGA 4JI8I 4LF9E 4HXZA 1H72C 2R3VA 1XNQI 4JI3I 2R42A 4DV0I 1Z59A 1YYOA 4DU7A 3D4JA 4LF8E 3J80C 4DV4E 4M2ZA 4X65E 2ZM6I 3JAMQ 3ZKBA 2NPFA 1WUUA 4MYTA 4Z7CA 1IBMI 2UUAI 2UU9I 2CPNA 1WHNA 1T4LB 4KHPI 1UEKA 4FW9A 1N33I 4LF9I 2B7TA 1OJ4A 2HHHE 3QT7A 4WUCA 4HY1A 4LF7E 3J81C 4GKKI 1N32E 5IWAE 1ZM9A 4LF8I 4DR7E 4DV4I 2VF3A 2JY9A 2E5LE 1T4NA 3K1JA 4LF4E 3HULA 1UHZA 2NUGA 4WUBA 1X48A 1A6FA 4DPXA 4MYUA 2F4VE 4LFAI 2V34A 2HHHI 1ZBTA 3WU3A 1H73A 3ZKDA 4LF7I 2RS6A 5IWAI 2X36A 2V2VA 2E5LI 5CFFE 4LFCE 1FNMA 4URLA 3J7AG 4K0KI 2HFSA 4B3TE 4PU9A 2X7IA 3J7AM 4I3HA 2HK3A 1RR9A 3WU5A 5IT9C 4DV7E 2F4VI 3GONA 3C4BA 1NHHA 2DEIA 1I94E 4YY3E 1H7SA 1EA6A 4P52A 2L3JA 1WHQA 1NHIA 2LUQA 2GS8A 3LLHA
chains in the Genus database with same CATH superfamily
2EOSA 2MDRA 3QT8A 4LFCI 3ZZ0A 3M85D 2L6MA 4B3TI 2EN1A 2NA2A 1NZ0A 4DV5E 2JVAA 1ELOA 5JEAA 4IFDD 4HTGA 2MC5A 4JV5I 2NN6A 2YT4A 4DV7I 2EM9A 1H74A 4J3DA 1D6TA 2LVHA 5KL7A 4JI3E 1ZU1A 1N0VC 4DV0E 1ZM3A 3B4TA 2JYAA 2HKEA 2PRTA 2RTXA 2UXCE 1IMUA 3LPSA 4DR4I 4R8OA 2F8BA 2LRSA 2DSYA 2EL6A 4FN5A 4DR5E 2ZM6E 3EPKA 4NHRA 2MKNA 1XHKA 2A2DA 3HQ1A 2EORA 2LCEA 2EOXA 1YSAC 1K47A 2EPRA 2ELYA 2A25A 4IFDC 1RMDA 4DMIA 4ZVIA 2CSHA 1IBME 2EWLA 2UXDE 2UUAE 4OO1D 2EL4A 5A2QC 5LLQA 1TF6A 1PJQA 2HC5A 2DB2A 1YFHA 2Z5EA 1IQSA 3T1HI 2EM2A 2YSOA 4KHPE 4DV5I 1NEIA 2ADRA 1N33E 1YYKA 4Q35B 1H7UA 2YTPA 4TUGA 1ZR9A 4WSPA 2YSPA 4FK5C 4DV6E 3DD6A 4MU0A 5EL9A 4IZJD 2BM1A 4DV1I 2EMAA 1BKNA 4O24A 4XTJA 2JR1A 4GKKE 1AAYA 2WW4A 5ELWA 1OYRA 2RS7A 4DPUA 5A6KA 3ZZTA 1X47A 1EKZA 4OO1C 4I8OA 3F6GA 2JEAA 2UXCI 2O1VA 3HJCA 3JTZA 4F9BB 4X8WA 1N3GA 4DR5I 1RQ0A 1Z5CA 4IS9A 2BB8A 1FWKA 4LTYA 2L3CA 1PVGA 3PS3A 2UXDI 2EOOA 4JI0E 1UILA 2LUPB 3ZM7A 2EOMA 4IFDA 3PYDA 3CWVA 2EQ3A 3IWCA 5DNYA 4R2SA 1MG7A 2J65A 1T4OA 2RQLA 4HACA 2EPUA 4JI4E 4P7AA 1X5WA 4LFAE 1VISA 1X6EA 2WNRA 4DV6I 1MX0A 2V8QB 4LFBI 1Z0EA 5C0XB 3CDIA 3CDJA 2EM8A 2CG9A 2LE2A 5FLXQ 2VQEE 4OZEA 4KWYA 2EOIA 2JPAA 4FWDA 1QNTA 2EN8A 3AUZA 3JU0A 4USKA 1EI1A 2BA1D 2CGEA 3J7Yp 2YTGA 5TSEA 2EOYA 4DUZE 4L8NA 3B8HA 4U3DA 3VHTB 5A6JA 1PKPA 4OO1A 1FJGI 1F2IG 3BBGA 3EPHA 2GQ0A 2LO3A 2ELZA 1A1IA 2UUBE 1HNZI 4K0KE 2V2QA 2LTSA 4JI2E 2LJUA 4JI0I 4DUYI 4X64E 4BC7A 2GHFA 2BA0G 2YU5A 3HPZA 4PRXA 1KTVA 4FW6A 4WYQB 4JI5E 1KYQA 4IZJA 4JI4I 1JK1A 1YH8A 2WCC3 2IHR1 3C4TA 2EOHA 2IOPA 3HTXA 2EN2A 3IWBA 2VQEI 4BC9A 4DKKA 4KQVA 3P06A 1P47A 2WP8B 3LTOA 3FIGA 3P76A 2YTDA 1X3CA 2NABA 2OI2A 2E72A 1WRJA 2EMGA 4AIDA 4DUZI 2DMIA 3RMPA 2LT7A 4WSGA 5LL6R 2HFUA 3U1YA 5C0XE 1EH8A 1ZM2A 1BBGA 2R1FA 1Z0WA 4AIMA 2UUBI 2YZTA 1RC7A 5LMNE 4UT4A 2EMKA 4JI2I 2N8XA 4X64I 2WBUA 3T1YE 2HK2A 1DARA 4NZVA 1R6LA 3V5RA 1TF3A 2RPCA 2KONA 4EMDA 2YTEA 4JI5I 4JV5E 3C6KA 2PO1B 1X49A 4NXME 1SFEA 3ADGA 5KL4A 2EMYA 4HYMA 2Q8UA 2XEXA 2CZ9A 4JG4A 3J80Q 2LMZA 2L2MA 4LCGA 4OOGC 3VK6A 1MEYC 1SR9A 1ZAAC 3H09A 2V88A 2E1RA 3PRYA 3NZKA 1DI2A 1UDSA 1A1LA 1Y5YA 4DR4E 2YPNA 2HKJA 3U1KA 2ODRD 1IBKE 2VE7C 1LLMC 5K36B 1A1KA 3GMEA 4MQYA 3DJWA 1Z0TA 2PNZA 2O1TA 4BBYA 4OO1B 4O43A 3JAMC 2YTNA 5C0XF 1QU6A 2DIXA 4LCFA 1U2RA 2N3HA 1MGTA 1XNRE 5LMNI 1B69A 1UDNA 1T39A 2EM7A 2DLQA 5KL3A 3T1HE 2Z5CA 2ZBKB 2VRDA 3T1YI 3OMLA 3HKMA 4USMA 4KZSA 3C6MA 2JE6B 4IZJB 4N3OA 1Z0GA 4IS1C 3J81Q 2EMHA 1E3PA 2KOUA 4OX9E 4DV1E 3ADIA 2ENCA 4NXMI 1S16A 2BR2A 3HPSA 1Y6ZA 2EPPA 1GTKA 3KWRA 2GS8A 1HK7A 3PS1A 4X66E 4B3ME 1XXEA 5F3WA 2C39B 3DF6A 4JI1I 3OTOE 1IBKI 1USVA 5GMEA 2AJ4A 4X62E 1B62A 4BA1A 4LF6I 3M7ND 3PYGA 1XMOE 1PJTA 4NXNI 3H1CA 4TUIA 1X6FA 1XNRI 4ISAA 1OYSA 4B3SE 5K36E 2EMXA 4RHBB 5DNXA 1XMQE 4R2RA 2C38B 3VYXA 5EKWA 4DXLA 2EPCA 3MHSC 2BA1G 4GKJI 4IJDA 4HEIA 4Z7YA 2YTOA 2C37A 5A6AA 5BR8I 2YWQA 4LFBE 4OX9I 5L3JA 2WBTA 4B3RI 5IV8B 1QZRA 4NBQA 4L5NC 4N4RB 2N3GA 2UXBI 4X66I 4B3MI 3OTOI 1Z5BA 1KKHA 1NHJA 2EE8A 1YYWA 5GMDA 2GPIA 2L2KB 1FJGE 4X62I 4AQYE 5A6BD 1HNZE 2DMYA 2E1MA 3M99B 1XMOI 1KJKA 2PO2A 4DUYE 3UHMA 3ECRA 5AC5A 1UBDC 2O1WA 2JWOA 3THOB 1RHYA 1USUA 4DPTA 5IT9Q 2EM0A 4B3SI 5JEAB 2J7JA 2EOQA 2YTIA 4BHCA 4F6NA 1YZ9A 1XMQI 5K36F 1KIJA 2FGGA 2UUCI 1UDQA 2NN6B 2LJPA 4LF5E 3QT6A 4PRVA 4R2QA 1ZXNA 1J5EE 3Q1QA 5DROA 2K4VA 5DRRA 2B3TB 1DGCA 1N0UA 4LU9A 4FW3A 2YRMA 3KZYA 1N34E 4DR1E 2YTFA 2PO0A 4F9AB 2Z5BA 2IOQA 4U3BA 4BMJA 4JI7E 5KL6A 4DV2E 4DR2E 3KZZA 3B78A 4JYAE 2DRPA 1UN6B 3ZZUA 4AQYI 3MHHC 4ZYHA 4BA2A 4RH8A 4YHHE 2MC6A 4MLVA 1A1HA 3VYYA 1FKAE 1HNXE 2GO3A 2V2ZA 4FW5A 4UTGA 2C37B 4LF5I 1IBLE 4FWHA 2DEJA 4DV3E 1J5EI 5DRQA 3K85A 4DR3E 2LJHA 4FW7A 2EZ6A 4WFTA 3GLLA 2EPAA 2L2NA 2DGCA 1S4EA 5JEAE 3PYEA 2BM0A 1A1FA 2B7VA 1Z0BA 1N34I 4X65I 3M85G 4DR1I 1PDAA 5LMUE 2NN6E 1HNWE 2JEBA 2JEAB 4P78A 3K17A 2JOBA 2EPXA 5A6BA 2VQFE 5A2QQ 4JI7I 4DV2I 3PYFA 4DR2I 3TQMA 4JYAI 3AV0A 1ZM4A 3P3GA 2PO2B 1L4SA 1YUIA 1A1GA 4IFDB 2EOFA 2EPZA 3K6QA 4YHHI 2LTRA 4HACB 4RPFA 1BB8A 4ED4A 1HNXI 2EM4A 4JI6E 2MKDA 2WNRB 2CT1A 1IBLI 4DV3I 5C0XD 3HXLA 1N32I 2EOEA 3ADJA 2RSMA 4DR3I 2V8PA 2EMBA 3PS2A 4DR7I 1G2DC 1B63A 2G7HA 4MLQA 4WX9A 4FWGA 2EMFA 5JEAF 2LBSB 2EOJA 2M9AA 5LMUI 4JI1E 2V89A 4WXDA 1O0WA 2PNLA 4WXCA 2NN6F 3Q6MA 4MU3A 2EMZA 1R6MA 4WUDA 4LF4I 2VQFI 1MU5A 4LF6E 4ZYDA 4DPYA 4NXNE 2L92A 1KVKA 3L00A 4O4KA 2CTDA 1Z5AA 2BV3A 4LOMA 3BIDA 4R2PA 3WU6A 5C0XC 1Z1BA 2FTXB 1FWLA 4LCHA 3MSWA 3ADLA 2O1UA 2EM6A 3UK3C 2Q2EB 4X9JA 4GKJE 4MDTA 3WU4A 4JI6I 5BR8E 2ODRC 3P1XA 2ZITA 4R1FA 4F9CB 2JXPA 2NUEA 4B3RE 4IFDE 5KL2A 5FLXC 4DR6E 4DU8A 2UXBE 1P42A 2B9DA 1G2FC 2AE8A 3F0NA 4R2DA 2EN3A 5AE2A 1HR0E 1ZXMA 2EM3A 2F1DA 5T6JA 2V83A 3LNUA 4M9VC 1N36E 4DPWA 4IZKA 2EQ1A 4M1KA 3KRNA 2EPKX 5DRPA 2R76A 1RREA 4F2JC 4JI8E 1BBOA 1Z0VA 3B82A 3P3EA 4OO1E 1J26A 2UUCE 4R03A 1XNQE 3IWDA 1PIEA 3QT5A 2JP9A 5C0XA 4MU4A 2NUFA 2YRKA 1I94I 4YY3I 1GQEA 3QG5C 1STUA 2KHXA 2H36X 1JK2A 3H4LA 1WJPA 4IFDF 2YTQA 3BF2A 4DR6I 2JOXA 1YUJA 2A2CA 3V2UC 2GO4A 2EMCA 5K36D 1Z0CA 2L33A 1FI4A 2PNZB 4MU1A 1HR0I 2J7KA 2UU9E 3M6AA 2JT2A 2L8TA 1N36I 2VF1A 2YRHA 2EN7A 4P7DA 4M30A 2EFGA 2FV4B 2Z5CB 4JI8I 4LF9E 2EL5A 2MDGA 1TN9A 2WZOA 4O5GA 2V87A 2EMWA 1X6HA 2CVEA 1H72C 4HXZA 2RSIA 4OO1F 2R3VA 1XNQI 4JI3I 2R42A 3LMLA 4DV0I 2M7QA 4BCAA 1YYOA 1Z59A 1YPNA 3GCMA 4DU7A 3D4JA 5K36C 2BR2B 4LF8E 4R2EA 4R2AA 2WP8A 3J80C 4GQUA 4DV4E 4M2ZA 4X65E 2ZM6I 3JAMQ 3ZKBA 5KL5A 2NPFA 1WUUA 2EQ0A 2EPOA 4MYTA 4Z7CA 1IBMI 4BA1B 2UUAI 2V86A 4Q28A 4IZKB 2CPNA 2UU9I 2I9IA 1WHNA 2ENAA 1T4LB 2M1SA 2EM5A 4KHPI 1UEKA 4FW9A 5FWKA 1N33I 1AH5A 2GLIA 4FW4A 4LF9I 5AE1A 2B7TA 4OKGA 1OJ4A 3Q6NA 2PO1A 1IQOA 2HHHE 3EQ1A 3QT7A 4WUCA 1YHCA 5IXMB 4HY1A 4LF7E 3J81C 4GKKI 1WXRA 1N32E 2WBSA 5IWAE 1ZM9A 3EPLA 2PNMA 4LF8I 2EN6A 3BGHA 4DR7E 3L7ZA 5AC4A 4DV4I 2IERA 2VF3A 1HNWI 2JY9A 5AASA 5K36A 2E5LE 1T4NA 2EN4A 2EPNA 2HGHA 3K1JA 4LF4E 4GZNC 3HULA 2EP3A 1UDOA 1UHZA 1Y60A 3F6HA 4ZYGA 2NUGA 4WUBA 4F54A 2EPLX 1X48A 2JE6A 1A6FA 4DPXA 4MYUA 5JEAD 2F4VE 1Y4SA 4LFAI 2V85A 3ZOQB 2LV2A 2NN6D 2V34A 1ZBTA 3WU3A 1H73A 2IESA 2HHHI 1OYPA 2M4IA 3P3CA 3ZKDA 4LF7I 3EPJA 2K7IA 2RS6A 2EJ4A 1A1JA 3M7NG 5IWAI 4GEQB 2X36A 2V2VA 2C39A 4WPYA 2O3ZA 2PO0B 4F6MA 1DQ3A 2ENHA 2Z5BB 2E5LI 5CFFE 4LFCE 1FNMA 4URLA 3J7AG 5JEAC 2HFSA 4K0KI 1NCSA 2EPMX 4B3TE 1GZ6A 4ZYEA 2NN6C 4PU9A 2X7IA 4QNKA 3J7AM 4I3HA 2HK3A 4LPFA 5AE3A 1ZBQA 2DLKA 1E3HA 1PJSA 4M0VA 1RR9A 3WU5A 2C38A 4BA2B 1EH7A 1T38A 5DNLA 3THNA 4DV7E 5IT9C 5ADZA 1VI7A 2F4VI 2VESA 3C4BA 3GONA 1NHHA 2I13A 2HJJA 2BA0D 2DEIA 2YU8A 1I94E 2D9HA 2EMIA 4AM3A 4YY3E 1H7SA 1Y4UA 1EA6A 3L7ZB 4R2CA 2BBGA 2EOZA 4QNJA 2EMLA 4BHBA 4BS9A 2L3JA 4P52A 1WHQA 1NHIA 2JEBB 1EH6A 2LUQA 4J8ZA 5A69A 2YTJA 3LLHA
chains in the Genus database with same CATH topology
2MDRA 3QT8A 4LFCI 3ZZ0A 2L6MA 4B3TI 2NA2A 1NZ0A 4DV5E 2JVAA 1ELOA 2MC5A 4JV5I 2YT4A 4DV7I 1H74A 1D6TA 4JI3E 1N0VC 4DV0E 1ZM3A 2HKEA 2UXCE 2RTXA 3LPSA 4DR4I 4R8OA 2F8BA 2LRSA 2DSYA 4FN5A 4DR5E 2ZM6E 1XHKA 2A2DA 3HQ1A 1K47A 4DMIA 4ZVIA 2UXDE 1IBME 2EWLA 2UUAE 5A2QC 2DB2A 2Z5EA 3T1HI 4KHPE 4DV5I 1N33E 1YYKA 1H7UA 4TUGA 4WSPA 4DV6E 4IZJD 2BM1A 4DV1I 1BKNA 4XTJA 2JR1A 4GKKE 2WW4A 2RS7A 4DPUA 3ZZTA 1X47A 1EKZA 4I8OA 3F6GA 2UXCI 2O1VA 3HJCA 3JTZA 4F9BB 4X8WA 4DR5I 1RQ0A 1Z5CA 1FWKA 4LTYA 2L3CA 1PVGA 2UXDI 4JI0E 1UILA 2LUPB 3ZM7A 3PYDA 3CWVA 3IWCA 5DNYA 1MG7A 1T4OA 4HACA 4JI4E 4P7AA 1VISA 4LFAE 4DV6I 1MX0A 2V8QB 4LFBI 1Z0EA 5FLXQ 2CG9A 2LE2A 2VQEE 4USKA 4FWDA 3AUZA 3JU0A 1EI1A 2CGEA 3J7Yp 4DUZE 4L8NA 3B8HA 1PKPA 1FJGI 2GQ0A 2UUBE 1HNZI 4K0KE 2V2QA 2LTSA 4JI2E 4JI0I 4DUYI 4X64E 4BC7A 3HPZA 4PRXA 1KTVA 4WYQB 4JI5E 4IZJA 4JI4I 2IHR1 3C4TA 2IOPA 3HTXA 3IWBA 2VQEI 4BC9A 4DKKA 4KQVA 3P06A 3LTOA 3FIGA 2OI2A 4DUZI 3RMPA 5LL6R 2HFUA 1ZM2A 1Z0WA 2UUBI 2YZTA 1RC7A 5LMNE 4UT4A 4JI2I 4X64I 3T1YE 2HK2A 1DARA 3V5RA 2KONA 4EMDA 4JI5I 4JV5E 1X49A 4NXME 3ADGA 4HYMA 2XEXA 2CZ9A 4JG4A 3J80Q 2LMZA 2L2MA 4OOGC 3VK6A 1SR9A 3H09A 2V88A 2E1RA 3PRYA 1DI2A 4DR4E 2HKJA 2ODRD 1IBKE 2VE7C 3DJWA 1Z0TA 2O1TA 4BBYA 3JAMC 1QU6A 2DIXA 1U2RA 2N3HA 1XNRE 5LMNI 2ZBKB 3T1HE 2Z5CA 3T1YI 3OMLA 4USMA 4KZSA 4IZJB 4N3OA 1Z0GA 3J81Q 2KOUA 4OX9E 4DV1E 3ADIA 4NXMI 1S16A 3HPSA 1Y6ZA 3KWRA 2GS8A 1HK7A 4X66E 4B3ME 5F3WA 3DF6A 4JI1I 3OTOE 1IBKI 1USVA 5GMEA 2AJ4A 4X62E 1B62A 4LF6I 3PYGA 1XMOE 4NXNI 4TUIA 1XNRI 4B3SE 1XMQE 3VYXA 4DXLA 4GKJI 4Z7YA 5BR8I 4LFBE 4OX9I 5L3JA 4B3RI 1QZRA 4L5NC 2N3GA 2UXBI 4X66I 4B3MI 3OTOI 1Z5BA 1KKHA 1NHJA 1YYWA 5GMDA 1FJGE 2L2KB 4X62I 4AQYE 1HNZE 2DMYA 2E1MA 1XMOI 4DUYE 2O1WA 2JWOA 1USUA 5IT9Q 4DPTA 4B3SI 1YZ9A 1XMQI 1KIJA 2FGGA 2UUCI 2LJPA 4LF5E 3QT6A 4PRVA 1ZXNA 3Q1QA 1J5EE 2K4VA 2B3TB 1N0UA 4LU9A 1N34E 4DR1E 4F9AB 2Z5BA 2IOQA 4BMJA 4JI7E 4DV2E 4DR2E 3B78A 4JYAE 3ZZUA 4AQYI 4YHHE 2MC6A 3VYYA 1FKAE 1HNXE 2V2ZA 4UTGA 4LF5I 1IBLE 4FWHA 2DEJA 4DV3E 1J5EI 3K85A 4DR3E 2LJHA 2EZ6A 4WFTA 2L2NA 1S4EA 3PYEA 2BM0A 1Z0BA 2B7VA 1N34I 4X65I 4DR1I 5LMUE 1HNWE 4P78A 3K17A 2JOBA 2VQFE 5A2QQ 4JI7I 4DV2I 3PYFA 4DR2I 4JYAI 3AV0A 1ZM4A 3K6QA 4YHHI 2LTRA 4HACB 4RPFA 4ED4A 1HNXI 4JI6E 1IBLI 4DV3I 1N32I 3HXLA 3ADJA 2RSMA 4DR3I 2V8PA 4DR7I 1B63A 2G7HA 4FWGA 2LBSB 5LMUI 4JI1E 2V89A 3Q6MA 1O0WA 2PNLA 4WUDA 1HNWI 4LF4I 2VQFI 1MU5A 4LF6E 4DPYA 4NXNE 2L92A 1KVKA 1Z5AA 2BV3A 3WU6A 2FTXB 1FWLA 3MSWA 3ADLA 2O1UA 2Q2EB 4GKJE 3WU4A 4JI6I 5BR8E 2ODRC 3P1XA 2ZITA 4R1FA 4F9CB 2NUEA 4B3RE 5FLXC 4DR6E 4DU8A 2UXBE 2B9DA 3F0NA 5AE2A 1HR0E 1ZXMA 5T6JA 2V83A 3LNUA 4DPWA 1N36E 4IZKA 4M1KA 1RREA 4JI8E 1Z0VA 3B82A 1J26A 2UUCE 4R03A 1XNQE 3IWDA 1PIEA 3QT5A 2NUFA 1I94I 4YY3I 1GQEA 1STUA 2KHXA 2H36X 3H4LA 4DR6I 2JOXA 2A2CA 3V2UC 1Z0CA 1FI4A 2L33A 1HR0I 2J7KA 2UU9E 3M6AA 2L8TA 1N36I 2VF1A 4M30A 4P7DA 2EFGA 2FV4B 2Z5CB 4JI8I 4LF9E 2WZOA 2V87A 4HXZA 1H72C 2R3VA 1XNQI 4JI3I 2R42A 3LMLA 4DV0I 2M7QA 4BCAA 1YYOA 1Z59A 4DU7A 3D4JA 4LF8E 3J80C 4DV4E 4M2ZA 4X65E 2ZM6I 3JAMQ 3ZKBA 2NPFA 1WUUA 4MYTA 4Z7CA 1IBMI 2UUAI 2V86A 4Q28A 4IZKB 2CPNA 2UU9I 1WHNA 1T4LB 2M1SA 4KHPI 1UEKA 4FW9A 5FWKA 1N33I 4LF9I 5AE1A 2B7TA 1OJ4A 3Q6NA 2HHHE 3QT7A 4WUCA 4HY1A 4LF7E 3J81C 4GKKI 1WXRA 1N32E 5IWAE 1ZM9A 2PNMA 4LF8I 4DR7E 4DV4I 2VF3A 2JY9A 5AASA 2E5LE 1T4NA 3K1JA 4LF4E 3HULA 1UHZA 3F6HA 2NUGA 4WUBA 4F54A 1X48A 1A6FA 4DPXA 4MYUA 2F4VE 1Y4SA 4LFAI 2V85A 3ZOQB 2V34A 2HHHI 1ZBTA 3WU3A 1H73A 2M4IA 3ZKDA 4LF7I 2RS6A 5IWAI 4GEQB 2X36A 2V2VA 4WPYA 1DQ3A 2Z5BB 2E5LI 5CFFE 4LFCE 1FNMA 4URLA 3J7AG 4K0KI 2HFSA 4B3TE 1GZ6A 4PU9A 2X7IA 3J7AM 4I3HA 2HK3A 5AE3A 1ZBQA 1RR9A 4M0VA 3WU5A 5IT9C 4DV7E 5ADZA 2F4VI 3GONA 3C4BA 1NHHA 2DEIA 1I94E 4YY3E 1H7SA 1Y4UA 1EA6A 4BS9A 2L3JA 4P52A 1WHQA 1NHIA 2LUQA 4J8ZA 3LLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDR A;  3QT8 A;  4LFC I;  3ZZ0 A;  4B3T I;  2NA2 A;  1NZ0 A;  4DV5 E;  2JVA A;  1ELO A;  4JV5 I;  2YT4 A;  4DV7 I;  1H74 A;  1D6T A;  4JI3 E;  1N0V C;  4DV0 E;  1ZM3 A;  2HKE A;  3LPS A;  2RTX A;  2UXC E;  4DR4 I;  2LRS A;  4FN5 A;  4DR5 E;  2ZM6 E;  1XHK A;  2A2D A;  1K47 A;  4ZVI A;  2UXD E;  1IBM E;  2UUA E;  5A2Q C;  2DB2 A;  3T1H I;  4KHP E;  4DV5 I;  1N33 E;  1YYK A;  1H7U A;  4DV6 E;  4DV1 I;  2BM1 A;  1BKN A;  4XTJ A;  2WW4 A;  4GKK E;  2RS7 A;  4DPU A;  3ZZT A;  1X47 A;  1EKZ A;  2UXC I;  4X8W A;  4DR5 I;  1RQ0 A;  1Z5C A;  1FWK A;  2L3C A;  1PVG A;  2UXD I;  4JI0 E;  1UIL A;  2LUP B;  3ZM7 A;  3PYD A;  3CWV A;  1MG7 A;  1T4O A;  4HAC A;  4JI4 E;  4P7A A;  1VIS A;  4LFA E;  4DV6 I;  1MX0 A;  4LFB I;  1Z0E A;  5FLX Q;  2VQE E;  4USK A;  4FWD A;  1EI1 A;  3J7Y p;  4DUZ E;  3B8H A;  1PKP A;  1FJG I;  2UUB E;  1HNZ I;  4K0K E;  2V2Q A;  2LTS A;  4JI2 E;  4JI0 I;  4DUY I;  4X64 E;  4PRX A;  1KTV A;  4WYQ B;  4JI5 E;  4JI4 I;  2IHR 1;  3C4T A;  3HTX A;  2VQE I;  4DKK A;  4KQV A;  3LTO A;  2OI2 A;  4DUZ I;  5LL6 R;  2HFU A;  1ZM2 A;  1Z0W A;  2UUB I;  1RC7 A;  4UT4 A;  5LMN E;  4JI2 I;  4X64 I;  3T1Y E;  2HK2 A;  1DAR A;  3V5R A;  4EMD A;  4JI5 I;  4JV5 E;  1X49 A;  4NXM E;  3ADG A;  4HYM A;  2XEX A;  2CZ9 A;  4JG4 A;  3J80 Q;  2L2M A;  4OOG C;  2E1R A;  1DI2 A;  4DR4 E;  2HKJ A;  1IBK E;  1Z0T A;  3JAM C;  1QU6 A;  2DIX A;  1U2R A;  2N3H A;  1XNR E;  5LMN I;  2ZBK B;  3T1H E;  3T1Y I;  4USM A;  1Z0G A;  3J81 Q;  4OX9 E;  4DV1 E;  3ADI A;  4NXM I;  1S16 A;  4X66 E;  4B3M E;  4JI1 I;  3OTO E;  1IBK I;  5GME A;  2AJ4 A;  4X62 E;  1B62 A;  4LF6 I;  3PYG A;  1XMO E;  4NXN I;  1XNR I;  4B3S E;  1XMQ E;  3VYX A;  4DXL A;  4GKJ I;  4Z7Y A;  5BR8 I;  4LFB E;  4OX9 I;  5L3J A;  4B3R I;  1QZR A;  2N3G A;  2UXB I;  4X66 I;  4B3M I;  3OTO I;  1Z5B A;  1KKH A;  1NHJ A;  1YYW A;  5GMD A;  1FJG E;  2L2K B;  4X62 I;  4AQY E;  1HNZ E;  2DMY A;  1XMO I;  4DUY E;  5IT9 Q;  4DPT A;  4B3S I;  1YZ9 A;  1XMQ I;  1KIJ A;  2UUC I;  2LJP A;  4LF5 E;  3QT6 A;  4PRV A;  1ZXN A;  3Q1Q A;  1J5E E;  2B3T B;  1N0U A;  1N34 E;  4DR1 E;  4JI7 E;  4DV2 E;  4DR2 E;  3B78 A;  4JYA E;  3ZZU A;  4AQY I;  4YHH E;  3VYY A;  1FKA E;  1HNX E;  2V2Z A;  4UTG A;  4LF5 I;  1IBL E;  4FWH A;  2DEJ A;  4DV3 E;  1J5E I;  4DR3 E;  2LJH A;  2EZ6 A;  4WFT A;  2L2N A;  1S4E A;  3PYE A;  2BM0 A;  1Z0B A;  2B7V A;  1N34 I;  4X65 I;  4DR1 I;  5LMU E;  1HNW E;  3K17 A;  2VQF E;  5A2Q Q;  4JI7 I;  4DV2 I;  3PYF A;  4DR2 I;  4JYA I;  1ZM4 A;  4YHH I;  2LTR A;  4HAC B;  4RPF A;  4ED4 A;  1HNX I;  4JI6 E;  1IBL I;  4DV3 I;  1N32 I;  3ADJ A;  2RSM A;  4DR3 I;  2V8P A;  4DR7 I;  1B63 A;  4FWG A;  2LBS B;  5LMU I;  4JI1 E;  1HNW I;  1O0W A;  4WUD A;  4LF4 I;  2VQF I;  1MU5 A;  4LF6 E;  4DPY A;  4NXN E;  1KVK A;  1Z5A A;  2BV3 A;  3WU6 A;  1FWL A;  3ADL A;  2Q2E B;  4GKJ E;  3WU4 A;  4JI6 I;  5BR8 E;  3P1X A;  2ZIT A;  4R1F A;  2NUE A;  4B3R E;  5FLX C;  4DR6 E;  4DU8 A;  2UXB E;  3F0N A;  1HR0 E;  1ZXM A;  3LNU A;  4DPW A;  1N36 E;  4M1K A;  1RRE A;  4JI8 E;  1Z0V A;  3B82 A;  1J26 A;  2UUC E;  3QT5 A;  1XNQ E;  1PIE A;  2NUF A;  1I94 I;  4YY3 I;  1GQE A;  1STU A;  2KHX A;  3H4L A;  4DR6 I;  2A2C A;  3V2U C;  1Z0C A;  1FI4 A;  2L33 A;  1HR0 I;  2J7K A;  2UU9 E;  3M6A A;  1N36 I;  4M30 A;  2EFG A;  4JI8 I;  4LF9 E;  4HXZ A;  1H72 C;  2R3V A;  1XNQ I;  4JI3 I;  2R42 A;  4DV0 I;  1Z59 A;  1YYO A;  4DU7 A;  3D4J A;  4LF8 E;  3J80 C;  4DV4 E;  4M2Z A;  4X65 E;  2ZM6 I;  3JAM Q;  3ZKB A;  2NPF A;  1WUU A;  4MYT A;  4Z7C A;  1IBM I;  2UUA I;  2UU9 I;  2CPN A;  1WHN A;  1T4L B;  4KHP I;  1UEK A;  4FW9 A;  1N33 I;  4LF9 I;  2B7T A;  1OJ4 A;  2HHH E;  3QT7 A;  4WUC A;  4HY1 A;  4LF7 E;  3J81 C;  4GKK I;  1N32 E;  5IWA E;  1ZM9 A;  4LF8 I;  4DR7 E;  4DV4 I;  2VF3 A;  2JY9 A;  2E5L E;  1T4N A;  3K1J A;  4LF4 E;  3HUL A;  1UHZ A;  2NUG A;  4WUB A;  1X48 A;  1A6F A;  4DPX A;  4MYU A;  2F4V E;  4LFA I;  2V34 A;  2HHH I;  1ZBT A;  3WU3 A;  1H73 A;  3ZKD A;  4LF7 I;  2RS6 A;  5IWA I;  2X36 A;  2V2V A;  2E5L I;  5CFF E;  4LFC E;  1FNM A;  4URL A;  3J7A G;  4K0K I;  2HFS A;  4B3T E;  4PU9 A;  2X7I A;  3J7A M;  4I3H A;  2HK3 A;  1RR9 A;  3WU5 A;  5IT9 C;  4DV7 E;  2F4V I;  3GON A;  3C4B A;  1NHH A;  2DEI A;  1I94 E;  4YY3 E;  1H7S A;  1EA6 A;  4P52 A;  2L3J A;  1WHQ A;  1NHI A;  2LUQ A;  2GS8 A;  3LLH A; 
#chains in the Genus database with same CATH topology
 2EOS A;  2MDR A;  3QT8 A;  4LFC I;  3ZZ0 A;  3M85 D;  2L6M A;  4B3T I;  2EN1 A;  2NA2 A;  1NZ0 A;  4DV5 E;  2JVA A;  1ELO A;  5JEA A;  4IFD D;  4HTG A;  2MC5 A;  4JV5 I;  2NN6 A;  2YT4 A;  4DV7 I;  2EM9 A;  1H74 A;  4J3D A;  1D6T A;  2LVH A;  5KL7 A;  4JI3 E;  1ZU1 A;  1N0V C;  4DV0 E;  1ZM3 A;  3B4T A;  2JYA A;  2HKE A;  2PRT A;  2RTX A;  2UXC E;  1IMU A;  3LPS A;  4DR4 I;  4R8O A;  2F8B A;  2LRS A;  2DSY A;  2EL6 A;  4FN5 A;  4DR5 E;  2ZM6 E;  3EPK A;  4NHR A;  2MKN A;  1XHK A;  2A2D A;  3HQ1 A;  2EOR A;  2LCE A;  2EOX A;  1YSA C;  1K47 A;  2EPR A;  2ELY A;  2A25 A;  4IFD C;  1RMD A;  4DMI A;  4ZVI A;  2CSH A;  1IBM E;  2EWL A;  2UXD E;  2UUA E;  4OO1 D;  2EL4 A;  5A2Q C;  5LLQ A;  1TF6 A;  1PJQ A;  2HC5 A;  2DB2 A;  1YFH A;  2Z5E A;  1IQS A;  3T1H I;  2EM2 A;  2YSO A;  4KHP E;  4DV5 I;  1NEI A;  2ADR A;  1N33 E;  1YYK A;  4Q35 B;  1H7U A;  2YTP A;  4TUG A;  1ZR9 A;  4WSP A;  2YSP A;  4FK5 C;  4DV6 E;  3DD6 A;  4MU0 A;  5EL9 A;  4IZJ D;  2BM1 A;  4DV1 I;  2EMA A;  1BKN A;  4O24 A;  4XTJ A;  2JR1 A;  4GKK E;  1AAY A;  2WW4 A;  5ELW A;  1OYR A;  2RS7 A;  4DPU A;  5A6K A;  3ZZT A;  1X47 A;  1EKZ A;  4OO1 C;  4I8O A;  3F6G A;  2JEA A;  2UXC I;  2O1V A;  3HJC A;  3JTZ A;  4F9B B;  4X8W A;  1N3G A;  4DR5 I;  1RQ0 A;  1Z5C A;  4IS9 A;  2BB8 A;  1FWK A;  4LTY A;  2L3C A;  1PVG A;  3PS3 A;  2UXD I;  2EOO A;  4JI0 E;  1UIL A;  2LUP B;  3ZM7 A;  2EOM A;  4IFD A;  3PYD A;  3CWV A;  2EQ3 A;  3IWC A;  5DNY A;  4R2S A;  1MG7 A;  2J65 A;  1T4O A;  2RQL A;  4HAC A;  2EPU A;  4JI4 E;  4P7A A;  1X5W A;  4LFA E;  1VIS A;  1X6E A;  2WNR A;  4DV6 I;  1MX0 A;  2V8Q B;  4LFB I;  1Z0E A;  5C0X B;  3CDI A;  3CDJ A;  2EM8 A;  2CG9 A;  2LE2 A;  5FLX Q;  2VQE E;  4OZE A;  4KWY A;  2EOI A;  2JPA A;  4FWD A;  1QNT A;  2EN8 A;  3AUZ A;  3JU0 A;  4USK A;  1EI1 A;  2BA1 D;  2CGE A;  3J7Y p;  2YTG A;  5TSE A;  2EOY A;  4DUZ E;  4L8N A;  3B8H A;  4U3D A;  3VHT B;  5A6J A;  1PKP A;  4OO1 A;  1FJG I;  1F2I G;  3BBG A;  3EPH A;  2GQ0 A;  2LO3 A;  2ELZ A;  1A1I A;  2UUB E;  1HNZ I;  4K0K E;  2V2Q A;  2LTS A;  4JI2 E;  2LJU A;  4JI0 I;  4DUY I;  4X64 E;  4BC7 A;  2GHF A;  2BA0 G;  2YU5 A;  3HPZ A;  4PRX A;  1KTV A;  4FW6 A;  4WYQ B;  4JI5 E;  1KYQ A;  4IZJ A;  4JI4 I;  1JK1 A;  1YH8 A;  2WCC 3;  2IHR 1;  3C4T A;  2EOH A;  2IOP A;  3HTX A;  2EN2 A;  3IWB A;  2VQE I;  4BC9 A;  4DKK A;  4KQV A;  3P06 A;  1P47 A;  2WP8 B;  3LTO A;  3FIG A;  3P76 A;  2YTD A;  1X3C A;  2NAB A;  2OI2 A;  2E72 A;  1WRJ A;  2EMG A;  4AID A;  4DUZ I;  2DMI A;  3RMP A;  2LT7 A;  4WSG A;  5LL6 R;  2HFU A;  3U1Y A;  5C0X E;  1EH8 A;  1ZM2 A;  1BBG A;  2R1F A;  1Z0W A;  4AIM A;  2UUB I;  2YZT A;  1RC7 A;  5LMN E;  4UT4 A;  2EMK A;  4JI2 I;  2N8X A;  4X64 I;  2WBU A;  3T1Y E;  2HK2 A;  1DAR A;  4NZV A;  1R6L A;  3V5R A;  1TF3 A;  2RPC A;  2KON A;  4EMD A;  2YTE A;  4JI5 I;  4JV5 E;  3C6K A;  2PO1 B;  1X49 A;  4NXM E;  1SFE A;  3ADG A;  5KL4 A;  2EMY A;  4HYM A;  2Q8U A;  2XEX A;  2CZ9 A;  4JG4 A;  3J80 Q;  2LMZ A;  2L2M A;  4LCG A;  4OOG C;  3VK6 A;  1MEY C;  1SR9 A;  1ZAA C;  3H09 A;  2V88 A;  2E1R A;  3PRY A;  3NZK A;  1DI2 A;  1UDS A;  1A1L A;  1Y5Y A;  4DR4 E;  2YPN A;  2HKJ A;  3U1K A;  2ODR D;  1IBK E;  2VE7 C;  1LLM C;  5K36 B;  1A1K A;  3GME A;  4MQY A;  3DJW A;  1Z0T A;  2PNZ A;  2O1T A;  4BBY A;  4OO1 B;  4O43 A;  3JAM C;  2YTN A;  5C0X F;  1QU6 A;  2DIX A;  4LCF A;  1U2R A;  2N3H A;  1MGT A;  1XNR E;  5LMN I;  1B69 A;  1UDN A;  1T39 A;  2EM7 A;  2DLQ A;  5KL3 A;  3T1H E;  2Z5C A;  2ZBK B;  2VRD A;  3T1Y I;  3OML A;  3HKM A;  4USM A;  4KZS A;  3C6M A;  2JE6 B;  4IZJ B;  4N3O A;  1Z0G A;  4IS1 C;  3J81 Q;  2EMH A;  1E3P A;  2KOU A;  4OX9 E;  4DV1 E;  3ADI A;  2ENC A;  4NXM I;  1S16 A;  2BR2 A;  3HPS A;  1Y6Z A;  2EPP A;  1GTK A;  3KWR A;  2GS8 A;  1HK7 A;  3PS1 A;  4X66 E;  4B3M E;  1XXE A;  5F3W A;  2C39 B;  3DF6 A;  4JI1 I;  3OTO E;  1IBK I;  1USV A;  5GME A;  2AJ4 A;  4X62 E;  1B62 A;  4BA1 A;  4LF6 I;  3M7N D;  3PYG A;  1XMO E;  1PJT A;  4NXN I;  3H1C A;  4TUI A;  1X6F A;  1XNR I;  4ISA A;  1OYS A;  4B3S E;  5K36 E;  2EMX A;  4RHB B;  5DNX A;  1XMQ E;  4R2R A;  2C38 B;  3VYX A;  5EKW A;  4DXL A;  2EPC A;  3MHS C;  2BA1 G;  4GKJ I;  4IJD A;  4HEI A;  4Z7Y A;  2YTO A;  2C37 A;  5A6A A;  5BR8 I;  2YWQ A;  4LFB E;  4OX9 I;  5L3J A;  2WBT A;  4B3R I;  5IV8 B;  1QZR A;  4NBQ A;  4L5N C;  4N4R B;  2N3G A;  2UXB I;  4X66 I;  4B3M I;  3OTO I;  1Z5B A;  1KKH A;  1NHJ A;  2EE8 A;  1YYW A;  5GMD A;  2GPI A;  2L2K B;  1FJG E;  4X62 I;  4AQY E;  5A6B D;  1HNZ E;  2DMY A;  2E1M A;  3M99 B;  1XMO I;  1KJK A;  2PO2 A;  4DUY E;  3UHM A;  3ECR A;  5AC5 A;  1UBD C;  2O1W A;  2JWO A;  3THO B;  1RHY A;  1USU A;  4DPT A;  5IT9 Q;  2EM0 A;  4B3S I;  5JEA B;  2J7J A;  2EOQ A;  2YTI A;  4BHC A;  4F6N A;  1YZ9 A;  1XMQ I;  5K36 F;  1KIJ A;  2FGG A;  2UUC I;  1UDQ A;  2NN6 B;  2LJP A;  4LF5 E;  3QT6 A;  4PRV A;  4R2Q A;  1ZXN A;  1J5E E;  3Q1Q A;  5DRO A;  2K4V A;  5DRR A;  2B3T B;  1DGC A;  1N0U A;  4LU9 A;  4FW3 A;  2YRM A;  3KZY A;  1N34 E;  4DR1 E;  2YTF A;  2PO0 A;  4F9A B;  2Z5B A;  2IOQ A;  4U3B A;  4BMJ A;  4JI7 E;  5KL6 A;  4DV2 E;  4DR2 E;  3KZZ A;  3B78 A;  4JYA E;  2DRP A;  1UN6 B;  3ZZU A;  4AQY I;  3MHH C;  4ZYH A;  4BA2 A;  4RH8 A;  4YHH E;  2MC6 A;  4MLV A;  1A1H A;  3VYY A;  1FKA E;  1HNX E;  2GO3 A;  2V2Z A;  4FW5 A;  4UTG A;  2C37 B;  4LF5 I;  1IBL E;  4FWH A;  2DEJ A;  4DV3 E;  1J5E I;  5DRQ A;  3K85 A;  4DR3 E;  2LJH A;  4FW7 A;  2EZ6 A;  4WFT A;  3GLL A;  2EPA A;  2L2N A;  2DGC A;  1S4E A;  5JEA E;  3PYE A;  2BM0 A;  1A1F A;  2B7V A;  1Z0B A;  1N34 I;  4X65 I;  3M85 G;  4DR1 I;  1PDA A;  5LMU E;  2NN6 E;  1HNW E;  2JEB A;  2JEA B;  4P78 A;  3K17 A;  2JOB A;  2EPX A;  5A6B A;  2VQF E;  5A2Q Q;  4JI7 I;  4DV2 I;  3PYF A;  4DR2 I;  3TQM A;  4JYA I;  3AV0 A;  1ZM4 A;  3P3G A;  2PO2 B;  1L4S A;  1YUI A;  1A1G A;  4IFD B;  2EOF A;  2EPZ A;  3K6Q A;  4YHH I;  2LTR A;  4HAC B;  4RPF A;  1BB8 A;  4ED4 A;  1HNX I;  2EM4 A;  4JI6 E;  2MKD A;  2WNR B;  2CT1 A;  1IBL I;  4DV3 I;  5C0X D;  3HXL A;  1N32 I;  2EOE A;  3ADJ A;  2RSM A;  4DR3 I;  2V8P A;  2EMB A;  3PS2 A;  4DR7 I;  1G2D C;  1B63 A;  2G7H A;  4MLQ A;  4WX9 A;  4FWG A;  2EMF A;  5JEA F;  2LBS B;  2EOJ A;  2M9A A;  5LMU I;  4JI1 E;  2V89 A;  4WXD A;  1O0W A;  2PNL A;  4WXC A;  2NN6 F;  3Q6M A;  4MU3 A;  2EMZ A;  1R6M A;  4WUD A;  4LF4 I;  2VQF I;  1MU5 A;  4LF6 E;  4ZYD A;  4DPY A;  4NXN E;  2L92 A;  1KVK A;  3L00 A;  4O4K A;  2CTD A;  1Z5A A;  2BV3 A;  4LOM A;  3BID A;  4R2P A;  3WU6 A;  5C0X C;  1Z1B A;  2FTX B;  1FWL A;  4LCH A;  3MSW A;  3ADL A;  2O1U A;  2EM6 A;  3UK3 C;  2Q2E B;  4X9J A;  4GKJ E;  4MDT A;  3WU4 A;  4JI6 I;  5BR8 E;  2ODR C;  3P1X A;  2ZIT A;  4R1F A;  4F9C B;  2JXP A;  2NUE A;  4B3R E;  4IFD E;  5KL2 A;  5FLX C;  4DR6 E;  4DU8 A;  2UXB E;  1P42 A;  2B9D A;  1G2F C;  2AE8 A;  3F0N A;  4R2D A;  2EN3 A;  5AE2 A;  1HR0 E;  1ZXM A;  2EM3 A;  2F1D A;  5T6J A;  2V83 A;  3LNU A;  4M9V C;  1N36 E;  4DPW A;  4IZK A;  2EQ1 A;  4M1K A;  3KRN A;  2EPK X;  5DRP A;  2R76 A;  1RRE A;  4F2J C;  4JI8 E;  1BBO A;  1Z0V A;  3B82 A;  3P3E A;  4OO1 E;  1J26 A;  2UUC E;  4R03 A;  1XNQ E;  3IWD A;  1PIE A;  3QT5 A;  2JP9 A;  5C0X A;  4MU4 A;  2NUF A;  2YRK A;  1I94 I;  4YY3 I;  1GQE A;  3QG5 C;  1STU A;  2KHX A;  2H36 X;  1JK2 A;  3H4L A;  1WJP A;  4IFD F;  2YTQ A;  3BF2 A;  4DR6 I;  2JOX A;  1YUJ A;  2A2C A;  3V2U C;  2GO4 A;  2EMC A;  5K36 D;  1Z0C A;  2L33 A;  1FI4 A;  2PNZ B;  4MU1 A;  1HR0 I;  2J7K A;  2UU9 E;  3M6A A;  2JT2 A;  2L8T A;  1N36 I;  2VF1 A;  2YRH A;  2EN7 A;  4P7D A;  4M30 A;  2EFG A;  2FV4 B;  2Z5C B;  4JI8 I;  4LF9 E;  2EL5 A;  2MDG A;  1TN9 A;  2WZO A;  4O5G A;  2V87 A;  2EMW A;  1X6H A;  2CVE A;  1H72 C;  4HXZ A;  2RSI A;  4OO1 F;  2R3V A;  1XNQ I;  4JI3 I;  2R42 A;  3LML A;  4DV0 I;  2M7Q A;  4BCA A;  1YYO A;  1Z59 A;  1YPN A;  3GCM A;  4DU7 A;  3D4J A;  5K36 C;  2BR2 B;  4LF8 E;  4R2E A;  4R2A A;  2WP8 A;  3J80 C;  4GQU A;  4DV4 E;  4M2Z A;  4X65 E;  2ZM6 I;  3JAM Q;  3ZKB A;  5KL5 A;  2NPF A;  1WUU A;  2EQ0 A;  2EPO A;  4MYT A;  4Z7C A;  1IBM I;  4BA1 B;  2UUA I;  2V86 A;  4Q28 A;  4IZK B;  2CPN A;  2UU9 I;  2I9I A;  1WHN A;  2ENA A;  1T4L B;  2M1S A;  2EM5 A;  4KHP I;  1UEK A;  4FW9 A;  5FWK A;  1N33 I;  1AH5 A;  2GLI A;  4FW4 A;  4LF9 I;  5AE1 A;  2B7T A;  4OKG A;  1OJ4 A;  3Q6N A;  2PO1 A;  1IQO A;  2HHH E;  3EQ1 A;  3QT7 A;  4WUC A;  1YHC A;  5IXM B;  4HY1 A;  4LF7 E;  3J81 C;  4GKK I;  1WXR A;  1N32 E;  2WBS A;  5IWA E;  1ZM9 A;  3EPL A;  2PNM A;  4LF8 I;  2EN6 A;  3BGH A;  4DR7 E;  3L7Z A;  5AC4 A;  4DV4 I;  2IER A;  2VF3 A;  1HNW I;  2JY9 A;  5AAS A;  5K36 A;  2E5L E;  1T4N A;  2EN4 A;  2EPN A;  2HGH A;  3K1J A;  4LF4 E;  4GZN C;  3HUL A;  2EP3 A;  1UDO A;  1UHZ A;  1Y60 A;  3F6H A;  4ZYG A;  2NUG A;  4WUB A;  4F54 A;  2EPL X;  1X48 A;  2JE6 A;  1A6F A;  4DPX A;  4MYU A;  5JEA D;  2F4V E;  1Y4S A;  4LFA I;  2V85 A;  3ZOQ B;  2LV2 A;  2NN6 D;  2V34 A;  1ZBT A;  3WU3 A;  1H73 A;  2IES A;  2HHH I;  1OYP A;  2M4I A;  3P3C A;  3ZKD A;  4LF7 I;  3EPJ A;  2K7I A;  2RS6 A;  2EJ4 A;  1A1J A;  3M7N G;  5IWA I;  4GEQ B;  2X36 A;  2V2V A;  2C39 A;  4WPY A;  2O3Z A;  2PO0 B;  4F6M A;  1DQ3 A;  2ENH A;  2Z5B B;  2E5L I;  5CFF E;  4LFC E;  1FNM A;  4URL A;  3J7A G;  5JEA C;  2HFS A;  4K0K I;  1NCS A;  2EPM X;  4B3T E;  1GZ6 A;  4ZYE A;  2NN6 C;  4PU9 A;  2X7I A;  4QNK A;  3J7A M;  4I3H A;  2HK3 A;  4LPF A;  5AE3 A;  1ZBQ A;  2DLK A;  1E3H A;  1PJS A;  4M0V A;  1RR9 A;  3WU5 A;  2C38 A;  4BA2 B;  1EH7 A;  1T38 A;  5DNL A;  3THN A;  4DV7 E;  5IT9 C;  5ADZ A;  1VI7 A;  2F4V I;  2VES A;  3C4B A;  3GON A;  1NHH A;  2I13 A;  2HJJ A;  2BA0 D;  2DEI A;  2YU8 A;  1I94 E;  2D9H A;  2EMI A;  4AM3 A;  4YY3 E;  1H7S A;  1Y4U A;  1EA6 A;  3L7Z B;  4R2C A;  2BBG A;  2EOZ A;  4QNJ A;  2EML A;  4BHB A;  4BS9 A;  2L3J A;  4P52 A;  1WHQ A;  1NHI A;  2JEB B;  1EH6 A;  2LUQ A;  4J8Z A;  5A69 A;  2YTJ A;  3LLH A; 
#chains in the Genus database with same CATH homology
 2MDR A;  3QT8 A;  4LFC I;  3ZZ0 A;  2L6M A;  4B3T I;  2NA2 A;  1NZ0 A;  4DV5 E;  2JVA A;  1ELO A;  2MC5 A;  4JV5 I;  2YT4 A;  4DV7 I;  1H74 A;  1D6T A;  4JI3 E;  1N0V C;  4DV0 E;  1ZM3 A;  2HKE A;  2UXC E;  2RTX A;  3LPS A;  4DR4 I;  4R8O A;  2F8B A;  2LRS A;  2DSY A;  4FN5 A;  4DR5 E;  2ZM6 E;  1XHK A;  2A2D A;  3HQ1 A;  1K47 A;  4DMI A;  4ZVI A;  2UXD E;  1IBM E;  2EWL A;  2UUA E;  5A2Q C;  2DB2 A;  2Z5E A;  3T1H I;  4KHP E;  4DV5 I;  1N33 E;  1YYK A;  1H7U A;  4TUG A;  4WSP A;  4DV6 E;  4IZJ D;  2BM1 A;  4DV1 I;  1BKN A;  4XTJ A;  2JR1 A;  4GKK E;  2WW4 A;  2RS7 A;  4DPU A;  3ZZT A;  1X47 A;  1EKZ A;  4I8O A;  3F6G A;  2UXC I;  2O1V A;  3HJC A;  3JTZ A;  4F9B B;  4X8W A;  4DR5 I;  1RQ0 A;  1Z5C A;  1FWK A;  4LTY A;  2L3C A;  1PVG A;  2UXD I;  4JI0 E;  1UIL A;  2LUP B;  3ZM7 A;  3PYD A;  3CWV A;  3IWC A;  5DNY A;  1MG7 A;  1T4O A;  4HAC A;  4JI4 E;  4P7A A;  1VIS A;  4LFA E;  4DV6 I;  1MX0 A;  2V8Q B;  4LFB I;  1Z0E A;  5FLX Q;  2CG9 A;  2LE2 A;  2VQE E;  4USK A;  4FWD A;  3AUZ A;  3JU0 A;  1EI1 A;  2CGE A;  3J7Y p;  4DUZ E;  4L8N A;  3B8H A;  1PKP A;  1FJG I;  2GQ0 A;  2UUB E;  1HNZ I;  4K0K E;  2V2Q A;  2LTS A;  4JI2 E;  4JI0 I;  4DUY I;  4X64 E;  4BC7 A;  3HPZ A;  4PRX A;  1KTV A;  4WYQ B;  4JI5 E;  4IZJ A;  4JI4 I;  2IHR 1;  3C4T A;  2IOP A;  3HTX A;  3IWB A;  2VQE I;  4BC9 A;  4DKK A;  4KQV A;  3P06 A;  3LTO A;  3FIG A;  2OI2 A;  4DUZ I;  3RMP A;  5LL6 R;  2HFU A;  1ZM2 A;  1Z0W A;  2UUB I;  2YZT A;  1RC7 A;  5LMN E;  4UT4 A;  4JI2 I;  4X64 I;  3T1Y E;  2HK2 A;  1DAR A;  3V5R A;  2KON A;  4EMD A;  4JI5 I;  4JV5 E;  1X49 A;  4NXM E;  3ADG A;  4HYM A;  2XEX A;  2CZ9 A;  4JG4 A;  3J80 Q;  2LMZ A;  2L2M A;  4OOG C;  3VK6 A;  1SR9 A;  3H09 A;  2V88 A;  2E1R A;  3PRY A;  1DI2 A;  4DR4 E;  2HKJ A;  2ODR D;  1IBK E;  2VE7 C;  3DJW A;  1Z0T A;  2O1T A;  4BBY A;  3JAM C;  1QU6 A;  2DIX A;  1U2R A;  2N3H A;  1XNR E;  5LMN I;  2ZBK B;  3T1H E;  2Z5C A;  3T1Y I;  3OML A;  4USM A;  4KZS A;  4IZJ B;  4N3O A;  1Z0G A;  3J81 Q;  2KOU A;  4OX9 E;  4DV1 E;  3ADI A;  4NXM I;  1S16 A;  3HPS A;  1Y6Z A;  3KWR A;  2GS8 A;  1HK7 A;  4X66 E;  4B3M E;  5F3W A;  3DF6 A;  4JI1 I;  3OTO E;  1IBK I;  1USV A;  5GME A;  2AJ4 A;  4X62 E;  1B62 A;  4LF6 I;  3PYG A;  1XMO E;  4NXN I;  4TUI A;  1XNR I;  4B3S E;  1XMQ E;  3VYX A;  4DXL A;  4GKJ I;  4Z7Y A;  5BR8 I;  4LFB E;  4OX9 I;  5L3J A;  4B3R I;  1QZR A;  4L5N C;  2N3G A;  2UXB I;  4X66 I;  4B3M I;  3OTO I;  1Z5B A;  1KKH A;  1NHJ A;  1YYW A;  5GMD A;  1FJG E;  2L2K B;  4X62 I;  4AQY E;  1HNZ E;  2DMY A;  2E1M A;  1XMO I;  4DUY E;  2O1W A;  2JWO A;  1USU A;  5IT9 Q;  4DPT A;  4B3S I;  1YZ9 A;  1XMQ I;  1KIJ A;  2FGG A;  2UUC I;  2LJP A;  4LF5 E;  3QT6 A;  4PRV A;  1ZXN A;  3Q1Q A;  1J5E E;  2K4V A;  2B3T B;  1N0U A;  4LU9 A;  1N34 E;  4DR1 E;  4F9A B;  2Z5B A;  2IOQ A;  4BMJ A;  4JI7 E;  4DV2 E;  4DR2 E;  3B78 A;  4JYA E;  3ZZU A;  4AQY I;  4YHH E;  2MC6 A;  3VYY A;  1FKA E;  1HNX E;  2V2Z A;  4UTG A;  4LF5 I;  1IBL E;  4FWH A;  2DEJ A;  4DV3 E;  1J5E I;  3K85 A;  4DR3 E;  2LJH A;  2EZ6 A;  4WFT A;  2L2N A;  1S4E A;  3PYE A;  2BM0 A;  1Z0B A;  2B7V A;  1N34 I;  4X65 I;  4DR1 I;  5LMU E;  1HNW E;  4P78 A;  3K17 A;  2JOB A;  2VQF E;  5A2Q Q;  4JI7 I;  4DV2 I;  3PYF A;  4DR2 I;  4JYA I;  3AV0 A;  1ZM4 A;  3K6Q A;  4YHH I;  2LTR A;  4HAC B;  4RPF A;  4ED4 A;  1HNX I;  4JI6 E;  1IBL I;  4DV3 I;  1N32 I;  3HXL A;  3ADJ A;  2RSM A;  4DR3 I;  2V8P A;  4DR7 I;  1B63 A;  2G7H A;  4FWG A;  2LBS B;  5LMU I;  4JI1 E;  2V89 A;  3Q6M A;  1O0W A;  2PNL A;  4WUD A;  1HNW I;  4LF4 I;  2VQF I;  1MU5 A;  4LF6 E;  4DPY A;  4NXN E;  2L92 A;  1KVK A;  1Z5A A;  2BV3 A;  3WU6 A;  2FTX B;  1FWL A;  3MSW A;  3ADL A;  2O1U A;  2Q2E B;  4GKJ E;  3WU4 A;  4JI6 I;  5BR8 E;  2ODR C;  3P1X A;  2ZIT A;  4R1F A;  4F9C B;  2NUE A;  4B3R E;  5FLX C;  4DR6 E;  4DU8 A;  2UXB E;  2B9D A;  3F0N A;  5AE2 A;  1HR0 E;  1ZXM A;  5T6J A;  2V83 A;  3LNU A;  4DPW A;  1N36 E;  4IZK A;  4M1K A;  1RRE A;  4JI8 E;  1Z0V A;  3B82 A;  1J26 A;  2UUC E;  4R03 A;  1XNQ E;  3IWD A;  1PIE A;  3QT5 A;  2NUF A;  1I94 I;  4YY3 I;  1GQE A;  1STU A;  2KHX A;  2H36 X;  3H4L A;  4DR6 I;  2JOX A;  2A2C A;  3V2U C;  1Z0C A;  1FI4 A;  2L33 A;  1HR0 I;  2J7K A;  2UU9 E;  3M6A A;  2L8T A;  1N36 I;  2VF1 A;  4M30 A;  4P7D A;  2EFG A;  2FV4 B;  2Z5C B;  4JI8 I;  4LF9 E;  2WZO A;  2V87 A;  4HXZ A;  1H72 C;  2R3V A;  1XNQ I;  4JI3 I;  2R42 A;  3LML A;  4DV0 I;  2M7Q A;  4BCA A;  1YYO A;  1Z59 A;  4DU7 A;  3D4J A;  4LF8 E;  3J80 C;  4DV4 E;  4M2Z A;  4X65 E;  2ZM6 I;  3JAM Q;  3ZKB A;  2NPF A;  1WUU A;  4MYT A;  4Z7C A;  1IBM I;  2UUA I;  2V86 A;  4Q28 A;  4IZK B;  2CPN A;  2UU9 I;  1WHN A;  1T4L B;  2M1S A;  4KHP I;  1UEK A;  4FW9 A;  5FWK A;  1N33 I;  4LF9 I;  5AE1 A;  2B7T A;  1OJ4 A;  3Q6N A;  2HHH E;  3QT7 A;  4WUC A;  4HY1 A;  4LF7 E;  3J81 C;  4GKK I;  1WXR A;  1N32 E;  5IWA E;  1ZM9 A;  2PNM A;  4LF8 I;  4DR7 E;  4DV4 I;  2VF3 A;  2JY9 A;  5AAS A;  2E5L E;  1T4N A;  3K1J A;  4LF4 E;  3HUL A;  1UHZ A;  3F6H A;  2NUG A;  4WUB A;  4F54 A;  1X48 A;  1A6F A;  4DPX A;  4MYU A;  2F4V E;  1Y4S A;  4LFA I;  2V85 A;  3ZOQ B;  2V34 A;  2HHH I;  1ZBT A;  3WU3 A;  1H73 A;  2M4I A;  3ZKD A;  4LF7 I;  2RS6 A;  5IWA I;  4GEQ B;  2X36 A;  2V2V A;  4WPY A;  1DQ3 A;  2Z5B B;  2E5L I;  5CFF E;  4LFC E;  1FNM A;  4URL A;  3J7A G;  4K0K I;  2HFS A;  4B3T E;  1GZ6 A;  4PU9 A;  2X7I A;  3J7A M;  4I3H A;  2HK3 A;  5AE3 A;  1ZBQ A;  1RR9 A;  4M0V A;  3WU5 A;  5IT9 C;  4DV7 E;  5ADZ A;  2F4V I;  3GON A;  3C4B A;  1NHH A;  2DEI A;  1I94 E;  4YY3 E;  1H7S A;  1Y4U A;  1EA6 A;  4BS9 A;  2L3J A;  4P52 A;  1WHQ A;  1NHI A;  2LUQ A;  4J8Z A;  3LLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...