1PKPA

The structure of ribosomal protein s5 reveals sites of interaction with 16s rrna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
INPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S5
publication title The structure of ribosomal protein S5 reveals sites of interaction with 16S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 1993-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1pkpA01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1pkpA02
1YYKA 2HKEA 4DUZE 3J7AM 1I94E 2V2QA 3B78A 4NXNE 3PYEA 4JI7I 1XNQE 4DR7E 1DARA 3J80C 1N36E 2UXCI 4LFAE 2UUBE 1N33E 1B63A 4WUDA 2ZITA 4NXME 4GKKE 1Z59A 2LTRA 2UU9E 4DV0E 4UTGA 4Z7YA 1GQEA 2NUGA 4DPXA 4JI5E 2RS7A 1ZXNA 4X66I 4LFCI 4X62E 4DV2I 1H74A 3ADJA 1N0UA 2ZM6E 4B3ME 4LF7I 2X36A 1XMQI 4B3RE 4WYQB 4JI7E 1NZ0A 4PU9A 2UXCE 2IHR1 1MX0A 1N0VC 4P52A 4M30A 2L3JA 3VYXA 4JI8I 4FWDA 4XTJA 2V34A 4DR2I 2UXDI 5FLXQ 4DV1I 3HTXA 2UXBI 1N32I 1ZM9A 2V2VA 4EMDA 1XMOI 4X65I 5GMDA 4AQYI 4LFCE 1RR9A 4DV2E 1Z0BA 1Z0CA 2RS6A 1J5EI 4UT4A 4LF7E 3OTOI 4HY1A 2YT4A 1U2RA 4DV7I 2RSMA 1PVGA 3J81C 3P1XA 1HR0I 2HKJA 4ED4A 3C4BA 2LBSB 2VQEI 3VYYA 4MYUA 4YHHI 1MG7A 1HNWI 1Z5BA 3J7Yp 1FNMA 1IBLI 1Z5AA 4DR2E 4DV1E 2E5LI 2UXBE 1N32E 4URLA 2NA2A 1XMOE 4X65E 4JI4I 4AQYE 1ZM4A 1WUUA 3ZM7A 1T4NA 1KIJA 3PYFA 3ZZ0A 1T4LB 5CFFE 4DV6I 4DU8A 1KTVA 1J5EE 3LLHA 3T1YI 2HHHE 3OTOE 4M1KA 3ZZUA 1FI4A 4LF4I 2R42A 4JV5E 2EFGA 5LMUI 1IBMI 4DXLA 4DV7E 1WHNA 4DUYI 1Z0GA 1RREA 2B7TA 2HK2A 3B8HA 2VQEE 4YHHE 1RC7A 3QT8A 1FWKA 4DU7A 1HNWE 2WW4A 1IBLE 1Z0WA 2DEIA 1HNZI 2E5LE 3QT5A 4LF9I 2DEJA 4JI4E 4Z7CA 3J80Q 4LF5I 1X48A 1PIEA 1EI1A 2BV3A 4DV6E 1S4EA 2LTSA 5LMNE 2EZ6A 3T1YE 5A2QC 4JI1E 4LF4E 1ELOA 4USMA 4ZVIA 5LMUE 1IBME 1VISA 1XHKA 4DUYE 1KVKA 5BR8I 5A2QQ 2UUAI 4I3HA 4DPTA 4FN5A 2A2CA 1HNZE 1Z0EA 1OJ4A 4LF9E 5LL6R 4LF8I 4PRVA 4DR3I 1FJGI 1IBKI 4JYAI 2N3HA 3QT7A 4X66E 1QU6A 4HXZA 5IWAI 2XEXA 2HFUA 2L2NA 4WFTA 5IT9C 4B3SI 4DR4I 1YYWA 2BM0A 2LUQA 4DKKA 1O0WA 4P7AA 1ZBTA 1XMQE 4K0KI 4R1FA 3ZZTA 2J7KA 1A6FA 2R3VA 2V8PA 3JAMC 5BR8E 1YYOA 1BKNA 1B62A 2UUAE 2A2DA 4DR6I 4OOGC 3T1HI 3ADGA 1ZM2A 1FWLA 4JI8E 1X47A 2UXDE 3J81Q 4HYMA 4DR3E 1FJGE 1IBKE 4JYAE 3F0NA 1T4OA 1XNRI 4DR5I 5IWAE 1YZ9A 1H7SA 1KKHA 3M6AA 2AJ4A 1XNQI 2MDRA 1H72C 4DR7I 1N36I 4B3SE 4DR4E 1MU5A 2N3GA 3PYDA 4DV0I 3QT6A 1EKZA 1S16A 1HR0E 1NHJA 4KHPI 4DPYA 2ZBKB 1STUA 3V2UC 3LTOA 4DR6E 1UHZA 2LRSA 4WUCA 4JI6I 1WHQA 2HFSA 4B3TI 4WUBA 1FKAE 1XNRE 1EA6A 4B3RI 4DR5E 4JG4A 2DB2A 2V2ZA 2JVAA 3K1JA 2B3TB 4DV5I 4DPWA 2LUPB 5GMEA 1PKPA 2NUEA 2CPNA 4MYTA 4DPUA 2B7VA 3ADLA 4KHPE 2NPFA 1Z0VA 4JI3I 1DI2A 2F4VI 4X64I 1ZM3A 3WU3A 3PYGA 4YY3I 4PRXA 2L3CA 4OX9I 1NHHA 3ADIA 4LF6I 1H73A 4JI6E 4JI0I 3J7AG 2LJHA 2BM1A 4B3TE 4FWGA 2GS8A 4LF5E 2X7IA 5FLXC 1H7UA 2VF3A 3LPSA 4DV5E 4X8WA 2Q2EB 4DR1I 2E1RA 3B82A 2L2MA 3WU4A 4FW9A 2VQFI 1D6TA 4M2ZA 2KHXA 4GKJI 4HACA 3Q1QA 2NUFA 3C4TA 3ZKDA 5L3JA 3H4LA 4JI3E 4LFBI 1HNXI 2CZ9A 3HULA 2F4VE 1ZXMA 4X64E 5IT9Q 3V5RA 4DV4I 4YY3E 1QZRA 2RTXA 1X49A 4OX9E 4LF6E 1Z0TA 1N34I 4JI0E 1K47A 4JI2I 1NHIA 2HHHI 4DV3I 3JAMQ 4LF8E 2UUCI 4JV5I 2HK3A 1Z5CA 3CWVA 1J26A 3WU6A 4DR1E 3D4JA 4DUZI 1I94I 4NXNI 2DIXA 4FWHA 4KQVA 1UEKA 2VQFE 2UUBI 4LFAI 1N33I 4USKA 2L2KB 4GKJE 4NXMI 2JY9A 4GKKI 2LJPA 2UU9I 2OI2A 3ZKBA 4K0KE 4RPFA 1UILA 4LFBE 1HNXE 4JI5I 3GONA 4DV4E 3T1HE 1RQ0A 4X62I 1N34E 4JI2E 2L33A 3K17A 5LMNI 2ZM6I 4DV3E 4JI1I 4HACB 2UUCE 3WU5A 4B3MI 2DMYA 3LNUA
chains in the Genus database with same CATH superfamily
4L5NC 1YYKA 2CT1A 2EM4A 2EPLX 1P47A 4IFDD 2HKEA 4DUZE 4N4RB 4AIDA 3J7AM 1I94E 5A6BD 2V2QA 3B78A 4NXNE 3PYEA 2EWLA 4JI7I 2N8XA 1XNQE 3M7NG 4DR7E 3GMEA 1DARA 3J80C 1N36E 2RSIA 4LFAE 2UUBE 1N33E 4OZEA 2UXCI 2A25A 4OO1E 2V88A 1B63A 3P3GA 2ZITA 3BIDA 4NXME 4WUDA 4IFDA 2J7JA 5A6BA 4GKKE 1Z59A 2LTRA 5JEAD 1A1GA 2UU9E 2FV4B 4DV0E 2C38A 3K85A 4UTGA 1GQEA 4Z7YA 3IWDA 4OO1B 2NUGA 2EQ1A 3C6MA 2NN6F 4DPXA 2PO0A 4JI5E 1TF6A 4R2AA 2YTFA 2RS7A 3M85G 5TSEA 1ZXNA 4X66I 1USUA 5JEAA 2HC5A 4RH8A 1G2DC 3C6KA 4IFDF 2JWOA 3HQ1A 2Z5CA 3BGHA 4LFCI 2EN1A 4X62E 2V89A 2IESA 4DV2I 4BBYA 2CSHA 3ADJA 1H74A 2ZM6E 1N0UA 2Z5EA 4O24A 1USVA 4B3ME 2IOPA 3EPKA 4LF7I 2EMWA 2EN4A 2X36A 3VK6A 5JEAF 1XMQI 4B3RE 4O4KA 5DNLA 2LCEA 1NCSA 3P3CA 4WYQB 4MDTA 4IZJB 2YTJA 2D9HA 2WBTA 2ENCA 2YU5A 1Z1BA 2PRTA 2EPAA 4JI7E 2EMLA 2L92A 1NZ0A 4MU3A 4PU9A 2UXCE 2IHR1 1MX0A 2EMBA 1N0VC 1R6LA 3HPSA 4P52A 5C0XD 2YRMA 4M30A 2NABA 2C39A 4R2DA 2L3JA 2EP3A 5DROA 2GLIA 2BA0D 1WJPA 3VYXA 4QNKA 2NN6C 4LTYA 2WP8A 4FWDA 4JI8I 4XTJA 2V83A 2Q8UA 2V34A 4DR2I 2UXDI 2Z5BB 5FLXQ 4DV1I 5C0XA 4F9BB 2JPAA 3HTXA 1Y4UA 2NN6E 4LCHA 2UXBI 1N32I 1ZM9A 1PJSA 2MKDA 2V2VA 4EMDA 1XMOI 2NN6B 4X65I 5GMDA 1TF3A 4AQYI 5KL5A 4IFDE 4WXDA 4LFCE 1RR9A 3IWBA 4DV2E 2BR2A 4P78A 1Z0BA 3PS1A 4R2RA 1Z0CA 3UHMA 2EOEA 2EPNA 1WRJA 2RS6A 1J5EI 4BA1A 5IXMB 4UT4A 4LF7E 3QG5C 3OTOI 2JYAA 4HY1A 2YRHA 3KZYA 5JEAE 4R03A 5AASA 4U3DA 2YT4A 2MC6A 3L00A 1U2RA 2EM0A 4DV7I 1HK7A 2RSMA 1PVGA 2EL6A 3K6QA 3VHTB 3J81C 1LLMC 3P1XA 1HR0I 2EOSA 1E3PA 2PNZA 2G7HA 2ADRA 2HKJA 4ED4A 4R2EA 3C4BA 2LBSB 3OMLA 2VQEI 2J65A 3VYYA 2GHFA 4MYUA 3HPZA 4YHHI 4FW6A 1MG7A 2C37B 1HNWI 3J7Yp 1Z5BA 1FNMA 1IBLI 2B9DA 4R2PA 1IQSA 2EOQA 1Z5AA 4DR2E 3P3EA 3DF6A 4DV1E 3RMPA 2E5LI 2CTDA 2UXBE 1N32E 4URLA 3THNA 2JEAB 2NA2A 2ELZA 3BF2A 2JE6A 1XMOE 3IWCA 4X65E 3UK3C 3KRNA 4JI4I 2PO1A 4AQYE 1ZM4A 1WUUA 3ZM7A 1T4NA 1KIJA 3PYFA 2LJUA 1YUIA 3M7ND 2DGCA 4N3OA 5KL3A 3EPLA 2MDGA 3ZZ0A 1ZAAC 1T4LB 2X7IA 5CFFE 2C39B 1PJTA 5A69A 1WXRA 2IERA 2O1VA 4DU8A 1KTVA 5AC4A 4DV6I 2FGGA 1J5EE 3LLHA 2WP8B 3T1YI 2HHHE 3OTOE 2O3ZA 4M1KA 5DRRA 3ZZUA 1FI4A 2CGEA 4LF4I 2R42A 1IBMI 1GZ6A 4JV5E 2EFGA 2V8QB 3MHSC 1EH6A 2EN3A 4IJDA 4MLVA 4DV7E 4LCFA 1WHNA 2H36X 1JK2A 2R1FA 4DXLA 3EPHA 3M85D 4DUYI 2IOQA 2JXPA 2GQ0A 5A6AA 1X5WA 4LU9A 1Z0GA 1RREA 4MU4A 2B7TA 2HK2A 4F9AB 3B8HA 2YSPA 2LVHA 2VQEE 2RQLA 2EN8A 4YHHE 3PRYA 2JP9A 4OO1C 5AC5A 1RC7A 1FWKA 3QT8A 2EPCA 1HNWE 4DU7A 2WW4A 4BC7A 2RPCA 2EMKA 1IBLE 1Z0WA 1A1HA 2DEIA 2GO4A 1T39A 1YH8A 1HNZI 2E5LE 2YZTA 1AAYA 3QT5A 1Y6ZA 4LF9I 2R76A 2DEJA 3DD6A 1X6EA 4JI4E 4Z7CA 1EH7A 3J80Q 4MU1A 1YFHA 4LF5I 2V87A 2EL4A 3AUZA 1X48A 1X6HA 1PIEA 1EI1A 2O1TA 2BV3A 4DV6E 3GLLA 1S4EA 2LTSA 5LMNE 2EZ6A 2ELYA 3T1YE 5DNXA 5A2QC 3U1YA 4JI1E 1IMUA 4LF4E 3EQ1A 1ELOA 4USMA 2EPXA 2EN6A 4ZVIA 5LMUE 1IBME 1BBGA 2BB8A 2EMIA 2DSYA 2BA1G 1EH8A 1VISA 1XHKA 5LLQA 2EM2A 4DUYE 1QNTA 4NBQA 2LV2A 4FW4A 4ZYGA 2EN7A 4WXCA 1KVKA 5BR8I 2DLQA 2EMFA 2PNMA 5A2QQ 4O5GA 4FW5A 2UUAI 1A1JA 4IZKA 4I3HA 4IS9A 1YUJA 1MEYC 2K4VA 1YHCA 2DMIA 2ODRC 4I8OA 4DPTA 1DGCA 4FN5A 2E72A 2JEBB 2A2CA 4OKGA 1HNZE 4GZNC 1OJ4A 1Z0EA 4LF9E 2I9IA 5LL6R 2M1SA 4LF8I 4NHRA 4PRVA 4DR3I 1FJGI 1IBKI 2EQ0A 4JYAI 2VF1A 4WPYA 2N3HA 4IFDC 3QT7A 4X66E 1QU6A 5K36D 4F54A 3KZZA 4HXZA 4J3DA 5IWAI 4BHCA 2XEXA 3THOB 1BBOA 2HFUA 3FIGA 2L2NA 2EOYA 3LMLA 2HJJA 4Q28A 1OYSA 4IFDB 3L7ZA 5K36A 4WFTA 5IT9C 5C0XF 1AH5A 2EE8A 2ENHA 1YYWA 4B3SI 4DR4I 3PS2A 1F2IG 2BM0A 5JEAC 2LUQA 2YU8A 1O0WA 4DKKA 2EPRA 2C38B 4P7AA 2EPKX 1ZBTA 4BA2A 1XMQE 2PO0B 2YRKA 4K0KI 1Y4SA 4R1FA 3EPJA 3TQMA 1TN9A 2F8BA 3ZZTA 2J7KA 1A6FA 2R3VA 2V8PA 5JEAB 3JAMC 5BR8E 3F6HA 1YYOA 2YTNA 2Z5CB 2YPNA 4Q35B 1BKNA 4HEIA 1B62A 2UUAE 2A2DA 4LOMA 5EKWA 3H09A 4OOGC 4FW7A 4DR6I 4AIMA 4OO1D 1Y5YA 1X3CA 2PNLA 3HJCA 3ADGA 3T1HI 2GO3A 3DJWA 1ZM2A 1FWLA 4JI8E 1X47A 2UXDE 3J81Q 2EMGA 4HYMA 4DR3E 1FJGE 1PJQA 2YTEA 1IBKE 2EM3A 4JYAE 3F0NA 4OO1A 4F6MA 4BC9A 1UDNA 3PS3A 1T4OA 1XNRI 1KJKA 2PO2A 2YWQA 1VI7A 4KWYA 4DR5I 5IWAE 2EL5A 5DNYA 2WNRA 1Y60A 1YZ9A 1UDOA 1B69A 1H7SA 1KKHA 3ECRA 3M6AA 2AJ4A 2BBGA 5C0XC 1XNQI 2MDRA 2DRPA 1H72C 4DR7I 2K7IA 2EJ4A 1N36I 4B3SE 4DR4E 5C0XE 1MU5A 4U3BA 2N3GA 1G2FC 2M7QA 4IZJD 4LCGA 1RHYA 4BMJA 5C0XB 3PYDA 2KONA 2EPPA 4DV0I 2EN2A 2FTXB 3QT6A 1EKZA 1S16A 1HR0E 4M9VC 1NHJA 4DPYA 4KHPI 1A1LA 2ZBKB 1STUA 4IZJA 3V2UC 5K36E 1A1FA 2EOZA 3LTOA 4DR6E 1UHZA 2EPZA 2WCC3 2LRSA 2MC5A 5A6JA 2BR2B 2EMYA 4WUCA 4GEQB 2YTIA 1ZBQA 4BA1B 4WSPA 4L8NA 2YTQA 2EQ3A 2YTOA 4JI6I 1WHQA 2NN6D 2JR1A 2HFSA 5EL9A 2EMAA 3AV0A 4WUBA 4B3TI 2WZOA 1UN6B 1FKAE 2Z5BA 2EPOA 1NEIA 1XNRE 1BB8A 1EA6A 4B3RI 2PNZB 4DR5E 2L6MA 4JG4A 2DB2A 3KWRA 2V2ZA 2JVAA 2NN6A 3K1JA 2B3TB 3JTZA 4DV5I 4BHBA 4DPWA 2LUPB 4M0VA 3NZKA 5GMEA 1PKPA 2NUEA 3GCMA 2CPNA 4HTGA 4MYTA 4QNJA 2WBSA 3ZOQB 1ZU1A 2YTGA 2EOJA 3Q6NA 4DPUA 2LE2A 2B7VA 1A1KA 3ADLA 1ZR9A 2WBUA 1R6MA 2JE6B 4IS1C 3H1CA 4KHPE 1P42A 2PO2B 2AE8A 1Z0VA 4FW3A 2V85A 4R2CA 2NPFA 2PO1B 4JI3I 2WNRB 1DI2A 2F4VI 2EPUA 4X64I 2MKNA 1GTKA 1ZM3A 1KYQA 3WU3A 3PYGA 1YPNA 4YY3I 4PRXA 2L3CA 2C37A 4OX9I 5IV8B 2HGHA 3ADIA 1H73A 1NHHA 4LF6I 4JI6E 4JI0I 3J7AG 1X6FA 2LJHA 2EM6A 2BM1A 1N3GA 4B3TE 4FWGA 5DRQA 4WSGA 4X9JA 3Q6MA 3F6GA 2GS8A 1E3HA 3U1KA 4ZYHA 2JEAA 3CDJA 5FLXC 4TUGA 4LF5E 4F9CB 3BBGA 1H7UA 2VF3A 4DV5E 4X8WA 2Q2EB 2JT2A 4FK5C 3LPSA 4P7DA 4DR1I 2YTPA 5T6JA 5AE3A 4ZYDA 2EM8A 1XXEA 5F3WA 2E1RA 2VRDA 2L2MA 5KL7A 3B82A 3WU4A 4R2SA 4FW9A 2VQFI 5KL2A 1D6TA 5AE1A 3CDIA 5KL4A 4M2ZA 2M4IA 2EMZA 2ENAA 2KHXA 4ISAA 4BS9A 4GKJI 4HACA 3Q1QA 2NUFA 5A6KA 2KOUA 3C4TA 1IQOA 3ZKDA 5L3JA 3H4LA 2DLKA 4JI3E 2EOXA 4J8ZA 1YSAC 2CG9A 1MGTA 4LFBI 2O1WA 1HNXI 5K36B 2CZ9A 3HULA 4MLQA 2F4VE 1ZXMA 4X64E 3P06A 5K36F 2JOXA 5IT9Q 2V86A 2EMXA 3V5RA 5FWKA 2VE7C 1L4SA 4DV4I 4YY3E 1QZRA 5LMUI 2EM7A 2RTXA 1X49A 4OX9E 4LF6E 1Z0TA 2EOHA 2LMZA 1JK1A 1A1IA 4JI0E 1K47A 4LPFA 1N34I 1NHIA 4JI2I 2EORA 4KZSA 2BA0G 2HHHI 4AM3A 1OYPA 3HXLA 4DV3I 3JAMQ 4LF8E 4ZYEA 2UUCI 1PDAA 4JV5I 2YTDA 2VESA 2I13A 2HK3A 2L8TA 1Z5CA 3B4TA 2LT7A 3CWVA 1J26A 4TUIA 1T38A 4R8OA 3WU6A 4DR1E 3D4JA 4DUZI 1RMDA 1I94I 4NZVA 2EMHA 4NXNI 2DIXA 4FWHA 4KQVA 1UEKA 4IZKB 2EM9A 4O43A 4DMIA 3MHHC 2VQFE 1UDSA 2UUBI 4LFAI 1N33I 4USKA 2L2KB 4OO1F 4F6NA 4GQUA 4GKJE 4NXMI 4RHBB 1SR9A 3MSWA 2JY9A 4GKKI 2GPIA 1DQ3A 2LJPA 2UU9I 2OI2A 2CVEA 3M99B 2JOBA 4K0KE 5DRPA 4RPFA 3JU0A 3P76A 1UILA 3ZKBA 4LFBE 2EOIA 5K36C 2EOOA 1HNXE 1UDQA 4JI5I 2DMYA 5KL6A 2O1UA 1OYRA 2LO3A 4R2QA 5ADZA 5AE2A 4F2JC 3GONA 2EMCA 4DV4E 3HKMA 3T1HE 2F1DA 1RQ0A 2E1MA 3L7ZB 5ELWA 2EPMX 1N34E 4X62I 4JI2E 2M9AA 2L33A 2YSOA 3K17A 5LMNI 4WX9A 4MU0A 4BCAA 2ODRD 2ZM6I 2EOMA 4DV3E 4JI1I 4HACB 1UBDC 2UUCE 2BA1D 2JEBA 4MQYA 2EM5A 2EOFA 3WU5A 4B3MI 4BA2B 1SFEA 3LNUA
chains in the Genus database with same CATH topology
4L5NC 1YYKA 2HKEA 4DUZE 3J7AM 1I94E 2V2QA 3B78A 4NXNE 3PYEA 2EWLA 4JI7I 1XNQE 4DR7E 1DARA 3J80C 1N36E 2UXCI 4LFAE 2UUBE 1N33E 2V88A 1B63A 4WUDA 2ZITA 4NXME 4GKKE 1Z59A 2LTRA 2UU9E 2FV4B 4DV0E 3K85A 4UTGA 4Z7YA 1GQEA 3IWDA 2NUGA 4DPXA 4JI5E 2RS7A 1ZXNA 4X66I 1USUA 2JWOA 3HQ1A 2Z5CA 4LFCI 4X62E 2V89A 4DV2I 4BBYA 3ADJA 1H74A 1N0UA 2ZM6E 2Z5EA 1USVA 4B3ME 2IOPA 4LF7I 2X36A 3VK6A 1XMQI 4B3RE 4WYQB 4IZJB 4JI7E 2L92A 1NZ0A 4PU9A 2UXCE 2IHR1 1MX0A 1N0VC 4P52A 3HPSA 4M30A 2L3JA 3VYXA 4JI8I 4LTYA 4FWDA 4XTJA 2V83A 2V34A 4DR2I 2UXDI 2Z5BB 5FLXQ 4DV1I 4F9BB 3HTXA 1Y4UA 2UXBI 1N32I 1ZM9A 2V2VA 4EMDA 1XMOI 4X65I 5GMDA 4AQYI 4LFCE 1RR9A 3IWBA 4DV2E 4P78A 1Z0BA 1Z0CA 2RS6A 1J5EI 4UT4A 4LF7E 3OTOI 4HY1A 4R03A 5AASA 2YT4A 2MC6A 1U2RA 4DV7I 1HK7A 2RSMA 1PVGA 3K6QA 3J81C 3P1XA 1HR0I 2G7HA 2HKJA 4ED4A 3C4BA 2LBSB 3OMLA 2VQEI 3VYYA 4MYUA 3HPZA 4YHHI 1MG7A 1HNWI 3J7Yp 1Z5BA 1FNMA 1IBLI 2B9DA 1Z5AA 4DR2E 3DF6A 4DV1E 3RMPA 2E5LI 2UXBE 1N32E 4URLA 2NA2A 1XMOE 3IWCA 4X65E 4JI4I 4AQYE 1ZM4A 1WUUA 3ZM7A 1T4NA 1KIJA 3PYFA 4N3OA 3ZZ0A 1T4LB 5CFFE 4DV6I 1WXRA 2O1VA 4DU8A 1KTVA 2FGGA 1J5EE 3LLHA 3T1YI 2HHHE 3OTOE 4M1KA 3ZZUA 1FI4A 2CGEA 4LF4I 2R42A 1GZ6A 4JV5E 2EFGA 2V8QB 5LMUI 1IBMI 4DXLA 4DV7E 1WHNA 2H36X 4DUYI 2IOQA 2GQ0A 4LU9A 1Z0GA 1RREA 2B7TA 2HK2A 4F9AB 3B8HA 2VQEE 4YHHE 3PRYA 1RC7A 3QT8A 1FWKA 4DU7A 1HNWE 2WW4A 4BC7A 1IBLE 1Z0WA 2DEIA 1HNZI 2E5LE 2YZTA 3QT5A 1Y6ZA 4LF9I 2DEJA 4JI4E 4Z7CA 3J80Q 4LF5I 2V87A 3AUZA 1X48A 1PIEA 1EI1A 2O1TA 2BV3A 4DV6E 1S4EA 2LTSA 5LMNE 2EZ6A 3T1YE 5A2QC 4JI1E 4LF4E 1ELOA 4USMA 4ZVIA 5LMUE 1IBME 2DSYA 1VISA 1XHKA 4DUYE 1KVKA 5BR8I 2PNMA 5A2QQ 2UUAI 4IZKA 4I3HA 2K4VA 2ODRC 4I8OA 4DPTA 4FN5A 2A2CA 1HNZE 1Z0EA 1OJ4A 4LF9E 5LL6R 2M1SA 4LF8I 4PRVA 4DR3I 1FJGI 1IBKI 4JYAI 2VF1A 4WPYA 2N3HA 3QT7A 4X66E 1QU6A 4F54A 4HXZA 5IWAI 2XEXA 2HFUA 3FIGA 4Q28A 3LMLA 2L2NA 4WFTA 5IT9C 4B3SI 4DR4I 1YYWA 2BM0A 2LUQA 4DKKA 1O0WA 4P7AA 1ZBTA 1XMQE 4K0KI 1Y4SA 4R1FA 2F8BA 3ZZTA 2J7KA 1A6FA 2R3VA 2V8PA 3JAMC 5BR8E 3F6HA 1YYOA 2Z5CB 1BKNA 1B62A 2UUAE 2A2DA 4DR6I 3H09A 4OOGC 2PNLA 3HJCA 3T1HI 3ADGA 3DJWA 1ZM2A 1FWLA 4JI8E 1X47A 2UXDE 3J81Q 4HYMA 4DR3E 1FJGE 1IBKE 4JYAE 3F0NA 4BC9A 1T4OA 1XNRI 4DR5I 5IWAE 5DNYA 1YZ9A 1H7SA 1KKHA 3M6AA 2AJ4A 1XNQI 2MDRA 1H72C 4DR7I 1N36I 4B3SE 4DR4E 1MU5A 2N3GA 2M7QA 4IZJD 4BMJA 3PYDA 2KONA 4DV0I 2FTXB 3QT6A 1EKZA 1S16A 1HR0E 1NHJA 4KHPI 4DPYA 2ZBKB 1STUA 4IZJA 3V2UC 3LTOA 4DR6E 1UHZA 2LRSA 2MC5A 4WUCA 4GEQB 1ZBQA 4WSPA 4L8NA 4JI6I 1WHQA 2JR1A 2HFSA 3AV0A 4WUBA 4B3TI 2WZOA 2Z5BA 1FKAE 1XNRE 1EA6A 4B3RI 4DR5E 2L6MA 4JG4A 2DB2A 3KWRA 2V2ZA 2JVAA 3K1JA 2B3TB 3JTZA 4DV5I 4DPWA 2LUPB 4M0VA 5GMEA 1PKPA 2NUEA 2CPNA 4MYTA 3ZOQB 3Q6NA 4DPUA 2LE2A 2B7VA 3ADLA 4KHPE 2NPFA 1Z0VA 2V85A 4JI3I 1DI2A 2F4VI 4X64I 1ZM3A 3WU3A 3PYGA 4YY3I 4PRXA 2L3CA 4OX9I 1NHHA 3ADIA 4LF6I 1H73A 4JI6E 4JI0I 3J7AG 2LJHA 2BM1A 4B3TE 4FWGA 3Q6MA 3F6GA 2GS8A 5FLXC 4TUGA 4LF5E 4F9CB 1H7UA 2VF3A 2X7IA 4DV5E 4X8WA 2Q2EB 3LPSA 4P7DA 4DR1I 5T6JA 5AE3A 5F3WA 2E1RA 3B82A 2L2MA 3WU4A 4FW9A 2VQFI 1D6TA 5AE1A 4M2ZA 2M4IA 2KHXA 4BS9A 4GKJI 4HACA 3Q1QA 2NUFA 2KOUA 3C4TA 3ZKDA 5L3JA 3H4LA 4JI3E 4J8ZA 2CG9A 4LFBI 2O1WA 1HNXI 2CZ9A 3HULA 2F4VE 1ZXMA 4X64E 3P06A 2JOXA 5IT9Q 2V86A 3V5RA 5FWKA 2VE7C 4DV4I 4YY3E 1QZRA 2RTXA 1X49A 4OX9E 4LF6E 1Z0TA 2LMZA 1N34I 4JI0E 1K47A 4JI2I 1NHIA 4KZSA 2HHHI 3HXLA 4DV3I 3JAMQ 4LF8E 2UUCI 4JV5I 2HK3A 2L8TA 1Z5CA 3CWVA 1J26A 4TUIA 4R8OA 3WU6A 4DR1E 3D4JA 4DUZI 1I94I 4NXNI 2DIXA 4FWHA 4KQVA 1UEKA 4IZKB 4DMIA 2VQFE 2UUBI 4LFAI 1N33I 4USKA 2L2KB 4GKJE 4NXMI 1SR9A 3MSWA 2JY9A 4GKKI 2LJPA 1DQ3A 2UU9I 2OI2A 2JOBA 4K0KE 3ZKBA 4RPFA 3JU0A 1UILA 4LFBE 1HNXE 4JI5I 2O1UA 5ADZA 5AE2A 3GONA 4DV4E 3T1HE 1RQ0A 2E1MA 4X62I 1N34E 4JI2E 2L33A 3K17A 5LMNI 4BCAA 2ODRD 2ZM6I 4DV3E 4JI1I 4HACB 2UUCE 3WU5A 4B3MI 2DMYA 3LNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYK A;  2HKE A;  4DUZ E;  3J7A M;  1I94 E;  2V2Q A;  3B78 A;  4NXN E;  3PYE A;  4JI7 I;  1XNQ E;  4DR7 E;  1DAR A;  3J80 C;  1N36 E;  2UXC I;  4LFA E;  2UUB E;  1N33 E;  1B63 A;  4WUD A;  2ZIT A;  4NXM E;  4GKK E;  1Z59 A;  2LTR A;  2UU9 E;  4DV0 E;  4UTG A;  4Z7Y A;  1GQE A;  2NUG A;  4DPX A;  4JI5 E;  2RS7 A;  1ZXN A;  4X66 I;  4LFC I;  4X62 E;  4DV2 I;  1H74 A;  3ADJ A;  1N0U A;  2ZM6 E;  4B3M E;  4LF7 I;  2X36 A;  1XMQ I;  4B3R E;  4WYQ B;  4JI7 E;  1NZ0 A;  4PU9 A;  2UXC E;  2IHR 1;  1MX0 A;  1N0V C;  4P52 A;  4M30 A;  2L3J A;  3VYX A;  4JI8 I;  4FWD A;  4XTJ A;  2V34 A;  4DR2 I;  2UXD I;  5FLX Q;  4DV1 I;  3HTX A;  2UXB I;  1N32 I;  1ZM9 A;  2V2V A;  4EMD A;  1XMO I;  4X65 I;  5GMD A;  4AQY I;  4LFC E;  1RR9 A;  4DV2 E;  1Z0B A;  1Z0C A;  2RS6 A;  1J5E I;  4UT4 A;  4LF7 E;  3OTO I;  4HY1 A;  2YT4 A;  1U2R A;  4DV7 I;  2RSM A;  1PVG A;  3J81 C;  3P1X A;  1HR0 I;  2HKJ A;  4ED4 A;  3C4B A;  2LBS B;  2VQE I;  3VYY A;  4MYU A;  4YHH I;  1MG7 A;  1HNW I;  1Z5B A;  3J7Y p;  1FNM A;  1IBL I;  1Z5A A;  4DR2 E;  4DV1 E;  2E5L I;  2UXB E;  1N32 E;  4URL A;  2NA2 A;  1XMO E;  4X65 E;  4JI4 I;  4AQY E;  1ZM4 A;  1WUU A;  3ZM7 A;  1T4N A;  1KIJ A;  3PYF A;  3ZZ0 A;  1T4L B;  5CFF E;  4DV6 I;  4DU8 A;  1KTV A;  1J5E E;  3LLH A;  3T1Y I;  2HHH E;  3OTO E;  4M1K A;  3ZZU A;  1FI4 A;  4LF4 I;  2R42 A;  4JV5 E;  2EFG A;  5LMU I;  1IBM I;  4DXL A;  4DV7 E;  1WHN A;  4DUY I;  1Z0G A;  1RRE A;  2B7T A;  2HK2 A;  3B8H A;  2VQE E;  4YHH E;  1RC7 A;  3QT8 A;  1FWK A;  4DU7 A;  1HNW E;  2WW4 A;  1IBL E;  1Z0W A;  2DEI A;  1HNZ I;  2E5L E;  3QT5 A;  4LF9 I;  2DEJ A;  4JI4 E;  4Z7C A;  3J80 Q;  4LF5 I;  1X48 A;  1PIE A;  1EI1 A;  2BV3 A;  4DV6 E;  1S4E A;  2LTS A;  5LMN E;  2EZ6 A;  3T1Y E;  5A2Q C;  4JI1 E;  4LF4 E;  1ELO A;  4USM A;  4ZVI A;  5LMU E;  1IBM E;  1VIS A;  1XHK A;  4DUY E;  1KVK A;  5BR8 I;  5A2Q Q;  2UUA I;  4I3H A;  4DPT A;  4FN5 A;  2A2C A;  1HNZ E;  1Z0E A;  1OJ4 A;  4LF9 E;  5LL6 R;  4LF8 I;  4PRV A;  4DR3 I;  1FJG I;  1IBK I;  4JYA I;  2N3H A;  3QT7 A;  4X66 E;  1QU6 A;  4HXZ A;  5IWA I;  2XEX A;  2HFU A;  2L2N A;  4WFT A;  5IT9 C;  4B3S I;  4DR4 I;  1YYW A;  2BM0 A;  2LUQ A;  4DKK A;  1O0W A;  4P7A A;  1ZBT A;  1XMQ E;  4K0K I;  4R1F A;  3ZZT A;  2J7K A;  1A6F A;  2R3V A;  2V8P A;  3JAM C;  5BR8 E;  1YYO A;  1BKN A;  1B62 A;  2UUA E;  2A2D A;  4DR6 I;  4OOG C;  3T1H I;  3ADG A;  1ZM2 A;  1FWL A;  4JI8 E;  1X47 A;  2UXD E;  3J81 Q;  4HYM A;  4DR3 E;  1FJG E;  1IBK E;  4JYA E;  3F0N A;  1T4O A;  1XNR I;  4DR5 I;  5IWA E;  1YZ9 A;  1H7S A;  1KKH A;  3M6A A;  2AJ4 A;  1XNQ I;  2MDR A;  1H72 C;  4DR7 I;  1N36 I;  4B3S E;  4DR4 E;  1MU5 A;  2N3G A;  3PYD A;  4DV0 I;  3QT6 A;  1EKZ A;  1S16 A;  1HR0 E;  1NHJ A;  4KHP I;  4DPY A;  2ZBK B;  1STU A;  3V2U C;  3LTO A;  4DR6 E;  1UHZ A;  2LRS A;  4WUC A;  4JI6 I;  1WHQ A;  2HFS A;  4B3T I;  4WUB A;  1FKA E;  1XNR E;  1EA6 A;  4B3R I;  4DR5 E;  4JG4 A;  2DB2 A;  2V2Z A;  2JVA A;  3K1J A;  2B3T B;  4DV5 I;  4DPW A;  2LUP B;  5GME A;  1PKP A;  2NUE A;  2CPN A;  4MYT A;  4DPU A;  2B7V A;  3ADL A;  4KHP E;  2NPF A;  1Z0V A;  4JI3 I;  1DI2 A;  2F4V I;  4X64 I;  1ZM3 A;  3WU3 A;  3PYG A;  4YY3 I;  4PRX A;  2L3C A;  4OX9 I;  1NHH A;  3ADI A;  4LF6 I;  1H73 A;  4JI6 E;  4JI0 I;  3J7A G;  2LJH A;  2BM1 A;  4B3T E;  4FWG A;  2GS8 A;  4LF5 E;  2X7I A;  5FLX C;  1H7U A;  2VF3 A;  3LPS A;  4DV5 E;  4X8W A;  2Q2E B;  4DR1 I;  2E1R A;  3B82 A;  2L2M A;  3WU4 A;  4FW9 A;  2VQF I;  1D6T A;  4M2Z A;  2KHX A;  4GKJ I;  4HAC A;  3Q1Q A;  2NUF A;  3C4T A;  3ZKD A;  5L3J A;  3H4L A;  4JI3 E;  4LFB I;  1HNX I;  2CZ9 A;  3HUL A;  2F4V E;  1ZXM A;  4X64 E;  5IT9 Q;  3V5R A;  4DV4 I;  4YY3 E;  1QZR A;  2RTX A;  1X49 A;  4OX9 E;  4LF6 E;  1Z0T A;  1N34 I;  4JI0 E;  1K47 A;  4JI2 I;  1NHI A;  2HHH I;  4DV3 I;  3JAM Q;  4LF8 E;  2UUC I;  4JV5 I;  2HK3 A;  1Z5C A;  3CWV A;  1J26 A;  3WU6 A;  4DR1 E;  3D4J A;  4DUZ I;  1I94 I;  4NXN I;  2DIX A;  4FWH A;  4KQV A;  1UEK A;  2VQF E;  2UUB I;  4LFA I;  1N33 I;  4USK A;  2L2K B;  4GKJ E;  4NXM I;  2JY9 A;  4GKK I;  2LJP A;  2UU9 I;  2OI2 A;  3ZKB A;  4K0K E;  4RPF A;  1UIL A;  4LFB E;  1HNX E;  4JI5 I;  3GON A;  4DV4 E;  3T1H E;  1RQ0 A;  4X62 I;  1N34 E;  4JI2 E;  2L33 A;  3K17 A;  5LMN I;  2ZM6 I;  4DV3 E;  4JI1 I;  4HAC B;  2UUC E;  3WU5 A;  4B3M I;  2DMY A;  3LNU A; 
#chains in the Genus database with same CATH topology
 4L5N C;  1YYK A;  2CT1 A;  2EM4 A;  2EPL X;  1P47 A;  4IFD D;  2HKE A;  4DUZ E;  4N4R B;  4AID A;  3J7A M;  1I94 E;  5A6B D;  2V2Q A;  3B78 A;  4NXN E;  3PYE A;  2EWL A;  4JI7 I;  2N8X A;  1XNQ E;  3M7N G;  4DR7 E;  3GME A;  1DAR A;  3J80 C;  1N36 E;  2RSI A;  4LFA E;  2UUB E;  1N33 E;  4OZE A;  2UXC I;  2A25 A;  4OO1 E;  2V88 A;  1B63 A;  3P3G A;  2ZIT A;  3BID A;  4NXM E;  4WUD A;  4IFD A;  2J7J A;  5A6B A;  4GKK E;  1Z59 A;  2LTR A;  5JEA D;  1A1G A;  2UU9 E;  2FV4 B;  4DV0 E;  2C38 A;  3K85 A;  4UTG A;  1GQE A;  4Z7Y A;  3IWD A;  4OO1 B;  2NUG A;  2EQ1 A;  3C6M A;  2NN6 F;  4DPX A;  2PO0 A;  4JI5 E;  1TF6 A;  4R2A A;  2YTF A;  2RS7 A;  3M85 G;  5TSE A;  1ZXN A;  4X66 I;  1USU A;  5JEA A;  2HC5 A;  4RH8 A;  1G2D C;  3C6K A;  4IFD F;  2JWO A;  3HQ1 A;  2Z5C A;  3BGH A;  4LFC I;  2EN1 A;  4X62 E;  2V89 A;  2IES A;  4DV2 I;  4BBY A;  2CSH A;  3ADJ A;  1H74 A;  2ZM6 E;  1N0U A;  2Z5E A;  4O24 A;  1USV A;  4B3M E;  2IOP A;  3EPK A;  4LF7 I;  2EMW A;  2EN4 A;  2X36 A;  3VK6 A;  5JEA F;  1XMQ I;  4B3R E;  4O4K A;  5DNL A;  2LCE A;  1NCS A;  3P3C A;  4WYQ B;  4MDT A;  4IZJ B;  2YTJ A;  2D9H A;  2WBT A;  2ENC A;  2YU5 A;  1Z1B A;  2PRT A;  2EPA A;  4JI7 E;  2EML A;  2L92 A;  1NZ0 A;  4MU3 A;  4PU9 A;  2UXC E;  2IHR 1;  1MX0 A;  2EMB A;  1N0V C;  1R6L A;  3HPS A;  4P52 A;  5C0X D;  2YRM A;  4M30 A;  2NAB A;  2C39 A;  4R2D A;  2L3J A;  2EP3 A;  5DRO A;  2GLI A;  2BA0 D;  1WJP A;  3VYX A;  4QNK A;  2NN6 C;  4LTY A;  2WP8 A;  4FWD A;  4JI8 I;  4XTJ A;  2V83 A;  2Q8U A;  2V34 A;  4DR2 I;  2UXD I;  2Z5B B;  5FLX Q;  4DV1 I;  5C0X A;  4F9B B;  2JPA A;  3HTX A;  1Y4U A;  2NN6 E;  4LCH A;  2UXB I;  1N32 I;  1ZM9 A;  1PJS A;  2MKD A;  2V2V A;  4EMD A;  1XMO I;  2NN6 B;  4X65 I;  5GMD A;  1TF3 A;  4AQY I;  5KL5 A;  4IFD E;  4WXD A;  4LFC E;  1RR9 A;  3IWB A;  4DV2 E;  2BR2 A;  4P78 A;  1Z0B A;  3PS1 A;  4R2R A;  1Z0C A;  3UHM A;  2EOE A;  2EPN A;  1WRJ A;  2RS6 A;  1J5E I;  4BA1 A;  5IXM B;  4UT4 A;  4LF7 E;  3QG5 C;  3OTO I;  2JYA A;  4HY1 A;  2YRH A;  3KZY A;  5JEA E;  4R03 A;  5AAS A;  4U3D A;  2YT4 A;  2MC6 A;  3L00 A;  1U2R A;  2EM0 A;  4DV7 I;  1HK7 A;  2RSM A;  1PVG A;  2EL6 A;  3K6Q A;  3VHT B;  3J81 C;  1LLM C;  3P1X A;  1HR0 I;  2EOS A;  1E3P A;  2PNZ A;  2G7H A;  2ADR A;  2HKJ A;  4ED4 A;  4R2E A;  3C4B A;  2LBS B;  3OML A;  2VQE I;  2J65 A;  3VYY A;  2GHF A;  4MYU A;  3HPZ A;  4YHH I;  4FW6 A;  1MG7 A;  2C37 B;  1HNW I;  3J7Y p;  1Z5B A;  1FNM A;  1IBL I;  2B9D A;  4R2P A;  1IQS A;  2EOQ A;  1Z5A A;  4DR2 E;  3P3E A;  3DF6 A;  4DV1 E;  3RMP A;  2E5L I;  2CTD A;  2UXB E;  1N32 E;  4URL A;  3THN A;  2JEA B;  2NA2 A;  2ELZ A;  3BF2 A;  2JE6 A;  1XMO E;  3IWC A;  4X65 E;  3UK3 C;  3KRN A;  4JI4 I;  2PO1 A;  4AQY E;  1ZM4 A;  1WUU A;  3ZM7 A;  1T4N A;  1KIJ A;  3PYF A;  2LJU A;  1YUI A;  3M7N D;  2DGC A;  4N3O A;  5KL3 A;  3EPL A;  2MDG A;  3ZZ0 A;  1ZAA C;  1T4L B;  2X7I A;  5CFF E;  2C39 B;  1PJT A;  5A69 A;  1WXR A;  2IER A;  2O1V A;  4DU8 A;  1KTV A;  5AC4 A;  4DV6 I;  2FGG A;  1J5E E;  3LLH A;  2WP8 B;  3T1Y I;  2HHH E;  3OTO E;  2O3Z A;  4M1K A;  5DRR A;  3ZZU A;  1FI4 A;  2CGE A;  4LF4 I;  2R42 A;  1IBM I;  1GZ6 A;  4JV5 E;  2EFG A;  2V8Q B;  3MHS C;  1EH6 A;  2EN3 A;  4IJD A;  4MLV A;  4DV7 E;  4LCF A;  1WHN A;  2H36 X;  1JK2 A;  2R1F A;  4DXL A;  3EPH A;  3M85 D;  4DUY I;  2IOQ A;  2JXP A;  2GQ0 A;  5A6A A;  1X5W A;  4LU9 A;  1Z0G A;  1RRE A;  4MU4 A;  2B7T A;  2HK2 A;  4F9A B;  3B8H A;  2YSP A;  2LVH A;  2VQE E;  2RQL A;  2EN8 A;  4YHH E;  3PRY A;  2JP9 A;  4OO1 C;  5AC5 A;  1RC7 A;  1FWK A;  3QT8 A;  2EPC A;  1HNW E;  4DU7 A;  2WW4 A;  4BC7 A;  2RPC A;  2EMK A;  1IBL E;  1Z0W A;  1A1H A;  2DEI A;  2GO4 A;  1T39 A;  1YH8 A;  1HNZ I;  2E5L E;  2YZT A;  1AAY A;  3QT5 A;  1Y6Z A;  4LF9 I;  2R76 A;  2DEJ A;  3DD6 A;  1X6E A;  4JI4 E;  4Z7C A;  1EH7 A;  3J80 Q;  4MU1 A;  1YFH A;  4LF5 I;  2V87 A;  2EL4 A;  3AUZ A;  1X48 A;  1X6H A;  1PIE A;  1EI1 A;  2O1T A;  2BV3 A;  4DV6 E;  3GLL A;  1S4E A;  2LTS A;  5LMN E;  2EZ6 A;  2ELY A;  3T1Y E;  5DNX A;  5A2Q C;  3U1Y A;  4JI1 E;  1IMU A;  4LF4 E;  3EQ1 A;  1ELO A;  4USM A;  2EPX A;  2EN6 A;  4ZVI A;  5LMU E;  1IBM E;  1BBG A;  2BB8 A;  2EMI A;  2DSY A;  2BA1 G;  1EH8 A;  1VIS A;  1XHK A;  5LLQ A;  2EM2 A;  4DUY E;  1QNT A;  4NBQ A;  2LV2 A;  4FW4 A;  4ZYG A;  2EN7 A;  4WXC A;  1KVK A;  5BR8 I;  2DLQ A;  2EMF A;  2PNM A;  5A2Q Q;  4O5G A;  4FW5 A;  2UUA I;  1A1J A;  4IZK A;  4I3H A;  4IS9 A;  1YUJ A;  1MEY C;  2K4V A;  1YHC A;  2DMI A;  2ODR C;  4I8O A;  4DPT A;  1DGC A;  4FN5 A;  2E72 A;  2JEB B;  2A2C A;  4OKG A;  1HNZ E;  4GZN C;  1OJ4 A;  1Z0E A;  4LF9 E;  2I9I A;  5LL6 R;  2M1S A;  4LF8 I;  4NHR A;  4PRV A;  4DR3 I;  1FJG I;  1IBK I;  2EQ0 A;  4JYA I;  2VF1 A;  4WPY A;  2N3H A;  4IFD C;  3QT7 A;  4X66 E;  1QU6 A;  5K36 D;  4F54 A;  3KZZ A;  4HXZ A;  4J3D A;  5IWA I;  4BHC A;  2XEX A;  3THO B;  1BBO A;  2HFU A;  3FIG A;  2L2N A;  2EOY A;  3LML A;  2HJJ A;  4Q28 A;  1OYS A;  4IFD B;  3L7Z A;  5K36 A;  4WFT A;  5IT9 C;  5C0X F;  1AH5 A;  2EE8 A;  2ENH A;  1YYW A;  4B3S I;  4DR4 I;  3PS2 A;  1F2I G;  2BM0 A;  5JEA C;  2LUQ A;  2YU8 A;  1O0W A;  4DKK A;  2EPR A;  2C38 B;  4P7A A;  2EPK X;  1ZBT A;  4BA2 A;  1XMQ E;  2PO0 B;  2YRK A;  4K0K I;  1Y4S A;  4R1F A;  3EPJ A;  3TQM A;  1TN9 A;  2F8B A;  3ZZT A;  2J7K A;  1A6F A;  2R3V A;  2V8P A;  5JEA B;  3JAM C;  5BR8 E;  3F6H A;  1YYO A;  2YTN A;  2Z5C B;  2YPN A;  4Q35 B;  1BKN A;  4HEI A;  1B62 A;  2UUA E;  2A2D A;  4LOM A;  5EKW A;  3H09 A;  4OOG C;  4FW7 A;  4DR6 I;  4AIM A;  4OO1 D;  1Y5Y A;  1X3C A;  2PNL A;  3HJC A;  3ADG A;  3T1H I;  2GO3 A;  3DJW A;  1ZM2 A;  1FWL A;  4JI8 E;  1X47 A;  2UXD E;  3J81 Q;  2EMG A;  4HYM A;  4DR3 E;  1FJG E;  1PJQ A;  2YTE A;  1IBK E;  2EM3 A;  4JYA E;  3F0N A;  4OO1 A;  4F6M A;  4BC9 A;  1UDN A;  3PS3 A;  1T4O A;  1XNR I;  1KJK A;  2PO2 A;  2YWQ A;  1VI7 A;  4KWY A;  4DR5 I;  5IWA E;  2EL5 A;  5DNY A;  2WNR A;  1Y60 A;  1YZ9 A;  1UDO A;  1B69 A;  1H7S A;  1KKH A;  3ECR A;  3M6A A;  2AJ4 A;  2BBG A;  5C0X C;  1XNQ I;  2MDR A;  2DRP A;  1H72 C;  4DR7 I;  2K7I A;  2EJ4 A;  1N36 I;  4B3S E;  4DR4 E;  5C0X E;  1MU5 A;  4U3B A;  2N3G A;  1G2F C;  2M7Q A;  4IZJ D;  4LCG A;  1RHY A;  4BMJ A;  5C0X B;  3PYD A;  2KON A;  2EPP A;  4DV0 I;  2EN2 A;  2FTX B;  3QT6 A;  1EKZ A;  1S16 A;  1HR0 E;  4M9V C;  1NHJ A;  4DPY A;  4KHP I;  1A1L A;  2ZBK B;  1STU A;  4IZJ A;  3V2U C;  5K36 E;  1A1F A;  2EOZ A;  3LTO A;  4DR6 E;  1UHZ A;  2EPZ A;  2WCC 3;  2LRS A;  2MC5 A;  5A6J A;  2BR2 B;  2EMY A;  4WUC A;  4GEQ B;  2YTI A;  1ZBQ A;  4BA1 B;  4WSP A;  4L8N A;  2YTQ A;  2EQ3 A;  2YTO A;  4JI6 I;  1WHQ A;  2NN6 D;  2JR1 A;  2HFS A;  5EL9 A;  2EMA A;  3AV0 A;  4WUB A;  4B3T I;  2WZO A;  1UN6 B;  1FKA E;  2Z5B A;  2EPO A;  1NEI A;  1XNR E;  1BB8 A;  1EA6 A;  4B3R I;  2PNZ B;  4DR5 E;  2L6M A;  4JG4 A;  2DB2 A;  3KWR A;  2V2Z A;  2JVA A;  2NN6 A;  3K1J A;  2B3T B;  3JTZ A;  4DV5 I;  4BHB A;  4DPW A;  2LUP B;  4M0V A;  3NZK A;  5GME A;  1PKP A;  2NUE A;  3GCM A;  2CPN A;  4HTG A;  4MYT A;  4QNJ A;  2WBS A;  3ZOQ B;  1ZU1 A;  2YTG A;  2EOJ A;  3Q6N A;  4DPU A;  2LE2 A;  2B7V A;  1A1K A;  3ADL A;  1ZR9 A;  2WBU A;  1R6M A;  2JE6 B;  4IS1 C;  3H1C A;  4KHP E;  1P42 A;  2PO2 B;  2AE8 A;  1Z0V A;  4FW3 A;  2V85 A;  4R2C A;  2NPF A;  2PO1 B;  4JI3 I;  2WNR B;  1DI2 A;  2F4V I;  2EPU A;  4X64 I;  2MKN A;  1GTK A;  1ZM3 A;  1KYQ A;  3WU3 A;  3PYG A;  1YPN A;  4YY3 I;  4PRX A;  2L3C A;  2C37 A;  4OX9 I;  5IV8 B;  2HGH A;  3ADI A;  1H73 A;  1NHH A;  4LF6 I;  4JI6 E;  4JI0 I;  3J7A G;  1X6F A;  2LJH A;  2EM6 A;  2BM1 A;  1N3G A;  4B3T E;  4FWG A;  5DRQ A;  4WSG A;  4X9J A;  3Q6M A;  3F6G A;  2GS8 A;  1E3H A;  3U1K A;  4ZYH A;  2JEA A;  3CDJ A;  5FLX C;  4TUG A;  4LF5 E;  4F9C B;  3BBG A;  1H7U A;  2VF3 A;  4DV5 E;  4X8W A;  2Q2E B;  2JT2 A;  4FK5 C;  3LPS A;  4P7D A;  4DR1 I;  2YTP A;  5T6J A;  5AE3 A;  4ZYD A;  2EM8 A;  1XXE A;  5F3W A;  2E1R A;  2VRD A;  2L2M A;  5KL7 A;  3B82 A;  3WU4 A;  4R2S A;  4FW9 A;  2VQF I;  5KL2 A;  1D6T A;  5AE1 A;  3CDI A;  5KL4 A;  4M2Z A;  2M4I A;  2EMZ A;  2ENA A;  2KHX A;  4ISA A;  4BS9 A;  4GKJ I;  4HAC A;  3Q1Q A;  2NUF A;  5A6K A;  2KOU A;  3C4T A;  1IQO A;  3ZKD A;  5L3J A;  3H4L A;  2DLK A;  4JI3 E;  2EOX A;  4J8Z A;  1YSA C;  2CG9 A;  1MGT A;  4LFB I;  2O1W A;  1HNX I;  5K36 B;  2CZ9 A;  3HUL A;  4MLQ A;  2F4V E;  1ZXM A;  4X64 E;  3P06 A;  5K36 F;  2JOX A;  5IT9 Q;  2V86 A;  2EMX A;  3V5R A;  5FWK A;  2VE7 C;  1L4S A;  4DV4 I;  4YY3 E;  1QZR A;  5LMU I;  2EM7 A;  2RTX A;  1X49 A;  4OX9 E;  4LF6 E;  1Z0T A;  2EOH A;  2LMZ A;  1JK1 A;  1A1I A;  4JI0 E;  1K47 A;  4LPF A;  1N34 I;  1NHI A;  4JI2 I;  2EOR A;  4KZS A;  2BA0 G;  2HHH I;  4AM3 A;  1OYP A;  3HXL A;  4DV3 I;  3JAM Q;  4LF8 E;  4ZYE A;  2UUC I;  1PDA A;  4JV5 I;  2YTD A;  2VES A;  2I13 A;  2HK3 A;  2L8T A;  1Z5C A;  3B4T A;  2LT7 A;  3CWV A;  1J26 A;  4TUI A;  1T38 A;  4R8O A;  3WU6 A;  4DR1 E;  3D4J A;  4DUZ I;  1RMD A;  1I94 I;  4NZV A;  2EMH A;  4NXN I;  2DIX A;  4FWH A;  4KQV A;  1UEK A;  4IZK B;  2EM9 A;  4O43 A;  4DMI A;  3MHH C;  2VQF E;  1UDS A;  2UUB I;  4LFA I;  1N33 I;  4USK A;  2L2K B;  4OO1 F;  4F6N A;  4GQU A;  4GKJ E;  4NXM I;  4RHB B;  1SR9 A;  3MSW A;  2JY9 A;  4GKK I;  2GPI A;  1DQ3 A;  2LJP A;  2UU9 I;  2OI2 A;  2CVE A;  3M99 B;  2JOB A;  4K0K E;  5DRP A;  4RPF A;  3JU0 A;  3P76 A;  1UIL A;  3ZKB A;  4LFB E;  2EOI A;  5K36 C;  2EOO A;  1HNX E;  1UDQ A;  4JI5 I;  2DMY A;  5KL6 A;  2O1U A;  1OYR A;  2LO3 A;  4R2Q A;  5ADZ A;  5AE2 A;  4F2J C;  3GON A;  2EMC A;  4DV4 E;  3HKM A;  3T1H E;  2F1D A;  1RQ0 A;  2E1M A;  3L7Z B;  5ELW A;  2EPM X;  1N34 E;  4X62 I;  4JI2 E;  2M9A A;  2L33 A;  2YSO A;  3K17 A;  5LMN I;  4WX9 A;  4MU0 A;  4BCA A;  2ODR D;  2ZM6 I;  2EOM A;  4DV3 E;  4JI1 I;  4HAC B;  1UBD C;  2UUC E;  2BA1 D;  2JEB A;  4MQY A;  2EM5 A;  2EOF A;  3WU5 A;  4B3M I;  4BA2 B;  1SFE A;  3LNU A; 
#chains in the Genus database with same CATH homology
 4L5N C;  1YYK A;  2HKE A;  4DUZ E;  3J7A M;  1I94 E;  2V2Q A;  3B78 A;  4NXN E;  3PYE A;  2EWL A;  4JI7 I;  1XNQ E;  4DR7 E;  1DAR A;  3J80 C;  1N36 E;  2UXC I;  4LFA E;  2UUB E;  1N33 E;  2V88 A;  1B63 A;  4WUD A;  2ZIT A;  4NXM E;  4GKK E;  1Z59 A;  2LTR A;  2UU9 E;  2FV4 B;  4DV0 E;  3K85 A;  4UTG A;  4Z7Y A;  1GQE A;  3IWD A;  2NUG A;  4DPX A;  4JI5 E;  2RS7 A;  1ZXN A;  4X66 I;  1USU A;  2JWO A;  3HQ1 A;  2Z5C A;  4LFC I;  4X62 E;  2V89 A;  4DV2 I;  4BBY A;  3ADJ A;  1H74 A;  1N0U A;  2ZM6 E;  2Z5E A;  1USV A;  4B3M E;  2IOP A;  4LF7 I;  2X36 A;  3VK6 A;  1XMQ I;  4B3R E;  4WYQ B;  4IZJ B;  4JI7 E;  2L92 A;  1NZ0 A;  4PU9 A;  2UXC E;  2IHR 1;  1MX0 A;  1N0V C;  4P52 A;  3HPS A;  4M30 A;  2L3J A;  3VYX A;  4JI8 I;  4LTY A;  4FWD A;  4XTJ A;  2V83 A;  2V34 A;  4DR2 I;  2UXD I;  2Z5B B;  5FLX Q;  4DV1 I;  4F9B B;  3HTX A;  1Y4U A;  2UXB I;  1N32 I;  1ZM9 A;  2V2V A;  4EMD A;  1XMO I;  4X65 I;  5GMD A;  4AQY I;  4LFC E;  1RR9 A;  3IWB A;  4DV2 E;  4P78 A;  1Z0B A;  1Z0C A;  2RS6 A;  1J5E I;  4UT4 A;  4LF7 E;  3OTO I;  4HY1 A;  4R03 A;  5AAS A;  2YT4 A;  2MC6 A;  1U2R A;  4DV7 I;  1HK7 A;  2RSM A;  1PVG A;  3K6Q A;  3J81 C;  3P1X A;  1HR0 I;  2G7H A;  2HKJ A;  4ED4 A;  3C4B A;  2LBS B;  3OML A;  2VQE I;  3VYY A;  4MYU A;  3HPZ A;  4YHH I;  1MG7 A;  1HNW I;  3J7Y p;  1Z5B A;  1FNM A;  1IBL I;  2B9D A;  1Z5A A;  4DR2 E;  3DF6 A;  4DV1 E;  3RMP A;  2E5L I;  2UXB E;  1N32 E;  4URL A;  2NA2 A;  1XMO E;  3IWC A;  4X65 E;  4JI4 I;  4AQY E;  1ZM4 A;  1WUU A;  3ZM7 A;  1T4N A;  1KIJ A;  3PYF A;  4N3O A;  3ZZ0 A;  1T4L B;  5CFF E;  4DV6 I;  1WXR A;  2O1V A;  4DU8 A;  1KTV A;  2FGG A;  1J5E E;  3LLH A;  3T1Y I;  2HHH E;  3OTO E;  4M1K A;  3ZZU A;  1FI4 A;  2CGE A;  4LF4 I;  2R42 A;  1GZ6 A;  4JV5 E;  2EFG A;  2V8Q B;  5LMU I;  1IBM I;  4DXL A;  4DV7 E;  1WHN A;  2H36 X;  4DUY I;  2IOQ A;  2GQ0 A;  4LU9 A;  1Z0G A;  1RRE A;  2B7T A;  2HK2 A;  4F9A B;  3B8H A;  2VQE E;  4YHH E;  3PRY A;  1RC7 A;  3QT8 A;  1FWK A;  4DU7 A;  1HNW E;  2WW4 A;  4BC7 A;  1IBL E;  1Z0W A;  2DEI A;  1HNZ I;  2E5L E;  2YZT A;  3QT5 A;  1Y6Z A;  4LF9 I;  2DEJ A;  4JI4 E;  4Z7C A;  3J80 Q;  4LF5 I;  2V87 A;  3AUZ A;  1X48 A;  1PIE A;  1EI1 A;  2O1T A;  2BV3 A;  4DV6 E;  1S4E A;  2LTS A;  5LMN E;  2EZ6 A;  3T1Y E;  5A2Q C;  4JI1 E;  4LF4 E;  1ELO A;  4USM A;  4ZVI A;  5LMU E;  1IBM E;  2DSY A;  1VIS A;  1XHK A;  4DUY E;  1KVK A;  5BR8 I;  2PNM A;  5A2Q Q;  2UUA I;  4IZK A;  4I3H A;  2K4V A;  2ODR C;  4I8O A;  4DPT A;  4FN5 A;  2A2C A;  1HNZ E;  1Z0E A;  1OJ4 A;  4LF9 E;  5LL6 R;  2M1S A;  4LF8 I;  4PRV A;  4DR3 I;  1FJG I;  1IBK I;  4JYA I;  2VF1 A;  4WPY A;  2N3H A;  3QT7 A;  4X66 E;  1QU6 A;  4F54 A;  4HXZ A;  5IWA I;  2XEX A;  2HFU A;  3FIG A;  4Q28 A;  3LML A;  2L2N A;  4WFT A;  5IT9 C;  4B3S I;  4DR4 I;  1YYW A;  2BM0 A;  2LUQ A;  4DKK A;  1O0W A;  4P7A A;  1ZBT A;  1XMQ E;  4K0K I;  1Y4S A;  4R1F A;  2F8B A;  3ZZT A;  2J7K A;  1A6F A;  2R3V A;  2V8P A;  3JAM C;  5BR8 E;  3F6H A;  1YYO A;  2Z5C B;  1BKN A;  1B62 A;  2UUA E;  2A2D A;  4DR6 I;  3H09 A;  4OOG C;  2PNL A;  3HJC A;  3T1H I;  3ADG A;  3DJW A;  1ZM2 A;  1FWL A;  4JI8 E;  1X47 A;  2UXD E;  3J81 Q;  4HYM A;  4DR3 E;  1FJG E;  1IBK E;  4JYA E;  3F0N A;  4BC9 A;  1T4O A;  1XNR I;  4DR5 I;  5IWA E;  5DNY A;  1YZ9 A;  1H7S A;  1KKH A;  3M6A A;  2AJ4 A;  1XNQ I;  2MDR A;  1H72 C;  4DR7 I;  1N36 I;  4B3S E;  4DR4 E;  1MU5 A;  2N3G A;  2M7Q A;  4IZJ D;  4BMJ A;  3PYD A;  2KON A;  4DV0 I;  2FTX B;  3QT6 A;  1EKZ A;  1S16 A;  1HR0 E;  1NHJ A;  4KHP I;  4DPY A;  2ZBK B;  1STU A;  4IZJ A;  3V2U C;  3LTO A;  4DR6 E;  1UHZ A;  2LRS A;  2MC5 A;  4WUC A;  4GEQ B;  1ZBQ A;  4WSP A;  4L8N A;  4JI6 I;  1WHQ A;  2JR1 A;  2HFS A;  3AV0 A;  4WUB A;  4B3T I;  2WZO A;  2Z5B A;  1FKA E;  1XNR E;  1EA6 A;  4B3R I;  4DR5 E;  2L6M A;  4JG4 A;  2DB2 A;  3KWR A;  2V2Z A;  2JVA A;  3K1J A;  2B3T B;  3JTZ A;  4DV5 I;  4DPW A;  2LUP B;  4M0V A;  5GME A;  1PKP A;  2NUE A;  2CPN A;  4MYT A;  3ZOQ B;  3Q6N A;  4DPU A;  2LE2 A;  2B7V A;  3ADL A;  4KHP E;  2NPF A;  1Z0V A;  2V85 A;  4JI3 I;  1DI2 A;  2F4V I;  4X64 I;  1ZM3 A;  3WU3 A;  3PYG A;  4YY3 I;  4PRX A;  2L3C A;  4OX9 I;  1NHH A;  3ADI A;  4LF6 I;  1H73 A;  4JI6 E;  4JI0 I;  3J7A G;  2LJH A;  2BM1 A;  4B3T E;  4FWG A;  3Q6M A;  3F6G A;  2GS8 A;  5FLX C;  4TUG A;  4LF5 E;  4F9C B;  1H7U A;  2VF3 A;  2X7I A;  4DV5 E;  4X8W A;  2Q2E B;  3LPS A;  4P7D A;  4DR1 I;  5T6J A;  5AE3 A;  5F3W A;  2E1R A;  3B82 A;  2L2M A;  3WU4 A;  4FW9 A;  2VQF I;  1D6T A;  5AE1 A;  4M2Z A;  2M4I A;  2KHX A;  4BS9 A;  4GKJ I;  4HAC A;  3Q1Q A;  2NUF A;  2KOU A;  3C4T A;  3ZKD A;  5L3J A;  3H4L A;  4JI3 E;  4J8Z A;  2CG9 A;  4LFB I;  2O1W A;  1HNX I;  2CZ9 A;  3HUL A;  2F4V E;  1ZXM A;  4X64 E;  3P06 A;  2JOX A;  5IT9 Q;  2V86 A;  3V5R A;  5FWK A;  2VE7 C;  4DV4 I;  4YY3 E;  1QZR A;  2RTX A;  1X49 A;  4OX9 E;  4LF6 E;  1Z0T A;  2LMZ A;  1N34 I;  4JI0 E;  1K47 A;  4JI2 I;  1NHI A;  4KZS A;  2HHH I;  3HXL A;  4DV3 I;  3JAM Q;  4LF8 E;  2UUC I;  4JV5 I;  2HK3 A;  2L8T A;  1Z5C A;  3CWV A;  1J26 A;  4TUI A;  4R8O A;  3WU6 A;  4DR1 E;  3D4J A;  4DUZ I;  1I94 I;  4NXN I;  2DIX A;  4FWH A;  4KQV A;  1UEK A;  4IZK B;  4DMI A;  2VQF E;  2UUB I;  4LFA I;  1N33 I;  4USK A;  2L2K B;  4GKJ E;  4NXM I;  1SR9 A;  3MSW A;  2JY9 A;  4GKK I;  2LJP A;  1DQ3 A;  2UU9 I;  2OI2 A;  2JOB A;  4K0K E;  3ZKB A;  4RPF A;  3JU0 A;  1UIL A;  4LFB E;  1HNX E;  4JI5 I;  2O1U A;  5ADZ A;  5AE2 A;  3GON A;  4DV4 E;  3T1H E;  1RQ0 A;  2E1M A;  4X62 I;  1N34 E;  4JI2 E;  2L33 A;  3K17 A;  5LMN I;  4BCA A;  2ODR D;  2ZM6 I;  4DV3 E;  4JI1 I;  4HAC B;  2UUC E;  3WU5 A;  4B3M I;  2DMY A;  3LNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...