1HNXE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnxE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnxE02
3P1XA 3ADLA 2DMYA 4NXNE 1ELOA 4WUBA 4FN5A 3D4JA 1XNRE 5A2QC 4DV5E 1ZXNA 4JG4A 2UUAI 2L2MA 1S16A 4DXLA 4DUZE 4GKJI 4JI2I 1OJ4A 4PRVA 4MYUA 4M1KA 2ZBKB 4DPUA 1KVKA 2JY9A 4M2ZA 4HY1A 1X48A 3H4LA 1A6FA 1EKZA 1X49A 2UU9E 4URLA 2NUEA 2VQEI 4EMDA 1YYWA 3F0NA 1WHNA 4DR3I 4FW9A 4AQYI 3WU4A 4JI1I 2XEXA 4B3TE 1STUA 3LPSA 5GMDA 4K0KE 4NXNI 1MG7A 3J80Q 2F4VI 2V2VA 3LLHA 2CPNA 1ZM9A 2V8PA 1XNRI 5IT9C 1ZXMA 4DUZI 4YHHI 2LRSA 2LTRA 4NXME 1O0WA 2UUBI 3ZZUA 1S4EA 4YY3E 1BKNA 4B3MI 4X65E 1N0UA 2A2CA 2UU9I 4DV7E 4HACA 2UUCE 4DPWA 1I94I 1HNWE 4PRXA 1EI1A 4B3TI 2E5LE 4DV3E 1X47A 4K0KI 4DU7A 2BM1A 1UILA 1PKPA 2R42A 2DEJA 4WUDA 2CZ9A 2YT4A 4DR7I 1B62A 4DV1E 3QT8A 1XHKA 2N3HA 3M6AA 4FWHA 5GMEA 2LBSB 4YY3I 1HR0E 1Z0WA 1ZBTA 3J81C 1HNXE 3PYGA 1FNMA 1Z59A 1FJGE 1T4LB 1NHIA 2BV3A 2J7KA 3WU6A 4X66E 4LF7E 2NUFA 2NA2A 4LF4E 4Z7YA 3OTOI 5L3JA 2A2DA 2UXCE 2E5LI 4DV3I 2GS8A 1Z5BA 4WYQB 2VQFE 1Z0EA 4LFAE 2LTSA 4DV0E 4OX9E 1XMQE 2V2ZA 4DV6E 4JI6E 3ZZTA 4DV1I 1Z5AA 1NHJA 2UXDE 3CWVA 4DR1E 4FWGA 3QT5A 2LUPB 2HKJA 1QZRA 3PYEA 1RC7A 3HULA 3C4BA 2ZM6E 4LF5E 1HNXI 4DKKA 5A2QQ 1MU5A 4JYAE 4DUYI 4LF8E 1N36E 4X66I 4LF7I 4DV2E 1VISA 1DI2A 4LF4I 2L3CA 1J26A 2IHR1 4JI0E 2NPFA 4DV4E 1N32E 2UXCI 3J7Yp 1XMOE 2HK2A 2B7TA 3JAMQ 2Q2EB 2VQFI 1Z0BA 3V5RA 4LFAI 4MYTA 4OX9I 2HKEA 4X62E 4UTGA 2BM0A 3K17A 4DV5I 3J80C 3GONA 3QT7A 2L33A 3T1HE 3VYXA 4DR5E 2UXDI 4ZVIA 1Z0VA 2N3GA 1FKAE 3LNUA 5LL6R 4LFBE 4JI7E 2ZM6I 1IBME 4JI3E 4I3HA 2E1RA 3T1YE 2X36A 5IT9Q 4JYAI 4B3RE 4LFCE 4RPFA 4LF8I 4USMA 4DV2I 1H7UA 5FLXQ 4JI0I 4DV4I 1N32I 3ADGA 4LF9E 2X7IA 1QU6A 2JVAA 2EZ6A 1ZM4A 1XMOI 1YZ9A 1KKHA 2EFGA 1NZ0A 3ZZ0A 4ED4A 4PU9A 4X62I 4JI5E 1XNQE 3V2UC 2LJPA 3T1HI 1Z0GA 2AJ4A 4DR5I 4XTJA 2RS6A 4DU8A 3ZKBA 1WHQA 4JV5E 4DR6E 5LMNE 4NXMI 4LFBI 4DR2E 1PVGA 1N0VC 4JI7I 4JI3I 3B8HA 3T1YI 4B3SE 1K47A 4X65I 4B3RI 4KQVA 3Q1QA 1FWKA 4P52A 4DV7I 1YYOA 2WW4A 2UUCI 4LF9I 1HNWI 4X64E 2R3VA 3J7AM 3VYYA 3ZKDA 3B78A 2DIXA 1T4OA 3J81Q 3QT6A 3C4TA 4HACB 4JI5I 1KIJA 2OI2A 1N34E 1MX0A 1Z0TA 1Z0CA 3ZM7A 1J5EE 4X8WA 4DR6I 1RREA 2VQEE 4DR2I 1D6TA 1IBKE 4B3SI 1HR0I 4JI1E 3PYFA 4DPTA 3WU3A 1HNZE 1FJGI 5BR8E 3ADJA 2F4VE 2RSMA 4GKKE 4R1FA 4X64I 1ZM3A 4HYMA 4YHHE 1FI4A 2V2QA 1EA6A 1U2RA 4LF6E 4FWDA 2B3TB 2UUBE 4DV0I 1XMQI 4KHPE 4DV6I 2MDRA 4DPYA 3B82A 3JAMC 1N34I 3ADIA 4B3ME 4JI6I 1J5EI 2L3JA 3LTOA 1I94E 4DR1I 2L2KB 1H74A 1IBKI 2HHHE 4Z7CA 4LF5I 1FWLA 1DARA 1UEKA 1HNZI 2DB2A 5BR8I 1KTVA 4GKKI 1N36I 5IWAE 1RQ0A 4DR7E 2LUQA 2RS7A 1NHHA 1WUUA 1Z5CA 4JI8E 5FLXC 1T4NA 4LF6I 4JI4E 4KHPI 1PIEA 1GQEA 1B63A 4P7AA 2L2NA 2DEIA 2B7VA 2HHHI 2UXBE 3OTOE 5LMUE 4WUCA 4DR4E 1H73A 1N33E 1IBLE 1IBMI 5CFFE 2HK3A 2V34A 4LFCI 1RR9A 4M30A 5IWAI 4JI8I 2KHXA 2UUAE 2ZITA 2HFSA 4GKJE 3PYDA 4JI2E 4JI4I 2RTXA 1ZM2A 3K1JA 1XNQI 4USKA 4DUYE 4WFTA 4HXZA 3WU5A 4JV5I 1UHZA 2NUGA 5LMNI 4DPXA 2UXBI 4OOGC 1H7SA 5LMUI 3HTXA 3J7AG 1H72C 4DR4I 2HFUA 2LJHA 1N33I 1IBLI 4DR3E 2VF3A 1YYKA 4UT4A 4AQYE
chains in the Genus database with same CATH superfamily
3P1XA 3ADLA 5EKWA 2EOOA 2LJUA 2DMYA 2EQ1A 4NXNE 1ELOA 2EOJA 5AASA 4WUBA 5AC4A 1A1IA 4FN5A 2GO3A 2EMFA 1OYPA 4GEQB 2PO1B 2I9IA 1AH5A 3D4JA 2VE7C 4GQUA 1XNRE 1IQSA 5A2QC 4DV5E 2LCEA 1ZXNA 4BCAA 4JG4A 2UUAI 1EH8A 2L2MA 4LU9A 1S16A 1SR9A 2JXPA 2WNRB 4DXLA 4DUZE 4DV0I 4GKJI 4JI2I 4BA1B 1E3PA 1OJ4A 1UN6B 2EWLA 2NN6A 2EQ3A 4PRVA 1TN9A 1T39A 4MYUA 4IZJD 4OO1D 2EMYA 3H09A 2C38B 5ADZA 2ZBKB 4M1KA 1KVKA 4DPUA 2FTXB 2JY9A 1XMQI 4M2ZA 5JEAB 4HY1A 1X48A 3H4LA 4NZVA 1A6FA 1UDQA 1EKZA 4IZKA 1X49A 5JEAF 2UU9E 4QNKA 4URLA 2V8QB 4ZYGA 2NUEA 2VQEI 4EMDA 1LLMC 1YYWA 1YHCA 3F0NA 1R6LA 1WHNA 2YRKA 4DR3I 5K36C 4FW9A 4WXDA 4AQYI 3WU4A 2CVEA 2CGEA 2XEXA 2JPAA 4JI1I 4B3TE 1STUA 1ZAAC 4O4KA 3LPSA 3BIDA 5GMDA 4K0KE 1Y4UA 1PJQA 5KL6A 4NXNI 1MG7A 5K36D 1WXRA 5C0XB 2CSHA 3J80Q 2EMXA 2JWOA 2JEBB 2F4VI 2V2VA 2JEAB 3LLHA 1GZ6A 5C0XF 2CPNA 1ZM9A 2V8PA 1XNRI 4F9BB 5IT9C 1ZXMA 2JE6B 2YU8A 4DUZI 2LT7A 2PNZA 2E1MA 4RHBB 4YHHI 1RMDA 2LRSA 2NN6E 3HPZA 2DSYA 1YH8A 2LTRA 3EQ1A 2EM8A 4FK5C 2HGHA 5DNYA 4NXME 4BHBA 1ZR9A 1O0WA 2O3ZA 2EL6A 2YTJA 1E3HA 5JEAC 3ZZUA 2UUBI 2YZTA 3DJWA 1S4EA 4YY3E 1BKNA 2B9DA 4B3MI 4X65E 4IS9A 4IFDB 1T38A 2EPRA 2EPKX 1N0UA 3L7ZA 4QNJA 3U1KA 2A2CA 4IFDF 4IZJA 4DV7E 2UU9I 5F3WA 4HACA 2Q8UA 1A1KA 2UUCE 2YTGA 4OO1A 3QG5C 4DPWA 4LTYA 1I94I 2L8TA 2EM6A 2A25A 3KZZA 2NN6F 1HNWE 3CDJA 1A1GA 4R2EA 4PRXA 2Z5CB 1EI1A 5FWKA 5C0XC 3P3EA 2GPIA 5DROA 2E5LE 4B3TI 4DV3E 2EMAA 1X47A 4R2RA 4K0KI 2BR2A 4DU7A 2YRMA 4R2DA 4P78A 2BM1A 1UILA 1PKPA 1X6EA 2R42A 3P06A 2EN2A 1RHYA 4OZEA 5C0XD 2C39A 4MU4A 2DEJA 1NEIA 2ADRA 5IV8B 3GCMA 4WUDA 2CZ9A 2YT4A 4DR7I 4P7DA 4BC9A 1P47A 3BBGA 4AM3A 2EM5A 2EPLX 1B62A 4MU0A 2EM9A 2EOSA 3BF2A 3M7NG 4F54A 4DV1E 3HKMA 3QT8A 1XHKA 4F9AB 1PJSA 4M0VA 2R1FA 2ODRD 1DGCA 1UDOA 2N3HA 2YTFA 3M6AA 4IFDC 4FWHA 1A1FA 2LBSB 5GMEA 4YY3I 3M85G 2EMZA 4J8ZA 2DLQA 4Q35B 1HR0E 1Z0WA 1ZBTA 3J81C 2LMZA 1HNXE 3PYGA 4OO1E 1FNMA 1Z59A 3HQ1A 2V87A 3MHSC 1T4LB 1FJGE 1NHIA 2BV3A 3K85A 2IESA 1UDSA 2J7KA 3WU6A 1G2DC 4X66E 2G7HA 4LF7E 2EOQA 2NUFA 2NA2A 4LF4E 4R2PA 4Z7YA 1Y4SA 3OTOI 2YRHA 2I13A 5L3JA 2A2DA 2BA1D 2UXCE 4TUIA 2E5LI 2JYAA 2GS8A 4DV3I 1ZU1A 4WX9A 3DF6A 3IWCA 2EM2A 5A6KA 1Z5BA 2L6MA 4WYQB 2VQFE 2WP8A 4IZJB 1Z0EA 4LFAE 2LTSA 3HPSA 4DV0E 4OX9E 1XMQE 1JK2A 1YPNA 4FW6A 2V2ZA 2LE2A 2EM3A 4DV6E 5IXMB 5K36E 2WBTA 2GQ0A 4JI6E 4MLQA 2EMBA 4KWYA 2RPCA 3UK3C 3ZZTA 2IOPA 2BA0G 4DV1I 3P76A 1Z5AA 1NHJA 4LCGA 2EM4A 3VK6A 2YTNA 2UXDE 3CWVA 4DR1E 4FWGA 3QT5A 1EH7A 2LUPB 4BA2A 2GHFA 1BBOA 2HKJA 1Z1BA 1QZRA 3PYEA 4LPFA 5DRRA 2PO2A 1RC7A 4FW4A 3HULA 3C4BA 2C37A 2YTIA 2ZM6E 2YSPA 4LF5E 1HNXI 4F9CB 4DKKA 5A2QQ 2FGGA 1MU5A 1SFEA 4JYAE 2WZOA 2M1SA 4DUYI 4LF8E 1N36E 1ZBQA 4X66I 4LF7I 4DV2E 2HC5A 2K7IA 1VISA 1DI2A 4LF4I 2L3CA 5A6JA 1J26A 2IHR1 4JI0E 2NPFA 4DV4E 1N32E 5A6BD 5DRQA 2UXCI 3J7Yp 5KL3A 2YTPA 3C6KA 2O1WA 2Z5BB 1XMOE 3KWRA 1Y5YA 2HK2A 2B7TA 3JAMQ 2Q2EB 2VQFI 1Z0BA 3V5RA 4LFAI 2BB8A 4MYTA 4OX9I 1NCSA 2PO0B 2EOIA 2F1DA 4LCFA 2HKEA 3LMLA 4R8OA 4X62E 2BM0A 3H1CA 4UTGA 2PRTA 2CG9A 3K17A 4DV5I 4HTGA 3J80C 3GONA 3QT7A 2IERA 3TQMA 2VESA 2JT2A 2L33A 3T1HE 3VYXA 4DR5E 2PNLA 3PRYA 2UXDI 2O1UA 4ZVIA 1Z0VA 2ENAA 2N3GA 2J7JA 1FKAE 3LNUA 5ELWA 2EPOA 5LL6R 4LFBE 1PJTA 2EN8A 5A6AA 1OYRA 2HJJA 2MKDA 4JI7E 2ZM6I 2CTDA 1IBME 4JI3E 4I3HA 2E1RA 3T1YE 2X36A 3M7ND 2L92A 5IT9Q 4JYAI 4B3RE 4LFCE 4RPFA 2EN4A 4LF8I 4USMA 3AUZA 5JEAD 4DV2I 1H7UA 2EJ4A 1R6MA 3EPJA 2EL4A 5FLXQ 4JI0I 3M85D 4DV4I 2EPXA 1Y6ZA 1N32I 2YTDA 2NN6B 2O1VA 3ADGA 4LF9E 1QNTA 2X7IA 1QU6A 1BB8A 2JVAA 5DRPA 2EZ6A 1GTKA 2EL5A 2F8BA 2EOMA 1ZM4A 3P3GA 1XMOI 1YZ9A 1KKHA 2EOFA 2EFGA 4Q28A 5A6BA 1NZ0A 4MLVA 2EE8A 2J65A 4IZKB 3ZZ0A 4IS1C 4PU9A 1VI7A 2O1TA 3KRNA 4ED4A 4JI5E 4X62I 1XNQE 5EL9A 3V2UC 2EN1A 2LJPA 4FW5A 3EPHA 4ISAA 4WSGA 2EN7A 5K36A 3T1HI 1Z0GA 2AJ4A 4DR5I 1AAYA 4XTJA 4AIMA 1USVA 1MEYC 2RS6A 1HK7A 4DU8A 3ZKBA 1WHQA 2D9HA 4HEIA 4DR6E 4JV5E 3DD6A 5LMNE 4NXMI 2PO1A 4O24A 1IMUA 3JU0A 1XXEA 4LFBI 4DR2E 2WCC3 1PVGA 5LLQA 1N0VC 4JI7I 2WNRA 5TSEA 4JI3I 3EPKA 3B8HA 3Q6NA 3F6GA 4BA1A 2M4IA 2MKNA 4B3SE 1K47A 2V85A 2BA0D 3PS3A 4KQVA 4X65I 4B3RI 3Q1QA 4L8NA 4U3DA 1YFHA 4WXCA 5AE2A 1FWKA 2NN6C 4P52A 4DV7I 2EMWA 1YYOA 2PNZB 3CDIA 2WW4A 2EM7A 2UUCI 2V83A 4BHCA 1MGTA 3K6QA 1TF3A 2MC5A 1N3GA 2EMCA 4LF9I 2NN6D 1HNWI 4RH8A 4X64E 5JEAA 2EPPA 2R3VA 3J7AM 3VYYA 3ZKDA 3B78A 3BGHA 1YSAC 2DIXA 1T4OA 3J81Q 3QT6A 3C4TA 3L7ZB 4F2JC 2BBGA 4HACB 4OO1B 4JI5I 2EPUA 1F2IG 5DNLA 1KIJA 2OI2A 4OO1F 1N34E 1YUJA 1MX0A 1Z0TA 2PNMA 5KL5A 4X9JA 1Z0CA 2IOQA 5KL4A 5C0XA 3ZM7A 4ZYHA 4I8OA 2JEBA 2JEAA 4NHRA 1J5EE 4X8WA 4DR6I 1RREA 1EH6A 2M7QA 3ZOQB 2VQEE 2BR2B 4MU1A 4OKGA 4DR2I 3HJCA 1P42A 2JE6A 1D6TA 2EMKA 1TF6A 2C39B 1IBKE 4BS9A 1A1JA 2EPAA 3L00A 4DMIA 5AE3A 1HR0I 4JI1E 3PYFA 2KONA 4B3SI 1PDAA 1Y60A 4DPTA 2EOHA 3WU3A 5K36B 4LCHA 1HNZE 1FJGI 5BR8E 3VHTB 3ADJA 5K36F 2F4VE 3FIGA 2V88A 2RSMA 1B69A 4GKKE 2LO3A 5JEAE 2JOXA 1UDNA 4R1FA 4X64I 1ZM3A 2EMIA 2RQLA 4IFDA 3U1YA 4HYMA 4NBQA 2KOUA 2JR1A 5AC5A 4R2CA 5KL7A 4R2SA 4YHHE 2YSOA 2EOXA 4OO1C 1A1LA 1FI4A 2VRDA 2VF3A 2V2QA 1EA6A 1U2RA 2EOYA 4ZYDA 2EN6A 2DRPA 4LF6E 3PS1A 2B3TB 2UUBE 4FWDA 2Z5CA 4KHPE 2V86A 3EPLA 2EM0A 4DV6I 2MDRA 4DPYA 3B82A 3AV0A 5T6JA 3JAMC 3ADIA 1IQOA 2RSIA 4B3ME 2BA1G 3P3CA 4J3DA 5C0XE 4JI6I 4MQYA 3ECRA 1N34I 1X6HA 4BBYA 3HXLA 4LOMA 4O5GA 2H36X 1J5EI 2L3JA 4R2QA 2EPMX 3LTOA 4L5NC 1I94E 2E72A 4DR1I 2L2KB 1H74A 4FW3A 5KL2A 2WP8B 1IBKI 2HHHE 3MHHC 3GMEA 5AE1A 4Z7CA 4U3BA 4LF5I 1FWLA 1DARA 2YU5A 1UEKA 1HNZI 2DB2A 5BR8I 2M9AA 3THOB 1KTVA 4GKKI 1N36I 5IWAE 4BC7A 1RQ0A 1WRJA 2EP3A 3IWBA 4IFDE 1L4SA 4WSPA 1KJKA 2VF1A 4DR7E 2V89A 4WPYA 2LUQA 2RS7A 4GZNC 1NHHA 4BA2B 2EMHA 1WUUA 1Z5CA 2NABA 4JI8E 5FLXC 2PO2B 3IWDA 4O43A 2YWQA 2C37B 2R76A 2YTEA 1T4NA 3M99B 4LF6I 4JI4E 4KHPI 4F6MA 1PIEA 2DGCA 4BMJA 2WBSA 2EOEA 3Q6MA 1GQEA 2LVHA 1B63A 4P7AA 3T1YI 1DQ3A 2WBUA 2JOBA 4MDTA 2YTOA 3B4TA 1X6FA 1OYSA 4TUGA 4IJDA 2L2NA 2DEIA 2B7VA 2HHHI 1UBDC 2UXBE 4R2AA 3OTOE 2EOZA 2EPCA 5LMUE 1JK1A 2GO4A 4WUCA 4DR4E 2MDGA 1H73A 1N33E 1IBLE 2Z5EA 1IBMI 5CFFE 2HK3A 2V34A 2YTQA 1YUIA 4LFCI 1RR9A 1X3CA 4M30A 4F6NA 3NZKA 2JP9A 5IWAI 2EPZA 1USUA 3GLLA 2FV4B 2N8XA 3THNA 2ODRC 2C38A 3RMPA 4AIDA 2DMIA 2KHXA 4JI8I 2UUAE 2ZITA 2HFSA 2ENCA 2EQ0A 3F6HA 1X5WA 4JI2E 4GKJE 2AE8A 3PYDA 1KYQA 4KZSA 1A1HA 5DNXA 2GLIA 2RTXA 3UHMA 4JI4I 4N3OA 1ZM2A 1G2FC 1YYKA 4ZYEA 3PS2A 2Z5BA 2EORA 3K1JA 1XNQI 4IFDD 3MSWA 2YPNA 3JTZA 2EPNA 4MU3A 2CT1A 2ENHA 1WJPA 4USKA 2PO0A 2EN3A 4DUYE 4WFTA 2MC6A 4HXZA 2ELZA 3WU5A 4R03A 1UHZA 2NUGA 4JV5I 5LMNI 1BBGA 4DPXA 2UXBI 4OOGC 1H7SA 3J7AG 4M9VC 2ELYA 3KZYA 3HTXA 4FW7A 5A69A 1H72C 5LMUI 3C6MA 2HFUA 2LJHA 2EMGA 2LV2A 4DR4I 1IBLI 3OMLA 1N33I 2EMLA 2DLKA 2K4VA 4N4RB 4DR3E 4UT4A 4AQYE
chains in the Genus database with same CATH topology
3P1XA 3ADLA 2DMYA 4NXNE 1ELOA 5AASA 4WUBA 4FN5A 4GEQB 3D4JA 2VE7C 1XNRE 5A2QC 4DV5E 1ZXNA 4JG4A 2UUAI 4BCAA 2L2MA 4LU9A 1S16A 4DXLA 1SR9A 4DUZE 4GKJI 4JI2I 1OJ4A 2EWLA 4PRVA 4MYUA 4M1KA 3H09A 5ADZA 2ZBKB 4DPUA 1KVKA 2FTXB 2JY9A 4M2ZA 4HY1A 1X48A 3H4LA 1A6FA 1EKZA 4IZKA 1X49A 2UU9E 4URLA 2V8QB 2NUEA 2VQEI 4EMDA 1YYWA 3F0NA 1WHNA 4DR3I 4FW9A 4AQYI 3WU4A 4JI1I 2CGEA 2XEXA 4B3TE 1STUA 3LPSA 5GMDA 4K0KE 1Y4UA 4NXNI 1MG7A 1WXRA 3J80Q 2JWOA 2F4VI 2V2VA 3LLHA 1GZ6A 2CPNA 1ZM9A 2V8PA 1XNRI 4F9BB 5IT9C 1ZXMA 4DUZI 2E1MA 4YHHI 2LRSA 3HPZA 2DSYA 2LTRA 4NXME 5DNYA 1O0WA 2UUBI 3ZZUA 2YZTA 3DJWA 1S4EA 4YY3E 1BKNA 2B9DA 4B3MI 4X65E 1N0UA 2A2CA 4IZJA 4DV7E 2UU9I 5F3WA 4HACA 2UUCE 4DPWA 4LTYA 1I94I 2L8TA 1HNWE 4PRXA 2Z5CB 1EI1A 5FWKA 4B3TI 2E5LE 4DV3E 1X47A 4K0KI 4DU7A 4P78A 2BM1A 1UILA 1PKPA 2R42A 3P06A 2DEJA 4WUDA 2CZ9A 2YT4A 4DR7I 4P7DA 4BC9A 1B62A 4F54A 4DV1E 3QT8A 1XHKA 4F9AB 4M0VA 2ODRD 2N3HA 3M6AA 4FWHA 5GMEA 2LBSB 4YY3I 4J8ZA 1HR0E 1Z0WA 1ZBTA 3J81C 2LMZA 1HNXE 3PYGA 1FNMA 1Z59A 3HQ1A 2V87A 1T4LB 1FJGE 1NHIA 2BV3A 3K85A 2J7KA 3WU6A 4X66E 2G7HA 4LF7E 2NUFA 2NA2A 4LF4E 4Z7YA 1Y4SA 3OTOI 5L3JA 2A2DA 2UXCE 4TUIA 2E5LI 4DV3I 2GS8A 3DF6A 3IWCA 1Z5BA 2L6MA 4WYQB 2VQFE 4IZJB 1Z0EA 4LFAE 2LTSA 3HPSA 4DV0E 4OX9E 1XMQE 2V2ZA 2LE2A 4DV6E 2GQ0A 4JI6E 3ZZTA 2IOPA 4DV1I 1Z5AA 1NHJA 3VK6A 2UXDE 3CWVA 4DR1E 4FWGA 3QT5A 2LUPB 2HKJA 1QZRA 3PYEA 1RC7A 3HULA 3C4BA 2ZM6E 4LF5E 1HNXI 4F9CB 4DKKA 5A2QQ 2FGGA 1MU5A 4JYAE 2WZOA 2M1SA 4DUYI 4LF8E 1N36E 1ZBQA 4X66I 4LF7I 4DV2E 1VISA 1DI2A 4LF4I 2L3CA 1J26A 2IHR1 4JI0E 2NPFA 4DV4E 1N32E 2UXCI 3J7Yp 2O1WA 2Z5BB 1XMOE 3KWRA 2HK2A 2B7TA 3JAMQ 2Q2EB 2VQFI 1Z0BA 3V5RA 4LFAI 4MYTA 4OX9I 2HKEA 3LMLA 4R8OA 4X62E 2BM0A 4UTGA 2CG9A 3K17A 4DV5I 3J80C 3GONA 3QT7A 2L33A 3T1HE 3VYXA 4DR5E 2PNLA 3PRYA 2UXDI 2O1UA 4ZVIA 1Z0VA 2N3GA 1FKAE 3LNUA 5LL6R 4LFBE 4JI7E 2ZM6I 1IBME 4JI3E 4I3HA 2E1RA 3T1YE 2X36A 5IT9Q 2L92A 4JYAI 4B3RE 4LFCE 4RPFA 4LF8I 4USMA 3AUZA 4DV2I 1H7UA 5FLXQ 4JI0I 4DV4I 1Y6ZA 1N32I 2O1VA 3ADGA 4LF9E 2X7IA 1QU6A 2JVAA 2EZ6A 2F8BA 1ZM4A 1XMOI 1YZ9A 1KKHA 2EFGA 4Q28A 1NZ0A 4IZKB 3ZZ0A 4ED4A 4PU9A 2O1TA 4X62I 4JI5E 1XNQE 3V2UC 2LJPA 3T1HI 1Z0GA 2AJ4A 4DR5I 4XTJA 1USVA 2RS6A 1HK7A 4DU8A 3ZKBA 1WHQA 4JV5E 4DR6E 5LMNE 4NXMI 3JU0A 4LFBI 4DR2E 1PVGA 1N0VC 4JI7I 4JI3I 3B8HA 3Q6NA 3F6GA 3T1YI 2M4IA 4B3SE 1K47A 2V85A 4X65I 4KQVA 4B3RI 3Q1QA 4L8NA 1FWKA 5AE2A 4P52A 4DV7I 1YYOA 2WW4A 2UUCI 2V83A 3K6QA 2MC5A 4LF9I 1HNWI 4X64E 2R3VA 3J7AM 3VYYA 3ZKDA 3B78A 2DIXA 1T4OA 3J81Q 3QT6A 3C4TA 4HACB 4JI5I 1KIJA 2OI2A 1N34E 1MX0A 1Z0TA 2PNMA 1Z0CA 2IOQA 3ZM7A 4I8OA 1J5EE 4X8WA 4DR6I 1RREA 3ZOQB 2M7QA 2VQEE 4DR2I 3HJCA 1D6TA 1IBKE 4BS9A 5AE3A 4DMIA 4B3SI 1HR0I 4JI1E 3PYFA 2KONA 4DPTA 3WU3A 1HNZE 1FJGI 5BR8E 3ADJA 2F4VE 3FIGA 2V88A 2RSMA 4GKKE 2JOXA 4R1FA 4X64I 1ZM3A 4HYMA 2KOUA 2JR1A 4YHHE 1FI4A 2V2QA 1EA6A 1U2RA 4IZJD 4LF6E 4FWDA 2B3TB 2UUBE 4DV0I 2Z5CA 4KHPE 2V86A 1XMQI 4DV6I 2MDRA 4DPYA 3B82A 3JAMC 3AV0A 5T6JA 3ADIA 1N34I 4B3ME 4JI6I 4BBYA 3HXLA 2H36X 1J5EI 2L3JA 3LTOA 4L5NC 1I94E 4DR1I 2L2KB 1H74A 1IBKI 2HHHE 5AE1A 4Z7CA 4LF5I 1FWLA 1DARA 1UEKA 1HNZI 2DB2A 5BR8I 1KTVA 4GKKI 1N36I 5IWAE 4BC7A 1RQ0A 3IWBA 4WSPA 2VF1A 4DR7E 2V89A 4WPYA 2LUQA 2RS7A 1NHHA 1WUUA 1Z5CA 4JI8E 5FLXC 3IWDA 1T4NA 4LF6I 4JI4E 4KHPI 1PIEA 4BMJA 3Q6MA 1GQEA 1B63A 4P7AA 1DQ3A 2JOBA 4TUGA 2L2NA 2DEIA 2B7VA 2HHHI 2UXBE 3OTOE 5LMUE 4WUCA 4DR4E 1H73A 1N33E 1IBLE 2Z5EA 1IBMI 5CFFE 2HK3A 2V34A 4LFCI 1RR9A 4M30A 5IWAI 1USUA 2FV4B 2ODRC 3RMPA 4JI8I 2KHXA 2UUAE 2ZITA 2HFSA 3F6HA 4GKJE 4JI2E 3PYDA 4KZSA 4JI4I 2RTXA 4N3OA 1ZM2A 2Z5BA 3K1JA 1XNQI 3MSWA 3JTZA 4USKA 4DUYE 4WFTA 2MC6A 4HXZA 3WU5A 4R03A 1UHZA 2NUGA 4JV5I 5LMNI 4DPXA 2UXBI 4OOGC 1H7SA 3J7AG 3HTXA 5LMUI 1H72C 4DR4I 2HFUA 2LJHA 1N33I 1IBLI 3OMLA 2K4VA 4DR3E 2VF3A 1YYKA 4UT4A 4AQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1X A;  3ADL A;  2DMY A;  4NXN E;  1ELO A;  4WUB A;  4FN5 A;  3D4J A;  1XNR E;  5A2Q C;  4DV5 E;  1ZXN A;  4JG4 A;  2UUA I;  2L2M A;  1S16 A;  4DXL A;  4DUZ E;  4GKJ I;  4JI2 I;  1OJ4 A;  4PRV A;  4MYU A;  4M1K A;  2ZBK B;  4DPU A;  1KVK A;  2JY9 A;  4M2Z A;  4HY1 A;  1X48 A;  3H4L A;  1A6F A;  1EKZ A;  1X49 A;  2UU9 E;  4URL A;  2NUE A;  2VQE I;  4EMD A;  1YYW A;  3F0N A;  1WHN A;  4DR3 I;  4FW9 A;  4AQY I;  3WU4 A;  4JI1 I;  2XEX A;  4B3T E;  1STU A;  3LPS A;  5GMD A;  4K0K E;  4NXN I;  1MG7 A;  3J80 Q;  2F4V I;  2V2V A;  3LLH A;  2CPN A;  1ZM9 A;  2V8P A;  1XNR I;  5IT9 C;  1ZXM A;  4DUZ I;  4YHH I;  2LRS A;  2LTR A;  4NXM E;  1O0W A;  2UUB I;  3ZZU A;  1S4E A;  4YY3 E;  1BKN A;  4B3M I;  4X65 E;  1N0U A;  2A2C A;  2UU9 I;  4DV7 E;  4HAC A;  2UUC E;  4DPW A;  1I94 I;  1HNW E;  4PRX A;  1EI1 A;  4B3T I;  2E5L E;  4DV3 E;  1X47 A;  4K0K I;  4DU7 A;  2BM1 A;  1UIL A;  1PKP A;  2R42 A;  2DEJ A;  4WUD A;  2CZ9 A;  2YT4 A;  4DR7 I;  1B62 A;  4DV1 E;  3QT8 A;  1XHK A;  2N3H A;  3M6A A;  4FWH A;  5GME A;  2LBS B;  4YY3 I;  1HR0 E;  1Z0W A;  1ZBT A;  3J81 C;  1HNX E;  3PYG A;  1FNM A;  1Z59 A;  1FJG E;  1T4L B;  1NHI A;  2BV3 A;  2J7K A;  3WU6 A;  4X66 E;  4LF7 E;  2NUF A;  2NA2 A;  4LF4 E;  4Z7Y A;  3OTO I;  5L3J A;  2A2D A;  2UXC E;  2E5L I;  4DV3 I;  2GS8 A;  1Z5B A;  4WYQ B;  2VQF E;  1Z0E A;  4LFA E;  2LTS A;  4DV0 E;  4OX9 E;  1XMQ E;  2V2Z A;  4DV6 E;  4JI6 E;  3ZZT A;  4DV1 I;  1Z5A A;  1NHJ A;  2UXD E;  3CWV A;  4DR1 E;  4FWG A;  3QT5 A;  2LUP B;  2HKJ A;  1QZR A;  3PYE A;  1RC7 A;  3HUL A;  3C4B A;  2ZM6 E;  4LF5 E;  1HNX I;  4DKK A;  5A2Q Q;  1MU5 A;  4JYA E;  4DUY I;  4LF8 E;  1N36 E;  4X66 I;  4LF7 I;  4DV2 E;  1VIS A;  1DI2 A;  4LF4 I;  2L3C A;  1J26 A;  2IHR 1;  4JI0 E;  2NPF A;  4DV4 E;  1N32 E;  2UXC I;  3J7Y p;  1XMO E;  2HK2 A;  2B7T A;  3JAM Q;  2Q2E B;  2VQF I;  1Z0B A;  3V5R A;  4LFA I;  4MYT A;  4OX9 I;  2HKE A;  4X62 E;  4UTG A;  2BM0 A;  3K17 A;  4DV5 I;  3J80 C;  3GON A;  3QT7 A;  2L33 A;  3T1H E;  3VYX A;  4DR5 E;  2UXD I;  4ZVI A;  1Z0V A;  2N3G A;  1FKA E;  3LNU A;  5LL6 R;  4LFB E;  4JI7 E;  2ZM6 I;  1IBM E;  4JI3 E;  4I3H A;  2E1R A;  3T1Y E;  2X36 A;  5IT9 Q;  4JYA I;  4B3R E;  4LFC E;  4RPF A;  4LF8 I;  4USM A;  4DV2 I;  1H7U A;  5FLX Q;  4JI0 I;  4DV4 I;  1N32 I;  3ADG A;  4LF9 E;  2X7I A;  1QU6 A;  2JVA A;  2EZ6 A;  1ZM4 A;  1XMO I;  1YZ9 A;  1KKH A;  2EFG A;  1NZ0 A;  3ZZ0 A;  4ED4 A;  4PU9 A;  4X62 I;  4JI5 E;  1XNQ E;  3V2U C;  2LJP A;  3T1H I;  1Z0G A;  2AJ4 A;  4DR5 I;  4XTJ A;  2RS6 A;  4DU8 A;  3ZKB A;  1WHQ A;  4JV5 E;  4DR6 E;  5LMN E;  4NXM I;  4LFB I;  4DR2 E;  1PVG A;  1N0V C;  4JI7 I;  4JI3 I;  3B8H A;  3T1Y I;  4B3S E;  1K47 A;  4X65 I;  4B3R I;  4KQV A;  3Q1Q A;  1FWK A;  4P52 A;  4DV7 I;  1YYO A;  2WW4 A;  2UUC I;  4LF9 I;  1HNW I;  4X64 E;  2R3V A;  3J7A M;  3VYY A;  3ZKD A;  3B78 A;  2DIX A;  1T4O A;  3J81 Q;  3QT6 A;  3C4T A;  4HAC B;  4JI5 I;  1KIJ A;  2OI2 A;  1N34 E;  1MX0 A;  1Z0T A;  1Z0C A;  3ZM7 A;  1J5E E;  4X8W A;  4DR6 I;  1RRE A;  2VQE E;  4DR2 I;  1D6T A;  1IBK E;  4B3S I;  1HR0 I;  4JI1 E;  3PYF A;  4DPT A;  3WU3 A;  1HNZ E;  1FJG I;  5BR8 E;  3ADJ A;  2F4V E;  2RSM A;  4GKK E;  4R1F A;  4X64 I;  1ZM3 A;  4HYM A;  4YHH E;  1FI4 A;  2V2Q A;  1EA6 A;  1U2R A;  4LF6 E;  4FWD A;  2B3T B;  2UUB E;  4DV0 I;  1XMQ I;  4KHP E;  4DV6 I;  2MDR A;  4DPY A;  3B82 A;  3JAM C;  1N34 I;  3ADI A;  4B3M E;  4JI6 I;  1J5E I;  2L3J A;  3LTO A;  1I94 E;  4DR1 I;  2L2K B;  1H74 A;  1IBK I;  2HHH E;  4Z7C A;  4LF5 I;  1FWL A;  1DAR A;  1UEK A;  1HNZ I;  2DB2 A;  5BR8 I;  1KTV A;  4GKK I;  1N36 I;  5IWA E;  1RQ0 A;  4DR7 E;  2LUQ A;  2RS7 A;  1NHH A;  1WUU A;  1Z5C A;  4JI8 E;  5FLX C;  1T4N A;  4LF6 I;  4JI4 E;  4KHP I;  1PIE A;  1GQE A;  1B63 A;  4P7A A;  2L2N A;  2DEI A;  2B7V A;  2HHH I;  2UXB E;  3OTO E;  5LMU E;  4WUC A;  4DR4 E;  1H73 A;  1N33 E;  1IBL E;  1IBM I;  5CFF E;  2HK3 A;  2V34 A;  4LFC I;  1RR9 A;  4M30 A;  5IWA I;  4JI8 I;  2KHX A;  2UUA E;  2ZIT A;  2HFS A;  4GKJ E;  3PYD A;  4JI2 E;  4JI4 I;  2RTX A;  1ZM2 A;  3K1J A;  1XNQ I;  4USK A;  4DUY E;  4WFT A;  4HXZ A;  3WU5 A;  4JV5 I;  1UHZ A;  2NUG A;  5LMN I;  4DPX A;  2UXB I;  4OOG C;  1H7S A;  5LMU I;  3HTX A;  3J7A G;  1H72 C;  4DR4 I;  2HFU A;  2LJH A;  1N33 I;  1IBL I;  4DR3 E;  2VF3 A;  1YYK A;  4UT4 A;  4AQY E; 
#chains in the Genus database with same CATH topology
 3P1X A;  3ADL A;  5EKW A;  2EOO A;  2LJU A;  2DMY A;  2EQ1 A;  4NXN E;  1ELO A;  2EOJ A;  5AAS A;  4WUB A;  5AC4 A;  1A1I A;  4FN5 A;  2GO3 A;  2EMF A;  1OYP A;  4GEQ B;  2PO1 B;  2I9I A;  1AH5 A;  3D4J A;  2VE7 C;  4GQU A;  1XNR E;  1IQS A;  5A2Q C;  4DV5 E;  2LCE A;  1ZXN A;  4BCA A;  4JG4 A;  2UUA I;  1EH8 A;  2L2M A;  4LU9 A;  1S16 A;  1SR9 A;  2JXP A;  2WNR B;  4DXL A;  4DUZ E;  4DV0 I;  4GKJ I;  4JI2 I;  4BA1 B;  1E3P A;  1OJ4 A;  1UN6 B;  2EWL A;  2NN6 A;  2EQ3 A;  4PRV A;  1TN9 A;  1T39 A;  4MYU A;  4IZJ D;  4OO1 D;  2EMY A;  3H09 A;  2C38 B;  5ADZ A;  2ZBK B;  4M1K A;  1KVK A;  4DPU A;  2FTX B;  2JY9 A;  1XMQ I;  4M2Z A;  5JEA B;  4HY1 A;  1X48 A;  3H4L A;  4NZV A;  1A6F A;  1UDQ A;  1EKZ A;  4IZK A;  1X49 A;  5JEA F;  2UU9 E;  4QNK A;  4URL A;  2V8Q B;  4ZYG A;  2NUE A;  2VQE I;  4EMD A;  1LLM C;  1YYW A;  1YHC A;  3F0N A;  1R6L A;  1WHN A;  2YRK A;  4DR3 I;  5K36 C;  4FW9 A;  4WXD A;  4AQY I;  3WU4 A;  2CVE A;  2CGE A;  2XEX A;  2JPA A;  4JI1 I;  4B3T E;  1STU A;  1ZAA C;  4O4K A;  3LPS A;  3BID A;  5GMD A;  4K0K E;  1Y4U A;  1PJQ A;  5KL6 A;  4NXN I;  1MG7 A;  5K36 D;  1WXR A;  5C0X B;  2CSH A;  3J80 Q;  2EMX A;  2JWO A;  2JEB B;  2F4V I;  2V2V A;  2JEA B;  3LLH A;  1GZ6 A;  5C0X F;  2CPN A;  1ZM9 A;  2V8P A;  1XNR I;  4F9B B;  5IT9 C;  1ZXM A;  2JE6 B;  2YU8 A;  4DUZ I;  2LT7 A;  2PNZ A;  2E1M A;  4RHB B;  4YHH I;  1RMD A;  2LRS A;  2NN6 E;  3HPZ A;  2DSY A;  1YH8 A;  2LTR A;  3EQ1 A;  2EM8 A;  4FK5 C;  2HGH A;  5DNY A;  4NXM E;  4BHB A;  1ZR9 A;  1O0W A;  2O3Z A;  2EL6 A;  2YTJ A;  1E3H A;  5JEA C;  3ZZU A;  2UUB I;  2YZT A;  3DJW A;  1S4E A;  4YY3 E;  1BKN A;  2B9D A;  4B3M I;  4X65 E;  4IS9 A;  4IFD B;  1T38 A;  2EPR A;  2EPK X;  1N0U A;  3L7Z A;  4QNJ A;  3U1K A;  2A2C A;  4IFD F;  4IZJ A;  4DV7 E;  2UU9 I;  5F3W A;  4HAC A;  2Q8U A;  1A1K A;  2UUC E;  2YTG A;  4OO1 A;  3QG5 C;  4DPW A;  4LTY A;  1I94 I;  2L8T A;  2EM6 A;  2A25 A;  3KZZ A;  2NN6 F;  1HNW E;  3CDJ A;  1A1G A;  4R2E A;  4PRX A;  2Z5C B;  1EI1 A;  5FWK A;  5C0X C;  3P3E A;  2GPI A;  5DRO A;  2E5L E;  4B3T I;  4DV3 E;  2EMA A;  1X47 A;  4R2R A;  4K0K I;  2BR2 A;  4DU7 A;  2YRM A;  4R2D A;  4P78 A;  2BM1 A;  1UIL A;  1PKP A;  1X6E A;  2R42 A;  3P06 A;  2EN2 A;  1RHY A;  4OZE A;  5C0X D;  2C39 A;  4MU4 A;  2DEJ A;  1NEI A;  2ADR A;  5IV8 B;  3GCM A;  4WUD A;  2CZ9 A;  2YT4 A;  4DR7 I;  4P7D A;  4BC9 A;  1P47 A;  3BBG A;  4AM3 A;  2EM5 A;  2EPL X;  1B62 A;  4MU0 A;  2EM9 A;  2EOS A;  3BF2 A;  3M7N G;  4F54 A;  4DV1 E;  3HKM A;  3QT8 A;  1XHK A;  4F9A B;  1PJS A;  4M0V A;  2R1F A;  2ODR D;  1DGC A;  1UDO A;  2N3H A;  2YTF A;  3M6A A;  4IFD C;  4FWH A;  1A1F A;  2LBS B;  5GME A;  4YY3 I;  3M85 G;  2EMZ A;  4J8Z A;  2DLQ A;  4Q35 B;  1HR0 E;  1Z0W A;  1ZBT A;  3J81 C;  2LMZ A;  1HNX E;  3PYG A;  4OO1 E;  1FNM A;  1Z59 A;  3HQ1 A;  2V87 A;  3MHS C;  1T4L B;  1FJG E;  1NHI A;  2BV3 A;  3K85 A;  2IES A;  1UDS A;  2J7K A;  3WU6 A;  1G2D C;  4X66 E;  2G7H A;  4LF7 E;  2EOQ A;  2NUF A;  2NA2 A;  4LF4 E;  4R2P A;  4Z7Y A;  1Y4S A;  3OTO I;  2YRH A;  2I13 A;  5L3J A;  2A2D A;  2BA1 D;  2UXC E;  4TUI A;  2E5L I;  2JYA A;  2GS8 A;  4DV3 I;  1ZU1 A;  4WX9 A;  3DF6 A;  3IWC A;  2EM2 A;  5A6K A;  1Z5B A;  2L6M A;  4WYQ B;  2VQF E;  2WP8 A;  4IZJ B;  1Z0E A;  4LFA E;  2LTS A;  3HPS A;  4DV0 E;  4OX9 E;  1XMQ E;  1JK2 A;  1YPN A;  4FW6 A;  2V2Z A;  2LE2 A;  2EM3 A;  4DV6 E;  5IXM B;  5K36 E;  2WBT A;  2GQ0 A;  4JI6 E;  4MLQ A;  2EMB A;  4KWY A;  2RPC A;  3UK3 C;  3ZZT A;  2IOP A;  2BA0 G;  4DV1 I;  3P76 A;  1Z5A A;  1NHJ A;  4LCG A;  2EM4 A;  3VK6 A;  2YTN A;  2UXD E;  3CWV A;  4DR1 E;  4FWG A;  3QT5 A;  1EH7 A;  2LUP B;  4BA2 A;  2GHF A;  1BBO A;  2HKJ A;  1Z1B A;  1QZR A;  3PYE A;  4LPF A;  5DRR A;  2PO2 A;  1RC7 A;  4FW4 A;  3HUL A;  3C4B A;  2C37 A;  2YTI A;  2ZM6 E;  2YSP A;  4LF5 E;  1HNX I;  4F9C B;  4DKK A;  5A2Q Q;  2FGG A;  1MU5 A;  1SFE A;  4JYA E;  2WZO A;  2M1S A;  4DUY I;  4LF8 E;  1N36 E;  1ZBQ A;  4X66 I;  4LF7 I;  4DV2 E;  2HC5 A;  2K7I A;  1VIS A;  1DI2 A;  4LF4 I;  2L3C A;  5A6J A;  1J26 A;  2IHR 1;  4JI0 E;  2NPF A;  4DV4 E;  1N32 E;  5A6B D;  5DRQ A;  2UXC I;  3J7Y p;  5KL3 A;  2YTP A;  3C6K A;  2O1W A;  2Z5B B;  1XMO E;  3KWR A;  1Y5Y A;  2HK2 A;  2B7T A;  3JAM Q;  2Q2E B;  2VQF I;  1Z0B A;  3V5R A;  4LFA I;  2BB8 A;  4MYT A;  4OX9 I;  1NCS A;  2PO0 B;  2EOI A;  2F1D A;  4LCF A;  2HKE A;  3LML A;  4R8O A;  4X62 E;  2BM0 A;  3H1C A;  4UTG A;  2PRT A;  2CG9 A;  3K17 A;  4DV5 I;  4HTG A;  3J80 C;  3GON A;  3QT7 A;  2IER A;  3TQM A;  2VES A;  2JT2 A;  2L33 A;  3T1H E;  3VYX A;  4DR5 E;  2PNL A;  3PRY A;  2UXD I;  2O1U A;  4ZVI A;  1Z0V A;  2ENA A;  2N3G A;  2J7J A;  1FKA E;  3LNU A;  5ELW A;  2EPO A;  5LL6 R;  4LFB E;  1PJT A;  2EN8 A;  5A6A A;  1OYR A;  2HJJ A;  2MKD A;  4JI7 E;  2ZM6 I;  2CTD A;  1IBM E;  4JI3 E;  4I3H A;  2E1R A;  3T1Y E;  2X36 A;  3M7N D;  2L92 A;  5IT9 Q;  4JYA I;  4B3R E;  4LFC E;  4RPF A;  2EN4 A;  4LF8 I;  4USM A;  3AUZ A;  5JEA D;  4DV2 I;  1H7U A;  2EJ4 A;  1R6M A;  3EPJ A;  2EL4 A;  5FLX Q;  4JI0 I;  3M85 D;  4DV4 I;  2EPX A;  1Y6Z A;  1N32 I;  2YTD A;  2NN6 B;  2O1V A;  3ADG A;  4LF9 E;  1QNT A;  2X7I A;  1QU6 A;  1BB8 A;  2JVA A;  5DRP A;  2EZ6 A;  1GTK A;  2EL5 A;  2F8B A;  2EOM A;  1ZM4 A;  3P3G A;  1XMO I;  1YZ9 A;  1KKH A;  2EOF A;  2EFG A;  4Q28 A;  5A6B A;  1NZ0 A;  4MLV A;  2EE8 A;  2J65 A;  4IZK B;  3ZZ0 A;  4IS1 C;  4PU9 A;  1VI7 A;  2O1T A;  3KRN A;  4ED4 A;  4JI5 E;  4X62 I;  1XNQ E;  5EL9 A;  3V2U C;  2EN1 A;  2LJP A;  4FW5 A;  3EPH A;  4ISA A;  4WSG A;  2EN7 A;  5K36 A;  3T1H I;  1Z0G A;  2AJ4 A;  4DR5 I;  1AAY A;  4XTJ A;  4AIM A;  1USV A;  1MEY C;  2RS6 A;  1HK7 A;  4DU8 A;  3ZKB A;  1WHQ A;  2D9H A;  4HEI A;  4DR6 E;  4JV5 E;  3DD6 A;  5LMN E;  4NXM I;  2PO1 A;  4O24 A;  1IMU A;  3JU0 A;  1XXE A;  4LFB I;  4DR2 E;  2WCC 3;  1PVG A;  5LLQ A;  1N0V C;  4JI7 I;  2WNR A;  5TSE A;  4JI3 I;  3EPK A;  3B8H A;  3Q6N A;  3F6G A;  4BA1 A;  2M4I A;  2MKN A;  4B3S E;  1K47 A;  2V85 A;  2BA0 D;  3PS3 A;  4KQV A;  4X65 I;  4B3R I;  3Q1Q A;  4L8N A;  4U3D A;  1YFH A;  4WXC A;  5AE2 A;  1FWK A;  2NN6 C;  4P52 A;  4DV7 I;  2EMW A;  1YYO A;  2PNZ B;  3CDI A;  2WW4 A;  2EM7 A;  2UUC I;  2V83 A;  4BHC A;  1MGT A;  3K6Q A;  1TF3 A;  2MC5 A;  1N3G A;  2EMC A;  4LF9 I;  2NN6 D;  1HNW I;  4RH8 A;  4X64 E;  5JEA A;  2EPP A;  2R3V A;  3J7A M;  3VYY A;  3ZKD A;  3B78 A;  3BGH A;  1YSA C;  2DIX A;  1T4O A;  3J81 Q;  3QT6 A;  3C4T A;  3L7Z B;  4F2J C;  2BBG A;  4HAC B;  4OO1 B;  4JI5 I;  2EPU A;  1F2I G;  5DNL A;  1KIJ A;  2OI2 A;  4OO1 F;  1N34 E;  1YUJ A;  1MX0 A;  1Z0T A;  2PNM A;  5KL5 A;  4X9J A;  1Z0C A;  2IOQ A;  5KL4 A;  5C0X A;  3ZM7 A;  4ZYH A;  4I8O A;  2JEB A;  2JEA A;  4NHR A;  1J5E E;  4X8W A;  4DR6 I;  1RRE A;  1EH6 A;  2M7Q A;  3ZOQ B;  2VQE E;  2BR2 B;  4MU1 A;  4OKG A;  4DR2 I;  3HJC A;  1P42 A;  2JE6 A;  1D6T A;  2EMK A;  1TF6 A;  2C39 B;  1IBK E;  4BS9 A;  1A1J A;  2EPA A;  3L00 A;  4DMI A;  5AE3 A;  1HR0 I;  4JI1 E;  3PYF A;  2KON A;  4B3S I;  1PDA A;  1Y60 A;  4DPT A;  2EOH A;  3WU3 A;  5K36 B;  4LCH A;  1HNZ E;  1FJG I;  5BR8 E;  3VHT B;  3ADJ A;  5K36 F;  2F4V E;  3FIG A;  2V88 A;  2RSM A;  1B69 A;  4GKK E;  2LO3 A;  5JEA E;  2JOX A;  1UDN A;  4R1F A;  4X64 I;  1ZM3 A;  2EMI A;  2RQL A;  4IFD A;  3U1Y A;  4HYM A;  4NBQ A;  2KOU A;  2JR1 A;  5AC5 A;  4R2C A;  5KL7 A;  4R2S A;  4YHH E;  2YSO A;  2EOX A;  4OO1 C;  1A1L A;  1FI4 A;  2VRD A;  2VF3 A;  2V2Q A;  1EA6 A;  1U2R A;  2EOY A;  4ZYD A;  2EN6 A;  2DRP A;  4LF6 E;  3PS1 A;  2B3T B;  2UUB E;  4FWD A;  2Z5C A;  4KHP E;  2V86 A;  3EPL A;  2EM0 A;  4DV6 I;  2MDR A;  4DPY A;  3B82 A;  3AV0 A;  5T6J A;  3JAM C;  3ADI A;  1IQO A;  2RSI A;  4B3M E;  2BA1 G;  3P3C A;  4J3D A;  5C0X E;  4JI6 I;  4MQY A;  3ECR A;  1N34 I;  1X6H A;  4BBY A;  3HXL A;  4LOM A;  4O5G A;  2H36 X;  1J5E I;  2L3J A;  4R2Q A;  2EPM X;  3LTO A;  4L5N C;  1I94 E;  2E72 A;  4DR1 I;  2L2K B;  1H74 A;  4FW3 A;  5KL2 A;  2WP8 B;  1IBK I;  2HHH E;  3MHH C;  3GME A;  5AE1 A;  4Z7C A;  4U3B A;  4LF5 I;  1FWL A;  1DAR A;  2YU5 A;  1UEK A;  1HNZ I;  2DB2 A;  5BR8 I;  2M9A A;  3THO B;  1KTV A;  4GKK I;  1N36 I;  5IWA E;  4BC7 A;  1RQ0 A;  1WRJ A;  2EP3 A;  3IWB A;  4IFD E;  1L4S A;  4WSP A;  1KJK A;  2VF1 A;  4DR7 E;  2V89 A;  4WPY A;  2LUQ A;  2RS7 A;  4GZN C;  1NHH A;  4BA2 B;  2EMH A;  1WUU A;  1Z5C A;  2NAB A;  4JI8 E;  5FLX C;  2PO2 B;  3IWD A;  4O43 A;  2YWQ A;  2C37 B;  2R76 A;  2YTE A;  1T4N A;  3M99 B;  4LF6 I;  4JI4 E;  4KHP I;  4F6M A;  1PIE A;  2DGC A;  4BMJ A;  2WBS A;  2EOE A;  3Q6M A;  1GQE A;  2LVH A;  1B63 A;  4P7A A;  3T1Y I;  1DQ3 A;  2WBU A;  2JOB A;  4MDT A;  2YTO A;  3B4T A;  1X6F A;  1OYS A;  4TUG A;  4IJD A;  2L2N A;  2DEI A;  2B7V A;  2HHH I;  1UBD C;  2UXB E;  4R2A A;  3OTO E;  2EOZ A;  2EPC A;  5LMU E;  1JK1 A;  2GO4 A;  4WUC A;  4DR4 E;  2MDG A;  1H73 A;  1N33 E;  1IBL E;  2Z5E A;  1IBM I;  5CFF E;  2HK3 A;  2V34 A;  2YTQ A;  1YUI A;  4LFC I;  1RR9 A;  1X3C A;  4M30 A;  4F6N A;  3NZK A;  2JP9 A;  5IWA I;  2EPZ A;  1USU A;  3GLL A;  2FV4 B;  2N8X A;  3THN A;  2ODR C;  2C38 A;  3RMP A;  4AID A;  2DMI A;  2KHX A;  4JI8 I;  2UUA E;  2ZIT A;  2HFS A;  2ENC A;  2EQ0 A;  3F6H A;  1X5W A;  4JI2 E;  4GKJ E;  2AE8 A;  3PYD A;  1KYQ A;  4KZS A;  1A1H A;  5DNX A;  2GLI A;  2RTX A;  3UHM A;  4JI4 I;  4N3O A;  1ZM2 A;  1G2F C;  1YYK A;  4ZYE A;  3PS2 A;  2Z5B A;  2EOR A;  3K1J A;  1XNQ I;  4IFD D;  3MSW A;  2YPN A;  3JTZ A;  2EPN A;  4MU3 A;  2CT1 A;  2ENH A;  1WJP A;  4USK A;  2PO0 A;  2EN3 A;  4DUY E;  4WFT A;  2MC6 A;  4HXZ A;  2ELZ A;  3WU5 A;  4R03 A;  1UHZ A;  2NUG A;  4JV5 I;  5LMN I;  1BBG A;  4DPX A;  2UXB I;  4OOG C;  1H7S A;  3J7A G;  4M9V C;  2ELY A;  3KZY A;  3HTX A;  4FW7 A;  5A69 A;  1H72 C;  5LMU I;  3C6M A;  2HFU A;  2LJH A;  2EMG A;  2LV2 A;  4DR4 I;  1IBL I;  3OML A;  1N33 I;  2EML A;  2DLK A;  2K4V A;  4N4R B;  4DR3 E;  4UT4 A;  4AQY E; 
#chains in the Genus database with same CATH homology
 3P1X A;  3ADL A;  2DMY A;  4NXN E;  1ELO A;  5AAS A;  4WUB A;  4FN5 A;  4GEQ B;  3D4J A;  2VE7 C;  1XNR E;  5A2Q C;  4DV5 E;  1ZXN A;  4JG4 A;  2UUA I;  4BCA A;  2L2M A;  4LU9 A;  1S16 A;  4DXL A;  1SR9 A;  4DUZ E;  4GKJ I;  4JI2 I;  1OJ4 A;  2EWL A;  4PRV A;  4MYU A;  4M1K A;  3H09 A;  5ADZ A;  2ZBK B;  4DPU A;  1KVK A;  2FTX B;  2JY9 A;  4M2Z A;  4HY1 A;  1X48 A;  3H4L A;  1A6F A;  1EKZ A;  4IZK A;  1X49 A;  2UU9 E;  4URL A;  2V8Q B;  2NUE A;  2VQE I;  4EMD A;  1YYW A;  3F0N A;  1WHN A;  4DR3 I;  4FW9 A;  4AQY I;  3WU4 A;  4JI1 I;  2CGE A;  2XEX A;  4B3T E;  1STU A;  3LPS A;  5GMD A;  4K0K E;  1Y4U A;  4NXN I;  1MG7 A;  1WXR A;  3J80 Q;  2JWO A;  2F4V I;  2V2V A;  3LLH A;  1GZ6 A;  2CPN A;  1ZM9 A;  2V8P A;  1XNR I;  4F9B B;  5IT9 C;  1ZXM A;  4DUZ I;  2E1M A;  4YHH I;  2LRS A;  3HPZ A;  2DSY A;  2LTR A;  4NXM E;  5DNY A;  1O0W A;  2UUB I;  3ZZU A;  2YZT A;  3DJW A;  1S4E A;  4YY3 E;  1BKN A;  2B9D A;  4B3M I;  4X65 E;  1N0U A;  2A2C A;  4IZJ A;  4DV7 E;  2UU9 I;  5F3W A;  4HAC A;  2UUC E;  4DPW A;  4LTY A;  1I94 I;  2L8T A;  1HNW E;  4PRX A;  2Z5C B;  1EI1 A;  5FWK A;  4B3T I;  2E5L E;  4DV3 E;  1X47 A;  4K0K I;  4DU7 A;  4P78 A;  2BM1 A;  1UIL A;  1PKP A;  2R42 A;  3P06 A;  2DEJ A;  4WUD A;  2CZ9 A;  2YT4 A;  4DR7 I;  4P7D A;  4BC9 A;  1B62 A;  4F54 A;  4DV1 E;  3QT8 A;  1XHK A;  4F9A B;  4M0V A;  2ODR D;  2N3H A;  3M6A A;  4FWH A;  5GME A;  2LBS B;  4YY3 I;  4J8Z A;  1HR0 E;  1Z0W A;  1ZBT A;  3J81 C;  2LMZ A;  1HNX E;  3PYG A;  1FNM A;  1Z59 A;  3HQ1 A;  2V87 A;  1T4L B;  1FJG E;  1NHI A;  2BV3 A;  3K85 A;  2J7K A;  3WU6 A;  4X66 E;  2G7H A;  4LF7 E;  2NUF A;  2NA2 A;  4LF4 E;  4Z7Y A;  1Y4S A;  3OTO I;  5L3J A;  2A2D A;  2UXC E;  4TUI A;  2E5L I;  4DV3 I;  2GS8 A;  3DF6 A;  3IWC A;  1Z5B A;  2L6M A;  4WYQ B;  2VQF E;  4IZJ B;  1Z0E A;  4LFA E;  2LTS A;  3HPS A;  4DV0 E;  4OX9 E;  1XMQ E;  2V2Z A;  2LE2 A;  4DV6 E;  2GQ0 A;  4JI6 E;  3ZZT A;  2IOP A;  4DV1 I;  1Z5A A;  1NHJ A;  3VK6 A;  2UXD E;  3CWV A;  4DR1 E;  4FWG A;  3QT5 A;  2LUP B;  2HKJ A;  1QZR A;  3PYE A;  1RC7 A;  3HUL A;  3C4B A;  2ZM6 E;  4LF5 E;  1HNX I;  4F9C B;  4DKK A;  5A2Q Q;  2FGG A;  1MU5 A;  4JYA E;  2WZO A;  2M1S A;  4DUY I;  4LF8 E;  1N36 E;  1ZBQ A;  4X66 I;  4LF7 I;  4DV2 E;  1VIS A;  1DI2 A;  4LF4 I;  2L3C A;  1J26 A;  2IHR 1;  4JI0 E;  2NPF A;  4DV4 E;  1N32 E;  2UXC I;  3J7Y p;  2O1W A;  2Z5B B;  1XMO E;  3KWR A;  2HK2 A;  2B7T A;  3JAM Q;  2Q2E B;  2VQF I;  1Z0B A;  3V5R A;  4LFA I;  4MYT A;  4OX9 I;  2HKE A;  3LML A;  4R8O A;  4X62 E;  2BM0 A;  4UTG A;  2CG9 A;  3K17 A;  4DV5 I;  3J80 C;  3GON A;  3QT7 A;  2L33 A;  3T1H E;  3VYX A;  4DR5 E;  2PNL A;  3PRY A;  2UXD I;  2O1U A;  4ZVI A;  1Z0V A;  2N3G A;  1FKA E;  3LNU A;  5LL6 R;  4LFB E;  4JI7 E;  2ZM6 I;  1IBM E;  4JI3 E;  4I3H A;  2E1R A;  3T1Y E;  2X36 A;  5IT9 Q;  2L92 A;  4JYA I;  4B3R E;  4LFC E;  4RPF A;  4LF8 I;  4USM A;  3AUZ A;  4DV2 I;  1H7U A;  5FLX Q;  4JI0 I;  4DV4 I;  1Y6Z A;  1N32 I;  2O1V A;  3ADG A;  4LF9 E;  2X7I A;  1QU6 A;  2JVA A;  2EZ6 A;  2F8B A;  1ZM4 A;  1XMO I;  1YZ9 A;  1KKH A;  2EFG A;  4Q28 A;  1NZ0 A;  4IZK B;  3ZZ0 A;  4ED4 A;  4PU9 A;  2O1T A;  4X62 I;  4JI5 E;  1XNQ E;  3V2U C;  2LJP A;  3T1H I;  1Z0G A;  2AJ4 A;  4DR5 I;  4XTJ A;  1USV A;  2RS6 A;  1HK7 A;  4DU8 A;  3ZKB A;  1WHQ A;  4JV5 E;  4DR6 E;  5LMN E;  4NXM I;  3JU0 A;  4LFB I;  4DR2 E;  1PVG A;  1N0V C;  4JI7 I;  4JI3 I;  3B8H A;  3Q6N A;  3F6G A;  3T1Y I;  2M4I A;  4B3S E;  1K47 A;  2V85 A;  4X65 I;  4KQV A;  4B3R I;  3Q1Q A;  4L8N A;  1FWK A;  5AE2 A;  4P52 A;  4DV7 I;  1YYO A;  2WW4 A;  2UUC I;  2V83 A;  3K6Q A;  2MC5 A;  4LF9 I;  1HNW I;  4X64 E;  2R3V A;  3J7A M;  3VYY A;  3ZKD A;  3B78 A;  2DIX A;  1T4O A;  3J81 Q;  3QT6 A;  3C4T A;  4HAC B;  4JI5 I;  1KIJ A;  2OI2 A;  1N34 E;  1MX0 A;  1Z0T A;  2PNM A;  1Z0C A;  2IOQ A;  3ZM7 A;  4I8O A;  1J5E E;  4X8W A;  4DR6 I;  1RRE A;  3ZOQ B;  2M7Q A;  2VQE E;  4DR2 I;  3HJC A;  1D6T A;  1IBK E;  4BS9 A;  5AE3 A;  4DMI A;  4B3S I;  1HR0 I;  4JI1 E;  3PYF A;  2KON A;  4DPT A;  3WU3 A;  1HNZ E;  1FJG I;  5BR8 E;  3ADJ A;  2F4V E;  3FIG A;  2V88 A;  2RSM A;  4GKK E;  2JOX A;  4R1F A;  4X64 I;  1ZM3 A;  4HYM A;  2KOU A;  2JR1 A;  4YHH E;  1FI4 A;  2V2Q A;  1EA6 A;  1U2R A;  4IZJ D;  4LF6 E;  4FWD A;  2B3T B;  2UUB E;  4DV0 I;  2Z5C A;  4KHP E;  2V86 A;  1XMQ I;  4DV6 I;  2MDR A;  4DPY A;  3B82 A;  3JAM C;  3AV0 A;  5T6J A;  3ADI A;  1N34 I;  4B3M E;  4JI6 I;  4BBY A;  3HXL A;  2H36 X;  1J5E I;  2L3J A;  3LTO A;  4L5N C;  1I94 E;  4DR1 I;  2L2K B;  1H74 A;  1IBK I;  2HHH E;  5AE1 A;  4Z7C A;  4LF5 I;  1FWL A;  1DAR A;  1UEK A;  1HNZ I;  2DB2 A;  5BR8 I;  1KTV A;  4GKK I;  1N36 I;  5IWA E;  4BC7 A;  1RQ0 A;  3IWB A;  4WSP A;  2VF1 A;  4DR7 E;  2V89 A;  4WPY A;  2LUQ A;  2RS7 A;  1NHH A;  1WUU A;  1Z5C A;  4JI8 E;  5FLX C;  3IWD A;  1T4N A;  4LF6 I;  4JI4 E;  4KHP I;  1PIE A;  4BMJ A;  3Q6M A;  1GQE A;  1B63 A;  4P7A A;  1DQ3 A;  2JOB A;  4TUG A;  2L2N A;  2DEI A;  2B7V A;  2HHH I;  2UXB E;  3OTO E;  5LMU E;  4WUC A;  4DR4 E;  1H73 A;  1N33 E;  1IBL E;  2Z5E A;  1IBM I;  5CFF E;  2HK3 A;  2V34 A;  4LFC I;  1RR9 A;  4M30 A;  5IWA I;  1USU A;  2FV4 B;  2ODR C;  3RMP A;  4JI8 I;  2KHX A;  2UUA E;  2ZIT A;  2HFS A;  3F6H A;  4GKJ E;  4JI2 E;  3PYD A;  4KZS A;  4JI4 I;  2RTX A;  4N3O A;  1ZM2 A;  2Z5B A;  3K1J A;  1XNQ I;  3MSW A;  3JTZ A;  4USK A;  4DUY E;  4WFT A;  2MC6 A;  4HXZ A;  3WU5 A;  4R03 A;  1UHZ A;  2NUG A;  4JV5 I;  5LMN I;  4DPX A;  2UXB I;  4OOG C;  1H7S A;  3J7A G;  3HTX A;  5LMU I;  1H72 C;  4DR4 I;  2HFU A;  2LJH A;  1N33 I;  1IBL I;  3OML A;  2K4V A;  4DR3 E;  2VF3 A;  1YYK A;  4UT4 A;  4AQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...