1HNXE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnxE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnxE02
1IBMI 2KHXA 2LJPA 3JAMQ 2NA2A 3V2UC 5IWAI 3T1YE 4YHHE 4JYAI 4DR2I 4JI8E 1IBKI 2R42A 4JI3E 1PKPA 2DB2A 2UUAE 2XEXA 1NZ0A 4GKKE 1PIEA 2MDRA 1Z5AA 3OTOE 4HY1A 1FKAE 4YY3I 4JG4A 4LF4E 3QT8A 1B62A 3ZZTA 4DUYE 1FI4A 3B78A 3D4JA 3WU6A 3P1XA 4I3HA 4DV6E 4B3RE 2EZ6A 1N32E 4PRXA 2N3GA 2UU9I 4JV5E 4JI6E 4DV1E 3JAMC 3ZZUA 4JI7I 4DPTA 4GKJI 4FWHA 1N0VC 3VYYA 1J26A 4ZVIA 3ZKDA 4DV7I 4B3SE 4JI4I 2VQEE 4DV0I 2VQFI 1NHHA 4DR3I 2HKEA 4LFCE 1DI2A 1D6TA 3H4LA 4DR5E 3K17A 4ED4A 3J80Q 4JI5I 4NXMI 5LMUE 1HNZI 4LFAI 1A6FA 3J81C 1H7SA 1J5EI 1XNRE 3QT7A 1N33I 2HK3A 4DPYA 4Z7CA 2NUEA 1MU5A 2E5LI 4K0KI 5A2QQ 4LF5E 1N36I 2A2DA 4DV4I 3B8HA 2RTXA 1HR0I 4DR7I 4DU8A 4P52A 1ZXMA 3J7AG 3ADGA 4JI1E 4LF7I 2F4VI 4URLA 4X64E 4X65E 1Z0TA 2DEIA 2LUQA 4DV2E 4WYQB 1KTVA 4LF8I 1K47A 4DR6I 1N34E 1VISA 2UXDE 1YYKA 4DR1I 5LMNI 1XMQE 2DEJA 2N3HA 1Z0VA 4FW9A 1MX0A 1XNQE 4FWDA 5GMDA 4AQYI 1STUA 4DR4E 2ZBKB 2A2CA 3PYDA 1NHIA 4DV3I 4DV5I 1Z0BA 2UXBI 1RREA 2L2KB 5A2QC 1HNXE 4X62I 3VYXA 1B63A 1DARA 1KKHA 4JI0E 4B3MI 2AJ4A 2UUCE 4KHPI 1I94E 5BR8E 3ZKBA 1IBLI 5CFFE 4NXNI 2LTRA 4LF9E 1XHKA 3ZM7A 2ZM6E 4DUZE 2UUBI 4LFBI 1EKZA 3J81Q 5IT9C 1NHJA 4X66I 4WUBA 3J7Yp 4M1KA 4OX9I 1H7UA 3WU3A 3T1HI 3ZZ0A 4WUDA 5LL6R 4UTGA 2NPFA 2UXCI 1Z0GA 1N0UA 4FWGA 1UILA 4HXZA 1XMOE 2HKJA 1HNWI 5L3JA 3WU4A 1BKNA 1IBME 2B7VA 4B3TI 2HHHI 3C4TA 2B3TB 5IWAE 2JY9A 1ELOA 1QZRA 4JYAE 4JI2I 1EA6A 2DIXA 4DR2E 1IBKE 3V5RA 4LF6E 4DPXA 2HFUA 2Q2EB 2L2NA 1RQ0A 2YT4A 3M6AA 4XTJA 3CWVA 1PVGA 1QU6A 1FJGI 2IHR1 4WUCA 2JVAA 1YZ9A 2L3JA 3LTOA 4YY3E 2X7IA 2RSMA 2VF3A 2EFGA 5GMEA 3T1YI 4YHHI 1ZM4A 3PYFA 1I94I 4JI8I 4USMA 3GONA 4HACB 4JI3I 2UUAI 3B82A 3PYEA 2UU9E 1MG7A 4GKKI 4JI7E 1GQEA 2ZM6I 5IT9Q 3C4BA 3OTOI 4X8WA 4P7AA 4GKJE 1X49A 4LF4I 4DV7E 2J7KA 4JI4E 4DUYI 4DV0E 2VQFE 4DR3E 1Z5BA 1YYWA 1S16A 4M2ZA 4DV6I 4B3RI 1N32I 4UT4A 4JV5I 1EI1A 2V2ZA 4JI5E 4JI6I 2LUPB 4NXME 4DV1I 2R3VA 1HNZE 4LFAE 1KIJA 3ADLA 2CZ9A 3LNUA 1X48A 2V34A 1J5EE 1ZBTA 1N33E 4WFTA 1Z59A 2E5LE 4K0KE 1Z0EA 5FLXC 4B3SI 1N36E 2X36A 2VQEI 2CPNA 4HACA 1OJ4A 4DKKA 4LFCI 4DR5I 1HR0E 4DR7E 4PU9A 3LLHA 2L2MA 4LF7E 2F4VE 3PYGA 5LMUI 2DMYA 4PRVA 1UHZA 1FWLA 3WU5A 4LF6I 2LRSA 2V2QA 4Z7YA 1XNRI 4HYMA 2BM1A 4LF8E 3HTXA 4DR6E 4LF5I 1UEKA 4MYTA 4DR1E 4OOGC 1WUUA 5LMNE 4EMDA 4JI1I 4AQYE 2OI2A 4DV5E 1H73A 4DV3E 4X64I 4X65I 1X47A 2UXBE 3K1JA 4M30A 2B7TA 4X62E 4DV2I 2GS8A 1T4OA 1Z0WA 1N34I 2UXDI 4B3ME 1ZM9A 4KHPE 1XMQI 1IBLE 4NXNE 3F0NA 4USKA 4RPFA 1XNQI 2NUFA 3QT6A 4DU7A 4DR4I 1T4LB 2BV3A 2UUBE 4LFBE 3J7AM 1S4EA 1HNXI 1Z5CA 1U2RA 4X66E 2L3CA 4DPWA 4OX9E 1WHNA 1ZM2A 4JI0I 2UUCI 4R1FA 3T1HE 1RR9A 2V8PA 2V2VA 1FNMA 1O0WA 5FLXQ 5BR8I 3Q1QA 2UXCE 4LF9I 1T4NA 2NUGA 4DXLA 4DUZI 2WW4A 1HNWE 1RC7A 2BM0A 3QT5A 1Z0CA 3ADJA 4KQVA 2L33A 3HULA 4B3TE 2HK2A 2E1RA 2HHHE 2LTSA 2RS6A 4FN5A 1WHQA 3J80C 4MYUA 4JI2E 1ZM3A 2LJHA 3ADIA 2ZITA 1ZXNA 1H74A 1H72C 1XMOI 3LPSA 2HFSA 1KVKA 4DPUA 1YYOA 1FJGE 2LBSB 1FWKA 2RS7A 4DV4E
chains in the Genus database with same CATH superfamily
1IBMI 2KHXA 4RH8A 2LJPA 2NA2A 5DRQA 3JAMQ 1USVA 2L6MA 3V2UC 2PO1B 5IWAI 4O43A 2BR2A 2NN6C 3JU0A 3T1YE 4L8NA 4YHHE 4JYAI 4HTGA 4DR2I 4JI8E 3FIGA 2CGEA 1IBKI 1TF3A 4MLVA 2J65A 2R42A 4JI3E 4MQYA 1PKPA 2DSYA 2DB2A 2EOSA 3EPJA 5ADZA 1A1LA 2YTFA 1KYQA 1AAYA 2UUAE 2XEXA 4IZJB 1NZ0A 2EPOA 4R2PA 4F54A 1YUIA 4ZYEA 4GKKE 1PIEA 4FW3A 2MDRA 4U3BA 1Z5AA 2NN6F 3P3GA 2DLKA 3OTOE 4HY1A 1FKAE 2WCC3 4YY3I 2MC6A 4JG4A 4OO1D 4LF4E 5KL6A 3QT8A 1B62A 3ZZTA 2RSIA 1TF6A 4DUYE 1PJSA 1FI4A 3B78A 2LVHA 1X6HA 2EMYA 5AE3A 1T39A 3D4JA 3WU6A 2RQLA 3P1XA 4I3HA 1OYSA 2EMBA 4DV6E 2EZ6A 4B3RE 3AUZA 1N32E 1RHYA 4PRXA 1WRJA 2J7JA 2YTDA 2N3GA 2UU9I 5A69A 4JV5E 3EPLA 4JI6E 4DV1E 3JAMC 4J3DA 3H09A 3ZZUA 2EN8A 2EOFA 4JI7I 1PDAA 3THOB 2YTOA 2YRHA 4IZKA 4DPTA 2F8BA 2JXPA 1WXRA 4GKJI 4FWHA 1N0VC 2EOZA 3VYYA 4R2SA 1J26A 4ZVIA 2AE8A 3ZKDA 2JE6B 4DV7I 4B3SE 4JI4I 2C37B 2VQEE 4DV0I 4WPYA 2VQFI 5A6BA 1NHHA 4DR3I 5K36B 2HKEA 4LFCE 1A1FA 1DI2A 4IZJA 1WJPA 3F6GA 3THNA 4DR5E 3H4LA 1D6TA 4LCFA 2EPLX 3K17A 4ED4A 3J80Q 2YSOA 4OO1E 4JI5I 3NZKA 5TSEA 4OO1B 3IWBA 4NXMI 2ODRD 1A1IA 5LMUE 1HNZI 4MU3A 1A6FA 5KL4A 1YHCA 3J81C 2O1UA 4LFAI 5JEAD 4WX9A 1H7SA 2B9DA 5C0XB 3HXLA 1J5EI 1XNRE 3QT7A 1N33I 2HK3A 4DPYA 4MDTA 4Z7CA 2EOEA 2NUEA 4WSPA 3HJCA 2PRTA 1MU5A 2E5LI 4K0KI 5A2QQ 1Y4SA 4LF5E 1N36I 3MHSC 4IFDB 2A2DA 4DV4I 3B8HA 4NHRA 1T38A 2RTXA 1HR0I 1GTKA 4FW7A 4DR7I 2E1MA 5DNYA 4DU8A 4AIMA 4X9JA 4P52A 3M85D 1ZXMA 2EM4A 2EQ0A 3J7AG 3ADGA 4JI1E 4LF7I 2F4VI 4WXDA 1P42A 4B3SI 4URLA 2VF1A 2EPPA 4X64E 4HEIA 2DGCA 5AC5A 1B69A 4X65E 2L8TA 3ZOQB 5F3WA 1Z0TA 2JE6A 3UHMA 2DEIA 2EM5A 2C37A 3HPSA 2LUQA 5EL9A 4DV2E 4WYQB 1KTVA 2WNRA 2C39B 2GQ0A 4LF8I 2EOXA 1K47A 4MU0A 4DR6I 4MU4A 1A1HA 2IOQA 1N34E 1VISA 3K85A 2CG9A 2UXDE 5JEAE 2V83A 1EH8A 2YPNA 1YYKA 4DR1I 2M9AA 5KL7A 5LMNI 1XMQE 2DEJA 2N3HA 1PJQA 1Z0VA 4FW9A 1MX0A 1XNQE 3KRNA 4FWDA 1BB8A 5GMDA 2EOMA 5C0XA 2Z5BA 1UDSA 4AQYI 2YSPA 1STUA 4BHCA 2JP9A 4DR4E 2ZBKB 2CTDA 1ZU1A 2A2CA 1NHIA 3PYDA 4DV3I 1Z0BA 4OZEA 4DV5I 3L7ZB 2UXBI 3ECRA 2L2KB 5A2QC 1RREA 2EN7A 4ISAA 1HNXE 4X62I 2DRPA 2EPKX 3Q6MA 4FW4A 2HGHA 3VYXA 2EOQA 5A6KA 1B63A 3AV0A 1DARA 1Z1BA 4J8ZA 4ZYGA 5IV8B 1KKHA 2WBUA 2YZTA 4JI0E 4B3MI 2AJ4A 2UUCE 1N3GA 4KHPI 2EM7A 1I94E 5BR8E 3ZKBA 1IBLI 2EJ4A 2ELZA 5CFFE 3B4TA 4NXNI 2O3ZA 3Q6NA 2LTRA 4R2AA 2EMAA 3DJWA 4LF9E 4LCHA 2EM9A 5C0XC 4R2CA 4AM3A 5K36F 2ELYA 1XHKA 3ZM7A 4M9VC 1A1GA 2C39A 2ZM6E 2IERA 4DUZE 2UUBI 2LO3A 4LFBI 2EE8A 3EPHA 4IS1C 1EKZA 5IT9C 4R2EA 1YSAC 2EPZA 3J81Q 2YRKA 1NHJA 4X66I 3F6HA 4IS9A 3J7Yp 4M1KA 3PS3A 2ADRA 4WUBA 4OX9I 1H7UA 3EPKA 4I8OA 1L4SA 4BHBA 4KZSA 5C0XF 3WU3A 4F9AB 1MEYC 5EKWA 3T1HI 4P7DA 5A6BD 4KWYA 3ZZ0A 4WUDA 4IZJD 5LL6R 2EP3A 4UTGA 2NPFA 1Y5YA 2EPRA 2UXCI 2VRDA 1Z0GA 4IFDF 1N0UA 3L7ZA 4U3DA 5DRRA 2G7HA 4FWGA 2EOIA 2EPUA 2H36X 3GMEA 2EM3A 1UILA 4HXZA 2MDGA 4R2QA 1YPNA 2PNZB 2WP8B 4N4RB 4BS9A 1XMOE 2HKJA 2PO1A 1HNWI 3KWRA 2EM2A 5L3JA 2JT2A 3MHHC 3WU4A 3JTZA 2LJUA 1BKNA 1GZ6A 3HPZA 1IBME 2PO2B 2B7VA 4B3TI 2HHHI 3C4TA 4F6MA 3EQ1A 4GEQB 1AH5A 2GHFA 2B3TB 5IWAE 2JY9A 1ELOA 1QZRA 2F1DA 4JYAE 2IESA 4JI2I 2YWQA 3U1YA 1EA6A 2DIXA 1X6EA 4DR2E 1IBKE 3KZYA 3V5RA 2ENAA 3L00A 4LF6E 4DPXA 2K4VA 2ENHA 2ENCA 4DMIA 2HFUA 2Q2EB 2A25A 2L2NA 2MC5A 4GQUA 1RQ0A 2YT4A 2WBSA 3M6AA 2KOUA 3CWVA 1PVGA 1QU6A 4XTJA 5AASA 2IHR1 1FJGI 4WUCA 2JVAA 3BF2A 1BBOA 2NN6D 3M7NG 1YZ9A 2IOPA 5K36C 2L3JA 3LTOA 3P3CA 2EPNA 4YY3E 2RSMA 1UDNA 2X7IA 2VF3A 4ZYHA 2EFGA 4BCAA 2JOXA 2BA1G 2EMGA 3UK3C 2KONA 5GMEA 4FW5A 3CDIA 2I13A 2PNZA 1ZBQA 2BBGA 2WP8A 4YHHI 1ZM4A 3PYFA 3T1YI 5A6JA 1I94I 4JI8I 1NEIA 4USMA 3GONA 2EM8A 4HACB 2JOBA 4JI3I 2EQ1A 1Y4UA 2EMLA 1F2IG 5FWKA 2GO4A 4NBQA 2UUAI 3B82A 3PYEA 2UU9E 1MG7A 4GKKI 2YU5A 5K36A 2PO2A 3GLLA 4AIDA 4JI7E 3DD6A 1RMDA 1GQEA 2BR2B 2PNLA 2EOYA 2ZM6I 5IT9Q 3C4BA 3C6MA 3OTOI 4X8WA 4P7AA 4GKJE 1X49A 4O4KA 4N3OA 2WBTA 4OO1F 1MGTA 4LF4I 2EN1A 2EQ3A 2JR1A 4DV7E 2VE7C 4ZYDA 1EH6A 4JI4E 2J7KA 1IQOA 4DUYI 3LMLA 4DV0E 2EMHA 2VQFE 4DR3E 2EORA 1G2DC 1Z5BA 1P47A 1YYWA 1OYPA 2LE2A 3K6QA 4WXCA 2EPXA 2Z5EA 2NN6E 2JEAB 1BBGA 4BA1B 2YRMA 4M2ZA 1S16A 4DV6I 4B3RI 1N32I 4Q35B 2DLQA 2GO3A 2Q8UA 4UT4A 1EI1A 2EN4A 4IJDA 2V2ZA 4JI5E 2M7QA 4JI6I 4IFDA 3M99B 2LUPB 2LV2A 4NXME 2R3VA 2Z5CB 4DV1I 3OMLA 1HNZE 4LFAE 1KIJA 3ADLA 2V85A 2CZ9A 3LNUA 1X48A 4JV5I 2N8XA 2V34A 1J5EE 2K7IA 1ZBTA 4TUGA 2ODRC 4WFTA 2GLIA 1N33E 4F9CB 2MKNA 4MU1A 4BBYA 4BMJA 2CSHA 1Z59A 2E5LE 4K0KE 1Z0EA 3BIDA 4L5NC 5FLXC 1N36E 2EL6A 1IQSA 3HQ1A 2X36A 4NZVA 2CPNA 4HACA 4MLQA 4LU9A 4QNJA 1OJ4A 4DKKA 4TUIA 1OYRA 4LFCI 1ZAAC 4OKGA 4DR5I 1HR0E 2YTPA 4DR7E 4IZKB 4PU9A 3VK6A 1YUJA 3CDJA 3P06A 5AC4A 4IFDC 1SR9A 2V86A 3LLHA 4BC9A 1TN9A 2GPIA 2JPAA 2L2MA 1ZR9A 4LF7E 2EMFA 2F4VE 4Q28A 4BC7A 3PYGA 2LCEA 5DNXA 5LMUI 2DMYA 4LOMA 4LPFA 4PRVA 5JEAF 1UHZA 1FWLA 3WU5A 4LF6I 2LRSA 2V2QA 1Y6ZA 4Z7YA 4LCGA 1USUA 1XNRI 3U1KA 5KL3A 2M4IA 4HYMA 2BM1A 2O1WA 1UBDC 5AE2A 4LF8E 3HTXA 5DRPA 4DR6E 2EOHA 1UEKA 4LF5I 4MYTA 2JEAA 4BA1A 2EL4A 1DQ3A 3QG5C 2EMWA 3BGHA 2R1FA 4DR1E 4OOGC 1WUUA 5LMNE 2E72A 2Z5CA 3KZZA 2JEBB 4EMDA 2EPMX 2PO0B 2BB8A 2EMZA 4LTYA 4JI1I 2V87A 1VI7A 4WSGA 2EOOA 2YTIA 4F2JC 4AQYE 2OI2A 2YTGA 4DV5E 1E3HA 4DV3E 1H73A 3IWCA 5DROA 4X64I 1SFEA 2EMIA 2M1SA 4X65I 1X47A 2UXBE 1UDOA 2D9HA 3K1JA 4R2RA 3HKMA 5KL5A 2L92A 2B7TA 4M30A 2YTJA 1X3CA 4X62E 2C38B 2VESA 4DV2I 4F9BB 4BA2B 2HC5A 2EMCA 4O24A 1JK2A 1T4OA 1Z0WA 2BA0G 2GS8A 1N34I 2BA0D 2EM6A 1JK1A 2UXDI 4B3ME 2NABA 2LT7A 1ZM9A 5LLQA 2VQEI 4KHPE 5ELWA 2RPCA 5JEAB 4P78A 1UDQA 4OO1A 2FV4B 5AE1A 1XMQI 5IXMB 1IBLE 2WZOA 4NXNE 3F0NA 4USKA 4RPFA 1XNQI 2NUFA 5A6AA 4FW6A 3QT6A 2V88A 4DU7A 2WNRB 2EL5A 4R03A 4DR4I 2JYAA 2O1TA 1UN6B 5K36D 2JWOA 1T4LB 2CT1A 2EN6A 4GZNC 3MSWA 3BBGA 3TQMA 5KL2A 4R2DA 2UUBE 4LFBE 2BV3A 2NN6B 4R8OA 1S4EA 2EPAA 1HNXI 3J7AM 1QNTA 3M7ND 1Z5CA 3H1CA 1YFHA 2YTQA 2YTEA 1G2FC 4X66E 2L3CA 1U2RA 4FK5C 2YU8A 4DPWA 4OX9E 1WHNA 1XXEA 2HJJA 2BA1D 5T6JA 1LLMC 1IMUA 1ZM2A 4F6NA 1HK7A 4JI0I 5C0XD 2JEBA 2YTNA 2Z5BB 4R1FA 3T1HE 2EM0A 2V89A 1RR9A 2PO0A 2V8PA 2UUCI 4OO1C 2V2VA 3IWDA 3RMPA 1FNMA 1O0WA 5FLXQ 5BR8I 3Q1QA 3PS2A 2UXCE 3PRYA 4LF9I 4IFDD 1Y60A 1KJKA 1E3PA 3DF6A 2PNMA 4BA2A 1T4NA 2I9IA 2C38A 1R6LA 2NUGA 2MKDA 4DXLA 4DUZI 1YH8A 3M85G 2WW4A 1HNWE 2V8QB 3PS1A 2R76A 1X6FA 2EPCA 1RC7A 2BM0A 2EN3A 1R6MA 1EH7A 3QT5A 3P3EA 4DV4E 1Z0CA 3GCMA 5JEAA 3ADJA 5K36E 4KQVA 1A1KA 1DGCA 2LMZA 4QNKA 2L33A 1A1JA 4RHBB 2EN2A 2FTXB 1X5WA 3C6KA 3HULA 4B3TE 2HK2A 2E1RA 2HHHE 5DNLA 2LTSA 2EWLA 2O1VA 2RS6A 4FN5A 1WHQA 3J80C 4MYUA 2NN6A 4JI2E 4O5GA 5C0XE 1ZM3A 2LJHA 3ADIA 3VHTB 2ZITA 3P76A 1ZXNA 2FGGA 2CVEA 1H74A 1H72C 1XMOI 3LPSA 2EOJA 2HFSA 1KVKA 4DPUA 4M0VA 5JEAC 2DMIA 1YYOA 4IFDE 1NCSA 2EMXA 1FJGE 2LBSB 1FWKA 2RS7A 2EMKA 1PJTA
chains in the Genus database with same CATH topology
1IBMI 2KHXA 2LJPA 3JAMQ 2NA2A 1USVA 2L6MA 3V2UC 5IWAI 3JU0A 3T1YE 4L8NA 4YHHE 4JYAI 4DR2I 4JI8E 3FIGA 2CGEA 1IBKI 2R42A 4JI3E 1PKPA 2DSYA 2DB2A 5ADZA 2UUAE 2XEXA 4IZJB 1NZ0A 4F54A 4GKKE 1PIEA 2MDRA 1Z5AA 3OTOE 4HY1A 1FKAE 4YY3I 2MC6A 4JG4A 4LF4E 3QT8A 1B62A 3ZZTA 4DUYE 1FI4A 3B78A 5AE3A 3D4JA 3WU6A 3P1XA 4I3HA 4DV6E 4B3RE 2EZ6A 3AUZA 1N32E 4PRXA 2N3GA 2UU9I 4JV5E 4JI6E 4DV1E 3JAMC 3H09A 3ZZUA 4JI7I 4IZKA 4DPTA 2F8BA 1WXRA 4GKJI 4FWHA 1N0VC 3VYYA 1J26A 4ZVIA 3ZKDA 4DV7I 4B3SE 4JI4I 2VQEE 4DV0I 4WPYA 2VQFI 1NHHA 4DR3I 2HKEA 4LFCE 1DI2A 4IZJA 3H4LA 3F6GA 4DR5E 1D6TA 3K17A 4ED4A 3J80Q 4JI5I 3IWBA 4NXMI 2ODRD 5LMUE 1HNZI 4LFAI 1A6FA 2O1UA 3J81C 1H7SA 2B9DA 3HXLA 1J5EI 1XNRE 3QT7A 1N33I 2HK3A 4DPYA 4Z7CA 2NUEA 4WSPA 3HJCA 1MU5A 2E5LI 4K0KI 5A2QQ 1Y4SA 4LF5E 1N36I 2A2DA 4DV4I 3B8HA 2RTXA 1HR0I 4DR7I 2E1MA 5DNYA 4DU8A 4P52A 1ZXMA 3J7AG 3ADGA 4JI1E 4LF7I 2F4VI 4URLA 2VF1A 4X64E 4X65E 2L8TA 3ZOQB 5F3WA 1Z0TA 2DEIA 3HPSA 2LUQA 4DV2E 4WYQB 1KTVA 2GQ0A 4LF8I 1K47A 4DR6I 2IOQA 1N34E 1VISA 3K85A 2CG9A 2UXDE 2V83A 1YYKA 4DR1I 5LMNI 1XMQE 2DEJA 2N3HA 1Z0VA 4FW9A 1MX0A 1XNQE 4FWDA 5GMDA 2Z5BA 4AQYI 1STUA 4DR4E 2ZBKB 2A2CA 3PYDA 1NHIA 4DV3I 4DV5I 1Z0BA 2UXBI 1RREA 2L2KB 5A2QC 1HNXE 4X62I 3Q6MA 3VYXA 1B63A 3AV0A 1DARA 4J8ZA 1KKHA 2YZTA 4JI0E 4B3MI 2AJ4A 2UUCE 4KHPI 1I94E 5BR8E 3ZKBA 1IBLI 5CFFE 4NXNI 3Q6NA 2LTRA 3DJWA 4LF9E 1XHKA 3ZM7A 2ZM6E 4DUZE 2UUBI 4LFBI 1EKZA 5IT9C 3J81Q 1NHJA 4X66I 3F6HA 4WUBA 3J7Yp 4M1KA 4OX9I 1H7UA 4I8OA 4KZSA 3WU3A 4F9AB 3T1HI 4P7DA 3ZZ0A 4WUDA 4IZJD 5LL6R 4UTGA 2NPFA 2UXCI 1Z0GA 1N0UA 2G7HA 4FWGA 2H36X 1UILA 4HXZA 4BS9A 1XMOE 2HKJA 1HNWI 3KWRA 5L3JA 3WU4A 3JTZA 1BKNA 1GZ6A 3HPZA 1IBME 2B7VA 4B3TI 2HHHI 3C4TA 4GEQB 2B3TB 5IWAE 2JY9A 1ELOA 1QZRA 4JYAE 4JI2I 1EA6A 2DIXA 4DR2E 1IBKE 3V5RA 4LF6E 4DPXA 2K4VA 4DMIA 2HFUA 2Q2EB 2L2NA 2MC5A 1RQ0A 2YT4A 3M6AA 2KOUA 3CWVA 1PVGA 1QU6A 4XTJA 5AASA 2IHR1 1FJGI 4WUCA 2JVAA 1YZ9A 2IOPA 2L3JA 3LTOA 4YY3E 2X7IA 2RSMA 2VF3A 2EFGA 4BCAA 2JOXA 2KONA 5GMEA 3T1YI 1ZBQA 4YHHI 1ZM4A 3PYFA 1I94I 4JI8I 4USMA 3GONA 4HACB 4JI3I 2JOBA 1Y4UA 5FWKA 2UUAI 3B82A 3PYEA 2UU9E 1MG7A 4GKKI 4JI7E 2PNLA 1GQEA 2ZM6I 5IT9Q 3C4BA 3OTOI 4X8WA 4P7AA 4GKJE 1X49A 4N3OA 4LF4I 2JR1A 4DV7E 2VE7C 4JI4E 2J7KA 4DUYI 3LMLA 4DV0E 2VQFE 4DR3E 1Z5BA 1YYWA 2Z5EA 2LE2A 3K6QA 1S16A 4M2ZA 4DV6I 4B3RI 1N32I 4UT4A 4JV5I 1EI1A 2V2ZA 4JI5E 2M7QA 4JI6I 2LUPB 4NXME 2Z5CB 2R3VA 4DV1I 3OMLA 1HNZE 4LFAE 1KIJA 3ADLA 2V85A 2CZ9A 3LNUA 1X48A 2V34A 1J5EE 1ZBTA 4TUGA 2ODRC 4WFTA 1N33E 4F9CB 4BBYA 4BMJA 1Z59A 2E5LE 4K0KE 1Z0EA 4L5NC 5FLXC 4B3SI 1N36E 2X36A 2VQEI 3HQ1A 2CPNA 4HACA 4LU9A 1OJ4A 4DKKA 4TUIA 4LFCI 4DR5I 1HR0E 4DR7E 4IZKB 4PU9A 3VK6A 3P06A 1SR9A 2V86A 3LLHA 4BC9A 2L2MA 4LF7E 2F4VE 4Q28A 4BC7A 3PYGA 5LMUI 2DMYA 4PRVA 1UHZA 1FWLA 3WU5A 4LF6I 2LRSA 2V2QA 1Y6ZA 4Z7YA 1USUA 1XNRI 2M4IA 4HYMA 2BM1A 2O1WA 5AE2A 4LF8E 3HTXA 4DR6E 4LF5I 1UEKA 4MYTA 1DQ3A 4DR1E 4OOGC 1WUUA 5LMNE 2Z5CA 4EMDA 4LTYA 4JI1I 2V87A 4AQYE 2OI2A 4DV5E 1H73A 4DV3E 4X64I 3IWCA 4X65I 2M1SA 1X47A 2UXBE 3K1JA 2L92A 2B7TA 4M30A 4X62E 4DV2I 4F9BB 2GS8A 1T4OA 1Z0WA 1N34I 2UXDI 4B3ME 1ZM9A 4KHPE 4P78A 2FV4B 5AE1A 1XMQI 1IBLE 2WZOA 4NXNE 3F0NA 4USKA 4RPFA 1XNQI 2NUFA 3QT6A 2V88A 4DU7A 4R03A 4DR4I 2O1TA 2JWOA 1T4LB 3MSWA 2BV3A 2UUBE 4LFBE 3J7AM 4R8OA 1S4EA 1HNXI 1Z5CA 1U2RA 4X66E 2L3CA 4DPWA 4OX9E 1WHNA 5T6JA 1ZM2A 1HK7A 4JI0I 2Z5BB 2UUCI 4R1FA 3T1HE 2V89A 1RR9A 2V8PA 2V2VA 3IWDA 3RMPA 1FNMA 1O0WA 5FLXQ 5BR8I 3Q1QA 2UXCE 3PRYA 4LF9I 3DF6A 2PNMA 1T4NA 2NUGA 4DXLA 4DUZI 2WW4A 1HNWE 2V8QB 1RC7A 2BM0A 3QT5A 1Z0CA 3ADJA 4KQVA 2LMZA 2L33A 2FTXB 3HULA 4B3TE 2HK2A 2E1RA 2HHHE 2LTSA 2EWLA 2O1VA 2RS6A 4FN5A 1WHQA 3J80C 4MYUA 4JI2E 1ZM3A 2LJHA 3ADIA 2ZITA 1ZXNA 2FGGA 1H74A 1H72C 1XMOI 3LPSA 2HFSA 1KVKA 4DPUA 4M0VA 1YYOA 1FJGE 2LBSB 1FWKA 2RS7A 4DV4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM I;  2KHX A;  2LJP A;  3JAM Q;  2NA2 A;  3V2U C;  5IWA I;  3T1Y E;  4YHH E;  4JYA I;  4DR2 I;  4JI8 E;  1IBK I;  2R42 A;  4JI3 E;  1PKP A;  2DB2 A;  2UUA E;  2XEX A;  1NZ0 A;  4GKK E;  1PIE A;  2MDR A;  1Z5A A;  3OTO E;  4HY1 A;  1FKA E;  4YY3 I;  4JG4 A;  4LF4 E;  3QT8 A;  1B62 A;  3ZZT A;  4DUY E;  1FI4 A;  3B78 A;  3D4J A;  3WU6 A;  3P1X A;  4I3H A;  4DV6 E;  4B3R E;  2EZ6 A;  1N32 E;  4PRX A;  2N3G A;  2UU9 I;  4JV5 E;  4JI6 E;  4DV1 E;  3JAM C;  3ZZU A;  4JI7 I;  4DPT A;  4GKJ I;  4FWH A;  1N0V C;  3VYY A;  1J26 A;  4ZVI A;  3ZKD A;  4DV7 I;  4B3S E;  4JI4 I;  2VQE E;  4DV0 I;  2VQF I;  1NHH A;  4DR3 I;  2HKE A;  4LFC E;  1DI2 A;  1D6T A;  3H4L A;  4DR5 E;  3K17 A;  4ED4 A;  3J80 Q;  4JI5 I;  4NXM I;  5LMU E;  1HNZ I;  4LFA I;  1A6F A;  3J81 C;  1H7S A;  1J5E I;  1XNR E;  3QT7 A;  1N33 I;  2HK3 A;  4DPY A;  4Z7C A;  2NUE A;  1MU5 A;  2E5L I;  4K0K I;  5A2Q Q;  4LF5 E;  1N36 I;  2A2D A;  4DV4 I;  3B8H A;  2RTX A;  1HR0 I;  4DR7 I;  4DU8 A;  4P52 A;  1ZXM A;  3J7A G;  3ADG A;  4JI1 E;  4LF7 I;  2F4V I;  4URL A;  4X64 E;  4X65 E;  1Z0T A;  2DEI A;  2LUQ A;  4DV2 E;  4WYQ B;  1KTV A;  4LF8 I;  1K47 A;  4DR6 I;  1N34 E;  1VIS A;  2UXD E;  1YYK A;  4DR1 I;  5LMN I;  1XMQ E;  2DEJ A;  2N3H A;  1Z0V A;  4FW9 A;  1MX0 A;  1XNQ E;  4FWD A;  5GMD A;  4AQY I;  1STU A;  4DR4 E;  2ZBK B;  2A2C A;  3PYD A;  1NHI A;  4DV3 I;  4DV5 I;  1Z0B A;  2UXB I;  1RRE A;  2L2K B;  5A2Q C;  1HNX E;  4X62 I;  3VYX A;  1B63 A;  1DAR A;  1KKH A;  4JI0 E;  4B3M I;  2AJ4 A;  2UUC E;  4KHP I;  1I94 E;  5BR8 E;  3ZKB A;  1IBL I;  5CFF E;  4NXN I;  2LTR A;  4LF9 E;  1XHK A;  3ZM7 A;  2ZM6 E;  4DUZ E;  2UUB I;  4LFB I;  1EKZ A;  3J81 Q;  5IT9 C;  1NHJ A;  4X66 I;  4WUB A;  3J7Y p;  4M1K A;  4OX9 I;  1H7U A;  3WU3 A;  3T1H I;  3ZZ0 A;  4WUD A;  5LL6 R;  4UTG A;  2NPF A;  2UXC I;  1Z0G A;  1N0U A;  4FWG A;  1UIL A;  4HXZ A;  1XMO E;  2HKJ A;  1HNW I;  5L3J A;  3WU4 A;  1BKN A;  1IBM E;  2B7V A;  4B3T I;  2HHH I;  3C4T A;  2B3T B;  5IWA E;  2JY9 A;  1ELO A;  1QZR A;  4JYA E;  4JI2 I;  1EA6 A;  2DIX A;  4DR2 E;  1IBK E;  3V5R A;  4LF6 E;  4DPX A;  2HFU A;  2Q2E B;  2L2N A;  1RQ0 A;  2YT4 A;  3M6A A;  4XTJ A;  3CWV A;  1PVG A;  1QU6 A;  1FJG I;  2IHR 1;  4WUC A;  2JVA A;  1YZ9 A;  2L3J A;  3LTO A;  4YY3 E;  2X7I A;  2RSM A;  2VF3 A;  2EFG A;  5GME A;  3T1Y I;  4YHH I;  1ZM4 A;  3PYF A;  1I94 I;  4JI8 I;  4USM A;  3GON A;  4HAC B;  4JI3 I;  2UUA I;  3B82 A;  3PYE A;  2UU9 E;  1MG7 A;  4GKK I;  4JI7 E;  1GQE A;  2ZM6 I;  5IT9 Q;  3C4B A;  3OTO I;  4X8W A;  4P7A A;  4GKJ E;  1X49 A;  4LF4 I;  4DV7 E;  2J7K A;  4JI4 E;  4DUY I;  4DV0 E;  2VQF E;  4DR3 E;  1Z5B A;  1YYW A;  1S16 A;  4M2Z A;  4DV6 I;  4B3R I;  1N32 I;  4UT4 A;  4JV5 I;  1EI1 A;  2V2Z A;  4JI5 E;  4JI6 I;  2LUP B;  4NXM E;  4DV1 I;  2R3V A;  1HNZ E;  4LFA E;  1KIJ A;  3ADL A;  2CZ9 A;  3LNU A;  1X48 A;  2V34 A;  1J5E E;  1ZBT A;  1N33 E;  4WFT A;  1Z59 A;  2E5L E;  4K0K E;  1Z0E A;  5FLX C;  4B3S I;  1N36 E;  2X36 A;  2VQE I;  2CPN A;  4HAC A;  1OJ4 A;  4DKK A;  4LFC I;  4DR5 I;  1HR0 E;  4DR7 E;  4PU9 A;  3LLH A;  2L2M A;  4LF7 E;  2F4V E;  3PYG A;  5LMU I;  2DMY A;  4PRV A;  1UHZ A;  1FWL A;  3WU5 A;  4LF6 I;  2LRS A;  2V2Q A;  4Z7Y A;  1XNR I;  4HYM A;  2BM1 A;  4LF8 E;  3HTX A;  4DR6 E;  4LF5 I;  1UEK A;  4MYT A;  4DR1 E;  4OOG C;  1WUU A;  5LMN E;  4EMD A;  4JI1 I;  4AQY E;  2OI2 A;  4DV5 E;  1H73 A;  4DV3 E;  4X64 I;  4X65 I;  1X47 A;  2UXB E;  3K1J A;  4M30 A;  2B7T A;  4X62 E;  4DV2 I;  2GS8 A;  1T4O A;  1Z0W A;  1N34 I;  2UXD I;  4B3M E;  1ZM9 A;  4KHP E;  1XMQ I;  1IBL E;  4NXN E;  3F0N A;  4USK A;  4RPF A;  1XNQ I;  2NUF A;  3QT6 A;  4DU7 A;  4DR4 I;  1T4L B;  2BV3 A;  2UUB E;  4LFB E;  3J7A M;  1S4E A;  1HNX I;  1Z5C A;  1U2R A;  4X66 E;  2L3C A;  4DPW A;  4OX9 E;  1WHN A;  1ZM2 A;  4JI0 I;  2UUC I;  4R1F A;  3T1H E;  1RR9 A;  2V8P A;  2V2V A;  1FNM A;  1O0W A;  5FLX Q;  5BR8 I;  3Q1Q A;  2UXC E;  4LF9 I;  1T4N A;  2NUG A;  4DXL A;  4DUZ I;  2WW4 A;  1HNW E;  1RC7 A;  2BM0 A;  3QT5 A;  1Z0C A;  3ADJ A;  4KQV A;  2L33 A;  3HUL A;  4B3T E;  2HK2 A;  2E1R A;  2HHH E;  2LTS A;  2RS6 A;  4FN5 A;  1WHQ A;  3J80 C;  4MYU A;  4JI2 E;  1ZM3 A;  2LJH A;  3ADI A;  2ZIT A;  1ZXN A;  1H74 A;  1H72 C;  1XMO I;  3LPS A;  2HFS A;  1KVK A;  4DPU A;  1YYO A;  1FJG E;  2LBS B;  1FWK A;  2RS7 A;  4DV4 E; 
#chains in the Genus database with same CATH topology
 1IBM I;  2KHX A;  4RH8 A;  2LJP A;  2NA2 A;  5DRQ A;  3JAM Q;  1USV A;  2L6M A;  3V2U C;  2PO1 B;  5IWA I;  4O43 A;  2BR2 A;  2NN6 C;  3JU0 A;  3T1Y E;  4L8N A;  4YHH E;  4JYA I;  4HTG A;  4DR2 I;  4JI8 E;  3FIG A;  2CGE A;  1IBK I;  1TF3 A;  4MLV A;  2J65 A;  2R42 A;  4JI3 E;  4MQY A;  1PKP A;  2DSY A;  2DB2 A;  2EOS A;  3EPJ A;  5ADZ A;  1A1L A;  2YTF A;  1KYQ A;  1AAY A;  2UUA E;  2XEX A;  4IZJ B;  1NZ0 A;  2EPO A;  4R2P A;  4F54 A;  1YUI A;  4ZYE A;  4GKK E;  1PIE A;  4FW3 A;  2MDR A;  4U3B A;  1Z5A A;  2NN6 F;  3P3G A;  2DLK A;  3OTO E;  4HY1 A;  1FKA E;  2WCC 3;  4YY3 I;  2MC6 A;  4JG4 A;  4OO1 D;  4LF4 E;  5KL6 A;  3QT8 A;  1B62 A;  3ZZT A;  2RSI A;  1TF6 A;  4DUY E;  1PJS A;  1FI4 A;  3B78 A;  2LVH A;  1X6H A;  2EMY A;  5AE3 A;  1T39 A;  3D4J A;  3WU6 A;  2RQL A;  3P1X A;  4I3H A;  1OYS A;  2EMB A;  4DV6 E;  2EZ6 A;  4B3R E;  3AUZ A;  1N32 E;  1RHY A;  4PRX A;  1WRJ A;  2J7J A;  2YTD A;  2N3G A;  2UU9 I;  5A69 A;  4JV5 E;  3EPL A;  4JI6 E;  4DV1 E;  3JAM C;  4J3D A;  3H09 A;  3ZZU A;  2EN8 A;  2EOF A;  4JI7 I;  1PDA A;  3THO B;  2YTO A;  2YRH A;  4IZK A;  4DPT A;  2F8B A;  2JXP A;  1WXR A;  4GKJ I;  4FWH A;  1N0V C;  2EOZ A;  3VYY A;  4R2S A;  1J26 A;  4ZVI A;  2AE8 A;  3ZKD A;  2JE6 B;  4DV7 I;  4B3S E;  4JI4 I;  2C37 B;  2VQE E;  4DV0 I;  4WPY A;  2VQF I;  5A6B A;  1NHH A;  4DR3 I;  5K36 B;  2HKE A;  4LFC E;  1A1F A;  1DI2 A;  4IZJ A;  1WJP A;  3F6G A;  3THN A;  4DR5 E;  3H4L A;  1D6T A;  4LCF A;  2EPL X;  3K17 A;  4ED4 A;  3J80 Q;  2YSO A;  4OO1 E;  4JI5 I;  3NZK A;  5TSE A;  4OO1 B;  3IWB A;  4NXM I;  2ODR D;  1A1I A;  5LMU E;  1HNZ I;  4MU3 A;  1A6F A;  5KL4 A;  1YHC A;  3J81 C;  2O1U A;  4LFA I;  5JEA D;  4WX9 A;  1H7S A;  2B9D A;  5C0X B;  3HXL A;  1J5E I;  1XNR E;  3QT7 A;  1N33 I;  2HK3 A;  4DPY A;  4MDT A;  4Z7C A;  2EOE A;  2NUE A;  4WSP A;  3HJC A;  2PRT A;  1MU5 A;  2E5L I;  4K0K I;  5A2Q Q;  1Y4S A;  4LF5 E;  1N36 I;  3MHS C;  4IFD B;  2A2D A;  4DV4 I;  3B8H A;  4NHR A;  1T38 A;  2RTX A;  1HR0 I;  1GTK A;  4FW7 A;  4DR7 I;  2E1M A;  5DNY A;  4DU8 A;  4AIM A;  4X9J A;  4P52 A;  3M85 D;  1ZXM A;  2EM4 A;  2EQ0 A;  3J7A G;  3ADG A;  4JI1 E;  4LF7 I;  2F4V I;  4WXD A;  1P42 A;  4B3S I;  4URL A;  2VF1 A;  2EPP A;  4X64 E;  4HEI A;  2DGC A;  5AC5 A;  1B69 A;  4X65 E;  2L8T A;  3ZOQ B;  5F3W A;  1Z0T A;  2JE6 A;  3UHM A;  2DEI A;  2EM5 A;  2C37 A;  3HPS A;  2LUQ A;  5EL9 A;  4DV2 E;  4WYQ B;  1KTV A;  2WNR A;  2C39 B;  2GQ0 A;  4LF8 I;  2EOX A;  1K47 A;  4MU0 A;  4DR6 I;  4MU4 A;  1A1H A;  2IOQ A;  1N34 E;  1VIS A;  3K85 A;  2CG9 A;  2UXD E;  5JEA E;  2V83 A;  1EH8 A;  2YPN A;  1YYK A;  4DR1 I;  2M9A A;  5KL7 A;  5LMN I;  1XMQ E;  2DEJ A;  2N3H A;  1PJQ A;  1Z0V A;  4FW9 A;  1MX0 A;  1XNQ E;  3KRN A;  4FWD A;  1BB8 A;  5GMD A;  2EOM A;  5C0X A;  2Z5B A;  1UDS A;  4AQY I;  2YSP A;  1STU A;  4BHC A;  2JP9 A;  4DR4 E;  2ZBK B;  2CTD A;  1ZU1 A;  2A2C A;  1NHI A;  3PYD A;  4DV3 I;  1Z0B A;  4OZE A;  4DV5 I;  3L7Z B;  2UXB I;  3ECR A;  2L2K B;  5A2Q C;  1RRE A;  2EN7 A;  4ISA A;  1HNX E;  4X62 I;  2DRP A;  2EPK X;  3Q6M A;  4FW4 A;  2HGH A;  3VYX A;  2EOQ A;  5A6K A;  1B63 A;  3AV0 A;  1DAR A;  1Z1B A;  4J8Z A;  4ZYG A;  5IV8 B;  1KKH A;  2WBU A;  2YZT A;  4JI0 E;  4B3M I;  2AJ4 A;  2UUC E;  1N3G A;  4KHP I;  2EM7 A;  1I94 E;  5BR8 E;  3ZKB A;  1IBL I;  2EJ4 A;  2ELZ A;  5CFF E;  3B4T A;  4NXN I;  2O3Z A;  3Q6N A;  2LTR A;  4R2A A;  2EMA A;  3DJW A;  4LF9 E;  4LCH A;  2EM9 A;  5C0X C;  4R2C A;  4AM3 A;  5K36 F;  2ELY A;  1XHK A;  3ZM7 A;  4M9V C;  1A1G A;  2C39 A;  2ZM6 E;  2IER A;  4DUZ E;  2UUB I;  2LO3 A;  4LFB I;  2EE8 A;  3EPH A;  4IS1 C;  1EKZ A;  5IT9 C;  4R2E A;  1YSA C;  2EPZ A;  3J81 Q;  2YRK A;  1NHJ A;  4X66 I;  3F6H A;  4IS9 A;  3J7Y p;  4M1K A;  3PS3 A;  2ADR A;  4WUB A;  4OX9 I;  1H7U A;  3EPK A;  4I8O A;  1L4S A;  4BHB A;  4KZS A;  5C0X F;  3WU3 A;  4F9A B;  1MEY C;  5EKW A;  3T1H I;  4P7D A;  5A6B D;  4KWY A;  3ZZ0 A;  4WUD A;  4IZJ D;  5LL6 R;  2EP3 A;  4UTG A;  2NPF A;  1Y5Y A;  2EPR A;  2UXC I;  2VRD A;  1Z0G A;  4IFD F;  1N0U A;  3L7Z A;  4U3D A;  5DRR A;  2G7H A;  4FWG A;  2EOI A;  2EPU A;  2H36 X;  3GME A;  2EM3 A;  1UIL A;  4HXZ A;  2MDG A;  4R2Q A;  1YPN A;  2PNZ B;  2WP8 B;  4N4R B;  4BS9 A;  1XMO E;  2HKJ A;  2PO1 A;  1HNW I;  3KWR A;  2EM2 A;  5L3J A;  2JT2 A;  3MHH C;  3WU4 A;  3JTZ A;  2LJU A;  1BKN A;  1GZ6 A;  3HPZ A;  1IBM E;  2PO2 B;  2B7V A;  4B3T I;  2HHH I;  3C4T A;  4F6M A;  3EQ1 A;  4GEQ B;  1AH5 A;  2GHF A;  2B3T B;  5IWA E;  2JY9 A;  1ELO A;  1QZR A;  2F1D A;  4JYA E;  2IES A;  4JI2 I;  2YWQ A;  3U1Y A;  1EA6 A;  2DIX A;  1X6E A;  4DR2 E;  1IBK E;  3KZY A;  3V5R A;  2ENA A;  3L00 A;  4LF6 E;  4DPX A;  2K4V A;  2ENH A;  2ENC A;  4DMI A;  2HFU A;  2Q2E B;  2A25 A;  2L2N A;  2MC5 A;  4GQU A;  1RQ0 A;  2YT4 A;  2WBS A;  3M6A A;  2KOU A;  3CWV A;  1PVG A;  1QU6 A;  4XTJ A;  5AAS A;  2IHR 1;  1FJG I;  4WUC A;  2JVA A;  3BF2 A;  1BBO A;  2NN6 D;  3M7N G;  1YZ9 A;  2IOP A;  5K36 C;  2L3J A;  3LTO A;  3P3C A;  2EPN A;  4YY3 E;  2RSM A;  1UDN A;  2X7I A;  2VF3 A;  4ZYH A;  2EFG A;  4BCA A;  2JOX A;  2BA1 G;  2EMG A;  3UK3 C;  2KON A;  5GME A;  4FW5 A;  3CDI A;  2I13 A;  2PNZ A;  1ZBQ A;  2BBG A;  2WP8 A;  4YHH I;  1ZM4 A;  3PYF A;  3T1Y I;  5A6J A;  1I94 I;  4JI8 I;  1NEI A;  4USM A;  3GON A;  2EM8 A;  4HAC B;  2JOB A;  4JI3 I;  2EQ1 A;  1Y4U A;  2EML A;  1F2I G;  5FWK A;  2GO4 A;  4NBQ A;  2UUA I;  3B82 A;  3PYE A;  2UU9 E;  1MG7 A;  4GKK I;  2YU5 A;  5K36 A;  2PO2 A;  3GLL A;  4AID A;  4JI7 E;  3DD6 A;  1RMD A;  1GQE A;  2BR2 B;  2PNL A;  2EOY A;  2ZM6 I;  5IT9 Q;  3C4B A;  3C6M A;  3OTO I;  4X8W A;  4P7A A;  4GKJ E;  1X49 A;  4O4K A;  4N3O A;  2WBT A;  4OO1 F;  1MGT A;  4LF4 I;  2EN1 A;  2EQ3 A;  2JR1 A;  4DV7 E;  2VE7 C;  4ZYD A;  1EH6 A;  4JI4 E;  2J7K A;  1IQO A;  4DUY I;  3LML A;  4DV0 E;  2EMH A;  2VQF E;  4DR3 E;  2EOR A;  1G2D C;  1Z5B A;  1P47 A;  1YYW A;  1OYP A;  2LE2 A;  3K6Q A;  4WXC A;  2EPX A;  2Z5E A;  2NN6 E;  2JEA B;  1BBG A;  4BA1 B;  2YRM A;  4M2Z A;  1S16 A;  4DV6 I;  4B3R I;  1N32 I;  4Q35 B;  2DLQ A;  2GO3 A;  2Q8U A;  4UT4 A;  1EI1 A;  2EN4 A;  4IJD A;  2V2Z A;  4JI5 E;  2M7Q A;  4JI6 I;  4IFD A;  3M99 B;  2LUP B;  2LV2 A;  4NXM E;  2R3V A;  2Z5C B;  4DV1 I;  3OML A;  1HNZ E;  4LFA E;  1KIJ A;  3ADL A;  2V85 A;  2CZ9 A;  3LNU A;  1X48 A;  4JV5 I;  2N8X A;  2V34 A;  1J5E E;  2K7I A;  1ZBT A;  4TUG A;  2ODR C;  4WFT A;  2GLI A;  1N33 E;  4F9C B;  2MKN A;  4MU1 A;  4BBY A;  4BMJ A;  2CSH A;  1Z59 A;  2E5L E;  4K0K E;  1Z0E A;  3BID A;  4L5N C;  5FLX C;  1N36 E;  2EL6 A;  1IQS A;  3HQ1 A;  2X36 A;  4NZV A;  2CPN A;  4HAC A;  4MLQ A;  4LU9 A;  4QNJ A;  1OJ4 A;  4DKK A;  4TUI A;  1OYR A;  4LFC I;  1ZAA C;  4OKG A;  4DR5 I;  1HR0 E;  2YTP A;  4DR7 E;  4IZK B;  4PU9 A;  3VK6 A;  1YUJ A;  3CDJ A;  3P06 A;  5AC4 A;  4IFD C;  1SR9 A;  2V86 A;  3LLH A;  4BC9 A;  1TN9 A;  2GPI A;  2JPA A;  2L2M A;  1ZR9 A;  4LF7 E;  2EMF A;  2F4V E;  4Q28 A;  4BC7 A;  3PYG A;  2LCE A;  5DNX A;  5LMU I;  2DMY A;  4LOM A;  4LPF A;  4PRV A;  5JEA F;  1UHZ A;  1FWL A;  3WU5 A;  4LF6 I;  2LRS A;  2V2Q A;  1Y6Z A;  4Z7Y A;  4LCG A;  1USU A;  1XNR I;  3U1K A;  5KL3 A;  2M4I A;  4HYM A;  2BM1 A;  2O1W A;  1UBD C;  5AE2 A;  4LF8 E;  3HTX A;  5DRP A;  4DR6 E;  2EOH A;  1UEK A;  4LF5 I;  4MYT A;  2JEA A;  4BA1 A;  2EL4 A;  1DQ3 A;  3QG5 C;  2EMW A;  3BGH A;  2R1F A;  4DR1 E;  4OOG C;  1WUU A;  5LMN E;  2E72 A;  2Z5C A;  3KZZ A;  2JEB B;  4EMD A;  2EPM X;  2PO0 B;  2BB8 A;  2EMZ A;  4LTY A;  4JI1 I;  2V87 A;  1VI7 A;  4WSG A;  2EOO A;  2YTI A;  4F2J C;  4AQY E;  2OI2 A;  2YTG A;  4DV5 E;  1E3H A;  4DV3 E;  1H73 A;  3IWC A;  5DRO A;  4X64 I;  1SFE A;  2EMI A;  2M1S A;  4X65 I;  1X47 A;  2UXB E;  1UDO A;  2D9H A;  3K1J A;  4R2R A;  3HKM A;  5KL5 A;  2L92 A;  2B7T A;  4M30 A;  2YTJ A;  1X3C A;  4X62 E;  2C38 B;  2VES A;  4DV2 I;  4F9B B;  4BA2 B;  2HC5 A;  2EMC A;  4O24 A;  1JK2 A;  1T4O A;  1Z0W A;  2BA0 G;  2GS8 A;  1N34 I;  2BA0 D;  2EM6 A;  1JK1 A;  2UXD I;  4B3M E;  2NAB A;  2LT7 A;  1ZM9 A;  5LLQ A;  2VQE I;  4KHP E;  5ELW A;  2RPC A;  5JEA B;  4P78 A;  1UDQ A;  4OO1 A;  2FV4 B;  5AE1 A;  1XMQ I;  5IXM B;  1IBL E;  2WZO A;  4NXN E;  3F0N A;  4USK A;  4RPF A;  1XNQ I;  2NUF A;  5A6A A;  4FW6 A;  3QT6 A;  2V88 A;  4DU7 A;  2WNR B;  2EL5 A;  4R03 A;  4DR4 I;  2JYA A;  2O1T A;  1UN6 B;  5K36 D;  2JWO A;  1T4L B;  2CT1 A;  2EN6 A;  4GZN C;  3MSW A;  3BBG A;  3TQM A;  5KL2 A;  4R2D A;  2UUB E;  4LFB E;  2BV3 A;  2NN6 B;  4R8O A;  1S4E A;  2EPA A;  1HNX I;  3J7A M;  1QNT A;  3M7N D;  1Z5C A;  3H1C A;  1YFH A;  2YTQ A;  2YTE A;  1G2F C;  4X66 E;  2L3C A;  1U2R A;  4FK5 C;  2YU8 A;  4DPW A;  4OX9 E;  1WHN A;  1XXE A;  2HJJ A;  2BA1 D;  5T6J A;  1LLM C;  1IMU A;  1ZM2 A;  4F6N A;  1HK7 A;  4JI0 I;  5C0X D;  2JEB A;  2YTN A;  2Z5B B;  4R1F A;  3T1H E;  2EM0 A;  2V89 A;  1RR9 A;  2PO0 A;  2V8P A;  2UUC I;  4OO1 C;  2V2V A;  3IWD A;  3RMP A;  1FNM A;  1O0W A;  5FLX Q;  5BR8 I;  3Q1Q A;  3PS2 A;  2UXC E;  3PRY A;  4LF9 I;  4IFD D;  1Y60 A;  1KJK A;  1E3P A;  3DF6 A;  2PNM A;  4BA2 A;  1T4N A;  2I9I A;  2C38 A;  1R6L A;  2NUG A;  2MKD A;  4DXL A;  4DUZ I;  1YH8 A;  3M85 G;  2WW4 A;  1HNW E;  2V8Q B;  3PS1 A;  2R76 A;  1X6F A;  2EPC A;  1RC7 A;  2BM0 A;  2EN3 A;  1R6M A;  1EH7 A;  3QT5 A;  3P3E A;  4DV4 E;  1Z0C A;  3GCM A;  5JEA A;  3ADJ A;  5K36 E;  4KQV A;  1A1K A;  1DGC A;  2LMZ A;  4QNK A;  2L33 A;  1A1J A;  4RHB B;  2EN2 A;  2FTX B;  1X5W A;  3C6K A;  3HUL A;  4B3T E;  2HK2 A;  2E1R A;  2HHH E;  5DNL A;  2LTS A;  2EWL A;  2O1V A;  2RS6 A;  4FN5 A;  1WHQ A;  3J80 C;  4MYU A;  2NN6 A;  4JI2 E;  4O5G A;  5C0X E;  1ZM3 A;  2LJH A;  3ADI A;  3VHT B;  2ZIT A;  3P76 A;  1ZXN A;  2FGG A;  2CVE A;  1H74 A;  1H72 C;  1XMO I;  3LPS A;  2EOJ A;  2HFS A;  1KVK A;  4DPU A;  4M0V A;  5JEA C;  2DMI A;  1YYO A;  4IFD E;  1NCS A;  2EMX A;  1FJG E;  2LBS B;  1FWK A;  2RS7 A;  2EMK A;  1PJT A; 
#chains in the Genus database with same CATH homology
 1IBM I;  2KHX A;  2LJP A;  3JAM Q;  2NA2 A;  1USV A;  2L6M A;  3V2U C;  5IWA I;  3JU0 A;  3T1Y E;  4L8N A;  4YHH E;  4JYA I;  4DR2 I;  4JI8 E;  3FIG A;  2CGE A;  1IBK I;  2R42 A;  4JI3 E;  1PKP A;  2DSY A;  2DB2 A;  5ADZ A;  2UUA E;  2XEX A;  4IZJ B;  1NZ0 A;  4F54 A;  4GKK E;  1PIE A;  2MDR A;  1Z5A A;  3OTO E;  4HY1 A;  1FKA E;  4YY3 I;  2MC6 A;  4JG4 A;  4LF4 E;  3QT8 A;  1B62 A;  3ZZT A;  4DUY E;  1FI4 A;  3B78 A;  5AE3 A;  3D4J A;  3WU6 A;  3P1X A;  4I3H A;  4DV6 E;  4B3R E;  2EZ6 A;  3AUZ A;  1N32 E;  4PRX A;  2N3G A;  2UU9 I;  4JV5 E;  4JI6 E;  4DV1 E;  3JAM C;  3H09 A;  3ZZU A;  4JI7 I;  4IZK A;  4DPT A;  2F8B A;  1WXR A;  4GKJ I;  4FWH A;  1N0V C;  3VYY A;  1J26 A;  4ZVI A;  3ZKD A;  4DV7 I;  4B3S E;  4JI4 I;  2VQE E;  4DV0 I;  4WPY A;  2VQF I;  1NHH A;  4DR3 I;  2HKE A;  4LFC E;  1DI2 A;  4IZJ A;  3H4L A;  3F6G A;  4DR5 E;  1D6T A;  3K17 A;  4ED4 A;  3J80 Q;  4JI5 I;  3IWB A;  4NXM I;  2ODR D;  5LMU E;  1HNZ I;  4LFA I;  1A6F A;  2O1U A;  3J81 C;  1H7S A;  2B9D A;  3HXL A;  1J5E I;  1XNR E;  3QT7 A;  1N33 I;  2HK3 A;  4DPY A;  4Z7C A;  2NUE A;  4WSP A;  3HJC A;  1MU5 A;  2E5L I;  4K0K I;  5A2Q Q;  1Y4S A;  4LF5 E;  1N36 I;  2A2D A;  4DV4 I;  3B8H A;  2RTX A;  1HR0 I;  4DR7 I;  2E1M A;  5DNY A;  4DU8 A;  4P52 A;  1ZXM A;  3J7A G;  3ADG A;  4JI1 E;  4LF7 I;  2F4V I;  4URL A;  2VF1 A;  4X64 E;  4X65 E;  2L8T A;  3ZOQ B;  5F3W A;  1Z0T A;  2DEI A;  3HPS A;  2LUQ A;  4DV2 E;  4WYQ B;  1KTV A;  2GQ0 A;  4LF8 I;  1K47 A;  4DR6 I;  2IOQ A;  1N34 E;  1VIS A;  3K85 A;  2CG9 A;  2UXD E;  2V83 A;  1YYK A;  4DR1 I;  5LMN I;  1XMQ E;  2DEJ A;  2N3H A;  1Z0V A;  4FW9 A;  1MX0 A;  1XNQ E;  4FWD A;  5GMD A;  2Z5B A;  4AQY I;  1STU A;  4DR4 E;  2ZBK B;  2A2C A;  3PYD A;  1NHI A;  4DV3 I;  4DV5 I;  1Z0B A;  2UXB I;  1RRE A;  2L2K B;  5A2Q C;  1HNX E;  4X62 I;  3Q6M A;  3VYX A;  1B63 A;  3AV0 A;  1DAR A;  4J8Z A;  1KKH A;  2YZT A;  4JI0 E;  4B3M I;  2AJ4 A;  2UUC E;  4KHP I;  1I94 E;  5BR8 E;  3ZKB A;  1IBL I;  5CFF E;  4NXN I;  3Q6N A;  2LTR A;  3DJW A;  4LF9 E;  1XHK A;  3ZM7 A;  2ZM6 E;  4DUZ E;  2UUB I;  4LFB I;  1EKZ A;  5IT9 C;  3J81 Q;  1NHJ A;  4X66 I;  3F6H A;  4WUB A;  3J7Y p;  4M1K A;  4OX9 I;  1H7U A;  4I8O A;  4KZS A;  3WU3 A;  4F9A B;  3T1H I;  4P7D A;  3ZZ0 A;  4WUD A;  4IZJ D;  5LL6 R;  4UTG A;  2NPF A;  2UXC I;  1Z0G A;  1N0U A;  2G7H A;  4FWG A;  2H36 X;  1UIL A;  4HXZ A;  4BS9 A;  1XMO E;  2HKJ A;  1HNW I;  3KWR A;  5L3J A;  3WU4 A;  3JTZ A;  1BKN A;  1GZ6 A;  3HPZ A;  1IBM E;  2B7V A;  4B3T I;  2HHH I;  3C4T A;  4GEQ B;  2B3T B;  5IWA E;  2JY9 A;  1ELO A;  1QZR A;  4JYA E;  4JI2 I;  1EA6 A;  2DIX A;  4DR2 E;  1IBK E;  3V5R A;  4LF6 E;  4DPX A;  2K4V A;  4DMI A;  2HFU A;  2Q2E B;  2L2N A;  2MC5 A;  1RQ0 A;  2YT4 A;  3M6A A;  2KOU A;  3CWV A;  1PVG A;  1QU6 A;  4XTJ A;  5AAS A;  2IHR 1;  1FJG I;  4WUC A;  2JVA A;  1YZ9 A;  2IOP A;  2L3J A;  3LTO A;  4YY3 E;  2X7I A;  2RSM A;  2VF3 A;  2EFG A;  4BCA A;  2JOX A;  2KON A;  5GME A;  3T1Y I;  1ZBQ A;  4YHH I;  1ZM4 A;  3PYF A;  1I94 I;  4JI8 I;  4USM A;  3GON A;  4HAC B;  4JI3 I;  2JOB A;  1Y4U A;  5FWK A;  2UUA I;  3B82 A;  3PYE A;  2UU9 E;  1MG7 A;  4GKK I;  4JI7 E;  2PNL A;  1GQE A;  2ZM6 I;  5IT9 Q;  3C4B A;  3OTO I;  4X8W A;  4P7A A;  4GKJ E;  1X49 A;  4N3O A;  4LF4 I;  2JR1 A;  4DV7 E;  2VE7 C;  4JI4 E;  2J7K A;  4DUY I;  3LML A;  4DV0 E;  2VQF E;  4DR3 E;  1Z5B A;  1YYW A;  2Z5E A;  2LE2 A;  3K6Q A;  1S16 A;  4M2Z A;  4DV6 I;  4B3R I;  1N32 I;  4UT4 A;  4JV5 I;  1EI1 A;  2V2Z A;  4JI5 E;  2M7Q A;  4JI6 I;  2LUP B;  4NXM E;  2Z5C B;  2R3V A;  4DV1 I;  3OML A;  1HNZ E;  4LFA E;  1KIJ A;  3ADL A;  2V85 A;  2CZ9 A;  3LNU A;  1X48 A;  2V34 A;  1J5E E;  1ZBT A;  4TUG A;  2ODR C;  4WFT A;  1N33 E;  4F9C B;  4BBY A;  4BMJ A;  1Z59 A;  2E5L E;  4K0K E;  1Z0E A;  4L5N C;  5FLX C;  4B3S I;  1N36 E;  2X36 A;  2VQE I;  3HQ1 A;  2CPN A;  4HAC A;  4LU9 A;  1OJ4 A;  4DKK A;  4TUI A;  4LFC I;  4DR5 I;  1HR0 E;  4DR7 E;  4IZK B;  4PU9 A;  3VK6 A;  3P06 A;  1SR9 A;  2V86 A;  3LLH A;  4BC9 A;  2L2M A;  4LF7 E;  2F4V E;  4Q28 A;  4BC7 A;  3PYG A;  5LMU I;  2DMY A;  4PRV A;  1UHZ A;  1FWL A;  3WU5 A;  4LF6 I;  2LRS A;  2V2Q A;  1Y6Z A;  4Z7Y A;  1USU A;  1XNR I;  2M4I A;  4HYM A;  2BM1 A;  2O1W A;  5AE2 A;  4LF8 E;  3HTX A;  4DR6 E;  4LF5 I;  1UEK A;  4MYT A;  1DQ3 A;  4DR1 E;  4OOG C;  1WUU A;  5LMN E;  2Z5C A;  4EMD A;  4LTY A;  4JI1 I;  2V87 A;  4AQY E;  2OI2 A;  4DV5 E;  1H73 A;  4DV3 E;  4X64 I;  3IWC A;  4X65 I;  2M1S A;  1X47 A;  2UXB E;  3K1J A;  2L92 A;  2B7T A;  4M30 A;  4X62 E;  4DV2 I;  4F9B B;  2GS8 A;  1T4O A;  1Z0W A;  1N34 I;  2UXD I;  4B3M E;  1ZM9 A;  4KHP E;  4P78 A;  2FV4 B;  5AE1 A;  1XMQ I;  1IBL E;  2WZO A;  4NXN E;  3F0N A;  4USK A;  4RPF A;  1XNQ I;  2NUF A;  3QT6 A;  2V88 A;  4DU7 A;  4R03 A;  4DR4 I;  2O1T A;  2JWO A;  1T4L B;  3MSW A;  2BV3 A;  2UUB E;  4LFB E;  3J7A M;  4R8O A;  1S4E A;  1HNX I;  1Z5C A;  1U2R A;  4X66 E;  2L3C A;  4DPW A;  4OX9 E;  1WHN A;  5T6J A;  1ZM2 A;  1HK7 A;  4JI0 I;  2Z5B B;  2UUC I;  4R1F A;  3T1H E;  2V89 A;  1RR9 A;  2V8P A;  2V2V A;  3IWD A;  3RMP A;  1FNM A;  1O0W A;  5FLX Q;  5BR8 I;  3Q1Q A;  2UXC E;  3PRY A;  4LF9 I;  3DF6 A;  2PNM A;  1T4N A;  2NUG A;  4DXL A;  4DUZ I;  2WW4 A;  1HNW E;  2V8Q B;  1RC7 A;  2BM0 A;  3QT5 A;  1Z0C A;  3ADJ A;  4KQV A;  2LMZ A;  2L33 A;  2FTX B;  3HUL A;  4B3T E;  2HK2 A;  2E1R A;  2HHH E;  2LTS A;  2EWL A;  2O1V A;  2RS6 A;  4FN5 A;  1WHQ A;  3J80 C;  4MYU A;  4JI2 E;  1ZM3 A;  2LJH A;  3ADI A;  2ZIT A;  1ZXN A;  2FGG A;  1H74 A;  1H72 C;  1XMO I;  3LPS A;  2HFS A;  1KVK A;  4DPU A;  4M0V A;  1YYO A;  1FJG E;  2LBS B;  1FWK A;  2RS7 A;  4DV4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...