4JI4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji4E02
4X66E 4M30A 1QU6A 4DUZI 2UU9I 4DR6E 4DV6E 4JI2I 1HR0E 2HHHI 4WYQB 3HTXA 2OI2A 2LRSA 2LJPA 4DXLA 1N34I 3Q1QA 2BM0A 1N0VC 2UXBE 1Z0GA 2V8PA 3K17A 4LFCE 4JI3E 4K0KE 1IBKI 4DV2E 2ZITA 1XMOI 2LBSB 4RPFA 1KTVA 4JI4I 1FNMA 2RS6A 4DR5I 3QT7A 4DR3I 2N3GA 4DV5I 4M2ZA 2L3JA 5L3JA 4FN5A 4OOGC 2AJ4A 1KKHA 1I94E 2V2QA 2V2VA 4HXZA 3J7AM 4LFBI 2UU9E 2VQEI 1B63A 4JI2E 2HHHE 1ZM2A 4GKKI 1DARA 2E1RA 4JYAI 1XNQI 3T1HI 4KQVA 2UUAI 3K1JA 1XMOE 1N36I 4JI4E 1STUA 4DU8A 1PKPA 4DR5E 3ZZUA 4DV5E 3LNUA 4DPWA 5FLXQ 1N0UA 2A2DA 1FKAE 2NUGA 4X8WA 3LPSA 4LFBE 3GONA 1U2RA 4Z7CA 2CZ9A 4X64E 5LMNI 1S16A 4GKKE 4KHPE 1H73A 5LMUI 4JYAE 1XNQE 1MU5A 2UUAE 2E5LE 2X7IA 1FWLA 2XEXA 4USMA 1UEKA 3HULA 4JI6I 1FJGI 1HNZI 4GKJI 3QT8A 4NXMI 1X47A 4HACA 1Z0CA 2UXCI 4B3ME 4LF5I 4Z7YA 5IT9C 4URLA 1A6FA 4B3SI 4JI1I 4DR4I 5LMNE 4DPXA 3QT5A 1H7SA 4DR1E 5LMUE 4WUCA 3WU4A 4JI6E 1RC7A 1FJGE 4DR2E 4NXME 1YZ9A 3ZKDA 1N32I 4DU7A 4X62E 2JVAA 5A2QC 3J7AG 2HFUA 4YHHI 4XTJA 3ADGA 3VYYA 3B78A 4DV4I 4LF5E 3LTOA 2KHXA 1Z0BA 2ZBKB 4JI1E 4DR4E 4DV1E 5GMEA 2VQFE 5IT9Q 4P7AA 3V5RA 2HKJA 1RR9A 5FLXC 2EZ6A 2R42A 3J81Q 1MG7A 4DPTA 3LLHA 4YHHE 5IWAI 1Z0WA 4DV4E 2L33A 5LL6R 4DUYI 5A2QQ 4DUZE 1T4LB 1HNXI 4JG4A 1N34E 2DEJA 1WHNA 3JAMQ 1IBKE 4JI0I 2V34A 2UUCI 2V2ZA 3OTOI 4AQYI 3ZZ0A 3J7Yp 1HNWI 5IWAE 1PVGA 2UXDI 1KIJA 2GS8A 4DR3E 1OJ4A 2J7KA 4USKA 2DEIA 4LF8I 4NXNI 2RSMA 4DUYE 2VQEE 2B3TB 2IHR1 4LF7I 1HNXE 4FWDA 4LF4I 2VF3A 3T1HE 1NHHA 2B7TA 4JV5I 1ZM4A 1N36E 3OTOE 5CFFE 1K47A 4AQYE 2LUPB 1IBLI 1WHQA 2L3CA 3H4LA 1S4EA 2UXDE 1PIEA 5GMDA 4PRVA 3PYEA 1WUUA 2B7VA 3C4TA 1IBMI 3F0NA 2LTSA 2LUQA 5BR8I 4FWGA 4LF6I 4NXNE 4LF9I 2RS7A 4LF7E 4ED4A 1ELOA 4LF4E 3QT6A 1Z0EA 4DV0I 2L2NA 3J81C 2X36A 3ADIA 1YYWA 4I3HA 2CPNA 1HNZE 3C4BA 1IBLE 4GKJE 4DV7I 3B8HA 2LTRA 1IBME 4LF6E 2UXCE 1ZM9A 4LFAI 4DV6I 4LF9E 1O0WA 3D4JA 1HR0I 4DV3I 2DB2A 4B3SE 1XNRI 3JAMC 2UXBI 1Z0TA 2L2MA 4DV2I 3ADJA 4DV0E 4HYMA 2RTXA 2Q2EB 2R3VA 1Z5BA 1XMQI 3B82A 4DR7I 4JI7I 4WUBA 4JI8I 1T4NA 4DV7E 1N32E 1H7UA 2DMYA 4YY3I 1KVKA 4ZVIA 1I94I 1GQEA 4FWHA 1B62A 2JY9A 1J5EI 2F4VI 4LFAE 2DIXA 1H74A 2NPFA 4DV3E 3ZZTA 1XNRE 1EA6A 4PU9A 1Z5AA 3PYFA 3ZM7A 1ZM3A 4MYTA 1XMQE 4FW9A 4DR7E 4JI7E 4JI8E 4DKKA 2LJHA 3VYXA 3WU3A 3V2UC 4YY3E 1J26A 1XHKA 1RQ0A 2MDRA 3J80C 1J5EE 2F4VE 2A2CA 2HK3A 4DPYA 2EFGA 4X64I 1MX0A 4KHPI 3ZKBA 4JI5I 4P52A 2HK2A 4UTGA 2E5LI 2BM1A 4X65I 2HKEA 3WU5A 1QZRA 1DI2A 1D6TA 1EI1A 2NA2A 1UILA 2UUBI 4JI0E 4HY1A 2UUCE 4UT4A 4DPUA 1EKZA 1HNWE 4B3MI 3T1YI 1ZXNA 2NUFA 4LF8E 1H72C 3P1XA 2ZM6I 1UHZA 1NHJA 4DR1I 4M1KA 1BKNA 4JI5E 3J80Q 4X65E 2YT4A 4B3TI 4WUDA 1N33I 1VISA 2WW4A 1Z0VA 4OX9I 4B3RI 4WFTA 3ADLA 4DR2I 4X62I 4JV5E 2UUBE 4HACB 1NZ0A 4PRXA 1T4OA 3T1YE 1FI4A 3WU6A 1NHIA 2BV3A 4X66I 1Z59A 5BR8E 4R1FA 1X49A 4DV1I 2ZM6E 4DR6I 1X48A 3PYDA 1ZXMA 3M6AA 2VQFI 4B3TE 1YYKA 4EMDA 1N33E 4LFCI 4JI3I 4K0KI 4OX9E 4B3RE 2N3HA 1ZBTA 2L2KB 3PYGA 2NUEA 3CWVA 1FWKA 1RREA 1YYOA 4MYUA 1Z5CA 2HFSA
chains in the Genus database with same CATH superfamily
4R2DA 1HK7A 2IOQA 1EH6A 4X66E 2PNMA 4M30A 1QU6A 5C0XF 2CVEA 4GEQB 1YSAC 4DUZI 3Q6MA 2UU9I 3QG5C 4DR6E 4DV6E 4JI2I 1HR0E 2YWQA 4WYQB 2HHHI 3IWDA 3HTXA 2YTIA 1L4SA 2OI2A 5K36D 2LRSA 2LJPA 4DXLA 1N34I 3Q1QA 2BM0A 1N0VC 2UXBE 1Z0GA 3UK3C 2V8PA 3K17A 4LFCE 2YRKA 4JI3E 4K0KE 3K85A 1IBKI 4DV2E 2EMLA 1E3HA 2ZITA 1A1KA 5C0XD 1XMOI 2LVHA 1YPNA 2LBSB 2BA0D 4RPFA 1KTVA 4AM3A 4IS1C 3PS2A 4WX9A 4JI4I 1FNMA 1WRJA 2RS6A 2JPAA 3AV0A 4DR5I 3QT7A 2JE6A 3F6HA 3LMLA 4DR3I 2N3GA 2LV2A 4F9CB 2CT1A 5KL4A 4M2ZA 2JE6B 4QNJA 4DV5I 2L3JA 5L3JA 4FN5A 2BB8A 4OOGC 3JU0A 1KKHA 2GLIA 2AJ4A 2Z5EA 1T38A 3AUZA 1I94E 2JEBA 2V2QA 2V2VA 4O5GA 4O4KA 4AIMA 4HXZA 3J7AM 4LFBI 2UU9E 2PNLA 1B63A 2C37A 2VQEI 4FW7A 2ENCA 4JI2E 4GZNC 2HHHE 1ZM2A 1R6LA 2EPKX 2EOIA 5ELWA 4GKKI 2EN4A 4ISAA 2CGEA 3DF6A 1DARA 3DD6A 4LTYA 2E1RA 4JYAI 2LJUA 4F9BB 3T1HI 1UDNA 1R6MA 4KQVA 2GHFA 2UUAI 1XNQI 3K1JA 2V88A 2WBUA 1XMOE 2BR2A 2VESA 2EPPA 2NN6E 4Q28A 2C39A 4OZEA 2R1FA 2PO2A 3BF2A 1N36I 3EPJA 4JI4E 2C39B 1STUA 4DU8A 3GCMA 1PKPA 4DR5E 2V85A 4MLQA 1UN6B 4WXCA 3P3GA 3ZZUA 4DV5E 3LNUA 4LOMA 4DPWA 3ECRA 2EPMX 4BS9A 4MU1A 3H1CA 5FLXQ 1N0UA 5C0XC 2HJJA 3VK6A 2A2DA 5ADZA 4IS9A 1FKAE 2LE2A 2NUGA 2LT7A 2WCC3 2EPXA 4X8WA 4F6MA 3KRNA 4LFBE 3GONA 1U2RA 3LPSA 5K36E 1GTKA 1Y60A 1WXRA 2L6MA 4Z7CA 4KZSA 5A6JA 4ZYDA 2CZ9A 5IV8B 1UDQA 2V86A 4X64E 5LMNI 1S16A 4GKKE 2WP8A 5C0XE 4KHPE 1H73A 3U1KA 5LMUI 4JYAE 5T6JA 1XNQE 4LCHA 4DMIA 1MU5A 2UUAE 3EPKA 2E5LE 2X7IA 1FWLA 2XEXA 2Z5CA 4USMA 2EN3A 1UEKA 3HULA 4JI6I 1FJGI 3BGHA 4TUIA 4OO1D 1KJKA 2EM8A 4MQYA 1GZ6A 1HNZI 2EM9A 5JEAD 2IOPA 2PO0A 3QT8A 4NXMI 3HPZA 4GKJI 2EM4A 1X47A 4HACA 1Z0CA 2EQ1A 1PJTA 4WXDA 4N3OA 2UXCI 2HC5A 3IWCA 4B3ME 2HGHA 2ENHA 4LF5I 4Z7YA 5IT9C 4URLA 3P3EA 5DRQA 4LPFA 1A6FA 4B3SI 2J65A 4JI1I 1ZBQA 4IFDF 4DR4I 5LMNE 4BCAA 4MU0A 4DPXA 3QT5A 4M0VA 2EMBA 1H7SA 4DR1E 2YTPA 5LMUE 5KL6A 1A1JA 4M9VC 2D9HA 4Q35B 4WUCA 1G2FC 3NZKA 3WU4A 4JI6E 1USVA 1RC7A 1FJGE 2YU5A 4IFDD 2EPLX 2EOYA 3PS3A 4QNKA 4DR2E 4NXME 1YZ9A 3ZKDA 2EMWA 4DU7A 1N32I 4MDTA 4X62E 5K36F 2JVAA 3HXLA 4IZJB 1YFHA 5A2QC 2NABA 3J7AG 2HFUA 4YHHI 3THOB 2EPZA 4XTJA 1PJSA 3ADGA 3VYYA 5EL9A 2M1SA 2YTGA 3HPSA 5AC5A 3B78A 4LF5E 4DV4I 3M7NG 2O1WA 2A25A 1JK2A 3LTOA 2KHXA 1Z0BA 2ZBKB 2YPNA 4R2EA 4JI1E 2EMXA 3C6KA 3PRYA 4DR4E 4DV1E 2EOQA 2YTEA 4R2QA 2EM5A 2EORA 1DGCA 2YTJA 2EPUA 4OO1E 5GMEA 3THNA 4F54A 2VQFE 5IT9Q 5AASA 4P7AA 3V5RA 5JEAE 4F6NA 3C6MA 3HKMA 2RPCA 2JP9A 2EN7A 2HKJA 1SR9A 4ZYGA 2EOFA 1NCSA 5FLXC 1RR9A 2EZ6A 2BA1G 1MGTA 2R42A 5A6BA 3J81Q 1MG7A 4DPTA 3K6QA 3LLHA 5KL3A 3MHHC 2YSOA 4YHHE 4HTGA 5IWAI 1Z0WA 4MU3A 4BC9A 4DV4E 2L33A 2NN6B 2LO3A 1MEYC 3GMEA 2EL4A 1AAYA 2YTQA 5LL6R 3JTZA 4DUYI 2BBGA 4LCFA 3BIDA 4FK5C 2CTDA 5A2QQ 4DUZE 4R2RA 1T4LB 2NN6C 2EMHA 2K7IA 1A1IA 1HNXI 4GQUA 3M7ND 2WBTA 2JXPA 2EQ0A 2EN2A 2L92A 5A6KA 4JG4A 4IFDE 1N34E 2JR1A 5DRPA 2DEJA 4HEIA 1WHNA 2JEAB 1KYQA 2E72A 2JWOA 1P47A 5K36B 4R2PA 3JAMQ 4BHCA 1IBKE 2EMIA 4LU9A 4JI0I 2V34A 2UUCI 2V2ZA 2IESA 4ZYHA 4FW3A 5C0XA 4N4RB 3OTOI 2J7JA 4AQYI 5C0XB 4BMJA 3J7Yp 3ZZ0A 2O1VA 1HNWI 5K36C 5F3WA 2E1MA 2EOJA 5IWAE 1PVGA 1KIJA 4IJDA 2GS8A 4DR3E 4FW6A 1OJ4A 2J7KA 1DQ3A 1BBOA 4USKA 1A1HA 2DLQA 2BA1D 2DEIA 1OYSA 4LF8I 2JOBA 2DSYA 1USUA 4NXNI 2RSMA 2O1TA 4DUYE 5AE1A 5AC4A 4L5NC 2YTOA 5TSEA 2VQEE 2B3TB 2IHR1 4LF7I 3P76A 1HNXE 4FWDA 4OO1F 1ZU1A 4LF4I 2F1DA 2G7HA 2GO4A 5JEAF 3KZYA 2YTNA 3VHTB 3HQ1A 2ELYA 5IXMB 2EOHA 2EM2A 2VF3A 4RHBB 1Y4SA 3T1HE 2WNRA 2VE7C 1NHHA 1RHYA 2B7TA 1OYRA 2EM7A 2FTXB 2WNRB 4JV5I 3OMLA 2EN6A 2ADRA 1N36E 4BC7A 5CFFE 3OTOE 1K47A 4AQYE 2MKNA 2LUPB 1ZM4A 1IBLI 1WHQA 2EM6A 2N8XA 2YU8A 2L3CA 1S4EA 2UXDE 1PIEA 3H4LA 3P3CA 5GMDA 4BA2B 1SFEA 3PYEA 4ZYEA 1WUUA 4PRVA 2B7VA 3C4TA 1T39A 2JYAA 1IBMI 1E3PA 3FIGA 1X5WA 2LTSA 1NEIA 2LUQA 2C38A 3F0NA 2EPNA 4FWGA 5BR8I 4LF6I 4NXNE 5AE3A 2C38B 3L7ZA 2B9DA 3IWBA 2KONA 4BHBA 4LF9I 3L7ZB 2UXDI 1AH5A 2EPOA 1A1FA 4NZVA 4F9AB 4R03A 2RS7A 4O24A 1TF6A 4LF7E 4ED4A 1ELOA 4LF4E 2IERA 2FGGA 3QT6A 2ENAA 1Z0EA 2EPCA 3M99B 4DV0I 2L2NA 3J81C 2X36A 3ADIA 1YYWA 4I3HA 2CPNA 2CG9A 4KWYA 2VF1A 1HNZE 3C4BA 1IBLE 2EL5A 4GKJE 1B69A 4DV7I 4IZJA 4OO1B 2Q8UA 2FV4B 3B8HA 1A1LA 2GPIA 2DGCA 2LTRA 4R2CA 5JEAB 4MLVA 1IBME 4LF6E 2YZTA 2WZOA 4WSGA 2UXCE 3GLLA 3PS1A 1OYPA 1ZM9A 4LFAI 3DJWA 4DV6I 4LF9E 4OO1C 1O0WA 3D4JA 1HR0I 2PO1B 4DV3I 5JEAC 2DB2A 4B3SE 1XNRI 2RQLA 3JAMC 2UXBI 2EMZA 1IQOA 1Z0TA 2L2MA 4DV2I 2JOXA 3ADJA 4DV0E 4HYMA 3MSWA 2RTXA 3F6GA 2EWLA 1JK1A 2Q2EB 5DNYA 2R3VA 1ZR9A 4TUGA 1Z5BA 2KOUA 1XMQI 3B82A 2EPRA 2EN8A 1YUIA 4JI7I 4DR7I 4WUBA 4JI8I 1T4NA 4DV7E 1N32E 1H7UA 2YSPA 2DMYA 2MC6A 2ODRD 2Z5BB 4YY3I 4IFDB 1BBGA 2EQ3A 1KVKA 4ZVIA 1I94I 2EOOA 1GQEA 4FWHA 1B62A 2JY9A 2NN6A 1J5EI 3KWRA 2F4VI 4LFAE 2DIXA 1H74A 2PNZA 4IFDC 2NPFA 4DV3E 3ZZTA 2EL6A 2EJ4A 2H36X 1XNRE 2PNZB 2JT2A 2YRHA 3BBGA 1EA6A 4PU9A 2EOEA 1N3GA 1YUJA 1Z5AA 3B4TA 2O1UA 3PYFA 5A69A 3ZM7A 5DRRA 1ZM3A 2JEAA 3CDIA 4MYTA 5FWKA 5K36A 2V87A 4F2JC 1XMQE 4FW9A 3TQMA 4DR7E 4JI7E 4JI8E 2LJHA 4DKKA 1X3CA 4MU4A 2I13A 1ZAAC 3VYXA 2ELZA 3WU3A 3V2UC 4YY3E 1PDAA 2EMKA 1QNTA 2LCEA 1J26A 1XHKA 2EM3A 1RQ0A 2MDRA 2LMZA 3EPHA 3J80C 2MDGA 2V8QB 4I8OA 2JEBB 1J5EE 2GO3A 4P7DA 2F4VE 3RMPA 4LCGA 3KZZA 2YRMA 2A2CA 2HK3A 2C37B 4DPYA 2EP3A 3L00A 2EFGA 4X64I 3CDJA 3HJCA 5DNXA 3ZOQB 1UBDC 1MX0A 2EE8A 3Q6NA 4IZKA 4KHPI 2ODRC 3ZKBA 4IZKB 2EMGA 1Y6ZA 4JI5I 4R8OA 2HK2A 4P52A 1EH7A 4UTGA 5KL2A 2E5LI 4WPYA 5KL5A 1F2IG 2BM1A 2M9AA 2HKEA 2BR2B 4X65I 3WU5A 2EOMA 1QZRA 2YTFA 1G2DC 1YH8A 4R2AA 1DI2A 2PO2B 4OKGA 1D6TA 2RSIA 2DMIA 4R2SA 2AE8A 1XXEA 1EI1A 2GQ0A 2NA2A 1X6FA 2VRDA 1UILA 2CSHA 2EN1A 2MC5A 2EOZA 4BBYA 2UUCE 3EQ1A 4JI0E 2EOXA 4HY1A 4BA1A 4UT4A 4BA1B 4DPUA 2M7QA 1EKZA 1HNWE 4B3MI 4BA2A 4P78A 1ZXNA 2NUFA 3T1YI 4NBQA 1X6HA 4LF8E 1RMDA 1A1GA 1H72C 1VI7A 3P1XA 1IMUA 2ZM6I 1LLMC 2EMYA 1P42A 1UHZA 1NHJA 4RH8A 4DR1I 2WP8B 4M1KA 1BKNA 4AIDA 4JI5E 3J80Q 1YHCA 2UUBI 3M85G 2I9IA 2PRTA 4U3DA 4X65E 2YT4A 2Z5CB 4B3TI 1UDSA 2V89A 4WUDA 4J3DA 1BB8A 1N33I 2K4VA 1VISA 1TN9A 2WW4A 4IZJD 3UHMA 1Z0VA 2DLKA 2L8TA 4OX9I 4B3RI 5EKWA 4J8ZA 4WFTA 3ADLA 2EM0A 1UDOA 4DR2I 2PO0B 4X62I 4JV5E 2UUBE 3H09A 4HACB 1Y4UA 2WBSA 4NHRA 1NZ0A 5DROA 2EMAA 2EMFA 2EPAA 4PRXA 2YTDA 4OO1A 1T4OA 3T1YE 1EH8A 1FI4A 5JEAA 3WU6A 1IQSA 1NHIA 5DNLA 2M4IA 2BV3A 4L8NA 4X66I 5LLQA 1Z59A 5BR8E 1WJPA 1X49A 2EOSA 2R76A 4R1FA 4DV1I 1Z1BA 3MHSC 2ZM6E 1TF3A 4DR6I 2PO1A 1X48A 4FW5A 3PYDA 2BA0G 1ZXMA 3U1YA 3M6AA 2NN6F 1X6EA 2VQFI 3EPLA 4B3TE 1YYKA 2EMCA 4EMDA 1N33E 4U3BA 4LFCI 4JI3I 5AE2A 4K0KI 3P06A 2MKDA 5A6BD 2V83A 4OX9E 2N3HA 1ZBTA 4B3RE 4FW4A 4O43A 2O3ZA 2L2KB 3PYGA 3M85D 2NUEA 4WSPA 5A6AA 2NN6D 1Y5YA 3CWVA 1FWKA 1RREA 4X9JA 2F8BA 2DRPA 1YYOA 2Z5BA 1Z5CA 4MYUA 1PJQA 5KL7A 4IFDA 2HFSA
chains in the Genus database with same CATH topology
1HK7A 2IOQA 4X66E 2PNMA 4M30A 1QU6A 4GEQB 4DUZI 3Q6MA 2UU9I 4DR6E 4DV6E 4JI2I 1HR0E 2HHHI 4WYQB 3IWDA 3HTXA 2OI2A 2LRSA 2LJPA 4DXLA 1N34I 3Q1QA 2BM0A 1N0VC 2UXBE 1Z0GA 2V8PA 3K17A 4LFCE 4JI3E 4K0KE 3K85A 1IBKI 4DV2E 2ZITA 1XMOI 2LBSB 4RPFA 1KTVA 4JI4I 1FNMA 2RS6A 3AV0A 4DR5I 3QT7A 3F6HA 3LMLA 4DR3I 2N3GA 4F9CB 4DV5I 4M2ZA 2L3JA 5L3JA 4FN5A 4OOGC 3JU0A 1KKHA 2AJ4A 2Z5EA 3AUZA 1I94E 2V2QA 2V2VA 4HXZA 3J7AM 4LFBI 2UU9E 2PNLA 1B63A 2VQEI 4JI2E 2HHHE 1ZM2A 4GKKI 2CGEA 3DF6A 1DARA 4LTYA 2E1RA 4JYAI 4F9BB 1XNQI 3T1HI 4KQVA 2UUAI 3K1JA 2V88A 1XMOE 4Q28A 1N36I 4JI4E 1STUA 4DU8A 1PKPA 4DR5E 2V85A 3ZZUA 4DV5E 3LNUA 4DPWA 4BS9A 5FLXQ 1N0UA 2A2DA 3VK6A 5ADZA 1FKAE 2LE2A 2NUGA 4X8WA 3LPSA 4LFBE 3GONA 1U2RA 1WXRA 2L6MA 4Z7CA 4KZSA 2CZ9A 2V86A 4X64E 5LMNI 1S16A 4GKKE 4KHPE 1H73A 5LMUI 4JYAE 5T6JA 1XNQE 4DMIA 1MU5A 2UUAE 2E5LE 2X7IA 1FWLA 2XEXA 2Z5CA 4USMA 1UEKA 3HULA 4JI6I 1FJGI 4TUIA 1GZ6A 1HNZI 2IOPA 4GKJI 3QT8A 4NXMI 3HPZA 1X47A 4HACA 1Z0CA 4N3OA 2UXCI 3IWCA 4B3ME 4LF5I 4Z7YA 5IT9C 4URLA 1A6FA 4B3SI 4JI1I 1ZBQA 4DR4I 5LMNE 4BCAA 4DPXA 3QT5A 4M0VA 1H7SA 4DR1E 5LMUE 4WUCA 3WU4A 4JI6E 1USVA 1RC7A 1FJGE 4DR2E 4NXME 1YZ9A 3ZKDA 1N32I 4DU7A 4X62E 2JVAA 3HXLA 4IZJB 5A2QC 3J7AG 2HFUA 4YHHI 4XTJA 3ADGA 3VYYA 2M1SA 3HPSA 3B78A 4DV4I 4LF5E 2O1WA 3LTOA 2KHXA 1Z0BA 2ZBKB 4JI1E 3PRYA 4DR4E 4DV1E 5GMEA 4F54A 2VQFE 5IT9Q 5AASA 4P7AA 3V5RA 2HKJA 1SR9A 5FLXC 1RR9A 2EZ6A 2R42A 3J81Q 1MG7A 4DPTA 3K6QA 3LLHA 4YHHE 5IWAI 1Z0WA 4BC9A 4DV4E 2L33A 5LL6R 3JTZA 4DUYI 5A2QQ 4DUZE 1T4LB 1HNXI 2L92A 4JG4A 1N34E 2JR1A 2DEJA 1WHNA 2JWOA 3JAMQ 1IBKE 4LU9A 4JI0I 2V34A 2UUCI 2V2ZA 3OTOI 4AQYI 4BMJA 3J7Yp 3ZZ0A 2O1VA 1HNWI 5F3WA 2E1MA 5IWAE 1PVGA 2UXDI 1KIJA 2GS8A 4DR3E 1OJ4A 2J7KA 1DQ3A 4USKA 2DEIA 4LF8I 2JOBA 2DSYA 1USUA 4NXNI 2RSMA 2O1TA 4DUYE 5AE1A 4L5NC 2VQEE 2B3TB 2IHR1 4LF7I 1HNXE 4FWDA 4LF4I 2G7HA 3HQ1A 2VF3A 1Y4SA 3T1HE 2VE7C 1NHHA 2B7TA 4JV5I 2FTXB 3OMLA 1N36E 4BC7A 5CFFE 3OTOE 1K47A 4AQYE 1ZM4A 2LUPB 1IBLI 1WHQA 2L3CA 3H4LA 1S4EA 2UXDE 1PIEA 5GMDA 4PRVA 3PYEA 1WUUA 2B7VA 3C4TA 1IBMI 3F0NA 3FIGA 2LTSA 2LUQA 5BR8I 4FWGA 4LF6I 4NXNE 5AE3A 2B9DA 3IWBA 2KONA 4LF9I 4F9AB 4R03A 2RS7A 4LF7E 4ED4A 1ELOA 4LF4E 2FGGA 3QT6A 1Z0EA 4DV0I 2L2NA 3J81C 2X36A 3ADIA 1YYWA 4I3HA 2CPNA 2CG9A 2VF1A 1HNZE 3C4BA 1IBLE 4GKJE 4DV7I 4IZJA 2FV4B 3B8HA 2LTRA 1IBME 4LF6E 2YZTA 2WZOA 2UXCE 1ZM9A 4LFAI 3DJWA 4DV6I 4LF9E 1O0WA 3D4JA 1HR0I 4DV3I 2DB2A 4B3SE 1XNRI 3JAMC 2UXBI 1Z0TA 2L2MA 4DV2I 2JOXA 3ADJA 4DV0E 4HYMA 3MSWA 2RTXA 3F6GA 2EWLA 2Q2EB 5DNYA 2R3VA 4TUGA 1Z5BA 2KOUA 1XMQI 3B82A 4DR7I 4JI7I 4WUBA 4JI8I 1T4NA 4DV7E 1N32E 1H7UA 2DMYA 2MC6A 2ODRD 2Z5BB 4YY3I 1KVKA 4ZVIA 1I94I 1GQEA 4FWHA 1B62A 2JY9A 1J5EI 3KWRA 2F4VI 4LFAE 2DIXA 1H74A 2NPFA 4DV3E 3ZZTA 2H36X 1XNRE 1EA6A 4PU9A 1Z5AA 2O1UA 3PYFA 3ZM7A 1ZM3A 5FWKA 4MYTA 2V87A 1XMQE 4FW9A 4DR7E 4JI7E 4DKKA 4JI8E 2LJHA 3VYXA 3WU3A 3V2UC 4YY3E 1J26A 1XHKA 1RQ0A 2MDRA 2LMZA 3J80C 4I8OA 2V8QB 1J5EE 4P7DA 2F4VE 3RMPA 2A2CA 2HK3A 4DPYA 2EFGA 4X64I 3HJCA 3ZOQB 1MX0A 3Q6NA 4IZKA 4KHPI 2ODRC 3ZKBA 4IZKB 1Y6ZA 4JI5I 4R8OA 2HK2A 4P52A 4UTGA 2E5LI 4WPYA 2BM1A 4X65I 2HKEA 3WU5A 1QZRA 1DI2A 1D6TA 1EI1A 2GQ0A 2NA2A 1UILA 2MC5A 4BBYA 4JI0E 2UUCE 4HY1A 2UUBI 4UT4A 4DPUA 2M7QA 1EKZA 1HNWE 4B3MI 4P78A 1ZXNA 2NUFA 3T1YI 4LF8E 1H72C 3P1XA 2ZM6I 1UHZA 1NHJA 4DR1I 4M1KA 1BKNA 4JI5E 3J80Q 4X65E 2YT4A 2Z5CB 4B3TI 2V89A 4WUDA 1N33I 2K4VA 1VISA 2WW4A 4IZJD 1Z0VA 2L8TA 4OX9I 4B3RI 4J8ZA 4WFTA 3ADLA 4DR2I 4X62I 4JV5E 2UUBE 3H09A 4HACB 1Y4UA 1NZ0A 4PRXA 1T4OA 3T1YE 1FI4A 3WU6A 1NHIA 2M4IA 2BV3A 4L8NA 4X66I 1Z59A 5BR8E 4R1FA 1X49A 4DV1I 2ZM6E 4DR6I 1X48A 3PYDA 1ZXMA 3M6AA 2VQFI 4B3TE 1YYKA 4EMDA 1N33E 4LFCI 4JI3I 5AE2A 4K0KI 3P06A 4OX9E 2V83A 4B3RE 2N3HA 1ZBTA 2L2KB 3PYGA 2NUEA 4WSPA 3CWVA 1FWKA 1RREA 2F8BA 1YYOA 2Z5BA 1Z5CA 4MYUA 2HFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 E;  4M30 A;  1QU6 A;  4DUZ I;  2UU9 I;  4DR6 E;  4DV6 E;  4JI2 I;  1HR0 E;  2HHH I;  4WYQ B;  3HTX A;  2OI2 A;  2LRS A;  2LJP A;  4DXL A;  1N34 I;  3Q1Q A;  2BM0 A;  1N0V C;  2UXB E;  1Z0G A;  2V8P A;  3K17 A;  4LFC E;  4JI3 E;  4K0K E;  1IBK I;  4DV2 E;  2ZIT A;  1XMO I;  2LBS B;  4RPF A;  1KTV A;  4JI4 I;  1FNM A;  2RS6 A;  4DR5 I;  3QT7 A;  4DR3 I;  2N3G A;  4DV5 I;  4M2Z A;  2L3J A;  5L3J A;  4FN5 A;  4OOG C;  2AJ4 A;  1KKH A;  1I94 E;  2V2Q A;  2V2V A;  4HXZ A;  3J7A M;  4LFB I;  2UU9 E;  2VQE I;  1B63 A;  4JI2 E;  2HHH E;  1ZM2 A;  4GKK I;  1DAR A;  2E1R A;  4JYA I;  1XNQ I;  3T1H I;  4KQV A;  2UUA I;  3K1J A;  1XMO E;  1N36 I;  4JI4 E;  1STU A;  4DU8 A;  1PKP A;  4DR5 E;  3ZZU A;  4DV5 E;  3LNU A;  4DPW A;  5FLX Q;  1N0U A;  2A2D A;  1FKA E;  2NUG A;  4X8W A;  3LPS A;  4LFB E;  3GON A;  1U2R A;  4Z7C A;  2CZ9 A;  4X64 E;  5LMN I;  1S16 A;  4GKK E;  4KHP E;  1H73 A;  5LMU I;  4JYA E;  1XNQ E;  1MU5 A;  2UUA E;  2E5L E;  2X7I A;  1FWL A;  2XEX A;  4USM A;  1UEK A;  3HUL A;  4JI6 I;  1FJG I;  1HNZ I;  4GKJ I;  3QT8 A;  4NXM I;  1X47 A;  4HAC A;  1Z0C A;  2UXC I;  4B3M E;  4LF5 I;  4Z7Y A;  5IT9 C;  4URL A;  1A6F A;  4B3S I;  4JI1 I;  4DR4 I;  5LMN E;  4DPX A;  3QT5 A;  1H7S A;  4DR1 E;  5LMU E;  4WUC A;  3WU4 A;  4JI6 E;  1RC7 A;  1FJG E;  4DR2 E;  4NXM E;  1YZ9 A;  3ZKD A;  1N32 I;  4DU7 A;  4X62 E;  2JVA A;  5A2Q C;  3J7A G;  2HFU A;  4YHH I;  4XTJ A;  3ADG A;  3VYY A;  3B78 A;  4DV4 I;  4LF5 E;  3LTO A;  2KHX A;  1Z0B A;  2ZBK B;  4JI1 E;  4DR4 E;  4DV1 E;  5GME A;  2VQF E;  5IT9 Q;  4P7A A;  3V5R A;  2HKJ A;  1RR9 A;  5FLX C;  2EZ6 A;  2R42 A;  3J81 Q;  1MG7 A;  4DPT A;  3LLH A;  4YHH E;  5IWA I;  1Z0W A;  4DV4 E;  2L33 A;  5LL6 R;  4DUY I;  5A2Q Q;  4DUZ E;  1T4L B;  1HNX I;  4JG4 A;  1N34 E;  2DEJ A;  1WHN A;  3JAM Q;  1IBK E;  4JI0 I;  2V34 A;  2UUC I;  2V2Z A;  3OTO I;  4AQY I;  3ZZ0 A;  3J7Y p;  1HNW I;  5IWA E;  1PVG A;  2UXD I;  1KIJ A;  2GS8 A;  4DR3 E;  1OJ4 A;  2J7K A;  4USK A;  2DEI A;  4LF8 I;  4NXN I;  2RSM A;  4DUY E;  2VQE E;  2B3T B;  2IHR 1;  4LF7 I;  1HNX E;  4FWD A;  4LF4 I;  2VF3 A;  3T1H E;  1NHH A;  2B7T A;  4JV5 I;  1ZM4 A;  1N36 E;  3OTO E;  5CFF E;  1K47 A;  4AQY E;  2LUP B;  1IBL I;  1WHQ A;  2L3C A;  3H4L A;  1S4E A;  2UXD E;  1PIE A;  5GMD A;  4PRV A;  3PYE A;  1WUU A;  2B7V A;  3C4T A;  1IBM I;  3F0N A;  2LTS A;  2LUQ A;  5BR8 I;  4FWG A;  4LF6 I;  4NXN E;  4LF9 I;  2RS7 A;  4LF7 E;  4ED4 A;  1ELO A;  4LF4 E;  3QT6 A;  1Z0E A;  4DV0 I;  2L2N A;  3J81 C;  2X36 A;  3ADI A;  1YYW A;  4I3H A;  2CPN A;  1HNZ E;  3C4B A;  1IBL E;  4GKJ E;  4DV7 I;  3B8H A;  2LTR A;  1IBM E;  4LF6 E;  2UXC E;  1ZM9 A;  4LFA I;  4DV6 I;  4LF9 E;  1O0W A;  3D4J A;  1HR0 I;  4DV3 I;  2DB2 A;  4B3S E;  1XNR I;  3JAM C;  2UXB I;  1Z0T A;  2L2M A;  4DV2 I;  3ADJ A;  4DV0 E;  4HYM A;  2RTX A;  2Q2E B;  2R3V A;  1Z5B A;  1XMQ I;  3B82 A;  4DR7 I;  4JI7 I;  4WUB A;  4JI8 I;  1T4N A;  4DV7 E;  1N32 E;  1H7U A;  2DMY A;  4YY3 I;  1KVK A;  4ZVI A;  1I94 I;  1GQE A;  4FWH A;  1B62 A;  2JY9 A;  1J5E I;  2F4V I;  4LFA E;  2DIX A;  1H74 A;  2NPF A;  4DV3 E;  3ZZT A;  1XNR E;  1EA6 A;  4PU9 A;  1Z5A A;  3PYF A;  3ZM7 A;  1ZM3 A;  4MYT A;  1XMQ E;  4FW9 A;  4DR7 E;  4JI7 E;  4JI8 E;  4DKK A;  2LJH A;  3VYX A;  3WU3 A;  3V2U C;  4YY3 E;  1J26 A;  1XHK A;  1RQ0 A;  2MDR A;  3J80 C;  1J5E E;  2F4V E;  2A2C A;  2HK3 A;  4DPY A;  2EFG A;  4X64 I;  1MX0 A;  4KHP I;  3ZKB A;  4JI5 I;  4P52 A;  2HK2 A;  4UTG A;  2E5L I;  2BM1 A;  4X65 I;  2HKE A;  3WU5 A;  1QZR A;  1DI2 A;  1D6T A;  1EI1 A;  2NA2 A;  1UIL A;  2UUB I;  4JI0 E;  4HY1 A;  2UUC E;  4UT4 A;  4DPU A;  1EKZ A;  1HNW E;  4B3M I;  3T1Y I;  1ZXN A;  2NUF A;  4LF8 E;  1H72 C;  3P1X A;  2ZM6 I;  1UHZ A;  1NHJ A;  4DR1 I;  4M1K A;  1BKN A;  4JI5 E;  3J80 Q;  4X65 E;  2YT4 A;  4B3T I;  4WUD A;  1N33 I;  1VIS A;  2WW4 A;  1Z0V A;  4OX9 I;  4B3R I;  4WFT A;  3ADL A;  4DR2 I;  4X62 I;  4JV5 E;  2UUB E;  4HAC B;  1NZ0 A;  4PRX A;  1T4O A;  3T1Y E;  1FI4 A;  3WU6 A;  1NHI A;  2BV3 A;  4X66 I;  1Z59 A;  5BR8 E;  4R1F A;  1X49 A;  4DV1 I;  2ZM6 E;  4DR6 I;  1X48 A;  3PYD A;  1ZXM A;  3M6A A;  2VQF I;  4B3T E;  1YYK A;  4EMD A;  1N33 E;  4LFC I;  4JI3 I;  4K0K I;  4OX9 E;  4B3R E;  2N3H A;  1ZBT A;  2L2K B;  3PYG A;  2NUE A;  3CWV A;  1FWK A;  1RRE A;  1YYO A;  4MYU A;  1Z5C A;  2HFS A; 
#chains in the Genus database with same CATH topology
 4R2D A;  1HK7 A;  2IOQ A;  1EH6 A;  4X66 E;  2PNM A;  4M30 A;  1QU6 A;  5C0X F;  2CVE A;  4GEQ B;  1YSA C;  4DUZ I;  3Q6M A;  2UU9 I;  3QG5 C;  4DR6 E;  4DV6 E;  4JI2 I;  1HR0 E;  2YWQ A;  4WYQ B;  2HHH I;  3IWD A;  3HTX A;  2YTI A;  1L4S A;  2OI2 A;  5K36 D;  2LRS A;  2LJP A;  4DXL A;  1N34 I;  3Q1Q A;  2BM0 A;  1N0V C;  2UXB E;  1Z0G A;  3UK3 C;  2V8P A;  3K17 A;  4LFC E;  2YRK A;  4JI3 E;  4K0K E;  3K85 A;  1IBK I;  4DV2 E;  2EML A;  1E3H A;  2ZIT A;  1A1K A;  5C0X D;  1XMO I;  2LVH A;  1YPN A;  2LBS B;  2BA0 D;  4RPF A;  1KTV A;  4AM3 A;  4IS1 C;  3PS2 A;  4WX9 A;  4JI4 I;  1FNM A;  1WRJ A;  2RS6 A;  2JPA A;  3AV0 A;  4DR5 I;  3QT7 A;  2JE6 A;  3F6H A;  3LML A;  4DR3 I;  2N3G A;  2LV2 A;  4F9C B;  2CT1 A;  5KL4 A;  4M2Z A;  2JE6 B;  4QNJ A;  4DV5 I;  2L3J A;  5L3J A;  4FN5 A;  2BB8 A;  4OOG C;  3JU0 A;  1KKH A;  2GLI A;  2AJ4 A;  2Z5E A;  1T38 A;  3AUZ A;  1I94 E;  2JEB A;  2V2Q A;  2V2V A;  4O5G A;  4O4K A;  4AIM A;  4HXZ A;  3J7A M;  4LFB I;  2UU9 E;  2PNL A;  1B63 A;  2C37 A;  2VQE I;  4FW7 A;  2ENC A;  4JI2 E;  4GZN C;  2HHH E;  1ZM2 A;  1R6L A;  2EPK X;  2EOI A;  5ELW A;  4GKK I;  2EN4 A;  4ISA A;  2CGE A;  3DF6 A;  1DAR A;  3DD6 A;  4LTY A;  2E1R A;  4JYA I;  2LJU A;  4F9B B;  3T1H I;  1UDN A;  1R6M A;  4KQV A;  2GHF A;  2UUA I;  1XNQ I;  3K1J A;  2V88 A;  2WBU A;  1XMO E;  2BR2 A;  2VES A;  2EPP A;  2NN6 E;  4Q28 A;  2C39 A;  4OZE A;  2R1F A;  2PO2 A;  3BF2 A;  1N36 I;  3EPJ A;  4JI4 E;  2C39 B;  1STU A;  4DU8 A;  3GCM A;  1PKP A;  4DR5 E;  2V85 A;  4MLQ A;  1UN6 B;  4WXC A;  3P3G A;  3ZZU A;  4DV5 E;  3LNU A;  4LOM A;  4DPW A;  3ECR A;  2EPM X;  4BS9 A;  4MU1 A;  3H1C A;  5FLX Q;  1N0U A;  5C0X C;  2HJJ A;  3VK6 A;  2A2D A;  5ADZ A;  4IS9 A;  1FKA E;  2LE2 A;  2NUG A;  2LT7 A;  2WCC 3;  2EPX A;  4X8W A;  4F6M A;  3KRN A;  4LFB E;  3GON A;  1U2R A;  3LPS A;  5K36 E;  1GTK A;  1Y60 A;  1WXR A;  2L6M A;  4Z7C A;  4KZS A;  5A6J A;  4ZYD A;  2CZ9 A;  5IV8 B;  1UDQ A;  2V86 A;  4X64 E;  5LMN I;  1S16 A;  4GKK E;  2WP8 A;  5C0X E;  4KHP E;  1H73 A;  3U1K A;  5LMU I;  4JYA E;  5T6J A;  1XNQ E;  4LCH A;  4DMI A;  1MU5 A;  2UUA E;  3EPK A;  2E5L E;  2X7I A;  1FWL A;  2XEX A;  2Z5C A;  4USM A;  2EN3 A;  1UEK A;  3HUL A;  4JI6 I;  1FJG I;  3BGH A;  4TUI A;  4OO1 D;  1KJK A;  2EM8 A;  4MQY A;  1GZ6 A;  1HNZ I;  2EM9 A;  5JEA D;  2IOP A;  2PO0 A;  3QT8 A;  4NXM I;  3HPZ A;  4GKJ I;  2EM4 A;  1X47 A;  4HAC A;  1Z0C A;  2EQ1 A;  1PJT A;  4WXD A;  4N3O A;  2UXC I;  2HC5 A;  3IWC A;  4B3M E;  2HGH A;  2ENH A;  4LF5 I;  4Z7Y A;  5IT9 C;  4URL A;  3P3E A;  5DRQ A;  4LPF A;  1A6F A;  4B3S I;  2J65 A;  4JI1 I;  1ZBQ A;  4IFD F;  4DR4 I;  5LMN E;  4BCA A;  4MU0 A;  4DPX A;  3QT5 A;  4M0V A;  2EMB A;  1H7S A;  4DR1 E;  2YTP A;  5LMU E;  5KL6 A;  1A1J A;  4M9V C;  2D9H A;  4Q35 B;  4WUC A;  1G2F C;  3NZK A;  3WU4 A;  4JI6 E;  1USV A;  1RC7 A;  1FJG E;  2YU5 A;  4IFD D;  2EPL X;  2EOY A;  3PS3 A;  4QNK A;  4DR2 E;  4NXM E;  1YZ9 A;  3ZKD A;  2EMW A;  4DU7 A;  1N32 I;  4MDT A;  4X62 E;  5K36 F;  2JVA A;  3HXL A;  4IZJ B;  1YFH A;  5A2Q C;  2NAB A;  3J7A G;  2HFU A;  4YHH I;  3THO B;  2EPZ A;  4XTJ A;  1PJS A;  3ADG A;  3VYY A;  5EL9 A;  2M1S A;  2YTG A;  3HPS A;  5AC5 A;  3B78 A;  4LF5 E;  4DV4 I;  3M7N G;  2O1W A;  2A25 A;  1JK2 A;  3LTO A;  2KHX A;  1Z0B A;  2ZBK B;  2YPN A;  4R2E A;  4JI1 E;  2EMX A;  3C6K A;  3PRY A;  4DR4 E;  4DV1 E;  2EOQ A;  2YTE A;  4R2Q A;  2EM5 A;  2EOR A;  1DGC A;  2YTJ A;  2EPU A;  4OO1 E;  5GME A;  3THN A;  4F54 A;  2VQF E;  5IT9 Q;  5AAS A;  4P7A A;  3V5R A;  5JEA E;  4F6N A;  3C6M A;  3HKM A;  2RPC A;  2JP9 A;  2EN7 A;  2HKJ A;  1SR9 A;  4ZYG A;  2EOF A;  1NCS A;  5FLX C;  1RR9 A;  2EZ6 A;  2BA1 G;  1MGT A;  2R42 A;  5A6B A;  3J81 Q;  1MG7 A;  4DPT A;  3K6Q A;  3LLH A;  5KL3 A;  3MHH C;  2YSO A;  4YHH E;  4HTG A;  5IWA I;  1Z0W A;  4MU3 A;  4BC9 A;  4DV4 E;  2L33 A;  2NN6 B;  2LO3 A;  1MEY C;  3GME A;  2EL4 A;  1AAY A;  2YTQ A;  5LL6 R;  3JTZ A;  4DUY I;  2BBG A;  4LCF A;  3BID A;  4FK5 C;  2CTD A;  5A2Q Q;  4DUZ E;  4R2R A;  1T4L B;  2NN6 C;  2EMH A;  2K7I A;  1A1I A;  1HNX I;  4GQU A;  3M7N D;  2WBT A;  2JXP A;  2EQ0 A;  2EN2 A;  2L92 A;  5A6K A;  4JG4 A;  4IFD E;  1N34 E;  2JR1 A;  5DRP A;  2DEJ A;  4HEI A;  1WHN A;  2JEA B;  1KYQ A;  2E72 A;  2JWO A;  1P47 A;  5K36 B;  4R2P A;  3JAM Q;  4BHC A;  1IBK E;  2EMI A;  4LU9 A;  4JI0 I;  2V34 A;  2UUC I;  2V2Z A;  2IES A;  4ZYH A;  4FW3 A;  5C0X A;  4N4R B;  3OTO I;  2J7J A;  4AQY I;  5C0X B;  4BMJ A;  3J7Y p;  3ZZ0 A;  2O1V A;  1HNW I;  5K36 C;  5F3W A;  2E1M A;  2EOJ A;  5IWA E;  1PVG A;  1KIJ A;  4IJD A;  2GS8 A;  4DR3 E;  4FW6 A;  1OJ4 A;  2J7K A;  1DQ3 A;  1BBO A;  4USK A;  1A1H A;  2DLQ A;  2BA1 D;  2DEI A;  1OYS A;  4LF8 I;  2JOB A;  2DSY A;  1USU A;  4NXN I;  2RSM A;  2O1T A;  4DUY E;  5AE1 A;  5AC4 A;  4L5N C;  2YTO A;  5TSE A;  2VQE E;  2B3T B;  2IHR 1;  4LF7 I;  3P76 A;  1HNX E;  4FWD A;  4OO1 F;  1ZU1 A;  4LF4 I;  2F1D A;  2G7H A;  2GO4 A;  5JEA F;  3KZY A;  2YTN A;  3VHT B;  3HQ1 A;  2ELY A;  5IXM B;  2EOH A;  2EM2 A;  2VF3 A;  4RHB B;  1Y4S A;  3T1H E;  2WNR A;  2VE7 C;  1NHH A;  1RHY A;  2B7T A;  1OYR A;  2EM7 A;  2FTX B;  2WNR B;  4JV5 I;  3OML A;  2EN6 A;  2ADR A;  1N36 E;  4BC7 A;  5CFF E;  3OTO E;  1K47 A;  4AQY E;  2MKN A;  2LUP B;  1ZM4 A;  1IBL I;  1WHQ A;  2EM6 A;  2N8X A;  2YU8 A;  2L3C A;  1S4E A;  2UXD E;  1PIE A;  3H4L A;  3P3C A;  5GMD A;  4BA2 B;  1SFE A;  3PYE A;  4ZYE A;  1WUU A;  4PRV A;  2B7V A;  3C4T A;  1T39 A;  2JYA A;  1IBM I;  1E3P A;  3FIG A;  1X5W A;  2LTS A;  1NEI A;  2LUQ A;  2C38 A;  3F0N A;  2EPN A;  4FWG A;  5BR8 I;  4LF6 I;  4NXN E;  5AE3 A;  2C38 B;  3L7Z A;  2B9D A;  3IWB A;  2KON A;  4BHB A;  4LF9 I;  3L7Z B;  2UXD I;  1AH5 A;  2EPO A;  1A1F A;  4NZV A;  4F9A B;  4R03 A;  2RS7 A;  4O24 A;  1TF6 A;  4LF7 E;  4ED4 A;  1ELO A;  4LF4 E;  2IER A;  2FGG A;  3QT6 A;  2ENA A;  1Z0E A;  2EPC A;  3M99 B;  4DV0 I;  2L2N A;  3J81 C;  2X36 A;  3ADI A;  1YYW A;  4I3H A;  2CPN A;  2CG9 A;  4KWY A;  2VF1 A;  1HNZ E;  3C4B A;  1IBL E;  2EL5 A;  4GKJ E;  1B69 A;  4DV7 I;  4IZJ A;  4OO1 B;  2Q8U A;  2FV4 B;  3B8H A;  1A1L A;  2GPI A;  2DGC A;  2LTR A;  4R2C A;  5JEA B;  4MLV A;  1IBM E;  4LF6 E;  2YZT A;  2WZO A;  4WSG A;  2UXC E;  3GLL A;  3PS1 A;  1OYP A;  1ZM9 A;  4LFA I;  3DJW A;  4DV6 I;  4LF9 E;  4OO1 C;  1O0W A;  3D4J A;  1HR0 I;  2PO1 B;  4DV3 I;  5JEA C;  2DB2 A;  4B3S E;  1XNR I;  2RQL A;  3JAM C;  2UXB I;  2EMZ A;  1IQO A;  1Z0T A;  2L2M A;  4DV2 I;  2JOX A;  3ADJ A;  4DV0 E;  4HYM A;  3MSW A;  2RTX A;  3F6G A;  2EWL A;  1JK1 A;  2Q2E B;  5DNY A;  2R3V A;  1ZR9 A;  4TUG A;  1Z5B A;  2KOU A;  1XMQ I;  3B82 A;  2EPR A;  2EN8 A;  1YUI A;  4JI7 I;  4DR7 I;  4WUB A;  4JI8 I;  1T4N A;  4DV7 E;  1N32 E;  1H7U A;  2YSP A;  2DMY A;  2MC6 A;  2ODR D;  2Z5B B;  4YY3 I;  4IFD B;  1BBG A;  2EQ3 A;  1KVK A;  4ZVI A;  1I94 I;  2EOO A;  1GQE A;  4FWH A;  1B62 A;  2JY9 A;  2NN6 A;  1J5E I;  3KWR A;  2F4V I;  4LFA E;  2DIX A;  1H74 A;  2PNZ A;  4IFD C;  2NPF A;  4DV3 E;  3ZZT A;  2EL6 A;  2EJ4 A;  2H36 X;  1XNR E;  2PNZ B;  2JT2 A;  2YRH A;  3BBG A;  1EA6 A;  4PU9 A;  2EOE A;  1N3G A;  1YUJ A;  1Z5A A;  3B4T A;  2O1U A;  3PYF A;  5A69 A;  3ZM7 A;  5DRR A;  1ZM3 A;  2JEA A;  3CDI A;  4MYT A;  5FWK A;  5K36 A;  2V87 A;  4F2J C;  1XMQ E;  4FW9 A;  3TQM A;  4DR7 E;  4JI7 E;  4JI8 E;  2LJH A;  4DKK A;  1X3C A;  4MU4 A;  2I13 A;  1ZAA C;  3VYX A;  2ELZ A;  3WU3 A;  3V2U C;  4YY3 E;  1PDA A;  2EMK A;  1QNT A;  2LCE A;  1J26 A;  1XHK A;  2EM3 A;  1RQ0 A;  2MDR A;  2LMZ A;  3EPH A;  3J80 C;  2MDG A;  2V8Q B;  4I8O A;  2JEB B;  1J5E E;  2GO3 A;  4P7D A;  2F4V E;  3RMP A;  4LCG A;  3KZZ A;  2YRM A;  2A2C A;  2HK3 A;  2C37 B;  4DPY A;  2EP3 A;  3L00 A;  2EFG A;  4X64 I;  3CDJ A;  3HJC A;  5DNX A;  3ZOQ B;  1UBD C;  1MX0 A;  2EE8 A;  3Q6N A;  4IZK A;  4KHP I;  2ODR C;  3ZKB A;  4IZK B;  2EMG A;  1Y6Z A;  4JI5 I;  4R8O A;  2HK2 A;  4P52 A;  1EH7 A;  4UTG A;  5KL2 A;  2E5L I;  4WPY A;  5KL5 A;  1F2I G;  2BM1 A;  2M9A A;  2HKE A;  2BR2 B;  4X65 I;  3WU5 A;  2EOM A;  1QZR A;  2YTF A;  1G2D C;  1YH8 A;  4R2A A;  1DI2 A;  2PO2 B;  4OKG A;  1D6T A;  2RSI A;  2DMI A;  4R2S A;  2AE8 A;  1XXE A;  1EI1 A;  2GQ0 A;  2NA2 A;  1X6F A;  2VRD A;  1UIL A;  2CSH A;  2EN1 A;  2MC5 A;  2EOZ A;  4BBY A;  2UUC E;  3EQ1 A;  4JI0 E;  2EOX A;  4HY1 A;  4BA1 A;  4UT4 A;  4BA1 B;  4DPU A;  2M7Q A;  1EKZ A;  1HNW E;  4B3M I;  4BA2 A;  4P78 A;  1ZXN A;  2NUF A;  3T1Y I;  4NBQ A;  1X6H A;  4LF8 E;  1RMD A;  1A1G A;  1H72 C;  1VI7 A;  3P1X A;  1IMU A;  2ZM6 I;  1LLM C;  2EMY A;  1P42 A;  1UHZ A;  1NHJ A;  4RH8 A;  4DR1 I;  2WP8 B;  4M1K A;  1BKN A;  4AID A;  4JI5 E;  3J80 Q;  1YHC A;  2UUB I;  3M85 G;  2I9I A;  2PRT A;  4U3D A;  4X65 E;  2YT4 A;  2Z5C B;  4B3T I;  1UDS A;  2V89 A;  4WUD A;  4J3D A;  1BB8 A;  1N33 I;  2K4V A;  1VIS A;  1TN9 A;  2WW4 A;  4IZJ D;  3UHM A;  1Z0V A;  2DLK A;  2L8T A;  4OX9 I;  4B3R I;  5EKW A;  4J8Z A;  4WFT A;  3ADL A;  2EM0 A;  1UDO A;  4DR2 I;  2PO0 B;  4X62 I;  4JV5 E;  2UUB E;  3H09 A;  4HAC B;  1Y4U A;  2WBS A;  4NHR A;  1NZ0 A;  5DRO A;  2EMA A;  2EMF A;  2EPA A;  4PRX A;  2YTD A;  4OO1 A;  1T4O A;  3T1Y E;  1EH8 A;  1FI4 A;  5JEA A;  3WU6 A;  1IQS A;  1NHI A;  5DNL A;  2M4I A;  2BV3 A;  4L8N A;  4X66 I;  5LLQ A;  1Z59 A;  5BR8 E;  1WJP A;  1X49 A;  2EOS A;  2R76 A;  4R1F A;  4DV1 I;  1Z1B A;  3MHS C;  2ZM6 E;  1TF3 A;  4DR6 I;  2PO1 A;  1X48 A;  4FW5 A;  3PYD A;  2BA0 G;  1ZXM A;  3U1Y A;  3M6A A;  2NN6 F;  1X6E A;  2VQF I;  3EPL A;  4B3T E;  1YYK A;  2EMC A;  4EMD A;  1N33 E;  4U3B A;  4LFC I;  4JI3 I;  5AE2 A;  4K0K I;  3P06 A;  2MKD A;  5A6B D;  2V83 A;  4OX9 E;  2N3H A;  1ZBT A;  4B3R E;  4FW4 A;  4O43 A;  2O3Z A;  2L2K B;  3PYG A;  3M85 D;  2NUE A;  4WSP A;  5A6A A;  2NN6 D;  1Y5Y A;  3CWV A;  1FWK A;  1RRE A;  4X9J A;  2F8B A;  2DRP A;  1YYO A;  2Z5B A;  1Z5C A;  4MYU A;  1PJQ A;  5KL7 A;  4IFD A;  2HFS A; 
#chains in the Genus database with same CATH homology
 1HK7 A;  2IOQ A;  4X66 E;  2PNM A;  4M30 A;  1QU6 A;  4GEQ B;  4DUZ I;  3Q6M A;  2UU9 I;  4DR6 E;  4DV6 E;  4JI2 I;  1HR0 E;  2HHH I;  4WYQ B;  3IWD A;  3HTX A;  2OI2 A;  2LRS A;  2LJP A;  4DXL A;  1N34 I;  3Q1Q A;  2BM0 A;  1N0V C;  2UXB E;  1Z0G A;  2V8P A;  3K17 A;  4LFC E;  4JI3 E;  4K0K E;  3K85 A;  1IBK I;  4DV2 E;  2ZIT A;  1XMO I;  2LBS B;  4RPF A;  1KTV A;  4JI4 I;  1FNM A;  2RS6 A;  3AV0 A;  4DR5 I;  3QT7 A;  3F6H A;  3LML A;  4DR3 I;  2N3G A;  4F9C B;  4DV5 I;  4M2Z A;  2L3J A;  5L3J A;  4FN5 A;  4OOG C;  3JU0 A;  1KKH A;  2AJ4 A;  2Z5E A;  3AUZ A;  1I94 E;  2V2Q A;  2V2V A;  4HXZ A;  3J7A M;  4LFB I;  2UU9 E;  2PNL A;  1B63 A;  2VQE I;  4JI2 E;  2HHH E;  1ZM2 A;  4GKK I;  2CGE A;  3DF6 A;  1DAR A;  4LTY A;  2E1R A;  4JYA I;  4F9B B;  1XNQ I;  3T1H I;  4KQV A;  2UUA I;  3K1J A;  2V88 A;  1XMO E;  4Q28 A;  1N36 I;  4JI4 E;  1STU A;  4DU8 A;  1PKP A;  4DR5 E;  2V85 A;  3ZZU A;  4DV5 E;  3LNU A;  4DPW A;  4BS9 A;  5FLX Q;  1N0U A;  2A2D A;  3VK6 A;  5ADZ A;  1FKA E;  2LE2 A;  2NUG A;  4X8W A;  3LPS A;  4LFB E;  3GON A;  1U2R A;  1WXR A;  2L6M A;  4Z7C A;  4KZS A;  2CZ9 A;  2V86 A;  4X64 E;  5LMN I;  1S16 A;  4GKK E;  4KHP E;  1H73 A;  5LMU I;  4JYA E;  5T6J A;  1XNQ E;  4DMI A;  1MU5 A;  2UUA E;  2E5L E;  2X7I A;  1FWL A;  2XEX A;  2Z5C A;  4USM A;  1UEK A;  3HUL A;  4JI6 I;  1FJG I;  4TUI A;  1GZ6 A;  1HNZ I;  2IOP A;  4GKJ I;  3QT8 A;  4NXM I;  3HPZ A;  1X47 A;  4HAC A;  1Z0C A;  4N3O A;  2UXC I;  3IWC A;  4B3M E;  4LF5 I;  4Z7Y A;  5IT9 C;  4URL A;  1A6F A;  4B3S I;  4JI1 I;  1ZBQ A;  4DR4 I;  5LMN E;  4BCA A;  4DPX A;  3QT5 A;  4M0V A;  1H7S A;  4DR1 E;  5LMU E;  4WUC A;  3WU4 A;  4JI6 E;  1USV A;  1RC7 A;  1FJG E;  4DR2 E;  4NXM E;  1YZ9 A;  3ZKD A;  1N32 I;  4DU7 A;  4X62 E;  2JVA A;  3HXL A;  4IZJ B;  5A2Q C;  3J7A G;  2HFU A;  4YHH I;  4XTJ A;  3ADG A;  3VYY A;  2M1S A;  3HPS A;  3B78 A;  4DV4 I;  4LF5 E;  2O1W A;  3LTO A;  2KHX A;  1Z0B A;  2ZBK B;  4JI1 E;  3PRY A;  4DR4 E;  4DV1 E;  5GME A;  4F54 A;  2VQF E;  5IT9 Q;  5AAS A;  4P7A A;  3V5R A;  2HKJ A;  1SR9 A;  5FLX C;  1RR9 A;  2EZ6 A;  2R42 A;  3J81 Q;  1MG7 A;  4DPT A;  3K6Q A;  3LLH A;  4YHH E;  5IWA I;  1Z0W A;  4BC9 A;  4DV4 E;  2L33 A;  5LL6 R;  3JTZ A;  4DUY I;  5A2Q Q;  4DUZ E;  1T4L B;  1HNX I;  2L92 A;  4JG4 A;  1N34 E;  2JR1 A;  2DEJ A;  1WHN A;  2JWO A;  3JAM Q;  1IBK E;  4LU9 A;  4JI0 I;  2V34 A;  2UUC I;  2V2Z A;  3OTO I;  4AQY I;  4BMJ A;  3J7Y p;  3ZZ0 A;  2O1V A;  1HNW I;  5F3W A;  2E1M A;  5IWA E;  1PVG A;  2UXD I;  1KIJ A;  2GS8 A;  4DR3 E;  1OJ4 A;  2J7K A;  1DQ3 A;  4USK A;  2DEI A;  4LF8 I;  2JOB A;  2DSY A;  1USU A;  4NXN I;  2RSM A;  2O1T A;  4DUY E;  5AE1 A;  4L5N C;  2VQE E;  2B3T B;  2IHR 1;  4LF7 I;  1HNX E;  4FWD A;  4LF4 I;  2G7H A;  3HQ1 A;  2VF3 A;  1Y4S A;  3T1H E;  2VE7 C;  1NHH A;  2B7T A;  4JV5 I;  2FTX B;  3OML A;  1N36 E;  4BC7 A;  5CFF E;  3OTO E;  1K47 A;  4AQY E;  1ZM4 A;  2LUP B;  1IBL I;  1WHQ A;  2L3C A;  3H4L A;  1S4E A;  2UXD E;  1PIE A;  5GMD A;  4PRV A;  3PYE A;  1WUU A;  2B7V A;  3C4T A;  1IBM I;  3F0N A;  3FIG A;  2LTS A;  2LUQ A;  5BR8 I;  4FWG A;  4LF6 I;  4NXN E;  5AE3 A;  2B9D A;  3IWB A;  2KON A;  4LF9 I;  4F9A B;  4R03 A;  2RS7 A;  4LF7 E;  4ED4 A;  1ELO A;  4LF4 E;  2FGG A;  3QT6 A;  1Z0E A;  4DV0 I;  2L2N A;  3J81 C;  2X36 A;  3ADI A;  1YYW A;  4I3H A;  2CPN A;  2CG9 A;  2VF1 A;  1HNZ E;  3C4B A;  1IBL E;  4GKJ E;  4DV7 I;  4IZJ A;  2FV4 B;  3B8H A;  2LTR A;  1IBM E;  4LF6 E;  2YZT A;  2WZO A;  2UXC E;  1ZM9 A;  4LFA I;  3DJW A;  4DV6 I;  4LF9 E;  1O0W A;  3D4J A;  1HR0 I;  4DV3 I;  2DB2 A;  4B3S E;  1XNR I;  3JAM C;  2UXB I;  1Z0T A;  2L2M A;  4DV2 I;  2JOX A;  3ADJ A;  4DV0 E;  4HYM A;  3MSW A;  2RTX A;  3F6G A;  2EWL A;  2Q2E B;  5DNY A;  2R3V A;  4TUG A;  1Z5B A;  2KOU A;  1XMQ I;  3B82 A;  4DR7 I;  4JI7 I;  4WUB A;  4JI8 I;  1T4N A;  4DV7 E;  1N32 E;  1H7U A;  2DMY A;  2MC6 A;  2ODR D;  2Z5B B;  4YY3 I;  1KVK A;  4ZVI A;  1I94 I;  1GQE A;  4FWH A;  1B62 A;  2JY9 A;  1J5E I;  3KWR A;  2F4V I;  4LFA E;  2DIX A;  1H74 A;  2NPF A;  4DV3 E;  3ZZT A;  2H36 X;  1XNR E;  1EA6 A;  4PU9 A;  1Z5A A;  2O1U A;  3PYF A;  3ZM7 A;  1ZM3 A;  5FWK A;  4MYT A;  2V87 A;  1XMQ E;  4FW9 A;  4DR7 E;  4JI7 E;  4DKK A;  4JI8 E;  2LJH A;  3VYX A;  3WU3 A;  3V2U C;  4YY3 E;  1J26 A;  1XHK A;  1RQ0 A;  2MDR A;  2LMZ A;  3J80 C;  4I8O A;  2V8Q B;  1J5E E;  4P7D A;  2F4V E;  3RMP A;  2A2C A;  2HK3 A;  4DPY A;  2EFG A;  4X64 I;  3HJC A;  3ZOQ B;  1MX0 A;  3Q6N A;  4IZK A;  4KHP I;  2ODR C;  3ZKB A;  4IZK B;  1Y6Z A;  4JI5 I;  4R8O A;  2HK2 A;  4P52 A;  4UTG A;  2E5L I;  4WPY A;  2BM1 A;  4X65 I;  2HKE A;  3WU5 A;  1QZR A;  1DI2 A;  1D6T A;  1EI1 A;  2GQ0 A;  2NA2 A;  1UIL A;  2MC5 A;  4BBY A;  4JI0 E;  2UUC E;  4HY1 A;  2UUB I;  4UT4 A;  4DPU A;  2M7Q A;  1EKZ A;  1HNW E;  4B3M I;  4P78 A;  1ZXN A;  2NUF A;  3T1Y I;  4LF8 E;  1H72 C;  3P1X A;  2ZM6 I;  1UHZ A;  1NHJ A;  4DR1 I;  4M1K A;  1BKN A;  4JI5 E;  3J80 Q;  4X65 E;  2YT4 A;  2Z5C B;  4B3T I;  2V89 A;  4WUD A;  1N33 I;  2K4V A;  1VIS A;  2WW4 A;  4IZJ D;  1Z0V A;  2L8T A;  4OX9 I;  4B3R I;  4J8Z A;  4WFT A;  3ADL A;  4DR2 I;  4X62 I;  4JV5 E;  2UUB E;  3H09 A;  4HAC B;  1Y4U A;  1NZ0 A;  4PRX A;  1T4O A;  3T1Y E;  1FI4 A;  3WU6 A;  1NHI A;  2M4I A;  2BV3 A;  4L8N A;  4X66 I;  1Z59 A;  5BR8 E;  4R1F A;  1X49 A;  4DV1 I;  2ZM6 E;  4DR6 I;  1X48 A;  3PYD A;  1ZXM A;  3M6A A;  2VQF I;  4B3T E;  1YYK A;  4EMD A;  1N33 E;  4LFC I;  4JI3 I;  5AE2 A;  4K0K I;  3P06 A;  4OX9 E;  2V83 A;  4B3R E;  2N3H A;  1ZBT A;  2L2K B;  3PYG A;  2NUE A;  4WSP A;  3CWV A;  1FWK A;  1RRE A;  2F8B A;  1YYO A;  2Z5B A;  1Z5C A;  4MYU A;  2HFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...