4JI4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji4E02
5GMDA 1GQEA 4FN5A 2A2CA 1YYKA 4DPWA 3ZZ0A 2IHR1 2XEXA 2LBSB 2UU9I 4FW9A 4PRVA 1OJ4A 1XNRE 2Q2EB 4X64E 2CZ9A 4HACB 2JY9A 2ZM6E 5BR8I 3J81C 2ZBKB 5IWAE 4DR2E 4URLA 5FLXQ 4OX9I 1S4EA 4JI0E 5BR8E 1B62A 2V8PA 1H73A 4ZVIA 4DPTA 4Z7CA 1WHNA 4DV1E 4DV5E 3JAMQ 4OX9E 2B7VA 3F0NA 3ADGA 1I94E 1YYOA 2NUEA 4OOGC 1HNXE 2MDRA 4GKJI 4DR6E 4JI1I 4DV4I 4DV6I 4JI5I 1H74A 1WHQA 4WUDA 4GKKI 4X66I 3T1HE 1EKZA 3CWVA 3J80Q 4JI3E 4JV5I 2B7TA 2X36A 4WYQB 2VQFE 3T1HI 2LJHA 4M2ZA 4JV5E 4LFBI 3JAMC 4JI4I 1N36E 4LF6I 1QZRA 4AQYE 4DV0I 4KHPE 1IBLE 1KTVA 4M1KA 5IT9Q 1ZXMA 4JI8E 4B3SE 1N33E 2HFSA 1XMOE 2B3TB 1X48A 2NUGA 3ADIA 4ED4A 4LFAI 2UUAE 1WUUA 2BM1A 4DPUA 1UEKA 4DU8A 4DV2E 1B63A 2N3GA 4KQVA 4EMDA 5CFFE 2UUAI 4YHHI 2L33A 3J7Yp 2UU9E 4Z7YA 2L3CA 1EA6A 1XNRI 2F4VI 2V2QA 5LMUI 2OI2A 4DR7I 2J7KA 3B82A 4LF9I 1FI4A 4JI2I 1RR9A 4X8WA 4DR4E 4B3ME 2VQEE 4DR1E 2HKEA 4MYUA 5LL6R 4DUZI 2EFGA 4R1FA 3M6AA 1HNZI 1H72C 3PYGA 2E5LI 4GKJE 3WU5A 2L2MA 1Z0TA 4DR6I 4JI1E 4YY3I 4DV7I 4JI5E 3T1YI 4DR5E 1FWLA 3Q1QA 1J5EE 4JI3I 2E5LE 1ZM4A 4JI7E 4LF8I 5LMNI 2UXDE 4DR5I 4LF5E 1J5EI 1RREA 4WUBA 2DEIA 1RQ0A 2DIXA 3H4LA 3J7AM 2HKJA 1K47A 2E1RA 2UXDI 1YYWA 2HK2A 4LF5I 3ADLA 3HTXA 2LUQA 1EI1A 1Z0BA 4USMA 3ZM7A 1IBLI 2A2DA 1Z0VA 4DXLA 2DMYA 1STUA 2X7IA 4X65E 1IBKE 4PU9A 1ELOA 4MYTA 4NXNI 1D6TA 2LTRA 2R3VA 3WU6A 4JYAI 4X64I 4LFCE 5LMUE 1H7UA 2V2VA 1KIJA 1HNWE 4X62I 2NA2A 4DU7A 3ZKBA 3OTOE 4DV3E 3ZZUA 1J26A 2V34A 1T4LB 1N0VC 1X47A 1I94I 4JI6E 2HFUA 1ZM2A 1MX0A 4LF7E 4NXME 3J80C 2DEJA 1NHJA 1RC7A 3VYYA 2N3HA 4DV4E 4DV6E 2DB2A 4GKKE 4LF7I 1FKAE 4NXMI 2V2ZA 4YY3E 2BM0A 2L2NA 4LF4E 3B8HA 2RS6A 5IT9C 4DR3E 1S16A 4DUYE 1KVKA 1Z5BA 2R42A 2BV3A 4DR3I 2VF3A 4JI4E 4DUYI 4K0KE 1UHZA 4DKKA 5A2QC 1H7SA 2UUBI 3D4JA 4B3SI 4HYMA 4HY1A 1UILA 3K1JA 4XTJA 2HK3A 3PYEA 2UUBE 1Z0GA 1X49A 2JVAA 2ZITA 1XNQI 2ZM6I 4P52A 5IWAI 4DR2I 1U2RA 4NXNE 4B3TE 1YZ9A 2NPFA 1Z0WA 1A6FA 2HHHI 4JI0I 1MU5A 4JYAE 4DPYA 5FLXC 4B3TI 3J7AG 4JI2E 4DV1I 4DV5I 3PYDA 4LF9E 3J81Q 1KKHA 3GONA 1NHIA 1FNMA 1HNXI 2VQEI 3QT8A 2EZ6A 1DARA 3OTOI 3V5RA 2UXCI 2L2KB 2LUPB 4X66E 1T4NA 4RPFA 1Z5CA 1ZM3A 4JI6I 1QU6A 4HACA 2UXCE 1PIEA 2KHXA 2L3JA 3WU4A 4FWDA 3B78A 2VQFI 4JI7I 3PYFA 4HXZA 4LF6E 4LFBE 4KHPI 1N36I 4WFTA 2WW4A 4DV0E 4AQYI 4JI8I 3LNUA 1N32E 3QT5A 1PKPA 4K0KI 4LFAE 1N33I 1XMOI 1NHHA 2UUCE 4FWHA 1N34E 1BKNA 3QT7A 4DPXA 5GMEA 1IBKI 4USKA 2UUCI 2LJPA 3LPSA 4M30A 2F4VE 4YHHE 3ZZTA 1N34I 3C4BA 1ZM9A 2NUFA 1XNQE 2CPNA 4UTGA 4DR7E 1XMQI 3P1XA 4JG4A 2HHHE 3ADJA 4P7AA 3C4TA 4LFCI 4WUCA 4B3MI 1IBMI 1XHKA 4DR1I 1XMQE 4DR4I 4DV3I 4DUZE 1HNWI 4X62E 1O0WA 2GS8A 3QT6A 3WU3A 2RTXA 2LTSA 1IBME 2RS7A 1Z0EA 3LTOA 5A2QQ 1HNZE 1PVGA 4DV7E 4PRXA 2YT4A 3V2UC 1NZ0A 3T1YE 2AJ4A 3HULA 1HR0I 1Z59A 2UXBI 2RSMA 4LF4I 4LF8E 3LLHA 4UT4A 5LMNE 1ZXNA 1FJGE 1HR0E 3K17A 2UXBE 4B3RE 1FWKA 4FWGA 5L3JA 2LRSA 1N0UA 1DI2A 1FJGI 1MG7A 1Z5AA 4I3HA 1ZBTA 1T4OA 4B3RI 3VYXA 1N32I 3ZKDA 4X65I 1VISA 1Z0CA 4DV2I
chains in the Genus database with same CATH superfamily
5GMDA 1GQEA 4FN5A 2RPCA 2V87A 3U1KA 2A2CA 1YYKA 4TUGA 4IZJB 3ZZ0A 4DPWA 2IHR1 3LMLA 3MHSC 5KL5A 2XEXA 2YWQA 1BBGA 2H36X 2JOBA 1Z0CA 2LBSB 2F1DA 2JE6B 1WJPA 2WBUA 3KRNA 4FW9A 2UU9I 2WNRA 1OJ4A 4PRVA 5A69A 1XNRE 5ELWA 2Q2EB 5DNXA 2EQ0A 4X64E 1DGCA 2CZ9A 4HACB 2JY9A 2EMAA 2ZM6E 5BR8I 3J81C 2Q8UA 2ZBKB 1A1JA 4LCHA 2EPKX 5IWAE 4DR2E 3P06A 4URLA 5FLXQ 4OX9I 1A1FA 4F54A 4R2PA 1S4EA 4IFDE 1YUIA 4JI0E 5BR8E 1B62A 5KL4A 2V8PA 3VHTB 1H73A 4ZVIA 2EPRA 2M4IA 2EOSA 4DPTA 4Z7CA 2NN6E 1WHNA 1E3PA 4DV1E 4DV5E 2F8BA 4OX9E 2NN6B 3JAMQ 2EM8A 2B7VA 2YTPA 1R6LA 3HPZA 2A25A 3F0NA 3ADGA 1I94E 4O24A 1YYOA 2NUEA 4OOGC 2YTDA 1HNXE 2J7JA 2MDRA 4IJDA 4GKJI 2LVHA 4GQUA 2HJJA 2DLQA 4DR6E 4R2QA 4JI1I 4WPYA 2VRDA 3L7ZA 4DV4I 2E72A 4DV6I 4JI5I 1QNTA 1WHQA 3C6KA 2WBSA 1H74A 4WUDA 4X66I 4GKKI 5K36E 2JEAB 3M7NG 3T1HE 1EKZA 3CWVA 3J80Q 1T39A 5DRPA 4JI3E 5AC5A 2B7TA 4R03A 2PO2B 2WP8B 4JV5I 1N3GA 2X36A 4LCGA 5ADZA 4R2RA 4BHBA 2EMFA 4WYQB 2VQFE 1TF6A 1UDQA 3T1HI 2LJHA 5K36B 4M2ZA 2YTGA 4JV5E 2EN1A 4LFBI 2GHFA 2V83A 3JAMC 4JI4I 1N36E 4LF6I 3L00A 1QZRA 4AQYE 4DV0I 4KHPE 2EMHA 5AC4A 2K7IA 1IBLE 1KTVA 3EPJA 4M1KA 2VF1A 2EORA 5IT9Q 4F6NA 2CGEA 3TQMA 4JI8E 1ZXMA 5AE3A 4B3SE 1X5WA 1N33E 3KZZA 4R2DA 1MEYC 2HFSA 4BS9A 1XMOE 2B3TB 1X48A 2BA1G 2NUGA 3ADIA 3HJCA 5EL9A 5IV8B 2EN2A 4ED4A 4LFAI 1YFHA 1L4SA 3EQ1A 5KL7A 2DSYA 2UUAE 2EPZA 1WUUA 2BM1A 4DPUA 4O4KA 4N3OA 5KL2A 1UEKA 2CT1A 4DV2E 1B63A 4DU8A 2N3GA 2YRKA 1JK1A 4KQVA 4EMDA 2EM6A 3L7ZB 2ODRD 3PS1A 4BC9A 5CFFE 4Q35B 4BHCA 2UUAI 2EPNA 4YHHI 2L33A 3J7Yp 2UU9E 2BA0G 4Z7YA 2ENAA 2EPMX 2L3CA 1A1KA 4ZYGA 1EA6A 1XNRI 2YU5A 2F4VI 3BF2A 2V2QA 1Z1BA 5LMUI 2OI2A 4AM3A 2NN6A 1IQSA 2M9AA 1EH7A 4DR7I 2J7KA 1YPNA 1A1LA 1YHCA 4ZYDA 1UDSA 4Q28A 3M7ND 4MLVA 4WXDA 3B82A 4LF9I 1PJQA 1FI4A 2LJUA 4JI2I 1RR9A 4IFDA 2EOEA 2ADRA 4X8WA 3C6MA 4MU1A 3HPSA 4F9CB 4DR4E 3P76A 4B3ME 1USVA 4ZYEA 2B9DA 1A1IA 2VQEE 4DR1E 2HKEA 4MYUA 2JP9A 2EL5A 5LL6R 4NHRA 4DUZI 4F6MA 2EFGA 4R1FA 2V88A 1RHYA 3M6AA 1VI7A 1HNZI 4IZKA 1H72C 3PYGA 2EPLX 2E5LI 2EMYA 4GKJE 4NZVA 3WU5A 4OKGA 2L2MA 1Z0TA 4IFDB 2YSPA 4DR6I 4JI1E 4YY3I 3K85A 4DV7I 4JI5E 3T1YI 4DR5E 1FWLA 3Q1QA 1J5EE 2EQ3A 4JI3I 2E5LE 1ZM4A 4O43A 4JI7E 4LF8I 5LMNI 2UXDE 5K36C 4DR5I 4MU4A 2V85A 4LF5E 1J5EI 1RREA 4WUBA 4LU9A 1WXRA 2C37A 4AIMA 2DEIA 1RQ0A 2DIXA 3H4LA 3J7AM 2HKJA 1K47A 2E1RA 2JEBA 2UXDI 1YYWA 2K4VA 2HK2A 2EM3A 4ZYHA 4BC7A 3ADLA 2PNZA 3HTXA 2LUQA 1UDNA 5KL3A 1EI1A 1TN9A 1Y6ZA 1Z0BA 2NN6F 2WP8A 3P3GA 3ZM7A 4USMA 1IBLI 2A2DA 4F9AB 5EKWA 2V86A 1UBDC 1Z0VA 1F2IG 4IS9A 1SFEA 4HTGA 1MGTA 1ZR9A 2EL4A 5AE1A 1YSAC 4DXLA 2Z5BB 2DMYA 3HKMA 1STUA 4R2AA 2X7IA 4X65E 1P47A 1IBKE 2GQ0A 4PU9A 2MKNA 1OYPA 4OO1E 2YTOA 4M9VC 1ELOA 2EM7A 1X6HA 4MYTA 2L6MA 1A1HA 4OO1D 3JTZA 2GLIA 4DR2I 2EM2A 2EPOA 4NXNI 2NN6D 1D6TA 1PJSA 2LTRA 3JU0A 2EOQA 2R3VA 3WU6A 2M1SA 2CVEA 4R2SA 4JYAI 2EMXA 4X64I 4IZKB 2YTIA 3IWBA 2EOXA 4LFCE 2WNRB 5LMUE 1H7UA 2Z5EA 2V2VA 4LF5I 5F3WA 2DGCA 1KIJA 3Q6MA 2JPAA 3GLLA 1HNWE 3U1YA 4X62I 2YTEA 2NA2A 1JK2A 4DU7A 2EPPA 3Q6NA 3OTOE 2EE8A 4DV3E 3QG5C 3ZKBA 2O3ZA 3ZZUA 4LOMA 2M7QA 4P78A 2CG9A 2EOJA 4F2JC 1J26A 2V34A 2EN8A 2EN6A 3GMEA 1T4LB 1PDAA 1N0VC 4OZEA 1X47A 4KWYA 3BGHA 1I94I 4JI6E 5IXMB 4FW3A 2YRHA 1ZM2A 2HFUA 1MX0A 3H09A 4LF7E 4NXME 2LV2A 3J80C 2DEJA 4U3DA 1NHJA 1RC7A 3VYYA 2EMBA 2EQ1A 1KJKA 5FWKA 5DNYA 1UDOA 2N3HA 4DV4E 4DV6E 1Y4SA 2DB2A 4GKKE 4WX9A 5C0XC 4LF7I 1FKAE 4NXMI 5K36D 2V2ZA 4U3BA 1X6EA 4YY3E 2BM0A 2L2NA 4LF4E 2RSIA 2RS6A 5KL6A 5IT9C 1YH8A 4BMJA 3B8HA 4DR3E 2GO3A 2EOOA 1S16A 4DUYE 2J65A 1BB8A 2PO1B 3IWDA 1YUJA 2JT2A 3THNA 1KVKA 4M0VA 2PNMA 2FV4B 1Z5BA 2YTFA 3IWCA 5A6KA 2R42A 2BV3A 3P3EA 4P7DA 2JOXA 4R2EA 1A1GA 5C0XF 2R1FA 2IESA 2VF3A 5C0XE 4DR3I 4JI4E 2EOHA 4DUYI 4K0KE 3M85D 1UHZA 4DKKA 3DF6A 5A2QC 4IS1C 5A6BA 1WRJA 2EMKA 2MDGA 1H7SA 2UUBI 3H1CA 3D4JA 2ENHA 5TSEA 2JE6A 4FW4A 4B3SI 4IFDD 2EP3A 3DD6A 1OYSA 4HYMA 2EOMA 4HY1A 3BBGA 4BBYA 4L8NA 2O1WA 2YTJA 5DNLA 1UILA 2I9IA 3K1JA 2PO0B 4OO1A 4XTJA 2EOFA 3DJWA 3AV0A 4J8ZA 4MLQA 2HK3A 3PYEA 4OO1C 2UUBE 2LCEA 1Z0GA 1X49A 3AUZA 1X6FA 1GTKA 2C38B 2EOZA 4N4RB 3PRYA 4QNJA 3K6QA 5JEAC 2JEAA 2MC5A 2Z5CA 2IOQA 2EM5A 1EH6A 2JVAA 3MSWA 1IMUA 4OO1B 1NEIA 2ZITA 4LPFA 2ODRC 4AIDA 4P52A 2G7HA 5IWAI 2ZM6I 4KZSA 4NXNE 1U2RA 4B3TE 1YZ9A 1Y5YA 4OO1F 1AH5A 3NZKA 2NPFA 1Z0WA 1A6FA 2C37B 2HHHI 4JI0I 2MKDA 4ISAA 1MU5A 1ZBQA 2EMGA 2YSOA 4JYAE 4BA2B 5AE2A 3HXLA 2FGGA 4DPYA 4IZJD 5FLXC 4B3TI 3J7AG 4JI2E 4DV1I 4DV5I 2VESA 1USUA 3PYDA 3ECRA 4LF9E 3J81Q 1HK7A 1KKHA 2JXPA 2EPAA 3GONA 2EN7A 1NHIA 1FNMA 2JR1A 2LO3A 1X3CA 1HNXI 2VQEI 3B4TA 2EOYA 2EZ6A 3QT8A 1IQOA 1DARA 2EPUA 2BR2B 3OTOI 4BCAA 2ELZA 2N8XA 1OYRA 3V5RA 2UXCI 2KOUA 2L2KB 2LUPB 4X66E 1Y60A 2IERA 1T4NA 3FIGA 4RPFA 3KWRA 2DMIA 1Z5CA 2O1UA 2GPIA 4QNKA 1R6MA 1ZM3A 4FW5A 5JEAD 2YRMA 3BIDA 4JI6I 2PO1A 1G2DC 5K36A 4X9JA 1QU6A 5DRRA 4HACA 4MDTA 2UXCE 2BA0D 1PIEA 2KHXA 5C0XB 2L3JA 3P3CA 3WU4A 2RQLA 3EPHA 4FWDA 5DROA 3B78A 2VQFI 2C38A 4JI7I 2IOPA 3HQ1A 2HGHA 2EWLA 3PYFA 2BBGA 2EMIA 4MU0A 4LF6E 2GO4A 2YPNA 2YTQA 3EPKA 4LFBE 4HXZA 2EMLA 4KHPI 1N36I 5C0XA 2V89A 4WFTA 2MC6A 2WW4A 4DV0E 4AQYI 2BA1D 4JI8I 2HC5A 4GEQB 4R8OA 3LNUA 3F6HA 2ELYA 2EPXA 3VK6A 1UN6B 1N32E 3QT5A 4FW7A 1PKPA 4K0KI 4LFAE 1N33I 2JWOA 4MU3A 2BR2A 1XMOI 5DRQA 1ZAAC 1ZU1A 5AASA 1NHHA 2EM9A 4HEIA 2UUCE 3KZYA 1EH8A 2I13A 4FWHA 2NN6C 3CDIA 3EPLA 1Y4UA 2C39B 1N34E 2ENCA 4L5NC 1BKNA 3QT7A 5JEAF 4F9BB 4O5GA 4DPXA 5GMEA 1IBKI 4USKA 4I8OA 4BA2A 2UUCI 2LJPA 3LPSA 4M30A 3MHHC 2PNLA 2F4VE 4YHHE 1BBOA 3CDJA 4GZNC 3ZZTA 1N34I 3C4BA 1ZM9A 2LE2A 1LLMC 4IZJA 2FTXB 2LMZA 2NUFA 4FW6A 2PRTA 1XNQE 1T38A 2CPNA 4NBQA 4UTGA 1XNQI 5LLQA 4DR7E 4BA1A 3P1XA 1XMQI 2R76A 4JG4A 2DRPA 2BB8A 2HHHE 2VE7C 3UHMA 1NCSA 3PS2A 4IFDC 2EMCA 3ADJA 4P7AA 5K36F 4FK5C 2LT7A 3C4TA 2NABA 4WUCA 4LFCI 4WSPA 4B3MI 1IBMI 1XHKA 1XXEA 4DR1I 2PNZB 1P42A 4LTYA 1XMQE 4DR4I 4DV3I 4DUZE 1G2FC 1HNWI 4X62E 1O0WA 1AAYA 2GS8A 3QT6A 3WU3A 1PJTA 2RTXA 5JEAA 1GZ6A 2LTSA 2V8QB 3THOB 5A6BD 2JYAA 1IBME 2RS7A 1Z0EA 4J3DA 2EM0A 3LTOA 5A2QQ 1HNZE 5T6JA 1SR9A 4DV7E 1PVGA 2PO0A 4PRXA 2EMZA 2YT4A 2EMWA 2EOIA 3V2UC 1NZ0A 3T1YE 2C39A 2AJ4A 2YTNA 3UK3C 1E3HA 5A6JA 3HULA 1HR0I 2EPCA 2Z5BA 4DMIA 1Z59A 2L92A 1DQ3A 2UXBI 3RMPA 3F6GA 4RH8A 5JEAE 3M85G 3PS3A 2RSMA 4LF4I 5C0XD 4LF8E 3LLHA 4UT4A 5LMNE 2WBTA 1ZXNA 4BA1B 3GCMA 1RMDA 3M99B 1HR0E 1FJGE 2EL6A 2L8TA 5A6AA 2WCC3 4RHBB 3K17A 2UXBE 2EM4A 2O1VA 2PO2A 2EJ4A 1B69A 4B3RE 2KONA 5JEAB 1FWKA 4FWGA 5L3JA 2LRSA 1TF3A 1N0UA 4MQYA 4WXCA 4LCFA 2CSHA 1DI2A 4IFDF 1FJGI 2WZOA 1KYQA 2Z5CB 3ZOQB 1MG7A 1Z5AA 2O1TA 4I3HA 1ZBTA 2EN3A 2EN4A 4WSGA 2AE8A 2YU8A 2JEBB 2CTDA 1T4OA 4B3RI 3VYXA 4R2CA 1N32I 3ZKDA 2D9HA 3OMLA 4X65I 2E1MA 2DLKA 1VISA 4TUIA 2YZTA 4DV2I
chains in the Genus database with same CATH topology
5GMDA 1GQEA 4FN5A 2V87A 2A2CA 1YYKA 4TUGA 4IZJB 3ZZ0A 4DPWA 2IHR1 3LMLA 2XEXA 2H36X 2JOBA 1Z0CA 2LBSB 2UU9I 4FW9A 4PRVA 1OJ4A 1XNRE 2Q2EB 4X64E 2CZ9A 4HACB 2JY9A 2ZM6E 5BR8I 3J81C 2ZBKB 5IWAE 4DR2E 3P06A 4URLA 5FLXQ 4OX9I 4F54A 1S4EA 4JI0E 5BR8E 1B62A 2V8PA 1H73A 4ZVIA 2M4IA 4DPTA 4Z7CA 1WHNA 4DV1E 4DV5E 2F8BA 4OX9E 3JAMQ 2B7VA 3HPZA 3F0NA 3ADGA 1I94E 1YYOA 2NUEA 4OOGC 1HNXE 2MDRA 4GKJI 4DR6E 4JI1I 4WPYA 4DV4I 4DV6I 4JI5I 1H74A 1WHQA 4WUDA 4GKKI 4X66I 3T1HE 1EKZA 3CWVA 3J80Q 4JI3E 4JV5I 2B7TA 4R03A 2X36A 5ADZA 4WYQB 2VQFE 3T1HI 2LJHA 4M2ZA 4JV5E 4LFBI 2V83A 3JAMC 4JI4I 1N36E 4LF6I 1QZRA 4AQYE 4DV0I 4KHPE 1IBLE 1KTVA 4M1KA 2VF1A 5IT9Q 2CGEA 1ZXMA 4JI8E 5AE3A 4B3SE 1N33E 2HFSA 4BS9A 1XMOE 2B3TB 1X48A 3HJCA 2NUGA 3ADIA 4ED4A 4LFAI 2DSYA 2UUAE 1WUUA 2BM1A 4DPUA 4N3OA 1UEKA 4DU8A 4DV2E 1B63A 2N3GA 4KQVA 4EMDA 2ODRD 4BC9A 5CFFE 2UUAI 4YHHI 2L33A 3J7Yp 2UU9E 4Z7YA 2L3CA 1EA6A 1XNRI 2F4VI 2V2QA 5LMUI 2OI2A 4DR7I 2J7KA 4Q28A 3B82A 4LF9I 1FI4A 4JI2I 1RR9A 4X8WA 3HPSA 4F9CB 4DR4E 4B3ME 1USVA 2B9DA 2VQEE 4DR1E 2HKEA 4MYUA 5LL6R 4DUZI 2EFGA 4R1FA 2V88A 3M6AA 1HNZI 4IZKA 1H72C 3PYGA 2E5LI 4GKJE 3WU5A 2L2MA 1Z0TA 4DR6I 4JI1E 4YY3I 3K85A 4DV7I 4JI5E 3T1YI 4DR5E 1FWLA 3Q1QA 1J5EE 4JI3I 2E5LE 1ZM4A 4JI7E 4LF8I 5LMNI 2UXDE 4DR5I 2V85A 4LF5E 1J5EI 1RREA 4WUBA 4LU9A 1WXRA 2DEIA 1RQ0A 2DIXA 3H4LA 3J7AM 2HKJA 1K47A 2E1RA 2UXDI 1YYWA 2K4VA 2HK2A 4BC7A 3ADLA 4LF5I 3HTXA 2LUQA 1EI1A 1Z0BA 4USMA 1Y6ZA 3ZM7A 1IBLI 2A2DA 4F9AB 2V86A 1Z0VA 5AE1A 4DXLA 2Z5BB 2DMYA 1STUA 2X7IA 4X65E 1IBKE 2GQ0A 4PU9A 1ELOA 4MYTA 2L6MA 3JTZA 4NXNI 1D6TA 2LTRA 3JU0A 2R3VA 3WU6A 2M1SA 4JYAI 4X64I 4IZKB 3IWBA 4LFCE 5LMUE 1H7UA 2Z5EA 2V2VA 5F3WA 3Q6MA 1KIJA 1HNWE 4X62I 2NA2A 4DU7A 3Q6NA 3OTOE 3ZKBA 4DV3E 3ZZUA 2M7QA 4P78A 2CG9A 1J26A 2V34A 1T4LB 1N0VC 1X47A 1I94I 4JI6E 1ZM2A 2HFUA 1MX0A 3H09A 4LF7E 4NXME 3J80C 2DEJA 1NHJA 1RC7A 3VYYA 5FWKA 5DNYA 2N3HA 4DV4E 4DV6E 1Y4SA 2DB2A 4GKKE 4LF7I 1FKAE 4NXMI 2V2ZA 4YY3E 2BM0A 2L2NA 4LF4E 3B8HA 2RS6A 5IT9C 4BMJA 4DR3E 1S16A 4DUYE 3IWDA 1KVKA 4M0VA 2PNMA 2FV4B 1Z5BA 3IWCA 2R42A 2BV3A 4P7DA 2JOXA 4DR3I 2VF3A 4JI4E 4DUYI 4K0KE 1UHZA 4DKKA 3DF6A 5A2QC 1H7SA 2UUBI 3D4JA 4B3SI 4HYMA 4HY1A 4BBYA 2O1WA 4L8NA 1UILA 3K1JA 4XTJA 3DJWA 3AV0A 4J8ZA 2HK3A 3PYEA 2UUBE 1Z0GA 1X49A 3AUZA 3PRYA 3K6QA 2MC5A 2Z5CA 2IOQA 2JVAA 3MSWA 2ZITA 1XNQI 2ODRC 2ZM6I 4P52A 2G7HA 5IWAI 4DR2I 4KZSA 4NXNE 1U2RA 4B3TE 1YZ9A 2NPFA 1Z0WA 1A6FA 2HHHI 4JI0I 1MU5A 1ZBQA 4JYAE 5AE2A 3HXLA 2FGGA 4DPYA 4IZJD 5FLXC 4B3TI 3J7AG 4JI2E 4DV1I 4DV5I 1USUA 3PYDA 4LF9E 3J81Q 1HK7A 1KKHA 3GONA 1NHIA 1FNMA 2JR1A 1HNXI 2VQEI 2EZ6A 3QT8A 1DARA 3OTOI 4BCAA 3V5RA 2UXCI 2KOUA 2L2KB 2LUPB 4X66E 1T4NA 3FIGA 4RPFA 3KWRA 1Z5CA 2O1UA 1ZM3A 4JI6I 1QU6A 4HACA 2UXCE 1PIEA 2KHXA 2L3JA 3WU4A 4FWDA 3B78A 2VQFI 4JI7I 2IOPA 3HQ1A 3PYFA 2EWLA 4LF6E 4HXZA 4LFBE 4KHPI 1N36I 2V89A 4WFTA 2MC6A 2WW4A 4DV0E 4AQYI 4JI8I 4GEQB 4R8OA 3LNUA 3F6HA 3VK6A 1N32E 3QT5A 1PKPA 4K0KI 4LFAE 1N33I 2JWOA 1XMOI 1NHHA 5AASA 2UUCE 4FWHA 1Y4UA 1N34E 4L5NC 1BKNA 3QT7A 4F9BB 4DPXA 5GMEA 1IBKI 4USKA 4I8OA 2UUCI 2LJPA 3LPSA 4M30A 2PNLA 2F4VE 4YHHE 3ZZTA 1N34I 3C4BA 1ZM9A 2LE2A 4IZJA 2FTXB 2LMZA 2NUFA 1XNQE 2CPNA 4UTGA 4DR7E 1XMQI 3P1XA 4JG4A 2HHHE 2VE7C 3ADJA 4P7AA 3C4TA 4LFCI 4WUCA 4B3MI 4WSPA 1IBMI 1XHKA 4DR1I 4LTYA 1XMQE 4DR4I 4DV3I 4DUZE 1HNWI 4X62E 1O0WA 2GS8A 3QT6A 3WU3A 2RTXA 1GZ6A 2LTSA 2V8QB 1IBME 2RS7A 1Z0EA 3LTOA 5A2QQ 1HNZE 5T6JA 1SR9A 4DV7E 1PVGA 4PRXA 2YT4A 3V2UC 1NZ0A 3T1YE 2AJ4A 3HULA 1HR0I 2Z5BA 4DMIA 1Z59A 2L92A 1DQ3A 2UXBI 3RMPA 3F6GA 2RSMA 4LF4I 4LF8E 3LLHA 4UT4A 5LMNE 1ZXNA 1FJGE 1HR0E 2L8TA 3K17A 2UXBE 2O1VA 4B3RE 2KONA 1FWKA 4FWGA 5L3JA 2LRSA 1N0UA 1DI2A 1FJGI 2WZOA 2Z5CB 3ZOQB 1MG7A 1Z5AA 2O1TA 4I3HA 1ZBTA 1T4OA 4B3RI 3VYXA 1N32I 3ZKDA 3OMLA 4X65I 2E1MA 1VISA 4TUIA 2YZTA 4DV2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMD A;  1GQE A;  4FN5 A;  2A2C A;  1YYK A;  4DPW A;  3ZZ0 A;  2IHR 1;  2XEX A;  2LBS B;  2UU9 I;  4FW9 A;  4PRV A;  1OJ4 A;  1XNR E;  2Q2E B;  4X64 E;  2CZ9 A;  4HAC B;  2JY9 A;  2ZM6 E;  5BR8 I;  3J81 C;  2ZBK B;  5IWA E;  4DR2 E;  4URL A;  5FLX Q;  4OX9 I;  1S4E A;  4JI0 E;  5BR8 E;  1B62 A;  2V8P A;  1H73 A;  4ZVI A;  4DPT A;  4Z7C A;  1WHN A;  4DV1 E;  4DV5 E;  3JAM Q;  4OX9 E;  2B7V A;  3F0N A;  3ADG A;  1I94 E;  1YYO A;  2NUE A;  4OOG C;  1HNX E;  2MDR A;  4GKJ I;  4DR6 E;  4JI1 I;  4DV4 I;  4DV6 I;  4JI5 I;  1H74 A;  1WHQ A;  4WUD A;  4GKK I;  4X66 I;  3T1H E;  1EKZ A;  3CWV A;  3J80 Q;  4JI3 E;  4JV5 I;  2B7T A;  2X36 A;  4WYQ B;  2VQF E;  3T1H I;  2LJH A;  4M2Z A;  4JV5 E;  4LFB I;  3JAM C;  4JI4 I;  1N36 E;  4LF6 I;  1QZR A;  4AQY E;  4DV0 I;  4KHP E;  1IBL E;  1KTV A;  4M1K A;  5IT9 Q;  1ZXM A;  4JI8 E;  4B3S E;  1N33 E;  2HFS A;  1XMO E;  2B3T B;  1X48 A;  2NUG A;  3ADI A;  4ED4 A;  4LFA I;  2UUA E;  1WUU A;  2BM1 A;  4DPU A;  1UEK A;  4DU8 A;  4DV2 E;  1B63 A;  2N3G A;  4KQV A;  4EMD A;  5CFF E;  2UUA I;  4YHH I;  2L33 A;  3J7Y p;  2UU9 E;  4Z7Y A;  2L3C A;  1EA6 A;  1XNR I;  2F4V I;  2V2Q A;  5LMU I;  2OI2 A;  4DR7 I;  2J7K A;  3B82 A;  4LF9 I;  1FI4 A;  4JI2 I;  1RR9 A;  4X8W A;  4DR4 E;  4B3M E;  2VQE E;  4DR1 E;  2HKE A;  4MYU A;  5LL6 R;  4DUZ I;  2EFG A;  4R1F A;  3M6A A;  1HNZ I;  1H72 C;  3PYG A;  2E5L I;  4GKJ E;  3WU5 A;  2L2M A;  1Z0T A;  4DR6 I;  4JI1 E;  4YY3 I;  4DV7 I;  4JI5 E;  3T1Y I;  4DR5 E;  1FWL A;  3Q1Q A;  1J5E E;  4JI3 I;  2E5L E;  1ZM4 A;  4JI7 E;  4LF8 I;  5LMN I;  2UXD E;  4DR5 I;  4LF5 E;  1J5E I;  1RRE A;  4WUB A;  2DEI A;  1RQ0 A;  2DIX A;  3H4L A;  3J7A M;  2HKJ A;  1K47 A;  2E1R A;  2UXD I;  1YYW A;  2HK2 A;  4LF5 I;  3ADL A;  3HTX A;  2LUQ A;  1EI1 A;  1Z0B A;  4USM A;  3ZM7 A;  1IBL I;  2A2D A;  1Z0V A;  4DXL A;  2DMY A;  1STU A;  2X7I A;  4X65 E;  1IBK E;  4PU9 A;  1ELO A;  4MYT A;  4NXN I;  1D6T A;  2LTR A;  2R3V A;  3WU6 A;  4JYA I;  4X64 I;  4LFC E;  5LMU E;  1H7U A;  2V2V A;  1KIJ A;  1HNW E;  4X62 I;  2NA2 A;  4DU7 A;  3ZKB A;  3OTO E;  4DV3 E;  3ZZU A;  1J26 A;  2V34 A;  1T4L B;  1N0V C;  1X47 A;  1I94 I;  4JI6 E;  2HFU A;  1ZM2 A;  1MX0 A;  4LF7 E;  4NXM E;  3J80 C;  2DEJ A;  1NHJ A;  1RC7 A;  3VYY A;  2N3H A;  4DV4 E;  4DV6 E;  2DB2 A;  4GKK E;  4LF7 I;  1FKA E;  4NXM I;  2V2Z A;  4YY3 E;  2BM0 A;  2L2N A;  4LF4 E;  3B8H A;  2RS6 A;  5IT9 C;  4DR3 E;  1S16 A;  4DUY E;  1KVK A;  1Z5B A;  2R42 A;  2BV3 A;  4DR3 I;  2VF3 A;  4JI4 E;  4DUY I;  4K0K E;  1UHZ A;  4DKK A;  5A2Q C;  1H7S A;  2UUB I;  3D4J A;  4B3S I;  4HYM A;  4HY1 A;  1UIL A;  3K1J A;  4XTJ A;  2HK3 A;  3PYE A;  2UUB E;  1Z0G A;  1X49 A;  2JVA A;  2ZIT A;  1XNQ I;  2ZM6 I;  4P52 A;  5IWA I;  4DR2 I;  1U2R A;  4NXN E;  4B3T E;  1YZ9 A;  2NPF A;  1Z0W A;  1A6F A;  2HHH I;  4JI0 I;  1MU5 A;  4JYA E;  4DPY A;  5FLX C;  4B3T I;  3J7A G;  4JI2 E;  4DV1 I;  4DV5 I;  3PYD A;  4LF9 E;  3J81 Q;  1KKH A;  3GON A;  1NHI A;  1FNM A;  1HNX I;  2VQE I;  3QT8 A;  2EZ6 A;  1DAR A;  3OTO I;  3V5R A;  2UXC I;  2L2K B;  2LUP B;  4X66 E;  1T4N A;  4RPF A;  1Z5C A;  1ZM3 A;  4JI6 I;  1QU6 A;  4HAC A;  2UXC E;  1PIE A;  2KHX A;  2L3J A;  3WU4 A;  4FWD A;  3B78 A;  2VQF I;  4JI7 I;  3PYF A;  4HXZ A;  4LF6 E;  4LFB E;  4KHP I;  1N36 I;  4WFT A;  2WW4 A;  4DV0 E;  4AQY I;  4JI8 I;  3LNU A;  1N32 E;  3QT5 A;  1PKP A;  4K0K I;  4LFA E;  1N33 I;  1XMO I;  1NHH A;  2UUC E;  4FWH A;  1N34 E;  1BKN A;  3QT7 A;  4DPX A;  5GME A;  1IBK I;  4USK A;  2UUC I;  2LJP A;  3LPS A;  4M30 A;  2F4V E;  4YHH E;  3ZZT A;  1N34 I;  3C4B A;  1ZM9 A;  2NUF A;  1XNQ E;  2CPN A;  4UTG A;  4DR7 E;  1XMQ I;  3P1X A;  4JG4 A;  2HHH E;  3ADJ A;  4P7A A;  3C4T A;  4LFC I;  4WUC A;  4B3M I;  1IBM I;  1XHK A;  4DR1 I;  1XMQ E;  4DR4 I;  4DV3 I;  4DUZ E;  1HNW I;  4X62 E;  1O0W A;  2GS8 A;  3QT6 A;  3WU3 A;  2RTX A;  2LTS A;  1IBM E;  2RS7 A;  1Z0E A;  3LTO A;  5A2Q Q;  1HNZ E;  1PVG A;  4DV7 E;  4PRX A;  2YT4 A;  3V2U C;  1NZ0 A;  3T1Y E;  2AJ4 A;  3HUL A;  1HR0 I;  1Z59 A;  2UXB I;  2RSM A;  4LF4 I;  4LF8 E;  3LLH A;  4UT4 A;  5LMN E;  1ZXN A;  1FJG E;  1HR0 E;  3K17 A;  2UXB E;  4B3R E;  1FWK A;  4FWG A;  5L3J A;  2LRS A;  1N0U A;  1DI2 A;  1FJG I;  1MG7 A;  1Z5A A;  4I3H A;  1ZBT A;  1T4O A;  4B3R I;  3VYX A;  1N32 I;  3ZKD A;  4X65 I;  1VIS A;  1Z0C A;  4DV2 I; 
#chains in the Genus database with same CATH topology
 5GMD A;  1GQE A;  4FN5 A;  2RPC A;  2V87 A;  3U1K A;  2A2C A;  1YYK A;  4TUG A;  4IZJ B;  3ZZ0 A;  4DPW A;  2IHR 1;  3LML A;  3MHS C;  5KL5 A;  2XEX A;  2YWQ A;  1BBG A;  2H36 X;  2JOB A;  1Z0C A;  2LBS B;  2F1D A;  2JE6 B;  1WJP A;  2WBU A;  3KRN A;  4FW9 A;  2UU9 I;  2WNR A;  1OJ4 A;  4PRV A;  5A69 A;  1XNR E;  5ELW A;  2Q2E B;  5DNX A;  2EQ0 A;  4X64 E;  1DGC A;  2CZ9 A;  4HAC B;  2JY9 A;  2EMA A;  2ZM6 E;  5BR8 I;  3J81 C;  2Q8U A;  2ZBK B;  1A1J A;  4LCH A;  2EPK X;  5IWA E;  4DR2 E;  3P06 A;  4URL A;  5FLX Q;  4OX9 I;  1A1F A;  4F54 A;  4R2P A;  1S4E A;  4IFD E;  1YUI A;  4JI0 E;  5BR8 E;  1B62 A;  5KL4 A;  2V8P A;  3VHT B;  1H73 A;  4ZVI A;  2EPR A;  2M4I A;  2EOS A;  4DPT A;  4Z7C A;  2NN6 E;  1WHN A;  1E3P A;  4DV1 E;  4DV5 E;  2F8B A;  4OX9 E;  2NN6 B;  3JAM Q;  2EM8 A;  2B7V A;  2YTP A;  1R6L A;  3HPZ A;  2A25 A;  3F0N A;  3ADG A;  1I94 E;  4O24 A;  1YYO A;  2NUE A;  4OOG C;  2YTD A;  1HNX E;  2J7J A;  2MDR A;  4IJD A;  4GKJ I;  2LVH A;  4GQU A;  2HJJ A;  2DLQ A;  4DR6 E;  4R2Q A;  4JI1 I;  4WPY A;  2VRD A;  3L7Z A;  4DV4 I;  2E72 A;  4DV6 I;  4JI5 I;  1QNT A;  1WHQ A;  3C6K A;  2WBS A;  1H74 A;  4WUD A;  4X66 I;  4GKK I;  5K36 E;  2JEA B;  3M7N G;  3T1H E;  1EKZ A;  3CWV A;  3J80 Q;  1T39 A;  5DRP A;  4JI3 E;  5AC5 A;  2B7T A;  4R03 A;  2PO2 B;  2WP8 B;  4JV5 I;  1N3G A;  2X36 A;  4LCG A;  5ADZ A;  4R2R A;  4BHB A;  2EMF A;  4WYQ B;  2VQF E;  1TF6 A;  1UDQ A;  3T1H I;  2LJH A;  5K36 B;  4M2Z A;  2YTG A;  4JV5 E;  2EN1 A;  4LFB I;  2GHF A;  2V83 A;  3JAM C;  4JI4 I;  1N36 E;  4LF6 I;  3L00 A;  1QZR A;  4AQY E;  4DV0 I;  4KHP E;  2EMH A;  5AC4 A;  2K7I A;  1IBL E;  1KTV A;  3EPJ A;  4M1K A;  2VF1 A;  2EOR A;  5IT9 Q;  4F6N A;  2CGE A;  3TQM A;  4JI8 E;  1ZXM A;  5AE3 A;  4B3S E;  1X5W A;  1N33 E;  3KZZ A;  4R2D A;  1MEY C;  2HFS A;  4BS9 A;  1XMO E;  2B3T B;  1X48 A;  2BA1 G;  2NUG A;  3ADI A;  3HJC A;  5EL9 A;  5IV8 B;  2EN2 A;  4ED4 A;  4LFA I;  1YFH A;  1L4S A;  3EQ1 A;  5KL7 A;  2DSY A;  2UUA E;  2EPZ A;  1WUU A;  2BM1 A;  4DPU A;  4O4K A;  4N3O A;  5KL2 A;  1UEK A;  2CT1 A;  4DV2 E;  1B63 A;  4DU8 A;  2N3G A;  2YRK A;  1JK1 A;  4KQV A;  4EMD A;  2EM6 A;  3L7Z B;  2ODR D;  3PS1 A;  4BC9 A;  5CFF E;  4Q35 B;  4BHC A;  2UUA I;  2EPN A;  4YHH I;  2L33 A;  3J7Y p;  2UU9 E;  2BA0 G;  4Z7Y A;  2ENA A;  2EPM X;  2L3C A;  1A1K A;  4ZYG A;  1EA6 A;  1XNR I;  2YU5 A;  2F4V I;  3BF2 A;  2V2Q A;  1Z1B A;  5LMU I;  2OI2 A;  4AM3 A;  2NN6 A;  1IQS A;  2M9A A;  1EH7 A;  4DR7 I;  2J7K A;  1YPN A;  1A1L A;  1YHC A;  4ZYD A;  1UDS A;  4Q28 A;  3M7N D;  4MLV A;  4WXD A;  3B82 A;  4LF9 I;  1PJQ A;  1FI4 A;  2LJU A;  4JI2 I;  1RR9 A;  4IFD A;  2EOE A;  2ADR A;  4X8W A;  3C6M A;  4MU1 A;  3HPS A;  4F9C B;  4DR4 E;  3P76 A;  4B3M E;  1USV A;  4ZYE A;  2B9D A;  1A1I A;  2VQE E;  4DR1 E;  2HKE A;  4MYU A;  2JP9 A;  2EL5 A;  5LL6 R;  4NHR A;  4DUZ I;  4F6M A;  2EFG A;  4R1F A;  2V88 A;  1RHY A;  3M6A A;  1VI7 A;  1HNZ I;  4IZK A;  1H72 C;  3PYG A;  2EPL X;  2E5L I;  2EMY A;  4GKJ E;  4NZV A;  3WU5 A;  4OKG A;  2L2M A;  1Z0T A;  4IFD B;  2YSP A;  4DR6 I;  4JI1 E;  4YY3 I;  3K85 A;  4DV7 I;  4JI5 E;  3T1Y I;  4DR5 E;  1FWL A;  3Q1Q A;  1J5E E;  2EQ3 A;  4JI3 I;  2E5L E;  1ZM4 A;  4O43 A;  4JI7 E;  4LF8 I;  5LMN I;  2UXD E;  5K36 C;  4DR5 I;  4MU4 A;  2V85 A;  4LF5 E;  1J5E I;  1RRE A;  4WUB A;  4LU9 A;  1WXR A;  2C37 A;  4AIM A;  2DEI A;  1RQ0 A;  2DIX A;  3H4L A;  3J7A M;  2HKJ A;  1K47 A;  2E1R A;  2JEB A;  2UXD I;  1YYW A;  2K4V A;  2HK2 A;  2EM3 A;  4ZYH A;  4BC7 A;  3ADL A;  2PNZ A;  3HTX A;  2LUQ A;  1UDN A;  5KL3 A;  1EI1 A;  1TN9 A;  1Y6Z A;  1Z0B A;  2NN6 F;  2WP8 A;  3P3G A;  3ZM7 A;  4USM A;  1IBL I;  2A2D A;  4F9A B;  5EKW A;  2V86 A;  1UBD C;  1Z0V A;  1F2I G;  4IS9 A;  1SFE A;  4HTG A;  1MGT A;  1ZR9 A;  2EL4 A;  5AE1 A;  1YSA C;  4DXL A;  2Z5B B;  2DMY A;  3HKM A;  1STU A;  4R2A A;  2X7I A;  4X65 E;  1P47 A;  1IBK E;  2GQ0 A;  4PU9 A;  2MKN A;  1OYP A;  4OO1 E;  2YTO A;  4M9V C;  1ELO A;  2EM7 A;  1X6H A;  4MYT A;  2L6M A;  1A1H A;  4OO1 D;  3JTZ A;  2GLI A;  4DR2 I;  2EM2 A;  2EPO A;  4NXN I;  2NN6 D;  1D6T A;  1PJS A;  2LTR A;  3JU0 A;  2EOQ A;  2R3V A;  3WU6 A;  2M1S A;  2CVE A;  4R2S A;  4JYA I;  2EMX A;  4X64 I;  4IZK B;  2YTI A;  3IWB A;  2EOX A;  4LFC E;  2WNR B;  5LMU E;  1H7U A;  2Z5E A;  2V2V A;  4LF5 I;  5F3W A;  2DGC A;  1KIJ A;  3Q6M A;  2JPA A;  3GLL A;  1HNW E;  3U1Y A;  4X62 I;  2YTE A;  2NA2 A;  1JK2 A;  4DU7 A;  2EPP A;  3Q6N A;  3OTO E;  2EE8 A;  4DV3 E;  3QG5 C;  3ZKB A;  2O3Z A;  3ZZU A;  4LOM A;  2M7Q A;  4P78 A;  2CG9 A;  2EOJ A;  4F2J C;  1J26 A;  2V34 A;  2EN8 A;  2EN6 A;  3GME A;  1T4L B;  1PDA A;  1N0V C;  4OZE A;  1X47 A;  4KWY A;  3BGH A;  1I94 I;  4JI6 E;  5IXM B;  4FW3 A;  2YRH A;  1ZM2 A;  2HFU A;  1MX0 A;  3H09 A;  4LF7 E;  4NXM E;  2LV2 A;  3J80 C;  2DEJ A;  4U3D A;  1NHJ A;  1RC7 A;  3VYY A;  2EMB A;  2EQ1 A;  1KJK A;  5FWK A;  5DNY A;  1UDO A;  2N3H A;  4DV4 E;  4DV6 E;  1Y4S A;  2DB2 A;  4GKK E;  4WX9 A;  5C0X C;  4LF7 I;  1FKA E;  4NXM I;  5K36 D;  2V2Z A;  4U3B A;  1X6E A;  4YY3 E;  2BM0 A;  2L2N A;  4LF4 E;  2RSI A;  2RS6 A;  5KL6 A;  5IT9 C;  1YH8 A;  4BMJ A;  3B8H A;  4DR3 E;  2GO3 A;  2EOO A;  1S16 A;  4DUY E;  2J65 A;  1BB8 A;  2PO1 B;  3IWD A;  1YUJ A;  2JT2 A;  3THN A;  1KVK A;  4M0V A;  2PNM A;  2FV4 B;  1Z5B A;  2YTF A;  3IWC A;  5A6K A;  2R42 A;  2BV3 A;  3P3E A;  4P7D A;  2JOX A;  4R2E A;  1A1G A;  5C0X F;  2R1F A;  2IES A;  2VF3 A;  5C0X E;  4DR3 I;  4JI4 E;  2EOH A;  4DUY I;  4K0K E;  3M85 D;  1UHZ A;  4DKK A;  3DF6 A;  5A2Q C;  4IS1 C;  5A6B A;  1WRJ A;  2EMK A;  2MDG A;  1H7S A;  2UUB I;  3H1C A;  3D4J A;  2ENH A;  5TSE A;  2JE6 A;  4FW4 A;  4B3S I;  4IFD D;  2EP3 A;  3DD6 A;  1OYS A;  4HYM A;  2EOM A;  4HY1 A;  3BBG A;  4BBY A;  4L8N A;  2O1W A;  2YTJ A;  5DNL A;  1UIL A;  2I9I A;  3K1J A;  2PO0 B;  4OO1 A;  4XTJ A;  2EOF A;  3DJW A;  3AV0 A;  4J8Z A;  4MLQ A;  2HK3 A;  3PYE A;  4OO1 C;  2UUB E;  2LCE A;  1Z0G A;  1X49 A;  3AUZ A;  1X6F A;  1GTK A;  2C38 B;  2EOZ A;  4N4R B;  3PRY A;  4QNJ A;  3K6Q A;  5JEA C;  2JEA A;  2MC5 A;  2Z5C A;  2IOQ A;  2EM5 A;  1EH6 A;  2JVA A;  3MSW A;  1IMU A;  4OO1 B;  1NEI A;  2ZIT A;  4LPF A;  2ODR C;  4AID A;  4P52 A;  2G7H A;  5IWA I;  2ZM6 I;  4KZS A;  4NXN E;  1U2R A;  4B3T E;  1YZ9 A;  1Y5Y A;  4OO1 F;  1AH5 A;  3NZK A;  2NPF A;  1Z0W A;  1A6F A;  2C37 B;  2HHH I;  4JI0 I;  2MKD A;  4ISA A;  1MU5 A;  1ZBQ A;  2EMG A;  2YSO A;  4JYA E;  4BA2 B;  5AE2 A;  3HXL A;  2FGG A;  4DPY A;  4IZJ D;  5FLX C;  4B3T I;  3J7A G;  4JI2 E;  4DV1 I;  4DV5 I;  2VES A;  1USU A;  3PYD A;  3ECR A;  4LF9 E;  3J81 Q;  1HK7 A;  1KKH A;  2JXP A;  2EPA A;  3GON A;  2EN7 A;  1NHI A;  1FNM A;  2JR1 A;  2LO3 A;  1X3C A;  1HNX I;  2VQE I;  3B4T A;  2EOY A;  2EZ6 A;  3QT8 A;  1IQO A;  1DAR A;  2EPU A;  2BR2 B;  3OTO I;  4BCA A;  2ELZ A;  2N8X A;  1OYR A;  3V5R A;  2UXC I;  2KOU A;  2L2K B;  2LUP B;  4X66 E;  1Y60 A;  2IER A;  1T4N A;  3FIG A;  4RPF A;  3KWR A;  2DMI A;  1Z5C A;  2O1U A;  2GPI A;  4QNK A;  1R6M A;  1ZM3 A;  4FW5 A;  5JEA D;  2YRM A;  3BID A;  4JI6 I;  2PO1 A;  1G2D C;  5K36 A;  4X9J A;  1QU6 A;  5DRR A;  4HAC A;  4MDT A;  2UXC E;  2BA0 D;  1PIE A;  2KHX A;  5C0X B;  2L3J A;  3P3C A;  3WU4 A;  2RQL A;  3EPH A;  4FWD A;  5DRO A;  3B78 A;  2VQF I;  2C38 A;  4JI7 I;  2IOP A;  3HQ1 A;  2HGH A;  2EWL A;  3PYF A;  2BBG A;  2EMI A;  4MU0 A;  4LF6 E;  2GO4 A;  2YPN A;  2YTQ A;  3EPK A;  4LFB E;  4HXZ A;  2EML A;  4KHP I;  1N36 I;  5C0X A;  2V89 A;  4WFT A;  2MC6 A;  2WW4 A;  4DV0 E;  4AQY I;  2BA1 D;  4JI8 I;  2HC5 A;  4GEQ B;  4R8O A;  3LNU A;  3F6H A;  2ELY A;  2EPX A;  3VK6 A;  1UN6 B;  1N32 E;  3QT5 A;  4FW7 A;  1PKP A;  4K0K I;  4LFA E;  1N33 I;  2JWO A;  4MU3 A;  2BR2 A;  1XMO I;  5DRQ A;  1ZAA C;  1ZU1 A;  5AAS A;  1NHH A;  2EM9 A;  4HEI A;  2UUC E;  3KZY A;  1EH8 A;  2I13 A;  4FWH A;  2NN6 C;  3CDI A;  3EPL A;  1Y4U A;  2C39 B;  1N34 E;  2ENC A;  4L5N C;  1BKN A;  3QT7 A;  5JEA F;  4F9B B;  4O5G A;  4DPX A;  5GME A;  1IBK I;  4USK A;  4I8O A;  4BA2 A;  2UUC I;  2LJP A;  3LPS A;  4M30 A;  3MHH C;  2PNL A;  2F4V E;  4YHH E;  1BBO A;  3CDJ A;  4GZN C;  3ZZT A;  1N34 I;  3C4B A;  1ZM9 A;  2LE2 A;  1LLM C;  4IZJ A;  2FTX B;  2LMZ A;  2NUF A;  4FW6 A;  2PRT A;  1XNQ E;  1T38 A;  2CPN A;  4NBQ A;  4UTG A;  1XNQ I;  5LLQ A;  4DR7 E;  4BA1 A;  3P1X A;  1XMQ I;  2R76 A;  4JG4 A;  2DRP A;  2BB8 A;  2HHH E;  2VE7 C;  3UHM A;  1NCS A;  3PS2 A;  4IFD C;  2EMC A;  3ADJ A;  4P7A A;  5K36 F;  4FK5 C;  2LT7 A;  3C4T A;  2NAB A;  4WUC A;  4LFC I;  4WSP A;  4B3M I;  1IBM I;  1XHK A;  1XXE A;  4DR1 I;  2PNZ B;  1P42 A;  4LTY A;  1XMQ E;  4DR4 I;  4DV3 I;  4DUZ E;  1G2F C;  1HNW I;  4X62 E;  1O0W A;  1AAY A;  2GS8 A;  3QT6 A;  3WU3 A;  1PJT A;  2RTX A;  5JEA A;  1GZ6 A;  2LTS A;  2V8Q B;  3THO B;  5A6B D;  2JYA A;  1IBM E;  2RS7 A;  1Z0E A;  4J3D A;  2EM0 A;  3LTO A;  5A2Q Q;  1HNZ E;  5T6J A;  1SR9 A;  4DV7 E;  1PVG A;  2PO0 A;  4PRX A;  2EMZ A;  2YT4 A;  2EMW A;  2EOI A;  3V2U C;  1NZ0 A;  3T1Y E;  2C39 A;  2AJ4 A;  2YTN A;  3UK3 C;  1E3H A;  5A6J A;  3HUL A;  1HR0 I;  2EPC A;  2Z5B A;  4DMI A;  1Z59 A;  2L92 A;  1DQ3 A;  2UXB I;  3RMP A;  3F6G A;  4RH8 A;  5JEA E;  3M85 G;  3PS3 A;  2RSM A;  4LF4 I;  5C0X D;  4LF8 E;  3LLH A;  4UT4 A;  5LMN E;  2WBT A;  1ZXN A;  4BA1 B;  3GCM A;  1RMD A;  3M99 B;  1HR0 E;  1FJG E;  2EL6 A;  2L8T A;  5A6A A;  2WCC 3;  4RHB B;  3K17 A;  2UXB E;  2EM4 A;  2O1V A;  2PO2 A;  2EJ4 A;  1B69 A;  4B3R E;  2KON A;  5JEA B;  1FWK A;  4FWG A;  5L3J A;  2LRS A;  1TF3 A;  1N0U A;  4MQY A;  4WXC A;  4LCF A;  2CSH A;  1DI2 A;  4IFD F;  1FJG I;  2WZO A;  1KYQ A;  2Z5C B;  3ZOQ B;  1MG7 A;  1Z5A A;  2O1T A;  4I3H A;  1ZBT A;  2EN3 A;  2EN4 A;  4WSG A;  2AE8 A;  2YU8 A;  2JEB B;  2CTD A;  1T4O A;  4B3R I;  3VYX A;  4R2C A;  1N32 I;  3ZKD A;  2D9H A;  3OML A;  4X65 I;  2E1M A;  2DLK A;  1VIS A;  4TUI A;  2YZT A;  4DV2 I; 
#chains in the Genus database with same CATH homology
 5GMD A;  1GQE A;  4FN5 A;  2V87 A;  2A2C A;  1YYK A;  4TUG A;  4IZJ B;  3ZZ0 A;  4DPW A;  2IHR 1;  3LML A;  2XEX A;  2H36 X;  2JOB A;  1Z0C A;  2LBS B;  2UU9 I;  4FW9 A;  4PRV A;  1OJ4 A;  1XNR E;  2Q2E B;  4X64 E;  2CZ9 A;  4HAC B;  2JY9 A;  2ZM6 E;  5BR8 I;  3J81 C;  2ZBK B;  5IWA E;  4DR2 E;  3P06 A;  4URL A;  5FLX Q;  4OX9 I;  4F54 A;  1S4E A;  4JI0 E;  5BR8 E;  1B62 A;  2V8P A;  1H73 A;  4ZVI A;  2M4I A;  4DPT A;  4Z7C A;  1WHN A;  4DV1 E;  4DV5 E;  2F8B A;  4OX9 E;  3JAM Q;  2B7V A;  3HPZ A;  3F0N A;  3ADG A;  1I94 E;  1YYO A;  2NUE A;  4OOG C;  1HNX E;  2MDR A;  4GKJ I;  4DR6 E;  4JI1 I;  4WPY A;  4DV4 I;  4DV6 I;  4JI5 I;  1H74 A;  1WHQ A;  4WUD A;  4GKK I;  4X66 I;  3T1H E;  1EKZ A;  3CWV A;  3J80 Q;  4JI3 E;  4JV5 I;  2B7T A;  4R03 A;  2X36 A;  5ADZ A;  4WYQ B;  2VQF E;  3T1H I;  2LJH A;  4M2Z A;  4JV5 E;  4LFB I;  2V83 A;  3JAM C;  4JI4 I;  1N36 E;  4LF6 I;  1QZR A;  4AQY E;  4DV0 I;  4KHP E;  1IBL E;  1KTV A;  4M1K A;  2VF1 A;  5IT9 Q;  2CGE A;  1ZXM A;  4JI8 E;  5AE3 A;  4B3S E;  1N33 E;  2HFS A;  4BS9 A;  1XMO E;  2B3T B;  1X48 A;  3HJC A;  2NUG A;  3ADI A;  4ED4 A;  4LFA I;  2DSY A;  2UUA E;  1WUU A;  2BM1 A;  4DPU A;  4N3O A;  1UEK A;  4DU8 A;  4DV2 E;  1B63 A;  2N3G A;  4KQV A;  4EMD A;  2ODR D;  4BC9 A;  5CFF E;  2UUA I;  4YHH I;  2L33 A;  3J7Y p;  2UU9 E;  4Z7Y A;  2L3C A;  1EA6 A;  1XNR I;  2F4V I;  2V2Q A;  5LMU I;  2OI2 A;  4DR7 I;  2J7K A;  4Q28 A;  3B82 A;  4LF9 I;  1FI4 A;  4JI2 I;  1RR9 A;  4X8W A;  3HPS A;  4F9C B;  4DR4 E;  4B3M E;  1USV A;  2B9D A;  2VQE E;  4DR1 E;  2HKE A;  4MYU A;  5LL6 R;  4DUZ I;  2EFG A;  4R1F A;  2V88 A;  3M6A A;  1HNZ I;  4IZK A;  1H72 C;  3PYG A;  2E5L I;  4GKJ E;  3WU5 A;  2L2M A;  1Z0T A;  4DR6 I;  4JI1 E;  4YY3 I;  3K85 A;  4DV7 I;  4JI5 E;  3T1Y I;  4DR5 E;  1FWL A;  3Q1Q A;  1J5E E;  4JI3 I;  2E5L E;  1ZM4 A;  4JI7 E;  4LF8 I;  5LMN I;  2UXD E;  4DR5 I;  2V85 A;  4LF5 E;  1J5E I;  1RRE A;  4WUB A;  4LU9 A;  1WXR A;  2DEI A;  1RQ0 A;  2DIX A;  3H4L A;  3J7A M;  2HKJ A;  1K47 A;  2E1R A;  2UXD I;  1YYW A;  2K4V A;  2HK2 A;  4BC7 A;  3ADL A;  4LF5 I;  3HTX A;  2LUQ A;  1EI1 A;  1Z0B A;  4USM A;  1Y6Z A;  3ZM7 A;  1IBL I;  2A2D A;  4F9A B;  2V86 A;  1Z0V A;  5AE1 A;  4DXL A;  2Z5B B;  2DMY A;  1STU A;  2X7I A;  4X65 E;  1IBK E;  2GQ0 A;  4PU9 A;  1ELO A;  4MYT A;  2L6M A;  3JTZ A;  4NXN I;  1D6T A;  2LTR A;  3JU0 A;  2R3V A;  3WU6 A;  2M1S A;  4JYA I;  4X64 I;  4IZK B;  3IWB A;  4LFC E;  5LMU E;  1H7U A;  2Z5E A;  2V2V A;  5F3W A;  3Q6M A;  1KIJ A;  1HNW E;  4X62 I;  2NA2 A;  4DU7 A;  3Q6N A;  3OTO E;  3ZKB A;  4DV3 E;  3ZZU A;  2M7Q A;  4P78 A;  2CG9 A;  1J26 A;  2V34 A;  1T4L B;  1N0V C;  1X47 A;  1I94 I;  4JI6 E;  1ZM2 A;  2HFU A;  1MX0 A;  3H09 A;  4LF7 E;  4NXM E;  3J80 C;  2DEJ A;  1NHJ A;  1RC7 A;  3VYY A;  5FWK A;  5DNY A;  2N3H A;  4DV4 E;  4DV6 E;  1Y4S A;  2DB2 A;  4GKK E;  4LF7 I;  1FKA E;  4NXM I;  2V2Z A;  4YY3 E;  2BM0 A;  2L2N A;  4LF4 E;  3B8H A;  2RS6 A;  5IT9 C;  4BMJ A;  4DR3 E;  1S16 A;  4DUY E;  3IWD A;  1KVK A;  4M0V A;  2PNM A;  2FV4 B;  1Z5B A;  3IWC A;  2R42 A;  2BV3 A;  4P7D A;  2JOX A;  4DR3 I;  2VF3 A;  4JI4 E;  4DUY I;  4K0K E;  1UHZ A;  4DKK A;  3DF6 A;  5A2Q C;  1H7S A;  2UUB I;  3D4J A;  4B3S I;  4HYM A;  4HY1 A;  4BBY A;  2O1W A;  4L8N A;  1UIL A;  3K1J A;  4XTJ A;  3DJW A;  3AV0 A;  4J8Z A;  2HK3 A;  3PYE A;  2UUB E;  1Z0G A;  1X49 A;  3AUZ A;  3PRY A;  3K6Q A;  2MC5 A;  2Z5C A;  2IOQ A;  2JVA A;  3MSW A;  2ZIT A;  1XNQ I;  2ODR C;  2ZM6 I;  4P52 A;  2G7H A;  5IWA I;  4DR2 I;  4KZS A;  4NXN E;  1U2R A;  4B3T E;  1YZ9 A;  2NPF A;  1Z0W A;  1A6F A;  2HHH I;  4JI0 I;  1MU5 A;  1ZBQ A;  4JYA E;  5AE2 A;  3HXL A;  2FGG A;  4DPY A;  4IZJ D;  5FLX C;  4B3T I;  3J7A G;  4JI2 E;  4DV1 I;  4DV5 I;  1USU A;  3PYD A;  4LF9 E;  3J81 Q;  1HK7 A;  1KKH A;  3GON A;  1NHI A;  1FNM A;  2JR1 A;  1HNX I;  2VQE I;  2EZ6 A;  3QT8 A;  1DAR A;  3OTO I;  4BCA A;  3V5R A;  2UXC I;  2KOU A;  2L2K B;  2LUP B;  4X66 E;  1T4N A;  3FIG A;  4RPF A;  3KWR A;  1Z5C A;  2O1U A;  1ZM3 A;  4JI6 I;  1QU6 A;  4HAC A;  2UXC E;  1PIE A;  2KHX A;  2L3J A;  3WU4 A;  4FWD A;  3B78 A;  2VQF I;  4JI7 I;  2IOP A;  3HQ1 A;  3PYF A;  2EWL A;  4LF6 E;  4HXZ A;  4LFB E;  4KHP I;  1N36 I;  2V89 A;  4WFT A;  2MC6 A;  2WW4 A;  4DV0 E;  4AQY I;  4JI8 I;  4GEQ B;  4R8O A;  3LNU A;  3F6H A;  3VK6 A;  1N32 E;  3QT5 A;  1PKP A;  4K0K I;  4LFA E;  1N33 I;  2JWO A;  1XMO I;  1NHH A;  5AAS A;  2UUC E;  4FWH A;  1Y4U A;  1N34 E;  4L5N C;  1BKN A;  3QT7 A;  4F9B B;  4DPX A;  5GME A;  1IBK I;  4USK A;  4I8O A;  2UUC I;  2LJP A;  3LPS A;  4M30 A;  2PNL A;  2F4V E;  4YHH E;  3ZZT A;  1N34 I;  3C4B A;  1ZM9 A;  2LE2 A;  4IZJ A;  2FTX B;  2LMZ A;  2NUF A;  1XNQ E;  2CPN A;  4UTG A;  4DR7 E;  1XMQ I;  3P1X A;  4JG4 A;  2HHH E;  2VE7 C;  3ADJ A;  4P7A A;  3C4T A;  4LFC I;  4WUC A;  4B3M I;  4WSP A;  1IBM I;  1XHK A;  4DR1 I;  4LTY A;  1XMQ E;  4DR4 I;  4DV3 I;  4DUZ E;  1HNW I;  4X62 E;  1O0W A;  2GS8 A;  3QT6 A;  3WU3 A;  2RTX A;  1GZ6 A;  2LTS A;  2V8Q B;  1IBM E;  2RS7 A;  1Z0E A;  3LTO A;  5A2Q Q;  1HNZ E;  5T6J A;  1SR9 A;  4DV7 E;  1PVG A;  4PRX A;  2YT4 A;  3V2U C;  1NZ0 A;  3T1Y E;  2AJ4 A;  3HUL A;  1HR0 I;  2Z5B A;  4DMI A;  1Z59 A;  2L92 A;  1DQ3 A;  2UXB I;  3RMP A;  3F6G A;  2RSM A;  4LF4 I;  4LF8 E;  3LLH A;  4UT4 A;  5LMN E;  1ZXN A;  1FJG E;  1HR0 E;  2L8T A;  3K17 A;  2UXB E;  2O1V A;  4B3R E;  2KON A;  1FWK A;  4FWG A;  5L3J A;  2LRS A;  1N0U A;  1DI2 A;  1FJG I;  2WZO A;  2Z5C B;  3ZOQ B;  1MG7 A;  1Z5A A;  2O1T A;  4I3H A;  1ZBT A;  1T4O A;  4B3R I;  3VYX A;  1N32 I;  3ZKD A;  3OML A;  4X65 I;  2E1M A;  1VIS A;  4TUI A;  2YZT A;  4DV2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...