4JI4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji4E02
1X47A 2LUQA 1ZM9A 2E5LI 2UUAE 2NPFA 3C4BA 1N36I 1T4OA 2LRSA 1Z0EA 4K0KE 3T1HE 2LTRA 1RQ0A 4GKJI 4JI2E 2NUGA 1Z5AA 3J7Yp 4B3TE 2YT4A 5BR8E 1T4NA 2F4VE 1KTVA 3P1XA 1N33E 1I94I 4DR7E 5CFFE 1ZBTA 4PU9A 3VYXA 3WU6A 1XMQI 1H7UA 4RPFA 4X66I 5LMNE 4DR1I 1H7SA 2DMYA 2IHR1 1S4EA 4DUYI 1MG7A 1UEKA 3H4LA 4USMA 3M6AA 4DR5E 2UUBI 2RTXA 1Z0CA 4MYUA 1FJGI 2UU9E 4DR4I 2N3HA 1PKPA 3V5RA 3T1YE 5IT9Q 1XHKA 4YY3I 2RSMA 1YYKA 4HXZA 1DARA 1B63A 3VYYA 4M30A 1STUA 4JI4E 4JV5E 1OJ4A 2UXBE 3PYGA 4X62E 1IBLI 4UTGA 1RREA 1HNXI 4DR3I 1GQEA 2LJHA 1FWLA 4DR6I 1QZRA 2EZ6A 2MDRA 4YHHE 4X65E 4JI3I 1XNQE 2CZ9A 2E5LE 3K17A 2ZM6I 4DKKA 1S16A 4OOGC 3J81Q 1HNZI 4DPYA 5LL6R 2HFUA 2L33A 1RC7A 4LF8E 2UXDE 4DV5I 2L2MA 1Z0GA 3C4TA 1PIEA 2ZITA 4JI1I 4DV7I 3J80C 1FI4A 3HULA 4LF5E 4FWDA 1FNMA 4LF6I 1I94E 4B3RE 1J26A 1XMQE 4EMDA 2X7IA 4NXME 4DV0I 4LF4I 3QT7A 2VQFE 2VQEE 3ADJA 4WYQB 2A2DA 4MYTA 3K1JA 1Z5BA 5LMUI 1Z0VA 4PRVA 3HTXA 2L2NA 1Z0BA 3LTOA 1IBME 1YYOA 2UXCI 1N0UA 2N3GA 4DV2I 3ZKBA 1FJGE 1J5EI 1XNRI 2NUEA 1HR0E 4HACA 3LLHA 2EFGA 4DV6I 2KHXA 2HHHI 4JYAI 1N34E 4WFTA 1NHIA 1NZ0A 4X64I 4DV4I 3CWVA 4PRXA 1H72C 2BV3A 4DUZI 4DR3E 4JI0I 4GKKI 1HNWI 1IBKE 4NXNI 4DPXA 4OX9I 4LFBE 1ELOA 1EKZA 1WHQA 2E1RA 4LFCI 2HK2A 4JI6E 2Q2EB 4LF7E 1B62A 4DV3E 5GMDA 4KHPI 4JI5E 2LTSA 2HK3A 4Z7CA 4DV5E 4B3MI 1ZM4A 3J7AG 4JI1E 5FLXQ 1N32I 3ZM7A 3J81C 4WUDA 3PYEA 3B82A 4HACB 1Z0WA 3OTOI 2BM1A 4DV1E 4JI7E 4DPWA 4LF4E 3ZZUA 2X36A 2R42A 4P7AA 2UUAI 3Q1QA 4WUCA 1XMOE 4ZVIA 1X49A 4DPUA 2DIXA 5A2QQ 2V2VA 1NHJA 2A2CA 4K0KI 3T1HI 1EI1A 4I3HA 3JAMQ 3LNUA 4B3TI 1ZXNA 3B78A 5BR8I 1H74A 3ADLA 1PVGA 2B3TB 2F4VI 1N36E 1XNRE 4JI8I 2HKEA 4LF9I 1WUUA 2RS7A 4GKJE 3LPSA 2B7TA 2L3CA 1O0WA 1BKNA 1EA6A 1ZM2A 2VF3A 2LBSB 4DR5I 4OX9E 4X66E 4DR1E 1NHHA 2UU9I 4DUYE 4DXLA 4ED4A 3T1YI 2ZBKB 2V34A 4JV5I 4JI4I 1U2RA 4WUBA 2UXBI 1DI2A 2UUBE 1WHNA 2J7KA 3ZZ0A 4X62I 2HFSA 3GONA 4DR4E 1N32E 4YY3E 4LFAI 2DEJA 1FWKA 2V2QA 1IBLE 4X65I 1Z0TA 4DU7A 1XNQI 5L3JA 1HNXE 5FLXC 2CPNA 3D4JA 3ADGA 5IT9C 4LF8I 4DR6E 2UXDI 1MU5A 4B3SI 4JI3E 4HY1A 3WU5A 2ZM6E 3V2UC 1HNZE 4XTJA 4LF5I 3QT6A 1KIJA 2WW4A 2JVAA 1YZ9A 4JI8E 4B3RI 1KKHA 4LF9E 5IWAI 2LJPA 2GS8A 5A2QC 4HYMA 4DPTA 3QT5A 4NXMI 4DV7E 2VQFI 1K47A 2VQEI 2NUFA 3PYDA 4DR2I 3JAMC 3B8HA 1ZM3A 2UUCI 4AQYI 4LF6E 2R3VA 1T4LB 1IBMI 1X48A 1FKAE 3ZKDA 4DV0E 5GMEA 1H73A 1A6FA 5LMUE 1HR0I 3QT8A 3ZZTA 1MX0A 4FWHA 4M1KA 4KQVA 4JI2I 2UXCE 1N34I 1Z5CA 4DV2E 1D6TA 1Z59A 3F0NA 2DB2A 1J5EE 3ADIA 1N33I 4DR7I 2V2ZA 3PYFA 1VISA 1RR9A 1IBKI 4DV6E 4LFAE 4FN5A 4URLA 2HHHE 4JYAE 2LUPB 3WU3A 4M2ZA 4LFBI 5LMNI 3WU4A 4X64E 4DV4E 4FW9A 2L2KB 4JI6I 2OI2A 3J7AM 4DUZE 4LF7I 4DV3I 4JI0E 4GKKE 1HNWE 4UT4A 4P52A 4JI5I 4NXNE 2BM0A 4USKA 1UHZA 4B3SE 1UILA 4FWGA 1ZXMA 1QU6A 2HKJA 2XEXA 4LFCE 2L3JA 1KVKA 1N0VC 4KHPE 1YYWA 5IWAE 4B3ME 2NA2A 4DV1I 4JG4A 4JI7I 2RS6A 4Z7YA 2AJ4A 2JY9A 2V8PA 4DR2E 2DEIA 4X8WA 1XMOI 2UUCE 4AQYE 2B7VA 4DU8A 3OTOE 3J80Q 4YHHI 4R1FA
chains in the Genus database with same CATH superfamily
1X47A 2FTXB 2LUQA 1ZM9A 5C0XA 2E5LI 4R2QA 5AE2A 4OZEA 2UUAE 2NPFA 4IFDB 3C4BA 2YRKA 1N36I 1T4OA 2YU5A 2PNZA 5K36C 4O43A 2EPKX 2LRSA 1DGCA 1G2DC 1Z0EA 4DMIA 4K0KE 3T1HE 2LTRA 1RQ0A 4GKJI 4M0VA 2JXPA 4ZYGA 2V89A 5A6KA 4JI2E 2NUGA 2F8BA 1Z5AA 4ZYHA 1ZU1A 3BBGA 3J7Yp 3UK3C 2YT4A 4B3TE 5BR8E 2EMYA 1T4NA 2F4VE 4P78A 1KTVA 3GLLA 2YPNA 3P1XA 1N33E 1I94I 4BA1A 2ODRC 4DR7E 2LO3A 5CFFE 2ENCA 1ZBTA 3P76A 4PU9A 4AM3A 3VYXA 3WU6A 1XMQI 3CDIA 4Q35B 5K36E 1H7UA 2EL4A 4RPFA 2K7IA 4GEQB 5LMNE 1UDOA 1H7SA 2EOFA 4X66I 2MDGA 4IS1C 4DR1I 2YWQA 1TF6A 2IESA 4R03A 2DMYA 2IHR1 4WXDA 5A6BD 1S4EA 1RMDA 4DUYI 3B4TA 3L00A 3HJCA 1MG7A 2WNRA 4F6MA 2EMGA 2EN2A 1UEKA 3H4LA 4USMA 3M6AA 4U3DA 2MKDA 4DR5E 2EMCA 2GQ0A 3DJWA 4HEIA 2UUBI 4FW3A 2RTXA 1Z0CA 2EQ0A 4FW6A 5K36D 4MYUA 2JOBA 2VESA 2EM8A 2HJJA 2L92A 1FJGI 5A69A 5KL2A 2UU9E 2C37A 2PO2A 4GQUA 5C0XB 1EH8A 2N3HA 1PKPA 2YTJA 4RH8A 3V5RA 3M85G 4DR4I 2NN6A 3T1YE 2WBUA 5IT9Q 2RQLA 3FIGA 1XHKA 2GO3A 5JEAC 2RSMA 1YYKA 4HXZA 1DARA 1B63A 3VYYA 4M30A 1STUA 2H36X 4JI4E 4JV5E 1OJ4A 4LCGA 2PNZB 4BHBA 2EPPA 3Q6MA 2EOEA 2CVEA 2UXBE 3PYGA 4X62E 1IBLI 2EN6A 2ODRD 3HQ1A 4UTGA 1RREA 1HNXI 4MLQA 4DR3I 1GQEA 2IERA 2LJHA 1FWLA 2MC6A 1MGTA 1QZRA 2LJUA 4BA2B 4DR6I 2EZ6A 4OO1C 2MDRA 2EPAA 2ELZA 4YHHE 5JEAE 4IFDA 4X65E 4JI3I 2EOSA 1A1LA 3P3EA 1XNQE 2CZ9A 2E5LE 3K17A 2ZM6I 4DKKA 1S16A 2JEAA 4OOGC 3J81Q 1HNZI 4F2JC 2YTDA 4DPYA 1GTKA 2YU8A 5LL6R 2HFUA 2L33A 1RC7A 1BBGA 4LF8E 2UXDE 4DV5I 2WNRB 2DLQA 4L8NA 3Q6NA 2L2MA 1Z0GA 2A25A 3C4TA 1PIEA 5KL6A 2ZITA 4JI1I 4BHCA 5ADZA 2PO0A 3J80C 4DV7I 1FI4A 2Z5CB 1RHYA 3HULA 4OO1E 4J3DA 1X3CA 3EPKA 1AH5A 4LF5E 4FWDA 1FNMA 1JK1A 5AE3A 2C37B 2YTFA 2VF1A 2PO2B 3K85A 4LF6I 1I94E 4B3RE 1J26A 1A1IA 5K36F 3IWCA 2LV2A 2NN6B 5DROA 1XMQE 4R1FA 1Y4SA 4R2RA 4EMDA 1ZR9A 2X7IA 3PRYA 4NXME 4DV0I 4LF4I 3QT7A 5ELWA 4R2PA 2VQFE 3ADJA 2VQEE 4WYQB 2A2DA 4IS9A 4MYTA 3K1JA 2EOZA 3HPZA 1P42A 2EMAA 1Z1BA 2Q8UA 4OO1D 1Z5BA 3P3GA 1UBDC 5LMUI 1Z0VA 4FK5C 2EMFA 4PRVA 2EMXA 2EL6A 3HTXA 2E72A 2ADRA 2F1DA 2L2NA 2EPRA 1Y5YA 1Z0BA 3L7ZA 1IBME 3LTOA 1YYOA 2UXCI 1N0UA 4I8OA 5F3WA 2N3GA 1YSAC 4DV2I 5KL5A 2J7JA 1YUIA 3ZKBA 1FJGE 4YHHI 1SFEA 3TQMA 1J5EI 1E3HA 1XNRI 2KONA 2EOYA 2YTGA 2NUEA 1HR0E 3M85D 2JEAB 1Y60A 4HACA 4IZKB 2JP9A 3LLHA 3MSWA 2EFGA 4DV6I 2KHXA 2MC5A 2HHHI 4TUGA 4JYAI 1N34E 4WFTA 2R1FA 1XXEA 1NHIA 4AIDA 1NZ0A 2YTIA 2VRDA 2V88A 4X64I 4DV4I 5A6AA 3CWVA 4PRXA 2EM9A 1H72C 2PO0B 2BV3A 3AV0A 1NCSA 4DUZI 1BB8A 4BA2A 1YFHA 4DR3E 4JI0I 1ZAAC 3GMEA 2O3ZA 4MU4A 2NN6D 4GKKI 1HNWI 1IBKE 4NXNI 3U1KA 5KL7A 4DPXA 5JEAF 4QNKA 2C39A 4OX9I 4LFBE 2L8TA 1IMUA 1ELOA 1EKZA 3OMLA 2EMIA 4BCAA 1WHQA 2E1RA 4LFCI 2HK2A 4JI6E 3MHHC 1G2FC 2Q2EB 1E3PA 1IQOA 4LF7E 1B62A 4DV3E 2CSHA 4MQYA 5GMDA 1EH6A 4KHPI 4JI5E 4R2DA 2LTSA 1LLMC 4YY3I 4ISAA 2HK3A 1UN6B 4Z7CA 4DV5E 2Z5CA 2EP3A 4B3MI 5AE1A 3MHSC 1ZM4A 1WJPA 1PJSA 2D9HA 3J7AG 4OO1F 3L7ZB 4JI1E 4U3BA 4IFDD 2EPXA 2ENAA 3AUZA 5FLXQ 1X6FA 2EJ4A 4LU9A 3HPSA 4X9JA 4MU3A 1N32I 1R6MA 3ZM7A 5C0XC 2DSYA 3J81C 4WUDA 2FV4B 2L6MA 3KZYA 3PYEA 3B82A 1Y4UA 4HACB 1Z0WA 3OTOI 2PNLA 2EPZA 4N4RB 2BM1A 2V8QB 2I13A 4DV1E 1OYRA 4JI7E 2PRTA 4DPWA 3CDJA 4LF4E 1IQSA 3ZZUA 3BIDA 4R8OA 2R42A 2X36A 4P7AA 2EPUA 2UUAI 3DF6A 3Q1QA 4WUCA 2HGHA 1XMOE 3P3CA 4ZVIA 2M7QA 4AIMA 1X49A 2EM6A 2DIXA 4TUIA 4DPUA 2G7HA 2LCEA 5A2QQ 1L4SA 2V2VA 1NHJA 2A2CA 4K0KI 3T1HI 1PJQA 2YRHA 2EORA 1EI1A 4BC7A 3F6HA 5IV8B 2EM2A 5C0XE 4I3HA 2C39B 1KJKA 2YZTA 3JAMQ 3LNUA 4BS9A 4IZKA 4KZSA 4B3TI 1ZXNA 2RPCA 3B78A 5BR8I 1A1GA 3F6GA 5A6BA 2B3TB 3ADLA 1H74A 1PVGA 3V2UC 2F4VI 4RHBB 1DQ3A 1N36E 1XNRE 2BA0G 2YSOA 4JI8I 1YH8A 2HKEA 1TF3A 4LF9I 4NHRA 3LMLA 1X6HA 2RS7A 1WUUA 1USUA 4GKJE 3GCMA 2EMWA 2BBGA 4R2AA 3LPSA 2B7TA 1A1KA 2L3CA 4Q28A 4IJDA 1O0WA 5C0XD 1BKNA 5K36A 2CTDA 4LTYA 2JE6A 2EOMA 2EPMX 5FWKA 2O1UA 1EA6A 5DRQA 4WX9A 1N3GA 2WZOA 3PS3A 1ZM2A 3BF2A 1Y6ZA 1A1JA 2EM7A 2NABA 2VF3A 2YSPA 4FW5A 2EPNA 4F9AB 2LBSB 4OX9E 2NN6C 4DR5I 3THOB 5KL3A 3IWDA 4X66E 2YTPA 4P7DA 4DR1E 1A1FA 5EKWA 5A6JA 2CGEA 2MKNA 1NHHA 2UU9I 4DUYE 4HTGA 2EN8A 4DXLA 4ED4A 3T1YI 2EMLA 2ZBKB 1WRJA 1WXRA 2EQ3A 2KOUA 2M4IA 4QNJA 2V34A 4JV5I 4JI4I 4B3RI 2PO1A 1U2RA 4FW7A 4WUBA 1A1HA 2UXBI 1DI2A 2V83A 2EOQA 2UUBE 1WHNA 2J7KA 3ZZ0A 4X62I 2JOXA 2JR1A 2HFSA 1GZ6A 4R2SA 2O1WA 2EN3A 3GONA 2Z5BA 2NN6E 4DR4E 2EN4A 4IFDC 2WBTA 3DD6A 2PNMA 3P06A 1N32E 3PS1A 4YY3E 4LFAI 3EQ1A 3M7NG 4BBYA 2EE8A 4BC9A 4OKGA 2DEJA 4MLVA 1FWKA 2V2QA 4J8ZA 1IBLE 3RMPA 4X65I 4MU1A 1Z0TA 2EN1A 4DU7A 2DGCA 5JEAA 1XNQI 5L3JA 2EMBA 5K36B 1HNXE 1PJTA 5FLXC 2CPNA 4BMJA 5KL4A 3D4JA 2ELYA 2LMZA 2JE6B 4F6NA 2JT2A 2GPIA 2JEBB 1UDNA 5C0XF 3ADGA 2FGGA 5IT9C 4LF8I 1X6EA 4DR6E 2UXDI 1MU5A 4B3SI 2BR2B 4IFDE 1PDAA 2R76A 2WP8B 4JI3E 4HY1A 4IZJA 3WU5A 1F2IG 4LCHA 3UHMA 2ZM6E 3IWBA 1HNZE 4WSPA 4ZYEA 4XTJA 2BB8A 1T38A 3KRNA 2V85A 2LT7A 1ZBQA 3HKMA 4OO1A 2YTEA 4LF5I 3QT6A 1KIJA 2DRPA 4M9VC 2JVAA 2BA0D 1YZ9A 4JI8E 1UDQA 5T6JA 3C6KA 1KKHA 2WW4A 2J65A 4LF9E 5IWAI 2LJPA 2GS8A 1YUJA 5A2QC 4HYMA 4DPTA 3KWRA 3C6MA 3U1YA 2EOJA 3QT5A 2GLIA 4N3OA 4NXMI 4DV7E 3QG5C 3ZOQB 2PO1B 2RSIA 2JWOA 2VQFI 3ECRA 4O24A 1K47A 2NUFA 2VQEI 3PYDA 3JTZA 4DR2I 3JAMC 2HC5A 2N8XA 3B8HA 1ZM3A 4O4KA 2UUCI 4AQYI 2EOIA 2Z5BB 1AAYA 4LF6E 2R3VA 2BA1G 2C38A 5AC4A 2EM4A 5DNYA 2EMZA 2EOHA 1T4LB 2Z5EA 1X48A 1R6LA 1IBMI 1FKAE 2VE7C 1YPNA 3ZKDA 4DV0E 2JPAA 3EPLA 2EOOA 4LCFA 5GMEA 4F54A 2EL5A 1H73A 3VHTB 2EN7A 4F9CB 5IXMB 3EPJA 1A6FA 3BGHA 5JEAB 5LMUE 1HR0I 2EMKA 3QT8A 3ZZTA 1MX0A 1USVA 4FWHA 2CT1A 5AASA 4M1KA 4KQVA 2LVHA 4MU0A 5DRPA 4JI2I 2M1SA 2UXCE 1N34I 2EQ1A 1P47A 1Z5CA 2O1TA 2GO4A 2YTNA 3KZZA 4WXCA 1UDSA 4DV2E 2NN6F 1D6TA 2DLKA 1X5WA 1Z59A 1B69A 3THNA 1YHCA 3F0NA 4IZJB 2DB2A 1J5EE 3ADIA 4O5GA 1N33I 2WBSA 5DNLA 4DR7I 1SR9A 2V2ZA 1VISA 3PYFA 4MDTA 1HK7A 5TSEA 1RR9A 2E1MA 5LLQA 2IOPA 1IBKI 4OO1B 2EPCA 4DV6E 4LFAE 4FN5A 3VK6A 4URLA 3M7ND 2HHHE 4JYAE 4BA1B 4L5NC 2LUPB 3WU3A 2ENHA 4M2ZA 5DNXA 5LMNI 4KWYA 1KYQA 4LFBI 4LPFA 3WU4A 3K6QA 4X64E 4DV4E 1BBOA 4WSGA 2O1VA 4FW9A 1TN9A 3H1CA 2L2KB 4JI6I 4F9BB 3EPHA 2JEBA 2OI2A 1NEIA 3J7AM 3JU0A 4DUZE 2EM3A 2IOQA 2V87A 4LF7I 2BR2A 3M99B 4JI0E 4DV3I 4IFDF 4GKKE 2YTQA 1HNWE 4P52A 2WP8A 5DRRA 4UT4A 4JI5I 4NXNE 2BM0A 4USKA 2B9DA 4NBQA 1QNTA 1UHZA 2LE2A 3HXLA 2GHFA 1UILA 4B3SE 2C38B 4FW4A 1ZXMA 4FWGA 3PS2A 1QU6A 4GZNC 2HKJA 1VI7A 2XEXA 2M9AA 2CG9A 4LFCE 5JEAD 2I9IA 4NZVA 2AE8A 2L3JA 4R2EA 1KVKA 4KHPE 1N0VC 1OYPA 4LOMA 1YYWA 2EPOA 2DMIA 2K4VA 2V86A 2JYAA 1OYSA 2EMHA 5IWAE 4B3ME 1T39A 2NA2A 1JK2A 2EM5A 4DV1I 4JG4A 4JI7I 2RS6A 3H09A 4Z7YA 2YTOA 4IZJD 2AJ4A 2JY9A 2WCC3 2V8PA 4DR2E 5EL9A 4ZYDA 2DEIA 4X8WA 1XMOI 4R2CA 2EWLA 2YRMA 4WPYA 1EH7A 4AQYE 2EPLX 2B7VA 2UUCE 1MEYC 3NZKA 2BA1D 4DU8A 3OTOE 3J80Q 5AC5A 2EM0A 2EOXA
chains in the Genus database with same CATH topology
1X47A 2FTXB 2LUQA 1ZM9A 2E5LI 5AE2A 2UUAE 2NPFA 3C4BA 1N36I 1T4OA 2LRSA 1Z0EA 4DMIA 4K0KE 3T1HE 2LTRA 1RQ0A 4GKJI 4M0VA 2V89A 4JI2E 2NUGA 2F8BA 1Z5AA 3J7Yp 4B3TE 2YT4A 5BR8E 1T4NA 2F4VE 4P78A 1KTVA 3P1XA 1N33E 1I94I 2ODRC 4DR7E 5CFFE 1ZBTA 4PU9A 3VYXA 3WU6A 1XMQI 1H7UA 4RPFA 4GEQB 5LMNE 4X66I 4DR1I 1H7SA 4R03A 2DMYA 2IHR1 1S4EA 4DUYI 3HJCA 1MG7A 1UEKA 3H4LA 4USMA 3M6AA 4DR5E 2GQ0A 3DJWA 2UUBI 2RTXA 1Z0CA 4MYUA 2JOBA 2L92A 1FJGI 2UU9E 4DR4I 2N3HA 1PKPA 3V5RA 3T1YE 5IT9Q 3FIGA 1XHKA 4YY3I 2RSMA 1YYKA 4HXZA 1DARA 1B63A 3VYYA 4M30A 1STUA 2H36X 4JI4E 4JV5E 1OJ4A 3Q6MA 2UXBE 3PYGA 4X62E 1IBLI 2ODRD 3HQ1A 4UTGA 1RREA 1HNXI 4DR3I 1GQEA 2LJHA 1FWLA 2MC6A 4DR6I 1QZRA 2EZ6A 2MDRA 4YHHE 4X65E 4JI3I 1XNQE 2CZ9A 2E5LE 3K17A 2ZM6I 4DKKA 1S16A 4OOGC 3J81Q 1HNZI 4DPYA 5LL6R 2HFUA 2L33A 1RC7A 4LF8E 2UXDE 4DV5I 4L8NA 3Q6NA 2L2MA 1Z0GA 3C4TA 1PIEA 2ZITA 4JI1I 5ADZA 4DV7I 3J80C 1FI4A 2Z5CB 3HULA 4LF5E 4FWDA 1FNMA 5AE3A 3K85A 2VF1A 4LF6I 1I94E 4B3RE 1J26A 3IWCA 1XMQE 1Y4SA 4EMDA 2X7IA 3PRYA 4NXME 4DV0I 4LF4I 3QT7A 2VQFE 3ADJA 2VQEE 4WYQB 2A2DA 4MYTA 3K1JA 3HPZA 1Z5BA 5LMUI 1Z0VA 4PRVA 3HTXA 2L2NA 1Z0BA 3LTOA 1IBME 1YYOA 2UXCI 1N0UA 4I8OA 5F3WA 2N3GA 4DV2I 3ZKBA 1FJGE 1J5EI 1XNRI 2KONA 2NUEA 1HR0E 4IZKB 4HACA 3LLHA 3MSWA 2EFGA 4DV6I 2KHXA 2MC5A 2HHHI 4TUGA 4JYAI 1N34E 4WFTA 1NHIA 1NZ0A 2V88A 4X64I 4DV4I 3CWVA 4PRXA 1H72C 2BV3A 3AV0A 4DUZI 4DR3E 4JI0I 4GKKI 1HNWI 1IBKE 4NXNI 4DPXA 4OX9I 4LFBE 2L8TA 1ELOA 1EKZA 3OMLA 4BCAA 1WHQA 2E1RA 4LFCI 2HK2A 4JI6E 2Q2EB 4LF7E 1B62A 4DV3E 5GMDA 4KHPI 4JI5E 2LTSA 2HK3A 4Z7CA 4DV5E 2Z5CA 4B3MI 5AE1A 1ZM4A 3J7AG 4JI1E 3AUZA 5FLXQ 4LU9A 3HPSA 1N32I 3ZM7A 2DSYA 3J81C 4WUDA 2FV4B 2L6MA 3PYEA 3B82A 1Y4UA 4HACB 1Z0WA 3OTOI 2PNLA 2BM1A 2V8QB 4DV1E 4JI7E 4DPWA 4LF4E 3ZZUA 4R8OA 2X36A 2R42A 4P7AA 2UUAI 3DF6A 3Q1QA 4WUCA 1XMOE 4ZVIA 2M7QA 1X49A 4DPUA 2DIXA 4TUIA 5A2QQ 2G7HA 2V2VA 1NHJA 2A2CA 4K0KI 3T1HI 1EI1A 4BC7A 3F6HA 4I3HA 3JAMQ 2YZTA 3LNUA 4BS9A 4IZKA 4KZSA 4B3TI 1ZXNA 3B78A 5BR8I 1H74A 3F6GA 3ADLA 2B3TB 1PVGA 2F4VI 1N36E 1DQ3A 1XNRE 4JI8I 2HKEA 4LF9I 3LMLA 1WUUA 2RS7A 1USUA 4GKJE 3LPSA 2B7TA 2L3CA 4Q28A 1O0WA 1BKNA 4LTYA 5FWKA 2O1UA 1EA6A 2WZOA 1ZM2A 1Y6ZA 2VF3A 4F9AB 2LBSB 4OX9E 4DR5I 3IWDA 4X66E 4P7DA 4DR1E 2CGEA 1NHHA 2UU9I 4DUYE 4DXLA 4ED4A 3T1YI 2ZBKB 1WXRA 2M4IA 2KOUA 2V34A 4JV5I 4JI4I 1U2RA 4WUBA 2UXBI 1DI2A 2V83A 2UUBE 1WHNA 2J7KA 3ZZ0A 4X62I 2JOXA 2JR1A 2HFSA 1GZ6A 2O1WA 3GONA 2Z5BA 4DR4E 2PNMA 3P06A 1N32E 4YY3E 4LFAI 4BBYA 4BC9A 2DEJA 1FWKA 2V2QA 4J8ZA 1IBLE 3RMPA 4X65I 1Z0TA 4DU7A 1XNQI 5L3JA 1HNXE 5FLXC 2CPNA 4BMJA 3D4JA 2LMZA 3ADGA 2FGGA 5IT9C 4LF8I 4DR6E 2UXDI 1MU5A 4B3SI 4JI3E 4HY1A 4IZJA 3WU5A 2ZM6E 3IWBA 1HNZE 4WSPA 4XTJA 3V2UC 4LF5I 2V85A 1ZBQA 3QT6A 1KIJA 2JVAA 2WW4A 1YZ9A 4JI8E 4B3RI 5T6JA 1KKHA 4LF9E 5IWAI 2LJPA 2GS8A 5A2QC 4HYMA 4DPTA 3KWRA 3QT5A 4N3OA 4NXMI 4DV7E 3ZOQB 2JWOA 2VQFI 1K47A 2VQEI 2NUFA 3PYDA 3JTZA 4DR2I 3JAMC 3B8HA 1ZM3A 2UUCI 4AQYI 2Z5BB 4LF6E 2R3VA 5DNYA 1T4LB 1IBMI 2Z5EA 1X48A 1FKAE 2VE7C 3ZKDA 4DV0E 5GMEA 4F54A 1H73A 4F9CB 1A6FA 5LMUE 1HR0I 3QT8A 3ZZTA 1MX0A 1USVA 4FWHA 5AASA 4M1KA 4KQVA 4JI2I 2M1SA 2UXCE 1N34I 1Z5CA 2O1TA 4DV2E 1D6TA 1Z59A 3F0NA 4IZJB 2DB2A 1J5EE 3ADIA 1N33I 4DR7I 1SR9A 2V2ZA 1VISA 3PYFA 1HK7A 1RR9A 2E1MA 2IOPA 1IBKI 4DV6E 4LFAE 4FN5A 3VK6A 4URLA 2HHHE 4JYAE 4L5NC 2LUPB 3WU3A 4M2ZA 4LFBI 5LMNI 3WU4A 3K6QA 4X64E 4DV4E 2O1VA 4FW9A 2L2KB 4JI6I 4F9BB 2OI2A 3J7AM 3JU0A 4DUZE 2IOQA 2V87A 4LF7I 4DV3I 4JI0E 4GKKE 1HNWE 4UT4A 4P52A 4JI5I 4NXNE 2BM0A 4USKA 2B9DA 1UHZA 2LE2A 3HXLA 4B3SE 1UILA 4FWGA 1ZXMA 1QU6A 2HKJA 2XEXA 2CG9A 4LFCE 2L3JA 1KVKA 1N0VC 4KHPE 1YYWA 2K4VA 2V86A 5IWAE 4B3ME 2NA2A 4DV1I 4JG4A 4JI7I 2RS6A 3H09A 4Z7YA 4IZJD 2AJ4A 2JY9A 2V8PA 4DR2E 2DEIA 4X8WA 1XMOI 2EWLA 2UUCE 4WPYA 4AQYE 2B7VA 4DU8A 3OTOE 3J80Q 4YHHI 4R1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X47 A;  2LUQ A;  1ZM9 A;  2E5L I;  2UUA E;  2NPF A;  3C4B A;  1N36 I;  1T4O A;  2LRS A;  1Z0E A;  4K0K E;  3T1H E;  2LTR A;  1RQ0 A;  4GKJ I;  4JI2 E;  2NUG A;  1Z5A A;  3J7Y p;  4B3T E;  2YT4 A;  5BR8 E;  1T4N A;  2F4V E;  1KTV A;  3P1X A;  1N33 E;  1I94 I;  4DR7 E;  5CFF E;  1ZBT A;  4PU9 A;  3VYX A;  3WU6 A;  1XMQ I;  1H7U A;  4RPF A;  4X66 I;  5LMN E;  4DR1 I;  1H7S A;  2DMY A;  2IHR 1;  1S4E A;  4DUY I;  1MG7 A;  1UEK A;  3H4L A;  4USM A;  3M6A A;  4DR5 E;  2UUB I;  2RTX A;  1Z0C A;  4MYU A;  1FJG I;  2UU9 E;  4DR4 I;  2N3H A;  1PKP A;  3V5R A;  3T1Y E;  5IT9 Q;  1XHK A;  4YY3 I;  2RSM A;  1YYK A;  4HXZ A;  1DAR A;  1B63 A;  3VYY A;  4M30 A;  1STU A;  4JI4 E;  4JV5 E;  1OJ4 A;  2UXB E;  3PYG A;  4X62 E;  1IBL I;  4UTG A;  1RRE A;  1HNX I;  4DR3 I;  1GQE A;  2LJH A;  1FWL A;  4DR6 I;  1QZR A;  2EZ6 A;  2MDR A;  4YHH E;  4X65 E;  4JI3 I;  1XNQ E;  2CZ9 A;  2E5L E;  3K17 A;  2ZM6 I;  4DKK A;  1S16 A;  4OOG C;  3J81 Q;  1HNZ I;  4DPY A;  5LL6 R;  2HFU A;  2L33 A;  1RC7 A;  4LF8 E;  2UXD E;  4DV5 I;  2L2M A;  1Z0G A;  3C4T A;  1PIE A;  2ZIT A;  4JI1 I;  4DV7 I;  3J80 C;  1FI4 A;  3HUL A;  4LF5 E;  4FWD A;  1FNM A;  4LF6 I;  1I94 E;  4B3R E;  1J26 A;  1XMQ E;  4EMD A;  2X7I A;  4NXM E;  4DV0 I;  4LF4 I;  3QT7 A;  2VQF E;  2VQE E;  3ADJ A;  4WYQ B;  2A2D A;  4MYT A;  3K1J A;  1Z5B A;  5LMU I;  1Z0V A;  4PRV A;  3HTX A;  2L2N A;  1Z0B A;  3LTO A;  1IBM E;  1YYO A;  2UXC I;  1N0U A;  2N3G A;  4DV2 I;  3ZKB A;  1FJG E;  1J5E I;  1XNR I;  2NUE A;  1HR0 E;  4HAC A;  3LLH A;  2EFG A;  4DV6 I;  2KHX A;  2HHH I;  4JYA I;  1N34 E;  4WFT A;  1NHI A;  1NZ0 A;  4X64 I;  4DV4 I;  3CWV A;  4PRX A;  1H72 C;  2BV3 A;  4DUZ I;  4DR3 E;  4JI0 I;  4GKK I;  1HNW I;  1IBK E;  4NXN I;  4DPX A;  4OX9 I;  4LFB E;  1ELO A;  1EKZ A;  1WHQ A;  2E1R A;  4LFC I;  2HK2 A;  4JI6 E;  2Q2E B;  4LF7 E;  1B62 A;  4DV3 E;  5GMD A;  4KHP I;  4JI5 E;  2LTS A;  2HK3 A;  4Z7C A;  4DV5 E;  4B3M I;  1ZM4 A;  3J7A G;  4JI1 E;  5FLX Q;  1N32 I;  3ZM7 A;  3J81 C;  4WUD A;  3PYE A;  3B82 A;  4HAC B;  1Z0W A;  3OTO I;  2BM1 A;  4DV1 E;  4JI7 E;  4DPW A;  4LF4 E;  3ZZU A;  2X36 A;  2R42 A;  4P7A A;  2UUA I;  3Q1Q A;  4WUC A;  1XMO E;  4ZVI A;  1X49 A;  4DPU A;  2DIX A;  5A2Q Q;  2V2V A;  1NHJ A;  2A2C A;  4K0K I;  3T1H I;  1EI1 A;  4I3H A;  3JAM Q;  3LNU A;  4B3T I;  1ZXN A;  3B78 A;  5BR8 I;  1H74 A;  3ADL A;  1PVG A;  2B3T B;  2F4V I;  1N36 E;  1XNR E;  4JI8 I;  2HKE A;  4LF9 I;  1WUU A;  2RS7 A;  4GKJ E;  3LPS A;  2B7T A;  2L3C A;  1O0W A;  1BKN A;  1EA6 A;  1ZM2 A;  2VF3 A;  2LBS B;  4DR5 I;  4OX9 E;  4X66 E;  4DR1 E;  1NHH A;  2UU9 I;  4DUY E;  4DXL A;  4ED4 A;  3T1Y I;  2ZBK B;  2V34 A;  4JV5 I;  4JI4 I;  1U2R A;  4WUB A;  2UXB I;  1DI2 A;  2UUB E;  1WHN A;  2J7K A;  3ZZ0 A;  4X62 I;  2HFS A;  3GON A;  4DR4 E;  1N32 E;  4YY3 E;  4LFA I;  2DEJ A;  1FWK A;  2V2Q A;  1IBL E;  4X65 I;  1Z0T A;  4DU7 A;  1XNQ I;  5L3J A;  1HNX E;  5FLX C;  2CPN A;  3D4J A;  3ADG A;  5IT9 C;  4LF8 I;  4DR6 E;  2UXD I;  1MU5 A;  4B3S I;  4JI3 E;  4HY1 A;  3WU5 A;  2ZM6 E;  3V2U C;  1HNZ E;  4XTJ A;  4LF5 I;  3QT6 A;  1KIJ A;  2WW4 A;  2JVA A;  1YZ9 A;  4JI8 E;  4B3R I;  1KKH A;  4LF9 E;  5IWA I;  2LJP A;  2GS8 A;  5A2Q C;  4HYM A;  4DPT A;  3QT5 A;  4NXM I;  4DV7 E;  2VQF I;  1K47 A;  2VQE I;  2NUF A;  3PYD A;  4DR2 I;  3JAM C;  3B8H A;  1ZM3 A;  2UUC I;  4AQY I;  4LF6 E;  2R3V A;  1T4L B;  1IBM I;  1X48 A;  1FKA E;  3ZKD A;  4DV0 E;  5GME A;  1H73 A;  1A6F A;  5LMU E;  1HR0 I;  3QT8 A;  3ZZT A;  1MX0 A;  4FWH A;  4M1K A;  4KQV A;  4JI2 I;  2UXC E;  1N34 I;  1Z5C A;  4DV2 E;  1D6T A;  1Z59 A;  3F0N A;  2DB2 A;  1J5E E;  3ADI A;  1N33 I;  4DR7 I;  2V2Z A;  3PYF A;  1VIS A;  1RR9 A;  1IBK I;  4DV6 E;  4LFA E;  4FN5 A;  4URL A;  2HHH E;  4JYA E;  2LUP B;  3WU3 A;  4M2Z A;  4LFB I;  5LMN I;  3WU4 A;  4X64 E;  4DV4 E;  4FW9 A;  2L2K B;  4JI6 I;  2OI2 A;  3J7A M;  4DUZ E;  4LF7 I;  4DV3 I;  4JI0 E;  4GKK E;  1HNW E;  4UT4 A;  4P52 A;  4JI5 I;  4NXN E;  2BM0 A;  4USK A;  1UHZ A;  4B3S E;  1UIL A;  4FWG A;  1ZXM A;  1QU6 A;  2HKJ A;  2XEX A;  4LFC E;  2L3J A;  1KVK A;  1N0V C;  4KHP E;  1YYW A;  5IWA E;  4B3M E;  2NA2 A;  4DV1 I;  4JG4 A;  4JI7 I;  2RS6 A;  4Z7Y A;  2AJ4 A;  2JY9 A;  2V8P A;  4DR2 E;  2DEI A;  4X8W A;  1XMO I;  2UUC E;  4AQY E;  2B7V A;  4DU8 A;  3OTO E;  3J80 Q;  4YHH I;  4R1F A; 
#chains in the Genus database with same CATH topology
 1X47 A;  2FTX B;  2LUQ A;  1ZM9 A;  5C0X A;  2E5L I;  4R2Q A;  5AE2 A;  4OZE A;  2UUA E;  2NPF A;  4IFD B;  3C4B A;  2YRK A;  1N36 I;  1T4O A;  2YU5 A;  2PNZ A;  5K36 C;  4O43 A;  2EPK X;  2LRS A;  1DGC A;  1G2D C;  1Z0E A;  4DMI A;  4K0K E;  3T1H E;  2LTR A;  1RQ0 A;  4GKJ I;  4M0V A;  2JXP A;  4ZYG A;  2V89 A;  5A6K A;  4JI2 E;  2NUG A;  2F8B A;  1Z5A A;  4ZYH A;  1ZU1 A;  3BBG A;  3J7Y p;  3UK3 C;  2YT4 A;  4B3T E;  5BR8 E;  2EMY A;  1T4N A;  2F4V E;  4P78 A;  1KTV A;  3GLL A;  2YPN A;  3P1X A;  1N33 E;  1I94 I;  4BA1 A;  2ODR C;  4DR7 E;  2LO3 A;  5CFF E;  2ENC A;  1ZBT A;  3P76 A;  4PU9 A;  4AM3 A;  3VYX A;  3WU6 A;  1XMQ I;  3CDI A;  4Q35 B;  5K36 E;  1H7U A;  2EL4 A;  4RPF A;  2K7I A;  4GEQ B;  5LMN E;  1UDO A;  1H7S A;  2EOF A;  4X66 I;  2MDG A;  4IS1 C;  4DR1 I;  2YWQ A;  1TF6 A;  2IES A;  4R03 A;  2DMY A;  2IHR 1;  4WXD A;  5A6B D;  1S4E A;  1RMD A;  4DUY I;  3B4T A;  3L00 A;  3HJC A;  1MG7 A;  2WNR A;  4F6M A;  2EMG A;  2EN2 A;  1UEK A;  3H4L A;  4USM A;  3M6A A;  4U3D A;  2MKD A;  4DR5 E;  2EMC A;  2GQ0 A;  3DJW A;  4HEI A;  2UUB I;  4FW3 A;  2RTX A;  1Z0C A;  2EQ0 A;  4FW6 A;  5K36 D;  4MYU A;  2JOB A;  2VES A;  2EM8 A;  2HJJ A;  2L92 A;  1FJG I;  5A69 A;  5KL2 A;  2UU9 E;  2C37 A;  2PO2 A;  4GQU A;  5C0X B;  1EH8 A;  2N3H A;  1PKP A;  2YTJ A;  4RH8 A;  3V5R A;  3M85 G;  4DR4 I;  2NN6 A;  3T1Y E;  2WBU A;  5IT9 Q;  2RQL A;  3FIG A;  1XHK A;  2GO3 A;  5JEA C;  2RSM A;  1YYK A;  4HXZ A;  1DAR A;  1B63 A;  3VYY A;  4M30 A;  1STU A;  2H36 X;  4JI4 E;  4JV5 E;  1OJ4 A;  4LCG A;  2PNZ B;  4BHB A;  2EPP A;  3Q6M A;  2EOE A;  2CVE A;  2UXB E;  3PYG A;  4X62 E;  1IBL I;  2EN6 A;  2ODR D;  3HQ1 A;  4UTG A;  1RRE A;  1HNX I;  4MLQ A;  4DR3 I;  1GQE A;  2IER A;  2LJH A;  1FWL A;  2MC6 A;  1MGT A;  1QZR A;  2LJU A;  4BA2 B;  4DR6 I;  2EZ6 A;  4OO1 C;  2MDR A;  2EPA A;  2ELZ A;  4YHH E;  5JEA E;  4IFD A;  4X65 E;  4JI3 I;  2EOS A;  1A1L A;  3P3E A;  1XNQ E;  2CZ9 A;  2E5L E;  3K17 A;  2ZM6 I;  4DKK A;  1S16 A;  2JEA A;  4OOG C;  3J81 Q;  1HNZ I;  4F2J C;  2YTD A;  4DPY A;  1GTK A;  2YU8 A;  5LL6 R;  2HFU A;  2L33 A;  1RC7 A;  1BBG A;  4LF8 E;  2UXD E;  4DV5 I;  2WNR B;  2DLQ A;  4L8N A;  3Q6N A;  2L2M A;  1Z0G A;  2A25 A;  3C4T A;  1PIE A;  5KL6 A;  2ZIT A;  4JI1 I;  4BHC A;  5ADZ A;  2PO0 A;  3J80 C;  4DV7 I;  1FI4 A;  2Z5C B;  1RHY A;  3HUL A;  4OO1 E;  4J3D A;  1X3C A;  3EPK A;  1AH5 A;  4LF5 E;  4FWD A;  1FNM A;  1JK1 A;  5AE3 A;  2C37 B;  2YTF A;  2VF1 A;  2PO2 B;  3K85 A;  4LF6 I;  1I94 E;  4B3R E;  1J26 A;  1A1I A;  5K36 F;  3IWC A;  2LV2 A;  2NN6 B;  5DRO A;  1XMQ E;  4R1F A;  1Y4S A;  4R2R A;  4EMD A;  1ZR9 A;  2X7I A;  3PRY A;  4NXM E;  4DV0 I;  4LF4 I;  3QT7 A;  5ELW A;  4R2P A;  2VQF E;  3ADJ A;  2VQE E;  4WYQ B;  2A2D A;  4IS9 A;  4MYT A;  3K1J A;  2EOZ A;  3HPZ A;  1P42 A;  2EMA A;  1Z1B A;  2Q8U A;  4OO1 D;  1Z5B A;  3P3G A;  1UBD C;  5LMU I;  1Z0V A;  4FK5 C;  2EMF A;  4PRV A;  2EMX A;  2EL6 A;  3HTX A;  2E72 A;  2ADR A;  2F1D A;  2L2N A;  2EPR A;  1Y5Y A;  1Z0B A;  3L7Z A;  1IBM E;  3LTO A;  1YYO A;  2UXC I;  1N0U A;  4I8O A;  5F3W A;  2N3G A;  1YSA C;  4DV2 I;  5KL5 A;  2J7J A;  1YUI A;  3ZKB A;  1FJG E;  4YHH I;  1SFE A;  3TQM A;  1J5E I;  1E3H A;  1XNR I;  2KON A;  2EOY A;  2YTG A;  2NUE A;  1HR0 E;  3M85 D;  2JEA B;  1Y60 A;  4HAC A;  4IZK B;  2JP9 A;  3LLH A;  3MSW A;  2EFG A;  4DV6 I;  2KHX A;  2MC5 A;  2HHH I;  4TUG A;  4JYA I;  1N34 E;  4WFT A;  2R1F A;  1XXE A;  1NHI A;  4AID A;  1NZ0 A;  2YTI A;  2VRD A;  2V88 A;  4X64 I;  4DV4 I;  5A6A A;  3CWV A;  4PRX A;  2EM9 A;  1H72 C;  2PO0 B;  2BV3 A;  3AV0 A;  1NCS A;  4DUZ I;  1BB8 A;  4BA2 A;  1YFH A;  4DR3 E;  4JI0 I;  1ZAA C;  3GME A;  2O3Z A;  4MU4 A;  2NN6 D;  4GKK I;  1HNW I;  1IBK E;  4NXN I;  3U1K A;  5KL7 A;  4DPX A;  5JEA F;  4QNK A;  2C39 A;  4OX9 I;  4LFB E;  2L8T A;  1IMU A;  1ELO A;  1EKZ A;  3OML A;  2EMI A;  4BCA A;  1WHQ A;  2E1R A;  4LFC I;  2HK2 A;  4JI6 E;  3MHH C;  1G2F C;  2Q2E B;  1E3P A;  1IQO A;  4LF7 E;  1B62 A;  4DV3 E;  2CSH A;  4MQY A;  5GMD A;  1EH6 A;  4KHP I;  4JI5 E;  4R2D A;  2LTS A;  1LLM C;  4YY3 I;  4ISA A;  2HK3 A;  1UN6 B;  4Z7C A;  4DV5 E;  2Z5C A;  2EP3 A;  4B3M I;  5AE1 A;  3MHS C;  1ZM4 A;  1WJP A;  1PJS A;  2D9H A;  3J7A G;  4OO1 F;  3L7Z B;  4JI1 E;  4U3B A;  4IFD D;  2EPX A;  2ENA A;  3AUZ A;  5FLX Q;  1X6F A;  2EJ4 A;  4LU9 A;  3HPS A;  4X9J A;  4MU3 A;  1N32 I;  1R6M A;  3ZM7 A;  5C0X C;  2DSY A;  3J81 C;  4WUD A;  2FV4 B;  2L6M A;  3KZY A;  3PYE A;  3B82 A;  1Y4U A;  4HAC B;  1Z0W A;  3OTO I;  2PNL A;  2EPZ A;  4N4R B;  2BM1 A;  2V8Q B;  2I13 A;  4DV1 E;  1OYR A;  4JI7 E;  2PRT A;  4DPW A;  3CDJ A;  4LF4 E;  1IQS A;  3ZZU A;  3BID A;  4R8O A;  2R42 A;  2X36 A;  4P7A A;  2EPU A;  2UUA I;  3DF6 A;  3Q1Q A;  4WUC A;  2HGH A;  1XMO E;  3P3C A;  4ZVI A;  2M7Q A;  4AIM A;  1X49 A;  2EM6 A;  2DIX A;  4TUI A;  4DPU A;  2G7H A;  2LCE A;  5A2Q Q;  1L4S A;  2V2V A;  1NHJ A;  2A2C A;  4K0K I;  3T1H I;  1PJQ A;  2YRH A;  2EOR A;  1EI1 A;  4BC7 A;  3F6H A;  5IV8 B;  2EM2 A;  5C0X E;  4I3H A;  2C39 B;  1KJK A;  2YZT A;  3JAM Q;  3LNU A;  4BS9 A;  4IZK A;  4KZS A;  4B3T I;  1ZXN A;  2RPC A;  3B78 A;  5BR8 I;  1A1G A;  3F6G A;  5A6B A;  2B3T B;  3ADL A;  1H74 A;  1PVG A;  3V2U C;  2F4V I;  4RHB B;  1DQ3 A;  1N36 E;  1XNR E;  2BA0 G;  2YSO A;  4JI8 I;  1YH8 A;  2HKE A;  1TF3 A;  4LF9 I;  4NHR A;  3LML A;  1X6H A;  2RS7 A;  1WUU A;  1USU A;  4GKJ E;  3GCM A;  2EMW A;  2BBG A;  4R2A A;  3LPS A;  2B7T A;  1A1K A;  2L3C A;  4Q28 A;  4IJD A;  1O0W A;  5C0X D;  1BKN A;  5K36 A;  2CTD A;  4LTY A;  2JE6 A;  2EOM A;  2EPM X;  5FWK A;  2O1U A;  1EA6 A;  5DRQ A;  4WX9 A;  1N3G A;  2WZO A;  3PS3 A;  1ZM2 A;  3BF2 A;  1Y6Z A;  1A1J A;  2EM7 A;  2NAB A;  2VF3 A;  2YSP A;  4FW5 A;  2EPN A;  4F9A B;  2LBS B;  4OX9 E;  2NN6 C;  4DR5 I;  3THO B;  5KL3 A;  3IWD A;  4X66 E;  2YTP A;  4P7D A;  4DR1 E;  1A1F A;  5EKW A;  5A6J A;  2CGE A;  2MKN A;  1NHH A;  2UU9 I;  4DUY E;  4HTG A;  2EN8 A;  4DXL A;  4ED4 A;  3T1Y I;  2EML A;  2ZBK B;  1WRJ A;  1WXR A;  2EQ3 A;  2KOU A;  2M4I A;  4QNJ A;  2V34 A;  4JV5 I;  4JI4 I;  4B3R I;  2PO1 A;  1U2R A;  4FW7 A;  4WUB A;  1A1H A;  2UXB I;  1DI2 A;  2V83 A;  2EOQ A;  2UUB E;  1WHN A;  2J7K A;  3ZZ0 A;  4X62 I;  2JOX A;  2JR1 A;  2HFS A;  1GZ6 A;  4R2S A;  2O1W A;  2EN3 A;  3GON A;  2Z5B A;  2NN6 E;  4DR4 E;  2EN4 A;  4IFD C;  2WBT A;  3DD6 A;  2PNM A;  3P06 A;  1N32 E;  3PS1 A;  4YY3 E;  4LFA I;  3EQ1 A;  3M7N G;  4BBY A;  2EE8 A;  4BC9 A;  4OKG A;  2DEJ A;  4MLV A;  1FWK A;  2V2Q A;  4J8Z A;  1IBL E;  3RMP A;  4X65 I;  4MU1 A;  1Z0T A;  2EN1 A;  4DU7 A;  2DGC A;  5JEA A;  1XNQ I;  5L3J A;  2EMB A;  5K36 B;  1HNX E;  1PJT A;  5FLX C;  2CPN A;  4BMJ A;  5KL4 A;  3D4J A;  2ELY A;  2LMZ A;  2JE6 B;  4F6N A;  2JT2 A;  2GPI A;  2JEB B;  1UDN A;  5C0X F;  3ADG A;  2FGG A;  5IT9 C;  4LF8 I;  1X6E A;  4DR6 E;  2UXD I;  1MU5 A;  4B3S I;  2BR2 B;  4IFD E;  1PDA A;  2R76 A;  2WP8 B;  4JI3 E;  4HY1 A;  4IZJ A;  3WU5 A;  1F2I G;  4LCH A;  3UHM A;  2ZM6 E;  3IWB A;  1HNZ E;  4WSP A;  4ZYE A;  4XTJ A;  2BB8 A;  1T38 A;  3KRN A;  2V85 A;  2LT7 A;  1ZBQ A;  3HKM A;  4OO1 A;  2YTE A;  4LF5 I;  3QT6 A;  1KIJ A;  2DRP A;  4M9V C;  2JVA A;  2BA0 D;  1YZ9 A;  4JI8 E;  1UDQ A;  5T6J A;  3C6K A;  1KKH A;  2WW4 A;  2J65 A;  4LF9 E;  5IWA I;  2LJP A;  2GS8 A;  1YUJ A;  5A2Q C;  4HYM A;  4DPT A;  3KWR A;  3C6M A;  3U1Y A;  2EOJ A;  3QT5 A;  2GLI A;  4N3O A;  4NXM I;  4DV7 E;  3QG5 C;  3ZOQ B;  2PO1 B;  2RSI A;  2JWO A;  2VQF I;  3ECR A;  4O24 A;  1K47 A;  2NUF A;  2VQE I;  3PYD A;  3JTZ A;  4DR2 I;  3JAM C;  2HC5 A;  2N8X A;  3B8H A;  1ZM3 A;  4O4K A;  2UUC I;  4AQY I;  2EOI A;  2Z5B B;  1AAY A;  4LF6 E;  2R3V A;  2BA1 G;  2C38 A;  5AC4 A;  2EM4 A;  5DNY A;  2EMZ A;  2EOH A;  1T4L B;  2Z5E A;  1X48 A;  1R6L A;  1IBM I;  1FKA E;  2VE7 C;  1YPN A;  3ZKD A;  4DV0 E;  2JPA A;  3EPL A;  2EOO A;  4LCF A;  5GME A;  4F54 A;  2EL5 A;  1H73 A;  3VHT B;  2EN7 A;  4F9C B;  5IXM B;  3EPJ A;  1A6F A;  3BGH A;  5JEA B;  5LMU E;  1HR0 I;  2EMK A;  3QT8 A;  3ZZT A;  1MX0 A;  1USV A;  4FWH A;  2CT1 A;  5AAS A;  4M1K A;  4KQV A;  2LVH A;  4MU0 A;  5DRP A;  4JI2 I;  2M1S A;  2UXC E;  1N34 I;  2EQ1 A;  1P47 A;  1Z5C A;  2O1T A;  2GO4 A;  2YTN A;  3KZZ A;  4WXC A;  1UDS A;  4DV2 E;  2NN6 F;  1D6T A;  2DLK A;  1X5W A;  1Z59 A;  1B69 A;  3THN A;  1YHC A;  3F0N A;  4IZJ B;  2DB2 A;  1J5E E;  3ADI A;  4O5G A;  1N33 I;  2WBS A;  5DNL A;  4DR7 I;  1SR9 A;  2V2Z A;  1VIS A;  3PYF A;  4MDT A;  1HK7 A;  5TSE A;  1RR9 A;  2E1M A;  5LLQ A;  2IOP A;  1IBK I;  4OO1 B;  2EPC A;  4DV6 E;  4LFA E;  4FN5 A;  3VK6 A;  4URL A;  3M7N D;  2HHH E;  4JYA E;  4BA1 B;  4L5N C;  2LUP B;  3WU3 A;  2ENH A;  4M2Z A;  5DNX A;  5LMN I;  4KWY A;  1KYQ A;  4LFB I;  4LPF A;  3WU4 A;  3K6Q A;  4X64 E;  4DV4 E;  1BBO A;  4WSG A;  2O1V A;  4FW9 A;  1TN9 A;  3H1C A;  2L2K B;  4JI6 I;  4F9B B;  3EPH A;  2JEB A;  2OI2 A;  1NEI A;  3J7A M;  3JU0 A;  4DUZ E;  2EM3 A;  2IOQ A;  2V87 A;  4LF7 I;  2BR2 A;  3M99 B;  4JI0 E;  4DV3 I;  4IFD F;  4GKK E;  2YTQ A;  1HNW E;  4P52 A;  2WP8 A;  5DRR A;  4UT4 A;  4JI5 I;  4NXN E;  2BM0 A;  4USK A;  2B9D A;  4NBQ A;  1QNT A;  1UHZ A;  2LE2 A;  3HXL A;  2GHF A;  1UIL A;  4B3S E;  2C38 B;  4FW4 A;  1ZXM A;  4FWG A;  3PS2 A;  1QU6 A;  4GZN C;  2HKJ A;  1VI7 A;  2XEX A;  2M9A A;  2CG9 A;  4LFC E;  5JEA D;  2I9I A;  4NZV A;  2AE8 A;  2L3J A;  4R2E A;  1KVK A;  4KHP E;  1N0V C;  1OYP A;  4LOM A;  1YYW A;  2EPO A;  2DMI A;  2K4V A;  2V86 A;  2JYA A;  1OYS A;  2EMH A;  5IWA E;  4B3M E;  1T39 A;  2NA2 A;  1JK2 A;  2EM5 A;  4DV1 I;  4JG4 A;  4JI7 I;  2RS6 A;  3H09 A;  4Z7Y A;  2YTO A;  4IZJ D;  2AJ4 A;  2JY9 A;  2WCC 3;  2V8P A;  4DR2 E;  5EL9 A;  4ZYD A;  2DEI A;  4X8W A;  1XMO I;  4R2C A;  2EWL A;  2YRM A;  4WPY A;  1EH7 A;  4AQY E;  2EPL X;  2B7V A;  2UUC E;  1MEY C;  3NZK A;  2BA1 D;  4DU8 A;  3OTO E;  3J80 Q;  5AC5 A;  2EM0 A;  2EOX A; 
#chains in the Genus database with same CATH homology
 1X47 A;  2FTX B;  2LUQ A;  1ZM9 A;  2E5L I;  5AE2 A;  2UUA E;  2NPF A;  3C4B A;  1N36 I;  1T4O A;  2LRS A;  1Z0E A;  4DMI A;  4K0K E;  3T1H E;  2LTR A;  1RQ0 A;  4GKJ I;  4M0V A;  2V89 A;  4JI2 E;  2NUG A;  2F8B A;  1Z5A A;  3J7Y p;  4B3T E;  2YT4 A;  5BR8 E;  1T4N A;  2F4V E;  4P78 A;  1KTV A;  3P1X A;  1N33 E;  1I94 I;  2ODR C;  4DR7 E;  5CFF E;  1ZBT A;  4PU9 A;  3VYX A;  3WU6 A;  1XMQ I;  1H7U A;  4RPF A;  4GEQ B;  5LMN E;  4X66 I;  4DR1 I;  1H7S A;  4R03 A;  2DMY A;  2IHR 1;  1S4E A;  4DUY I;  3HJC A;  1MG7 A;  1UEK A;  3H4L A;  4USM A;  3M6A A;  4DR5 E;  2GQ0 A;  3DJW A;  2UUB I;  2RTX A;  1Z0C A;  4MYU A;  2JOB A;  2L92 A;  1FJG I;  2UU9 E;  4DR4 I;  2N3H A;  1PKP A;  3V5R A;  3T1Y E;  5IT9 Q;  3FIG A;  1XHK A;  4YY3 I;  2RSM A;  1YYK A;  4HXZ A;  1DAR A;  1B63 A;  3VYY A;  4M30 A;  1STU A;  2H36 X;  4JI4 E;  4JV5 E;  1OJ4 A;  3Q6M A;  2UXB E;  3PYG A;  4X62 E;  1IBL I;  2ODR D;  3HQ1 A;  4UTG A;  1RRE A;  1HNX I;  4DR3 I;  1GQE A;  2LJH A;  1FWL A;  2MC6 A;  4DR6 I;  1QZR A;  2EZ6 A;  2MDR A;  4YHH E;  4X65 E;  4JI3 I;  1XNQ E;  2CZ9 A;  2E5L E;  3K17 A;  2ZM6 I;  4DKK A;  1S16 A;  4OOG C;  3J81 Q;  1HNZ I;  4DPY A;  5LL6 R;  2HFU A;  2L33 A;  1RC7 A;  4LF8 E;  2UXD E;  4DV5 I;  4L8N A;  3Q6N A;  2L2M A;  1Z0G A;  3C4T A;  1PIE A;  2ZIT A;  4JI1 I;  5ADZ A;  4DV7 I;  3J80 C;  1FI4 A;  2Z5C B;  3HUL A;  4LF5 E;  4FWD A;  1FNM A;  5AE3 A;  3K85 A;  2VF1 A;  4LF6 I;  1I94 E;  4B3R E;  1J26 A;  3IWC A;  1XMQ E;  1Y4S A;  4EMD A;  2X7I A;  3PRY A;  4NXM E;  4DV0 I;  4LF4 I;  3QT7 A;  2VQF E;  3ADJ A;  2VQE E;  4WYQ B;  2A2D A;  4MYT A;  3K1J A;  3HPZ A;  1Z5B A;  5LMU I;  1Z0V A;  4PRV A;  3HTX A;  2L2N A;  1Z0B A;  3LTO A;  1IBM E;  1YYO A;  2UXC I;  1N0U A;  4I8O A;  5F3W A;  2N3G A;  4DV2 I;  3ZKB A;  1FJG E;  1J5E I;  1XNR I;  2KON A;  2NUE A;  1HR0 E;  4IZK B;  4HAC A;  3LLH A;  3MSW A;  2EFG A;  4DV6 I;  2KHX A;  2MC5 A;  2HHH I;  4TUG A;  4JYA I;  1N34 E;  4WFT A;  1NHI A;  1NZ0 A;  2V88 A;  4X64 I;  4DV4 I;  3CWV A;  4PRX A;  1H72 C;  2BV3 A;  3AV0 A;  4DUZ I;  4DR3 E;  4JI0 I;  4GKK I;  1HNW I;  1IBK E;  4NXN I;  4DPX A;  4OX9 I;  4LFB E;  2L8T A;  1ELO A;  1EKZ A;  3OML A;  4BCA A;  1WHQ A;  2E1R A;  4LFC I;  2HK2 A;  4JI6 E;  2Q2E B;  4LF7 E;  1B62 A;  4DV3 E;  5GMD A;  4KHP I;  4JI5 E;  2LTS A;  2HK3 A;  4Z7C A;  4DV5 E;  2Z5C A;  4B3M I;  5AE1 A;  1ZM4 A;  3J7A G;  4JI1 E;  3AUZ A;  5FLX Q;  4LU9 A;  3HPS A;  1N32 I;  3ZM7 A;  2DSY A;  3J81 C;  4WUD A;  2FV4 B;  2L6M A;  3PYE A;  3B82 A;  1Y4U A;  4HAC B;  1Z0W A;  3OTO I;  2PNL A;  2BM1 A;  2V8Q B;  4DV1 E;  4JI7 E;  4DPW A;  4LF4 E;  3ZZU A;  4R8O A;  2X36 A;  2R42 A;  4P7A A;  2UUA I;  3DF6 A;  3Q1Q A;  4WUC A;  1XMO E;  4ZVI A;  2M7Q A;  1X49 A;  4DPU A;  2DIX A;  4TUI A;  5A2Q Q;  2G7H A;  2V2V A;  1NHJ A;  2A2C A;  4K0K I;  3T1H I;  1EI1 A;  4BC7 A;  3F6H A;  4I3H A;  3JAM Q;  2YZT A;  3LNU A;  4BS9 A;  4IZK A;  4KZS A;  4B3T I;  1ZXN A;  3B78 A;  5BR8 I;  1H74 A;  3F6G A;  3ADL A;  2B3T B;  1PVG A;  2F4V I;  1N36 E;  1DQ3 A;  1XNR E;  4JI8 I;  2HKE A;  4LF9 I;  3LML A;  1WUU A;  2RS7 A;  1USU A;  4GKJ E;  3LPS A;  2B7T A;  2L3C A;  4Q28 A;  1O0W A;  1BKN A;  4LTY A;  5FWK A;  2O1U A;  1EA6 A;  2WZO A;  1ZM2 A;  1Y6Z A;  2VF3 A;  4F9A B;  2LBS B;  4OX9 E;  4DR5 I;  3IWD A;  4X66 E;  4P7D A;  4DR1 E;  2CGE A;  1NHH A;  2UU9 I;  4DUY E;  4DXL A;  4ED4 A;  3T1Y I;  2ZBK B;  1WXR A;  2M4I A;  2KOU A;  2V34 A;  4JV5 I;  4JI4 I;  1U2R A;  4WUB A;  2UXB I;  1DI2 A;  2V83 A;  2UUB E;  1WHN A;  2J7K A;  3ZZ0 A;  4X62 I;  2JOX A;  2JR1 A;  2HFS A;  1GZ6 A;  2O1W A;  3GON A;  2Z5B A;  4DR4 E;  2PNM A;  3P06 A;  1N32 E;  4YY3 E;  4LFA I;  4BBY A;  4BC9 A;  2DEJ A;  1FWK A;  2V2Q A;  4J8Z A;  1IBL E;  3RMP A;  4X65 I;  1Z0T A;  4DU7 A;  1XNQ I;  5L3J A;  1HNX E;  5FLX C;  2CPN A;  4BMJ A;  3D4J A;  2LMZ A;  3ADG A;  2FGG A;  5IT9 C;  4LF8 I;  4DR6 E;  2UXD I;  1MU5 A;  4B3S I;  4JI3 E;  4HY1 A;  4IZJ A;  3WU5 A;  2ZM6 E;  3IWB A;  1HNZ E;  4WSP A;  4XTJ A;  3V2U C;  4LF5 I;  2V85 A;  1ZBQ A;  3QT6 A;  1KIJ A;  2JVA A;  2WW4 A;  1YZ9 A;  4JI8 E;  4B3R I;  5T6J A;  1KKH A;  4LF9 E;  5IWA I;  2LJP A;  2GS8 A;  5A2Q C;  4HYM A;  4DPT A;  3KWR A;  3QT5 A;  4N3O A;  4NXM I;  4DV7 E;  3ZOQ B;  2JWO A;  2VQF I;  1K47 A;  2VQE I;  2NUF A;  3PYD A;  3JTZ A;  4DR2 I;  3JAM C;  3B8H A;  1ZM3 A;  2UUC I;  4AQY I;  2Z5B B;  4LF6 E;  2R3V A;  5DNY A;  1T4L B;  1IBM I;  2Z5E A;  1X48 A;  1FKA E;  2VE7 C;  3ZKD A;  4DV0 E;  5GME A;  4F54 A;  1H73 A;  4F9C B;  1A6F A;  5LMU E;  1HR0 I;  3QT8 A;  3ZZT A;  1MX0 A;  1USV A;  4FWH A;  5AAS A;  4M1K A;  4KQV A;  4JI2 I;  2M1S A;  2UXC E;  1N34 I;  1Z5C A;  2O1T A;  4DV2 E;  1D6T A;  1Z59 A;  3F0N A;  4IZJ B;  2DB2 A;  1J5E E;  3ADI A;  1N33 I;  4DR7 I;  1SR9 A;  2V2Z A;  1VIS A;  3PYF A;  1HK7 A;  1RR9 A;  2E1M A;  2IOP A;  1IBK I;  4DV6 E;  4LFA E;  4FN5 A;  3VK6 A;  4URL A;  2HHH E;  4JYA E;  4L5N C;  2LUP B;  3WU3 A;  4M2Z A;  4LFB I;  5LMN I;  3WU4 A;  3K6Q A;  4X64 E;  4DV4 E;  2O1V A;  4FW9 A;  2L2K B;  4JI6 I;  4F9B B;  2OI2 A;  3J7A M;  3JU0 A;  4DUZ E;  2IOQ A;  2V87 A;  4LF7 I;  4DV3 I;  4JI0 E;  4GKK E;  1HNW E;  4UT4 A;  4P52 A;  4JI5 I;  4NXN E;  2BM0 A;  4USK A;  2B9D A;  1UHZ A;  2LE2 A;  3HXL A;  4B3S E;  1UIL A;  4FWG A;  1ZXM A;  1QU6 A;  2HKJ A;  2XEX A;  2CG9 A;  4LFC E;  2L3J A;  1KVK A;  1N0V C;  4KHP E;  1YYW A;  2K4V A;  2V86 A;  5IWA E;  4B3M E;  2NA2 A;  4DV1 I;  4JG4 A;  4JI7 I;  2RS6 A;  3H09 A;  4Z7Y A;  4IZJ D;  2AJ4 A;  2JY9 A;  2V8P A;  4DR2 E;  2DEI A;  4X8W A;  1XMO I;  2EWL A;  2UUC E;  4WPY A;  4AQY E;  2B7V A;  4DU8 A;  3OTO E;  3J80 Q;  4YHH I;  4R1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...