4JI4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji4E02
3J7Yp 1B63A 4B3RE 3K1JA 2NUFA 2X7IA 4X66E 1BKNA 1HR0E 1N0UA 2VF3A 3ADJA 1KKHA 4B3SE 4DPWA 3PYEA 1STUA 4JI3E 1Z0GA 4XTJA 3V5RA 4DV5I 3J7AG 4B3ME 4HACB 1XMOI 4DV1E 4JI8I 5BR8I 3VYYA 2NA2A 2HKEA 4JI5E 4WFTA 2A2CA 4LF7I 5CFFE 4PRVA 4YY3E 2E5LI 1XNRE 4FWGA 1PIEA 3QT7A 4MYUA 2L3JA 4JI4E 1YZ9A 2UXCE 3C4TA 4DV7I 4DPUA 4PRXA 5FLXQ 5LL6R 1YYKA 1PVGA 4GKJE 1RREA 2VQFI 2NPFA 4DU7A 5LMUE 2NUGA 4JI2I 1HNZI 1EKZA 1N32E 1HNWE 3J81Q 3D4JA 4B3RI 1OJ4A 4ZVIA 3P1XA 2VQEE 1HR0I 2ZM6E 4YHHE 1EA6A 4JI3I 2B3TB 4B3MI 1O0WA 1RR9A 4LFBE 1S4EA 4JI5I 2UU9E 4YY3I 2KHXA 1XNRI 1H7SA 2LUPB 4PU9A 1ZM3A 2LRSA 2UXBI 2LBSB 4DXLA 5FLXC 4X64I 4JI4I 4GKKI 2HHHE 3J80C 4WUDA 4DV6I 4GKJI 1NHHA 3V2UC 3J7AM 4JG4A 5LMUI 1S16A 1DARA 2X36A 4B3TE 1N33E 3J81C 1T4NA 1HNWI 1N32I 1X49A 2N3GA 3F0NA 3PYGA 1A6FA 2VQEI 2LTSA 4HY1A 2JY9A 1MX0A 4EMDA 4USMA 2ZM6I 4DR4E 4YHHI 4DV0I 3LLHA 2HFUA 4OX9E 4DV3E 4DV2I 3Q1QA 4LFBI 2E1RA 2L2MA 2OI2A 1ZXNA 2RTXA 4JYAE 4FWDA 3CWVA 2HKJA 4JI6E 2Q2EB 4Z7YA 4LFAE 2IHR1 1H74A 3LNUA 2V2QA 1I94E 2CZ9A 2V2VA 5L3JA 2R42A 2HHHI 3JAMC 4JI7I 1UILA 1YYWA 3HTXA 2LJPA 4NXME 1N34I 1UEKA 1Z5CA 1D6TA 1Z0CA 1X47A 4DR6I 2ZITA 4LF9E 4ED4A 4B3TI 1N33I 2UUBE 3ZM7A 2UXDE 4LF4E 4KHPE 3J80Q 4DR1E 2ZBKB 1WHNA 4X65E 1QU6A 1B62A 4DUZI 4RPFA 4DR4I 3WU6A 5IWAE 4FWHA 4OX9I 3T1HE 3B8HA 4WUBA 4DV3I 3LTOA 1RC7A 4X66I 2F4VE 1UHZA 1Z0WA 1XMQE 1ZM4A 3ZZ0A 4FW9A 1FJGE 1N0VC 1T4OA 4B3SI 4JYAI 2LUQA 2V8PA 1ELOA 2DEIA 4P52A 4NXNE 4LFAI 4DV1I 4X8WA 4K0KE 2BM1A 2V2ZA 1WHQA 1I94I 1IBME 1ZM9A 1MU5A 1DI2A 4HYMA 4FN5A 1IBLE 3GONA 1GQEA 4DV4E 4LF8E 1EI1A 3B82A 4DR5E 1H72C 4LFCE 1NHJA 1J5EE 2N3HA 1IBKE 4LF9I 1N36E 2UUBI 4I3HA 2UXCI 2UXDI 3WU5A 4LF4I 4KHPI 3JAMQ 2UUCE 4DR1I 3ADGA 4X65I 1XMOE 5IWAI 4LF6E 4OOGC 2LTRA 2LJHA 4LF7E 4HACA 3VYXA 4M30A 2GS8A 2YT4A 1XMQI 1FJGI 1WUUA 1Z5BA 2L2NA 4K0KI 4P7AA 4AQYE 2WW4A 3ZZTA 2EZ6A 2UU9I 1IBLI 3QT8A 4WYQB 1KIJA 2VQFE 4LF8I 1T4LB 3B78A 2CPNA 3QT6A 1IBKI 2R3VA 1N36I 3C4BA 2L33A 4DKKA 4DR3E 2HFSA 3HULA 2UUCI 1PKPA 2DB2A 3K17A 2UUAE 2NUEA 1MG7A 4X62E 1NZ0A 4LF6I 2AJ4A 4JV5E 1H7UA 5IT9C 2EFGA 3ADLA 5LMNE 1KTVA 2DMYA 2RSMA 2RS6A 5GMDA 4DUYE 4DR7E 1Z0VA 1ZXMA 1ZBTA 5A2QQ 3T1YE 2UXBE 4JI0E 1X48A 1K47A 4JI1E 4X64E 2J7KA 4GKKE 1HNXE 3OTOE 4AQYI 3LPSA 2L2KB 4UTGA 2A2DA 4DV6E 1XHKA 2L3CA 2DEJA 2XEXA 4JI6I 3ZKDA 1ZM2A 2MDRA 1VISA 3QT5A 2JVAA 4LF5E 4DR2E 1Z0BA 1FNMA 1XNQE 2BV3A 4DR3I 4M1KA 2HK3A 4NXMI 4R1FA 4DV0E 2UUAI 4DPXA 4USKA 4X62I 2BM0A 4MYTA 4DU8A 1KVKA 4DV2E 1FWKA 4JV5I 1J26A 5LMNI 1Z0TA 5A2QC 4DUYI 4DV5E 4DR7I 5GMEA 3PYDA 1Z59A 4KQVA 3T1YI 4JI0I 1Z0EA 2HK2A 4Z7CA 4JI8E 5BR8E 3T1HI 1H73A 1FI4A 4WUCA 3M6AA 4JI1I 3ZZUA 4DPYA 1HNXI 3ADIA 3OTOI 4UT4A 2F4VI 4JI7E 2E5LE 5IT9Q 4HXZA 1NHIA 2DIXA 1N34E 4M2ZA 1QZRA 2B7TA 4DR6E 1Z5AA 4NXNI 1RQ0A 3WU4A 4DV7E 1FWLA 1U2RA 1IBMI 4LF5I 2B7VA 4DR2I 3ZKBA 3WU3A 2RS7A 4DPTA 3PYFA 1XNQI 4DV4I 3H4LA 1YYOA 4DUZE 2V34A 4DR5I 1FKAE 4JI2E 4URLA 1HNZE 4LFCI 1J5EI
chains in the Genus database with same CATH superfamily
3J7Yp 2PNLA 2O3ZA 1A1KA 1B63A 1T38A 4B3RE 2Q8UA 3K1JA 2K7IA 1GTKA 2NUFA 3K6QA 2EPRA 2FTXB 1HK7A 2X7IA 4X66E 1BKNA 1HR0E 4IFDF 1N0UA 2EN6A 2VF3A 3ADJA 2YRKA 2EMYA 1KKHA 4B3SE 4DPWA 5T6JA 3PYEA 1STUA 4JI3E 1Z0GA 4IZKB 4XTJA 3V5RA 4NBQA 4DV5I 2EMCA 2VE7C 3J7AG 1YPNA 4B3ME 2DGCA 4HACB 1XMOI 1X5WA 4IZJA 2YTPA 2DLKA 4DV1E 2V85A 2ENHA 1AH5A 4F2JC 2YZTA 4JI8I 5BR8I 4BHCA 2DMIA 2NA2A 2L6MA 5A6BD 3VYYA 4JI5E 2HKEA 4WFTA 2A2CA 2GO4A 5CFFE 4LF7I 2F1DA 2IERA 2JEAA 4PRVA 3U1KA 3EPHA 5KL4A 2ADRA 4YY3E 1USVA 2YSPA 3M85G 2E5LI 1XNRE 2DSYA 1E3HA 4FWGA 1PIEA 2EN8A 4F6MA 3RMPA 4BA1B 1RMDA 3PRYA 2EM2A 4WXDA 2FV4B 1YSAC 4I8OA 3QT7A 2R1FA 4MYUA 2L3JA 2YRHA 3LMLA 2EPMX 2JXPA 3BIDA 4JI4E 1YZ9A 3C4TA 2UXCE 1EH8A 5JEAB 4DPUA 4DV7I 2J7JA 5KL6A 4PRXA 5FLXQ 2PO1A 5LL6R 1YYKA 2NABA 4MU1A 2VRDA 1Y4UA 1GZ6A 3C6KA 4LTYA 5AE2A 4GKJE 1PVGA 1RREA 1G2FC 1UDSA 3HJCA 3NZKA 2NPFA 3M85D 2VQFI 2WBUA 1LLMC 2BA1G 4DU7A 4BC7A 5LMUE 5AC5A 2BA0D 2NUGA 2LE2A 4JI2I 2HGHA 3PS1A 1HNZI 3M7NG 3HPZA 2JWOA 2EMZA 1EKZA 4LCFA 2JOXA 4LCGA 5DNXA 1N32E 1HNWE 3KRNA 3J81Q 3D4JA 4B3RI 1OJ4A 4IZJD 5IV8B 4F9BB 2CGEA 4ZVIA 5C0XB 2WBTA 3P1XA 2VQEE 2M7QA 2PNZA 1HR0I 4U3BA 1USUA 3Q6MA 2ZM6E 4YHHE 3KWRA 2JE6B 2PO0B 1EA6A 4JI3I 2B3TB 1E3PA 1F2IG 2PNMA 2LMZA 2EOSA 4MU0A 2F8BA 4B3MI 4O43A 1O0WA 4FW5A 1RR9A 2D9HA 2J65A 2K4VA 4LFBE 1S4EA 5FWKA 4JI5I 2ENAA 2CTDA 2Z5EA 2UU9E 2EPXA 2O1VA 4YY3I 2KHXA 2MC6A 4WX9A 2JT2A 1XNRI 1H7SA 2KONA 2C37A 1P42A 2IESA 3IWCA 2LUPB 2V83A 4FK5C 4PU9A 1ZM3A 2CT1A 2C38A 2LRSA 2UXBI 2EPOA 4BS9A 1NCSA 2LBSB 4DXLA 5FLXC 4X64I 3MHSC 4JI4I 5C0XE 4GKKI 5K36C 3HKMA 4R2DA 2HHHE 3J80C 2Z5BA 2V88A 5LLQA 1PJTA 4NZVA 4ZYHA 2EMKA 3QG5C 2WZOA 4WUDA 4DV6I 4GKJI 1NHHA 2WBSA 2ELZA 3V2UC 3J7AM 2WNRB 3BF2A 2IOPA 4JG4A 1S16A 5LMUI 2EN7A 1DARA 2CSHA 2PO2A 2NN6B 2X36A 1X3CA 4B3TE 4O5GA 3J81C 1N33E 1UDNA 4ZYGA 4HTGA 2I13A 1T4NA 1UBDC 1HNWI 1N32I 1X49A 2YU5A 2N3GA 2YTDA 3F0NA 3PYGA 1A6FA 2VQEI 2LTSA 3THOB 4HY1A 2JY9A 3BBGA 4P78A 5KL2A 1MX0A 4HEIA 4DR4E 4EMDA 4USMA 2EOEA 4YHHI 2ZM6I 3LLHA 2HFUA 4DV0I 5EL9A 4LOMA 4OO1B 2LV2A 2O1WA 4OX9E 1IQSA 2BR2B 2O1TA 2EPUA 1IMUA 2MKDA 4DV3E 3GLLA 4DV2I 4M9VC 3Q1QA 4AM3A 4LFBI 1Y60A 2E1RA 2L2MA 5JEAC 2OI2A 4F9CB 1ZXNA 1UDQA 3FIGA 4P7DA 2RTXA 5A6JA 4JYAE 4FWDA 4KWYA 2EOJA 3TQMA 1A1IA 3CWVA 3GCMA 2HKJA 4JI6E 4QNJA 3JTZA 2Q2EB 4BA2A 1MGTA 4OZEA 3HQ1A 4Z7YA 2V8QB 2EWLA 2ODRC 4LFAE 2Z5CB 2IHR1 1H74A 3LNUA 5AASA 4TUIA 2JEBA 3PS2A 2EPKX 4M0VA 2V2QA 1I94E 2CZ9A 2V2VA 5DROA 5L3JA 2JPAA 2R42A 2HHHI 3MHHC 3JAMC 4O4KA 4JI7I 1UILA 1YYWA 3HTXA 2LJPA 2EOZA 4NXME 3ECRA 5C0XC 1N34I 4OO1E 1UEKA 1A1HA 1Z5CA 1Z0CA 5K36E 1D6TA 5C0XA 1X47A 5DRQA 4DR6I 1Y6ZA 3BGHA 5K36F 2ZITA 1AAYA 4LF9E 4L8NA 2PRTA 2AE8A 4ED4A 4B3TI 2L8TA 5KL5A 2UUBE 2PO0A 1N33I 2JP9A 4Q28A 2H36X 3ZM7A 1EH6A 2UXDE 2EMHA 2VF1A 2M9AA 1ZU1A 2M1SA 3CDJA 4LF4E 4KHPE 2B9DA 3J80Q 4WXCA 4DR1E 2ZBKB 1WHNA 4X65E 1QU6A 2EMIA 3AV0A 2E1MA 1B62A 2YTOA 2C39A 4RPFA 4DUZI 4DR4I 2YTEA 3M7ND 3KZZA 4R2EA 5KL7A 3WU6A 4N3OA 1A1GA 5TSEA 5IWAE 4FWHA 4OX9I 3T1HE 4X9JA 3B8HA 4WUBA 4DV3I 3MSWA 4U3DA 2YTFA 3LTOA 1RC7A 4X66I 2F4VE 2EPCA 1UHZA 3H09A 5KL3A 1TF6A 1XMQE 1Z0WA 1ZM4A 3ZZ0A 4Q35B 4FW9A 1FJGE 2EOIA 1N0VC 1T4OA 4B3SI 4JYAI 1N3GA 4IZJB 2LUQA 5AE3A 2EMAA 2EM7A 3F6GA 1ELOA 2LVHA 1P47A 2DEIA 2V8PA 3L7ZB 2LCEA 2LO3A 4P52A 5JEAE 5A69A 3OMLA 2EMLA 5DNLA 2V86A 4NXNE 5C0XD 2E72A 4LFAI 2JEAB 4DV1I 4X8WA 4K0KE 2BM1A 2EMXA 2NN6C 2V2ZA 3P3GA 1WHQA 2N8XA 1I94I 1IBME 1ZM9A 1MU5A 1DI2A 2EQ1A 2CVEA 4HYMA 1BBGA 4FN5A 2LJUA 2M4IA 2RSIA 4R2SA 3DJWA 1IBLE 2EOYA 3GONA 3P3EA 1GQEA 1A1LA 4DV4E 2GQ0A 4WSGA 4AIDA 2EN2A 3ZOQB 4LF8E 4IS1C 2EM5A 1EI1A 3B82A 5DNYA 4DR5E 5F3WA 1H72C 2YTGA 2BBGA 1A1JA 4LFCE 1NHJA 3UHMA 1J5EE 1X6HA 1WJPA 2EN4A 2N3HA 1IBKE 4BMJA 4LF9I 1N36E 4OO1C 1KJKA 4I3HA 2UUBI 2UXCI 5DRRA 1X6FA 4OO1A 5K36A 4F6NA 5C0XF 1SFEA 2UXDI 2EL5A 3WU5A 4LF4I 4KHPI 3JAMQ 2UUCE 4DR1I 3ADGA 4F54A 4J8ZA 4X65I 4DMIA 2I9IA 4R2PA 2RQLA 2EM9A 3U1YA 2JOBA 2EOHA 4KZSA 2DLQA 1XMOE 2WP8B 4IZKA 1UN6B 4LF6E 5IWAI 2EQ3A 1R6LA 4TUGA 2PNZB 2FGGA 4OOGC 2LTRA 1TN9A 2LJHA 4LF7E 4HACA 5A6AA 3VYXA 1PJSA 2Z5CA 4M30A 2GS8A 2YT4A 4IFDB 1XMQI 2EP3A 4FW4A 1ZBQA 1FJGI 4R8OA 3QT5A 3P3CA 2EQ0A 3IWBA 1PJQA 5IXMB 3M99B 1WUUA 2ELYA 4ZYDA 1B69A 1EH7A 2MKNA 4BA1A 1Z5BA 4L5NC 2L2NA 4K0KI 4P7AA 3UK3C 4AQYE 2C37B 4F9AB 2WW4A 3ZZTA 2EZ6A 2UU9I 2EOQA 5JEAA 1IBLI 3QT8A 4WYQB 4OO1D 2C38B 1KIJA 5K36D 2VQFE 4LF8I 1T4LB 2NN6E 3B78A 4RH8A 2BB8A 3HXLA 2NN6F 2CPNA 1L4SA 1DGCA 2EPZA 2Z5BB 3P06A 3K85A 2EN3A 3QT6A 1IBKI 2R3VA 3C6MA 1N36I 3C4BA 2L33A 4DKKA 2YTJA 4RHBB 4IFDE 5DRPA 4DR3E 2HFSA 3L00A 2WCC3 2O1UA 3HULA 2KOUA 2PO2B 2UUCI 1PKPA 2DB2A 4R2RA 3K17A 2YSOA 3EPJA 2UUAE 5A6KA 2NUEA 4OO1F 2ENCA 2YTIA 4R03A 1MG7A 4FW7A 4X62E 4FW6A 2EMWA 2JE6A 1NZ0A 4LF6I 2EORA 1JK2A 3L7ZA 2AJ4A 1WXRA 4JV5E 4BBYA 1H7UA 5IT9C 3VK6A 2EFGA 1QNTA 3AUZA 1OYSA 5LMNE 2DMYA 2RSMA 2RS6A 2EPNA 3ADLA 1YFHA 1KTVA 2BA1D 4LPFA 1RHYA 5GMDA 3JU0A 1T39A 4DUYE 4DR7E 1Z1BA 1Z0VA 1MEYC 1ZXMA 5JEAD 1ZBTA 2GHFA 4WPYA 2EJ4A 5AE1A 2EOOA 3T1YE 4JI0E 2UXBE 5A2QQ 1X48A 3THNA 3H1CA 2EOXA 2YRMA 1K47A 2JR1A 2YU8A 4X64E 4JI1E 2J7KA 4GKKE 1HNXE 4MDTA 3OTOE 2ODRD 4AQYI 2GLIA 3LPSA 2JYAA 3EQ1A 4WSPA 2L2KB 4UTGA 2A2DA 4BA2B 4DV6E 1XHKA 3DF6A 2L3CA 4NHRA 1VI7A 2CG9A 2DEJA 2XEXA 2JEBB 4GZNC 4JI6I 3ZKDA 3EPKA 2BA0G 1ZM2A 2EOFA 1PDAA 2EM8A 3B4TA 5JEAF 2WNRA 3CDIA 2HC5A 4MLVA 5ELWA 4GQUA 4LCHA 1YH8A 2MDRA 1VISA 2NN6A 2JVAA 3VHTB 1R6MA 3GMEA 4LF5E 2EPLX 4DR2E 4BHBA 1Z0BA 1FNMA 2WP8A 2G7HA 1XNQE 2BV3A 2EMBA 4DR3I 4M1KA 2HK3A 2L92A 1NEIA 4NXMI 2LT7A 4N4RB 4R1FA 4DV0E 2DRPA 5EKWA 2V89A 4ISAA 3KZYA 4IFDC 2UUAI 2EMFA 4ZYEA 4DPXA 4USKA 4IFDA 1ZAAC 4IS9A 4QNKA 4O24A 1SR9A 4X62I 2PO1B 2EN1A 1YUJA 2BM0A 3IWDA 4MYTA 2MDGA 4DU8A 2YPNA 1KVKA 4MQYA 4R2AA 4DV2E 1FWKA 2BR2A 4JV5I 2EL6A 2VESA 2C39B 2EM0A 2V87A 1J26A 3P76A 1WRJA 5LMNI 2R76A 1Y5YA 1Z0TA 2YTNA 4BC9A 2EE8A 2EPAA 2GPIA 3HPSA 5A2QC 4DUYI 4DV5E 3EPLA 5GMEA 4DR7I 2RPCA 3PYDA 2EPPA 1Z59A 4KQVA 1YHCA 3T1YI 4JI0I 1Z0EA 2MC5A 2HK2A 4Z7CA 4JI8E 5BR8E 4AIMA 3T1HI 1H73A 1FI4A 4WUCA 3M6AA 4JI1I 3ZZUA 4DPYA 1BBOA 1HNXI 3ADIA 3OTOI 4UT4A 2A25A 2F4VI 4JI7E 2E5LE 1XXEA 4J3DA 5IT9Q 4HXZA 1NHIA 2DIXA 2NN6D 4MLQA 1N34E 4M2ZA 1QZRA 4IJDA 2B7TA 4R2QA 1JK1A 2EOMA 4DR6E 1Z5AA 1G2DC 1OYRA 1ZR9A 5A6BA 2EM4A 3Q6NA 4NXNI 2HJJA 2EL4A 1RQ0A 4BCAA 3WU4A 4DV7E 1FWLA 4MU4A 1A1FA 1U2RA 1BB8A 1IBMI 4MU3A 4IFDD 4OKGA 2EM3A 4LF5I 2B7VA 4GEQB 4DR2I 1X6EA 3ZKBA 3WU3A 2RS7A 4DPTA 3PS3A 3PYFA 2EM6A 1XNQI 4DV4I 3DD6A 1YUIA 4R2CA 3H4LA 1TF3A 5ADZA 1KYQA 2YWQA 1YYOA 4DUZE 1DQ3A 2GO3A 1Y4SA 2V34A 4DR5I 1FKAE 4JI2E 1IQOA 1HNZE 4URLA 2EMGA 4LFCI 4LU9A 2YTQA 5AC4A 1J5EI 1UDOA 4FW3A 5K36B 3F6HA 2IOQA 1OYPA
chains in the Genus database with same CATH topology
3J7Yp 2PNLA 1B63A 4B3RE 3K1JA 2NUFA 1HK7A 3K6QA 2FTXB 2X7IA 4X66E 1BKNA 1HR0E 1N0UA 2VF3A 3ADJA 1KKHA 4B3SE 4DPWA 5T6JA 3PYEA 1STUA 4JI3E 1Z0GA 4IZKB 4XTJA 3V5RA 4DV5I 2VE7C 3J7AG 4B3ME 4HACB 1XMOI 4IZJA 4DV1E 4JI8I 5BR8I 2V85A 2YZTA 3VYYA 2NA2A 2L6MA 2HKEA 4JI5E 4WFTA 2A2CA 4LF7I 5CFFE 4PRVA 1USVA 4YY3E 2E5LI 1XNRE 2DSYA 4FWGA 1PIEA 3RMPA 3PRYA 2FV4B 3QT7A 4I8OA 4MYUA 2L3JA 4JI4E 3LMLA 1YZ9A 2UXCE 3C4TA 4DV7I 4DPUA 4PRXA 5FLXQ 5LL6R 1YYKA 1Y4UA 1GZ6A 4LTYA 4GKJE 5AE2A 1PVGA 3HJCA 1RREA 2VQFI 2NPFA 4DU7A 4BC7A 5LMUE 2NUGA 2LE2A 4JI2I 1HNZI 3HPZA 2JWOA 1EKZA 2JOXA 1N32E 1HNWE 3J81Q 3D4JA 4B3RI 1OJ4A 4IZJD 4F9BB 2CGEA 4ZVIA 3P1XA 2VQEE 2M7QA 1HR0I 1USUA 3Q6MA 2ZM6E 4YHHE 3KWRA 1EA6A 4JI3I 2B3TB 2PNMA 2LMZA 2F8BA 4B3MI 1O0WA 1RR9A 2K4VA 4LFBE 1S4EA 5FWKA 4JI5I 2Z5EA 2UU9E 2O1VA 4YY3I 2KHXA 2MC6A 1XNRI 1H7SA 2KONA 3IWCA 2LUPB 2V83A 4PU9A 1ZM3A 2LRSA 2UXBI 4BS9A 2LBSB 4DXLA 5FLXC 4X64I 4JI4I 4GKKI 2HHHE 3J80C 2Z5BA 2V88A 2WZOA 4WUDA 4DV6I 4GKJI 1NHHA 3V2UC 3J7AM 2IOPA 4JG4A 1S16A 5LMUI 1DARA 2X36A 4B3TE 1N33E 3J81C 1T4NA 1HNWI 1N32I 1X49A 2N3GA 3F0NA 3PYGA 1A6FA 2VQEI 2LTSA 4HY1A 2JY9A 4P78A 1MX0A 4EMDA 4USMA 2ZM6I 4DR4E 4YHHI 4DV0I 3LLHA 2HFUA 2O1WA 4OX9E 2O1TA 4DV3E 4DV2I 3Q1QA 4LFBI 2E1RA 2L2MA 2OI2A 4F9CB 1ZXNA 3FIGA 4P7DA 2RTXA 4JYAE 4FWDA 3CWVA 2HKJA 4JI6E 3JTZA 2Q2EB 3HQ1A 4Z7YA 2V8QB 2EWLA 2ODRC 4LFAE 2Z5CB 1H74A 2IHR1 3LNUA 5AASA 4TUIA 4M0VA 2V2QA 1I94E 2CZ9A 2V2VA 5L3JA 2R42A 2HHHI 3JAMC 4JI7I 1UILA 1YYWA 3HTXA 2LJPA 4NXME 1N34I 1UEKA 1Z5CA 1D6TA 1Z0CA 1X47A 4DR6I 1Y6ZA 2ZITA 4LF9E 4L8NA 4ED4A 4B3TI 1N33I 2L8TA 2UUBE 4Q28A 2H36X 3ZM7A 2UXDE 2VF1A 2M1SA 4LF4E 4KHPE 2B9DA 3J80Q 4DR1E 2ZBKB 1WHNA 4X65E 1QU6A 3AV0A 1B62A 2E1MA 4DUZI 4RPFA 4DR4I 3WU6A 4N3OA 5IWAE 4FWHA 4OX9I 3T1HE 3B8HA 4WUBA 4DV3I 3MSWA 3LTOA 1RC7A 4X66I 2F4VE 1UHZA 3H09A 1Z0WA 1XMQE 1ZM4A 3ZZ0A 4FW9A 1FJGE 1N0VC 1T4OA 4B3SI 4JYAI 4IZJB 2LUQA 5AE3A 3F6GA 1ELOA 2V8PA 2DEIA 4P52A 3OMLA 4NXNE 2V86A 4LFAI 4DV1I 4X8WA 4K0KE 2BM1A 2V2ZA 1WHQA 1I94I 1IBME 1ZM9A 1MU5A 1DI2A 4HYMA 4FN5A 2M4IA 3DJWA 1IBLE 3GONA 1GQEA 2GQ0A 4DV4E 3ZOQB 4LF8E 1EI1A 3B82A 5DNYA 4DR5E 5F3WA 1H72C 4LFCE 1NHJA 1J5EE 2N3HA 1IBKE 4BMJA 4LF9I 1N36E 2UUBI 4I3HA 2UXCI 2UXDI 3WU5A 4LF4I 4KHPI 3JAMQ 2UUCE 4DR1I 3ADGA 4F54A 4J8ZA 4X65I 4DMIA 2JOBA 4KZSA 1XMOE 4IZKA 5IWAI 4LF6E 4TUGA 2FGGA 4OOGC 2LTRA 2LJHA 4LF7E 4HACA 2Z5CA 3VYXA 4M30A 2GS8A 2YT4A 1XMQI 1ZBQA 1FJGI 4R8OA 3IWBA 1WUUA 1Z5BA 4L5NC 2L2NA 4K0KI 4P7AA 4AQYE 4F9AB 2WW4A 3ZZTA 2EZ6A 2UU9I 1IBLI 3QT8A 4WYQB 1KIJA 2VQFE 4LF8I 1T4LB 3B78A 3HXLA 2CPNA 2Z5BB 3P06A 3K85A 3QT6A 1IBKI 2R3VA 1N36I 3C4BA 2L33A 4DKKA 4DR3E 2HFSA 2O1UA 3HULA 2KOUA 2UUCI 1PKPA 2DB2A 3K17A 2UUAE 2NUEA 4R03A 1MG7A 4X62E 1NZ0A 4LF6I 2AJ4A 1WXRA 4JV5E 4BBYA 1H7UA 5IT9C 3VK6A 2EFGA 3AUZA 3ADLA 5LMNE 2RSMA 2DMYA 2RS6A 1KTVA 5GMDA 3JU0A 4DUYE 4DR7E 1Z0VA 1ZXMA 1ZBTA 4WPYA 5A2QQ 5AE1A 3T1YE 2UXBE 4JI0E 1X48A 1K47A 2JR1A 4X64E 4JI1E 2J7KA 4GKKE 1HNXE 3OTOE 2ODRD 4AQYI 3LPSA 2L2KB 4WSPA 4UTGA 2A2DA 4DV6E 1XHKA 3DF6A 2L3CA 2CG9A 2DEJA 2XEXA 4JI6I 3ZKDA 1ZM2A 2MDRA 1VISA 3QT5A 2JVAA 4LF5E 4DR2E 1Z0BA 1FNMA 2G7HA 1XNQE 2BV3A 4DR3I 4M1KA 2HK3A 2L92A 4NXMI 4R1FA 4DV0E 2V89A 2UUAI 4DPXA 4USKA 1SR9A 4X62I 2BM0A 4MYTA 3IWDA 4DU8A 1KVKA 4DV2E 1FWKA 4JV5I 2V87A 1J26A 5LMNI 1Z0TA 4BC9A 3HPSA 5A2QC 4DUYI 4DV5E 4DR7I 5GMEA 3PYDA 1Z59A 4KQVA 3T1YI 4JI0I 1Z0EA 2MC5A 2HK2A 4Z7CA 4JI8E 5BR8E 3T1HI 1H73A 1FI4A 4WUCA 3M6AA 4JI1I 3ZZUA 4DPYA 1HNXI 3ADIA 3OTOI 4UT4A 2F4VI 4JI7E 2E5LE 5IT9Q 4HXZA 1NHIA 2DIXA 1N34E 4M2ZA 1QZRA 2B7TA 4DR6E 1Z5AA 3Q6NA 4NXNI 1RQ0A 4BCAA 3WU4A 4DV7E 1FWLA 1U2RA 1IBMI 4LF5I 2B7VA 4GEQB 4DR2I 3ZKBA 3WU3A 2RS7A 4DPTA 3PYFA 1XNQI 4DV4I 3H4LA 5ADZA 1YYOA 4DUZE 1DQ3A 1Y4SA 2V34A 4DR5I 1FKAE 4JI2E 4URLA 1HNZE 4LFCI 4LU9A 1J5EI 3F6HA 2IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y p;  1B63 A;  4B3R E;  3K1J A;  2NUF A;  2X7I A;  4X66 E;  1BKN A;  1HR0 E;  1N0U A;  2VF3 A;  3ADJ A;  1KKH A;  4B3S E;  4DPW A;  3PYE A;  1STU A;  4JI3 E;  1Z0G A;  4XTJ A;  3V5R A;  4DV5 I;  3J7A G;  4B3M E;  4HAC B;  1XMO I;  4DV1 E;  4JI8 I;  5BR8 I;  3VYY A;  2NA2 A;  2HKE A;  4JI5 E;  4WFT A;  2A2C A;  4LF7 I;  5CFF E;  4PRV A;  4YY3 E;  2E5L I;  1XNR E;  4FWG A;  1PIE A;  3QT7 A;  4MYU A;  2L3J A;  4JI4 E;  1YZ9 A;  2UXC E;  3C4T A;  4DV7 I;  4DPU A;  4PRX A;  5FLX Q;  5LL6 R;  1YYK A;  1PVG A;  4GKJ E;  1RRE A;  2VQF I;  2NPF A;  4DU7 A;  5LMU E;  2NUG A;  4JI2 I;  1HNZ I;  1EKZ A;  1N32 E;  1HNW E;  3J81 Q;  3D4J A;  4B3R I;  1OJ4 A;  4ZVI A;  3P1X A;  2VQE E;  1HR0 I;  2ZM6 E;  4YHH E;  1EA6 A;  4JI3 I;  2B3T B;  4B3M I;  1O0W A;  1RR9 A;  4LFB E;  1S4E A;  4JI5 I;  2UU9 E;  4YY3 I;  2KHX A;  1XNR I;  1H7S A;  2LUP B;  4PU9 A;  1ZM3 A;  2LRS A;  2UXB I;  2LBS B;  4DXL A;  5FLX C;  4X64 I;  4JI4 I;  4GKK I;  2HHH E;  3J80 C;  4WUD A;  4DV6 I;  4GKJ I;  1NHH A;  3V2U C;  3J7A M;  4JG4 A;  5LMU I;  1S16 A;  1DAR A;  2X36 A;  4B3T E;  1N33 E;  3J81 C;  1T4N A;  1HNW I;  1N32 I;  1X49 A;  2N3G A;  3F0N A;  3PYG A;  1A6F A;  2VQE I;  2LTS A;  4HY1 A;  2JY9 A;  1MX0 A;  4EMD A;  4USM A;  2ZM6 I;  4DR4 E;  4YHH I;  4DV0 I;  3LLH A;  2HFU A;  4OX9 E;  4DV3 E;  4DV2 I;  3Q1Q A;  4LFB I;  2E1R A;  2L2M A;  2OI2 A;  1ZXN A;  2RTX A;  4JYA E;  4FWD A;  3CWV A;  2HKJ A;  4JI6 E;  2Q2E B;  4Z7Y A;  4LFA E;  2IHR 1;  1H74 A;  3LNU A;  2V2Q A;  1I94 E;  2CZ9 A;  2V2V A;  5L3J A;  2R42 A;  2HHH I;  3JAM C;  4JI7 I;  1UIL A;  1YYW A;  3HTX A;  2LJP A;  4NXM E;  1N34 I;  1UEK A;  1Z5C A;  1D6T A;  1Z0C A;  1X47 A;  4DR6 I;  2ZIT A;  4LF9 E;  4ED4 A;  4B3T I;  1N33 I;  2UUB E;  3ZM7 A;  2UXD E;  4LF4 E;  4KHP E;  3J80 Q;  4DR1 E;  2ZBK B;  1WHN A;  4X65 E;  1QU6 A;  1B62 A;  4DUZ I;  4RPF A;  4DR4 I;  3WU6 A;  5IWA E;  4FWH A;  4OX9 I;  3T1H E;  3B8H A;  4WUB A;  4DV3 I;  3LTO A;  1RC7 A;  4X66 I;  2F4V E;  1UHZ A;  1Z0W A;  1XMQ E;  1ZM4 A;  3ZZ0 A;  4FW9 A;  1FJG E;  1N0V C;  1T4O A;  4B3S I;  4JYA I;  2LUQ A;  2V8P A;  1ELO A;  2DEI A;  4P52 A;  4NXN E;  4LFA I;  4DV1 I;  4X8W A;  4K0K E;  2BM1 A;  2V2Z A;  1WHQ A;  1I94 I;  1IBM E;  1ZM9 A;  1MU5 A;  1DI2 A;  4HYM A;  4FN5 A;  1IBL E;  3GON A;  1GQE A;  4DV4 E;  4LF8 E;  1EI1 A;  3B82 A;  4DR5 E;  1H72 C;  4LFC E;  1NHJ A;  1J5E E;  2N3H A;  1IBK E;  4LF9 I;  1N36 E;  2UUB I;  4I3H A;  2UXC I;  2UXD I;  3WU5 A;  4LF4 I;  4KHP I;  3JAM Q;  2UUC E;  4DR1 I;  3ADG A;  4X65 I;  1XMO E;  5IWA I;  4LF6 E;  4OOG C;  2LTR A;  2LJH A;  4LF7 E;  4HAC A;  3VYX A;  4M30 A;  2GS8 A;  2YT4 A;  1XMQ I;  1FJG I;  1WUU A;  1Z5B A;  2L2N A;  4K0K I;  4P7A A;  4AQY E;  2WW4 A;  3ZZT A;  2EZ6 A;  2UU9 I;  1IBL I;  3QT8 A;  4WYQ B;  1KIJ A;  2VQF E;  4LF8 I;  1T4L B;  3B78 A;  2CPN A;  3QT6 A;  1IBK I;  2R3V A;  1N36 I;  3C4B A;  2L33 A;  4DKK A;  4DR3 E;  2HFS A;  3HUL A;  2UUC I;  1PKP A;  2DB2 A;  3K17 A;  2UUA E;  2NUE A;  1MG7 A;  4X62 E;  1NZ0 A;  4LF6 I;  2AJ4 A;  4JV5 E;  1H7U A;  5IT9 C;  2EFG A;  3ADL A;  5LMN E;  1KTV A;  2DMY A;  2RSM A;  2RS6 A;  5GMD A;  4DUY E;  4DR7 E;  1Z0V A;  1ZXM A;  1ZBT A;  5A2Q Q;  3T1Y E;  2UXB E;  4JI0 E;  1X48 A;  1K47 A;  4JI1 E;  4X64 E;  2J7K A;  4GKK E;  1HNX E;  3OTO E;  4AQY I;  3LPS A;  2L2K B;  4UTG A;  2A2D A;  4DV6 E;  1XHK A;  2L3C A;  2DEJ A;  2XEX A;  4JI6 I;  3ZKD A;  1ZM2 A;  2MDR A;  1VIS A;  3QT5 A;  2JVA A;  4LF5 E;  4DR2 E;  1Z0B A;  1FNM A;  1XNQ E;  2BV3 A;  4DR3 I;  4M1K A;  2HK3 A;  4NXM I;  4R1F A;  4DV0 E;  2UUA I;  4DPX A;  4USK A;  4X62 I;  2BM0 A;  4MYT A;  4DU8 A;  1KVK A;  4DV2 E;  1FWK A;  4JV5 I;  1J26 A;  5LMN I;  1Z0T A;  5A2Q C;  4DUY I;  4DV5 E;  4DR7 I;  5GME A;  3PYD A;  1Z59 A;  4KQV A;  3T1Y I;  4JI0 I;  1Z0E A;  2HK2 A;  4Z7C A;  4JI8 E;  5BR8 E;  3T1H I;  1H73 A;  1FI4 A;  4WUC A;  3M6A A;  4JI1 I;  3ZZU A;  4DPY A;  1HNX I;  3ADI A;  3OTO I;  4UT4 A;  2F4V I;  4JI7 E;  2E5L E;  5IT9 Q;  4HXZ A;  1NHI A;  2DIX A;  1N34 E;  4M2Z A;  1QZR A;  2B7T A;  4DR6 E;  1Z5A A;  4NXN I;  1RQ0 A;  3WU4 A;  4DV7 E;  1FWL A;  1U2R A;  1IBM I;  4LF5 I;  2B7V A;  4DR2 I;  3ZKB A;  3WU3 A;  2RS7 A;  4DPT A;  3PYF A;  1XNQ I;  4DV4 I;  3H4L A;  1YYO A;  4DUZ E;  2V34 A;  4DR5 I;  1FKA E;  4JI2 E;  4URL A;  1HNZ E;  4LFC I;  1J5E I; 
#chains in the Genus database with same CATH topology
 3J7Y p;  2PNL A;  2O3Z A;  1A1K A;  1B63 A;  1T38 A;  4B3R E;  2Q8U A;  3K1J A;  2K7I A;  1GTK A;  2NUF A;  3K6Q A;  2EPR A;  2FTX B;  1HK7 A;  2X7I A;  4X66 E;  1BKN A;  1HR0 E;  4IFD F;  1N0U A;  2EN6 A;  2VF3 A;  3ADJ A;  2YRK A;  2EMY A;  1KKH A;  4B3S E;  4DPW A;  5T6J A;  3PYE A;  1STU A;  4JI3 E;  1Z0G A;  4IZK B;  4XTJ A;  3V5R A;  4NBQ A;  4DV5 I;  2EMC A;  2VE7 C;  3J7A G;  1YPN A;  4B3M E;  2DGC A;  4HAC B;  1XMO I;  1X5W A;  4IZJ A;  2YTP A;  2DLK A;  4DV1 E;  2V85 A;  2ENH A;  1AH5 A;  4F2J C;  2YZT A;  4JI8 I;  5BR8 I;  4BHC A;  2DMI A;  2NA2 A;  2L6M A;  5A6B D;  3VYY A;  4JI5 E;  2HKE A;  4WFT A;  2A2C A;  2GO4 A;  5CFF E;  4LF7 I;  2F1D A;  2IER A;  2JEA A;  4PRV A;  3U1K A;  3EPH A;  5KL4 A;  2ADR A;  4YY3 E;  1USV A;  2YSP A;  3M85 G;  2E5L I;  1XNR E;  2DSY A;  1E3H A;  4FWG A;  1PIE A;  2EN8 A;  4F6M A;  3RMP A;  4BA1 B;  1RMD A;  3PRY A;  2EM2 A;  4WXD A;  2FV4 B;  1YSA C;  4I8O A;  3QT7 A;  2R1F A;  4MYU A;  2L3J A;  2YRH A;  3LML A;  2EPM X;  2JXP A;  3BID A;  4JI4 E;  1YZ9 A;  3C4T A;  2UXC E;  1EH8 A;  5JEA B;  4DPU A;  4DV7 I;  2J7J A;  5KL6 A;  4PRX A;  5FLX Q;  2PO1 A;  5LL6 R;  1YYK A;  2NAB A;  4MU1 A;  2VRD A;  1Y4U A;  1GZ6 A;  3C6K A;  4LTY A;  5AE2 A;  4GKJ E;  1PVG A;  1RRE A;  1G2F C;  1UDS A;  3HJC A;  3NZK A;  2NPF A;  3M85 D;  2VQF I;  2WBU A;  1LLM C;  2BA1 G;  4DU7 A;  4BC7 A;  5LMU E;  5AC5 A;  2BA0 D;  2NUG A;  2LE2 A;  4JI2 I;  2HGH A;  3PS1 A;  1HNZ I;  3M7N G;  3HPZ A;  2JWO A;  2EMZ A;  1EKZ A;  4LCF A;  2JOX A;  4LCG A;  5DNX A;  1N32 E;  1HNW E;  3KRN A;  3J81 Q;  3D4J A;  4B3R I;  1OJ4 A;  4IZJ D;  5IV8 B;  4F9B B;  2CGE A;  4ZVI A;  5C0X B;  2WBT A;  3P1X A;  2VQE E;  2M7Q A;  2PNZ A;  1HR0 I;  4U3B A;  1USU A;  3Q6M A;  2ZM6 E;  4YHH E;  3KWR A;  2JE6 B;  2PO0 B;  1EA6 A;  4JI3 I;  2B3T B;  1E3P A;  1F2I G;  2PNM A;  2LMZ A;  2EOS A;  4MU0 A;  2F8B A;  4B3M I;  4O43 A;  1O0W A;  4FW5 A;  1RR9 A;  2D9H A;  2J65 A;  2K4V A;  4LFB E;  1S4E A;  5FWK A;  4JI5 I;  2ENA A;  2CTD A;  2Z5E A;  2UU9 E;  2EPX A;  2O1V A;  4YY3 I;  2KHX A;  2MC6 A;  4WX9 A;  2JT2 A;  1XNR I;  1H7S A;  2KON A;  2C37 A;  1P42 A;  2IES A;  3IWC A;  2LUP B;  2V83 A;  4FK5 C;  4PU9 A;  1ZM3 A;  2CT1 A;  2C38 A;  2LRS A;  2UXB I;  2EPO A;  4BS9 A;  1NCS A;  2LBS B;  4DXL A;  5FLX C;  4X64 I;  3MHS C;  4JI4 I;  5C0X E;  4GKK I;  5K36 C;  3HKM A;  4R2D A;  2HHH E;  3J80 C;  2Z5B A;  2V88 A;  5LLQ A;  1PJT A;  4NZV A;  4ZYH A;  2EMK A;  3QG5 C;  2WZO A;  4WUD A;  4DV6 I;  4GKJ I;  1NHH A;  2WBS A;  2ELZ A;  3V2U C;  3J7A M;  2WNR B;  3BF2 A;  2IOP A;  4JG4 A;  1S16 A;  5LMU I;  2EN7 A;  1DAR A;  2CSH A;  2PO2 A;  2NN6 B;  2X36 A;  1X3C A;  4B3T E;  4O5G A;  3J81 C;  1N33 E;  1UDN A;  4ZYG A;  4HTG A;  2I13 A;  1T4N A;  1UBD C;  1HNW I;  1N32 I;  1X49 A;  2YU5 A;  2N3G A;  2YTD A;  3F0N A;  3PYG A;  1A6F A;  2VQE I;  2LTS A;  3THO B;  4HY1 A;  2JY9 A;  3BBG A;  4P78 A;  5KL2 A;  1MX0 A;  4HEI A;  4DR4 E;  4EMD A;  4USM A;  2EOE A;  4YHH I;  2ZM6 I;  3LLH A;  2HFU A;  4DV0 I;  5EL9 A;  4LOM A;  4OO1 B;  2LV2 A;  2O1W A;  4OX9 E;  1IQS A;  2BR2 B;  2O1T A;  2EPU A;  1IMU A;  2MKD A;  4DV3 E;  3GLL A;  4DV2 I;  4M9V C;  3Q1Q A;  4AM3 A;  4LFB I;  1Y60 A;  2E1R A;  2L2M A;  5JEA C;  2OI2 A;  4F9C B;  1ZXN A;  1UDQ A;  3FIG A;  4P7D A;  2RTX A;  5A6J A;  4JYA E;  4FWD A;  4KWY A;  2EOJ A;  3TQM A;  1A1I A;  3CWV A;  3GCM A;  2HKJ A;  4JI6 E;  4QNJ A;  3JTZ A;  2Q2E B;  4BA2 A;  1MGT A;  4OZE A;  3HQ1 A;  4Z7Y A;  2V8Q B;  2EWL A;  2ODR C;  4LFA E;  2Z5C B;  2IHR 1;  1H74 A;  3LNU A;  5AAS A;  4TUI A;  2JEB A;  3PS2 A;  2EPK X;  4M0V A;  2V2Q A;  1I94 E;  2CZ9 A;  2V2V A;  5DRO A;  5L3J A;  2JPA A;  2R42 A;  2HHH I;  3MHH C;  3JAM C;  4O4K A;  4JI7 I;  1UIL A;  1YYW A;  3HTX A;  2LJP A;  2EOZ A;  4NXM E;  3ECR A;  5C0X C;  1N34 I;  4OO1 E;  1UEK A;  1A1H A;  1Z5C A;  1Z0C A;  5K36 E;  1D6T A;  5C0X A;  1X47 A;  5DRQ A;  4DR6 I;  1Y6Z A;  3BGH A;  5K36 F;  2ZIT A;  1AAY A;  4LF9 E;  4L8N A;  2PRT A;  2AE8 A;  4ED4 A;  4B3T I;  2L8T A;  5KL5 A;  2UUB E;  2PO0 A;  1N33 I;  2JP9 A;  4Q28 A;  2H36 X;  3ZM7 A;  1EH6 A;  2UXD E;  2EMH A;  2VF1 A;  2M9A A;  1ZU1 A;  2M1S A;  3CDJ A;  4LF4 E;  4KHP E;  2B9D A;  3J80 Q;  4WXC A;  4DR1 E;  2ZBK B;  1WHN A;  4X65 E;  1QU6 A;  2EMI A;  3AV0 A;  2E1M A;  1B62 A;  2YTO A;  2C39 A;  4RPF A;  4DUZ I;  4DR4 I;  2YTE A;  3M7N D;  3KZZ A;  4R2E A;  5KL7 A;  3WU6 A;  4N3O A;  1A1G A;  5TSE A;  5IWA E;  4FWH A;  4OX9 I;  3T1H E;  4X9J A;  3B8H A;  4WUB A;  4DV3 I;  3MSW A;  4U3D A;  2YTF A;  3LTO A;  1RC7 A;  4X66 I;  2F4V E;  2EPC A;  1UHZ A;  3H09 A;  5KL3 A;  1TF6 A;  1XMQ E;  1Z0W A;  1ZM4 A;  3ZZ0 A;  4Q35 B;  4FW9 A;  1FJG E;  2EOI A;  1N0V C;  1T4O A;  4B3S I;  4JYA I;  1N3G A;  4IZJ B;  2LUQ A;  5AE3 A;  2EMA A;  2EM7 A;  3F6G A;  1ELO A;  2LVH A;  1P47 A;  2DEI A;  2V8P A;  3L7Z B;  2LCE A;  2LO3 A;  4P52 A;  5JEA E;  5A69 A;  3OML A;  2EML A;  5DNL A;  2V86 A;  4NXN E;  5C0X D;  2E72 A;  4LFA I;  2JEA B;  4DV1 I;  4X8W A;  4K0K E;  2BM1 A;  2EMX A;  2NN6 C;  2V2Z A;  3P3G A;  1WHQ A;  2N8X A;  1I94 I;  1IBM E;  1ZM9 A;  1MU5 A;  1DI2 A;  2EQ1 A;  2CVE A;  4HYM A;  1BBG A;  4FN5 A;  2LJU A;  2M4I A;  2RSI A;  4R2S A;  3DJW A;  1IBL E;  2EOY A;  3GON A;  3P3E A;  1GQE A;  1A1L A;  4DV4 E;  2GQ0 A;  4WSG A;  4AID A;  2EN2 A;  3ZOQ B;  4LF8 E;  4IS1 C;  2EM5 A;  1EI1 A;  3B82 A;  5DNY A;  4DR5 E;  5F3W A;  1H72 C;  2YTG A;  2BBG A;  1A1J A;  4LFC E;  1NHJ A;  3UHM A;  1J5E E;  1X6H A;  1WJP A;  2EN4 A;  2N3H A;  1IBK E;  4BMJ A;  4LF9 I;  1N36 E;  4OO1 C;  1KJK A;  4I3H A;  2UUB I;  2UXC I;  5DRR A;  1X6F A;  4OO1 A;  5K36 A;  4F6N A;  5C0X F;  1SFE A;  2UXD I;  2EL5 A;  3WU5 A;  4LF4 I;  4KHP I;  3JAM Q;  2UUC E;  4DR1 I;  3ADG A;  4F54 A;  4J8Z A;  4X65 I;  4DMI A;  2I9I A;  4R2P A;  2RQL A;  2EM9 A;  3U1Y A;  2JOB A;  2EOH A;  4KZS A;  2DLQ A;  1XMO E;  2WP8 B;  4IZK A;  1UN6 B;  4LF6 E;  5IWA I;  2EQ3 A;  1R6L A;  4TUG A;  2PNZ B;  2FGG A;  4OOG C;  2LTR A;  1TN9 A;  2LJH A;  4LF7 E;  4HAC A;  5A6A A;  3VYX A;  1PJS A;  2Z5C A;  4M30 A;  2GS8 A;  2YT4 A;  4IFD B;  1XMQ I;  2EP3 A;  4FW4 A;  1ZBQ A;  1FJG I;  4R8O A;  3QT5 A;  3P3C A;  2EQ0 A;  3IWB A;  1PJQ A;  5IXM B;  3M99 B;  1WUU A;  2ELY A;  4ZYD A;  1B69 A;  1EH7 A;  2MKN A;  4BA1 A;  1Z5B A;  4L5N C;  2L2N A;  4K0K I;  4P7A A;  3UK3 C;  4AQY E;  2C37 B;  4F9A B;  2WW4 A;  3ZZT A;  2EZ6 A;  2UU9 I;  2EOQ A;  5JEA A;  1IBL I;  3QT8 A;  4WYQ B;  4OO1 D;  2C38 B;  1KIJ A;  5K36 D;  2VQF E;  4LF8 I;  1T4L B;  2NN6 E;  3B78 A;  4RH8 A;  2BB8 A;  3HXL A;  2NN6 F;  2CPN A;  1L4S A;  1DGC A;  2EPZ A;  2Z5B B;  3P06 A;  3K85 A;  2EN3 A;  3QT6 A;  1IBK I;  2R3V A;  3C6M A;  1N36 I;  3C4B A;  2L33 A;  4DKK A;  2YTJ A;  4RHB B;  4IFD E;  5DRP A;  4DR3 E;  2HFS A;  3L00 A;  2WCC 3;  2O1U A;  3HUL A;  2KOU A;  2PO2 B;  2UUC I;  1PKP A;  2DB2 A;  4R2R A;  3K17 A;  2YSO A;  3EPJ A;  2UUA E;  5A6K A;  2NUE A;  4OO1 F;  2ENC A;  2YTI A;  4R03 A;  1MG7 A;  4FW7 A;  4X62 E;  4FW6 A;  2EMW A;  2JE6 A;  1NZ0 A;  4LF6 I;  2EOR A;  1JK2 A;  3L7Z A;  2AJ4 A;  1WXR A;  4JV5 E;  4BBY A;  1H7U A;  5IT9 C;  3VK6 A;  2EFG A;  1QNT A;  3AUZ A;  1OYS A;  5LMN E;  2DMY A;  2RSM A;  2RS6 A;  2EPN A;  3ADL A;  1YFH A;  1KTV A;  2BA1 D;  4LPF A;  1RHY A;  5GMD A;  3JU0 A;  1T39 A;  4DUY E;  4DR7 E;  1Z1B A;  1Z0V A;  1MEY C;  1ZXM A;  5JEA D;  1ZBT A;  2GHF A;  4WPY A;  2EJ4 A;  5AE1 A;  2EOO A;  3T1Y E;  4JI0 E;  2UXB E;  5A2Q Q;  1X48 A;  3THN A;  3H1C A;  2EOX A;  2YRM A;  1K47 A;  2JR1 A;  2YU8 A;  4X64 E;  4JI1 E;  2J7K A;  4GKK E;  1HNX E;  4MDT A;  3OTO E;  2ODR D;  4AQY I;  2GLI A;  3LPS A;  2JYA A;  3EQ1 A;  4WSP A;  2L2K B;  4UTG A;  2A2D A;  4BA2 B;  4DV6 E;  1XHK A;  3DF6 A;  2L3C A;  4NHR A;  1VI7 A;  2CG9 A;  2DEJ A;  2XEX A;  2JEB B;  4GZN C;  4JI6 I;  3ZKD A;  3EPK A;  2BA0 G;  1ZM2 A;  2EOF A;  1PDA A;  2EM8 A;  3B4T A;  5JEA F;  2WNR A;  3CDI A;  2HC5 A;  4MLV A;  5ELW A;  4GQU A;  4LCH A;  1YH8 A;  2MDR A;  1VIS A;  2NN6 A;  2JVA A;  3VHT B;  1R6M A;  3GME A;  4LF5 E;  2EPL X;  4DR2 E;  4BHB A;  1Z0B A;  1FNM A;  2WP8 A;  2G7H A;  1XNQ E;  2BV3 A;  2EMB A;  4DR3 I;  4M1K A;  2HK3 A;  2L92 A;  1NEI A;  4NXM I;  2LT7 A;  4N4R B;  4R1F A;  4DV0 E;  2DRP A;  5EKW A;  2V89 A;  4ISA A;  3KZY A;  4IFD C;  2UUA I;  2EMF A;  4ZYE A;  4DPX A;  4USK A;  4IFD A;  1ZAA C;  4IS9 A;  4QNK A;  4O24 A;  1SR9 A;  4X62 I;  2PO1 B;  2EN1 A;  1YUJ A;  2BM0 A;  3IWD A;  4MYT A;  2MDG A;  4DU8 A;  2YPN A;  1KVK A;  4MQY A;  4R2A A;  4DV2 E;  1FWK A;  2BR2 A;  4JV5 I;  2EL6 A;  2VES A;  2C39 B;  2EM0 A;  2V87 A;  1J26 A;  3P76 A;  1WRJ A;  5LMN I;  2R76 A;  1Y5Y A;  1Z0T A;  2YTN A;  4BC9 A;  2EE8 A;  2EPA A;  2GPI A;  3HPS A;  5A2Q C;  4DUY I;  4DV5 E;  3EPL A;  5GME A;  4DR7 I;  2RPC A;  3PYD A;  2EPP A;  1Z59 A;  4KQV A;  1YHC A;  3T1Y I;  4JI0 I;  1Z0E A;  2MC5 A;  2HK2 A;  4Z7C A;  4JI8 E;  5BR8 E;  4AIM A;  3T1H I;  1H73 A;  1FI4 A;  4WUC A;  3M6A A;  4JI1 I;  3ZZU A;  4DPY A;  1BBO A;  1HNX I;  3ADI A;  3OTO I;  4UT4 A;  2A25 A;  2F4V I;  4JI7 E;  2E5L E;  1XXE A;  4J3D A;  5IT9 Q;  4HXZ A;  1NHI A;  2DIX A;  2NN6 D;  4MLQ A;  1N34 E;  4M2Z A;  1QZR A;  4IJD A;  2B7T A;  4R2Q A;  1JK1 A;  2EOM A;  4DR6 E;  1Z5A A;  1G2D C;  1OYR A;  1ZR9 A;  5A6B A;  2EM4 A;  3Q6N A;  4NXN I;  2HJJ A;  2EL4 A;  1RQ0 A;  4BCA A;  3WU4 A;  4DV7 E;  1FWL A;  4MU4 A;  1A1F A;  1U2R A;  1BB8 A;  1IBM I;  4MU3 A;  4IFD D;  4OKG A;  2EM3 A;  4LF5 I;  2B7V A;  4GEQ B;  4DR2 I;  1X6E A;  3ZKB A;  3WU3 A;  2RS7 A;  4DPT A;  3PS3 A;  3PYF A;  2EM6 A;  1XNQ I;  4DV4 I;  3DD6 A;  1YUI A;  4R2C A;  3H4L A;  1TF3 A;  5ADZ A;  1KYQ A;  2YWQ A;  1YYO A;  4DUZ E;  1DQ3 A;  2GO3 A;  1Y4S A;  2V34 A;  4DR5 I;  1FKA E;  4JI2 E;  1IQO A;  1HNZ E;  4URL A;  2EMG A;  4LFC I;  4LU9 A;  2YTQ A;  5AC4 A;  1J5E I;  1UDO A;  4FW3 A;  5K36 B;  3F6H A;  2IOQ A;  1OYP A; 
#chains in the Genus database with same CATH homology
 3J7Y p;  2PNL A;  1B63 A;  4B3R E;  3K1J A;  2NUF A;  1HK7 A;  3K6Q A;  2FTX B;  2X7I A;  4X66 E;  1BKN A;  1HR0 E;  1N0U A;  2VF3 A;  3ADJ A;  1KKH A;  4B3S E;  4DPW A;  5T6J A;  3PYE A;  1STU A;  4JI3 E;  1Z0G A;  4IZK B;  4XTJ A;  3V5R A;  4DV5 I;  2VE7 C;  3J7A G;  4B3M E;  4HAC B;  1XMO I;  4IZJ A;  4DV1 E;  4JI8 I;  5BR8 I;  2V85 A;  2YZT A;  3VYY A;  2NA2 A;  2L6M A;  2HKE A;  4JI5 E;  4WFT A;  2A2C A;  4LF7 I;  5CFF E;  4PRV A;  1USV A;  4YY3 E;  2E5L I;  1XNR E;  2DSY A;  4FWG A;  1PIE A;  3RMP A;  3PRY A;  2FV4 B;  3QT7 A;  4I8O A;  4MYU A;  2L3J A;  4JI4 E;  3LML A;  1YZ9 A;  2UXC E;  3C4T A;  4DV7 I;  4DPU A;  4PRX A;  5FLX Q;  5LL6 R;  1YYK A;  1Y4U A;  1GZ6 A;  4LTY A;  4GKJ E;  5AE2 A;  1PVG A;  3HJC A;  1RRE A;  2VQF I;  2NPF A;  4DU7 A;  4BC7 A;  5LMU E;  2NUG A;  2LE2 A;  4JI2 I;  1HNZ I;  3HPZ A;  2JWO A;  1EKZ A;  2JOX A;  1N32 E;  1HNW E;  3J81 Q;  3D4J A;  4B3R I;  1OJ4 A;  4IZJ D;  4F9B B;  2CGE A;  4ZVI A;  3P1X A;  2VQE E;  2M7Q A;  1HR0 I;  1USU A;  3Q6M A;  2ZM6 E;  4YHH E;  3KWR A;  1EA6 A;  4JI3 I;  2B3T B;  2PNM A;  2LMZ A;  2F8B A;  4B3M I;  1O0W A;  1RR9 A;  2K4V A;  4LFB E;  1S4E A;  5FWK A;  4JI5 I;  2Z5E A;  2UU9 E;  2O1V A;  4YY3 I;  2KHX A;  2MC6 A;  1XNR I;  1H7S A;  2KON A;  3IWC A;  2LUP B;  2V83 A;  4PU9 A;  1ZM3 A;  2LRS A;  2UXB I;  4BS9 A;  2LBS B;  4DXL A;  5FLX C;  4X64 I;  4JI4 I;  4GKK I;  2HHH E;  3J80 C;  2Z5B A;  2V88 A;  2WZO A;  4WUD A;  4DV6 I;  4GKJ I;  1NHH A;  3V2U C;  3J7A M;  2IOP A;  4JG4 A;  1S16 A;  5LMU I;  1DAR A;  2X36 A;  4B3T E;  1N33 E;  3J81 C;  1T4N A;  1HNW I;  1N32 I;  1X49 A;  2N3G A;  3F0N A;  3PYG A;  1A6F A;  2VQE I;  2LTS A;  4HY1 A;  2JY9 A;  4P78 A;  1MX0 A;  4EMD A;  4USM A;  2ZM6 I;  4DR4 E;  4YHH I;  4DV0 I;  3LLH A;  2HFU A;  2O1W A;  4OX9 E;  2O1T A;  4DV3 E;  4DV2 I;  3Q1Q A;  4LFB I;  2E1R A;  2L2M A;  2OI2 A;  4F9C B;  1ZXN A;  3FIG A;  4P7D A;  2RTX A;  4JYA E;  4FWD A;  3CWV A;  2HKJ A;  4JI6 E;  3JTZ A;  2Q2E B;  3HQ1 A;  4Z7Y A;  2V8Q B;  2EWL A;  2ODR C;  4LFA E;  2Z5C B;  1H74 A;  2IHR 1;  3LNU A;  5AAS A;  4TUI A;  4M0V A;  2V2Q A;  1I94 E;  2CZ9 A;  2V2V A;  5L3J A;  2R42 A;  2HHH I;  3JAM C;  4JI7 I;  1UIL A;  1YYW A;  3HTX A;  2LJP A;  4NXM E;  1N34 I;  1UEK A;  1Z5C A;  1D6T A;  1Z0C A;  1X47 A;  4DR6 I;  1Y6Z A;  2ZIT A;  4LF9 E;  4L8N A;  4ED4 A;  4B3T I;  1N33 I;  2L8T A;  2UUB E;  4Q28 A;  2H36 X;  3ZM7 A;  2UXD E;  2VF1 A;  2M1S A;  4LF4 E;  4KHP E;  2B9D A;  3J80 Q;  4DR1 E;  2ZBK B;  1WHN A;  4X65 E;  1QU6 A;  3AV0 A;  1B62 A;  2E1M A;  4DUZ I;  4RPF A;  4DR4 I;  3WU6 A;  4N3O A;  5IWA E;  4FWH A;  4OX9 I;  3T1H E;  3B8H A;  4WUB A;  4DV3 I;  3MSW A;  3LTO A;  1RC7 A;  4X66 I;  2F4V E;  1UHZ A;  3H09 A;  1Z0W A;  1XMQ E;  1ZM4 A;  3ZZ0 A;  4FW9 A;  1FJG E;  1N0V C;  1T4O A;  4B3S I;  4JYA I;  4IZJ B;  2LUQ A;  5AE3 A;  3F6G A;  1ELO A;  2V8P A;  2DEI A;  4P52 A;  3OML A;  4NXN E;  2V86 A;  4LFA I;  4DV1 I;  4X8W A;  4K0K E;  2BM1 A;  2V2Z A;  1WHQ A;  1I94 I;  1IBM E;  1ZM9 A;  1MU5 A;  1DI2 A;  4HYM A;  4FN5 A;  2M4I A;  3DJW A;  1IBL E;  3GON A;  1GQE A;  2GQ0 A;  4DV4 E;  3ZOQ B;  4LF8 E;  1EI1 A;  3B82 A;  5DNY A;  4DR5 E;  5F3W A;  1H72 C;  4LFC E;  1NHJ A;  1J5E E;  2N3H A;  1IBK E;  4BMJ A;  4LF9 I;  1N36 E;  2UUB I;  4I3H A;  2UXC I;  2UXD I;  3WU5 A;  4LF4 I;  4KHP I;  3JAM Q;  2UUC E;  4DR1 I;  3ADG A;  4F54 A;  4J8Z A;  4X65 I;  4DMI A;  2JOB A;  4KZS A;  1XMO E;  4IZK A;  5IWA I;  4LF6 E;  4TUG A;  2FGG A;  4OOG C;  2LTR A;  2LJH A;  4LF7 E;  4HAC A;  2Z5C A;  3VYX A;  4M30 A;  2GS8 A;  2YT4 A;  1XMQ I;  1ZBQ A;  1FJG I;  4R8O A;  3IWB A;  1WUU A;  1Z5B A;  4L5N C;  2L2N A;  4K0K I;  4P7A A;  4AQY E;  4F9A B;  2WW4 A;  3ZZT A;  2EZ6 A;  2UU9 I;  1IBL I;  3QT8 A;  4WYQ B;  1KIJ A;  2VQF E;  4LF8 I;  1T4L B;  3B78 A;  3HXL A;  2CPN A;  2Z5B B;  3P06 A;  3K85 A;  3QT6 A;  1IBK I;  2R3V A;  1N36 I;  3C4B A;  2L33 A;  4DKK A;  4DR3 E;  2HFS A;  2O1U A;  3HUL A;  2KOU A;  2UUC I;  1PKP A;  2DB2 A;  3K17 A;  2UUA E;  2NUE A;  4R03 A;  1MG7 A;  4X62 E;  1NZ0 A;  4LF6 I;  2AJ4 A;  1WXR A;  4JV5 E;  4BBY A;  1H7U A;  5IT9 C;  3VK6 A;  2EFG A;  3AUZ A;  3ADL A;  5LMN E;  2RSM A;  2DMY A;  2RS6 A;  1KTV A;  5GMD A;  3JU0 A;  4DUY E;  4DR7 E;  1Z0V A;  1ZXM A;  1ZBT A;  4WPY A;  5A2Q Q;  5AE1 A;  3T1Y E;  2UXB E;  4JI0 E;  1X48 A;  1K47 A;  2JR1 A;  4X64 E;  4JI1 E;  2J7K A;  4GKK E;  1HNX E;  3OTO E;  2ODR D;  4AQY I;  3LPS A;  2L2K B;  4WSP A;  4UTG A;  2A2D A;  4DV6 E;  1XHK A;  3DF6 A;  2L3C A;  2CG9 A;  2DEJ A;  2XEX A;  4JI6 I;  3ZKD A;  1ZM2 A;  2MDR A;  1VIS A;  3QT5 A;  2JVA A;  4LF5 E;  4DR2 E;  1Z0B A;  1FNM A;  2G7H A;  1XNQ E;  2BV3 A;  4DR3 I;  4M1K A;  2HK3 A;  2L92 A;  4NXM I;  4R1F A;  4DV0 E;  2V89 A;  2UUA I;  4DPX A;  4USK A;  1SR9 A;  4X62 I;  2BM0 A;  4MYT A;  3IWD A;  4DU8 A;  1KVK A;  4DV2 E;  1FWK A;  4JV5 I;  2V87 A;  1J26 A;  5LMN I;  1Z0T A;  4BC9 A;  3HPS A;  5A2Q C;  4DUY I;  4DV5 E;  4DR7 I;  5GME A;  3PYD A;  1Z59 A;  4KQV A;  3T1Y I;  4JI0 I;  1Z0E A;  2MC5 A;  2HK2 A;  4Z7C A;  4JI8 E;  5BR8 E;  3T1H I;  1H73 A;  1FI4 A;  4WUC A;  3M6A A;  4JI1 I;  3ZZU A;  4DPY A;  1HNX I;  3ADI A;  3OTO I;  4UT4 A;  2F4V I;  4JI7 E;  2E5L E;  5IT9 Q;  4HXZ A;  1NHI A;  2DIX A;  1N34 E;  4M2Z A;  1QZR A;  2B7T A;  4DR6 E;  1Z5A A;  3Q6N A;  4NXN I;  1RQ0 A;  4BCA A;  3WU4 A;  4DV7 E;  1FWL A;  1U2R A;  1IBM I;  4LF5 I;  2B7V A;  4GEQ B;  4DR2 I;  3ZKB A;  3WU3 A;  2RS7 A;  4DPT A;  3PYF A;  1XNQ I;  4DV4 I;  3H4L A;  5ADZ A;  1YYO A;  4DUZ E;  1DQ3 A;  1Y4S A;  2V34 A;  4DR5 I;  1FKA E;  4JI2 E;  4URL A;  1HNZ E;  4LFC I;  4LU9 A;  1J5E I;  3F6H A;  2IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...