4JI4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji4E02
4LFBE 3QT8A 1NHIA 4USKA 2LUQA 1ZBTA 3JAMC 1XNQE 2LUPB 4UT4A 1IBKE 4X62I 1PIEA 4DR7E 2LTRA 2DEJA 3ZZ0A 2NPFA 1WHNA 4DV6I 4LF9E 4DV2E 1Z59A 3HTXA 3B82A 1Z0TA 1ZM9A 2DIXA 1A6FA 4JI5E 1Z0VA 3WU4A 1Z0WA 1XMQI 4AQYE 2X36A 3C4BA 4K0KI 1X49A 4B3TI 1X48A 4PRXA 1I94I 4LFCI 2L3JA 4GKKE 5IT9Q 2L2MA 3ADGA 1N36E 1U2RA 2VQEE 1KKHA 4K0KE 3J7AM 1NZ0A 5BR8E 4R1FA 3C4TA 2HHHE 4DR1E 1H7UA 4FWDA 4EMDA 2B7TA 3LPSA 4JI6I 1HR0I 4JI8E 4DV6E 1VISA 5FLXC 3PYEA 4YY3E 2BM0A 2R3VA 1HNXI 3VYXA 1Z5AA 4GKJI 1O0WA 1J26A 4AQYI 4LF8I 5GMDA 3QT7A 4DR2I 2LTSA 2BV3A 4JV5E 5LMUE 5A2QC 1YYKA 2ZITA 3J7AG 4JI7E 1Z0BA 3K17A 2V8PA 2LJPA 4NXNI 3V2UC 3ZM7A 4LF5I 1EA6A 1IBKI 4DKKA 1KVKA 2UXDI 1EKZA 4HYMA 2N3GA 1OJ4A 2R42A 1YZ9A 4JI0E 2UUAE 4DXLA 1FJGI 4DV1I 3PYDA 2DEIA 2VQFI 4B3RE 3V5RA 1HR0E 3P1XA 4WUDA 4X65E 4LFAI 2EFGA 4B3SI 1T4NA 3JAMQ 3ZKDA 4ED4A 3T1YE 4JI2I 5LMUI 1IBLE 4PRVA 2OI2A 4LF9I 2HHHI 3ADIA 4WUBA 4B3ME 1N34I 4DPUA 1XMQE 4P52A 3GONA 4DU8A 1ZXNA 3Q1QA 2MDRA 4JI0I 4M30A 2L3CA 4B3RI 3T1HE 3HULA 1S4EA 2ZM6E 4HY1A 1D6TA 1N33E 1KTVA 1N0UA 4HACB 4X66I 4B3SE 2XEXA 4OX9E 2AJ4A 3OTOI 4JI2E 2X7IA 4WUCA 2LJHA 1H73A 3J80Q 4LFAE 4NXME 4JI3I 3ZKBA 1HNWI 1N32E 1Z0GA 2LRSA 2UUBI 2UU9E 5GMEA 1J5EE 1T4LB 4DU7A 4DR2E 2NUFA 4JI1I 1FJGE 2UXDE 4KQVA 2UUAI 4GKJE 2DB2A 5A2QQ 2YT4A 4FWHA 1HNZI 1ZM2A 2UXBI 4DV4I 1MG7A 2L2NA 4M2ZA 4JI7I 1QU6A 3B78A 4DPYA 4KHPI 4DV0E 1PKPA 2Q2EB 3T1HI 2ZBKB 4OX9I 3K1JA 2HK3A 2E5LI 3B8HA 4DR6E 4ZVIA 2UU9I 5LL6R 4NXMI 2HKEA 1HNWE 4FN5A 4RPFA 4LF6E 3LTOA 4X8WA 4DPTA 3ZZTA 4JI4I 2J7KA 4MYUA 2CZ9A 4PU9A 3CWVA 1IBLI 3D4JA 4FW9A 4DV3I 1FI4A 3PYFA 2L2KB 4OOGC 3WU3A 4JYAE 1QZRA 3H4LA 1N34E 4YHHE 3VYYA 1B63A 1FNMA 4M1KA 2NA2A 4FWGA 1PVGA 3OTOE 4B3TE 3J81Q 1XNQI 2VF3A 4DUYI 5LMNE 1UEKA 4DR3I 4DR5I 3F0NA 4DR6I 1X47A 1EI1A 4DUZI 4LF7I 1ZM3A 3J81C 2A2CA 3QT5A 4X65I 4WYQB 3T1YI 2EZ6A 1DI2A 1XMOE 2V2QA 1NHJA 2UUCI 4DR4I 1FWLA 2A2DA 3WU5A 1N0VC 5FLXQ 4DV2I 1KIJA 4X64E 4DPWA 2DMYA 1NHHA 5IWAI 1J5EI 1GQEA 4DV5I 2BM1A 4X66E 2LBSB 2V34A 2UXBE 2V2ZA 1RQ0A 1N33I 4P7AA 5IWAE 1ZXMA 4Z7YA 4DV0I 3WU6A 1STUA 4DV1E 2RS6A 4HXZA 2VQEI 1UHZA 4MYTA 1Z5CA 3J80C 2L33A 4URLA 2NUGA 4XTJA 4KHPE 2WW4A 4DPXA 2UUCE 1XHKA 1Z5BA 4DR4E 1B62A 4JI3E 4JI6E 1ZM4A 2UXCE 3ZZUA 1RR9A 2RTXA 2B7VA 4JI8I 4JI5I 1H74A 3ADJA 4DR5E 4UTGA 1RC7A 1H7SA 1ELOA 4DR3E 5LMNI 1IBMI 1T4OA 4LF7E 4DUYE 4LF4E 1K47A 4DV3E 1FKAE 4DUZE 1HNXE 4YY3I 4GKKI 2F4VI 1I94E 1DARA 4LFCE 1Z0CA 1XNRI 3PYGA 1RREA 5L3JA 5IT9C 1N36I 1Z0EA 2NUEA 4B3MI 1XMOI 4DV7I 4DR7I 1MU5A 3ADLA 4I3HA 4Z7CA 1UILA 1S16A 2ZM6I 4YHHI 2HFSA 1YYWA 1XNRE 2HFUA 3LNUA 2CPNA 4DR1I 4WFTA 4DV7E 2N3HA 1YYOA 1WUUA 2HK2A 3QT6A 4JI4E 2KHXA 2VQFE 4LF6I 4X62E 4LFBI 1BKNA 4LF4I 4HACA 3J7Yp 4USMA 1IBME 1MX0A 2GS8A 1H72C 4JYAI 2V2VA 2F4VE 2E5LE 2UUBE 4X64I 4JI1E 4DV4E 4LF5E 4NXNE 1FWKA 4JG4A 2JVAA 3LLHA 2E1RA 3M6AA 2HKJA 2JY9A 1HNZE 1WHQA 4DV5E 2UXCI 2RS7A 4JV5I 2RSMA 4LF8E 5BR8I 1N32I 5CFFE 2B3TB 2IHR1
chains in the Genus database with same CATH superfamily
4LFBE 2PO0A 3QT8A 2YU8A 1NHIA 2Z5CA 3BIDA 2YTFA 5C0XF 1BBGA 2F8BA 2J7JA 2LUQA 4MQYA 4USKA 3HJCA 1ZBTA 3PS1A 2LMZA 3Q6MA 3JAMC 1XNQE 2LUPB 1A1GA 4UT4A 1IBKE 1HK7A 3THNA 2EMIA 1Z1BA 5AC5A 4DR7E 1PIEA 4X62I 2LTRA 2DEJA 4MU4A 5LLQA 3ZZ0A 1QNTA 2NPFA 1WHNA 4BMJA 4O4KA 4DV6I 3DJWA 4DV2E 4LF9E 2FTXB 1Z59A 3KWRA 4BC7A 3HTXA 2ELYA 2JWOA 4GZNC 3B82A 4U3BA 4F54A 2DSYA 3BBGA 2FGGA 4LCFA 3M99B 1Z0TA 1ZM9A 5DNLA 2DIXA 1A6FA 4JI5E 2BB8A 1Z0VA 3EPLA 1KJKA 3P76A 3WU4A 4R2CA 1Z0WA 4KWYA 1X6FA 1NEIA 1XMQI 4AQYE 2X36A 4OZEA 3C4BA 4HEIA 4F2JC 1TF3A 1USUA 2WP8B 4K0KI 1X49A 2JT2A 4B3TI 1X48A 4PRXA 4O24A 1OYSA 1I94I 3JU0A 2EM7A 2I13A 2JEBB 1EH6A 5AE2A 2L3JA 1LLMC 4GKKE 2NN6E 2E72A 4LFCI 2L2MA 2VESA 5IT9Q 1N3GA 4ISAA 1BBOA 3ADGA 4F9AB 2G7HA 1N36E 2BBGA 1U2RA 1GTKA 2EMXA 4MU0A 2VQEE 1KKHA 4MU3A 4OKGA 4K0KE 5DROA 4WSGA 3J7AM 1NZ0A 5BR8E 4F9CB 4RHBB 3C4TA 2M7QA 1UDNA 1SR9A 2C37A 3HKMA 4R1FA 5KL7A 1DGCA 2HHHE 4DR1E 2J65A 1H7UA 1B69A 4FWDA 2WP8A 3P3CA 2B7TA 3LPSA 4EMDA 4IZJA 2EPOA 2DLQA 2JPAA 4JI6I 4AIMA 4IFDC 2K4VA 2EM5A 2EOIA 2EPAA 3JTZA 1HR0I 2GPIA 4JI8E 4DV6E 5ELWA 2YRKA 5FLXC 1VISA 3PYEA 4YY3E 3IWBA 3F6GA 2BM0A 2R3VA 1HNXI 3VYXA 2EQ3A 1OYPA 1AAYA 1Y60A 1Z5AA 2EMZA 4GKJI 1O0WA 5K36F 1J26A 4AQYI 4LF8I 5GMDA 2Z5EA 2C38B 3QT7A 4DR2I 2ADRA 2LTSA 5C0XA 2BV3A 3P06A 3F6HA 5LMUE 4JV5E 5A2QC 2RQLA 1YYKA 1A1LA 3J7AG 2ZITA 1YSAC 4I8OA 4JI7E 2EMGA 2WCC3 1JK1A 3MHHC 1WRJA 1Z0BA 3BF2A 1YHCA 2BA0G 3K17A 2EOJA 2V8PA 2LJPA 2NN6F 4NXNI 2YTIA 3V2UC 3ZM7A 2F1DA 4KZSA 1EA6A 1IBKI 4LF5I 2WZOA 2EM9A 2CVEA 4IFDE 4DKKA 3UHMA 1KVKA 3HPZA 2UXDI 3TQMA 2EPMX 1EKZA 2N3GA 4HYMA 2VE7C 1OJ4A 2I9IA 2R42A 2PO0B 1YZ9A 2ODRC 1G2DC 1IQOA 4JI0E 2O3ZA 1X6EA 1RHYA 2LVHA 2UUAE 4DXLA 5JEAA 1FJGI 1VI7A 2PNZA 4ZYEA 3IWCA 2YTJA 3PYDA 4DV1I 5KL2A 2DEIA 2IERA 2IOPA 2EM3A 3L00A 2YWQA 2Q8UA 2VQFI 4B3RE 3IWDA 3V5RA 4IZKB 1SFEA 1HR0E 3P1XA 4WUDA 2NN6C 4F6MA 4LCGA 4X65E 3VHTB 2EN7A 4LFAI 4WSPA 2EFGA 4RH8A 4B3SI 4OO1B 1T4NA 3JAMQ 2JOXA 2WBTA 3GLLA 3T1YE 3GMEA 3ZKDA 4ED4A 5LMUI 4JI2I 3RMPA 2WBSA 2PO1B 1IBLE 2VRDA 2M4IA 2OI2A 3PS3A 2YPNA 4PRVA 1WXRA 3HXLA 2EMBA 2O1UA 4ZYDA 4IZJB 4LF9I 2HHHI 2KONA 3ADIA 2R76A 4N4RB 5IV8B 4WUBA 2CT1A 4J8ZA 1UN6B 4B3ME 2KOUA 2EPUA 2YTDA 4NBQA 4FW6A 2GO4A 1N34I 3LMLA 3PS2A 1L4SA 4DPUA 4LTYA 2EQ1A 1XMQE 4P52A 2EN8A 3KZZA 4FW5A 5C0XD 5JEAE 3GONA 4TUIA 2V89A 4DU8A 2EPLX 5EKWA 4GEQB 2NN6D 1ZXNA 3Q1QA 2MDRA 4JI0I 2AE8A 2EPCA 5A69A 4M30A 2LE2A 5ADZA 2L3CA 4LCHA 4B3RI 3T1HE 3HULA 3MSWA 1S4EA 2EOMA 4DMIA 2ZM6E 5KL3A 4HY1A 4U3DA 1D6TA 2YTEA 1N33E 5AE1A 1KTVA 2NN6B 2NN6A 4P7DA 3FIGA 5A6BA 1TF6A 1N0UA 4HACB 2LV2A 3L7ZA 4B3SE 3OMLA 2XEXA 4X66I 4MDTA 4OX9E 5JEAB 5C0XB 3U1KA 2V83A 2Z5BB 2BR2A 2AJ4A 2EL4A 3OTOI 2D9HA 1EH7A 4JI2E 2X7IA 4WUCA 2LJHA 1H73A 3J80Q 4LFAE 4R2PA 1BB8A 4IJDA 4J3DA 5JEAC 4NXME 4JI3I 3ZKBA 1HNWI 1N32E 2K7IA 1Z0GA 2PO2A 2LRSA 2UUBI 5K36B 2UU9E 2MC5A 5GMEA 1J5EE 2EN4A 1T4LB 1P42A 4DR2E 2NUFA 4DU7A 3PRYA 4JI1I 1MEYC 1FJGE 2UXDE 4KQVA 2UUAI 4GKJE 1A1IA 4BA1A 2EPRA 2EPXA 2EP3A 2EPKX 2JR1A 2DB2A 5A2QQ 2YT4A 4HTGA 4FWHA 2EOHA 1HNZI 2PO1A 2V86A 4BCAA 1ZM2A 2DLKA 1Y4UA 2HC5A 2UXBI 3P3GA 3C6KA 2R1FA 5AE3A 5A6JA 4DV4I 2JOBA 1MG7A 5JEAD 2LT7A 2JEBA 2L2NA 1P47A 2EN2A 4M2ZA 4JI7I 1QU6A 3EPHA 2ODRD 4WXDA 2V85A 3B78A 4DPYA 4KHPI 4IFDD 5K36A 4DV0E 1PKPA 2Q2EB 3T1HI 4F6NA 3H09A 2LCEA 4NZVA 2ZBKB 4OX9I 2E1MA 4IS1C 1JK2A 1Y4SA 2V88A 3K1JA 2NABA 2HK3A 2EM8A 4MLQA 2E5LI 3B8HA 2EMLA 4DR6E 2BA0D 2ENCA 4R2QA 2CGEA 1Y6ZA 4ZVIA 2ENHA 3CDJA 2UU9I 5LL6R 4NXMI 2EM0A 2HKEA 1HNWE 1R6MA 1GZ6A 5C0XC 3DF6A 2PNZB 1OYRA 3EQ1A 4FN5A 4LF6E 4RPFA 1Y5YA 2RPCA 5K36C 4Q35B 4X8WA 3LTOA 3ZZTA 4DPTA 4JI4I 2J7KA 4MYUA 2CZ9A 2YU5A 4GQUA 4BHCA 4PU9A 3CWVA 4MU1A 1IBLI 2EOSA 3D4JA 1A1FA 4FW9A 4DV3I 1FI4A 2EORA 3PYFA 2L2KB 4OOGC 3WU3A 2EOOA 4JYAE 2C38A 2GHFA 1QZRA 1NCSA 3QG5C 3H4LA 2JEAB 3M7ND 1N34E 4ZYGA 2YTQA 4YHHE 3VYYA 1B63A 5A6BD 1FNMA 4M1KA 2YSOA 3K85A 2O1TA 4R2EA 2NA2A 2YTPA 4FWGA 1PVGA 2BA1D 3OTOE 4WXCA 5A6KA 4B3TE 3H1CA 3J81Q 1XNQI 2EMCA 3DD6A 2VF3A 4LOMA 1YUIA 4DUYI 2IOQA 5LMNE 1UEKA 2JE6B 4DR3I 3P3EA 4DR5I 2YRHA 3F0NA 2A25A 1UDQA 4DR6I 1X47A 1IMUA 1EI1A 1A1JA 4DUZI 4R2DA 3J81C 1R6LA 1ZM3A 4LF7I 4IFDF 2A2CA 3AUZA 1E3HA 5DRRA 4P78A 3QT5A 4X65I 5KL4A 1PDAA 3UK3C 5FWKA 2MKNA 1RMDA 2DRPA 1USVA 4WYQB 2PO2B 3T1YI 4BBYA 2LO3A 3Q6NA 4R2AA 2EZ6A 1DI2A 1XMOE 1YPNA 1A1HA 2V2QA 1NHJA 1ZU1A 2UUCI 4BA1B 4DR4I 1YH8A 4R2RA 1FWLA 4OO1F 1PJSA 2JEAA 4AM3A 2A2DA 3WU5A 1N0VC 1YFHA 2WBUA 5EL9A 2JE6A 5FLXQ 4DV2I 5AASA 1WJPA 4OO1E 4WX9A 1KIJA 4R2SA 2RSIA 4X64E 1KYQA 4IZJD 1T38A 4DPWA 5DRPA 2DMYA 4IFDA 1NHHA 2YZTA 4Q28A 5JEAF 5IWAI 3CDIA 1J5EI 4BA2B 3AV0A 4FK5C 1GQEA 5DNYA 4BC9A 2BR2B 1ZBQA 3U1YA 3EPKA 2EMAA 4OO1D 2EL5A 4DV5I 3BGHA 1A1KA 2BM1A 4IS9A 1YUJA 2L92A 3B4TA 2N8XA 4X66E 4R03A 2LBSB 2BA1G 2UXBE 2V34A 2V2ZA 2ELZA 1RQ0A 1N33I 4P7AA 2DMIA 5IWAE 1ZXMA 4AIDA 1PJTA 5A6AA 4QNKA 4Z7YA 2YTGA 3WU6A 4DV0I 1STUA 1EH8A 2CTDA 4DV1E 2IESA 2RS6A 4HXZA 5DNXA 2EWLA 2VQEI 2CSHA 1UHZA 4MYTA 1AH5A 1Z5CA 3J80C 4FW3A 2L33A 2EJ4A 4URLA 2NUGA 4XTJA 4KHPE 2JYAA 1UDOA 2WW4A 2MKDA 4NHRA 4DPXA 3M85D 2ENAA 2UUCE 1XHKA 1Z5BA 4DR4E 1B62A 4JI3E 4JI6E 1ZM4A 2UXCE 3ZZUA 1RR9A 2Z5CB 2RTXA 2B7VA 4JI8I 2M9AA 2VF1A 4JI5I 2EM6A 1H74A 2L8TA 3ADJA 4R8OA 3ZOQB 2WNRA 4MLVA 3NZKA 4N3OA 4DR5E 4UTGA 1RC7A 1H7SA 2PNLA 1ELOA 4DR3E 5LMNI 2L6MA 2CG9A 2GQ0A 5DRQA 1IBMI 1T4OA 4LF7E 4DUYE 2C39B 3GCMA 2YRMA 4LF4E 4DV3E 1FKAE 1HNXE 2EM2A 2EMFA 4DUZE 1K47A 4LPFA 4YY3I 4TUGA 4BS9A 2F4VI 2EE8A 4GKKI 1I94E 2EN1A 1DARA 3MHSC 4LFCE 1Z0CA 2FV4B 3PYGA 1XNRI 5K36E 3C6MA 2PNMA 1RREA 2HJJA 5IT9C 3L7ZB 5L3JA 2EOXA 5C0XE 5F3WA 3THOB 1Z0EA 1N36I 2NUEA 4B3MI 2MDGA 1UDSA 1XMOI 4DV7I 5T6JA 4DR7I 2EOYA 2O1VA 1MU5A 2EOFA 3ADLA 4I3HA 4Z7CA 1UILA 2DGCA 1S16A 2ZM6I 4YHHI 2HFSA 1TN9A 2EOQA 1DQ3A 4L8NA 2PRTA 4QNJA 1YYWA 1XNRE 1X3CA 2HFUA 3LNUA 4IFDB 2CPNA 3KRNA 2EMKA 2O1WA 2M1SA 4IZKA 4ZYHA 4DR1I 2EPNA 4WFTA 4LU9A 4L5NC 1IQSA 4DV7E 2N3HA 3HPSA 2GLIA 1YYOA 2EN3A 3K6QA 2B9DA 5AC4A 2V87A 4X9JA 2JXPA 1WUUA 2HK2A 4WPYA 3QT6A 4JI4E 2Z5BA 3M7NG 2YTOA 2KHXA 2VQFE 4LF6I 4FW4A 2EPPA 4F9BB 4X62E 1F2IG 1E3PA 1BKNA 4LFBI 4LF4I 4HACA 3J7Yp 1ZAAC 1X6HA 2V8QB 4OO1C 4USMA 5TSEA 2EM4A 2YTNA 1IBME 1MX0A 2GS8A 2EMYA 1H72C 1XXEA 2MC6A 4JYAI 2V2VA 3ECRA 2E5LE 2F4VE 4BA2A 2EMWA 2UUBE 5K36D 2EOZA 4O43A 4X64I 1UBDC 2EMHA 4M0VA 2C37B 4FW7A 1X5WA 2HGHA 4JI1E 5KL5A 4DV4E 3M85G 4LF5E 2EOEA 4NXNE 4BHBA 1G2FC 1FWKA 4JG4A 2EN6A 2JVAA 3LLHA 3KZYA 2E1RA 3M6AA 2H36X 2HKJA 2EL6A 4OO1A 2JY9A 1HNZE 1WHQA 1ZR9A 4DV5E 2UXCI 5IXMB 3VK6A 2JP9A 4O5GA 2YSPA 2RS7A 2GO3A 4JV5I 2C39A 2RSMA 5KL6A 4LF8E 5BR8I 3EPJA 2EPZA 1T39A 1PJQA 4M9VC 5CFFE 2EQ0A 2LJUA 2WNRB 1N32I 2B3TB 1MGTA 3HQ1A 2IHR1
chains in the Genus database with same CATH topology
4LFBE 3QT8A 2Z5CA 1NHIA 2F8BA 4USKA 2LUQA 3HJCA 1ZBTA 3Q6MA 2LMZA 3JAMC 1XNQE 2LUPB 4UT4A 1IBKE 1HK7A 4X62I 1PIEA 4DR7E 2LTRA 2DEJA 3ZZ0A 2NPFA 1WHNA 4BMJA 4DV6I 3DJWA 4DV2E 4LF9E 2FTXB 1Z59A 3KWRA 4BC7A 3HTXA 2JWOA 3B82A 4F54A 2DSYA 2FGGA 1Z0TA 1ZM9A 2DIXA 1A6FA 4JI5E 1Z0VA 3WU4A 1Z0WA 1XMQI 4AQYE 2X36A 3C4BA 4K0KI 1USUA 1X49A 4B3TI 1X48A 4PRXA 1I94I 3JU0A 4LFCI 5AE2A 2L3JA 4GKKE 5IT9Q 2L2MA 3ADGA 4F9AB 2G7HA 1N36E 1U2RA 2VQEE 1KKHA 4K0KE 3J7AM 1NZ0A 5BR8E 4F9CB 2M7QA 3C4TA 4R1FA 1SR9A 2HHHE 4DR1E 1H7UA 4FWDA 4EMDA 2B7TA 3LPSA 4IZJA 4JI6I 2K4VA 3JTZA 1HR0I 4JI8E 4DV6E 5FLXC 1VISA 3PYEA 4YY3E 3IWBA 3F6GA 2BM0A 2R3VA 1HNXI 3VYXA 1Z5AA 4GKJI 1O0WA 1J26A 4AQYI 4LF8I 5GMDA 2Z5EA 3QT7A 4DR2I 2LTSA 2BV3A 3P06A 3F6HA 5LMUE 4JV5E 5A2QC 1YYKA 3J7AG 2ZITA 4I8OA 4JI7E 1Z0BA 3K17A 2V8PA 2LJPA 4NXNI 3V2UC 3ZM7A 4LF5I 4KZSA 1EA6A 1IBKI 2WZOA 4DKKA 1KVKA 3HPZA 2UXDI 1EKZA 4HYMA 2N3GA 2VE7C 1OJ4A 2R42A 1YZ9A 2ODRC 4JI0E 2UUAE 4DXLA 1FJGI 3IWCA 4DV1I 3PYDA 2DEIA 2IOPA 2VQFI 4B3RE 3IWDA 3V5RA 4IZKB 1HR0E 3P1XA 4WUDA 4X65E 4LFAI 4WSPA 2EFGA 4B3SI 1T4NA 3JAMQ 2JOXA 3ZKDA 4ED4A 3T1YE 4JI2I 5LMUI 3RMPA 1IBLE 4PRVA 2M4IA 2OI2A 1WXRA 3HXLA 2O1UA 4IZJB 4LF9I 2HHHI 2KONA 3ADIA 4WUBA 4J8ZA 4B3ME 2KOUA 1N34I 3LMLA 4DPUA 4LTYA 1XMQE 4P52A 3GONA 4TUIA 2V89A 4DU8A 4GEQB 1ZXNA 3Q1QA 2MDRA 4JI0I 4M30A 2LE2A 5ADZA 2L3CA 4B3RI 3T1HE 3HULA 3MSWA 1S4EA 4DMIA 2ZM6E 4HY1A 1D6TA 1N33E 1KTVA 5AE1A 4P7DA 3FIGA 1N0UA 4HACB 4X66I 4B3SE 3OMLA 2XEXA 4OX9E 2V83A 2Z5BB 2AJ4A 3OTOI 4JI2E 2X7IA 4WUCA 2LJHA 1H73A 3J80Q 4LFAE 4NXME 4JI3I 3ZKBA 1HNWI 1N32E 1Z0GA 2LRSA 2UUBI 2UU9E 2MC5A 5GMEA 1J5EE 1T4LB 4DU7A 4DR2E 2NUFA 3PRYA 4JI1I 1FJGE 2UXDE 4KQVA 2UUAI 4GKJE 2JR1A 2DB2A 5A2QQ 2YT4A 4FWHA 1HNZI 2V86A 4BCAA 1ZM2A 1Y4UA 2UXBI 5AE3A 4DV4I 2JOBA 1MG7A 2L2NA 4M2ZA 4JI7I 1QU6A 2ODRD 2V85A 3B78A 4DPYA 4KHPI 4DV0E 1PKPA 2Q2EB 3T1HI 3H09A 2ZBKB 4OX9I 2E1MA 1Y4SA 2V88A 3K1JA 2HK3A 2E5LI 3B8HA 4DR6E 2CGEA 1Y6ZA 4ZVIA 2UU9I 5LL6R 4NXMI 2HKEA 1HNWE 1GZ6A 3DF6A 4FN5A 4RPFA 4LF6E 3LTOA 4X8WA 4DPTA 3ZZTA 4JI4I 2J7KA 4MYUA 2CZ9A 4PU9A 3CWVA 1IBLI 3D4JA 4FW9A 4DV3I 1FI4A 3PYFA 2L2KB 4OOGC 3WU3A 4JYAE 1QZRA 3H4LA 1N34E 4YHHE 3VYYA 1B63A 1FNMA 4M1KA 3K85A 2O1TA 2NA2A 4FWGA 1PVGA 3OTOE 4B3TE 3J81Q 1XNQI 2VF3A 4DUYI 2IOQA 5LMNE 1UEKA 4DR3I 4DR5I 3F0NA 4DR6I 1X47A 1EI1A 4DUZI 4LF7I 1ZM3A 3J81C 2A2CA 3AUZA 4P78A 3QT5A 4X65I 5FWKA 1USVA 4WYQB 3T1YI 4BBYA 3Q6NA 2EZ6A 1DI2A 1XMOE 2V2QA 1NHJA 2UUCI 4DR4I 1FWLA 2A2DA 3WU5A 1N0VC 5FLXQ 4DV2I 5AASA 1KIJA 4X64E 4IZJD 4DPWA 2DMYA 1NHHA 2YZTA 4Q28A 5IWAI 1J5EI 3AV0A 1GQEA 5DNYA 4BC9A 1ZBQA 4DV5I 2BM1A 2L92A 4X66E 4R03A 2LBSB 2V34A 2UXBE 2V2ZA 1RQ0A 1N33I 4P7AA 5IWAE 1ZXMA 4Z7YA 4DV0I 3WU6A 1STUA 4DV1E 2RS6A 4HXZA 2VQEI 2EWLA 1UHZA 4MYTA 1Z5CA 3J80C 2L33A 4URLA 2NUGA 4XTJA 4KHPE 2WW4A 4DPXA 2UUCE 1XHKA 1Z5BA 4DR4E 1B62A 4JI3E 4JI6E 1ZM4A 2UXCE 3ZZUA 1RR9A 2Z5CB 2RTXA 2B7VA 4JI8I 2VF1A 4JI5I 1H74A 2L8TA 3ADJA 4R8OA 3ZOQB 4N3OA 4DR5E 4UTGA 1RC7A 1H7SA 2PNLA 1ELOA 4DR3E 5LMNI 2L6MA 2CG9A 2GQ0A 1IBMI 1T4OA 4LF7E 4DUYE 4LF4E 1K47A 4DV3E 1FKAE 4DUZE 1HNXE 4YY3I 4GKKI 4TUGA 4BS9A 2F4VI 1I94E 1DARA 4LFCE 1Z0CA 2FV4B 3PYGA 1XNRI 2PNMA 1RREA 5IT9C 5L3JA 1N36I 5F3WA 1Z0EA 2NUEA 4B3MI 1XMOI 4DV7I 5T6JA 4DR7I 2O1VA 1MU5A 3ADLA 4I3HA 4Z7CA 1UILA 1S16A 2ZM6I 4YHHI 2HFSA 1DQ3A 4L8NA 1YYWA 1XNRE 2HFUA 3LNUA 2CPNA 4DR1I 2O1WA 2M1SA 4IZKA 4WFTA 4LU9A 4L5NC 4DV7E 2N3HA 3HPSA 1YYOA 3K6QA 2B9DA 2V87A 1WUUA 2HK2A 4WPYA 3QT6A 4JI4E 2Z5BA 2KHXA 2VQFE 4LF6I 4X62E 4F9BB 4LFBI 1BKNA 4LF4I 4HACA 3J7Yp 2V8QB 4USMA 1IBME 1MX0A 2GS8A 1H72C 2MC6A 4JYAI 2V2VA 2F4VE 2E5LE 2UUBE 4X64I 4M0VA 4JI1E 4DV4E 4LF5E 4NXNE 1FWKA 4JG4A 2JVAA 3LLHA 2E1RA 3M6AA 2H36X 2HKJA 2JY9A 1HNZE 1WHQA 4DV5E 2UXCI 3VK6A 2RS7A 4JV5I 2RSMA 4LF8E 5BR8I 1N32I 5CFFE 2B3TB 3HQ1A 2IHR1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB E;  3QT8 A;  1NHI A;  4USK A;  2LUQ A;  1ZBT A;  3JAM C;  1XNQ E;  2LUP B;  4UT4 A;  1IBK E;  4X62 I;  1PIE A;  4DR7 E;  2LTR A;  2DEJ A;  3ZZ0 A;  2NPF A;  1WHN A;  4DV6 I;  4LF9 E;  4DV2 E;  1Z59 A;  3HTX A;  3B82 A;  1Z0T A;  1ZM9 A;  2DIX A;  1A6F A;  4JI5 E;  1Z0V A;  3WU4 A;  1Z0W A;  1XMQ I;  4AQY E;  2X36 A;  3C4B A;  4K0K I;  1X49 A;  4B3T I;  1X48 A;  4PRX A;  1I94 I;  4LFC I;  2L3J A;  4GKK E;  5IT9 Q;  2L2M A;  3ADG A;  1N36 E;  1U2R A;  2VQE E;  1KKH A;  4K0K E;  3J7A M;  1NZ0 A;  5BR8 E;  4R1F A;  3C4T A;  2HHH E;  4DR1 E;  1H7U A;  4FWD A;  4EMD A;  2B7T A;  3LPS A;  4JI6 I;  1HR0 I;  4JI8 E;  4DV6 E;  1VIS A;  5FLX C;  3PYE A;  4YY3 E;  2BM0 A;  2R3V A;  1HNX I;  3VYX A;  1Z5A A;  4GKJ I;  1O0W A;  1J26 A;  4AQY I;  4LF8 I;  5GMD A;  3QT7 A;  4DR2 I;  2LTS A;  2BV3 A;  4JV5 E;  5LMU E;  5A2Q C;  1YYK A;  2ZIT A;  3J7A G;  4JI7 E;  1Z0B A;  3K17 A;  2V8P A;  2LJP A;  4NXN I;  3V2U C;  3ZM7 A;  4LF5 I;  1EA6 A;  1IBK I;  4DKK A;  1KVK A;  2UXD I;  1EKZ A;  4HYM A;  2N3G A;  1OJ4 A;  2R42 A;  1YZ9 A;  4JI0 E;  2UUA E;  4DXL A;  1FJG I;  4DV1 I;  3PYD A;  2DEI A;  2VQF I;  4B3R E;  3V5R A;  1HR0 E;  3P1X A;  4WUD A;  4X65 E;  4LFA I;  2EFG A;  4B3S I;  1T4N A;  3JAM Q;  3ZKD A;  4ED4 A;  3T1Y E;  4JI2 I;  5LMU I;  1IBL E;  4PRV A;  2OI2 A;  4LF9 I;  2HHH I;  3ADI A;  4WUB A;  4B3M E;  1N34 I;  4DPU A;  1XMQ E;  4P52 A;  3GON A;  4DU8 A;  1ZXN A;  3Q1Q A;  2MDR A;  4JI0 I;  4M30 A;  2L3C A;  4B3R I;  3T1H E;  3HUL A;  1S4E A;  2ZM6 E;  4HY1 A;  1D6T A;  1N33 E;  1KTV A;  1N0U A;  4HAC B;  4X66 I;  4B3S E;  2XEX A;  4OX9 E;  2AJ4 A;  3OTO I;  4JI2 E;  2X7I A;  4WUC A;  2LJH A;  1H73 A;  3J80 Q;  4LFA E;  4NXM E;  4JI3 I;  3ZKB A;  1HNW I;  1N32 E;  1Z0G A;  2LRS A;  2UUB I;  2UU9 E;  5GME A;  1J5E E;  1T4L B;  4DU7 A;  4DR2 E;  2NUF A;  4JI1 I;  1FJG E;  2UXD E;  4KQV A;  2UUA I;  4GKJ E;  2DB2 A;  5A2Q Q;  2YT4 A;  4FWH A;  1HNZ I;  1ZM2 A;  2UXB I;  4DV4 I;  1MG7 A;  2L2N A;  4M2Z A;  4JI7 I;  1QU6 A;  3B78 A;  4DPY A;  4KHP I;  4DV0 E;  1PKP A;  2Q2E B;  3T1H I;  2ZBK B;  4OX9 I;  3K1J A;  2HK3 A;  2E5L I;  3B8H A;  4DR6 E;  4ZVI A;  2UU9 I;  5LL6 R;  4NXM I;  2HKE A;  1HNW E;  4FN5 A;  4RPF A;  4LF6 E;  3LTO A;  4X8W A;  4DPT A;  3ZZT A;  4JI4 I;  2J7K A;  4MYU A;  2CZ9 A;  4PU9 A;  3CWV A;  1IBL I;  3D4J A;  4FW9 A;  4DV3 I;  1FI4 A;  3PYF A;  2L2K B;  4OOG C;  3WU3 A;  4JYA E;  1QZR A;  3H4L A;  1N34 E;  4YHH E;  3VYY A;  1B63 A;  1FNM A;  4M1K A;  2NA2 A;  4FWG A;  1PVG A;  3OTO E;  4B3T E;  3J81 Q;  1XNQ I;  2VF3 A;  4DUY I;  5LMN E;  1UEK A;  4DR3 I;  4DR5 I;  3F0N A;  4DR6 I;  1X47 A;  1EI1 A;  4DUZ I;  4LF7 I;  1ZM3 A;  3J81 C;  2A2C A;  3QT5 A;  4X65 I;  4WYQ B;  3T1Y I;  2EZ6 A;  1DI2 A;  1XMO E;  2V2Q A;  1NHJ A;  2UUC I;  4DR4 I;  1FWL A;  2A2D A;  3WU5 A;  1N0V C;  5FLX Q;  4DV2 I;  1KIJ A;  4X64 E;  4DPW A;  2DMY A;  1NHH A;  5IWA I;  1J5E I;  1GQE A;  4DV5 I;  2BM1 A;  4X66 E;  2LBS B;  2V34 A;  2UXB E;  2V2Z A;  1RQ0 A;  1N33 I;  4P7A A;  5IWA E;  1ZXM A;  4Z7Y A;  4DV0 I;  3WU6 A;  1STU A;  4DV1 E;  2RS6 A;  4HXZ A;  2VQE I;  1UHZ A;  4MYT A;  1Z5C A;  3J80 C;  2L33 A;  4URL A;  2NUG A;  4XTJ A;  4KHP E;  2WW4 A;  4DPX A;  2UUC E;  1XHK A;  1Z5B A;  4DR4 E;  1B62 A;  4JI3 E;  4JI6 E;  1ZM4 A;  2UXC E;  3ZZU A;  1RR9 A;  2RTX A;  2B7V A;  4JI8 I;  4JI5 I;  1H74 A;  3ADJ A;  4DR5 E;  4UTG A;  1RC7 A;  1H7S A;  1ELO A;  4DR3 E;  5LMN I;  1IBM I;  1T4O A;  4LF7 E;  4DUY E;  4LF4 E;  1K47 A;  4DV3 E;  1FKA E;  4DUZ E;  1HNX E;  4YY3 I;  4GKK I;  2F4V I;  1I94 E;  1DAR A;  4LFC E;  1Z0C A;  1XNR I;  3PYG A;  1RRE A;  5L3J A;  5IT9 C;  1N36 I;  1Z0E A;  2NUE A;  4B3M I;  1XMO I;  4DV7 I;  4DR7 I;  1MU5 A;  3ADL A;  4I3H A;  4Z7C A;  1UIL A;  1S16 A;  2ZM6 I;  4YHH I;  2HFS A;  1YYW A;  1XNR E;  2HFU A;  3LNU A;  2CPN A;  4DR1 I;  4WFT A;  4DV7 E;  2N3H A;  1YYO A;  1WUU A;  2HK2 A;  3QT6 A;  4JI4 E;  2KHX A;  2VQF E;  4LF6 I;  4X62 E;  4LFB I;  1BKN A;  4LF4 I;  4HAC A;  3J7Y p;  4USM A;  1IBM E;  1MX0 A;  2GS8 A;  1H72 C;  4JYA I;  2V2V A;  2F4V E;  2E5L E;  2UUB E;  4X64 I;  4JI1 E;  4DV4 E;  4LF5 E;  4NXN E;  1FWK A;  4JG4 A;  2JVA A;  3LLH A;  2E1R A;  3M6A A;  2HKJ A;  2JY9 A;  1HNZ E;  1WHQ A;  4DV5 E;  2UXC I;  2RS7 A;  4JV5 I;  2RSM A;  4LF8 E;  5BR8 I;  1N32 I;  5CFF E;  2B3T B;  2IHR 1; 
#chains in the Genus database with same CATH topology
 4LFB E;  2PO0 A;  3QT8 A;  2YU8 A;  1NHI A;  2Z5C A;  3BID A;  2YTF A;  5C0X F;  1BBG A;  2F8B A;  2J7J A;  2LUQ A;  4MQY A;  4USK A;  3HJC A;  1ZBT A;  3PS1 A;  2LMZ A;  3Q6M A;  3JAM C;  1XNQ E;  2LUP B;  1A1G A;  4UT4 A;  1IBK E;  1HK7 A;  3THN A;  2EMI A;  1Z1B A;  5AC5 A;  4DR7 E;  1PIE A;  4X62 I;  2LTR A;  2DEJ A;  4MU4 A;  5LLQ A;  3ZZ0 A;  1QNT A;  2NPF A;  1WHN A;  4BMJ A;  4O4K A;  4DV6 I;  3DJW A;  4DV2 E;  4LF9 E;  2FTX B;  1Z59 A;  3KWR A;  4BC7 A;  3HTX A;  2ELY A;  2JWO A;  4GZN C;  3B82 A;  4U3B A;  4F54 A;  2DSY A;  3BBG A;  2FGG A;  4LCF A;  3M99 B;  1Z0T A;  1ZM9 A;  5DNL A;  2DIX A;  1A6F A;  4JI5 E;  2BB8 A;  1Z0V A;  3EPL A;  1KJK A;  3P76 A;  3WU4 A;  4R2C A;  1Z0W A;  4KWY A;  1X6F A;  1NEI A;  1XMQ I;  4AQY E;  2X36 A;  4OZE A;  3C4B A;  4HEI A;  4F2J C;  1TF3 A;  1USU A;  2WP8 B;  4K0K I;  1X49 A;  2JT2 A;  4B3T I;  1X48 A;  4PRX A;  4O24 A;  1OYS A;  1I94 I;  3JU0 A;  2EM7 A;  2I13 A;  2JEB B;  1EH6 A;  5AE2 A;  2L3J A;  1LLM C;  4GKK E;  2NN6 E;  2E72 A;  4LFC I;  2L2M A;  2VES A;  5IT9 Q;  1N3G A;  4ISA A;  1BBO A;  3ADG A;  4F9A B;  2G7H A;  1N36 E;  2BBG A;  1U2R A;  1GTK A;  2EMX A;  4MU0 A;  2VQE E;  1KKH A;  4MU3 A;  4OKG A;  4K0K E;  5DRO A;  4WSG A;  3J7A M;  1NZ0 A;  5BR8 E;  4F9C B;  4RHB B;  3C4T A;  2M7Q A;  1UDN A;  1SR9 A;  2C37 A;  3HKM A;  4R1F A;  5KL7 A;  1DGC A;  2HHH E;  4DR1 E;  2J65 A;  1H7U A;  1B69 A;  4FWD A;  2WP8 A;  3P3C A;  2B7T A;  3LPS A;  4EMD A;  4IZJ A;  2EPO A;  2DLQ A;  2JPA A;  4JI6 I;  4AIM A;  4IFD C;  2K4V A;  2EM5 A;  2EOI A;  2EPA A;  3JTZ A;  1HR0 I;  2GPI A;  4JI8 E;  4DV6 E;  5ELW A;  2YRK A;  5FLX C;  1VIS A;  3PYE A;  4YY3 E;  3IWB A;  3F6G A;  2BM0 A;  2R3V A;  1HNX I;  3VYX A;  2EQ3 A;  1OYP A;  1AAY A;  1Y60 A;  1Z5A A;  2EMZ A;  4GKJ I;  1O0W A;  5K36 F;  1J26 A;  4AQY I;  4LF8 I;  5GMD A;  2Z5E A;  2C38 B;  3QT7 A;  4DR2 I;  2ADR A;  2LTS A;  5C0X A;  2BV3 A;  3P06 A;  3F6H A;  5LMU E;  4JV5 E;  5A2Q C;  2RQL A;  1YYK A;  1A1L A;  3J7A G;  2ZIT A;  1YSA C;  4I8O A;  4JI7 E;  2EMG A;  2WCC 3;  1JK1 A;  3MHH C;  1WRJ A;  1Z0B A;  3BF2 A;  1YHC A;  2BA0 G;  3K17 A;  2EOJ A;  2V8P A;  2LJP A;  2NN6 F;  4NXN I;  2YTI A;  3V2U C;  3ZM7 A;  2F1D A;  4KZS A;  1EA6 A;  1IBK I;  4LF5 I;  2WZO A;  2EM9 A;  2CVE A;  4IFD E;  4DKK A;  3UHM A;  1KVK A;  3HPZ A;  2UXD I;  3TQM A;  2EPM X;  1EKZ A;  2N3G A;  4HYM A;  2VE7 C;  1OJ4 A;  2I9I A;  2R42 A;  2PO0 B;  1YZ9 A;  2ODR C;  1G2D C;  1IQO A;  4JI0 E;  2O3Z A;  1X6E A;  1RHY A;  2LVH A;  2UUA E;  4DXL A;  5JEA A;  1FJG I;  1VI7 A;  2PNZ A;  4ZYE A;  3IWC A;  2YTJ A;  3PYD A;  4DV1 I;  5KL2 A;  2DEI A;  2IER A;  2IOP A;  2EM3 A;  3L00 A;  2YWQ A;  2Q8U A;  2VQF I;  4B3R E;  3IWD A;  3V5R A;  4IZK B;  1SFE A;  1HR0 E;  3P1X A;  4WUD A;  2NN6 C;  4F6M A;  4LCG A;  4X65 E;  3VHT B;  2EN7 A;  4LFA I;  4WSP A;  2EFG A;  4RH8 A;  4B3S I;  4OO1 B;  1T4N A;  3JAM Q;  2JOX A;  2WBT A;  3GLL A;  3T1Y E;  3GME A;  3ZKD A;  4ED4 A;  5LMU I;  4JI2 I;  3RMP A;  2WBS A;  2PO1 B;  1IBL E;  2VRD A;  2M4I A;  2OI2 A;  3PS3 A;  2YPN A;  4PRV A;  1WXR A;  3HXL A;  2EMB A;  2O1U A;  4ZYD A;  4IZJ B;  4LF9 I;  2HHH I;  2KON A;  3ADI A;  2R76 A;  4N4R B;  5IV8 B;  4WUB A;  2CT1 A;  4J8Z A;  1UN6 B;  4B3M E;  2KOU A;  2EPU A;  2YTD A;  4NBQ A;  4FW6 A;  2GO4 A;  1N34 I;  3LML A;  3PS2 A;  1L4S A;  4DPU A;  4LTY A;  2EQ1 A;  1XMQ E;  4P52 A;  2EN8 A;  3KZZ A;  4FW5 A;  5C0X D;  5JEA E;  3GON A;  4TUI A;  2V89 A;  4DU8 A;  2EPL X;  5EKW A;  4GEQ B;  2NN6 D;  1ZXN A;  3Q1Q A;  2MDR A;  4JI0 I;  2AE8 A;  2EPC A;  5A69 A;  4M30 A;  2LE2 A;  5ADZ A;  2L3C A;  4LCH A;  4B3R I;  3T1H E;  3HUL A;  3MSW A;  1S4E A;  2EOM A;  4DMI A;  2ZM6 E;  5KL3 A;  4HY1 A;  4U3D A;  1D6T A;  2YTE A;  1N33 E;  5AE1 A;  1KTV A;  2NN6 B;  2NN6 A;  4P7D A;  3FIG A;  5A6B A;  1TF6 A;  1N0U A;  4HAC B;  2LV2 A;  3L7Z A;  4B3S E;  3OML A;  2XEX A;  4X66 I;  4MDT A;  4OX9 E;  5JEA B;  5C0X B;  3U1K A;  2V83 A;  2Z5B B;  2BR2 A;  2AJ4 A;  2EL4 A;  3OTO I;  2D9H A;  1EH7 A;  4JI2 E;  2X7I A;  4WUC A;  2LJH A;  1H73 A;  3J80 Q;  4LFA E;  4R2P A;  1BB8 A;  4IJD A;  4J3D A;  5JEA C;  4NXM E;  4JI3 I;  3ZKB A;  1HNW I;  1N32 E;  2K7I A;  1Z0G A;  2PO2 A;  2LRS A;  2UUB I;  5K36 B;  2UU9 E;  2MC5 A;  5GME A;  1J5E E;  2EN4 A;  1T4L B;  1P42 A;  4DR2 E;  2NUF A;  4DU7 A;  3PRY A;  4JI1 I;  1MEY C;  1FJG E;  2UXD E;  4KQV A;  2UUA I;  4GKJ E;  1A1I A;  4BA1 A;  2EPR A;  2EPX A;  2EP3 A;  2EPK X;  2JR1 A;  2DB2 A;  5A2Q Q;  2YT4 A;  4HTG A;  4FWH A;  2EOH A;  1HNZ I;  2PO1 A;  2V86 A;  4BCA A;  1ZM2 A;  2DLK A;  1Y4U A;  2HC5 A;  2UXB I;  3P3G A;  3C6K A;  2R1F A;  5AE3 A;  5A6J A;  4DV4 I;  2JOB A;  1MG7 A;  5JEA D;  2LT7 A;  2JEB A;  2L2N A;  1P47 A;  2EN2 A;  4M2Z A;  4JI7 I;  1QU6 A;  3EPH A;  2ODR D;  4WXD A;  2V85 A;  3B78 A;  4DPY A;  4KHP I;  4IFD D;  5K36 A;  4DV0 E;  1PKP A;  2Q2E B;  3T1H I;  4F6N A;  3H09 A;  2LCE A;  4NZV A;  2ZBK B;  4OX9 I;  2E1M A;  4IS1 C;  1JK2 A;  1Y4S A;  2V88 A;  3K1J A;  2NAB A;  2HK3 A;  2EM8 A;  4MLQ A;  2E5L I;  3B8H A;  2EML A;  4DR6 E;  2BA0 D;  2ENC A;  4R2Q A;  2CGE A;  1Y6Z A;  4ZVI A;  2ENH A;  3CDJ A;  2UU9 I;  5LL6 R;  4NXM I;  2EM0 A;  2HKE A;  1HNW E;  1R6M A;  1GZ6 A;  5C0X C;  3DF6 A;  2PNZ B;  1OYR A;  3EQ1 A;  4FN5 A;  4LF6 E;  4RPF A;  1Y5Y A;  2RPC A;  5K36 C;  4Q35 B;  4X8W A;  3LTO A;  3ZZT A;  4DPT A;  4JI4 I;  2J7K A;  4MYU A;  2CZ9 A;  2YU5 A;  4GQU A;  4BHC A;  4PU9 A;  3CWV A;  4MU1 A;  1IBL I;  2EOS A;  3D4J A;  1A1F A;  4FW9 A;  4DV3 I;  1FI4 A;  2EOR A;  3PYF A;  2L2K B;  4OOG C;  3WU3 A;  2EOO A;  4JYA E;  2C38 A;  2GHF A;  1QZR A;  1NCS A;  3QG5 C;  3H4L A;  2JEA B;  3M7N D;  1N34 E;  4ZYG A;  2YTQ A;  4YHH E;  3VYY A;  1B63 A;  5A6B D;  1FNM A;  4M1K A;  2YSO A;  3K85 A;  2O1T A;  4R2E A;  2NA2 A;  2YTP A;  4FWG A;  1PVG A;  2BA1 D;  3OTO E;  4WXC A;  5A6K A;  4B3T E;  3H1C A;  3J81 Q;  1XNQ I;  2EMC A;  3DD6 A;  2VF3 A;  4LOM A;  1YUI A;  4DUY I;  2IOQ A;  5LMN E;  1UEK A;  2JE6 B;  4DR3 I;  3P3E A;  4DR5 I;  2YRH A;  3F0N A;  2A25 A;  1UDQ A;  4DR6 I;  1X47 A;  1IMU A;  1EI1 A;  1A1J A;  4DUZ I;  4R2D A;  3J81 C;  1R6L A;  1ZM3 A;  4LF7 I;  4IFD F;  2A2C A;  3AUZ A;  1E3H A;  5DRR A;  4P78 A;  3QT5 A;  4X65 I;  5KL4 A;  1PDA A;  3UK3 C;  5FWK A;  2MKN A;  1RMD A;  2DRP A;  1USV A;  4WYQ B;  2PO2 B;  3T1Y I;  4BBY A;  2LO3 A;  3Q6N A;  4R2A A;  2EZ6 A;  1DI2 A;  1XMO E;  1YPN A;  1A1H A;  2V2Q A;  1NHJ A;  1ZU1 A;  2UUC I;  4BA1 B;  4DR4 I;  1YH8 A;  4R2R A;  1FWL A;  4OO1 F;  1PJS A;  2JEA A;  4AM3 A;  2A2D A;  3WU5 A;  1N0V C;  1YFH A;  2WBU A;  5EL9 A;  2JE6 A;  5FLX Q;  4DV2 I;  5AAS A;  1WJP A;  4OO1 E;  4WX9 A;  1KIJ A;  4R2S A;  2RSI A;  4X64 E;  1KYQ A;  4IZJ D;  1T38 A;  4DPW A;  5DRP A;  2DMY A;  4IFD A;  1NHH A;  2YZT A;  4Q28 A;  5JEA F;  5IWA I;  3CDI A;  1J5E I;  4BA2 B;  3AV0 A;  4FK5 C;  1GQE A;  5DNY A;  4BC9 A;  2BR2 B;  1ZBQ A;  3U1Y A;  3EPK A;  2EMA A;  4OO1 D;  2EL5 A;  4DV5 I;  3BGH A;  1A1K A;  2BM1 A;  4IS9 A;  1YUJ A;  2L92 A;  3B4T A;  2N8X A;  4X66 E;  4R03 A;  2LBS B;  2BA1 G;  2UXB E;  2V34 A;  2V2Z A;  2ELZ A;  1RQ0 A;  1N33 I;  4P7A A;  2DMI A;  5IWA E;  1ZXM A;  4AID A;  1PJT A;  5A6A A;  4QNK A;  4Z7Y A;  2YTG A;  3WU6 A;  4DV0 I;  1STU A;  1EH8 A;  2CTD A;  4DV1 E;  2IES A;  2RS6 A;  4HXZ A;  5DNX A;  2EWL A;  2VQE I;  2CSH A;  1UHZ A;  4MYT A;  1AH5 A;  1Z5C A;  3J80 C;  4FW3 A;  2L33 A;  2EJ4 A;  4URL A;  2NUG A;  4XTJ A;  4KHP E;  2JYA A;  1UDO A;  2WW4 A;  2MKD A;  4NHR A;  4DPX A;  3M85 D;  2ENA A;  2UUC E;  1XHK A;  1Z5B A;  4DR4 E;  1B62 A;  4JI3 E;  4JI6 E;  1ZM4 A;  2UXC E;  3ZZU A;  1RR9 A;  2Z5C B;  2RTX A;  2B7V A;  4JI8 I;  2M9A A;  2VF1 A;  4JI5 I;  2EM6 A;  1H74 A;  2L8T A;  3ADJ A;  4R8O A;  3ZOQ B;  2WNR A;  4MLV A;  3NZK A;  4N3O A;  4DR5 E;  4UTG A;  1RC7 A;  1H7S A;  2PNL A;  1ELO A;  4DR3 E;  5LMN I;  2L6M A;  2CG9 A;  2GQ0 A;  5DRQ A;  1IBM I;  1T4O A;  4LF7 E;  4DUY E;  2C39 B;  3GCM A;  2YRM A;  4LF4 E;  4DV3 E;  1FKA E;  1HNX E;  2EM2 A;  2EMF A;  4DUZ E;  1K47 A;  4LPF A;  4YY3 I;  4TUG A;  4BS9 A;  2F4V I;  2EE8 A;  4GKK I;  1I94 E;  2EN1 A;  1DAR A;  3MHS C;  4LFC E;  1Z0C A;  2FV4 B;  3PYG A;  1XNR I;  5K36 E;  3C6M A;  2PNM A;  1RRE A;  2HJJ A;  5IT9 C;  3L7Z B;  5L3J A;  2EOX A;  5C0X E;  5F3W A;  3THO B;  1Z0E A;  1N36 I;  2NUE A;  4B3M I;  2MDG A;  1UDS A;  1XMO I;  4DV7 I;  5T6J A;  4DR7 I;  2EOY A;  2O1V A;  1MU5 A;  2EOF A;  3ADL A;  4I3H A;  4Z7C A;  1UIL A;  2DGC A;  1S16 A;  2ZM6 I;  4YHH I;  2HFS A;  1TN9 A;  2EOQ A;  1DQ3 A;  4L8N A;  2PRT A;  4QNJ A;  1YYW A;  1XNR E;  1X3C A;  2HFU A;  3LNU A;  4IFD B;  2CPN A;  3KRN A;  2EMK A;  2O1W A;  2M1S A;  4IZK A;  4ZYH A;  4DR1 I;  2EPN A;  4WFT A;  4LU9 A;  4L5N C;  1IQS A;  4DV7 E;  2N3H A;  3HPS A;  2GLI A;  1YYO A;  2EN3 A;  3K6Q A;  2B9D A;  5AC4 A;  2V87 A;  4X9J A;  2JXP A;  1WUU A;  2HK2 A;  4WPY A;  3QT6 A;  4JI4 E;  2Z5B A;  3M7N G;  2YTO A;  2KHX A;  2VQF E;  4LF6 I;  4FW4 A;  2EPP A;  4F9B B;  4X62 E;  1F2I G;  1E3P A;  1BKN A;  4LFB I;  4LF4 I;  4HAC A;  3J7Y p;  1ZAA C;  1X6H A;  2V8Q B;  4OO1 C;  4USM A;  5TSE A;  2EM4 A;  2YTN A;  1IBM E;  1MX0 A;  2GS8 A;  2EMY A;  1H72 C;  1XXE A;  2MC6 A;  4JYA I;  2V2V A;  3ECR A;  2E5L E;  2F4V E;  4BA2 A;  2EMW A;  2UUB E;  5K36 D;  2EOZ A;  4O43 A;  4X64 I;  1UBD C;  2EMH A;  4M0V A;  2C37 B;  4FW7 A;  1X5W A;  2HGH A;  4JI1 E;  5KL5 A;  4DV4 E;  3M85 G;  4LF5 E;  2EOE A;  4NXN E;  4BHB A;  1G2F C;  1FWK A;  4JG4 A;  2EN6 A;  2JVA A;  3LLH A;  3KZY A;  2E1R A;  3M6A A;  2H36 X;  2HKJ A;  2EL6 A;  4OO1 A;  2JY9 A;  1HNZ E;  1WHQ A;  1ZR9 A;  4DV5 E;  2UXC I;  5IXM B;  3VK6 A;  2JP9 A;  4O5G A;  2YSP A;  2RS7 A;  2GO3 A;  4JV5 I;  2C39 A;  2RSM A;  5KL6 A;  4LF8 E;  5BR8 I;  3EPJ A;  2EPZ A;  1T39 A;  1PJQ A;  4M9V C;  5CFF E;  2EQ0 A;  2LJU A;  2WNR B;  1N32 I;  2B3T B;  1MGT A;  3HQ1 A;  2IHR 1; 
#chains in the Genus database with same CATH homology
 4LFB E;  3QT8 A;  2Z5C A;  1NHI A;  2F8B A;  4USK A;  2LUQ A;  3HJC A;  1ZBT A;  3Q6M A;  2LMZ A;  3JAM C;  1XNQ E;  2LUP B;  4UT4 A;  1IBK E;  1HK7 A;  4X62 I;  1PIE A;  4DR7 E;  2LTR A;  2DEJ A;  3ZZ0 A;  2NPF A;  1WHN A;  4BMJ A;  4DV6 I;  3DJW A;  4DV2 E;  4LF9 E;  2FTX B;  1Z59 A;  3KWR A;  4BC7 A;  3HTX A;  2JWO A;  3B82 A;  4F54 A;  2DSY A;  2FGG A;  1Z0T A;  1ZM9 A;  2DIX A;  1A6F A;  4JI5 E;  1Z0V A;  3WU4 A;  1Z0W A;  1XMQ I;  4AQY E;  2X36 A;  3C4B A;  4K0K I;  1USU A;  1X49 A;  4B3T I;  1X48 A;  4PRX A;  1I94 I;  3JU0 A;  4LFC I;  5AE2 A;  2L3J A;  4GKK E;  5IT9 Q;  2L2M A;  3ADG A;  4F9A B;  2G7H A;  1N36 E;  1U2R A;  2VQE E;  1KKH A;  4K0K E;  3J7A M;  1NZ0 A;  5BR8 E;  4F9C B;  2M7Q A;  3C4T A;  4R1F A;  1SR9 A;  2HHH E;  4DR1 E;  1H7U A;  4FWD A;  4EMD A;  2B7T A;  3LPS A;  4IZJ A;  4JI6 I;  2K4V A;  3JTZ A;  1HR0 I;  4JI8 E;  4DV6 E;  5FLX C;  1VIS A;  3PYE A;  4YY3 E;  3IWB A;  3F6G A;  2BM0 A;  2R3V A;  1HNX I;  3VYX A;  1Z5A A;  4GKJ I;  1O0W A;  1J26 A;  4AQY I;  4LF8 I;  5GMD A;  2Z5E A;  3QT7 A;  4DR2 I;  2LTS A;  2BV3 A;  3P06 A;  3F6H A;  5LMU E;  4JV5 E;  5A2Q C;  1YYK A;  3J7A G;  2ZIT A;  4I8O A;  4JI7 E;  1Z0B A;  3K17 A;  2V8P A;  2LJP A;  4NXN I;  3V2U C;  3ZM7 A;  4LF5 I;  4KZS A;  1EA6 A;  1IBK I;  2WZO A;  4DKK A;  1KVK A;  3HPZ A;  2UXD I;  1EKZ A;  4HYM A;  2N3G A;  2VE7 C;  1OJ4 A;  2R42 A;  1YZ9 A;  2ODR C;  4JI0 E;  2UUA E;  4DXL A;  1FJG I;  3IWC A;  4DV1 I;  3PYD A;  2DEI A;  2IOP A;  2VQF I;  4B3R E;  3IWD A;  3V5R A;  4IZK B;  1HR0 E;  3P1X A;  4WUD A;  4X65 E;  4LFA I;  4WSP A;  2EFG A;  4B3S I;  1T4N A;  3JAM Q;  2JOX A;  3ZKD A;  4ED4 A;  3T1Y E;  4JI2 I;  5LMU I;  3RMP A;  1IBL E;  4PRV A;  2M4I A;  2OI2 A;  1WXR A;  3HXL A;  2O1U A;  4IZJ B;  4LF9 I;  2HHH I;  2KON A;  3ADI A;  4WUB A;  4J8Z A;  4B3M E;  2KOU A;  1N34 I;  3LML A;  4DPU A;  4LTY A;  1XMQ E;  4P52 A;  3GON A;  4TUI A;  2V89 A;  4DU8 A;  4GEQ B;  1ZXN A;  3Q1Q A;  2MDR A;  4JI0 I;  4M30 A;  2LE2 A;  5ADZ A;  2L3C A;  4B3R I;  3T1H E;  3HUL A;  3MSW A;  1S4E A;  4DMI A;  2ZM6 E;  4HY1 A;  1D6T A;  1N33 E;  1KTV A;  5AE1 A;  4P7D A;  3FIG A;  1N0U A;  4HAC B;  4X66 I;  4B3S E;  3OML A;  2XEX A;  4OX9 E;  2V83 A;  2Z5B B;  2AJ4 A;  3OTO I;  4JI2 E;  2X7I A;  4WUC A;  2LJH A;  1H73 A;  3J80 Q;  4LFA E;  4NXM E;  4JI3 I;  3ZKB A;  1HNW I;  1N32 E;  1Z0G A;  2LRS A;  2UUB I;  2UU9 E;  2MC5 A;  5GME A;  1J5E E;  1T4L B;  4DU7 A;  4DR2 E;  2NUF A;  3PRY A;  4JI1 I;  1FJG E;  2UXD E;  4KQV A;  2UUA I;  4GKJ E;  2JR1 A;  2DB2 A;  5A2Q Q;  2YT4 A;  4FWH A;  1HNZ I;  2V86 A;  4BCA A;  1ZM2 A;  1Y4U A;  2UXB I;  5AE3 A;  4DV4 I;  2JOB A;  1MG7 A;  2L2N A;  4M2Z A;  4JI7 I;  1QU6 A;  2ODR D;  2V85 A;  3B78 A;  4DPY A;  4KHP I;  4DV0 E;  1PKP A;  2Q2E B;  3T1H I;  3H09 A;  2ZBK B;  4OX9 I;  2E1M A;  1Y4S A;  2V88 A;  3K1J A;  2HK3 A;  2E5L I;  3B8H A;  4DR6 E;  2CGE A;  1Y6Z A;  4ZVI A;  2UU9 I;  5LL6 R;  4NXM I;  2HKE A;  1HNW E;  1GZ6 A;  3DF6 A;  4FN5 A;  4RPF A;  4LF6 E;  3LTO A;  4X8W A;  4DPT A;  3ZZT A;  4JI4 I;  2J7K A;  4MYU A;  2CZ9 A;  4PU9 A;  3CWV A;  1IBL I;  3D4J A;  4FW9 A;  4DV3 I;  1FI4 A;  3PYF A;  2L2K B;  4OOG C;  3WU3 A;  4JYA E;  1QZR A;  3H4L A;  1N34 E;  4YHH E;  3VYY A;  1B63 A;  1FNM A;  4M1K A;  3K85 A;  2O1T A;  2NA2 A;  4FWG A;  1PVG A;  3OTO E;  4B3T E;  3J81 Q;  1XNQ I;  2VF3 A;  4DUY I;  2IOQ A;  5LMN E;  1UEK A;  4DR3 I;  4DR5 I;  3F0N A;  4DR6 I;  1X47 A;  1EI1 A;  4DUZ I;  4LF7 I;  1ZM3 A;  3J81 C;  2A2C A;  3AUZ A;  4P78 A;  3QT5 A;  4X65 I;  5FWK A;  1USV A;  4WYQ B;  3T1Y I;  4BBY A;  3Q6N A;  2EZ6 A;  1DI2 A;  1XMO E;  2V2Q A;  1NHJ A;  2UUC I;  4DR4 I;  1FWL A;  2A2D A;  3WU5 A;  1N0V C;  5FLX Q;  4DV2 I;  5AAS A;  1KIJ A;  4X64 E;  4IZJ D;  4DPW A;  2DMY A;  1NHH A;  2YZT A;  4Q28 A;  5IWA I;  1J5E I;  3AV0 A;  1GQE A;  5DNY A;  4BC9 A;  1ZBQ A;  4DV5 I;  2BM1 A;  2L92 A;  4X66 E;  4R03 A;  2LBS B;  2V34 A;  2UXB E;  2V2Z A;  1RQ0 A;  1N33 I;  4P7A A;  5IWA E;  1ZXM A;  4Z7Y A;  4DV0 I;  3WU6 A;  1STU A;  4DV1 E;  2RS6 A;  4HXZ A;  2VQE I;  2EWL A;  1UHZ A;  4MYT A;  1Z5C A;  3J80 C;  2L33 A;  4URL A;  2NUG A;  4XTJ A;  4KHP E;  2WW4 A;  4DPX A;  2UUC E;  1XHK A;  1Z5B A;  4DR4 E;  1B62 A;  4JI3 E;  4JI6 E;  1ZM4 A;  2UXC E;  3ZZU A;  1RR9 A;  2Z5C B;  2RTX A;  2B7V A;  4JI8 I;  2VF1 A;  4JI5 I;  1H74 A;  2L8T A;  3ADJ A;  4R8O A;  3ZOQ B;  4N3O A;  4DR5 E;  4UTG A;  1RC7 A;  1H7S A;  2PNL A;  1ELO A;  4DR3 E;  5LMN I;  2L6M A;  2CG9 A;  2GQ0 A;  1IBM I;  1T4O A;  4LF7 E;  4DUY E;  4LF4 E;  1K47 A;  4DV3 E;  1FKA E;  4DUZ E;  1HNX E;  4YY3 I;  4GKK I;  4TUG A;  4BS9 A;  2F4V I;  1I94 E;  1DAR A;  4LFC E;  1Z0C A;  2FV4 B;  3PYG A;  1XNR I;  2PNM A;  1RRE A;  5IT9 C;  5L3J A;  1N36 I;  5F3W A;  1Z0E A;  2NUE A;  4B3M I;  1XMO I;  4DV7 I;  5T6J A;  4DR7 I;  2O1V A;  1MU5 A;  3ADL A;  4I3H A;  4Z7C A;  1UIL A;  1S16 A;  2ZM6 I;  4YHH I;  2HFS A;  1DQ3 A;  4L8N A;  1YYW A;  1XNR E;  2HFU A;  3LNU A;  2CPN A;  4DR1 I;  2O1W A;  2M1S A;  4IZK A;  4WFT A;  4LU9 A;  4L5N C;  4DV7 E;  2N3H A;  3HPS A;  1YYO A;  3K6Q A;  2B9D A;  2V87 A;  1WUU A;  2HK2 A;  4WPY A;  3QT6 A;  4JI4 E;  2Z5B A;  2KHX A;  2VQF E;  4LF6 I;  4X62 E;  4F9B B;  4LFB I;  1BKN A;  4LF4 I;  4HAC A;  3J7Y p;  2V8Q B;  4USM A;  1IBM E;  1MX0 A;  2GS8 A;  1H72 C;  2MC6 A;  4JYA I;  2V2V A;  2F4V E;  2E5L E;  2UUB E;  4X64 I;  4M0V A;  4JI1 E;  4DV4 E;  4LF5 E;  4NXN E;  1FWK A;  4JG4 A;  2JVA A;  3LLH A;  2E1R A;  3M6A A;  2H36 X;  2HKJ A;  2JY9 A;  1HNZ E;  1WHQ A;  4DV5 E;  2UXC I;  3VK6 A;  2RS7 A;  4JV5 I;  2RSM A;  4LF8 E;  5BR8 I;  1N32 I;  5CFF E;  2B3T B;  3HQ1 A;  2IHR 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...