2UXDE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxdE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdE02
4JI5E 1IBLE 1MX0A 4X66I 4WFTA 2RSMA 2N3GA 3H4LA 1X47A 2UXBE 5IWAI 4KHPE 1RREA 2L3JA 2R42A 2OI2A 4WYQB 4FW9A 1Z0GA 4DV4I 1ZM2A 4M2ZA 5IT9C 1Z59A 4DXLA 1YYKA 3C4TA 4FWDA 4HYMA 5GMDA 4FN5A 1S16A 4DV4E 2NPFA 1IBKI 4HACB 1PKPA 4USKA 4X65I 4DU8A 3T1HE 2F4VE 1XHKA 4LF5I 4MYUA 1XNQI 3VYYA 4I3HA 4DKKA 4LF9E 1K47A 4X65E 4DV3E 2V2QA 5BR8I 3VYXA 4MYTA 1XNQE 4GKJI 4JI8I 4FWHA 3P1XA 1ZXMA 1FWLA 3B8HA 4DR5I 1J26A 2JVAA 2LTSA 3ZKDA 4Z7YA 2V8PA 4X64I 3HTXA 4OOGC 2N3HA 3ZZTA 4B3ME 1KTVA 2ZITA 4DPTA 4LF8E 4LFBI 5FLXC 4X64E 5LMUI 1X48A 4NXMI 4DV7I 3C4BA 1QZRA 3ADIA 4B3SI 4DR7I 2LRSA 2XEXA 4B3TI 1YYWA 5LMUE 4UT4A 4DPWA 4LF4I 4JI7E 1J5EE 4JI2E 1MG7A 3HULA 4DV7E 4DV2E 4JI6I 4DR7E 4B3TE 1FNMA 4P7AA 1XMOI 3WU4A 4JI0E 3J80Q 1XMQI 4LF7I 1DARA 1EA6A 1HNXI 4OX9I 1H7SA 2UU9I 3K17A 1PIEA 4DU7A 2L3CA 3ADGA 4JI5I 4ED4A 2NA2A 2CPNA 2HKJA 1Z0BA 2GS8A 4DPYA 3LNUA 2UXBI 3ZZ0A 4KHPI 4DV5E 2ZBKB 1N32E 4WUBA 4P52A 3LTOA 1WHNA 3K1JA 1UHZA 4JV5I 3JAMC 1X49A 1N33E 4Z7CA 4DR3E 3PYDA 4K0KI 4JV5E 1ZM3A 3T1YE 1IBME 2HK3A 1Z5BA 3WU6A 1RQ0A 4URLA 3J7Yp 2BM0A 4K0KE 1N36E 3LLHA 3T1HI 1Z5AA 3OTOE 2F4VI 4LFAE 3QT7A 1Z0EA 1XNRE 1HNWI 1FKAE 5LMNE 4LF9I 4PU9A 4NXNI 1FWKA 1BKNA 4DV3I 2ZM6E 4LFCE 2HKEA 4DR2E 4PRVA 1HNWE 1Z0WA 1Z0CA 4HXZA 2V2ZA 3J7AG 4NXNE 1ZM9A 1Z0TA 2DEJA 1H7UA 5L3JA 5A2QC 4DV1E 3QT5A 2E5LE 2DIXA 4DR1I 4B3MI 4JG4A 2LUPB 3ADLA 2JY9A 2A2CA 1KVKA 1UEKA 4LF8I 4DR1E 1ZBTA 2RTXA 1EI1A 1D6TA 4YY3E 3CWVA 3WU5A 3F0NA 3D4JA 1O0WA 1A6FA 1PVGA 4JI7I 1J5EI 4JI2I 2DB2A 1B63A 4DV2I 1DI2A 1T4LB 1T4OA 2NUGA 2L2MA 4JI0I 2X7IA 2BM1A 4X8WA 4EMDA 2UUAE 1B62A 2V34A 1WUUA 2B7VA 1S4EA 2RS6A 4DR4E 2L2KB 3V2UC 1HR0I 3M6AA 1HNZE 1FI4A 2HFUA 4DUZE 2LTRA 1HR0E 4M30A 1FJGE 4DV5I 3PYGA 1N32I 4YHHI 4PRXA 2B7TA 4DUYE 4JYAE 3WU3A 1NHHA 4YHHE 3B78A 2VQEE 1T4NA 4GKKE 2CZ9A 3J7AM 3Q1QA 1N33I 2R3VA 2VQFE 4DR3I 1EKZA 4X62I 4DV0E 1GQEA 3T1YI 4RPFA 1IBMI 1RR9A 2HFSA 4UTGA 1H73A 4X62E 2HK2A 1N0UA 2UXDI 1N36I 3OTOI 4LFAI 2UXCE 1ZXNA 2UUCI 1XNRI 2LUQA 5LMNI 4LF6E 4JI4I 2UXDE 2EZ6A 1QU6A 2ZM6I 2DEIA 2NUFA 4JI1I 3ZM7A 1I94I 4X66E 2E1RA 4LFCI 2UUCE 4DR2I 5IWAE 4JI4E 3J81Q 1Z0VA 1N0VC 4JI1E 1I94E 4XTJA 3ZZUA 2J7KA 1NHIA 4DV1I 5LL6R 1NHJA 4B3RI 4ZVIA 2E5LI 3ADJA 1RC7A 3B82A 2DMYA 2A2DA 4B3RE 1UILA 1OJ4A 3JAMQ 2AJ4A 1IBKE 4AQYI 4YY3I 3LPSA 1VISA 2RS7A 2V2VA 2LJHA 2NUEA 5IT9Q 2LBSB 1KKHA 2X36A 4AQYE 2IHR1 4LF5E 1H72C 3J80C 4DPUA 4HY1A 4DR6I 2UUAI 1Z5CA 1H74A 2L2NA 1ELOA 5BR8E 2YT4A 4GKJE 4DR4I 4R1FA 4JI8E 4DR6E 4JI3I 5GMEA 1U2RA 4DR5E 4DPXA 2UUBI 1HNZI 1YZ9A 2LJPA 4JI3E 4WUDA 4DUZI 2EFGA 1STUA 5A2QQ 2WW4A 1FJGI 4HACA 2UUBE 3V5RA 4LFBE 4USMA 1KIJA 4FWGA 2HHHI 5CFFE 4DUYI 4NXME 4JYAI 1N34I 2BV3A 4B3SE 1ZM4A 2VQEI 4M1KA 4GKKI 4LF4E 1MU5A 2HHHE 1WHQA 2VQFI 1YYOA 4WUCA 2B3TB 2VF3A 5FLXQ 4JI6E 1N34E 4DV0I 4KQVA 4DV6I 1XMOE 1NZ0A 3PYFA 2Q2EB 2KHXA 1XMQE 4LF7E 3PYEA 3QT6A 3QT8A 2L33A 2MDRA 1IBLI 4DV6E 3J81C 1HNXE 4OX9E 2UXCI 3ZKBA 3GONA 2UU9E 4LF6I
chains in the Genus database with same CATH superfamily
4JI5E 3IWDA 1IBLE 1MX0A 4X66I 4L5NC 4WFTA 2RSMA 1RHYA 2N3GA 2EOIA 3H4LA 1X47A 2UXBE 3IWCA 5IWAI 4KHPE 2E1MA 1RREA 4F6NA 1ZBQA 2L3JA 2R42A 2OI2A 5C0XA 5AASA 1YUIA 1EH6A 3K85A 5C0XF 2DGCA 3Q6NA 4MDTA 4OO1D 1KJKA 4WYQB 2EN3A 2JEAB 4FW9A 2GHFA 1Z0GA 5DNXA 4DV4I 2J65A 1ZM2A 4M2ZA 5IT9C 3KWRA 4OKGA 1Z59A 1N3GA 4DXLA 1YYKA 4OO1E 3C4TA 4R2RA 4FWDA 4HYMA 5JEAA 1GZ6A 2EM6A 4IZJD 2R76A 1G2DC 4FN5A 5GMDA 2BB8A 4DV4E 1S16A 2NPFA 2EMGA 5JEAF 2C37A 1IBKI 4HACB 4M9VC 5K36C 2WCC3 1GTKA 2ELZA 3EQ1A 4LCHA 1BBGA 2Z5BB 4LOMA 4IFDA 1PKPA 4F9AB 4IFDF 3H1CA 4FW3A 1ZR9A 3L7ZA 4USKA 1JK2A 4X65I 4DU8A 2PO0B 3CDIA 3T1HE 2BA1D 2M9AA 2CGEA 2F4VE 1E3PA 1F2IG 1XHKA 2IESA 1YPNA 4F9BB 4LF5I 4MYUA 1XNQI 2V88A 4FW4A 3LMLA 1X6FA 2EPUA 1X3CA 4WPYA 3VYYA 1L4SA 2EOHA 4DKKA 2BR2A 4I3HA 4LF9E 1K47A 4HTGA 4X65E 4R2AA 2EN4A 4DV3E 2EM2A 2EPKX 1PJQA 2EOJA 4LU9A 2CVEA 3B4TA 5K36F 2V2QA 2YTEA 3AV0A 5BR8I 1TF6A 3VYXA 2L6MA 3EPKA 1XNQE 1Y4UA 4MYTA 4GKJI 2EMYA 4JI8I 2V8QB 3PRYA 5AE3A 4FWHA 3P1XA 4IZKA 4WSGA 4O24A 1ZXMA 2MDGA 1AAYA 2EM9A 1FWLA 1OYRA 3B8HA 4DR5I 1Y60A 1J26A 3KZYA 2JVAA 2LTSA 3ZKDA 4Z7YA 2V8PA 4X64I 2YTNA 4OOGC 4F2JC 2N3HA 3F6HA 3HTXA 3GLLA 3ZZTA 4B3ME 1R6MA 4MLVA 2EMZA 1KTVA 2ZITA 4WXDA 4DPTA 2YTFA 1Y6ZA 4FK5C 3HPZA 4QNJA 2Q8UA 4LF8E 4LFBI 5FLXC 2O3ZA 4X64E 3M85G 2EPOA 5LMUI 2NN6C 1X48A 2FV4B 1YH8A 2EM5A 3GCMA 2V86A 2LT7A 4IS1C 4NXMI 1USUA 2L92A 4DV7I 3C4BA 2EPLX 3HQ1A 1QZRA 3ADIA 1BBOA 4Q28A 4B3SI 2LRSA 1UBDC 2XEXA 4DR7I 4B3TI 5C0XB 1YYWA 5LMUE 4R2QA 4UT4A 2VE7C 4DPWA 1A1LA 2PRTA 4LF4I 2VESA 3IWBA 2BA0G 2R1FA 5EKWA 4JI7E 1J5EE 4JI2E 1MG7A 3HULA 2EMCA 2YTIA 4DV2E 3MSWA 4BBYA 4DV7E 4JI6I 4I8OA 4DR7E 4B3TE 2YSPA 1FNMA 2CTDA 3M99B 4P7AA 5IXMB 4ZYDA 2NN6A 3WU4A 4F9CB 4R03A 4LCFA 4JI0E 2NN6F 4J8ZA 2WZOA 2WBUA 3J80Q 1XMQI 4LF7I 5A6BA 4L8NA 1DARA 5JEAB 1R6LA 3EPLA 4BC7A 4N4RB 4R2CA 2AE8A 2C37B 1EA6A 4BA1B 1HNXI 1T39A 4OX9I 3M7ND 1H7SA 4IFDB 1UDNA 2FGGA 5KL4A 3OMLA 2UU9I 3K17A 3L7ZB 2C39B 1PIEA 4ISAA 4MU3A 4DU7A 2GLIA 1P47A 2Z5CA 1TN9A 2L3CA 3ADGA 2KONA 5C0XD 4ED4A 4JI5I 2BBGA 1T38A 2NA2A 2CPNA 2HKJA 1Z0BA 2IERA 2M1SA 5A6KA 2GS8A 4DPYA 3LNUA 4IS9A 2UXBI 2BR2B 3ZZ0A 4KHPI 5LLQA 1YFHA 2E72A 4DV5E 1A1FA 4TUGA 2GQ0A 1BB8A 2ZBKB 4LCGA 1N32E 2PNLA 1LLMC 3HJCA 2YWQA 2EMIA 2ODRD 4WUBA 3MHSC 4P52A 5EL9A 5KL6A 3LTOA 1WHNA 3K1JA 1P42A 1MGTA 4M0VA 4AIMA 4RH8A 1UHZA 4JV5I 2O1TA 3JAMC 2EWLA 2EJ4A 4Q35B 1X49A 2JOBA 1N33E 4HEIA 4R2EA 4Z7CA 4IFDD 2YTPA 4DR3E 4FW6A 3PYDA 2EMLA 3QG5C 4K0KI 1PJTA 1VI7A 2JP9A 4JV5E 4MLQA 1ZM3A 2LJUA 2C38A 3T1YE 1IBME 1SR9A 5DRPA 2HK3A 1Z5BA 3WU6A 4IFDE 1RQ0A 2LCEA 5DNYA 4URLA 2CG9A 3J7Yp 2BM0A 3AUZA 4K0KE 1N36E 3LLHA 5KL2A 1Z5AA 3T1HI 3OTOE 2F4VI 4LFAE 5DRRA 2V85A 4KZSA 1Z1BA 3QT7A 1Z0EA 1XNRE 2EOMA 1HNWI 1FKAE 2JT2A 1UDQA 4OO1C 1UN6B 1IQSA 3HXLA 5LMNE 2EMKA 2EOEA 2EPNA 4PU9A 4NXNI 1FWKA 4LF9I 1BKNA 4DV3I 2ZM6E 2O1UA 3PS2A 3THOB 4LFCE 2HKEA 4DR2E 4PRVA 2EM4A 1HNWE 1Z0WA 1Z0CA 4HXZA 4BA2A 4ZYEA 2CT1A 2CSHA 2EMAA 2HC5A 3J7AG 2V2ZA 4NXNE 1ZM9A 1Z0TA 2DEJA 1YHCA 1H7UA 5L3JA 2WNRA 5K36A 5A2QC 3CDJA 4R2SA 4OO1A 4DV1E 3QT5A 5DROA 4OO1F 2E5LE 2DIXA 4DR1I 4B3MI 2EN6A 3NZKA 2EMBA 1USVA 2EM0A 2ENCA 2YTDA 4JG4A 2LUPB 4ZYGA 2JY9A 3BGHA 3ADLA 1OYPA 2A2CA 1KVKA 1UEKA 2Z5CB 4LF8I 2EL4A 2RPCA 2EPAA 3C6MA 4DR1E 4GEQB 1ZBTA 3VHTB 2JYAA 2D9HA 1YSAC 4DMIA 2RTXA 1EI1A 2EMHA 4BHBA 1D6TA 4NBQA 2H36X 1SFEA 4YY3E 3CWVA 3UHMA 3WU5A 3F0NA 3P76A 2V87A 3KRNA 1EH8A 3D4JA 1O0WA 2EMXA 3JU0A 1A6FA 2G7HA 1PVGA 4JI7I 1NCSA 1J5EI 5A6BD 4JI2I 2DB2A 1B63A 2EMFA 4DV2I 1DI2A 1T4LB 2EQ0A 2I9IA 4AIDA 1T4OA 2NUGA 2L2MA 5IV8B 1DQ3A 4BC9A 4JI0I 3BIDA 2GO3A 2X7IA 2BM1A 4X8WA 4EMDA 2BA1G 2M4IA 2UUAE 4P7DA 1B62A 2V34A 2EL5A 5TSEA 1WUUA 2RSIA 2K4VA 2JEBA 2B7VA 1S4EA 2RS6A 2GPIA 4P78A 1X5WA 2L2KB 5A69A 4IJDA 4DR4E 1E3HA 2C38B 3V2UC 5KL7A 2ADRA 2IOQA 1HR0I 3M6AA 5A6AA 1HNZE 1PDAA 1QNTA 1FI4A 2YZTA 2PO1A 4U3DA 5FWKA 2DLKA 3DJWA 2HFUA 4DUZE 2DRPA 2J7JA 2LTRA 3KZZA 1A1HA 1HR0E 3EPJA 3TQMA 4M30A 1FJGE 1G2FC 2ENAA 2ELYA 4DV5I 1EH7A 3DF6A 4GZNC 2EPCA 1YUJA 2MKDA 3PYGA 1N32I 4YHHI 2RQLA 4PRXA 5T6JA 4BA2B 2EQ3A 2K7IA 2B7TA 4DUYE 1WXRA 2EOSA 2PNMA 5KL5A 2EOXA 4JYAE 2JPAA 3WU3A 4NHRA 3VK6A 2LV2A 2WNRB 5C0XE 1NHHA 5K36B 2YRMA 4YHHE 3B78A 3P3EA 2VQEE 1T4NA 4GKKE 1UDOA 2CZ9A 3J7AM 3Q1QA 3HPSA 2VQFE 2R3VA 4OO1B 4F54A 1N33I 4DR3I 5JEAD 2EOOA 2EE8A 1EKZA 4IZKB 2EN7A 1OYSA 4MU4A 4X62I 4DV0E 1RMDA 2KOUA 5C0XC 4MU1A 5KL3A 2MC6A 1GQEA 2PNZA 4RPFA 3T1YI 2EPXA 1IBMI 1RR9A 2HFSA 4UTGA 2MKNA 1X6EA 1H73A 4X62E 2HK2A 1N0UA 5JEAE 2UXDI 1N36I 3F6GA 4U3BA 3OTOI 4LFAI 2O1WA 2UXCE 2EN2A 1ZXNA 2NABA 2F1DA 2YTOA 2ODRC 2UUCI 1XNRI 4O5GA 2LUQA 3C6KA 2HJJA 5LMNI 4LF6E 1WRJA 4JI4I 5JEAC 2UXDE 2EZ6A 1WJPA 1QU6A 2EN8A 1ZU1A 2ZM6I 5K36D 2DEIA 2NUFA 4JI1I 4FW7A 3ZM7A 1I94I 2FTXB 4X66E 2E1RA 2JE6A 2LMZA 4TUIA 2UUCE 4LFCI 4J3DA 4DR2I 3M7NG 4IFDC 2LVHA 2I13A 2DLQA 2VRDA 5ADZA 5IWAE 4JI4E 2EOZA 2O1VA 5F3WA 1Z0VA 1N0VC 1XXEA 3U1YA 3J81Q 4BHCA 3RMPA 4X9JA 4FW5A 1XMOI 5AC5A 4JI1E 5K36E 1I94E 4XTJA 2JEBB 3ZZUA 2JWOA 1NHIA 4R2PA 3FIGA 2J7KA 1IMUA 3M85D 4DV1I 1KYQA 5LL6R 1NHJA 4B3RI 2NN6B 4ZVIA 2E5LI 1DGCA 2M7QA 3ADJA 2EPRA 3THNA 1RC7A 1A1JA 3BF2A 3B82A 3ZOQB 2EPMX 4LTYA 3HKMA 4AM3A 2DMYA 2A2DA 2A25A 2PO1B 2PO2A 4F6MA 4B3RE 1UILA 1NEIA 2YPNA 1OJ4A 1A1IA 2C39A 3JAMQ 2AJ4A 2BA0D 4R2DA 1IBKE 4AQYI 4YY3I 3GMEA 3LPSA 2YU8A 2EM7A 1VISA 3Q6MA 2RS7A 2V2VA 2EQ1A 2JR1A 2LJHA 2NUEA 5A6JA 1A1KA 2V83A 2N8XA 2YTQA 2LBSB 5IT9Q 4IZJA 4GQUA 1KKHA 2X36A 4AQYE 2IHR1 4LF5E 1Y5YA 1H72C 3J80C 3L00A 4DPUA 4HY1A 4BCAA 2NN6D 4DR6I 2WP8B 2B9DA 2EM8A 4QNKA 3K6QA 2UUAI 1Z5CA 1H74A 2L2NA 3MHHC 4O4KA 1ELOA 1Y4SA 2EM3A 2Z5EA 5DNLA 3H09A 5BR8E 2YT4A 4R8OA 4GKJE 3P06A 4DR4I 5AE2A 4JI8E 4R1FA 4DR6E 2NN6E 2PNZB 4JI3I 2JEAA 5AC4A 3P3GA 1UDSA 4LPFA 3UK3C 4WXCA 5GMEA 1U2RA 4WX9A 4DR5E 4DPXA 1HNZI 2UUBI 3ECRA 1YZ9A 2LJPA 2LE2A 3EPHA 4JI3E 4WUDA 4DUZI 2EPZA 2EFGA 2JXPA 4BMJA 1STUA 3JTZA 4BA1A 4KWYA 4BS9A 5A2QQ 2DMIA 2WW4A 1FJGI 2UUBE 4HACA 1B69A 2LO3A 5DRQA 2EOQA 4LFBE 3V5RA 3P3CA 4USMA 2EOYA 1KIJA 2Z5BA 3U1KA 2YRKA 2JE6B 2MC5A 1ZAAC 4FWGA 2HHHI 5CFFE 4DUYI 4NXME 4NZVA 1HK7A 2PO0A 1IQOA 2WP8A 2F8BA 4JYAI 2L8TA 2BV3A 1N34I 4B3SE 1TF3A 4ZYHA 2EMWA 2JOXA 1ZM4A 3PS1A 2YRHA 3BBGA 2WBSA 2VQEI 4M1KA 4GKKI 4RHBB 4LF4E 2WBTA 2HHHE 1WHQA 1MU5A 4MU0A 1YYOA 4WUCA 2VQFI 2B3TB 2IOPA 2VF3A 2EN1A 4O43A 2GO4A 5FLXQ 4JI6E 3DD6A 2YTJA 1N34E 2YSOA 2ENHA 1A1GA 1MEYC 4DV0I 4KQVA 2EPPA 4DV6I 1XMOE 1NZ0A 3PYFA 1PJSA 2HGHA 2Q2EB 2PO2B 2KHXA 2V89A 1AH5A 2EOFA 2YU5A 1XMQE 4LF7E 3PYEA 3QT6A 1JK1A 5ELWA 2VF1A 3QT8A 2L33A 2MDRA 4N3OA 1IBLI 4DV6E 3J81C 1HNXE 2DSYA 4OX9E 2UXCI 3ZKBA 3PS3A 3GONA 2EL6A 2YTGA 2UU9E 4WSPA 4OZEA 4LF6I 1X6HA 5AE1A 4MQYA 4IZJB 2EP3A 2EORA
chains in the Genus database with same CATH topology
4JI5E 3IWDA 1IBLE 1MX0A 4X66I 4L5NC 4WFTA 2RSMA 2N3GA 3H4LA 1X47A 2UXBE 3IWCA 5IWAI 4KHPE 2E1MA 1RREA 1ZBQA 2L3JA 2R42A 2OI2A 5AASA 3K85A 3Q6NA 4WYQB 4FW9A 1Z0GA 4DV4I 1ZM2A 4M2ZA 5IT9C 3KWRA 1Z59A 4DXLA 1YYKA 3C4TA 4FWDA 4HYMA 1GZ6A 4IZJD 5GMDA 4FN5A 1S16A 4DV4E 2NPFA 1IBKI 4HACB 2Z5BB 1PKPA 4F9AB 4USKA 4X65I 4DU8A 3T1HE 2CGEA 2F4VE 1XHKA 4F9BB 4LF5I 4MYUA 1XNQI 2V88A 3LMLA 3VYYA 4WPYA 4I3HA 4DKKA 4LF9E 1K47A 4X65E 4DV3E 4LU9A 2V2QA 3AV0A 5BR8I 3VYXA 2L6MA 1XNQE 1Y4UA 4MYTA 4GKJI 4JI8I 2V8QB 3PRYA 5AE3A 4FWHA 3P1XA 4IZKA 1ZXMA 1FWLA 3B8HA 4DR5I 1J26A 2JVAA 2LTSA 3ZKDA 4Z7YA 2V8PA 4X64I 3HTXA 4OOGC 2N3HA 3F6HA 3ZZTA 4B3ME 1KTVA 2ZITA 4DPTA 1Y6ZA 3HPZA 4LF8E 4LFBI 5FLXC 4X64E 5LMUI 1X48A 2FV4B 2V86A 4NXMI 1USUA 2L92A 4DV7I 3C4BA 3HQ1A 1QZRA 3ADIA 4B3SI 4Q28A 4DR7I 2LRSA 2XEXA 4B3TI 1YYWA 5LMUE 4UT4A 2VE7C 4DPWA 4LF4I 3IWBA 4JI7E 1J5EE 4JI2E 1MG7A 3HULA 4DV7E 4DV2E 3MSWA 4BBYA 4JI6I 4I8OA 4DR7E 4B3TE 1FNMA 4P7AA 1XMOI 3WU4A 4F9CB 4R03A 4JI0E 4J8ZA 2WZOA 3J80Q 1XMQI 4LF7I 4L8NA 1DARA 4BC7A 1EA6A 1HNXI 4OX9I 1H7SA 2FGGA 3OMLA 2UU9I 3K17A 1PIEA 4DU7A 2Z5CA 2L3CA 3ADGA 2KONA 4JI5I 4ED4A 2NA2A 2CPNA 2HKJA 1Z0BA 2M1SA 2GS8A 4DPYA 3LNUA 2UXBI 3ZZ0A 4KHPI 4DV5E 2GQ0A 4TUGA 2ZBKB 1N32E 2PNLA 3HJCA 2ODRD 4WUBA 4P52A 3LTOA 1WHNA 3K1JA 4M0VA 1UHZA 4JV5I 2O1TA 3JAMC 2EWLA 1X49A 2JOBA 1N33E 4Z7CA 4DR3E 3PYDA 4K0KI 4JV5E 1ZM3A 3T1YE 1IBME 1SR9A 2HK3A 1Z5BA 3WU6A 1RQ0A 5DNYA 4URLA 2CG9A 3J7Yp 2BM0A 3AUZA 4K0KE 1N36E 3LLHA 3T1HI 1Z5AA 3OTOE 2F4VI 4LFAE 2V85A 4KZSA 3QT7A 1Z0EA 1XNRE 1HNWI 1FKAE 3HXLA 5LMNE 4LF9I 4PU9A 4NXNI 1FWKA 1BKNA 4DV3I 2ZM6E 2O1UA 4LFCE 2HKEA 4DR2E 4PRVA 1HNWE 1Z0WA 1Z0CA 4HXZA 2V2ZA 3J7AG 4NXNE 1ZM9A 1Z0TA 2DEJA 1H7UA 5L3JA 5A2QC 4DV1E 3QT5A 2E5LE 2DIXA 4DR1I 4B3MI 1USVA 4JG4A 2LUPB 3ADLA 2JY9A 2A2CA 1KVKA 1UEKA 2Z5CB 4LF8I 4DR1E 4GEQB 1ZBTA 4DMIA 2RTXA 1EI1A 1D6TA 2H36X 4YY3E 3CWVA 3WU5A 3F0NA 2V87A 3D4JA 1O0WA 1A6FA 3JU0A 2G7HA 1PVGA 4JI7I 1J5EI 4JI2I 2DB2A 1B63A 4DV2I 1DI2A 1T4LB 1T4OA 2NUGA 2L2MA 1DQ3A 4BC9A 4JI0I 2X7IA 2BM1A 4X8WA 4EMDA 2M4IA 2UUAE 4P7DA 1B62A 2V34A 1WUUA 2K4VA 2B7VA 1S4EA 2RS6A 4DR4E 4P78A 2L2KB 3V2UC 2IOQA 1HR0I 3M6AA 1HNZE 1FI4A 2YZTA 5FWKA 3DJWA 2HFUA 4DUZE 2LTRA 1HR0E 4M30A 1FJGE 4DV5I 3DF6A 3PYGA 1N32I 4YHHI 4PRXA 5T6JA 2B7TA 4DUYE 1WXRA 2PNMA 4JYAE 3WU3A 3VK6A 1NHHA 4YHHE 3B78A 2VQEE 1T4NA 4GKKE 2CZ9A 3J7AM 3Q1QA 1N33I 3HPSA 2VQFE 2R3VA 4F54A 4DR3I 1EKZA 4IZKB 4X62I 4DV0E 2KOUA 2MC6A 1GQEA 3T1YI 4RPFA 1IBMI 1RR9A 2HFSA 4UTGA 1H73A 4X62E 2HK2A 1N0UA 2UXDI 1N36I 3F6GA 3OTOI 4LFAI 2O1WA 2UXCE 1ZXNA 2UUCI 2ODRC 1XNRI 2LUQA 5LMNI 4LF6E 4JI4I 2UXDE 2EZ6A 1QU6A 2ZM6I 2DEIA 2NUFA 4JI1I 3ZM7A 1I94I 2FTXB 4X66E 2E1RA 4LFCI 2LMZA 4TUIA 2UUCE 4DR2I 5IWAE 5ADZA 4JI4E 2O1VA 3J81Q 5F3WA 1Z0VA 1N0VC 3RMPA 4JI1E 1I94E 4XTJA 3ZZUA 2JWOA 1NHIA 2J7KA 3FIGA 4DV1I 5LL6R 1NHJA 4B3RI 4ZVIA 2E5LI 2M7QA 3ADJA 1RC7A 3B82A 3ZOQB 4LTYA 2DMYA 2A2DA 4B3RE 1UILA 1OJ4A 3JAMQ 2AJ4A 1IBKE 4AQYI 4YY3I 3LPSA 1VISA 3Q6MA 2RS7A 2V2VA 2LJHA 2JR1A 2NUEA 2V83A 5IT9Q 2LBSB 4IZJA 1KKHA 2X36A 4AQYE 2IHR1 4LF5E 1H72C 3J80C 4DPUA 4HY1A 4BCAA 4DR6I 2B9DA 3K6QA 2UUAI 1Z5CA 1H74A 2L2NA 1Y4SA 1ELOA 2Z5EA 3H09A 5BR8E 2YT4A 4R8OA 4GKJE 3P06A 4DR4I 5AE2A 4JI8E 4R1FA 4DR6E 4JI3I 5GMEA 1U2RA 4DR5E 4DPXA 2UUBI 1HNZI 1YZ9A 2LJPA 2LE2A 4JI3E 4WUDA 4DUZI 2EFGA 4BMJA 1STUA 3JTZA 4BS9A 5A2QQ 2WW4A 1FJGI 2UUBE 4HACA 3V5RA 4LFBE 4USMA 1KIJA 2Z5BA 4FWGA 2MC5A 2HHHI 5CFFE 4DUYI 4NXME 1HK7A 2F8BA 4JYAI 2L8TA 2BV3A 1N34I 4B3SE 2JOXA 1ZM4A 2VQEI 4M1KA 4GKKI 4LF4E 1MU5A 2HHHE 1WHQA 2VQFI 1YYOA 4WUCA 2B3TB 2IOPA 2VF3A 5FLXQ 4JI6E 1N34E 4DV0I 4KQVA 4DV6I 1XMOE 1NZ0A 3PYFA 2Q2EB 2KHXA 2V89A 1XMQE 4LF7E 3PYEA 3QT6A 2VF1A 3QT8A 2L33A 2MDRA 4N3OA 1IBLI 4DV6E 3J81C 1HNXE 2DSYA 4OX9E 2UXCI 3ZKBA 3GONA 2UU9E 4WSPA 4LF6I 5AE1A 4IZJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 E;  1IBL E;  1MX0 A;  4X66 I;  4WFT A;  2RSM A;  2N3G A;  3H4L A;  1X47 A;  2UXB E;  5IWA I;  4KHP E;  1RRE A;  2L3J A;  2R42 A;  2OI2 A;  4WYQ B;  4FW9 A;  1Z0G A;  4DV4 I;  1ZM2 A;  4M2Z A;  5IT9 C;  1Z59 A;  4DXL A;  1YYK A;  3C4T A;  4FWD A;  4HYM A;  5GMD A;  4FN5 A;  1S16 A;  4DV4 E;  2NPF A;  1IBK I;  4HAC B;  1PKP A;  4USK A;  4X65 I;  4DU8 A;  3T1H E;  2F4V E;  1XHK A;  4LF5 I;  4MYU A;  1XNQ I;  3VYY A;  4I3H A;  4DKK A;  4LF9 E;  1K47 A;  4X65 E;  4DV3 E;  2V2Q A;  5BR8 I;  3VYX A;  4MYT A;  1XNQ E;  4GKJ I;  4JI8 I;  4FWH A;  3P1X A;  1ZXM A;  1FWL A;  3B8H A;  4DR5 I;  1J26 A;  2JVA A;  2LTS A;  3ZKD A;  4Z7Y A;  2V8P A;  4X64 I;  3HTX A;  4OOG C;  2N3H A;  3ZZT A;  4B3M E;  1KTV A;  2ZIT A;  4DPT A;  4LF8 E;  4LFB I;  5FLX C;  4X64 E;  5LMU I;  1X48 A;  4NXM I;  4DV7 I;  3C4B A;  1QZR A;  3ADI A;  4B3S I;  4DR7 I;  2LRS A;  2XEX A;  4B3T I;  1YYW A;  5LMU E;  4UT4 A;  4DPW A;  4LF4 I;  4JI7 E;  1J5E E;  4JI2 E;  1MG7 A;  3HUL A;  4DV7 E;  4DV2 E;  4JI6 I;  4DR7 E;  4B3T E;  1FNM A;  4P7A A;  1XMO I;  3WU4 A;  4JI0 E;  3J80 Q;  1XMQ I;  4LF7 I;  1DAR A;  1EA6 A;  1HNX I;  4OX9 I;  1H7S A;  2UU9 I;  3K17 A;  1PIE A;  4DU7 A;  2L3C A;  3ADG A;  4JI5 I;  4ED4 A;  2NA2 A;  2CPN A;  2HKJ A;  1Z0B A;  2GS8 A;  4DPY A;  3LNU A;  2UXB I;  3ZZ0 A;  4KHP I;  4DV5 E;  2ZBK B;  1N32 E;  4WUB A;  4P52 A;  3LTO A;  1WHN A;  3K1J A;  1UHZ A;  4JV5 I;  3JAM C;  1X49 A;  1N33 E;  4Z7C A;  4DR3 E;  3PYD A;  4K0K I;  4JV5 E;  1ZM3 A;  3T1Y E;  1IBM E;  2HK3 A;  1Z5B A;  3WU6 A;  1RQ0 A;  4URL A;  3J7Y p;  2BM0 A;  4K0K E;  1N36 E;  3LLH A;  3T1H I;  1Z5A A;  3OTO E;  2F4V I;  4LFA E;  3QT7 A;  1Z0E A;  1XNR E;  1HNW I;  1FKA E;  5LMN E;  4LF9 I;  4PU9 A;  4NXN I;  1FWK A;  1BKN A;  4DV3 I;  2ZM6 E;  4LFC E;  2HKE A;  4DR2 E;  4PRV A;  1HNW E;  1Z0W A;  1Z0C A;  4HXZ A;  2V2Z A;  3J7A G;  4NXN E;  1ZM9 A;  1Z0T A;  2DEJ A;  1H7U A;  5L3J A;  5A2Q C;  4DV1 E;  3QT5 A;  2E5L E;  2DIX A;  4DR1 I;  4B3M I;  4JG4 A;  2LUP B;  3ADL A;  2JY9 A;  2A2C A;  1KVK A;  1UEK A;  4LF8 I;  4DR1 E;  1ZBT A;  2RTX A;  1EI1 A;  1D6T A;  4YY3 E;  3CWV A;  3WU5 A;  3F0N A;  3D4J A;  1O0W A;  1A6F A;  1PVG A;  4JI7 I;  1J5E I;  4JI2 I;  2DB2 A;  1B63 A;  4DV2 I;  1DI2 A;  1T4L B;  1T4O A;  2NUG A;  2L2M A;  4JI0 I;  2X7I A;  2BM1 A;  4X8W A;  4EMD A;  2UUA E;  1B62 A;  2V34 A;  1WUU A;  2B7V A;  1S4E A;  2RS6 A;  4DR4 E;  2L2K B;  3V2U C;  1HR0 I;  3M6A A;  1HNZ E;  1FI4 A;  2HFU A;  4DUZ E;  2LTR A;  1HR0 E;  4M30 A;  1FJG E;  4DV5 I;  3PYG A;  1N32 I;  4YHH I;  4PRX A;  2B7T A;  4DUY E;  4JYA E;  3WU3 A;  1NHH A;  4YHH E;  3B78 A;  2VQE E;  1T4N A;  4GKK E;  2CZ9 A;  3J7A M;  3Q1Q A;  1N33 I;  2R3V A;  2VQF E;  4DR3 I;  1EKZ A;  4X62 I;  4DV0 E;  1GQE A;  3T1Y I;  4RPF A;  1IBM I;  1RR9 A;  2HFS A;  4UTG A;  1H73 A;  4X62 E;  2HK2 A;  1N0U A;  2UXD I;  1N36 I;  3OTO I;  4LFA I;  2UXC E;  1ZXN A;  2UUC I;  1XNR I;  2LUQ A;  5LMN I;  4LF6 E;  4JI4 I;  2UXD E;  2EZ6 A;  1QU6 A;  2ZM6 I;  2DEI A;  2NUF A;  4JI1 I;  3ZM7 A;  1I94 I;  4X66 E;  2E1R A;  4LFC I;  2UUC E;  4DR2 I;  5IWA E;  4JI4 E;  3J81 Q;  1Z0V A;  1N0V C;  4JI1 E;  1I94 E;  4XTJ A;  3ZZU A;  2J7K A;  1NHI A;  4DV1 I;  5LL6 R;  1NHJ A;  4B3R I;  4ZVI A;  2E5L I;  3ADJ A;  1RC7 A;  3B82 A;  2DMY A;  2A2D A;  4B3R E;  1UIL A;  1OJ4 A;  3JAM Q;  2AJ4 A;  1IBK E;  4AQY I;  4YY3 I;  3LPS A;  1VIS A;  2RS7 A;  2V2V A;  2LJH A;  2NUE A;  5IT9 Q;  2LBS B;  1KKH A;  2X36 A;  4AQY E;  2IHR 1;  4LF5 E;  1H72 C;  3J80 C;  4DPU A;  4HY1 A;  4DR6 I;  2UUA I;  1Z5C A;  1H74 A;  2L2N A;  1ELO A;  5BR8 E;  2YT4 A;  4GKJ E;  4DR4 I;  4R1F A;  4JI8 E;  4DR6 E;  4JI3 I;  5GME A;  1U2R A;  4DR5 E;  4DPX A;  2UUB I;  1HNZ I;  1YZ9 A;  2LJP A;  4JI3 E;  4WUD A;  4DUZ I;  2EFG A;  1STU A;  5A2Q Q;  2WW4 A;  1FJG I;  4HAC A;  2UUB E;  3V5R A;  4LFB E;  4USM A;  1KIJ A;  4FWG A;  2HHH I;  5CFF E;  4DUY I;  4NXM E;  4JYA I;  1N34 I;  2BV3 A;  4B3S E;  1ZM4 A;  2VQE I;  4M1K A;  4GKK I;  4LF4 E;  1MU5 A;  2HHH E;  1WHQ A;  2VQF I;  1YYO A;  4WUC A;  2B3T B;  2VF3 A;  5FLX Q;  4JI6 E;  1N34 E;  4DV0 I;  4KQV A;  4DV6 I;  1XMO E;  1NZ0 A;  3PYF A;  2Q2E B;  2KHX A;  1XMQ E;  4LF7 E;  3PYE A;  3QT6 A;  3QT8 A;  2L33 A;  2MDR A;  1IBL I;  4DV6 E;  3J81 C;  1HNX E;  4OX9 E;  2UXC I;  3ZKB A;  3GON A;  2UU9 E;  4LF6 I; 
#chains in the Genus database with same CATH topology
 4JI5 E;  3IWD A;  1IBL E;  1MX0 A;  4X66 I;  4L5N C;  4WFT A;  2RSM A;  1RHY A;  2N3G A;  2EOI A;  3H4L A;  1X47 A;  2UXB E;  3IWC A;  5IWA I;  4KHP E;  2E1M A;  1RRE A;  4F6N A;  1ZBQ A;  2L3J A;  2R42 A;  2OI2 A;  5C0X A;  5AAS A;  1YUI A;  1EH6 A;  3K85 A;  5C0X F;  2DGC A;  3Q6N A;  4MDT A;  4OO1 D;  1KJK A;  4WYQ B;  2EN3 A;  2JEA B;  4FW9 A;  2GHF A;  1Z0G A;  5DNX A;  4DV4 I;  2J65 A;  1ZM2 A;  4M2Z A;  5IT9 C;  3KWR A;  4OKG A;  1Z59 A;  1N3G A;  4DXL A;  1YYK A;  4OO1 E;  3C4T A;  4R2R A;  4FWD A;  4HYM A;  5JEA A;  1GZ6 A;  2EM6 A;  4IZJ D;  2R76 A;  1G2D C;  4FN5 A;  5GMD A;  2BB8 A;  4DV4 E;  1S16 A;  2NPF A;  2EMG A;  5JEA F;  2C37 A;  1IBK I;  4HAC B;  4M9V C;  5K36 C;  2WCC 3;  1GTK A;  2ELZ A;  3EQ1 A;  4LCH A;  1BBG A;  2Z5B B;  4LOM A;  4IFD A;  1PKP A;  4F9A B;  4IFD F;  3H1C A;  4FW3 A;  1ZR9 A;  3L7Z A;  4USK A;  1JK2 A;  4X65 I;  4DU8 A;  2PO0 B;  3CDI A;  3T1H E;  2BA1 D;  2M9A A;  2CGE A;  2F4V E;  1E3P A;  1F2I G;  1XHK A;  2IES A;  1YPN A;  4F9B B;  4LF5 I;  4MYU A;  1XNQ I;  2V88 A;  4FW4 A;  3LML A;  1X6F A;  2EPU A;  1X3C A;  4WPY A;  3VYY A;  1L4S A;  2EOH A;  4DKK A;  2BR2 A;  4I3H A;  4LF9 E;  1K47 A;  4HTG A;  4X65 E;  4R2A A;  2EN4 A;  4DV3 E;  2EM2 A;  2EPK X;  1PJQ A;  2EOJ A;  4LU9 A;  2CVE A;  3B4T A;  5K36 F;  2V2Q A;  2YTE A;  3AV0 A;  5BR8 I;  1TF6 A;  3VYX A;  2L6M A;  3EPK A;  1XNQ E;  1Y4U A;  4MYT A;  4GKJ I;  2EMY A;  4JI8 I;  2V8Q B;  3PRY A;  5AE3 A;  4FWH A;  3P1X A;  4IZK A;  4WSG A;  4O24 A;  1ZXM A;  2MDG A;  1AAY A;  2EM9 A;  1FWL A;  1OYR A;  3B8H A;  4DR5 I;  1Y60 A;  1J26 A;  3KZY A;  2JVA A;  2LTS A;  3ZKD A;  4Z7Y A;  2V8P A;  4X64 I;  2YTN A;  4OOG C;  4F2J C;  2N3H A;  3F6H A;  3HTX A;  3GLL A;  3ZZT A;  4B3M E;  1R6M A;  4MLV A;  2EMZ A;  1KTV A;  2ZIT A;  4WXD A;  4DPT A;  2YTF A;  1Y6Z A;  4FK5 C;  3HPZ A;  4QNJ A;  2Q8U A;  4LF8 E;  4LFB I;  5FLX C;  2O3Z A;  4X64 E;  3M85 G;  2EPO A;  5LMU I;  2NN6 C;  1X48 A;  2FV4 B;  1YH8 A;  2EM5 A;  3GCM A;  2V86 A;  2LT7 A;  4IS1 C;  4NXM I;  1USU A;  2L92 A;  4DV7 I;  3C4B A;  2EPL X;  3HQ1 A;  1QZR A;  3ADI A;  1BBO A;  4Q28 A;  4B3S I;  2LRS A;  1UBD C;  2XEX A;  4DR7 I;  4B3T I;  5C0X B;  1YYW A;  5LMU E;  4R2Q A;  4UT4 A;  2VE7 C;  4DPW A;  1A1L A;  2PRT A;  4LF4 I;  2VES A;  3IWB A;  2BA0 G;  2R1F A;  5EKW A;  4JI7 E;  1J5E E;  4JI2 E;  1MG7 A;  3HUL A;  2EMC A;  2YTI A;  4DV2 E;  3MSW A;  4BBY A;  4DV7 E;  4JI6 I;  4I8O A;  4DR7 E;  4B3T E;  2YSP A;  1FNM A;  2CTD A;  3M99 B;  4P7A A;  5IXM B;  4ZYD A;  2NN6 A;  3WU4 A;  4F9C B;  4R03 A;  4LCF A;  4JI0 E;  2NN6 F;  4J8Z A;  2WZO A;  2WBU A;  3J80 Q;  1XMQ I;  4LF7 I;  5A6B A;  4L8N A;  1DAR A;  5JEA B;  1R6L A;  3EPL A;  4BC7 A;  4N4R B;  4R2C A;  2AE8 A;  2C37 B;  1EA6 A;  4BA1 B;  1HNX I;  1T39 A;  4OX9 I;  3M7N D;  1H7S A;  4IFD B;  1UDN A;  2FGG A;  5KL4 A;  3OML A;  2UU9 I;  3K17 A;  3L7Z B;  2C39 B;  1PIE A;  4ISA A;  4MU3 A;  4DU7 A;  2GLI A;  1P47 A;  2Z5C A;  1TN9 A;  2L3C A;  3ADG A;  2KON A;  5C0X D;  4ED4 A;  4JI5 I;  2BBG A;  1T38 A;  2NA2 A;  2CPN A;  2HKJ A;  1Z0B A;  2IER A;  2M1S A;  5A6K A;  2GS8 A;  4DPY A;  3LNU A;  4IS9 A;  2UXB I;  2BR2 B;  3ZZ0 A;  4KHP I;  5LLQ A;  1YFH A;  2E72 A;  4DV5 E;  1A1F A;  4TUG A;  2GQ0 A;  1BB8 A;  2ZBK B;  4LCG A;  1N32 E;  2PNL A;  1LLM C;  3HJC A;  2YWQ A;  2EMI A;  2ODR D;  4WUB A;  3MHS C;  4P52 A;  5EL9 A;  5KL6 A;  3LTO A;  1WHN A;  3K1J A;  1P42 A;  1MGT A;  4M0V A;  4AIM A;  4RH8 A;  1UHZ A;  4JV5 I;  2O1T A;  3JAM C;  2EWL A;  2EJ4 A;  4Q35 B;  1X49 A;  2JOB A;  1N33 E;  4HEI A;  4R2E A;  4Z7C A;  4IFD D;  2YTP A;  4DR3 E;  4FW6 A;  3PYD A;  2EML A;  3QG5 C;  4K0K I;  1PJT A;  1VI7 A;  2JP9 A;  4JV5 E;  4MLQ A;  1ZM3 A;  2LJU A;  2C38 A;  3T1Y E;  1IBM E;  1SR9 A;  5DRP A;  2HK3 A;  1Z5B A;  3WU6 A;  4IFD E;  1RQ0 A;  2LCE A;  5DNY A;  4URL A;  2CG9 A;  3J7Y p;  2BM0 A;  3AUZ A;  4K0K E;  1N36 E;  3LLH A;  5KL2 A;  1Z5A A;  3T1H I;  3OTO E;  2F4V I;  4LFA E;  5DRR A;  2V85 A;  4KZS A;  1Z1B A;  3QT7 A;  1Z0E A;  1XNR E;  2EOM A;  1HNW I;  1FKA E;  2JT2 A;  1UDQ A;  4OO1 C;  1UN6 B;  1IQS A;  3HXL A;  5LMN E;  2EMK A;  2EOE A;  2EPN A;  4PU9 A;  4NXN I;  1FWK A;  4LF9 I;  1BKN A;  4DV3 I;  2ZM6 E;  2O1U A;  3PS2 A;  3THO B;  4LFC E;  2HKE A;  4DR2 E;  4PRV A;  2EM4 A;  1HNW E;  1Z0W A;  1Z0C A;  4HXZ A;  4BA2 A;  4ZYE A;  2CT1 A;  2CSH A;  2EMA A;  2HC5 A;  3J7A G;  2V2Z A;  4NXN E;  1ZM9 A;  1Z0T A;  2DEJ A;  1YHC A;  1H7U A;  5L3J A;  2WNR A;  5K36 A;  5A2Q C;  3CDJ A;  4R2S A;  4OO1 A;  4DV1 E;  3QT5 A;  5DRO A;  4OO1 F;  2E5L E;  2DIX A;  4DR1 I;  4B3M I;  2EN6 A;  3NZK A;  2EMB A;  1USV A;  2EM0 A;  2ENC A;  2YTD A;  4JG4 A;  2LUP B;  4ZYG A;  2JY9 A;  3BGH A;  3ADL A;  1OYP A;  2A2C A;  1KVK A;  1UEK A;  2Z5C B;  4LF8 I;  2EL4 A;  2RPC A;  2EPA A;  3C6M A;  4DR1 E;  4GEQ B;  1ZBT A;  3VHT B;  2JYA A;  2D9H A;  1YSA C;  4DMI A;  2RTX A;  1EI1 A;  2EMH A;  4BHB A;  1D6T A;  4NBQ A;  2H36 X;  1SFE A;  4YY3 E;  3CWV A;  3UHM A;  3WU5 A;  3F0N A;  3P76 A;  2V87 A;  3KRN A;  1EH8 A;  3D4J A;  1O0W A;  2EMX A;  3JU0 A;  1A6F A;  2G7H A;  1PVG A;  4JI7 I;  1NCS A;  1J5E I;  5A6B D;  4JI2 I;  2DB2 A;  1B63 A;  2EMF A;  4DV2 I;  1DI2 A;  1T4L B;  2EQ0 A;  2I9I A;  4AID A;  1T4O A;  2NUG A;  2L2M A;  5IV8 B;  1DQ3 A;  4BC9 A;  4JI0 I;  3BID A;  2GO3 A;  2X7I A;  2BM1 A;  4X8W A;  4EMD A;  2BA1 G;  2M4I A;  2UUA E;  4P7D A;  1B62 A;  2V34 A;  2EL5 A;  5TSE A;  1WUU A;  2RSI A;  2K4V A;  2JEB A;  2B7V A;  1S4E A;  2RS6 A;  2GPI A;  4P78 A;  1X5W A;  2L2K B;  5A69 A;  4IJD A;  4DR4 E;  1E3H A;  2C38 B;  3V2U C;  5KL7 A;  2ADR A;  2IOQ A;  1HR0 I;  3M6A A;  5A6A A;  1HNZ E;  1PDA A;  1QNT A;  1FI4 A;  2YZT A;  2PO1 A;  4U3D A;  5FWK A;  2DLK A;  3DJW A;  2HFU A;  4DUZ E;  2DRP A;  2J7J A;  2LTR A;  3KZZ A;  1A1H A;  1HR0 E;  3EPJ A;  3TQM A;  4M30 A;  1FJG E;  1G2F C;  2ENA A;  2ELY A;  4DV5 I;  1EH7 A;  3DF6 A;  4GZN C;  2EPC A;  1YUJ A;  2MKD A;  3PYG A;  1N32 I;  4YHH I;  2RQL A;  4PRX A;  5T6J A;  4BA2 B;  2EQ3 A;  2K7I A;  2B7T A;  4DUY E;  1WXR A;  2EOS A;  2PNM A;  5KL5 A;  2EOX A;  4JYA E;  2JPA A;  3WU3 A;  4NHR A;  3VK6 A;  2LV2 A;  2WNR B;  5C0X E;  1NHH A;  5K36 B;  2YRM A;  4YHH E;  3B78 A;  3P3E A;  2VQE E;  1T4N A;  4GKK E;  1UDO A;  2CZ9 A;  3J7A M;  3Q1Q A;  3HPS A;  2VQF E;  2R3V A;  4OO1 B;  4F54 A;  1N33 I;  4DR3 I;  5JEA D;  2EOO A;  2EE8 A;  1EKZ A;  4IZK B;  2EN7 A;  1OYS A;  4MU4 A;  4X62 I;  4DV0 E;  1RMD A;  2KOU A;  5C0X C;  4MU1 A;  5KL3 A;  2MC6 A;  1GQE A;  2PNZ A;  4RPF A;  3T1Y I;  2EPX A;  1IBM I;  1RR9 A;  2HFS A;  4UTG A;  2MKN A;  1X6E A;  1H73 A;  4X62 E;  2HK2 A;  1N0U A;  5JEA E;  2UXD I;  1N36 I;  3F6G A;  4U3B A;  3OTO I;  4LFA I;  2O1W A;  2UXC E;  2EN2 A;  1ZXN A;  2NAB A;  2F1D A;  2YTO A;  2ODR C;  2UUC I;  1XNR I;  4O5G A;  2LUQ A;  3C6K A;  2HJJ A;  5LMN I;  4LF6 E;  1WRJ A;  4JI4 I;  5JEA C;  2UXD E;  2EZ6 A;  1WJP A;  1QU6 A;  2EN8 A;  1ZU1 A;  2ZM6 I;  5K36 D;  2DEI A;  2NUF A;  4JI1 I;  4FW7 A;  3ZM7 A;  1I94 I;  2FTX B;  4X66 E;  2E1R A;  2JE6 A;  2LMZ A;  4TUI A;  2UUC E;  4LFC I;  4J3D A;  4DR2 I;  3M7N G;  4IFD C;  2LVH A;  2I13 A;  2DLQ A;  2VRD A;  5ADZ A;  5IWA E;  4JI4 E;  2EOZ A;  2O1V A;  5F3W A;  1Z0V A;  1N0V C;  1XXE A;  3U1Y A;  3J81 Q;  4BHC A;  3RMP A;  4X9J A;  4FW5 A;  1XMO I;  5AC5 A;  4JI1 E;  5K36 E;  1I94 E;  4XTJ A;  2JEB B;  3ZZU A;  2JWO A;  1NHI A;  4R2P A;  3FIG A;  2J7K A;  1IMU A;  3M85 D;  4DV1 I;  1KYQ A;  5LL6 R;  1NHJ A;  4B3R I;  2NN6 B;  4ZVI A;  2E5L I;  1DGC A;  2M7Q A;  3ADJ A;  2EPR A;  3THN A;  1RC7 A;  1A1J A;  3BF2 A;  3B82 A;  3ZOQ B;  2EPM X;  4LTY A;  3HKM A;  4AM3 A;  2DMY A;  2A2D A;  2A25 A;  2PO1 B;  2PO2 A;  4F6M A;  4B3R E;  1UIL A;  1NEI A;  2YPN A;  1OJ4 A;  1A1I A;  2C39 A;  3JAM Q;  2AJ4 A;  2BA0 D;  4R2D A;  1IBK E;  4AQY I;  4YY3 I;  3GME A;  3LPS A;  2YU8 A;  2EM7 A;  1VIS A;  3Q6M A;  2RS7 A;  2V2V A;  2EQ1 A;  2JR1 A;  2LJH A;  2NUE A;  5A6J A;  1A1K A;  2V83 A;  2N8X A;  2YTQ A;  2LBS B;  5IT9 Q;  4IZJ A;  4GQU A;  1KKH A;  2X36 A;  4AQY E;  2IHR 1;  4LF5 E;  1Y5Y A;  1H72 C;  3J80 C;  3L00 A;  4DPU A;  4HY1 A;  4BCA A;  2NN6 D;  4DR6 I;  2WP8 B;  2B9D A;  2EM8 A;  4QNK A;  3K6Q A;  2UUA I;  1Z5C A;  1H74 A;  2L2N A;  3MHH C;  4O4K A;  1ELO A;  1Y4S A;  2EM3 A;  2Z5E A;  5DNL A;  3H09 A;  5BR8 E;  2YT4 A;  4R8O A;  4GKJ E;  3P06 A;  4DR4 I;  5AE2 A;  4JI8 E;  4R1F A;  4DR6 E;  2NN6 E;  2PNZ B;  4JI3 I;  2JEA A;  5AC4 A;  3P3G A;  1UDS A;  4LPF A;  3UK3 C;  4WXC A;  5GME A;  1U2R A;  4WX9 A;  4DR5 E;  4DPX A;  1HNZ I;  2UUB I;  3ECR A;  1YZ9 A;  2LJP A;  2LE2 A;  3EPH A;  4JI3 E;  4WUD A;  4DUZ I;  2EPZ A;  2EFG A;  2JXP A;  4BMJ A;  1STU A;  3JTZ A;  4BA1 A;  4KWY A;  4BS9 A;  5A2Q Q;  2DMI A;  2WW4 A;  1FJG I;  2UUB E;  4HAC A;  1B69 A;  2LO3 A;  5DRQ A;  2EOQ A;  4LFB E;  3V5R A;  3P3C A;  4USM A;  2EOY A;  1KIJ A;  2Z5B A;  3U1K A;  2YRK A;  2JE6 B;  2MC5 A;  1ZAA C;  4FWG A;  2HHH I;  5CFF E;  4DUY I;  4NXM E;  4NZV A;  1HK7 A;  2PO0 A;  1IQO A;  2WP8 A;  2F8B A;  4JYA I;  2L8T A;  2BV3 A;  1N34 I;  4B3S E;  1TF3 A;  4ZYH A;  2EMW A;  2JOX A;  1ZM4 A;  3PS1 A;  2YRH A;  3BBG A;  2WBS A;  2VQE I;  4M1K A;  4GKK I;  4RHB B;  4LF4 E;  2WBT A;  2HHH E;  1WHQ A;  1MU5 A;  4MU0 A;  1YYO A;  4WUC A;  2VQF I;  2B3T B;  2IOP A;  2VF3 A;  2EN1 A;  4O43 A;  2GO4 A;  5FLX Q;  4JI6 E;  3DD6 A;  2YTJ A;  1N34 E;  2YSO A;  2ENH A;  1A1G A;  1MEY C;  4DV0 I;  4KQV A;  2EPP A;  4DV6 I;  1XMO E;  1NZ0 A;  3PYF A;  1PJS A;  2HGH A;  2Q2E B;  2PO2 B;  2KHX A;  2V89 A;  1AH5 A;  2EOF A;  2YU5 A;  1XMQ E;  4LF7 E;  3PYE A;  3QT6 A;  1JK1 A;  5ELW A;  2VF1 A;  3QT8 A;  2L33 A;  2MDR A;  4N3O A;  1IBL I;  4DV6 E;  3J81 C;  1HNX E;  2DSY A;  4OX9 E;  2UXC I;  3ZKB A;  3PS3 A;  3GON A;  2EL6 A;  2YTG A;  2UU9 E;  4WSP A;  4OZE A;  4LF6 I;  1X6H A;  5AE1 A;  4MQY A;  4IZJ B;  2EP3 A;  2EOR A; 
#chains in the Genus database with same CATH homology
 4JI5 E;  3IWD A;  1IBL E;  1MX0 A;  4X66 I;  4L5N C;  4WFT A;  2RSM A;  2N3G A;  3H4L A;  1X47 A;  2UXB E;  3IWC A;  5IWA I;  4KHP E;  2E1M A;  1RRE A;  1ZBQ A;  2L3J A;  2R42 A;  2OI2 A;  5AAS A;  3K85 A;  3Q6N A;  4WYQ B;  4FW9 A;  1Z0G A;  4DV4 I;  1ZM2 A;  4M2Z A;  5IT9 C;  3KWR A;  1Z59 A;  4DXL A;  1YYK A;  3C4T A;  4FWD A;  4HYM A;  1GZ6 A;  4IZJ D;  5GMD A;  4FN5 A;  1S16 A;  4DV4 E;  2NPF A;  1IBK I;  4HAC B;  2Z5B B;  1PKP A;  4F9A B;  4USK A;  4X65 I;  4DU8 A;  3T1H E;  2CGE A;  2F4V E;  1XHK A;  4F9B B;  4LF5 I;  4MYU A;  1XNQ I;  2V88 A;  3LML A;  3VYY A;  4WPY A;  4I3H A;  4DKK A;  4LF9 E;  1K47 A;  4X65 E;  4DV3 E;  4LU9 A;  2V2Q A;  3AV0 A;  5BR8 I;  3VYX A;  2L6M A;  1XNQ E;  1Y4U A;  4MYT A;  4GKJ I;  4JI8 I;  2V8Q B;  3PRY A;  5AE3 A;  4FWH A;  3P1X A;  4IZK A;  1ZXM A;  1FWL A;  3B8H A;  4DR5 I;  1J26 A;  2JVA A;  2LTS A;  3ZKD A;  4Z7Y A;  2V8P A;  4X64 I;  3HTX A;  4OOG C;  2N3H A;  3F6H A;  3ZZT A;  4B3M E;  1KTV A;  2ZIT A;  4DPT A;  1Y6Z A;  3HPZ A;  4LF8 E;  4LFB I;  5FLX C;  4X64 E;  5LMU I;  1X48 A;  2FV4 B;  2V86 A;  4NXM I;  1USU A;  2L92 A;  4DV7 I;  3C4B A;  3HQ1 A;  1QZR A;  3ADI A;  4B3S I;  4Q28 A;  4DR7 I;  2LRS A;  2XEX A;  4B3T I;  1YYW A;  5LMU E;  4UT4 A;  2VE7 C;  4DPW A;  4LF4 I;  3IWB A;  4JI7 E;  1J5E E;  4JI2 E;  1MG7 A;  3HUL A;  4DV7 E;  4DV2 E;  3MSW A;  4BBY A;  4JI6 I;  4I8O A;  4DR7 E;  4B3T E;  1FNM A;  4P7A A;  1XMO I;  3WU4 A;  4F9C B;  4R03 A;  4JI0 E;  4J8Z A;  2WZO A;  3J80 Q;  1XMQ I;  4LF7 I;  4L8N A;  1DAR A;  4BC7 A;  1EA6 A;  1HNX I;  4OX9 I;  1H7S A;  2FGG A;  3OML A;  2UU9 I;  3K17 A;  1PIE A;  4DU7 A;  2Z5C A;  2L3C A;  3ADG A;  2KON A;  4JI5 I;  4ED4 A;  2NA2 A;  2CPN A;  2HKJ A;  1Z0B A;  2M1S A;  2GS8 A;  4DPY A;  3LNU A;  2UXB I;  3ZZ0 A;  4KHP I;  4DV5 E;  2GQ0 A;  4TUG A;  2ZBK B;  1N32 E;  2PNL A;  3HJC A;  2ODR D;  4WUB A;  4P52 A;  3LTO A;  1WHN A;  3K1J A;  4M0V A;  1UHZ A;  4JV5 I;  2O1T A;  3JAM C;  2EWL A;  1X49 A;  2JOB A;  1N33 E;  4Z7C A;  4DR3 E;  3PYD A;  4K0K I;  4JV5 E;  1ZM3 A;  3T1Y E;  1IBM E;  1SR9 A;  2HK3 A;  1Z5B A;  3WU6 A;  1RQ0 A;  5DNY A;  4URL A;  2CG9 A;  3J7Y p;  2BM0 A;  3AUZ A;  4K0K E;  1N36 E;  3LLH A;  3T1H I;  1Z5A A;  3OTO E;  2F4V I;  4LFA E;  2V85 A;  4KZS A;  3QT7 A;  1Z0E A;  1XNR E;  1HNW I;  1FKA E;  3HXL A;  5LMN E;  4LF9 I;  4PU9 A;  4NXN I;  1FWK A;  1BKN A;  4DV3 I;  2ZM6 E;  2O1U A;  4LFC E;  2HKE A;  4DR2 E;  4PRV A;  1HNW E;  1Z0W A;  1Z0C A;  4HXZ A;  2V2Z A;  3J7A G;  4NXN E;  1ZM9 A;  1Z0T A;  2DEJ A;  1H7U A;  5L3J A;  5A2Q C;  4DV1 E;  3QT5 A;  2E5L E;  2DIX A;  4DR1 I;  4B3M I;  1USV A;  4JG4 A;  2LUP B;  3ADL A;  2JY9 A;  2A2C A;  1KVK A;  1UEK A;  2Z5C B;  4LF8 I;  4DR1 E;  4GEQ B;  1ZBT A;  4DMI A;  2RTX A;  1EI1 A;  1D6T A;  2H36 X;  4YY3 E;  3CWV A;  3WU5 A;  3F0N A;  2V87 A;  3D4J A;  1O0W A;  1A6F A;  3JU0 A;  2G7H A;  1PVG A;  4JI7 I;  1J5E I;  4JI2 I;  2DB2 A;  1B63 A;  4DV2 I;  1DI2 A;  1T4L B;  1T4O A;  2NUG A;  2L2M A;  1DQ3 A;  4BC9 A;  4JI0 I;  2X7I A;  2BM1 A;  4X8W A;  4EMD A;  2M4I A;  2UUA E;  4P7D A;  1B62 A;  2V34 A;  1WUU A;  2K4V A;  2B7V A;  1S4E A;  2RS6 A;  4DR4 E;  4P78 A;  2L2K B;  3V2U C;  2IOQ A;  1HR0 I;  3M6A A;  1HNZ E;  1FI4 A;  2YZT A;  5FWK A;  3DJW A;  2HFU A;  4DUZ E;  2LTR A;  1HR0 E;  4M30 A;  1FJG E;  4DV5 I;  3DF6 A;  3PYG A;  1N32 I;  4YHH I;  4PRX A;  5T6J A;  2B7T A;  4DUY E;  1WXR A;  2PNM A;  4JYA E;  3WU3 A;  3VK6 A;  1NHH A;  4YHH E;  3B78 A;  2VQE E;  1T4N A;  4GKK E;  2CZ9 A;  3J7A M;  3Q1Q A;  1N33 I;  3HPS A;  2VQF E;  2R3V A;  4F54 A;  4DR3 I;  1EKZ A;  4IZK B;  4X62 I;  4DV0 E;  2KOU A;  2MC6 A;  1GQE A;  3T1Y I;  4RPF A;  1IBM I;  1RR9 A;  2HFS A;  4UTG A;  1H73 A;  4X62 E;  2HK2 A;  1N0U A;  2UXD I;  1N36 I;  3F6G A;  3OTO I;  4LFA I;  2O1W A;  2UXC E;  1ZXN A;  2UUC I;  2ODR C;  1XNR I;  2LUQ A;  5LMN I;  4LF6 E;  4JI4 I;  2UXD E;  2EZ6 A;  1QU6 A;  2ZM6 I;  2DEI A;  2NUF A;  4JI1 I;  3ZM7 A;  1I94 I;  2FTX B;  4X66 E;  2E1R A;  4LFC I;  2LMZ A;  4TUI A;  2UUC E;  4DR2 I;  5IWA E;  5ADZ A;  4JI4 E;  2O1V A;  3J81 Q;  5F3W A;  1Z0V A;  1N0V C;  3RMP A;  4JI1 E;  1I94 E;  4XTJ A;  3ZZU A;  2JWO A;  1NHI A;  2J7K A;  3FIG A;  4DV1 I;  5LL6 R;  1NHJ A;  4B3R I;  4ZVI A;  2E5L I;  2M7Q A;  3ADJ A;  1RC7 A;  3B82 A;  3ZOQ B;  4LTY A;  2DMY A;  2A2D A;  4B3R E;  1UIL A;  1OJ4 A;  3JAM Q;  2AJ4 A;  1IBK E;  4AQY I;  4YY3 I;  3LPS A;  1VIS A;  3Q6M A;  2RS7 A;  2V2V A;  2LJH A;  2JR1 A;  2NUE A;  2V83 A;  5IT9 Q;  2LBS B;  4IZJ A;  1KKH A;  2X36 A;  4AQY E;  2IHR 1;  4LF5 E;  1H72 C;  3J80 C;  4DPU A;  4HY1 A;  4BCA A;  4DR6 I;  2B9D A;  3K6Q A;  2UUA I;  1Z5C A;  1H74 A;  2L2N A;  1Y4S A;  1ELO A;  2Z5E A;  3H09 A;  5BR8 E;  2YT4 A;  4R8O A;  4GKJ E;  3P06 A;  4DR4 I;  5AE2 A;  4JI8 E;  4R1F A;  4DR6 E;  4JI3 I;  5GME A;  1U2R A;  4DR5 E;  4DPX A;  2UUB I;  1HNZ I;  1YZ9 A;  2LJP A;  2LE2 A;  4JI3 E;  4WUD A;  4DUZ I;  2EFG A;  4BMJ A;  1STU A;  3JTZ A;  4BS9 A;  5A2Q Q;  2WW4 A;  1FJG I;  2UUB E;  4HAC A;  3V5R A;  4LFB E;  4USM A;  1KIJ A;  2Z5B A;  4FWG A;  2MC5 A;  2HHH I;  5CFF E;  4DUY I;  4NXM E;  1HK7 A;  2F8B A;  4JYA I;  2L8T A;  2BV3 A;  1N34 I;  4B3S E;  2JOX A;  1ZM4 A;  2VQE I;  4M1K A;  4GKK I;  4LF4 E;  1MU5 A;  2HHH E;  1WHQ A;  2VQF I;  1YYO A;  4WUC A;  2B3T B;  2IOP A;  2VF3 A;  5FLX Q;  4JI6 E;  1N34 E;  4DV0 I;  4KQV A;  4DV6 I;  1XMO E;  1NZ0 A;  3PYF A;  2Q2E B;  2KHX A;  2V89 A;  1XMQ E;  4LF7 E;  3PYE A;  3QT6 A;  2VF1 A;  3QT8 A;  2L33 A;  2MDR A;  4N3O A;  1IBL I;  4DV6 E;  3J81 C;  1HNX E;  2DSY A;  4OX9 E;  2UXC I;  3ZKB A;  3GON A;  2UU9 E;  4WSP A;  4LF6 I;  5AE1 A;  4IZJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...