2UXDE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxdE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdE02
3T1YE 1H73A 2L33A 2V8PA 2LRSA 1Z5CA 2HK3A 2R3VA 3D4JA 4YHHE 1ZM2A 1Z0EA 4JI2I 2LTSA 3WU4A 4X64I 3T1HI 3CWVA 4B3TI 4JI5I 2B7VA 4UT4A 1HR0E 4LF5I 2UXDI 3QT8A 4X66E 2L2MA 3HTXA 5BR8I 1B63A 1N0VC 4ZVIA 4DR6I 2B3TB 5A2QQ 4X62I 3P1XA 1ZM4A 1NHHA 3ZKBA 2L3JA 1UILA 5IWAI 2LJPA 1B62A 3ADIA 3K1JA 1N36I 4JI6I 4Z7CA 4JI7E 5CFFE 4DUYE 4YY3I 1I94I 4P52A 2E5LI 4USKA 2EFGA 3B78A 2L2NA 1HNXI 2L3CA 3PYEA 4JI4I 2Q2EB 4OOGC 2MDRA 1PKPA 1RQ0A 3V5RA 4X65E 2BM1A 4JI0E 1N34I 4DR2I 3OTOE 4DV6I 2UUAE 2VQEE 2N3HA 2RS7A 1EA6A 3WU5A 2L2KB 4JYAI 1DARA 5LMNE 4B3ME 4JV5E 1RC7A 2KHXA 4URLA 4DU8A 4LF7E 1YYWA 4LFAE 1ZM9A 1PIEA 1X47A 3LLHA 4JI3I 1IBME 4HYMA 2HFSA 3B8HA 2UXBI 1IBKI 3PYGA 1J26A 1N32E 2BV3A 1J5EI 3J7AM 4JI8I 2ZBKB 1XNQI 4MYTA 4DV0I 4Z7YA 4B3SI 1FI4A 1NHJA 1ZXMA 4YY3E 2WW4A 2HHHI 1FNMA 4LFCI 4WUBA 1A6FA 1KKHA 4PRVA 1D6TA 1N33E 4DU7A 4LF4E 1WUUA 3H4LA 1NHIA 2ZM6E 4DPTA 4AQYI 4M2ZA 2UUCI 4DR5E 4LF9I 4M1KA 4DR7I 1H7SA 1H7UA 2UU9I 2NA2A 4LF8E 4LFBE 1N0UA 2OI2A 1FWLA 2A2CA 4K0KE 4KQVA 4FN5A 2BM0A 4NXMI 2E1RA 1FJGE 1XNRE 4JG4A 1HNZE 3C4TA 4DR4E 1ZXNA 1T4OA 3M6AA 1XMOI 4DPWA 4DV3I 1Z0BA 1XNQE 4KHPI 3WU6A 2AJ4A 4B3RE 4OX9I 3VYYA 4X8WA 2YT4A 3LTOA 2GS8A 4JI1E 4DUZI 2RS6A 1XMQI 3QT7A 2VQFE 1Z0TA 1IBLI 2UXCE 4DV5E 4GKJI 1T4NA 4DR1E 4I3HA 2LUPB 3ZZUA 4LF6I 2HKJA 1HNWI 1RR9A 3J7Yp 1WHNA 4JI2E 1MG7A 5IT9C 4FWGA 2V2QA 2DMYA 4X64E 4DXLA 4GKKI 3T1HE 2LBSB 4DV4I 4B3TE 4JI5E 1EKZA 4DV2I 1U2RA 2CZ9A 4DV3E 1MX0A 1WHQA 4NXNI 4LF5E 2UXDE 2NPFA 3QT5A 4DV7I 5BR8E 1VISA 4DR6E 2V2VA 4HACA 1NZ0A 4X62E 3ZM7A 4ED4A 1YYOA 2V2ZA 2JVAA 1KIJA 5LMUI 2HKEA 4DKKA 5IWAE 3T1YI 4DV1I 3J80Q 1N36E 4YHHI 1Z59A 4JI6E 1YYKA 4HACB 2E5LE 5FLXC 1I94E 4M30A 2NUEA 4GKJE 4WUDA 1DI2A 2LTRA 1OJ4A 1HNXE 3PYDA 4JI4E 4USMA 2HK2A 5IT9Q 4WUCA 4X66I 5LMUE 1N34E 4PU9A 5GMDA 3LNUA 4DR2E 4DV6E 1H72C 3ZZTA 1Z0GA 3K17A 3ZKDA 4JYAE 2UUBI 2ZITA 3V2UC 1FWKA 2CPNA 1ELOA 2R42A 3QT6A 4JI3E 4JI7I 4DUYI 4FWDA 2UXBE 5GMEA 1IBKE 1J5EE 2EZ6A 4JI8E 4DV0E 1FKAE 1K47A 4B3SE 5FLXQ 4DV1E 2HFUA 3ZZ0A 1RREA 4X65I 4JI0I 1MU5A 2N3GA 3ADGA 2HHHE 4LFCE 3J81Q 1UEKA 3OTOI 2DEIA 2UUAI 2VQEI 4XTJA 3ADLA 1KTVA 4FWHA 5LMNI 4AQYE 4B3MI 4JV5I 3LPSA 2UUCE 4LF9E 4DR7E 4LF7I 1Z5AA 1GQEA 4LFAI 4R1FA 2UU9E 3J80C 2X7IA 1X48A 1IBMI 2UUBE 1O0WA 1YZ9A 1N32I 5LL6R 4NXME 2F4VI 1BKNA 3B82A 4FW9A 1XMOE 1S4EA 1N33I 4LF4I 1X49A 3C4BA 2NUGA 2B7TA 3F0NA 3ADJA 2ZM6I 4KHPE 1Z0VA 4DR3I 1PVGA 3JAMC 2JY9A 4DR5I 4OX9E 4MYUA 4UTGA 1QZRA 3HULA 4RPFA 4LF8I 4LFBI 2NUFA 1Z0WA 4EMDA 1H74A 2DB2A 3PYFA 4DUZE 4K0KI 1XMQE 2RSMA 4DPXA 1IBLE 1UHZA 2XEXA 1FJGI 2A2DA 1XNRI 1HNZI 1XHKA 1ZM3A 3J81C 4DR4I 4LF6E 1QU6A 1Z0CA 1HNWE 2LJHA 1HR0I 3J7AG 2LUQA 1STUA 1EI1A 4WYQB 2F4VE 1S16A 4GKKE 4B3RI 2V34A 4DV4E 4DPUA 2RTXA 2X36A 5L3JA 4DV2E 3WU3A 5A2QC 3GONA 4NXNE 3JAMQ 2DEJA 4DPYA 4DV7E 2IHR1 4JI1I 4DR3E 2J7KA 2VQFI 1T4LB 1KVKA 4PRXA 4HXZA 3Q1QA 2UXCI 4DV5I 4P7AA 1ZBTA 4DR1I 4HY1A 3VYXA 1Z5BA 2DIXA 4WFTA 2VF3A
chains in the Genus database with same CATH superfamily
2YTEA 2JE6A 3T1YE 3Q6NA 1H73A 2L33A 2V8PA 2LRSA 1Z5CA 2HK3A 2R3VA 3D4JA 4YHHE 4R2EA 1ZM2A 1UBDC 1Z0EA 2Z5BA 1HK7A 3B4TA 4U3DA 4JI2I 2LTSA 4FW6A 2B9DA 2GHFA 1KJKA 3QG5C 2BR2B 4O24A 3WU4A 4X64I 3T1HI 2MC5A 2M4IA 3CWVA 2C39A 4B3TI 4JI5I 2JE6B 2JEBA 2EM8A 1N3GA 2BA1D 2B7VA 5KL2A 1YHCA 4UT4A 1HR0E 5EL9A 1TF6A 4WXCA 4LF5I 4IFDE 2UXDI 3QT8A 2Z5BB 4X66E 2PRTA 2L2MA 3Q6MA 5A6BD 3HTXA 2HGHA 5C0XF 1B63A 5BR8I 4R2SA 1N0VC 4ZVIA 5AE3A 4DR6I 1NEIA 2B3TB 3TQMA 3EPJA 2IOPA 5A2QQ 4MLQA 1QNTA 3UHMA 4X62I 5AC5A 2K4VA 2EN3A 3P1XA 1ZM4A 1WJPA 2LO3A 1NHHA 3ZKBA 3LMLA 5A69A 2L3JA 1UILA 2EMZA 2EQ1A 5IWAI 1DQ3A 2R76A 2LJPA 4R2DA 1B62A 2O1TA 3ADIA 3K1JA 1N36I 4JI6I 1G2FC 4JI7E 4Z7CA 5CFFE 5AC4A 2EPMX 3MSWA 4DUYE 4P52A 4YY3I 1I94I 2E5LI 2EMBA 4USKA 2EFGA 4IZJA 5JEAF 3B78A 2HJJA 2EN4A 2L2NA 4ISAA 1HNXI 1UDOA 2L3CA 3PYEA 4LOMA 3H09A 4NZVA 2Q2EB 4ZYHA 4JI4I 4OOGC 2MDRA 4RHBB 4IFDC 1PKPA 1RQ0A 5C0XB 3V5RA 4X65E 5KL7A 4JI0E 2BM1A 2V86A 1P42A 2YRMA 1N34I 1Y6ZA 2YTGA 3H1CA 2WP8A 2YTFA 4DR2I 3OTOE 4M9VC 1BBGA 4DV6I 4MQYA 2UUAE 2VQEE 2N3HA 4KWYA 1UDNA 2EPOA 2VRDA 4DMIA 2DGCA 4MU0A 2RS7A 1EA6A 3WU5A 2L2KB 1VI7A 1DARA 4JYAI 5LMNE 2GLIA 5K36E 4LCFA 4B3ME 4JV5E 3M85G 5DRPA 1RC7A 2KHXA 4URLA 4DU8A 5ELWA 4LF7E 2WP8B 5A6AA 2O1UA 5DNYA 2EOOA 4X9JA 1YYWA 4LFAE 1ZM9A 2ENHA 1PIEA 1X47A 3LLHA 1NCSA 1KYQA 4JI3I 1IBME 4HYMA 4J3DA 2JT2A 2HFSA 4BHBA 2L6MA 3B8HA 2EOFA 2NN6E 2O1WA 2UXBI 1OYRA 2YTIA 2EPNA 1IBKI 3PYGA 3BBGA 4R2CA 1J26A 1N32E 2BV3A 1J5EI 4OO1E 5KL4A 5FWKA 1X6FA 4JI8I 2GO3A 2ZBKB 3J7AM 1XNQI 4MYTA 3FIGA 4AIMA 4DV0I 4Z7YA 4B3SI 4BC9A 1FI4A 2WCC3 2YRKA 2L92A 2JP9A 5K36D 1PJQA 5A6BA 2WNRA 3L00A 1NHJA 1IMUA 3CDIA 1ZXMA 2Z5CA 3K6QA 2EPXA 4YY3E 2EMYA 4WPYA 1FNMA 2WW4A 4LFCI 2HHHI 4WUBA 4IFDF 3C6KA 1A6FA 4F9BB 1KKHA 2Z5EA 4PRVA 2PO1A 1D6TA 2E72A 1N33E 4DU7A 1BBOA 1PJTA 4LF4E 3VHTB 2VE7C 4RH8A 5F3WA 1WUUA 2CG9A 3H4LA 5K36C 1NHIA 2ZM6E 4R2PA 4IFDD 4DPTA 2EPLX 3HJCA 4FK5C 1XXEA 4AQYI 4R8OA 4M2ZA 3BF2A 2UUCI 4DR5E 2Z5CB 4M1KA 2EPKX 4LCHA 4LF9I 1PJSA 2V8QB 4DR7I 4OO1D 1H7SA 2VF1A 1H7UA 4OKGA 1PDAA 2EM6A 5AE2A 2UU9I 4IFDA 2EQ3A 4HEIA 2NABA 2NA2A 4F6NA 4LF8E 4LFBE 3MHSC 3KRNA 1X6HA 2ODRC 5JEAD 4TUIA 2EMIA 4WSPA 3K85A 2EM7A 1N0UA 2EORA 2OI2A 1FWLA 2A2CA 4QNJA 4OO1C 2EM5A 4K0KE 3M99B 4KQVA 2HC5A 3RMPA 3PRYA 4FN5A 2K7IA 2BM0A 1IQSA 2EOIA 3F6GA 5A6JA 4NXMI 2YTQA 3BIDA 5JEAC 3DF6A 4IFDB 2E1RA 2KONA 2EOEA 1FJGE 1X6EA 2MKDA 1XNRE 2DRPA 1HNZE 4JG4A 2LCEA 3OMLA 2LV2A 3C4TA 3P76A 4DR4E 1ZXNA 2V88A 2EPZA 1T4OA 4R2RA 2PNLA 3M6AA 5A6KA 4DPWA 4J8ZA 1XMOI 2EMCA 4R2QA 4DV3I 1Z0BA 1XNQE 3PS2A 2YU5A 1GZ6A 3IWBA 5KL6A 4F6MA 4KHPI 3WU6A 2DMIA 2EOQA 5K36F 2AJ4A 4WSGA 4B3RE 1Y60A 1ZBQA 2DLKA 2ENCA 4OX9I 4Q28A 1ZAAC 3VYYA 4X8WA 1A1HA 2YT4A 5KL3A 2EOXA 3F6HA 2C37B 3LTOA 4P78A 2GS8A 1WRJA 4BA1A 2ADRA 3M85D 4JI1E 2NN6F 4DUZI 2RS6A 4FW7A 1XMQI 3QT7A 2VQFE 1Z0TA 2V85A 5C0XA 2EP3A 4OO1F 1IBLI 4IS9A 2EMXA 2EMHA 2UXCE 4DV5E 1B69A 4GKJI 1T4NA 1T38A 2E1MA 5AE1A 4DR1E 4I3HA 2LUPB 2RSIA 2YTPA 2G7HA 1E3HA 4BA1B 3THNA 2L8TA 2WBTA 2EMAA 3ZZUA 4IZKA 4LF6I 1EH6A 2HKJA 1HNWI 2EMFA 3GCMA 5K36B 4BA2B 1RR9A 1YH8A 2CT1A 2EOSA 3J7Yp 4F54A 1WHNA 3HPSA 4JI2E 1MG7A 2EWLA 5IT9C 4OO1A 4FWGA 2V2QA 2DMYA 4MU3A 4X64E 4DXLA 4GKKI 3T1HE 2LBSB 5DNXA 4DV4I 5LLQA 4B3TE 2JXPA 4JI5E 3GMEA 1EKZA 3P3CA 3ZOQB 4IZKB 2EM3A 5JEAA 2EOYA 1ZR9A 4DV2I 1SR9A 1OYPA 1U2RA 2LJUA 2CZ9A 4ZYEA 1X5WA 4DV3E 1MX0A 1WHQA 2EL5A 2JWOA 4NXNI 4LF5E 2UXDE 2PNZA 4F2JC 2NPFA 2CTDA 3QT5A 4OO1B 4DV7I 2YSOA 5BR8E 1VISA 3JU0A 4DR6E 2AE8A 5JEAB 4BC7A 3IWCA 1R6LA 2V2VA 4FW4A 2GPIA 4HACA 2JPAA 1AAYA 4X62E 1NZ0A 3ZM7A 4ED4A 1LLMC 1YYOA 2V2ZA 1A1IA 4P7DA 2PNZB 3U1YA 2JVAA 1KIJA 5LMUI 2HKEA 2FGGA 4DKKA 2EMLA 5IWAE 4BHCA 3T1YI 3KZYA 4DV1I 3J80Q 2V83A 1N36E 4WXDA 1T39A 5DROA 1Z59A 4YHHI 4JI6E 1YYKA 4HACB 2E5LE 5FLXC 1I94E 1UDQA 4M30A 2NUEA 4GKJE 4WUDA 4TUGA 1DI2A 4O4KA 2EM4A 2YTOA 4O5GA 2LTRA 1OJ4A 3P06A 1F2IG 3P3GA 1HNXE 3PYDA 2CVEA 4BBYA 3KWRA 4JI4E 2LE2A 2EPPA 4USMA 5IV8B 4I8OA 2HK2A 2ODRD 2NN6D 5IT9Q 4WUCA 1DGCA 2EN1A 1UN6B 3PS1A 3AV0A 2JR1A 1A1JA 3P3EA 3MHHC 4X66I 5LMUE 1N34E 4PU9A 5GMDA 3LNUA 1TF3A 4DR2E 4DV6E 1H72C 3ZZTA 2BBGA 2DSYA 3L7ZA 4OZEA 2GO4A 2NN6C 4FW3A 1Z0GA 3K17A 2C38A 4JYAE 1OYSA 4IZJD 1A1FA 3ZKDA 2UUBI 1Z1BA 2RQLA 2I13A 2ZITA 4O43A 2D9HA 2MC6A 1RHYA 3V2UC 1FWKA 3NZKA 2EJ4A 4LTYA 1WXRA 1Y5YA 2CPNA 2LT7A 2EOZA 2YPNA 3VK6A 1ELOA 2R42A 3QT6A 4MDTA 3GLLA 2WBUA 3L7ZB 1EH8A 3HQ1A 2ELYA 2YSPA 4WX9A 4JI3E 2C38B 3M7NG 4JI7I 2EN7A 4DUYI 4FWDA 2YTDA 2EM9A 5IXMB 3EPHA 4MU4A 3THOB 2UXBE 5GMEA 4ZYGA 1IBKE 1X3CA 2PO2A 1RMDA 1J5EE 2EZ6A 2C37A 4JI8E 2FV4B 2IESA 5T6JA 2FTXB 4DV0E 1FKAE 1K47A 4B3SE 5FLXQ 4DV1E 2HFUA 3ZZ0A 5AASA 1RREA 4X65I 4AIDA 4JI0I 2EMGA 1MU5A 1G2DC 2RPCA 2EPCA 2N3GA 3ADGA 2HHHE 2EN6A 4LFCE 1MGTA 3J81Q 1UEKA 4L8NA 3OTOI 3ECRA 1MEYC 2PO2B 2DEIA 2UUAI 2VQEI 4XTJA 4LPFA 2V89A 4GZNC 4NHRA 3ADLA 1KTVA 1IQOA 2J7JA 4FWHA 5LMNI 3EPLA 4AQYE 4B3MI 4U3BA 2WBSA 3LPSA 4FW5A 4JV5I 2UUCE 2GQ0A 4LF9E 1USVA 2F1DA 1L4SA 4DR7E 4LF7I 1UDSA 1Z5AA 5EKWA 5K36A 1GQEA 4BA2A 1ZU1A 4LFAI 4IS1C 1EH7A 4IJDA 4R1FA 2UU9E 1SFEA 3J80C 2C39B 2MDGA 4GEQB 2X7IA 4N4RB 2JEBB 1X48A 1IBMI 3IWDA 3HKMA 2BA0D 2YRHA 2UUBE 1O0WA 3PS3A 4LCGA 1A1KA 1YZ9A 1N32I 2NN6A 3UK3C 5LL6R 2EM2A 4NXME 1TN9A 2JOBA 3DJWA 2O1VA 2JOXA 2F4VI 2F8BA 1Y4SA 3HPZA 2BB8A 2LVHA 3JTZA 2YTJA 1BKNA 3B82A 2PO0A 4FW9A 2EL4A 2H36X 1XMOE 1S4EA 1N33I 2NN6B 4LF4I 1X49A 2EOHA 3C4BA 2NUGA 5ADZA 2B7TA 2BA1G 1A1LA 3F0NA 3ADJA 2ZM6I 4KHPE 1YUIA 1Z0VA 2O3ZA 1YFHA 4DR3I 1PVGA 1BB8A 5KL5A 1YPNA 3JAMC 2JY9A 4DR5I 5DRQA 4OX9E 4BCAA 2V87A 1E3PA 4QNKA 4Q35B 2CSHA 4MYUA 3HXLA 2PO0B 4HTGA 4IZJB 4LU9A 4UTGA 1Y4UA 5DRRA 1QZRA 3HULA 2EMKA 4RPFA 2EQ0A 2EPUA 4LF8I 4MLVA 2NUFA 2BA0G 2VESA 1Z0WA 4LFBI 4EMDA 1JK2A 1H74A 3KZZA 2DB2A 2EE8A 3PYFA 5DNLA 2EPRA 5C0XE 2EN8A 4R03A 4DUZE 4K0KI 2DLQA 2LMZA 2M7QA 1XMQE 2RSMA 4N3OA 2IOQA 4L5NC 4DPXA 1IBLE 3CDJA 1UHZA 4MU1A 2XEXA 3M7ND 1FJGI 2MKNA 2A2DA 1XNRI 4F9CB 1HNZI 1XHKA 1ZM3A 2A25A 3J81C 4DR4I 4M0VA 1R6MA 3C6MA 2WZOA 2I9IA 4LF6E 1QU6A 4NBQA 1Z0CA 4ZYDA 1USUA 1HNWE 2LJHA 1HR0I 3J7AG 4BS9A 2ELZA 1AH5A 4F9AB 1YUJA 2LUQA 1STUA 2EPAA 1EI1A 2YWQA 4BMJA 2IERA 5C0XD 4WYQB 5JEAE 2F4VE 1S16A 4GKKE 4B3RI 2V34A 2CGEA 2J65A 4DV4E 4DPUA 2EL6A 2R1FA 2PNMA 2RTXA 2X36A 2KOUA 2YU8A 4KZSA 4GQUA 5L3JA 1JK1A 2JEAA 1A1GA 1P47A 3AUZA 4DV2E 1YSAC 2N8XA 3WU3A 2EM0A 5A2QC 3GONA 2EMWA 2YZTA 4NXNE 2M1SA 2DEJA 3U1KA 3JAMQ 4DPYA 5C0XC 2M9AA 4DV7E 2YTNA 2IHR1 3EQ1A 3DD6A 4DR3E 2WNRB 4JI1I 5TSEA 2J7KA 2EOJA 4R2AA 2VQFI 1T4LB 2JEAB 4AM3A 1KVKA 4PRXA 3BGHA 2EOMA 2JYAA 4HXZA 2PO1B 3Q1QA 2UXCI 4DV5I 1GTKA 2Q8UA 4P7AA 1ZBTA 2ENAA 4DR1I 4HY1A 3VYXA 2EN2A 1Z5BA 2BR2A 2DIXA 4WFTA 3EPKA 2VF3A
chains in the Genus database with same CATH topology
3T1YE 3Q6NA 1H73A 2L33A 2V8PA 2LRSA 1Z5CA 2HK3A 2R3VA 3D4JA 4YHHE 1ZM2A 1Z0EA 2Z5BA 1HK7A 4JI2I 2LTSA 2B9DA 3WU4A 4X64I 3T1HI 2MC5A 2M4IA 3CWVA 4B3TI 4JI5I 2B7VA 4UT4A 1HR0E 4LF5I 2UXDI 3QT8A 2Z5BB 4X66E 2L2MA 3Q6MA 3HTXA 5BR8I 1B63A 1N0VC 4ZVIA 5AE3A 4DR6I 2B3TB 2IOPA 5A2QQ 4X62I 2K4VA 3P1XA 1ZM4A 1NHHA 3ZKBA 3LMLA 2L3JA 1UILA 5IWAI 1DQ3A 2O1TA 2LJPA 1B62A 3ADIA 3K1JA 1N36I 4JI6I 4Z7CA 4JI7E 5CFFE 4DUYE 4YY3I 3MSWA 4P52A 1I94I 2E5LI 4USKA 2EFGA 4IZJA 3B78A 2L2NA 1HNXI 2L3CA 3PYEA 3H09A 4JI4I 2Q2EB 4OOGC 2MDRA 1PKPA 1RQ0A 3V5RA 4X65E 2BM1A 4JI0E 2V86A 1N34I 1Y6ZA 4DR2I 3OTOE 4DV6I 2UUAE 2VQEE 2N3HA 4DMIA 2RS7A 1EA6A 3WU5A 2L2KB 4JYAI 1DARA 5LMNE 4B3ME 4JV5E 1RC7A 2KHXA 4URLA 4DU8A 4LF7E 2O1UA 5DNYA 1YYWA 4LFAE 1ZM9A 1PIEA 1X47A 3LLHA 4JI3I 1IBME 4HYMA 2HFSA 2L6MA 3B8HA 2O1WA 2UXBI 1IBKI 3PYGA 1J26A 1N32E 2BV3A 1J5EI 3J7AM 5FWKA 4JI8I 2ZBKB 1XNQI 4MYTA 3FIGA 4DV0I 4Z7YA 4B3SI 4BC9A 1FI4A 2L92A 1NHJA 1ZXMA 2Z5CA 3K6QA 4YY3E 2WW4A 2HHHI 4WPYA 1FNMA 4LFCI 4WUBA 1A6FA 4F9BB 1KKHA 2Z5EA 4PRVA 1D6TA 1N33E 4DU7A 4LF4E 2VE7C 1WUUA 5F3WA 2CG9A 3H4LA 1NHIA 2ZM6E 4DPTA 4AQYI 3HJCA 4R8OA 4M2ZA 2UUCI 4DR5E 2Z5CB 4M1KA 4LF9I 2V8QB 4DR7I 1H7SA 2VF1A 1H7UA 5AE2A 2UU9I 2NA2A 4LF8E 4LFBE 2ODRC 4TUIA 4WSPA 3K85A 1N0UA 2OI2A 1FWLA 2A2CA 4K0KE 4KQVA 3PRYA 3RMPA 4FN5A 2BM0A 3F6GA 4NXMI 3DF6A 2E1RA 2KONA 1FJGE 1XNRE 4JG4A 1HNZE 3OMLA 3C4TA 4DR4E 1ZXNA 2V88A 1T4OA 3M6AA 2PNLA 1XMOI 4DPWA 4J8ZA 4DV3I 1Z0BA 1XNQE 1GZ6A 3IWBA 4KHPI 3WU6A 2AJ4A 4B3RE 1ZBQA 4OX9I 4Q28A 3VYYA 4X8WA 2YT4A 3F6HA 3LTOA 4P78A 2GS8A 4JI1E 4DUZI 2RS6A 1XMQI 3QT7A 2VQFE 1Z0TA 2V85A 1IBLI 2UXCE 4DV5E 4GKJI 1T4NA 2E1MA 5AE1A 4DR1E 4I3HA 2LUPB 2G7HA 2L8TA 3ZZUA 4IZKA 4LF6I 2HKJA 1HNWI 1RR9A 3J7Yp 4F54A 1WHNA 3HPSA 4JI2E 1MG7A 2EWLA 5IT9C 4FWGA 2V2QA 2DMYA 4X64E 4DXLA 4GKKI 3T1HE 2LBSB 4DV4I 4B3TE 4JI5E 1EKZA 4IZKB 3ZOQB 4DV2I 1SR9A 1U2RA 2CZ9A 4DV3E 1MX0A 1WHQA 2JWOA 4NXNI 4LF5E 2UXDE 2NPFA 3QT5A 4DV7I 5BR8E 1VISA 3JU0A 4DR6E 4BC7A 3IWCA 2V2VA 4HACA 1NZ0A 4X62E 3ZM7A 4ED4A 1YYOA 2V2ZA 4P7DA 2JVAA 1KIJA 5LMUI 2HKEA 2FGGA 4DKKA 5IWAE 3T1YI 4DV1I 3J80Q 2V83A 1N36E 4YHHI 1Z59A 4JI6E 1YYKA 4HACB 2E5LE 5FLXC 1I94E 4M30A 2NUEA 4GKJE 4WUDA 4TUGA 1DI2A 2LTRA 1OJ4A 3P06A 1HNXE 3PYDA 4BBYA 3KWRA 4JI4E 2LE2A 4USMA 2HK2A 4I8OA 5IT9Q 2ODRD 4WUCA 3AV0A 2JR1A 4X66I 1N34E 4PU9A 5GMDA 3LNUA 4DR2E 4DV6E 1H72C 3ZZTA 2DSYA 1Z0GA 3K17A 3ZKDA 4JYAE 4IZJD 2UUBI 2ZITA 3V2UC 2MC6A 1FWKA 4LTYA 1WXRA 2CPNA 3VK6A 1ELOA 2R42A 3QT6A 3HQ1A 4JI3E 4JI7I 4DUYI 4FWDA 2UXBE 5GMEA 1IBKE 1J5EE 2EZ6A 4JI8E 2FV4B 5T6JA 2FTXB 1FKAE 4DV0E 1K47A 4B3SE 5FLXQ 4DV1E 2HFUA 3ZZ0A 5AASA 1RREA 4X65I 4JI0I 1MU5A 2N3GA 3ADGA 2HHHE 4LFCE 3J81Q 1UEKA 4L8NA 3OTOI 2DEIA 2UUAI 2VQEI 4XTJA 2V89A 3ADLA 1KTVA 4FWHA 5LMNI 4AQYE 4B3MI 4JV5I 3LPSA 2UUCE 2GQ0A 4LF9E 1USVA 4DR7E 4LF7I 1Z5AA 1GQEA 4LFAI 4R1FA 2UU9E 3J80C 4GEQB 2X7IA 1X48A 1IBMI 3IWDA 2UUBE 1O0WA 1YZ9A 1N32I 5LL6R 4NXME 2JOBA 3DJWA 2O1VA 2JOXA 2F4VI 2F8BA 1Y4SA 3HPZA 3JTZA 1BKNA 3B82A 4FW9A 2H36X 1XMOE 1S4EA 1N33I 4LF4I 1X49A 3C4BA 2NUGA 5ADZA 2B7TA 3F0NA 3ADJA 2ZM6I 4KHPE 1Z0VA 4DR3I 1PVGA 3JAMC 2JY9A 4DR5I 4OX9E 4BCAA 2V87A 4MYUA 3HXLA 4IZJB 4LU9A 4UTGA 1Y4UA 1QZRA 3HULA 4RPFA 4LF8I 4LFBI 2NUFA 1Z0WA 4EMDA 1H74A 2DB2A 3PYFA 4R03A 4DUZE 4K0KI 2LMZA 2M7QA 1XMQE 2RSMA 4N3OA 2IOQA 4L5NC 4DPXA 1IBLE 1UHZA 2XEXA 1FJGI 2A2DA 1XNRI 4F9CB 1HNZI 1XHKA 1ZM3A 3J81C 4DR4I 4M0VA 2WZOA 4LF6E 1QU6A 1Z0CA 1USUA 1HNWE 2LJHA 1HR0I 3J7AG 4BS9A 4F9AB 2LUQA 1STUA 1EI1A 4BMJA 4WYQB 2F4VE 1S16A 4GKKE 4B3RI 2V34A 2CGEA 4DV4E 4DPUA 2PNMA 2RTXA 2X36A 2KOUA 4KZSA 5L3JA 3AUZA 4DV2E 3WU3A 5A2QC 3GONA 2YZTA 4NXNE 2M1SA 2DEJA 3JAMQ 4DPYA 4DV7E 2IHR1 4JI1I 4DR3E 2J7KA 2VQFI 1T4LB 1KVKA 4PRXA 4HXZA 3Q1QA 2UXCI 2DIXA 4DV5I 4P7AA 1ZBTA 4DR1I 4HY1A 3VYXA 1Z5BA 5LMUE 4WFTA 2VF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y E;  1H73 A;  2L33 A;  2V8P A;  2LRS A;  1Z5C A;  2HK3 A;  2R3V A;  3D4J A;  4YHH E;  1ZM2 A;  1Z0E A;  4JI2 I;  2LTS A;  3WU4 A;  4X64 I;  3T1H I;  3CWV A;  4B3T I;  4JI5 I;  2B7V A;  4UT4 A;  1HR0 E;  4LF5 I;  2UXD I;  3QT8 A;  4X66 E;  2L2M A;  3HTX A;  5BR8 I;  1B63 A;  1N0V C;  4ZVI A;  4DR6 I;  2B3T B;  5A2Q Q;  4X62 I;  3P1X A;  1ZM4 A;  1NHH A;  3ZKB A;  2L3J A;  1UIL A;  5IWA I;  2LJP A;  1B62 A;  3ADI A;  3K1J A;  1N36 I;  4JI6 I;  4Z7C A;  4JI7 E;  5CFF E;  4DUY E;  4YY3 I;  1I94 I;  4P52 A;  2E5L I;  4USK A;  2EFG A;  3B78 A;  2L2N A;  1HNX I;  2L3C A;  3PYE A;  4JI4 I;  2Q2E B;  4OOG C;  2MDR A;  1PKP A;  1RQ0 A;  3V5R A;  4X65 E;  2BM1 A;  4JI0 E;  1N34 I;  4DR2 I;  3OTO E;  4DV6 I;  2UUA E;  2VQE E;  2N3H A;  2RS7 A;  1EA6 A;  3WU5 A;  2L2K B;  4JYA I;  1DAR A;  5LMN E;  4B3M E;  4JV5 E;  1RC7 A;  2KHX A;  4URL A;  4DU8 A;  4LF7 E;  1YYW A;  4LFA E;  1ZM9 A;  1PIE A;  1X47 A;  3LLH A;  4JI3 I;  1IBM E;  4HYM A;  2HFS A;  3B8H A;  2UXB I;  1IBK I;  3PYG A;  1J26 A;  1N32 E;  2BV3 A;  1J5E I;  3J7A M;  4JI8 I;  2ZBK B;  1XNQ I;  4MYT A;  4DV0 I;  4Z7Y A;  4B3S I;  1FI4 A;  1NHJ A;  1ZXM A;  4YY3 E;  2WW4 A;  2HHH I;  1FNM A;  4LFC I;  4WUB A;  1A6F A;  1KKH A;  4PRV A;  1D6T A;  1N33 E;  4DU7 A;  4LF4 E;  1WUU A;  3H4L A;  1NHI A;  2ZM6 E;  4DPT A;  4AQY I;  4M2Z A;  2UUC I;  4DR5 E;  4LF9 I;  4M1K A;  4DR7 I;  1H7S A;  1H7U A;  2UU9 I;  2NA2 A;  4LF8 E;  4LFB E;  1N0U A;  2OI2 A;  1FWL A;  2A2C A;  4K0K E;  4KQV A;  4FN5 A;  2BM0 A;  4NXM I;  2E1R A;  1FJG E;  1XNR E;  4JG4 A;  1HNZ E;  3C4T A;  4DR4 E;  1ZXN A;  1T4O A;  3M6A A;  1XMO I;  4DPW A;  4DV3 I;  1Z0B A;  1XNQ E;  4KHP I;  3WU6 A;  2AJ4 A;  4B3R E;  4OX9 I;  3VYY A;  4X8W A;  2YT4 A;  3LTO A;  2GS8 A;  4JI1 E;  4DUZ I;  2RS6 A;  1XMQ I;  3QT7 A;  2VQF E;  1Z0T A;  1IBL I;  2UXC E;  4DV5 E;  4GKJ I;  1T4N A;  4DR1 E;  4I3H A;  2LUP B;  3ZZU A;  4LF6 I;  2HKJ A;  1HNW I;  1RR9 A;  3J7Y p;  1WHN A;  4JI2 E;  1MG7 A;  5IT9 C;  4FWG A;  2V2Q A;  2DMY A;  4X64 E;  4DXL A;  4GKK I;  3T1H E;  2LBS B;  4DV4 I;  4B3T E;  4JI5 E;  1EKZ A;  4DV2 I;  1U2R A;  2CZ9 A;  4DV3 E;  1MX0 A;  1WHQ A;  4NXN I;  4LF5 E;  2UXD E;  2NPF A;  3QT5 A;  4DV7 I;  5BR8 E;  1VIS A;  4DR6 E;  2V2V A;  4HAC A;  1NZ0 A;  4X62 E;  3ZM7 A;  4ED4 A;  1YYO A;  2V2Z A;  2JVA A;  1KIJ A;  5LMU I;  2HKE A;  4DKK A;  5IWA E;  3T1Y I;  4DV1 I;  3J80 Q;  1N36 E;  4YHH I;  1Z59 A;  4JI6 E;  1YYK A;  4HAC B;  2E5L E;  5FLX C;  1I94 E;  4M30 A;  2NUE A;  4GKJ E;  4WUD A;  1DI2 A;  2LTR A;  1OJ4 A;  1HNX E;  3PYD A;  4JI4 E;  4USM A;  2HK2 A;  5IT9 Q;  4WUC A;  4X66 I;  5LMU E;  1N34 E;  4PU9 A;  5GMD A;  3LNU A;  4DR2 E;  4DV6 E;  1H72 C;  3ZZT A;  1Z0G A;  3K17 A;  3ZKD A;  4JYA E;  2UUB I;  2ZIT A;  3V2U C;  1FWK A;  2CPN A;  1ELO A;  2R42 A;  3QT6 A;  4JI3 E;  4JI7 I;  4DUY I;  4FWD A;  2UXB E;  5GME A;  1IBK E;  1J5E E;  2EZ6 A;  4JI8 E;  4DV0 E;  1FKA E;  1K47 A;  4B3S E;  5FLX Q;  4DV1 E;  2HFU A;  3ZZ0 A;  1RRE A;  4X65 I;  4JI0 I;  1MU5 A;  2N3G A;  3ADG A;  2HHH E;  4LFC E;  3J81 Q;  1UEK A;  3OTO I;  2DEI A;  2UUA I;  2VQE I;  4XTJ A;  3ADL A;  1KTV A;  4FWH A;  5LMN I;  4AQY E;  4B3M I;  4JV5 I;  3LPS A;  2UUC E;  4LF9 E;  4DR7 E;  4LF7 I;  1Z5A A;  1GQE A;  4LFA I;  4R1F A;  2UU9 E;  3J80 C;  2X7I A;  1X48 A;  1IBM I;  2UUB E;  1O0W A;  1YZ9 A;  1N32 I;  5LL6 R;  4NXM E;  2F4V I;  1BKN A;  3B82 A;  4FW9 A;  1XMO E;  1S4E A;  1N33 I;  4LF4 I;  1X49 A;  3C4B A;  2NUG A;  2B7T A;  3F0N A;  3ADJ A;  2ZM6 I;  4KHP E;  1Z0V A;  4DR3 I;  1PVG A;  3JAM C;  2JY9 A;  4DR5 I;  4OX9 E;  4MYU A;  4UTG A;  1QZR A;  3HUL A;  4RPF A;  4LF8 I;  4LFB I;  2NUF A;  1Z0W A;  4EMD A;  1H74 A;  2DB2 A;  3PYF A;  4DUZ E;  4K0K I;  1XMQ E;  2RSM A;  4DPX A;  1IBL E;  1UHZ A;  2XEX A;  1FJG I;  2A2D A;  1XNR I;  1HNZ I;  1XHK A;  1ZM3 A;  3J81 C;  4DR4 I;  4LF6 E;  1QU6 A;  1Z0C A;  1HNW E;  2LJH A;  1HR0 I;  3J7A G;  2LUQ A;  1STU A;  1EI1 A;  4WYQ B;  2F4V E;  1S16 A;  4GKK E;  4B3R I;  2V34 A;  4DV4 E;  4DPU A;  2RTX A;  2X36 A;  5L3J A;  4DV2 E;  3WU3 A;  5A2Q C;  3GON A;  4NXN E;  3JAM Q;  2DEJ A;  4DPY A;  4DV7 E;  2IHR 1;  4JI1 I;  4DR3 E;  2J7K A;  2VQF I;  1T4L B;  1KVK A;  4PRX A;  4HXZ A;  3Q1Q A;  2UXC I;  4DV5 I;  4P7A A;  1ZBT A;  4DR1 I;  4HY1 A;  3VYX A;  1Z5B A;  2DIX A;  4WFT A;  2VF3 A; 
#chains in the Genus database with same CATH topology
 2YTE A;  2JE6 A;  3T1Y E;  3Q6N A;  1H73 A;  2L33 A;  2V8P A;  2LRS A;  1Z5C A;  2HK3 A;  2R3V A;  3D4J A;  4YHH E;  4R2E A;  1ZM2 A;  1UBD C;  1Z0E A;  2Z5B A;  1HK7 A;  3B4T A;  4U3D A;  4JI2 I;  2LTS A;  4FW6 A;  2B9D A;  2GHF A;  1KJK A;  3QG5 C;  2BR2 B;  4O24 A;  3WU4 A;  4X64 I;  3T1H I;  2MC5 A;  2M4I A;  3CWV A;  2C39 A;  4B3T I;  4JI5 I;  2JE6 B;  2JEB A;  2EM8 A;  1N3G A;  2BA1 D;  2B7V A;  5KL2 A;  1YHC A;  4UT4 A;  1HR0 E;  5EL9 A;  1TF6 A;  4WXC A;  4LF5 I;  4IFD E;  2UXD I;  3QT8 A;  2Z5B B;  4X66 E;  2PRT A;  2L2M A;  3Q6M A;  5A6B D;  3HTX A;  2HGH A;  5C0X F;  1B63 A;  5BR8 I;  4R2S A;  1N0V C;  4ZVI A;  5AE3 A;  4DR6 I;  1NEI A;  2B3T B;  3TQM A;  3EPJ A;  2IOP A;  5A2Q Q;  4MLQ A;  1QNT A;  3UHM A;  4X62 I;  5AC5 A;  2K4V A;  2EN3 A;  3P1X A;  1ZM4 A;  1WJP A;  2LO3 A;  1NHH A;  3ZKB A;  3LML A;  5A69 A;  2L3J A;  1UIL A;  2EMZ A;  2EQ1 A;  5IWA I;  1DQ3 A;  2R76 A;  2LJP A;  4R2D A;  1B62 A;  2O1T A;  3ADI A;  3K1J A;  1N36 I;  4JI6 I;  1G2F C;  4JI7 E;  4Z7C A;  5CFF E;  5AC4 A;  2EPM X;  3MSW A;  4DUY E;  4P52 A;  4YY3 I;  1I94 I;  2E5L I;  2EMB A;  4USK A;  2EFG A;  4IZJ A;  5JEA F;  3B78 A;  2HJJ A;  2EN4 A;  2L2N A;  4ISA A;  1HNX I;  1UDO A;  2L3C A;  3PYE A;  4LOM A;  3H09 A;  4NZV A;  2Q2E B;  4ZYH A;  4JI4 I;  4OOG C;  2MDR A;  4RHB B;  4IFD C;  1PKP A;  1RQ0 A;  5C0X B;  3V5R A;  4X65 E;  5KL7 A;  4JI0 E;  2BM1 A;  2V86 A;  1P42 A;  2YRM A;  1N34 I;  1Y6Z A;  2YTG A;  3H1C A;  2WP8 A;  2YTF A;  4DR2 I;  3OTO E;  4M9V C;  1BBG A;  4DV6 I;  4MQY A;  2UUA E;  2VQE E;  2N3H A;  4KWY A;  1UDN A;  2EPO A;  2VRD A;  4DMI A;  2DGC A;  4MU0 A;  2RS7 A;  1EA6 A;  3WU5 A;  2L2K B;  1VI7 A;  1DAR A;  4JYA I;  5LMN E;  2GLI A;  5K36 E;  4LCF A;  4B3M E;  4JV5 E;  3M85 G;  5DRP A;  1RC7 A;  2KHX A;  4URL A;  4DU8 A;  5ELW A;  4LF7 E;  2WP8 B;  5A6A A;  2O1U A;  5DNY A;  2EOO A;  4X9J A;  1YYW A;  4LFA E;  1ZM9 A;  2ENH A;  1PIE A;  1X47 A;  3LLH A;  1NCS A;  1KYQ A;  4JI3 I;  1IBM E;  4HYM A;  4J3D A;  2JT2 A;  2HFS A;  4BHB A;  2L6M A;  3B8H A;  2EOF A;  2NN6 E;  2O1W A;  2UXB I;  1OYR A;  2YTI A;  2EPN A;  1IBK I;  3PYG A;  3BBG A;  4R2C A;  1J26 A;  1N32 E;  2BV3 A;  1J5E I;  4OO1 E;  5KL4 A;  5FWK A;  1X6F A;  4JI8 I;  2GO3 A;  2ZBK B;  3J7A M;  1XNQ I;  4MYT A;  3FIG A;  4AIM A;  4DV0 I;  4Z7Y A;  4B3S I;  4BC9 A;  1FI4 A;  2WCC 3;  2YRK A;  2L92 A;  2JP9 A;  5K36 D;  1PJQ A;  5A6B A;  2WNR A;  3L00 A;  1NHJ A;  1IMU A;  3CDI A;  1ZXM A;  2Z5C A;  3K6Q A;  2EPX A;  4YY3 E;  2EMY A;  4WPY A;  1FNM A;  2WW4 A;  4LFC I;  2HHH I;  4WUB A;  4IFD F;  3C6K A;  1A6F A;  4F9B B;  1KKH A;  2Z5E A;  4PRV A;  2PO1 A;  1D6T A;  2E72 A;  1N33 E;  4DU7 A;  1BBO A;  1PJT A;  4LF4 E;  3VHT B;  2VE7 C;  4RH8 A;  5F3W A;  1WUU A;  2CG9 A;  3H4L A;  5K36 C;  1NHI A;  2ZM6 E;  4R2P A;  4IFD D;  4DPT A;  2EPL X;  3HJC A;  4FK5 C;  1XXE A;  4AQY I;  4R8O A;  4M2Z A;  3BF2 A;  2UUC I;  4DR5 E;  2Z5C B;  4M1K A;  2EPK X;  4LCH A;  4LF9 I;  1PJS A;  2V8Q B;  4DR7 I;  4OO1 D;  1H7S A;  2VF1 A;  1H7U A;  4OKG A;  1PDA A;  2EM6 A;  5AE2 A;  2UU9 I;  4IFD A;  2EQ3 A;  4HEI A;  2NAB A;  2NA2 A;  4F6N A;  4LF8 E;  4LFB E;  3MHS C;  3KRN A;  1X6H A;  2ODR C;  5JEA D;  4TUI A;  2EMI A;  4WSP A;  3K85 A;  2EM7 A;  1N0U A;  2EOR A;  2OI2 A;  1FWL A;  2A2C A;  4QNJ A;  4OO1 C;  2EM5 A;  4K0K E;  3M99 B;  4KQV A;  2HC5 A;  3RMP A;  3PRY A;  4FN5 A;  2K7I A;  2BM0 A;  1IQS A;  2EOI A;  3F6G A;  5A6J A;  4NXM I;  2YTQ A;  3BID A;  5JEA C;  3DF6 A;  4IFD B;  2E1R A;  2KON A;  2EOE A;  1FJG E;  1X6E A;  2MKD A;  1XNR E;  2DRP A;  1HNZ E;  4JG4 A;  2LCE A;  3OML A;  2LV2 A;  3C4T A;  3P76 A;  4DR4 E;  1ZXN A;  2V88 A;  2EPZ A;  1T4O A;  4R2R A;  2PNL A;  3M6A A;  5A6K A;  4DPW A;  4J8Z A;  1XMO I;  2EMC A;  4R2Q A;  4DV3 I;  1Z0B A;  1XNQ E;  3PS2 A;  2YU5 A;  1GZ6 A;  3IWB A;  5KL6 A;  4F6M A;  4KHP I;  3WU6 A;  2DMI A;  2EOQ A;  5K36 F;  2AJ4 A;  4WSG A;  4B3R E;  1Y60 A;  1ZBQ A;  2DLK A;  2ENC A;  4OX9 I;  4Q28 A;  1ZAA C;  3VYY A;  4X8W A;  1A1H A;  2YT4 A;  5KL3 A;  2EOX A;  3F6H A;  2C37 B;  3LTO A;  4P78 A;  2GS8 A;  1WRJ A;  4BA1 A;  2ADR A;  3M85 D;  4JI1 E;  2NN6 F;  4DUZ I;  2RS6 A;  4FW7 A;  1XMQ I;  3QT7 A;  2VQF E;  1Z0T A;  2V85 A;  5C0X A;  2EP3 A;  4OO1 F;  1IBL I;  4IS9 A;  2EMX A;  2EMH A;  2UXC E;  4DV5 E;  1B69 A;  4GKJ I;  1T4N A;  1T38 A;  2E1M A;  5AE1 A;  4DR1 E;  4I3H A;  2LUP B;  2RSI A;  2YTP A;  2G7H A;  1E3H A;  4BA1 B;  3THN A;  2L8T A;  2WBT A;  2EMA A;  3ZZU A;  4IZK A;  4LF6 I;  1EH6 A;  2HKJ A;  1HNW I;  2EMF A;  3GCM A;  5K36 B;  4BA2 B;  1RR9 A;  1YH8 A;  2CT1 A;  2EOS A;  3J7Y p;  4F54 A;  1WHN A;  3HPS A;  4JI2 E;  1MG7 A;  2EWL A;  5IT9 C;  4OO1 A;  4FWG A;  2V2Q A;  2DMY A;  4MU3 A;  4X64 E;  4DXL A;  4GKK I;  3T1H E;  2LBS B;  5DNX A;  4DV4 I;  5LLQ A;  4B3T E;  2JXP A;  4JI5 E;  3GME A;  1EKZ A;  3P3C A;  3ZOQ B;  4IZK B;  2EM3 A;  5JEA A;  2EOY A;  1ZR9 A;  4DV2 I;  1SR9 A;  1OYP A;  1U2R A;  2LJU A;  2CZ9 A;  4ZYE A;  1X5W A;  4DV3 E;  1MX0 A;  1WHQ A;  2EL5 A;  2JWO A;  4NXN I;  4LF5 E;  2UXD E;  2PNZ A;  4F2J C;  2NPF A;  2CTD A;  3QT5 A;  4OO1 B;  4DV7 I;  2YSO A;  5BR8 E;  1VIS A;  3JU0 A;  4DR6 E;  2AE8 A;  5JEA B;  4BC7 A;  3IWC A;  1R6L A;  2V2V A;  4FW4 A;  2GPI A;  4HAC A;  2JPA A;  1AAY A;  4X62 E;  1NZ0 A;  3ZM7 A;  4ED4 A;  1LLM C;  1YYO A;  2V2Z A;  1A1I A;  4P7D A;  2PNZ B;  3U1Y A;  2JVA A;  1KIJ A;  5LMU I;  2HKE A;  2FGG A;  4DKK A;  2EML A;  5IWA E;  4BHC A;  3T1Y I;  3KZY A;  4DV1 I;  3J80 Q;  2V83 A;  1N36 E;  4WXD A;  1T39 A;  5DRO A;  1Z59 A;  4YHH I;  4JI6 E;  1YYK A;  4HAC B;  2E5L E;  5FLX C;  1I94 E;  1UDQ A;  4M30 A;  2NUE A;  4GKJ E;  4WUD A;  4TUG A;  1DI2 A;  4O4K A;  2EM4 A;  2YTO A;  4O5G A;  2LTR A;  1OJ4 A;  3P06 A;  1F2I G;  3P3G A;  1HNX E;  3PYD A;  2CVE A;  4BBY A;  3KWR A;  4JI4 E;  2LE2 A;  2EPP A;  4USM A;  5IV8 B;  4I8O A;  2HK2 A;  2ODR D;  2NN6 D;  5IT9 Q;  4WUC A;  1DGC A;  2EN1 A;  1UN6 B;  3PS1 A;  3AV0 A;  2JR1 A;  1A1J A;  3P3E A;  3MHH C;  4X66 I;  5LMU E;  1N34 E;  4PU9 A;  5GMD A;  3LNU A;  1TF3 A;  4DR2 E;  4DV6 E;  1H72 C;  3ZZT A;  2BBG A;  2DSY A;  3L7Z A;  4OZE A;  2GO4 A;  2NN6 C;  4FW3 A;  1Z0G A;  3K17 A;  2C38 A;  4JYA E;  1OYS A;  4IZJ D;  1A1F A;  3ZKD A;  2UUB I;  1Z1B A;  2RQL A;  2I13 A;  2ZIT A;  4O43 A;  2D9H A;  2MC6 A;  1RHY A;  3V2U C;  1FWK A;  3NZK A;  2EJ4 A;  4LTY A;  1WXR A;  1Y5Y A;  2CPN A;  2LT7 A;  2EOZ A;  2YPN A;  3VK6 A;  1ELO A;  2R42 A;  3QT6 A;  4MDT A;  3GLL A;  2WBU A;  3L7Z B;  1EH8 A;  3HQ1 A;  2ELY A;  2YSP A;  4WX9 A;  4JI3 E;  2C38 B;  3M7N G;  4JI7 I;  2EN7 A;  4DUY I;  4FWD A;  2YTD A;  2EM9 A;  5IXM B;  3EPH A;  4MU4 A;  3THO B;  2UXB E;  5GME A;  4ZYG A;  1IBK E;  1X3C A;  2PO2 A;  1RMD A;  1J5E E;  2EZ6 A;  2C37 A;  4JI8 E;  2FV4 B;  2IES A;  5T6J A;  2FTX B;  4DV0 E;  1FKA E;  1K47 A;  4B3S E;  5FLX Q;  4DV1 E;  2HFU A;  3ZZ0 A;  5AAS A;  1RRE A;  4X65 I;  4AID A;  4JI0 I;  2EMG A;  1MU5 A;  1G2D C;  2RPC A;  2EPC A;  2N3G A;  3ADG A;  2HHH E;  2EN6 A;  4LFC E;  1MGT A;  3J81 Q;  1UEK A;  4L8N A;  3OTO I;  3ECR A;  1MEY C;  2PO2 B;  2DEI A;  2UUA I;  2VQE I;  4XTJ A;  4LPF A;  2V89 A;  4GZN C;  4NHR A;  3ADL A;  1KTV A;  1IQO A;  2J7J A;  4FWH A;  5LMN I;  3EPL A;  4AQY E;  4B3M I;  4U3B A;  2WBS A;  3LPS A;  4FW5 A;  4JV5 I;  2UUC E;  2GQ0 A;  4LF9 E;  1USV A;  2F1D A;  1L4S A;  4DR7 E;  4LF7 I;  1UDS A;  1Z5A A;  5EKW A;  5K36 A;  1GQE A;  4BA2 A;  1ZU1 A;  4LFA I;  4IS1 C;  1EH7 A;  4IJD A;  4R1F A;  2UU9 E;  1SFE A;  3J80 C;  2C39 B;  2MDG A;  4GEQ B;  2X7I A;  4N4R B;  2JEB B;  1X48 A;  1IBM I;  3IWD A;  3HKM A;  2BA0 D;  2YRH A;  2UUB E;  1O0W A;  3PS3 A;  4LCG A;  1A1K A;  1YZ9 A;  1N32 I;  2NN6 A;  3UK3 C;  5LL6 R;  2EM2 A;  4NXM E;  1TN9 A;  2JOB A;  3DJW A;  2O1V A;  2JOX A;  2F4V I;  2F8B A;  1Y4S A;  3HPZ A;  2BB8 A;  2LVH A;  3JTZ A;  2YTJ A;  1BKN A;  3B82 A;  2PO0 A;  4FW9 A;  2EL4 A;  2H36 X;  1XMO E;  1S4E A;  1N33 I;  2NN6 B;  4LF4 I;  1X49 A;  2EOH A;  3C4B A;  2NUG A;  5ADZ A;  2B7T A;  2BA1 G;  1A1L A;  3F0N A;  3ADJ A;  2ZM6 I;  4KHP E;  1YUI A;  1Z0V A;  2O3Z A;  1YFH A;  4DR3 I;  1PVG A;  1BB8 A;  5KL5 A;  1YPN A;  3JAM C;  2JY9 A;  4DR5 I;  5DRQ A;  4OX9 E;  4BCA A;  2V87 A;  1E3P A;  4QNK A;  4Q35 B;  2CSH A;  4MYU A;  3HXL A;  2PO0 B;  4HTG A;  4IZJ B;  4LU9 A;  4UTG A;  1Y4U A;  5DRR A;  1QZR A;  3HUL A;  2EMK A;  4RPF A;  2EQ0 A;  2EPU A;  4LF8 I;  4MLV A;  2NUF A;  2BA0 G;  2VES A;  1Z0W A;  4LFB I;  4EMD A;  1JK2 A;  1H74 A;  3KZZ A;  2DB2 A;  2EE8 A;  3PYF A;  5DNL A;  2EPR A;  5C0X E;  2EN8 A;  4R03 A;  4DUZ E;  4K0K I;  2DLQ A;  2LMZ A;  2M7Q A;  1XMQ E;  2RSM A;  4N3O A;  2IOQ A;  4L5N C;  4DPX A;  1IBL E;  3CDJ A;  1UHZ A;  4MU1 A;  2XEX A;  3M7N D;  1FJG I;  2MKN A;  2A2D A;  1XNR I;  4F9C B;  1HNZ I;  1XHK A;  1ZM3 A;  2A25 A;  3J81 C;  4DR4 I;  4M0V A;  1R6M A;  3C6M A;  2WZO A;  2I9I A;  4LF6 E;  1QU6 A;  4NBQ A;  1Z0C A;  4ZYD A;  1USU A;  1HNW E;  2LJH A;  1HR0 I;  3J7A G;  4BS9 A;  2ELZ A;  1AH5 A;  4F9A B;  1YUJ A;  2LUQ A;  1STU A;  2EPA A;  1EI1 A;  2YWQ A;  4BMJ A;  2IER A;  5C0X D;  4WYQ B;  5JEA E;  2F4V E;  1S16 A;  4GKK E;  4B3R I;  2V34 A;  2CGE A;  2J65 A;  4DV4 E;  4DPU A;  2EL6 A;  2R1F A;  2PNM A;  2RTX A;  2X36 A;  2KOU A;  2YU8 A;  4KZS A;  4GQU A;  5L3J A;  1JK1 A;  2JEA A;  1A1G A;  1P47 A;  3AUZ A;  4DV2 E;  1YSA C;  2N8X A;  3WU3 A;  2EM0 A;  5A2Q C;  3GON A;  2EMW A;  2YZT A;  4NXN E;  2M1S A;  2DEJ A;  3U1K A;  3JAM Q;  4DPY A;  5C0X C;  2M9A A;  4DV7 E;  2YTN A;  2IHR 1;  3EQ1 A;  3DD6 A;  4DR3 E;  2WNR B;  4JI1 I;  5TSE A;  2J7K A;  2EOJ A;  4R2A A;  2VQF I;  1T4L B;  2JEA B;  4AM3 A;  1KVK A;  4PRX A;  3BGH A;  2EOM A;  2JYA A;  4HXZ A;  2PO1 B;  3Q1Q A;  2UXC I;  4DV5 I;  1GTK A;  2Q8U A;  4P7A A;  1ZBT A;  2ENA A;  4DR1 I;  4HY1 A;  3VYX A;  2EN2 A;  1Z5B A;  2BR2 A;  2DIX A;  4WFT A;  3EPK A;  2VF3 A; 
#chains in the Genus database with same CATH homology
 3T1Y E;  3Q6N A;  1H73 A;  2L33 A;  2V8P A;  2LRS A;  1Z5C A;  2HK3 A;  2R3V A;  3D4J A;  4YHH E;  1ZM2 A;  1Z0E A;  2Z5B A;  1HK7 A;  4JI2 I;  2LTS A;  2B9D A;  3WU4 A;  4X64 I;  3T1H I;  2MC5 A;  2M4I A;  3CWV A;  4B3T I;  4JI5 I;  2B7V A;  4UT4 A;  1HR0 E;  4LF5 I;  2UXD I;  3QT8 A;  2Z5B B;  4X66 E;  2L2M A;  3Q6M A;  3HTX A;  5BR8 I;  1B63 A;  1N0V C;  4ZVI A;  5AE3 A;  4DR6 I;  2B3T B;  2IOP A;  5A2Q Q;  4X62 I;  2K4V A;  3P1X A;  1ZM4 A;  1NHH A;  3ZKB A;  3LML A;  2L3J A;  1UIL A;  5IWA I;  1DQ3 A;  2O1T A;  2LJP A;  1B62 A;  3ADI A;  3K1J A;  1N36 I;  4JI6 I;  4Z7C A;  4JI7 E;  5CFF E;  4DUY E;  4YY3 I;  3MSW A;  4P52 A;  1I94 I;  2E5L I;  4USK A;  2EFG A;  4IZJ A;  3B78 A;  2L2N A;  1HNX I;  2L3C A;  3PYE A;  3H09 A;  4JI4 I;  2Q2E B;  4OOG C;  2MDR A;  1PKP A;  1RQ0 A;  3V5R A;  4X65 E;  2BM1 A;  4JI0 E;  2V86 A;  1N34 I;  1Y6Z A;  4DR2 I;  3OTO E;  4DV6 I;  2UUA E;  2VQE E;  2N3H A;  4DMI A;  2RS7 A;  1EA6 A;  3WU5 A;  2L2K B;  4JYA I;  1DAR A;  5LMN E;  4B3M E;  4JV5 E;  1RC7 A;  2KHX A;  4URL A;  4DU8 A;  4LF7 E;  2O1U A;  5DNY A;  1YYW A;  4LFA E;  1ZM9 A;  1PIE A;  1X47 A;  3LLH A;  4JI3 I;  1IBM E;  4HYM A;  2HFS A;  2L6M A;  3B8H A;  2O1W A;  2UXB I;  1IBK I;  3PYG A;  1J26 A;  1N32 E;  2BV3 A;  1J5E I;  3J7A M;  5FWK A;  4JI8 I;  2ZBK B;  1XNQ I;  4MYT A;  3FIG A;  4DV0 I;  4Z7Y A;  4B3S I;  4BC9 A;  1FI4 A;  2L92 A;  1NHJ A;  1ZXM A;  2Z5C A;  3K6Q A;  4YY3 E;  2WW4 A;  2HHH I;  4WPY A;  1FNM A;  4LFC I;  4WUB A;  1A6F A;  4F9B B;  1KKH A;  2Z5E A;  4PRV A;  1D6T A;  1N33 E;  4DU7 A;  4LF4 E;  2VE7 C;  1WUU A;  5F3W A;  2CG9 A;  3H4L A;  1NHI A;  2ZM6 E;  4DPT A;  4AQY I;  3HJC A;  4R8O A;  4M2Z A;  2UUC I;  4DR5 E;  2Z5C B;  4M1K A;  4LF9 I;  2V8Q B;  4DR7 I;  1H7S A;  2VF1 A;  1H7U A;  5AE2 A;  2UU9 I;  2NA2 A;  4LF8 E;  4LFB E;  2ODR C;  4TUI A;  4WSP A;  3K85 A;  1N0U A;  2OI2 A;  1FWL A;  2A2C A;  4K0K E;  4KQV A;  3PRY A;  3RMP A;  4FN5 A;  2BM0 A;  3F6G A;  4NXM I;  3DF6 A;  2E1R A;  2KON A;  1FJG E;  1XNR E;  4JG4 A;  1HNZ E;  3OML A;  3C4T A;  4DR4 E;  1ZXN A;  2V88 A;  1T4O A;  3M6A A;  2PNL A;  1XMO I;  4DPW A;  4J8Z A;  4DV3 I;  1Z0B A;  1XNQ E;  1GZ6 A;  3IWB A;  4KHP I;  3WU6 A;  2AJ4 A;  4B3R E;  1ZBQ A;  4OX9 I;  4Q28 A;  3VYY A;  4X8W A;  2YT4 A;  3F6H A;  3LTO A;  4P78 A;  2GS8 A;  4JI1 E;  4DUZ I;  2RS6 A;  1XMQ I;  3QT7 A;  2VQF E;  1Z0T A;  2V85 A;  1IBL I;  2UXC E;  4DV5 E;  4GKJ I;  1T4N A;  2E1M A;  5AE1 A;  4DR1 E;  4I3H A;  2LUP B;  2G7H A;  2L8T A;  3ZZU A;  4IZK A;  4LF6 I;  2HKJ A;  1HNW I;  1RR9 A;  3J7Y p;  4F54 A;  1WHN A;  3HPS A;  4JI2 E;  1MG7 A;  2EWL A;  5IT9 C;  4FWG A;  2V2Q A;  2DMY A;  4X64 E;  4DXL A;  4GKK I;  3T1H E;  2LBS B;  4DV4 I;  4B3T E;  4JI5 E;  1EKZ A;  4IZK B;  3ZOQ B;  4DV2 I;  1SR9 A;  1U2R A;  2CZ9 A;  4DV3 E;  1MX0 A;  1WHQ A;  2JWO A;  4NXN I;  4LF5 E;  2UXD E;  2NPF A;  3QT5 A;  4DV7 I;  5BR8 E;  1VIS A;  3JU0 A;  4DR6 E;  4BC7 A;  3IWC A;  2V2V A;  4HAC A;  1NZ0 A;  4X62 E;  3ZM7 A;  4ED4 A;  1YYO A;  2V2Z A;  4P7D A;  2JVA A;  1KIJ A;  5LMU I;  2HKE A;  2FGG A;  4DKK A;  5IWA E;  3T1Y I;  4DV1 I;  3J80 Q;  2V83 A;  1N36 E;  4YHH I;  1Z59 A;  4JI6 E;  1YYK A;  4HAC B;  2E5L E;  5FLX C;  1I94 E;  4M30 A;  2NUE A;  4GKJ E;  4WUD A;  4TUG A;  1DI2 A;  2LTR A;  1OJ4 A;  3P06 A;  1HNX E;  3PYD A;  4BBY A;  3KWR A;  4JI4 E;  2LE2 A;  4USM A;  2HK2 A;  4I8O A;  5IT9 Q;  2ODR D;  4WUC A;  3AV0 A;  2JR1 A;  4X66 I;  1N34 E;  4PU9 A;  5GMD A;  3LNU A;  4DR2 E;  4DV6 E;  1H72 C;  3ZZT A;  2DSY A;  1Z0G A;  3K17 A;  3ZKD A;  4JYA E;  4IZJ D;  2UUB I;  2ZIT A;  3V2U C;  2MC6 A;  1FWK A;  4LTY A;  1WXR A;  2CPN A;  3VK6 A;  1ELO A;  2R42 A;  3QT6 A;  3HQ1 A;  4JI3 E;  4JI7 I;  4DUY I;  4FWD A;  2UXB E;  5GME A;  1IBK E;  1J5E E;  2EZ6 A;  4JI8 E;  2FV4 B;  5T6J A;  2FTX B;  1FKA E;  4DV0 E;  1K47 A;  4B3S E;  5FLX Q;  4DV1 E;  2HFU A;  3ZZ0 A;  5AAS A;  1RRE A;  4X65 I;  4JI0 I;  1MU5 A;  2N3G A;  3ADG A;  2HHH E;  4LFC E;  3J81 Q;  1UEK A;  4L8N A;  3OTO I;  2DEI A;  2UUA I;  2VQE I;  4XTJ A;  2V89 A;  3ADL A;  1KTV A;  4FWH A;  5LMN I;  4AQY E;  4B3M I;  4JV5 I;  3LPS A;  2UUC E;  2GQ0 A;  4LF9 E;  1USV A;  4DR7 E;  4LF7 I;  1Z5A A;  1GQE A;  4LFA I;  4R1F A;  2UU9 E;  3J80 C;  4GEQ B;  2X7I A;  1X48 A;  1IBM I;  3IWD A;  2UUB E;  1O0W A;  1YZ9 A;  1N32 I;  5LL6 R;  4NXM E;  2JOB A;  3DJW A;  2O1V A;  2JOX A;  2F4V I;  2F8B A;  1Y4S A;  3HPZ A;  3JTZ A;  1BKN A;  3B82 A;  4FW9 A;  2H36 X;  1XMO E;  1S4E A;  1N33 I;  4LF4 I;  1X49 A;  3C4B A;  2NUG A;  5ADZ A;  2B7T A;  3F0N A;  3ADJ A;  2ZM6 I;  4KHP E;  1Z0V A;  4DR3 I;  1PVG A;  3JAM C;  2JY9 A;  4DR5 I;  4OX9 E;  4BCA A;  2V87 A;  4MYU A;  3HXL A;  4IZJ B;  4LU9 A;  4UTG A;  1Y4U A;  1QZR A;  3HUL A;  4RPF A;  4LF8 I;  4LFB I;  2NUF A;  1Z0W A;  4EMD A;  1H74 A;  2DB2 A;  3PYF A;  4R03 A;  4DUZ E;  4K0K I;  2LMZ A;  2M7Q A;  1XMQ E;  2RSM A;  4N3O A;  2IOQ A;  4L5N C;  4DPX A;  1IBL E;  1UHZ A;  2XEX A;  1FJG I;  2A2D A;  1XNR I;  4F9C B;  1HNZ I;  1XHK A;  1ZM3 A;  3J81 C;  4DR4 I;  4M0V A;  2WZO A;  4LF6 E;  1QU6 A;  1Z0C A;  1USU A;  1HNW E;  2LJH A;  1HR0 I;  3J7A G;  4BS9 A;  4F9A B;  2LUQ A;  1STU A;  1EI1 A;  4BMJ A;  4WYQ B;  2F4V E;  1S16 A;  4GKK E;  4B3R I;  2V34 A;  2CGE A;  4DV4 E;  4DPU A;  2PNM A;  2RTX A;  2X36 A;  2KOU A;  4KZS A;  5L3J A;  3AUZ A;  4DV2 E;  3WU3 A;  5A2Q C;  3GON A;  2YZT A;  4NXN E;  2M1S A;  2DEJ A;  3JAM Q;  4DPY A;  4DV7 E;  2IHR 1;  4JI1 I;  4DR3 E;  2J7K A;  2VQF I;  1T4L B;  1KVK A;  4PRX A;  4HXZ A;  3Q1Q A;  2UXC I;  2DIX A;  4DV5 I;  4P7A A;  1ZBT A;  4DR1 I;  4HY1 A;  3VYX A;  1Z5B A;  5LMU E;  4WFT A;  2VF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...