2UXDE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxdE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdE02
2N3HA 4HY1A 2L2MA 1FJGE 4WUDA 4DV5I 1KKHA 2A2CA 1XMOI 4DV2E 2JY9A 1IBKE 1J5EI 3OTOI 1N33E 1RR9A 2RS7A 5LL6R 2VQEE 4USKA 1Z5CA 2N3GA 4DPWA 1PVGA 4KHPI 3ADLA 1HNXI 4FWHA 4DV1E 4DR1E 2DEJA 4DU8A 3LPSA 1FI4A 3T1HE 2L3JA 1N33I 1BKNA 4JG4A 3ADJA 3B8HA 5L3JA 4GKJE 4MYTA 4FWDA 3J7AG 5CFFE 4DV1I 4JYAI 2VQFE 4GKJI 4XTJA 4DV2I 2UUAE 4DV3I 4AQYE 1Z0GA 4DPXA 4JI6I 4JI3I 4DV5E 1X47A 3ZKDA 4LFAE 4DR2E 2UUAI 4NXNE 2J7KA 4HACB 2X7IA 2F4VE 4X8WA 1VISA 4M1KA 3V5RA 4JI7E 4WUCA 4LFCI 3C4TA 2E5LI 1UILA 3K17A 4HYMA 4DV6E 1ZM4A 4WFTA 4LFAI 3ZZUA 4FWGA 5A2QC 2V8PA 2B3TB 3WU4A 2UXBI 1UHZA 2LTSA 4DV3E 4DV0E 2DIXA 2LJPA 1RQ0A 2NA2A 1ZM9A 1U2RA 1QZRA 2IHR1 1YYKA 4WYQB 2UU9E 2ZM6E 3QT7A 3Q1QA 5A2QQ 5IT9C 2F4VI 2HK3A 4DR4E 1ZBTA 1WHNA 3D4JA 3HULA 2ZM6I 2XEXA 1WHQA 1T4LB 1N36E 2YT4A 3PYFA 4M2ZA 2JVAA 4NXMI 4PRVA 2LRSA 2V2ZA 1Z0VA 2ZITA 4JI1E 1S4EA 1XNRI 2A2DA 1NHIA 4DUYE 4GKKI 3ZM7A 1MX0A 2MDRA 3ZZ0A 2UUBE 4LF7I 4JI3E 1S16A 4KHPE 2UXBE 4JI5E 1J5EE 1IBKI 4DR2I 1H7SA 3QT8A 4LF7E 2DEIA 4X65I 1XHKA 1HNWI 5LMUE 2UXDI 2RS6A 4PRXA 1XMQI 4EMDA 4ED4A 1J26A 1FJGI 1N34E 4NXNI 4ZVIA 1HNWE 1FWLA 1Z0CA 3PYGA 4K0KE 4JI1I 2HHHI 3JAMC 1YYOA 4LF5E 3J7Yp 4B3SE 4JI5I 5LMNI 1HNZI 4AQYI 1IBME 4JYAE 4DUYI 1XNRE 4LF9E 3JAMQ 4LF4E 4DR5E 5IWAE 3HTXA 4B3ME 2B7VA 2BM1A 1HR0I 2UUCI 4LF4I 1H72C 2LUQA 4DU7A 4B3SI 4X65E 3ZKBA 1I94E 1ZM3A 2R3VA 2LBSB 4DR6E 4JI2E 1EI1A 1H73A 2V2VA 4JV5I 4B3RI 1NHJA 1N34I 1UEKA 3ZZTA 2NPFA 2HHHE 4LF9I 1DARA 2CPNA 3J80C 1PIEA 1HNZE 4LFBE 5LMNE 2OI2A 4DR6I 4B3RE 4OOGC 4JV5E 3ADIA 1H74A 2RSMA 2NUFA 1K47A 3M6AA 2UXCE 1I94I 4M30A 1O0WA 4B3MI 3LTOA 3F0NA 1A6FA 5LMUI 1XMQE 4USMA 4Z7CA 1MU5A 2ZBKB 2V34A 4DV0I 1X48A 4X64I 3T1YE 3GONA 1Z5BA 5IT9Q 4X62I 2DB2A 3LLHA 1FWKA 2LJHA 3WU3A 1HNXE 4UT4A 4DR5I 5BR8E 4K0KI 4RPFA 4YHHI 1DI2A 4JI0I 1IBMI 1H7UA 2WW4A 3PYEA 4JI7I 2NUEA 4WUBA 3J81Q 2BV3A 4JI2I 1IBLI 1B63A 4LF5I 4R1FA 1KIJA 4YY3I 1NZ0A 1FNMA 2UUBI 1D6TA 5FLXQ 3QT6A 2L3CA 1WUUA 1FKAE 2L33A 4P7AA 1N0UA 4LF8E 1XNQE 3J7AM 5GMDA 1OJ4A 4DV4I 4DUZE 2EZ6A 3C4BA 2UUCE 3CWVA 3T1HI 1Z0EA 5FLXC 1XNQI 4OX9E 2EFGA 4LF6E 4KQVA 3VYXA 4JI0E 5GMEA 4JI8I 1ZM2A 4B3TE 4DR3I 2RTXA 1PKPA 1NHHA 3K1JA 3QT5A 4DPTA 2VQFI 2VF3A 3B78A 4P52A 4DR3E 4B3TI 2R42A 1MG7A 4OX9I 1YYWA 4LF8I 2E1RA 4JI6E 2NUGA 3LNUA 4Z7YA 2CZ9A 4I3HA 1RC7A 4HACA 3T1YI 1QU6A 5IWAI 4DR4I 4JI4E 4DKKA 4FN5A 1KVKA 2VQEI 4DPYA 4X66E 1STUA 5BR8I 4PU9A 1IBLE 4MYUA 4DUZI 3OTOE 2LUPB 4NXME 3WU5A 2UXCI 4DV4E 2GS8A 2BM0A 3J80Q 1RREA 4X66I 4GKKE 1EA6A 1Z5AA 1ZXMA 4DR1I 1T4NA 1GQEA 1Z0WA 1N32E 1Z0BA 1Z0TA 4YY3E 2B7TA 2UU9I 2AJ4A 4YHHE 4X64E 2L2NA 1EKZA 1X49A 1HR0E 1YZ9A 1N36I 2HKJA 1ELOA 1ZXNA 2E5LE 4DV7I 2HKEA 4JI4I 4LF6I 2L2KB 1N0VC 4URLA 2LTRA 3V2UC 4JI8E 1XMOE 4DV7E 4X62E 3ADGA 1Z59A 2HFUA 3PYDA 3VYYA 3P1XA 4DV6I 2KHXA 4DXLA 3H4LA 1B62A 2HFSA 4LFBI 2Q2EB 2HK2A 4DR7E 4HXZA 3J81C 4LFCE 4DPUA 1N32I 1T4OA 2DMYA 4FW9A 4UTGA 4DR7I 3B82A 2UXDE 1KTVA 2X36A 3WU6A 2V2QA
chains in the Genus database with same CATH superfamily
1UDQA 4IS1C 2N3HA 3HJCA 4HY1A 4R2CA 1YUIA 4OO1A 2D9HA 2L2MA 1FJGE 3B4TA 2EL5A 3K85A 4Q28A 2PO0B 4WUDA 4IFDD 2LV2A 4DV5I 2ODRD 1KKHA 2A2CA 2ELYA 1XMOI 3C6MA 2JY9A 2MC6A 4DV2E 1IBKE 1J5EI 2M1SA 1MEYC 2LJUA 3OTOI 1N33E 2EORA 1RR9A 2RS7A 5LL6R 2VQEE 4USKA 1Z5CA 5DNYA 2EMYA 2N3GA 2YU8A 3HXLA 2NN6F 3THOB 2EM2A 4DPWA 2PO2B 5JEAA 1PVGA 2AE8A 2EOYA 3M85G 2EPKX 2EOXA 4R2DA 4KHPI 3M99B 3ADLA 4IJDA 2LE2A 1A1FA 1HNXI 4FWHA 1YPNA 3PRYA 4DV1E 4DR1E 5A6AA 2DEJA 2EOQA 2PO1A 4ZYDA 4DU8A 3LPSA 3DF6A 1FI4A 2PNZB 3JU0A 1ZAAC 2EPLX 3T1HE 2HGHA 2RSIA 2L3JA 1N33I 3AUZA 3RMPA 2NABA 4I8OA 1IMUA 1BBOA 1IQOA 2EMIA 1YUJA 1BKNA 4JG4A 2IOPA 2EPAA 3EQ1A 5AC5A 3ADJA 3B8HA 2EPRA 4BBYA 1A1KA 2WNRB 5L3JA 3T1YI 2EE8A 2FV4B 4GKJE 2YZTA 2VE7C 3ZOQB 1KJKA 4FWDA 4P78A 4MYTA 1P47A 2EPXA 3J7AG 5CFFE 2JEBB 4MU1A 2VQFE 4DV1I 4JYAI 5K36B 2EN1A 4GKJI 5AE3A 2LO3A 4DMIA 1XXEA 4XTJA 2O3ZA 4DV2I 2UUAE 3LMLA 1NEIA 2NN6D 4AQYE 1Z0GA 4WXDA 4DPXA 4DV3I 4JI6I 2ENCA 1UBDC 2V86A 1A1IA 4JI3I 4DV5E 1X47A 5FWKA 4HEIA 5T6JA 2JYAA 3ZKDA 4LFAE 1T38A 4DR2E 4J3DA 2UUAI 2YRMA 1RHYA 2A25A 2M7QA 3GMEA 4NXNE 2J7KA 4HACB 2EOIA 4M9VC 2X7IA 2DRPA 2F4VE 4X8WA 1VISA 4M1KA 3V5RA 4JI7E 2IERA 2VRDA 1HK7A 1B69A 4WUCA 4LFCI 3C4TA 2E5LI 1UILA 3K17A 1Y60A 4DV6E 1ZM4A 3EPHA 4HYMA 4WFTA 4LFAI 2IOQA 3ZZUA 5KL5A 4FWGA 5A2QC 2V8PA 1PDAA 2B3TB 3WU4A 4R03A 2UXBI 2E1MA 1UHZA 2LTSA 2L8TA 4DV3E 4DV0E 4R2SA 1WRJA 1TF6A 2DIXA 4IFDC 2LJPA 1RQ0A 5A6BD 2NA2A 5AE2A 1ZM9A 2VF1A 1U2RA 1QZRA 1PJQA 2IHR1 1YYKA 3P3EA 2JR1A 2EN2A 4WSPA 4WYQB 2UU9E 2NN6E 3EPJA 4FW6A 2ZM6E 3QT7A 2EN8A 2L92A 3Q1QA 5A2QQ 2R1FA 2EN6A 1BBGA 5IT9C 2F4VI 4L8NA 2JP9A 2HK3A 2EPMX 3F6GA 4DR4E 4MLVA 1ZBTA 1WHNA 5TSEA 2PNZA 3D4JA 3HULA 3UHMA 2ZM6I 5JEAC 2XEXA 3DJWA 4FK5C 4IZJB 1WHQA 2YPNA 1NCSA 1T4LB 1N36E 3CDJA 2YT4A 1SFEA 3PYFA 3U1YA 1R6MA 4M2ZA 2VESA 5AC4A 2JVAA 2JWOA 3VK6A 4NXMI 3ECRA 4F6NA 4PRVA 2JEAA 2LRSA 2I13A 4ZYHA 2V2ZA 1YSAC 1Z0VA 2G7HA 3P76A 2EM3A 2ZITA 5A6BA 4JI1E 1S4EA 2GLIA 1XNRI 2A2DA 1NHIA 4DUYE 5AASA 1UDOA 1YH8A 4GKKI 3ZM7A 1MX0A 2MDRA 3ZZ0A 2ENAA 2UUBE 2Z5EA 2EL6A 3EPLA 1MGTA 4JI3E 1S16A 4KHPE 3L7ZB 4LF7I 2UXBE 4FW7A 2PNLA 4JI5E 4OO1B 4N4RB 1J5EE 1G2DC 1IBKI 3BF2A 4DR2I 2M9AA 3OMLA 1H7SA 4WPYA 2EQ0A 4LOMA 2GO4A 3QT8A 4LF7E 2DEIA 4X65I 2CG9A 2EM0A 2JPAA 1XHKA 3BIDA 3JTZA 4BC9A 1BB8A 1HNWI 2PRTA 5LMUE 1YHCA 2RS6A 4PRXA 1XMQI 4EMDA 4OKGA 2UXDI 2ODRC 4ED4A 4KZSA 1TN9A 2GQ0A 1J26A 4OO1F 5IV8B 5KL6A 1N34E 2H36X 1FJGI 4NXNI 4ZVIA 1HNWE 5DNLA 4IFDF 1FWLA 1AAYA 2PO2A 1EH7A 1Z0CA 4K0KE 2PO0A 3KRNA 3PYGA 4JI1I 2HHHI 3JAMC 3CDIA 4IZKB 1YYOA 4LF5E 2K7IA 2YTOA 3J7Yp 4KWYA 5ADZA 4B3SE 4BHCA 5LMNI 4JI5I 1HNZI 3FIGA 3Q6MA 4LTYA 4AQYI 2YRKA 2JOBA 1E3PA 4U3BA 4BHBA 3MHSC 1IBME 2EN3A 4JYAE 4DUYI 1XNRE 4LF9E 3BGHA 3HKMA 4O43A 3JAMQ 4BA2B 3HQ1A 2ADRA 2YTIA 4LF4E 4DR5E 4IFDA 5IWAE 4ISAA 3HTXA 2CT1A 4B3ME 2B7VA 1X5WA 2BM1A 2EMAA 3H1CA 3IWCA 4FW3A 3PS2A 2V87A 1HR0I 4Q35B 2UUCI 5AE1A 2C38B 4BA1A 4LF4I 1H72C 2LUQA 4DU7A 4N3OA 4B3SI 4X65E 5K36C 3GLLA 3P06A 3ZKBA 1EH6A 2ELZA 2EN4A 1I94E 2Z5CB 1ZM3A 2R3VA 3THNA 2LBSB 1ZBQA 2EPUA 4DR6E 5DRQA 4JI2E 3UK3C 5KL7A 4LPFA 1EI1A 1H73A 2V2VA 2V89A 4JV5I 4LCGA 4QNJA 4R2AA 3PS3A 5JEAF 4B3RI 1A1HA 1NHJA 1N34I 1UEKA 3ZZTA 2EOSA 2NPFA 4BC7A 2HHHE 4LF9I 1PJTA 2O1VA 1DARA 2EMBA 4MQYA 2CPNA 4L5NC 2Z5BB 2M4IA 2YTDA 3J80C 1OYSA 1PIEA 5K36D 1X6HA 1YFHA 1HNZE 4LFBE 2PNMA 5LMNE 1LLMC 2RQLA 2EOHA 1IQSA 3C6KA 2OI2A 4B3RE 1WJPA 2GO3A 4DR6I 2WZOA 4OOGC 4OO1C 2FGGA 4JV5E 3ADIA 1H74A 2GHFA 1UDSA 1RMDA 2RSMA 2NUFA 1K47A 2RPCA 3M6AA 3U1KA 5KL2A 2E72A 1F2IG 2UXCE 2EMCA 1Y5YA 1I94I 1GTKA 4M30A 2EWLA 1O0WA 1VI7A 4B3MI 3LTOA 3F0NA 5C0XD 1R6LA 4NBQA 1L4SA 2O1WA 1A1GA 1A6FA 5LMUI 4OO1E 1XMQE 4USMA 4IZJD 2V88A 2YTEA 4IFDE 4R8OA 1A1LA 4BS9A 4R2PA 1JK2A 1MU5A 2YTPA 3BBGA 2ZBKB 4Z7CA 2V34A 4MDTA 2EOEA 4FW4A 4DV0I 1X48A 2YTFA 2BA1G 3T1YE 3GONA 1DGCA 1Z5BA 4X64I 2EM4A 5IT9Q 4X62I 2DB2A 3LLHA 1FWKA 2DSYA 2EOFA 2LJHA 4AIMA 1UN6B 3L7ZA 2EL4A 3WU3A 4RH8A 1HNXE 2WP8A 2K4VA 3QG5C 4UT4A 4DR5I 5BR8E 2C37A 4K0KI 4RPFA 1A1JA 2JE6B 2NN6A 2CGEA 4YHHI 3K6QA 1ZU1A 2R76A 1DI2A 4JI0I 1IBMI 1H7UA 4QNKA 2B9DA 2WW4A 3PYEA 2NN6B 2J65A 2WNRA 2EM7A 2EMLA 2C37B 2KOUA 2EN7A 4JI7I 2NUEA 2WP8B 3EPKA 2WBSA 2BA0D 2NN6C 4WUBA 2GPIA 2DLKA 3AV0A 2Z5CA 2C39A 4GQUA 5EL9A 2BV3A 3J81Q 4F2JC 4JI2I 1IBLI 3P3CA 2ENHA 1B63A 4LF5I 2LMZA 5DRPA 4FW5A 4R1FA 2EPCA 4IZKA 1ZR9A 1KIJA 1NZ0A 4YY3I 2YRHA 1FNMA 4MU0A 4GEQB 2BR2A 4MLQA 3IWDA 5JEAE 2DMIA 2UUBI 1D6TA 5FLXQ 2DGCA 2YSOA 3QT6A 2JE6A 2L3CA 1WUUA 3Q6NA 2O1TA 3L00A 1FKAE 2L33A 4P7AA 3M85D 4TUIA 4F9CB 4ZYGA 2Z5BA 4LCFA 1N0UA 4LF8E 3KWRA 2BBGA 1XNQE 5JEAD 3J7AM 5GMDA 1OJ4A 5A6JA 4DV4I 2EJ4A 2KONA 4TUGA 4LCHA 5C0XE 3C4BA 4DUZE 2HC5A 2EZ6A 2JT2A 2UUCE 3CWVA 4BMJA 3T1HI 1Z0EA 5FLXC 4WX9A 1T39A 1XNQI 2YTQA 2JEAB 4OX9E 2EFGA 2BB8A 4LF6E 5KL3A 5K36E 4KQVA 3VYXA 3IWBA 3M7NG 4JI0E 5GMEA 4JI8I 4AM3A 1ZM2A 4B3TE 1G2FC 4DR3I 2CSHA 2EMFA 2RTXA 5F3WA 1PKPA 2WCC3 1NHHA 3MSWA 4MU4A 1AH5A 3K1JA 3QT5A 2LCEA 1X6EA 2BR2B 4DPTA 2F1DA 2VQFI 2EPZA 2V85A 2EM6A 2VF3A 3B78A 4P52A 4DR3E 4B3TI 1OYPA 2FTXB 4X9JA 2R42A 1MG7A 4OX9I 2LVHA 1YYWA 4LF8I 1X6FA 2E1RA 4J8ZA 1USVA 1TF3A 4JI6E 2NUGA 4NHRA 3LNUA 4Z7YA 2CZ9A 4I3HA 1RC7A 2N8XA 2DLQA 2Q8UA 3HPSA 1QU6A 4HACA 2EMWA 3HPZA 4HTGA 4JI4E 5IWAI 5DNXA 3TQMA 1JK1A 2O1UA 4DKKA 5EKWA 4FN5A 2EM8A 5LLQA 4IFDB 1KVKA 2CTDA 2VQEI 4DPYA 4X66E 1STUA 4OO1D 1GZ6A 5IXMB 5BR8I 4WSGA 2MDGA 4PU9A 1IBLE 4MYUA 4DUZI 3OTOE 2L6MA 2LUPB 1Y6ZA 3M7ND 5A69A 4NXME 2BA1D 2LT7A 2EM9A 5DROA 3WU5A 4NZVA 1UDNA 1PJSA 1E3HA 4R2QA 2BA0G 2EMGA 4IS9A 1X3CA 2CVEA 2UXCI 2MC5A 4O24A 4DV4E 3KZZA 4WXCA 2GS8A 2EMXA 2BM0A 1N3GA 5DRRA 3J80Q 4DR4I 2F8BA 1RREA 4M0VA 4X66I 1USUA 2PO1B 4GKKE 1P42A 1EA6A 1Z5AA 1ZXMA 4DR1I 1T4NA 1EH8A 1GQEA 2J7JA 3KZYA 4R2RA 1Z0WA 1N32E 4F6MA 3VHTB 1Z0BA 1Z0TA 5A6KA 4YY3E 2B7TA 2EQ1A 4O4KA 2UU9I 2C39B 2AJ4A 4IZJA 2WBUA 3P3GA 2YTGA 4R2EA 1SR9A 4YHHE 4X64E 2L2NA 2EPOA 1EKZA 2EOOA 1X49A 2WBTA 2V8QB 2IESA 1HR0E 2EMZA 1YZ9A 2YTJA 5C0XF 2EMHA 5KL4A 4BCAA 4BA2A 5JEAB 2YWQA 5ELWA 2V83A 2HKJA 1ELOA 1N36I 1ZXNA 2YU5A 1DQ3A 4P7DA 1OYRA 2YSPA 2MKDA 5K36F 2E5LE 4DV7I 1QNTA 2EM5A 2HKEA 2JXPA 4JI4I 5K36A 4LF6I 3NZKA 2EPNA 2L2KB 3MHHC 2YTNA 2EQ3A 4ZYEA 1N0VC 4URLA 2LTRA 3V2UC 4F54A 2EMKA 4JI8E 1XMOE 5C0XB 1Z1BA 4RHBB 4DV7E 4X62E 3GCMA 5C0XC 3ADGA 1Z59A 4AIDA 2EPPA 4U3DA 2JOXA 2HFUA 3PYDA 3H09A 3VYYA 3P1XA 1WXRA 2HJJA 4F9BB 1Y4SA 2KHXA 4DXLA 4DV6I 3H4LA 1B62A 2HFSA 5C0XA 1Y4UA 4MU3A 2EOMA 2Q2EB 2HK2A 4DR7E 4HXZA 2EOJA 4OZEA 4LFBI 3J81C 4LFCE 4DPUA 2C38A 4BA1B 1N32I 1T4OA 3F6HA 2DMYA 4FW9A 4UTGA 2EOZA 4O5GA 2I9IA 2JEBA 3PS1A 2EP3A 3DD6A 1KYQA 4DR7I 4GZNC 3B82A 2UXDE 1KTVA 2X36A 3WU6A 2MKNA 4F9AB 2V2QA 4LU9A
chains in the Genus database with same CATH topology
2N3HA 3HJCA 4HY1A 2L2MA 3K85A 1FJGE 4Q28A 4WUDA 4DV5I 2ODRD 1KKHA 2A2CA 1XMOI 2JY9A 2MC6A 4DV2E 1IBKE 1J5EI 2M1SA 3OTOI 1N33E 1RR9A 2RS7A 5LL6R 2VQEE 4USKA 1Z5CA 5DNYA 3HXLA 2N3GA 4DPWA 1PVGA 4KHPI 3ADLA 1HNXI 2LE2A 4FWHA 3PRYA 4DV1E 4DR1E 2DEJA 4DU8A 3LPSA 3DF6A 1FI4A 3JU0A 3T1HE 2L3JA 1N33I 3AUZA 3RMPA 4I8OA 1BKNA 4JG4A 2IOPA 3ADJA 3B8HA 4BBYA 5L3JA 2FV4B 4GKJE 2YZTA 2VE7C 3ZOQB 4MYTA 4FWDA 4P78A 3J7AG 5CFFE 4DV1I 4JYAI 2VQFE 4GKJI 5AE3A 4DMIA 4XTJA 4DV2I 2UUAE 3LMLA 4DV3I 4AQYE 1Z0GA 4DPXA 4JI6I 2V86A 4JI3I 4DV5E 1X47A 5FWKA 5T6JA 3ZKDA 4LFAE 4DR2E 2UUAI 2M7QA 4NXNE 2J7KA 4HACB 2X7IA 2F4VE 4X8WA 1VISA 4M1KA 3V5RA 4JI7E 1HK7A 4WUCA 4LFCI 3C4TA 2E5LI 1UILA 3K17A 4DV6E 1ZM4A 4HYMA 4WFTA 4LFAI 2IOQA 3ZZUA 4FWGA 5A2QC 2V8PA 2B3TB 3WU4A 4R03A 2UXBI 2E1MA 1UHZA 2LTSA 2L8TA 4DV3E 4DV0E 2DIXA 2LJPA 1RQ0A 2NA2A 5AE2A 1ZM9A 2VF1A 1U2RA 1QZRA 2IHR1 1YYKA 2JR1A 4WSPA 4WYQB 2UU9E 2ZM6E 3QT7A 2L92A 3Q1QA 5A2QQ 5IT9C 2F4VI 4L8NA 2HK3A 3F6GA 4DR4E 1ZBTA 1WHNA 3D4JA 3HULA 2ZM6I 2XEXA 3DJWA 4IZJB 1WHQA 1T4LB 1N36E 2YT4A 3PYFA 4M2ZA 2JVAA 2JWOA 3VK6A 4NXMI 4PRVA 2LRSA 2V2ZA 1Z0VA 2G7HA 2ZITA 4JI1E 1S4EA 1XNRI 2A2DA 1NHIA 4DUYE 5AASA 4GKKI 3ZM7A 1MX0A 2MDRA 3ZZ0A 2UUBE 2Z5EA 4LF7I 4JI3E 1S16A 4KHPE 2UXBE 2PNLA 4JI5E 1J5EE 1IBKI 4DR2I 3OMLA 1H7SA 4WPYA 3QT8A 4LF7E 2DEIA 4X65I 2CG9A 1XHKA 3JTZA 4BC9A 1HNWI 5LMUE 2UXDI 2RS6A 4PRXA 1XMQI 4EMDA 2ODRC 4ED4A 4KZSA 2GQ0A 1J26A 1FJGI 1N34E 2H36X 4NXNI 4ZVIA 1HNWE 1FWLA 1Z0CA 3PYGA 4K0KE 4JI1I 2HHHI 3JAMC 4IZKB 1YYOA 4LF5E 3J7Yp 4B3SE 5ADZA 4JI5I 5LMNI 1HNZI 3FIGA 3Q6MA 4LTYA 4AQYI 2JOBA 1IBME 4JYAE 4DUYI 1XNRE 4LF9E 3JAMQ 3HQ1A 4LF4E 4DR5E 5IWAE 3HTXA 4B3ME 2B7VA 2BM1A 3IWCA 2V87A 1HR0I 2UUCI 5AE1A 4LF4I 1H72C 2LUQA 4DU7A 4N3OA 4B3SI 4X65E 3P06A 3ZKBA 1I94E 2Z5CB 1ZM3A 2R3VA 2LBSB 1ZBQA 4DR6E 4JI2E 1EI1A 1H73A 2V2VA 2V89A 4JV5I 4B3RI 1NHJA 1N34I 1UEKA 3ZZTA 2NPFA 4BC7A 2HHHE 4LF9I 2O1VA 1DARA 2CPNA 4L5NC 2Z5BB 2M4IA 3J80C 1PIEA 1HNZE 4LFBE 2PNMA 5LMNE 2OI2A 4DR6I 4B3RE 2WZOA 4OOGC 2FGGA 4JV5E 3ADIA 1H74A 2RSMA 2NUFA 1K47A 3M6AA 2UXCE 1I94I 4M30A 2EWLA 1O0WA 4B3MI 3LTOA 3F0NA 2O1WA 1A6FA 5LMUI 1XMQE 4USMA 4IZJD 2V88A 4R8OA 4BS9A 4Z7CA 1MU5A 2ZBKB 2V34A 4DV0I 1X48A 4X64I 3T1YE 3GONA 1Z5BA 5IT9Q 4X62I 2DB2A 3LLHA 1FWKA 2DSYA 2LJHA 3WU3A 1HNXE 2K4VA 4UT4A 4DR5I 5BR8E 4K0KI 4RPFA 2CGEA 4YHHI 3K6QA 1DI2A 4JI0I 1IBMI 1H7UA 2B9DA 2WW4A 3PYEA 4JI7I 2KOUA 2NUEA 4WUBA 3AV0A 2Z5CA 3J81Q 2BV3A 4JI2I 1IBLI 1B63A 4LF5I 2LMZA 4R1FA 4IZKA 1KIJA 4YY3I 1NZ0A 1FNMA 4GEQB 3IWDA 2UUBI 1D6TA 5FLXQ 3QT6A 2L3CA 1WUUA 3Q6NA 2O1TA 1FKAE 2L33A 4P7AA 4TUIA 4F9CB 2Z5BA 1N0UA 4LF8E 3KWRA 1XNQE 3J7AM 5GMDA 1OJ4A 4DV4I 2KONA 4TUGA 4DUZE 2EZ6A 3C4BA 2UUCE 3CWVA 4BMJA 3T1HI 1Z0EA 5FLXC 1XNQI 4OX9E 2EFGA 4LF6E 4KQVA 3VYXA 3IWBA 4JI0E 5GMEA 4JI8I 1ZM2A 4B3TE 4DR3I 5F3WA 2RTXA 1PKPA 1NHHA 3MSWA 3K1JA 3QT5A 4DPTA 2VQFI 2V85A 2VF3A 3B78A 4P52A 4DR3E 4B3TI 2R42A 2FTXB 1MG7A 4OX9I 1YYWA 4LF8I 2E1RA 4J8ZA 1USVA 4JI6E 2NUGA 3LNUA 4Z7YA 2CZ9A 4I3HA 1RC7A 4HACA 3T1YI 3HPSA 1QU6A 5IWAI 3HPZA 4DR4I 4JI4E 2O1UA 4DKKA 4FN5A 1KVKA 2VQEI 4DPYA 4X66E 1STUA 1GZ6A 5BR8I 4PU9A 1IBLE 4MYUA 4DUZI 3OTOE 2L6MA 2LUPB 1Y6ZA 4NXME 3WU5A 2UXCI 2MC5A 4DV4E 2GS8A 2BM0A 3J80Q 2F8BA 1RREA 4M0VA 4X66I 1USUA 4GKKE 1EA6A 1Z5AA 1ZXMA 4DR1I 1T4NA 1GQEA 1Z0WA 1N32E 1Z0BA 1Z0TA 4YY3E 2B7TA 2UU9I 2AJ4A 4IZJA 1SR9A 4YHHE 4X64E 2L2NA 1EKZA 1X49A 2V8QB 1HR0E 1YZ9A 4BCAA 1N36I 2V83A 2HKJA 1ELOA 1ZXNA 1DQ3A 4P7DA 2E5LE 4DV7I 2HKEA 4JI4I 4LF6I 2L2KB 1N0VC 4URLA 2LTRA 3V2UC 4F54A 4JI8E 1XMOE 4DV7E 4X62E 3ADGA 1Z59A 2JOXA 2HFUA 3PYDA 3H09A 3VYYA 3P1XA 1WXRA 1Y4SA 4F9BB 4DV6I 2KHXA 4DXLA 3H4LA 1B62A 2HFSA 1Y4UA 4LFBI 2Q2EB 2HK2A 4DR7E 4HXZA 3J81C 4LFCE 4DPUA 1N32I 1T4OA 3F6HA 2DMYA 4FW9A 4UTGA 4DR7I 3B82A 2UXDE 1KTVA 2X36A 3WU6A 4F9AB 2V2QA 4LU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3H A;  4HY1 A;  2L2M A;  1FJG E;  4WUD A;  4DV5 I;  1KKH A;  2A2C A;  1XMO I;  4DV2 E;  2JY9 A;  1IBK E;  1J5E I;  3OTO I;  1N33 E;  1RR9 A;  2RS7 A;  5LL6 R;  2VQE E;  4USK A;  1Z5C A;  2N3G A;  4DPW A;  1PVG A;  4KHP I;  3ADL A;  1HNX I;  4FWH A;  4DV1 E;  4DR1 E;  2DEJ A;  4DU8 A;  3LPS A;  1FI4 A;  3T1H E;  2L3J A;  1N33 I;  1BKN A;  4JG4 A;  3ADJ A;  3B8H A;  5L3J A;  4GKJ E;  4MYT A;  4FWD A;  3J7A G;  5CFF E;  4DV1 I;  4JYA I;  2VQF E;  4GKJ I;  4XTJ A;  4DV2 I;  2UUA E;  4DV3 I;  4AQY E;  1Z0G A;  4DPX A;  4JI6 I;  4JI3 I;  4DV5 E;  1X47 A;  3ZKD A;  4LFA E;  4DR2 E;  2UUA I;  4NXN E;  2J7K A;  4HAC B;  2X7I A;  2F4V E;  4X8W A;  1VIS A;  4M1K A;  3V5R A;  4JI7 E;  4WUC A;  4LFC I;  3C4T A;  2E5L I;  1UIL A;  3K17 A;  4HYM A;  4DV6 E;  1ZM4 A;  4WFT A;  4LFA I;  3ZZU A;  4FWG A;  5A2Q C;  2V8P A;  2B3T B;  3WU4 A;  2UXB I;  1UHZ A;  2LTS A;  4DV3 E;  4DV0 E;  2DIX A;  2LJP A;  1RQ0 A;  2NA2 A;  1ZM9 A;  1U2R A;  1QZR A;  2IHR 1;  1YYK A;  4WYQ B;  2UU9 E;  2ZM6 E;  3QT7 A;  3Q1Q A;  5A2Q Q;  5IT9 C;  2F4V I;  2HK3 A;  4DR4 E;  1ZBT A;  1WHN A;  3D4J A;  3HUL A;  2ZM6 I;  2XEX A;  1WHQ A;  1T4L B;  1N36 E;  2YT4 A;  3PYF A;  4M2Z A;  2JVA A;  4NXM I;  4PRV A;  2LRS A;  2V2Z A;  1Z0V A;  2ZIT A;  4JI1 E;  1S4E A;  1XNR I;  2A2D A;  1NHI A;  4DUY E;  4GKK I;  3ZM7 A;  1MX0 A;  2MDR A;  3ZZ0 A;  2UUB E;  4LF7 I;  4JI3 E;  1S16 A;  4KHP E;  2UXB E;  4JI5 E;  1J5E E;  1IBK I;  4DR2 I;  1H7S A;  3QT8 A;  4LF7 E;  2DEI A;  4X65 I;  1XHK A;  1HNW I;  5LMU E;  2UXD I;  2RS6 A;  4PRX A;  1XMQ I;  4EMD A;  4ED4 A;  1J26 A;  1FJG I;  1N34 E;  4NXN I;  4ZVI A;  1HNW E;  1FWL A;  1Z0C A;  3PYG A;  4K0K E;  4JI1 I;  2HHH I;  3JAM C;  1YYO A;  4LF5 E;  3J7Y p;  4B3S E;  4JI5 I;  5LMN I;  1HNZ I;  4AQY I;  1IBM E;  4JYA E;  4DUY I;  1XNR E;  4LF9 E;  3JAM Q;  4LF4 E;  4DR5 E;  5IWA E;  3HTX A;  4B3M E;  2B7V A;  2BM1 A;  1HR0 I;  2UUC I;  4LF4 I;  1H72 C;  2LUQ A;  4DU7 A;  4B3S I;  4X65 E;  3ZKB A;  1I94 E;  1ZM3 A;  2R3V A;  2LBS B;  4DR6 E;  4JI2 E;  1EI1 A;  1H73 A;  2V2V A;  4JV5 I;  4B3R I;  1NHJ A;  1N34 I;  1UEK A;  3ZZT A;  2NPF A;  2HHH E;  4LF9 I;  1DAR A;  2CPN A;  3J80 C;  1PIE A;  1HNZ E;  4LFB E;  5LMN E;  2OI2 A;  4DR6 I;  4B3R E;  4OOG C;  4JV5 E;  3ADI A;  1H74 A;  2RSM A;  2NUF A;  1K47 A;  3M6A A;  2UXC E;  1I94 I;  4M30 A;  1O0W A;  4B3M I;  3LTO A;  3F0N A;  1A6F A;  5LMU I;  1XMQ E;  4USM A;  4Z7C A;  1MU5 A;  2ZBK B;  2V34 A;  4DV0 I;  1X48 A;  4X64 I;  3T1Y E;  3GON A;  1Z5B A;  5IT9 Q;  4X62 I;  2DB2 A;  3LLH A;  1FWK A;  2LJH A;  3WU3 A;  1HNX E;  4UT4 A;  4DR5 I;  5BR8 E;  4K0K I;  4RPF A;  4YHH I;  1DI2 A;  4JI0 I;  1IBM I;  1H7U A;  2WW4 A;  3PYE A;  4JI7 I;  2NUE A;  4WUB A;  3J81 Q;  2BV3 A;  4JI2 I;  1IBL I;  1B63 A;  4LF5 I;  4R1F A;  1KIJ A;  4YY3 I;  1NZ0 A;  1FNM A;  2UUB I;  1D6T A;  5FLX Q;  3QT6 A;  2L3C A;  1WUU A;  1FKA E;  2L33 A;  4P7A A;  1N0U A;  4LF8 E;  1XNQ E;  3J7A M;  5GMD A;  1OJ4 A;  4DV4 I;  4DUZ E;  2EZ6 A;  3C4B A;  2UUC E;  3CWV A;  3T1H I;  1Z0E A;  5FLX C;  1XNQ I;  4OX9 E;  2EFG A;  4LF6 E;  4KQV A;  3VYX A;  4JI0 E;  5GME A;  4JI8 I;  1ZM2 A;  4B3T E;  4DR3 I;  2RTX A;  1PKP A;  1NHH A;  3K1J A;  3QT5 A;  4DPT A;  2VQF I;  2VF3 A;  3B78 A;  4P52 A;  4DR3 E;  4B3T I;  2R42 A;  1MG7 A;  4OX9 I;  1YYW A;  4LF8 I;  2E1R A;  4JI6 E;  2NUG A;  3LNU A;  4Z7Y A;  2CZ9 A;  4I3H A;  1RC7 A;  4HAC A;  3T1Y I;  1QU6 A;  5IWA I;  4DR4 I;  4JI4 E;  4DKK A;  4FN5 A;  1KVK A;  2VQE I;  4DPY A;  4X66 E;  1STU A;  5BR8 I;  4PU9 A;  1IBL E;  4MYU A;  4DUZ I;  3OTO E;  2LUP B;  4NXM E;  3WU5 A;  2UXC I;  4DV4 E;  2GS8 A;  2BM0 A;  3J80 Q;  1RRE A;  4X66 I;  4GKK E;  1EA6 A;  1Z5A A;  1ZXM A;  4DR1 I;  1T4N A;  1GQE A;  1Z0W A;  1N32 E;  1Z0B A;  1Z0T A;  4YY3 E;  2B7T A;  2UU9 I;  2AJ4 A;  4YHH E;  4X64 E;  2L2N A;  1EKZ A;  1X49 A;  1HR0 E;  1YZ9 A;  1N36 I;  2HKJ A;  1ELO A;  1ZXN A;  2E5L E;  4DV7 I;  2HKE A;  4JI4 I;  4LF6 I;  2L2K B;  1N0V C;  4URL A;  2LTR A;  3V2U C;  4JI8 E;  1XMO E;  4DV7 E;  4X62 E;  3ADG A;  1Z59 A;  2HFU A;  3PYD A;  3VYY A;  3P1X A;  4DV6 I;  2KHX A;  4DXL A;  3H4L A;  1B62 A;  2HFS A;  4LFB I;  2Q2E B;  2HK2 A;  4DR7 E;  4HXZ A;  3J81 C;  4LFC E;  4DPU A;  1N32 I;  1T4O A;  2DMY A;  4FW9 A;  4UTG A;  4DR7 I;  3B82 A;  2UXD E;  1KTV A;  2X36 A;  3WU6 A;  2V2Q A; 
#chains in the Genus database with same CATH topology
 1UDQ A;  4IS1 C;  2N3H A;  3HJC A;  4HY1 A;  4R2C A;  1YUI A;  4OO1 A;  2D9H A;  2L2M A;  1FJG E;  3B4T A;  2EL5 A;  3K85 A;  4Q28 A;  2PO0 B;  4WUD A;  4IFD D;  2LV2 A;  4DV5 I;  2ODR D;  1KKH A;  2A2C A;  2ELY A;  1XMO I;  3C6M A;  2JY9 A;  2MC6 A;  4DV2 E;  1IBK E;  1J5E I;  2M1S A;  1MEY C;  2LJU A;  3OTO I;  1N33 E;  2EOR A;  1RR9 A;  2RS7 A;  5LL6 R;  2VQE E;  4USK A;  1Z5C A;  5DNY A;  2EMY A;  2N3G A;  2YU8 A;  3HXL A;  2NN6 F;  3THO B;  2EM2 A;  4DPW A;  2PO2 B;  5JEA A;  1PVG A;  2AE8 A;  2EOY A;  3M85 G;  2EPK X;  2EOX A;  4R2D A;  4KHP I;  3M99 B;  3ADL A;  4IJD A;  2LE2 A;  1A1F A;  1HNX I;  4FWH A;  1YPN A;  3PRY A;  4DV1 E;  4DR1 E;  5A6A A;  2DEJ A;  2EOQ A;  2PO1 A;  4ZYD A;  4DU8 A;  3LPS A;  3DF6 A;  1FI4 A;  2PNZ B;  3JU0 A;  1ZAA C;  2EPL X;  3T1H E;  2HGH A;  2RSI A;  2L3J A;  1N33 I;  3AUZ A;  3RMP A;  2NAB A;  4I8O A;  1IMU A;  1BBO A;  1IQO A;  2EMI A;  1YUJ A;  1BKN A;  4JG4 A;  2IOP A;  2EPA A;  3EQ1 A;  5AC5 A;  3ADJ A;  3B8H A;  2EPR A;  4BBY A;  1A1K A;  2WNR B;  5L3J A;  3T1Y I;  2EE8 A;  2FV4 B;  4GKJ E;  2YZT A;  2VE7 C;  3ZOQ B;  1KJK A;  4FWD A;  4P78 A;  4MYT A;  1P47 A;  2EPX A;  3J7A G;  5CFF E;  2JEB B;  4MU1 A;  2VQF E;  4DV1 I;  4JYA I;  5K36 B;  2EN1 A;  4GKJ I;  5AE3 A;  2LO3 A;  4DMI A;  1XXE A;  4XTJ A;  2O3Z A;  4DV2 I;  2UUA E;  3LML A;  1NEI A;  2NN6 D;  4AQY E;  1Z0G A;  4WXD A;  4DPX A;  4DV3 I;  4JI6 I;  2ENC A;  1UBD C;  2V86 A;  1A1I A;  4JI3 I;  4DV5 E;  1X47 A;  5FWK A;  4HEI A;  5T6J A;  2JYA A;  3ZKD A;  4LFA E;  1T38 A;  4DR2 E;  4J3D A;  2UUA I;  2YRM A;  1RHY A;  2A25 A;  2M7Q A;  3GME A;  4NXN E;  2J7K A;  4HAC B;  2EOI A;  4M9V C;  2X7I A;  2DRP A;  2F4V E;  4X8W A;  1VIS A;  4M1K A;  3V5R A;  4JI7 E;  2IER A;  2VRD A;  1HK7 A;  1B69 A;  4WUC A;  4LFC I;  3C4T A;  2E5L I;  1UIL A;  3K17 A;  1Y60 A;  4DV6 E;  1ZM4 A;  3EPH A;  4HYM A;  4WFT A;  4LFA I;  2IOQ A;  3ZZU A;  5KL5 A;  4FWG A;  5A2Q C;  2V8P A;  1PDA A;  2B3T B;  3WU4 A;  4R03 A;  2UXB I;  2E1M A;  1UHZ A;  2LTS A;  2L8T A;  4DV3 E;  4DV0 E;  4R2S A;  1WRJ A;  1TF6 A;  2DIX A;  4IFD C;  2LJP A;  1RQ0 A;  5A6B D;  2NA2 A;  5AE2 A;  1ZM9 A;  2VF1 A;  1U2R A;  1QZR A;  1PJQ A;  2IHR 1;  1YYK A;  3P3E A;  2JR1 A;  2EN2 A;  4WSP A;  4WYQ B;  2UU9 E;  2NN6 E;  3EPJ A;  4FW6 A;  2ZM6 E;  3QT7 A;  2EN8 A;  2L92 A;  3Q1Q A;  5A2Q Q;  2R1F A;  2EN6 A;  1BBG A;  5IT9 C;  2F4V I;  4L8N A;  2JP9 A;  2HK3 A;  2EPM X;  3F6G A;  4DR4 E;  4MLV A;  1ZBT A;  1WHN A;  5TSE A;  2PNZ A;  3D4J A;  3HUL A;  3UHM A;  2ZM6 I;  5JEA C;  2XEX A;  3DJW A;  4FK5 C;  4IZJ B;  1WHQ A;  2YPN A;  1NCS A;  1T4L B;  1N36 E;  3CDJ A;  2YT4 A;  1SFE A;  3PYF A;  3U1Y A;  1R6M A;  4M2Z A;  2VES A;  5AC4 A;  2JVA A;  2JWO A;  3VK6 A;  4NXM I;  3ECR A;  4F6N A;  4PRV A;  2JEA A;  2LRS A;  2I13 A;  4ZYH A;  2V2Z A;  1YSA C;  1Z0V A;  2G7H A;  3P76 A;  2EM3 A;  2ZIT A;  5A6B A;  4JI1 E;  1S4E A;  2GLI A;  1XNR I;  2A2D A;  1NHI A;  4DUY E;  5AAS A;  1UDO A;  1YH8 A;  4GKK I;  3ZM7 A;  1MX0 A;  2MDR A;  3ZZ0 A;  2ENA A;  2UUB E;  2Z5E A;  2EL6 A;  3EPL A;  1MGT A;  4JI3 E;  1S16 A;  4KHP E;  3L7Z B;  4LF7 I;  2UXB E;  4FW7 A;  2PNL A;  4JI5 E;  4OO1 B;  4N4R B;  1J5E E;  1G2D C;  1IBK I;  3BF2 A;  4DR2 I;  2M9A A;  3OML A;  1H7S A;  4WPY A;  2EQ0 A;  4LOM A;  2GO4 A;  3QT8 A;  4LF7 E;  2DEI A;  4X65 I;  2CG9 A;  2EM0 A;  2JPA A;  1XHK A;  3BID A;  3JTZ A;  4BC9 A;  1BB8 A;  1HNW I;  2PRT A;  5LMU E;  1YHC A;  2RS6 A;  4PRX A;  1XMQ I;  4EMD A;  4OKG A;  2UXD I;  2ODR C;  4ED4 A;  4KZS A;  1TN9 A;  2GQ0 A;  1J26 A;  4OO1 F;  5IV8 B;  5KL6 A;  1N34 E;  2H36 X;  1FJG I;  4NXN I;  4ZVI A;  1HNW E;  5DNL A;  4IFD F;  1FWL A;  1AAY A;  2PO2 A;  1EH7 A;  1Z0C A;  4K0K E;  2PO0 A;  3KRN A;  3PYG A;  4JI1 I;  2HHH I;  3JAM C;  3CDI A;  4IZK B;  1YYO A;  4LF5 E;  2K7I A;  2YTO A;  3J7Y p;  4KWY A;  5ADZ A;  4B3S E;  4BHC A;  5LMN I;  4JI5 I;  1HNZ I;  3FIG A;  3Q6M A;  4LTY A;  4AQY I;  2YRK A;  2JOB A;  1E3P A;  4U3B A;  4BHB A;  3MHS C;  1IBM E;  2EN3 A;  4JYA E;  4DUY I;  1XNR E;  4LF9 E;  3BGH A;  3HKM A;  4O43 A;  3JAM Q;  4BA2 B;  3HQ1 A;  2ADR A;  2YTI A;  4LF4 E;  4DR5 E;  4IFD A;  5IWA E;  4ISA A;  3HTX A;  2CT1 A;  4B3M E;  2B7V A;  1X5W A;  2BM1 A;  2EMA A;  3H1C A;  3IWC A;  4FW3 A;  3PS2 A;  2V87 A;  1HR0 I;  4Q35 B;  2UUC I;  5AE1 A;  2C38 B;  4BA1 A;  4LF4 I;  1H72 C;  2LUQ A;  4DU7 A;  4N3O A;  4B3S I;  4X65 E;  5K36 C;  3GLL A;  3P06 A;  3ZKB A;  1EH6 A;  2ELZ A;  2EN4 A;  1I94 E;  2Z5C B;  1ZM3 A;  2R3V A;  3THN A;  2LBS B;  1ZBQ A;  2EPU A;  4DR6 E;  5DRQ A;  4JI2 E;  3UK3 C;  5KL7 A;  4LPF A;  1EI1 A;  1H73 A;  2V2V A;  2V89 A;  4JV5 I;  4LCG A;  4QNJ A;  4R2A A;  3PS3 A;  5JEA F;  4B3R I;  1A1H A;  1NHJ A;  1N34 I;  1UEK A;  3ZZT A;  2EOS A;  2NPF A;  4BC7 A;  2HHH E;  4LF9 I;  1PJT A;  2O1V A;  1DAR A;  2EMB A;  4MQY A;  2CPN A;  4L5N C;  2Z5B B;  2M4I A;  2YTD A;  3J80 C;  1OYS A;  1PIE A;  5K36 D;  1X6H A;  1YFH A;  1HNZ E;  4LFB E;  2PNM A;  5LMN E;  1LLM C;  2RQL A;  2EOH A;  1IQS A;  3C6K A;  2OI2 A;  4B3R E;  1WJP A;  2GO3 A;  4DR6 I;  2WZO A;  4OOG C;  4OO1 C;  2FGG A;  4JV5 E;  3ADI A;  1H74 A;  2GHF A;  1UDS A;  1RMD A;  2RSM A;  2NUF A;  1K47 A;  2RPC A;  3M6A A;  3U1K A;  5KL2 A;  2E72 A;  1F2I G;  2UXC E;  2EMC A;  1Y5Y A;  1I94 I;  1GTK A;  4M30 A;  2EWL A;  1O0W A;  1VI7 A;  4B3M I;  3LTO A;  3F0N A;  5C0X D;  1R6L A;  4NBQ A;  1L4S A;  2O1W A;  1A1G A;  1A6F A;  5LMU I;  4OO1 E;  1XMQ E;  4USM A;  4IZJ D;  2V88 A;  2YTE A;  4IFD E;  4R8O A;  1A1L A;  4BS9 A;  4R2P A;  1JK2 A;  1MU5 A;  2YTP A;  3BBG A;  2ZBK B;  4Z7C A;  2V34 A;  4MDT A;  2EOE A;  4FW4 A;  4DV0 I;  1X48 A;  2YTF A;  2BA1 G;  3T1Y E;  3GON A;  1DGC A;  1Z5B A;  4X64 I;  2EM4 A;  5IT9 Q;  4X62 I;  2DB2 A;  3LLH A;  1FWK A;  2DSY A;  2EOF A;  2LJH A;  4AIM A;  1UN6 B;  3L7Z A;  2EL4 A;  3WU3 A;  4RH8 A;  1HNX E;  2WP8 A;  2K4V A;  3QG5 C;  4UT4 A;  4DR5 I;  5BR8 E;  2C37 A;  4K0K I;  4RPF A;  1A1J A;  2JE6 B;  2NN6 A;  2CGE A;  4YHH I;  3K6Q A;  1ZU1 A;  2R76 A;  1DI2 A;  4JI0 I;  1IBM I;  1H7U A;  4QNK A;  2B9D A;  2WW4 A;  3PYE A;  2NN6 B;  2J65 A;  2WNR A;  2EM7 A;  2EML A;  2C37 B;  2KOU A;  2EN7 A;  4JI7 I;  2NUE A;  2WP8 B;  3EPK A;  2WBS A;  2BA0 D;  2NN6 C;  4WUB A;  2GPI A;  2DLK A;  3AV0 A;  2Z5C A;  2C39 A;  4GQU A;  5EL9 A;  2BV3 A;  3J81 Q;  4F2J C;  4JI2 I;  1IBL I;  3P3C A;  2ENH A;  1B63 A;  4LF5 I;  2LMZ A;  5DRP A;  4FW5 A;  4R1F A;  2EPC A;  4IZK A;  1ZR9 A;  1KIJ A;  1NZ0 A;  4YY3 I;  2YRH A;  1FNM A;  4MU0 A;  4GEQ B;  2BR2 A;  4MLQ A;  3IWD A;  5JEA E;  2DMI A;  2UUB I;  1D6T A;  5FLX Q;  2DGC A;  2YSO A;  3QT6 A;  2JE6 A;  2L3C A;  1WUU A;  3Q6N A;  2O1T A;  3L00 A;  1FKA E;  2L33 A;  4P7A A;  3M85 D;  4TUI A;  4F9C B;  4ZYG A;  2Z5B A;  4LCF A;  1N0U A;  4LF8 E;  3KWR A;  2BBG A;  1XNQ E;  5JEA D;  3J7A M;  5GMD A;  1OJ4 A;  5A6J A;  4DV4 I;  2EJ4 A;  2KON A;  4TUG A;  4LCH A;  5C0X E;  3C4B A;  4DUZ E;  2HC5 A;  2EZ6 A;  2JT2 A;  2UUC E;  3CWV A;  4BMJ A;  3T1H I;  1Z0E A;  5FLX C;  4WX9 A;  1T39 A;  1XNQ I;  2YTQ A;  2JEA B;  4OX9 E;  2EFG A;  2BB8 A;  4LF6 E;  5KL3 A;  5K36 E;  4KQV A;  3VYX A;  3IWB A;  3M7N G;  4JI0 E;  5GME A;  4JI8 I;  4AM3 A;  1ZM2 A;  4B3T E;  1G2F C;  4DR3 I;  2CSH A;  2EMF A;  2RTX A;  5F3W A;  1PKP A;  2WCC 3;  1NHH A;  3MSW A;  4MU4 A;  1AH5 A;  3K1J A;  3QT5 A;  2LCE A;  1X6E A;  2BR2 B;  4DPT A;  2F1D A;  2VQF I;  2EPZ A;  2V85 A;  2EM6 A;  2VF3 A;  3B78 A;  4P52 A;  4DR3 E;  4B3T I;  1OYP A;  2FTX B;  4X9J A;  2R42 A;  1MG7 A;  4OX9 I;  2LVH A;  1YYW A;  4LF8 I;  1X6F A;  2E1R A;  4J8Z A;  1USV A;  1TF3 A;  4JI6 E;  2NUG A;  4NHR A;  3LNU A;  4Z7Y A;  2CZ9 A;  4I3H A;  1RC7 A;  2N8X A;  2DLQ A;  2Q8U A;  3HPS A;  1QU6 A;  4HAC A;  2EMW A;  3HPZ A;  4HTG A;  4JI4 E;  5IWA I;  5DNX A;  3TQM A;  1JK1 A;  2O1U A;  4DKK A;  5EKW A;  4FN5 A;  2EM8 A;  5LLQ A;  4IFD B;  1KVK A;  2CTD A;  2VQE I;  4DPY A;  4X66 E;  1STU A;  4OO1 D;  1GZ6 A;  5IXM B;  5BR8 I;  4WSG A;  2MDG A;  4PU9 A;  1IBL E;  4MYU A;  4DUZ I;  3OTO E;  2L6M A;  2LUP B;  1Y6Z A;  3M7N D;  5A69 A;  4NXM E;  2BA1 D;  2LT7 A;  2EM9 A;  5DRO A;  3WU5 A;  4NZV A;  1UDN A;  1PJS A;  1E3H A;  4R2Q A;  2BA0 G;  2EMG A;  4IS9 A;  1X3C A;  2CVE A;  2UXC I;  2MC5 A;  4O24 A;  4DV4 E;  3KZZ A;  4WXC A;  2GS8 A;  2EMX A;  2BM0 A;  1N3G A;  5DRR A;  3J80 Q;  4DR4 I;  2F8B A;  1RRE A;  4M0V A;  4X66 I;  1USU A;  2PO1 B;  4GKK E;  1P42 A;  1EA6 A;  1Z5A A;  1ZXM A;  4DR1 I;  1T4N A;  1EH8 A;  1GQE A;  2J7J A;  3KZY A;  4R2R A;  1Z0W A;  1N32 E;  4F6M A;  3VHT B;  1Z0B A;  1Z0T A;  5A6K A;  4YY3 E;  2B7T A;  2EQ1 A;  4O4K A;  2UU9 I;  2C39 B;  2AJ4 A;  4IZJ A;  2WBU A;  3P3G A;  2YTG A;  4R2E A;  1SR9 A;  4YHH E;  4X64 E;  2L2N A;  2EPO A;  1EKZ A;  2EOO A;  1X49 A;  2WBT A;  2V8Q B;  2IES A;  1HR0 E;  2EMZ A;  1YZ9 A;  2YTJ A;  5C0X F;  2EMH A;  5KL4 A;  4BCA A;  4BA2 A;  5JEA B;  2YWQ A;  5ELW A;  2V83 A;  2HKJ A;  1ELO A;  1N36 I;  1ZXN A;  2YU5 A;  1DQ3 A;  4P7D A;  1OYR A;  2YSP A;  2MKD A;  5K36 F;  2E5L E;  4DV7 I;  1QNT A;  2EM5 A;  2HKE A;  2JXP A;  4JI4 I;  5K36 A;  4LF6 I;  3NZK A;  2EPN A;  2L2K B;  3MHH C;  2YTN A;  2EQ3 A;  4ZYE A;  1N0V C;  4URL A;  2LTR A;  3V2U C;  4F54 A;  2EMK A;  4JI8 E;  1XMO E;  5C0X B;  1Z1B A;  4RHB B;  4DV7 E;  4X62 E;  3GCM A;  5C0X C;  3ADG A;  1Z59 A;  4AID A;  2EPP A;  4U3D A;  2JOX A;  2HFU A;  3PYD A;  3H09 A;  3VYY A;  3P1X A;  1WXR A;  2HJJ A;  4F9B B;  1Y4S A;  2KHX A;  4DXL A;  4DV6 I;  3H4L A;  1B62 A;  2HFS A;  5C0X A;  1Y4U A;  4MU3 A;  2EOM A;  2Q2E B;  2HK2 A;  4DR7 E;  4HXZ A;  2EOJ A;  4OZE A;  4LFB I;  3J81 C;  4LFC E;  4DPU A;  2C38 A;  4BA1 B;  1N32 I;  1T4O A;  3F6H A;  2DMY A;  4FW9 A;  4UTG A;  2EOZ A;  4O5G A;  2I9I A;  2JEB A;  3PS1 A;  2EP3 A;  3DD6 A;  1KYQ A;  4DR7 I;  4GZN C;  3B82 A;  2UXD E;  1KTV A;  2X36 A;  3WU6 A;  2MKN A;  4F9A B;  2V2Q A;  4LU9 A; 
#chains in the Genus database with same CATH homology
 2N3H A;  3HJC A;  4HY1 A;  2L2M A;  3K85 A;  1FJG E;  4Q28 A;  4WUD A;  4DV5 I;  2ODR D;  1KKH A;  2A2C A;  1XMO I;  2JY9 A;  2MC6 A;  4DV2 E;  1IBK E;  1J5E I;  2M1S A;  3OTO I;  1N33 E;  1RR9 A;  2RS7 A;  5LL6 R;  2VQE E;  4USK A;  1Z5C A;  5DNY A;  3HXL A;  2N3G A;  4DPW A;  1PVG A;  4KHP I;  3ADL A;  1HNX I;  2LE2 A;  4FWH A;  3PRY A;  4DV1 E;  4DR1 E;  2DEJ A;  4DU8 A;  3LPS A;  3DF6 A;  1FI4 A;  3JU0 A;  3T1H E;  2L3J A;  1N33 I;  3AUZ A;  3RMP A;  4I8O A;  1BKN A;  4JG4 A;  2IOP A;  3ADJ A;  3B8H A;  4BBY A;  5L3J A;  2FV4 B;  4GKJ E;  2YZT A;  2VE7 C;  3ZOQ B;  4MYT A;  4FWD A;  4P78 A;  3J7A G;  5CFF E;  4DV1 I;  4JYA I;  2VQF E;  4GKJ I;  5AE3 A;  4DMI A;  4XTJ A;  4DV2 I;  2UUA E;  3LML A;  4DV3 I;  4AQY E;  1Z0G A;  4DPX A;  4JI6 I;  2V86 A;  4JI3 I;  4DV5 E;  1X47 A;  5FWK A;  5T6J A;  3ZKD A;  4LFA E;  4DR2 E;  2UUA I;  2M7Q A;  4NXN E;  2J7K A;  4HAC B;  2X7I A;  2F4V E;  4X8W A;  1VIS A;  4M1K A;  3V5R A;  4JI7 E;  1HK7 A;  4WUC A;  4LFC I;  3C4T A;  2E5L I;  1UIL A;  3K17 A;  4DV6 E;  1ZM4 A;  4HYM A;  4WFT A;  4LFA I;  2IOQ A;  3ZZU A;  4FWG A;  5A2Q C;  2V8P A;  2B3T B;  3WU4 A;  4R03 A;  2UXB I;  2E1M A;  1UHZ A;  2LTS A;  2L8T A;  4DV3 E;  4DV0 E;  2DIX A;  2LJP A;  1RQ0 A;  2NA2 A;  5AE2 A;  1ZM9 A;  2VF1 A;  1U2R A;  1QZR A;  2IHR 1;  1YYK A;  2JR1 A;  4WSP A;  4WYQ B;  2UU9 E;  2ZM6 E;  3QT7 A;  2L92 A;  3Q1Q A;  5A2Q Q;  5IT9 C;  2F4V I;  4L8N A;  2HK3 A;  3F6G A;  4DR4 E;  1ZBT A;  1WHN A;  3D4J A;  3HUL A;  2ZM6 I;  2XEX A;  3DJW A;  4IZJ B;  1WHQ A;  1T4L B;  1N36 E;  2YT4 A;  3PYF A;  4M2Z A;  2JVA A;  2JWO A;  3VK6 A;  4NXM I;  4PRV A;  2LRS A;  2V2Z A;  1Z0V A;  2G7H A;  2ZIT A;  4JI1 E;  1S4E A;  1XNR I;  2A2D A;  1NHI A;  4DUY E;  5AAS A;  4GKK I;  3ZM7 A;  1MX0 A;  2MDR A;  3ZZ0 A;  2UUB E;  2Z5E A;  4LF7 I;  4JI3 E;  1S16 A;  4KHP E;  2UXB E;  2PNL A;  4JI5 E;  1J5E E;  1IBK I;  4DR2 I;  3OML A;  1H7S A;  4WPY A;  3QT8 A;  4LF7 E;  2DEI A;  4X65 I;  2CG9 A;  1XHK A;  3JTZ A;  4BC9 A;  1HNW I;  5LMU E;  2UXD I;  2RS6 A;  4PRX A;  1XMQ I;  4EMD A;  2ODR C;  4ED4 A;  4KZS A;  2GQ0 A;  1J26 A;  1FJG I;  1N34 E;  2H36 X;  4NXN I;  4ZVI A;  1HNW E;  1FWL A;  1Z0C A;  3PYG A;  4K0K E;  4JI1 I;  2HHH I;  3JAM C;  4IZK B;  1YYO A;  4LF5 E;  3J7Y p;  4B3S E;  5ADZ A;  4JI5 I;  5LMN I;  1HNZ I;  3FIG A;  3Q6M A;  4LTY A;  4AQY I;  2JOB A;  1IBM E;  4JYA E;  4DUY I;  1XNR E;  4LF9 E;  3JAM Q;  3HQ1 A;  4LF4 E;  4DR5 E;  5IWA E;  3HTX A;  4B3M E;  2B7V A;  2BM1 A;  3IWC A;  2V87 A;  1HR0 I;  2UUC I;  5AE1 A;  4LF4 I;  1H72 C;  2LUQ A;  4DU7 A;  4N3O A;  4B3S I;  4X65 E;  3P06 A;  3ZKB A;  1I94 E;  2Z5C B;  1ZM3 A;  2R3V A;  2LBS B;  1ZBQ A;  4DR6 E;  4JI2 E;  1EI1 A;  1H73 A;  2V2V A;  2V89 A;  4JV5 I;  4B3R I;  1NHJ A;  1N34 I;  1UEK A;  3ZZT A;  2NPF A;  4BC7 A;  2HHH E;  4LF9 I;  2O1V A;  1DAR A;  2CPN A;  4L5N C;  2Z5B B;  2M4I A;  3J80 C;  1PIE A;  1HNZ E;  4LFB E;  2PNM A;  5LMN E;  2OI2 A;  4DR6 I;  4B3R E;  2WZO A;  4OOG C;  2FGG A;  4JV5 E;  3ADI A;  1H74 A;  2RSM A;  2NUF A;  1K47 A;  3M6A A;  2UXC E;  1I94 I;  4M30 A;  2EWL A;  1O0W A;  4B3M I;  3LTO A;  3F0N A;  2O1W A;  1A6F A;  5LMU I;  1XMQ E;  4USM A;  4IZJ D;  2V88 A;  4R8O A;  4BS9 A;  4Z7C A;  1MU5 A;  2ZBK B;  2V34 A;  4DV0 I;  1X48 A;  4X64 I;  3T1Y E;  3GON A;  1Z5B A;  5IT9 Q;  4X62 I;  2DB2 A;  3LLH A;  1FWK A;  2DSY A;  2LJH A;  3WU3 A;  1HNX E;  2K4V A;  4UT4 A;  4DR5 I;  5BR8 E;  4K0K I;  4RPF A;  2CGE A;  4YHH I;  3K6Q A;  1DI2 A;  4JI0 I;  1IBM I;  1H7U A;  2B9D A;  2WW4 A;  3PYE A;  4JI7 I;  2KOU A;  2NUE A;  4WUB A;  3AV0 A;  2Z5C A;  3J81 Q;  2BV3 A;  4JI2 I;  1IBL I;  1B63 A;  4LF5 I;  2LMZ A;  4R1F A;  4IZK A;  1KIJ A;  4YY3 I;  1NZ0 A;  1FNM A;  4GEQ B;  3IWD A;  2UUB I;  1D6T A;  5FLX Q;  3QT6 A;  2L3C A;  1WUU A;  3Q6N A;  2O1T A;  1FKA E;  2L33 A;  4P7A A;  4TUI A;  4F9C B;  2Z5B A;  1N0U A;  4LF8 E;  3KWR A;  1XNQ E;  3J7A M;  5GMD A;  1OJ4 A;  4DV4 I;  2KON A;  4TUG A;  4DUZ E;  2EZ6 A;  3C4B A;  2UUC E;  3CWV A;  4BMJ A;  3T1H I;  1Z0E A;  5FLX C;  1XNQ I;  4OX9 E;  2EFG A;  4LF6 E;  4KQV A;  3VYX A;  3IWB A;  4JI0 E;  5GME A;  4JI8 I;  1ZM2 A;  4B3T E;  4DR3 I;  5F3W A;  2RTX A;  1PKP A;  1NHH A;  3MSW A;  3K1J A;  3QT5 A;  4DPT A;  2VQF I;  2V85 A;  2VF3 A;  3B78 A;  4P52 A;  4DR3 E;  4B3T I;  2R42 A;  2FTX B;  1MG7 A;  4OX9 I;  1YYW A;  4LF8 I;  2E1R A;  4J8Z A;  1USV A;  4JI6 E;  2NUG A;  3LNU A;  4Z7Y A;  2CZ9 A;  4I3H A;  1RC7 A;  4HAC A;  3T1Y I;  3HPS A;  1QU6 A;  5IWA I;  3HPZ A;  4DR4 I;  4JI4 E;  2O1U A;  4DKK A;  4FN5 A;  1KVK A;  2VQE I;  4DPY A;  4X66 E;  1STU A;  1GZ6 A;  5BR8 I;  4PU9 A;  1IBL E;  4MYU A;  4DUZ I;  3OTO E;  2L6M A;  2LUP B;  1Y6Z A;  4NXM E;  3WU5 A;  2UXC I;  2MC5 A;  4DV4 E;  2GS8 A;  2BM0 A;  3J80 Q;  2F8B A;  1RRE A;  4M0V A;  4X66 I;  1USU A;  4GKK E;  1EA6 A;  1Z5A A;  1ZXM A;  4DR1 I;  1T4N A;  1GQE A;  1Z0W A;  1N32 E;  1Z0B A;  1Z0T A;  4YY3 E;  2B7T A;  2UU9 I;  2AJ4 A;  4IZJ A;  1SR9 A;  4YHH E;  4X64 E;  2L2N A;  1EKZ A;  1X49 A;  2V8Q B;  1HR0 E;  1YZ9 A;  4BCA A;  1N36 I;  2V83 A;  2HKJ A;  1ELO A;  1ZXN A;  1DQ3 A;  4P7D A;  2E5L E;  4DV7 I;  2HKE A;  4JI4 I;  4LF6 I;  2L2K B;  1N0V C;  4URL A;  2LTR A;  3V2U C;  4F54 A;  4JI8 E;  1XMO E;  4DV7 E;  4X62 E;  3ADG A;  1Z59 A;  2JOX A;  2HFU A;  3PYD A;  3H09 A;  3VYY A;  3P1X A;  1WXR A;  1Y4S A;  4F9B B;  4DV6 I;  2KHX A;  4DXL A;  3H4L A;  1B62 A;  2HFS A;  1Y4U A;  4LFB I;  2Q2E B;  2HK2 A;  4DR7 E;  4HXZ A;  3J81 C;  4LFC E;  4DPU A;  1N32 I;  1T4O A;  3F6H A;  2DMY A;  4FW9 A;  4UTG A;  4DR7 I;  3B82 A;  2UXD E;  1KTV A;  2X36 A;  3WU6 A;  4F9A B;  2V2Q A;  4LU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...