2UXDE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxdE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdE02
4WUDA 3J81Q 4DR3I 4HXZA 3PYEA 1GQEA 5GMDA 1H7SA 2V8PA 3ZZUA 4X62I 1ZXMA 4WYQB 3J7Yp 1IBME 4JI8I 4KQVA 2RSMA 4DUYE 4LF9I 3V2UC 1IBKI 2ZITA 4DV4E 2CZ9A 1Z0BA 4X65E 4DR5I 1KIJA 1YYWA 2F4VE 2R3VA 1NHHA 3J80C 1MU5A 3PYGA 4JI2I 1A6FA 4WUBA 3ADJA 3C4BA 5IWAE 4FWDA 2A2DA 4DV7I 4B3RE 3T1YI 2RTXA 4DUYI 2F4VI 2ZBKB 3WU3A 1D6TA 2RS7A 3D4JA 5LMUI 4LFAE 4JI0I 4KHPI 4DPXA 2L3JA 4JG4A 4DV3E 1N32E 1K47A 4DR5E 4FW9A 4X65I 3LPSA 4B3RI 4JI7I 1QZRA 4LFAI 2WW4A 4DR1I 2LUPB 4DR2E 4LF8I 4DV3I 1I94E 4DPYA 1N32I 4DV6E 3T1YE 5LMUE 5FLXC 1H7UA 1ELOA 5A2QC 1I94I 3P1XA 4JI8E 4HACB 4LFCE 4NXNE 4DV4I 4X66E 1FNMA 5GMEA 4USMA 1BKNA 3Q1QA 2UUAE 2UUCI 1Z5BA 1HR0E 2JY9A 3J7AG 4DV1E 4DR1E 4B3SE 2HFSA 1Z0GA 4DR2I 1N0VC 1H74A 2HK3A 1RC7A 1FJGI 1U2RA 1N36I 4LF7I 2L3CA 1T4LB 4UTGA 4I3HA 5IT9Q 4Z7CA 3ZKBA 4YY3I 2LBSB 1J5EE 1HNWI 4OX9E 3QT7A 4RPFA 2KHXA 2NUFA 1XNRI 3LTOA 4DV1I 4B3SI 2ZM6I 4WFTA 1UEKA 2UU9I 4X64I 2VQFI 1N33I 2UUCE 1T4NA 4DV0E 3J7AM 4MYTA 1XHKA 2DEIA 1YYOA 2VF3A 1T4OA 1KKHA 1Z0EA 4FN5A 4LFBE 1Z5AA 4HYMA 4DV7E 4K0KI 1IBLE 4FWGA 4P52A 2E5LI 4DR7E 2LTRA 2A2CA 3T1HE 1HNWE 1XMOE 1ZBTA 4DR4I 1FKAE 2L2KB 3LNUA 4DUZI 2B7TA 4P7AA 2RS6A 4LFCI 4LF5I 4B3TE 3GONA 1XMOI 3ADGA 1XNQI 1HNZE 2UXCE 1B63A 5CFFE 1FWKA 4LF4E 1NHIA 4JI3I 4X62E 2YT4A 3QT8A 2MDRA 2UXDE 4LF7E 4USKA 4MYUA 1H72C 5FLXQ 1WHQA 1RR9A 4YY3E 1XMQE 3VYXA 1Z5CA 4DR6E 3J80Q 3WU4A 2HFUA 4OX9I 1XNQE 4DU8A 1N0UA 2LRSA 4JV5E 3QT6A 2J7KA 4LF8E 4AQYE 2B7VA 1YYKA 1YZ9A 2EZ6A 4DV6I 2LTSA 3VYYA 2NPFA 2E1RA 4DPTA 2IHR1 1X49A 1HNZI 1Z0TA 2UXCI 3ZM7A 2L2MA 1OJ4A 1ZM9A 4DV5E 1EI1A 2N3HA 2NA2A 1PVGA 4XTJA 4K0KE 2BM0A 4NXMI 4ED4A 2GS8A 3PYDA 1XMQI 4DV5I 1PKPA 1X47A 4OOGC 2N3GA 2LUQA 4JI7E 4DUZE 4DR4E 1HNXE 2NUEA 1ZM3A 1VISA 1O0WA 4B3TI 4M30A 4B3ME 4FWHA 1FJGE 2Q2EB 3J81C 1N36E 4JI5I 4DPWA 2XEXA 2LJHA 3PYFA 2BV3A 4JI6I 4LF4I 4LF6E 1S4EA 1J5EI 5LMNE 1Z59A 1H73A 3JAMQ 4R1FA 2VQEE 3HULA 3K1JA 3CWVA 4HACA 3WU5A 1EKZA 1KTVA 2BM1A 2X7IA 3WU6A 4NXNI 3OTOE 4DV2I 2OI2A 4LF6I 4GKJE 2UXBI 4DR6I 2UU9E 3B8HA 2DEJA 2V34A 5LL6R 1EA6A 3ZZTA 3K17A 1HR0I 4X8WA 3B82A 2HKJA 4JI6E 1QU6A 4JV5I 2L33A 4M2ZA 4EMDA 2VQEI 2V2ZA 2R42A 5IT9C 2CPNA 4LFBI 3F0NA 2HHHI 4DV2E 1ZM2A 1Z0CA 4PRVA 1WHNA 1DI2A 2EFGA 4GKKI 1J26A 1N34E 4LF5E 4NXME 2UUBE 2V2VA 3HTXA 3B78A 1XNRE 4DPUA 2ZM6E 4GKJI 2HK2A 1RQ0A 1UILA 1B62A 1Z0WA 1NZ0A 4DV0I 1ZM4A 5A2QQ 1S16A 1MG7A 4M1KA 4JI3E 4PU9A 4JI4E 1WUUA 4DXLA 5IWAI 5BR8E 3LLHA 4JI5E 4DR3E 4DU7A 2E5LE 1ZXNA 4DR7I 4JI4I 5LMNI 4ZVIA 5L3JA 3QT5A 4GKKE 4HY1A 2AJ4A 2DMYA 1IBKE 3OTOI 4JI1I 1MX0A 1PIEA 2JVAA 2DB2A 4YHHI 3M6AA 2V2QA 1HNXI 1Z0VA 3C4TA 1FI4A 1KVKA 4JI1E 4X66I 4JI2E 4B3MI 4UT4A 1X48A 2UXDI 1NHJA 5BR8I 2X36A 4YHHE 2DIXA 2HHHE 4JYAE 3JAMC 2B3TB 3ADIA 1DARA 1N34I 1STUA 1IBLI 2UUBI 4JYAI 1RREA 4JI0E 4KHPE 3V5RA 3ADLA 3H4LA 4AQYI 2UXBE 2UUAI 3T1HI 2HKEA 4WUCA 1FWLA 4URLA 2LJPA 2L2NA 1UHZA 3ZKDA 4LF9E 4DKKA 4PRXA 4Z7YA 2NUGA 3ZZ0A 4X64E 2VQFE 1N33E 1IBMI
chains in the Genus database with same CATH superfamily
1IQSA 4WUDA 3Q6MA 3J81Q 4HEIA 4DR3I 2WP8A 2JYAA 4HXZA 4IZKA 5EL9A 3PYEA 4BA1B 1X5WA 4WXCA 1GQEA 2YTGA 1USUA 1H7SA 2WNRA 4IS1C 2EPUA 5AE3A 2V8PA 5GMDA 3ZZUA 4X62I 2PO2A 2CGEA 1ZXMA 2EOXA 3KZZA 4WYQB 2MC6A 3J7Yp 1IBME 1USVA 3NZKA 4JI8I 2YTNA 4KQVA 1AH5A 2RSMA 2EM7A 2L6MA 4O24A 4DUYE 2HGHA 2O1TA 2C39B 3PRYA 4LF9I 2E1MA 3V2UC 1IBKI 2C37B 2ZITA 2EL6A 4DV4E 1X3CA 2CZ9A 1Z0BA 1SFEA 4Q28A 5KL6A 4WX9A 5DNYA 4X65E 4TUGA 4DR5I 2EPAA 1KIJA 2EL4A 2V89A 1YYWA 2F4VE 2EPOA 2R3VA 4FW6A 1NHHA 3J80C 2YTPA 2EORA 4BHCA 1MU5A 2GO3A 3PYGA 2GO4A 2EPZA 2EOIA 2DSYA 4JI2I 2H36X 2HHHI 1A6FA 4GZNC 1ZBQA 4WUBA 4LTYA 2VE7C 2EPCA 3ADJA 3C4BA 5IWAE 1A1GA 4FWDA 2A2DA 4DV7I 4B3RE 3T1YI 2RTXA 4DUYI 2EOEA 2F4VI 2ZBKB 2DLKA 2V8QB 3WU3A 2ELZA 4MLVA 5AC5A 2PNLA 1D6TA 1EH6A 2EM4A 2RS7A 4F9BB 2MKNA 2EMWA 4QNKA 2JEAB 2G7HA 1UBDC 3D4JA 1B69A 4R03A 2YSPA 4M0VA 3P06A 1GZ6A 3LMLA 2Z5CA 2M1SA 3BIDA 5LMUI 4LFAE 4JI0I 4KHPI 2GLIA 4IFDF 2WNRB 4DPXA 2YTOA 2K7IA 2L3JA 4DV3E 1N32E 4P7DA 1K47A 4R2QA 4JG4A 5DROA 4DR5E 5F3WA 4FK5C 3LPSA 4FW9A 2YRMA 1MEYC 4R2SA 4X65I 4B3RI 2BR2A 4JI7I 1T38A 1QZRA 5KL2A 3DD6A 4MQYA 2V83A 3C6MA 2JE6B 1OYSA 2WW4A 2MKDA 2LUPB 4DR1I 1UDQA 2FTXB 4DR2E 4LFAI 5K36C 4LF8I 4DV3I 1I94E 4DPYA 1N32I 5IXMB 4DV6E 1LLMC 2JPAA 4MU4A 2EMGA 2JEAA 3UK3C 4AM3A 3T1YE 2D9HA 2O1VA 2CTDA 5LMUE 3M85D 2CSHA 5FLXC 3F6HA 3F6GA 4O43A 5JEAD 1X6HA 1WRJA 1PJQA 4ZYGA 1Z1BA 2YSOA 1YUJA 5A2QC 1ELOA 1H7UA 1I94I 1HK7A 3P1XA 2V87A 4JI8E 4HACB 4LFCE 2PRTA 2EOHA 4NXNE 4DV4I 2JE6A 4X66E 4AIDA 1FNMA 2IESA 2NABA 2V88A 5GMEA 4USMA 1BKNA 2X36A 2FV4B 2PO1A 2UUAE 2VESA 2WP8B 3Q1QA 4FW3A 2UUCI 1Z5BA 4BC9A 1HR0E 5K36A 2JOBA 1TF6A 3L00A 2JY9A 3H1CA 3J7AG 2BA1D 4LCFA 4R2DA 4DV1E 4DR1E 4B3SE 2HFSA 1Z0GA 4DR2I 1N0VC 1H74A 2C39A 1RC7A 4R2RA 1U2RA 2HK3A 1FJGI 1N36I 2EL5A 2L3CA 1T4LB 4MU0A 4UTGA 1TN9A 2BBGA 2BA0D 4U3DA 4I3HA 5IT9Q 4X9JA 4Z7CA 2EPKX 1YH8A 1YPNA 3ZKBA 4YY3I 2NN6C 1QNTA 5IV8B 2LBSB 2IOPA 3RMPA 1J5EE 2VRDA 4F9AB 1UDSA 4O4KA 4OZEA 1HNWI 1Y4SA 2YTJA 4OX9E 3QT7A 4LF7I 3KWRA 2M7QA 4RPFA 2KHXA 3H09A 4BA1A 2NUFA 2EPPA 3IWBA 5A6AA 2JT2A 2LV2A 4GEQB 2O1WA 3LTOA 3Q6NA 4DV1I 2ZM6I 4B3SI 1XNRI 2ENAA 2I9IA 4WFTA 1UEKA 5FWKA 1P42A 2WBTA 2UU9I 2EM0A 4X64I 2VQFI 3QG5C 1BBGA 2UUCE 1N33I 1SR9A 2BB8A 5K36F 3PS1A 3CDIA 1T4NA 2GQ0A 3JU0A 4DMIA 4DV0E 1EH8A 2YRKA 4OKGA 3J7AM 2RSIA 4MYTA 1XHKA 2DEIA 1YYOA 2IERA 1OYPA 4M9VC 2VF3A 3U1KA 2EWLA 1T4OA 4F6MA 2EM9A 3EPHA 1KKHA 1UDOA 1UDNA 5DRRA 1PDAA 1Z0EA 4FN5A 5C0XD 4LFBE 1Z5AA 3EPJA 2NN6A 4HYMA 4DV7E 4K0KI 4BBYA 1IBLE 4FWGA 4P52A 2LCEA 2EPNA 4L5NC 1Y4UA 2E5LI 1X6FA 4DR7E 2NN6E 2LTRA 4OO1D 2A2CA 3ECRA 3C6KA 3DF6A 3T1HE 1XMOE 1HNWE 3B4TA 2C38A 4WSGA 2LMZA 1ZBTA 1MGTA 5JEAA 1FKAE 4LOMA 2L2KB 3LNUA 1N3GA 2B7TA 2WBUA 3P3EA 2L8TA 4DUZI 2EMIA 2RS6A 2A25A 4P7AA 4LFCI 4WXDA 4LF5I 2NN6D 4B3TE 3L7ZA 5AC4A 4F9CB 3GONA 3DJWA 4R8OA 4LPFA 4ISAA 2EN7A 2JWOA 2ODRC 1XMOI 1NEIA 2EMXA 2L92A 3ADGA 5ADZA 1VI7A 1XNQI 2M9AA 1HNZE 2UXCE 1B63A 2PO2B 4O5GA 5CFFE 1A1IA 3TQMA 1FWKA 4LU9A 4MDTA 1RMDA 2WBSA 1DGCA 2DRPA 4LF4E 1NHIA 4JI3I 1YUIA 4X62E 3M85G 2HC5A 2YT4A 5EKWA 2BA1G 3QT8A 2MDRA 5DRPA 2UXDE 3HJCA 4LF7E 1Y5YA 1A1FA 4USKA 5KL4A 4DR4I 4MYUA 1H72C 1IMUA 2RPCA 5FLXQ 4F2JC 4DV6I 2NN6F 4R2CA 1WHQA 4IFDB 1RR9A 4BS9A 4YY3E 1XMQE 1PJSA 3VYXA 5K36E 2EMHA 1Z5CA 4DR6E 3P3GA 3J80Q 2CG9A 3WU4A 2YWQA 2HFUA 4OX9I 1JK1A 1XNQE 4OO1F 2JOXA 4DU8A 1N0UA 4OO1E 1EH7A 2LRSA 4JV5E 4WPYA 3QT6A 2J7KA 3P76A 2ELYA 2PNZB 4LF8E 4AQYE 2MDGA 2B7VA 1YYKA 2EM8A 1YZ9A 2EZ6A 4J3DA 5C0XF 2LTSA 4OO1A 3VYYA 2EMLA 2NPFA 2E1RA 3HXLA 4DPTA 2IHR1 2JR1A 5AASA 5C0XE 4MU3A 1X49A 1HNZI 1Z0TA 2UXCI 2BA0G 3ZM7A 2Z5BB 2J7JA 2EMFA 4BC7A 1T39A 2PO0B 2EMKA 2L2MA 1OJ4A 2EOMA 1ZM9A 3MSWA 2PO0A 4BA2B 2EM3A 4DV5E 3GLLA 2EMZA 2EN3A 4KZSA 5ELWA 5C0XA 1EI1A 5K36D 2N3HA 4KWYA 4MU1A 2NA2A 2GHFA 1PVGA 3CDJA 1G2DC 4XTJA 2ADRA 4P78A 2EN8A 4K0KE 3EQ1A 2BM0A 3HKMA 4ED4A 2EPXA 3UHMA 4NXMI 2GS8A 3PYDA 1XMQI 2EN6A 4DV5I 2EOZA 2LE2A 1PKPA 2R76A 3PS3A 2EPLX 1X47A 1PJTA 4OOGC 1YSAC 1XXEA 2PNMA 2N3GA 1WXRA 2LUQA 4WSPA 4JI7E 1R6LA 4DUZE 4DR4E 1HNXE 3IWCA 2NUEA 1ZM3A 5DNLA 1VISA 1O0WA 4NBQA 3L7ZB 2EPMX 4B3TI 4M30A 1L4SA 5AE1A 4B3ME 4FWHA 1Y6ZA 2EMBA 1FJGE 2Q2EB 3J81C 2DMIA 2JEBA 4IZJB 1N36E 4IZJA 4IFDA 2JP9A 1WJPA 4R2AA 1IQOA 3JTZA 4JI5I 2YTDA 4DPWA 4BCAA 2JEBB 2XEXA 2LJHA 4IFDE 3PYFA 2BV3A 4JI6I 4LF4I 4LF6E 5KL7A 1E3HA 1S4EA 1J5EI 5JEAE 5LMNE 1Z59A 4ZYDA 1H73A 2Z5CB 3JAMQ 5KL5A 4R1FA 2VQEE 3ZOQB 3HULA 3K1JA 3CWVA 4HACA 3WU5A 1EKZA 1UN6B 2EOFA 1KTVA 2BM1A 3K85A 2EMYA 4LCGA 2X7IA 3WU6A 4NXNI 3OTOE 1DQ3A 4TUIA 4DV2I 2OI2A 4IZJD 4LF6I 4GKJE 2UXBI 1P47A 4DR6I 2UU9E 2O3ZA 3B8HA 2DEJA 2V34A 5LL6R 1EA6A 3ZZTA 3K17A 3EPKA 2FGGA 4FW4A 1HR0I 4X8WA 5DRQA 3B82A 2HKJA 3GMEA 5JEAF 2WZOA 1ZR9A 4JI6E 4OO1C 1QU6A 1R6MA 4JV5I 2F8BA 2L33A 4N4RB 4M2ZA 4QNJA 1A1LA 4EMDA 2AE8A 2VQEI 2V2ZA 5IT9C 1KJKA 2R42A 2CPNA 5A6JA 4OO1B 2CT1A 4MLQA 5A6BA 5C0XC 4LFBI 2PNZA 2EMAA 1A1JA 3F0NA 2EE8A 1YFHA 1JK2A 2J65A 2HJJA 3THOB 2MC5A 4GQUA 4IZKB 4U3BA 4DV2E 4N3OA 1ZM2A 3OMLA 1IBMI 1Z0CA 2I13A 5JEAC 4PRVA 5LLQA 2EMCA 2O1UA 1WHNA 1DI2A 2GPIA 4RH8A 2YTEA 2CVEA 2EFGA 1X6EA 4GKKI 1J26A 4IFDD 1N34E 4LF5E 4NXME 2UUBE 4R2EA 2V86A 3HTXA 2V2VA 3B78A 1XNRE 4DPUA 4ZYEA 2DGCA 2ZM6E 3BBGA 4GKJI 2EPRA 5A6BD 2K4VA 1RQ0A 2HK2A 2F1DA 2YU5A 1TF3A 1ZAAC 3KRNA 2DLQA 1UILA 1B62A 2C38B 3KZYA 2EP3A 4I8OA 4AIMA 1A1KA 1Z0WA 1NZ0A 4DV0I 1ZM4A 1GTKA 1S16A 1G2FC 5A2QQ 1MG7A 2YZTA 2EOYA 4M1KA 4JI3E 2KONA 4PU9A 3HQ1A 4JI4E 2YRHA 3BGHA 1WUUA 3THNA 2Z5EA 4DXLA 3VHTB 5IWAI 5BR8E 3LLHA 1F2IG 2YU8A 3K6QA 4JI5E 2EM5A 2ENCA 2KOUA 4DR3E 1A1HA 4DU7A 2E5LE 1ZXNA 2IOQA 4DR7I 1Y60A 2Q8UA 4JI4I 3GCMA 2ENHA 5LMNI 4ZVIA 4F54A 5L3JA 5A6KA 3AV0A 3QT5A 4GKKE 3M7NG 4HY1A 5JEAB 2EOSA 2BR2B 2AJ4A 2LO3A 4NHRA 2EM2A 4ZYHA 2R1FA 2DMYA 1IBKE 3OTOI 4JI1I 4F6NA 1MX0A 2EQ3A 2EM6A 2YTQA 2E72A 1PIEA 1RHYA 2EJ4A 2EOQA 3M7ND 2JVAA 3MHSC 3PS2A 4FW7A 2DB2A 4YHHI 3M6AA 3EPLA 1ZU1A 2V2QA 4NZVA 1HNXI 1Z0VA 3C4TA 4IJDA 4RHBB 1FI4A 1KVKA 5T6JA 2WCC3 5KL3A 4J8ZA 4JI1E 4X66I 4LCHA 4Q35B 4JI2E 4B3MI 2ODRD 2VF1A 1X48A 4IS9A 4UT4A 1NHJA 3VK6A 5BR8I 2UXDI 2EQ0A 2LT7A 3FIGA 2YTIA 4YHHE 2DIXA 4L8NA 3HPZA 1KYQA 2V85A 4BMJA 3MHHC 2HHHE 1OYRA 1NCSA 4JYAE 5C0XB 3JAMC 4BA2A 3AUZA 1BBOA 5TSEA 2B3TB 2RQLA 2Z5BA 2EQ1A 3ADIA 5A69A 2NN6B 3BF2A 2EOOA 1DARA 1N34I 2YTFA 2EN4A 1STUA 1IBLI 2M4IA 5AE2A 2UUBI 4IFDC 4JYAI 1RREA 4JI0E 4KHPE 3V5RA 3ADLA 3H4LA 4AQYI 2UXBE 4R2PA 2UUAI 3T1HI 3HPSA 2LVHA 2HKEA 1BB8A 4WUCA 1FWLA 3IWDA 4URLA 2LJPA 2L2NA 1UHZA 2B9DA 2YPNA 4BHBA 3ZKDA 4LF9E 1E3PA 4DKKA 2C37A 4FW5A 3M99B 4PRXA 4HTGA 1AAYA 4Z7YA 1YHCA 2LJUA 5K36B 2JXPA 2EN2A 3U1YA 2NUGA 2EN1A 3P3CA 3ZZ0A 2N8XA 4X64E 2VQFE 1N33E 5DNXA 2PO1B 2EOJA
chains in the Genus database with same CATH topology
4WUDA 3Q6MA 3J81Q 4DR3I 4HXZA 4IZKA 3PYEA 1GQEA 1USUA 5GMDA 1H7SA 5AE3A 2V8PA 3ZZUA 4X62I 2CGEA 1ZXMA 4WYQB 2MC6A 3J7Yp 1IBME 1USVA 4JI8I 4KQVA 2RSMA 2O1TA 2L6MA 4DUYE 3PRYA 4LF9I 2E1MA 3V2UC 1IBKI 2ZITA 4DV4E 2CZ9A 1Z0BA 4Q28A 5DNYA 4X65E 4TUGA 4DR5I 1KIJA 2V89A 1YYWA 2F4VE 2R3VA 1NHHA 3J80C 1MU5A 3PYGA 2DSYA 4JI2I 2H36X 1A6FA 4WUBA 1ZBQA 4LTYA 2VE7C 3ADJA 3C4BA 5IWAE 4FWDA 2A2DA 4DV7I 4B3RE 3T1YI 2RTXA 4DUYI 2F4VI 2ZBKB 2V8QB 3WU3A 2PNLA 1D6TA 2RS7A 4F9BB 2G7HA 3D4JA 4R03A 4M0VA 3P06A 1GZ6A 3LMLA 2Z5CA 2M1SA 5LMUI 4LFAE 4JI0I 4KHPI 4DPXA 2L3JA 4JG4A 4DV3E 1N32E 1K47A 4P7DA 4DR5E 5F3WA 4FW9A 3LPSA 4X65I 4B3RI 4JI7I 1QZRA 2V83A 4LFAI 2WW4A 4DR1I 2LUPB 2FTXB 4DR2E 4LF8I 4DV3I 1I94E 4DPYA 1N32I 4DV6E 3T1YE 2O1VA 5LMUE 5FLXC 3F6HA 3F6GA 5A2QC 1ELOA 1H7UA 1I94I 1HK7A 3P1XA 2V87A 4JI8E 4HACB 4LFCE 4NXNE 4DV4I 4X66E 1FNMA 2V88A 5GMEA 4USMA 1BKNA 3Q1QA 2FV4B 2UUAE 2UUCI 1Z5BA 4BC9A 1HR0E 2JOBA 2JY9A 3J7AG 4DV1E 4DR1E 4B3SE 2HFSA 1Z0GA 4DR2I 1N0VC 1H74A 2HK3A 1RC7A 1FJGI 1U2RA 1N36I 4LF7I 2L3CA 1T4LB 4UTGA 4I3HA 5IT9Q 4Z7CA 3ZKBA 4YY3I 2LBSB 2IOPA 3RMPA 1J5EE 4F9AB 1HNWI 1Y4SA 4OX9E 3QT7A 3KWRA 2M7QA 4RPFA 2KHXA 3H09A 2NUFA 2O1WA 3IWBA 3Q6NA 4GEQB 1XNRI 3LTOA 4DV1I 4B3SI 2ZM6I 4WFTA 1UEKA 5FWKA 2UU9I 4X64I 2VQFI 1N33I 2UUCE 1SR9A 1T4NA 2GQ0A 3JU0A 4DMIA 4DV0E 3J7AM 4MYTA 1XHKA 2DEIA 1YYOA 2VF3A 2EWLA 1T4OA 1KKHA 1Z0EA 4FN5A 4LFBE 1Z5AA 4HYMA 4DV7E 4K0KI 4BBYA 1IBLE 4FWGA 4P52A 4L5NC 1Y4UA 2E5LI 4DR7E 2LTRA 2A2CA 3T1HE 3DF6A 1HNWE 1XMOE 2LMZA 1ZBTA 4DR4I 1FKAE 2L2KB 3LNUA 4DUZI 2B7TA 2L8TA 4P7AA 2RS6A 4LFCI 4LF5I 4B3TE 4F9CB 3GONA 3DJWA 4R8OA 2JWOA 2ODRC 1XMOI 2L92A 3ADGA 5ADZA 1XNQI 1HNZE 2UXCE 1B63A 5CFFE 1FWKA 4LU9A 4LF4E 1NHIA 4JI3I 4X62E 2YT4A 3QT8A 2MDRA 2UXDE 3HJCA 4LF7E 4USKA 4MYUA 1H72C 5FLXQ 1WHQA 1RR9A 4BS9A 4YY3E 1XMQE 3VYXA 1Z5CA 4DR6E 3J80Q 2CG9A 3WU4A 2HFUA 4OX9I 1XNQE 2JOXA 4DU8A 1N0UA 2LRSA 4JV5E 4WPYA 3QT6A 2J7KA 4LF8E 4AQYE 2B7VA 1YYKA 1YZ9A 2EZ6A 4DV6I 2LTSA 3VYYA 2NPFA 2E1RA 3HXLA 4DPTA 2IHR1 2JR1A 5AASA 1X49A 1HNZI 1Z0TA 2UXCI 3ZM7A 2Z5BB 4BC7A 2L2MA 1OJ4A 1ZM9A 3MSWA 4DV5E 4KZSA 1EI1A 2N3HA 2NA2A 1PVGA 4XTJA 4P78A 4K0KE 2BM0A 4NXMI 4ED4A 2GS8A 3PYDA 1XMQI 4DV5I 2LE2A 1PKPA 1X47A 4OOGC 2PNMA 2N3GA 1WXRA 2LUQA 4WSPA 4JI7E 4DUZE 4DR4E 1HNXE 3IWCA 2NUEA 1ZM3A 1VISA 1O0WA 4B3TI 4M30A 5AE1A 4B3ME 4FWHA 1Y6ZA 1FJGE 2Q2EB 3J81C 4IZJB 1N36E 4IZJA 3JTZA 4JI5I 4DPWA 4BCAA 2XEXA 2LJHA 3PYFA 2BV3A 4JI6I 4LF4I 4LF6E 1S4EA 1J5EI 5LMNE 1Z59A 1H73A 2Z5CB 3JAMQ 4R1FA 2VQEE 3ZOQB 3HULA 3K1JA 3CWVA 4HACA 3WU5A 1EKZA 1KTVA 2BM1A 3K85A 2X7IA 3WU6A 4NXNI 3OTOE 1DQ3A 4TUIA 4DV2I 2OI2A 4IZJD 4LF6I 4GKJE 2UXBI 4DR6I 2UU9E 3B8HA 2DEJA 2V34A 5LL6R 1EA6A 3ZZTA 3K17A 2FGGA 1HR0I 4X8WA 3B82A 2HKJA 2WZOA 4JI6E 1QU6A 4JV5I 2F8BA 2L33A 4M2ZA 4EMDA 2VQEI 2V2ZA 5IT9C 2R42A 2CPNA 4LFBI 3F0NA 2HHHI 2MC5A 4IZKB 4DV2E 4N3OA 1ZM2A 3OMLA 1Z0CA 4PRVA 2O1UA 1WHNA 1DI2A 2EFGA 4GKKI 1J26A 1N34E 4LF5E 4NXME 2UUBE 2V2VA 2V86A 3HTXA 3B78A 1XNRE 4DPUA 2ZM6E 4GKJI 2K4VA 1RQ0A 2HK2A 1UILA 1B62A 4I8OA 1Z0WA 1NZ0A 4DV0I 1ZM4A 5A2QQ 1S16A 1MG7A 2YZTA 4M1KA 4JI3E 2KONA 4PU9A 3HQ1A 4JI4E 1WUUA 4DXLA 5IWAI 5BR8E 3LLHA 3K6QA 4JI5E 2KOUA 4DR3E 4DU7A 2E5LE 1ZXNA 2IOQA 4DR7I 4JI4I 5LMNI 4ZVIA 4F54A 5L3JA 3AV0A 3QT5A 4GKKE 4HY1A 2AJ4A 2DMYA 1IBKE 3OTOI 4JI1I 1MX0A 1PIEA 2JVAA 2DB2A 4YHHI 3M6AA 2V2QA 1HNXI 1Z0VA 3C4TA 1FI4A 1KVKA 5T6JA 4J8ZA 4JI1E 4X66I 4JI2E 4B3MI 2ODRD 2VF1A 1X48A 4UT4A 2UXDI 1NHJA 3VK6A 5BR8I 2Z5EA 3FIGA 4YHHE 2X36A 2DIXA 3HPZA 4L8NA 2V85A 4BMJA 2HHHE 4JYAE 3JAMC 3AUZA 2B3TB 2Z5BA 3ADIA 1DARA 1N34I 1STUA 1IBLI 2M4IA 5AE2A 2UUBI 4JYAI 1RREA 4JI0E 4KHPE 3V5RA 3ADLA 3H4LA 4AQYI 2UXBE 2UUAI 3T1HI 3HPSA 2HKEA 4WUCA 1FWLA 3IWDA 4URLA 2LJPA 2L2NA 1UHZA 2B9DA 3ZKDA 4LF9E 4DKKA 4PRXA 4Z7YA 2NUGA 3ZZ0A 4X64E 2VQFE 1N33E 1IBMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUD A;  3J81 Q;  4DR3 I;  4HXZ A;  3PYE A;  1GQE A;  5GMD A;  1H7S A;  2V8P A;  3ZZU A;  4X62 I;  1ZXM A;  4WYQ B;  3J7Y p;  1IBM E;  4JI8 I;  4KQV A;  2RSM A;  4DUY E;  4LF9 I;  3V2U C;  1IBK I;  2ZIT A;  4DV4 E;  2CZ9 A;  1Z0B A;  4X65 E;  4DR5 I;  1KIJ A;  1YYW A;  2F4V E;  2R3V A;  1NHH A;  3J80 C;  1MU5 A;  3PYG A;  4JI2 I;  1A6F A;  4WUB A;  3ADJ A;  3C4B A;  5IWA E;  4FWD A;  2A2D A;  4DV7 I;  4B3R E;  3T1Y I;  2RTX A;  4DUY I;  2F4V I;  2ZBK B;  3WU3 A;  1D6T A;  2RS7 A;  3D4J A;  5LMU I;  4LFA E;  4JI0 I;  4KHP I;  4DPX A;  2L3J A;  4JG4 A;  4DV3 E;  1N32 E;  1K47 A;  4DR5 E;  4FW9 A;  4X65 I;  3LPS A;  4B3R I;  4JI7 I;  1QZR A;  4LFA I;  2WW4 A;  4DR1 I;  2LUP B;  4DR2 E;  4LF8 I;  4DV3 I;  1I94 E;  4DPY A;  1N32 I;  4DV6 E;  3T1Y E;  5LMU E;  5FLX C;  1H7U A;  1ELO A;  5A2Q C;  1I94 I;  3P1X A;  4JI8 E;  4HAC B;  4LFC E;  4NXN E;  4DV4 I;  4X66 E;  1FNM A;  5GME A;  4USM A;  1BKN A;  3Q1Q A;  2UUA E;  2UUC I;  1Z5B A;  1HR0 E;  2JY9 A;  3J7A G;  4DV1 E;  4DR1 E;  4B3S E;  2HFS A;  1Z0G A;  4DR2 I;  1N0V C;  1H74 A;  2HK3 A;  1RC7 A;  1FJG I;  1U2R A;  1N36 I;  4LF7 I;  2L3C A;  1T4L B;  4UTG A;  4I3H A;  5IT9 Q;  4Z7C A;  3ZKB A;  4YY3 I;  2LBS B;  1J5E E;  1HNW I;  4OX9 E;  3QT7 A;  4RPF A;  2KHX A;  2NUF A;  1XNR I;  3LTO A;  4DV1 I;  4B3S I;  2ZM6 I;  4WFT A;  1UEK A;  2UU9 I;  4X64 I;  2VQF I;  1N33 I;  2UUC E;  1T4N A;  4DV0 E;  3J7A M;  4MYT A;  1XHK A;  2DEI A;  1YYO A;  2VF3 A;  1T4O A;  1KKH A;  1Z0E A;  4FN5 A;  4LFB E;  1Z5A A;  4HYM A;  4DV7 E;  4K0K I;  1IBL E;  4FWG A;  4P52 A;  2E5L I;  4DR7 E;  2LTR A;  2A2C A;  3T1H E;  1HNW E;  1XMO E;  1ZBT A;  4DR4 I;  1FKA E;  2L2K B;  3LNU A;  4DUZ I;  2B7T A;  4P7A A;  2RS6 A;  4LFC I;  4LF5 I;  4B3T E;  3GON A;  1XMO I;  3ADG A;  1XNQ I;  1HNZ E;  2UXC E;  1B63 A;  5CFF E;  1FWK A;  4LF4 E;  1NHI A;  4JI3 I;  4X62 E;  2YT4 A;  3QT8 A;  2MDR A;  2UXD E;  4LF7 E;  4USK A;  4MYU A;  1H72 C;  5FLX Q;  1WHQ A;  1RR9 A;  4YY3 E;  1XMQ E;  3VYX A;  1Z5C A;  4DR6 E;  3J80 Q;  3WU4 A;  2HFU A;  4OX9 I;  1XNQ E;  4DU8 A;  1N0U A;  2LRS A;  4JV5 E;  3QT6 A;  2J7K A;  4LF8 E;  4AQY E;  2B7V A;  1YYK A;  1YZ9 A;  2EZ6 A;  4DV6 I;  2LTS A;  3VYY A;  2NPF A;  2E1R A;  4DPT A;  2IHR 1;  1X49 A;  1HNZ I;  1Z0T A;  2UXC I;  3ZM7 A;  2L2M A;  1OJ4 A;  1ZM9 A;  4DV5 E;  1EI1 A;  2N3H A;  2NA2 A;  1PVG A;  4XTJ A;  4K0K E;  2BM0 A;  4NXM I;  4ED4 A;  2GS8 A;  3PYD A;  1XMQ I;  4DV5 I;  1PKP A;  1X47 A;  4OOG C;  2N3G A;  2LUQ A;  4JI7 E;  4DUZ E;  4DR4 E;  1HNX E;  2NUE A;  1ZM3 A;  1VIS A;  1O0W A;  4B3T I;  4M30 A;  4B3M E;  4FWH A;  1FJG E;  2Q2E B;  3J81 C;  1N36 E;  4JI5 I;  4DPW A;  2XEX A;  2LJH A;  3PYF A;  2BV3 A;  4JI6 I;  4LF4 I;  4LF6 E;  1S4E A;  1J5E I;  5LMN E;  1Z59 A;  1H73 A;  3JAM Q;  4R1F A;  2VQE E;  3HUL A;  3K1J A;  3CWV A;  4HAC A;  3WU5 A;  1EKZ A;  1KTV A;  2BM1 A;  2X7I A;  3WU6 A;  4NXN I;  3OTO E;  4DV2 I;  2OI2 A;  4LF6 I;  4GKJ E;  2UXB I;  4DR6 I;  2UU9 E;  3B8H A;  2DEJ A;  2V34 A;  5LL6 R;  1EA6 A;  3ZZT A;  3K17 A;  1HR0 I;  4X8W A;  3B82 A;  2HKJ A;  4JI6 E;  1QU6 A;  4JV5 I;  2L33 A;  4M2Z A;  4EMD A;  2VQE I;  2V2Z A;  2R42 A;  5IT9 C;  2CPN A;  4LFB I;  3F0N A;  2HHH I;  4DV2 E;  1ZM2 A;  1Z0C A;  4PRV A;  1WHN A;  1DI2 A;  2EFG A;  4GKK I;  1J26 A;  1N34 E;  4LF5 E;  4NXM E;  2UUB E;  2V2V A;  3HTX A;  3B78 A;  1XNR E;  4DPU A;  2ZM6 E;  4GKJ I;  2HK2 A;  1RQ0 A;  1UIL A;  1B62 A;  1Z0W A;  1NZ0 A;  4DV0 I;  1ZM4 A;  5A2Q Q;  1S16 A;  1MG7 A;  4M1K A;  4JI3 E;  4PU9 A;  4JI4 E;  1WUU A;  4DXL A;  5IWA I;  5BR8 E;  3LLH A;  4JI5 E;  4DR3 E;  4DU7 A;  2E5L E;  1ZXN A;  4DR7 I;  4JI4 I;  5LMN I;  4ZVI A;  5L3J A;  3QT5 A;  4GKK E;  4HY1 A;  2AJ4 A;  2DMY A;  1IBK E;  3OTO I;  4JI1 I;  1MX0 A;  1PIE A;  2JVA A;  2DB2 A;  4YHH I;  3M6A A;  2V2Q A;  1HNX I;  1Z0V A;  3C4T A;  1FI4 A;  1KVK A;  4JI1 E;  4X66 I;  4JI2 E;  4B3M I;  4UT4 A;  1X48 A;  2UXD I;  1NHJ A;  5BR8 I;  2X36 A;  4YHH E;  2DIX A;  2HHH E;  4JYA E;  3JAM C;  2B3T B;  3ADI A;  1DAR A;  1N34 I;  1STU A;  1IBL I;  2UUB I;  4JYA I;  1RRE A;  4JI0 E;  4KHP E;  3V5R A;  3ADL A;  3H4L A;  4AQY I;  2UXB E;  2UUA I;  3T1H I;  2HKE A;  4WUC A;  1FWL A;  4URL A;  2LJP A;  2L2N A;  1UHZ A;  3ZKD A;  4LF9 E;  4DKK A;  4PRX A;  4Z7Y A;  2NUG A;  3ZZ0 A;  4X64 E;  2VQF E;  1N33 E;  1IBM I; 
#chains in the Genus database with same CATH topology
 1IQS A;  4WUD A;  3Q6M A;  3J81 Q;  4HEI A;  4DR3 I;  2WP8 A;  2JYA A;  4HXZ A;  4IZK A;  5EL9 A;  3PYE A;  4BA1 B;  1X5W A;  4WXC A;  1GQE A;  2YTG A;  1USU A;  1H7S A;  2WNR A;  4IS1 C;  2EPU A;  5AE3 A;  2V8P A;  5GMD A;  3ZZU A;  4X62 I;  2PO2 A;  2CGE A;  1ZXM A;  2EOX A;  3KZZ A;  4WYQ B;  2MC6 A;  3J7Y p;  1IBM E;  1USV A;  3NZK A;  4JI8 I;  2YTN A;  4KQV A;  1AH5 A;  2RSM A;  2EM7 A;  2L6M A;  4O24 A;  4DUY E;  2HGH A;  2O1T A;  2C39 B;  3PRY A;  4LF9 I;  2E1M A;  3V2U C;  1IBK I;  2C37 B;  2ZIT A;  2EL6 A;  4DV4 E;  1X3C A;  2CZ9 A;  1Z0B A;  1SFE A;  4Q28 A;  5KL6 A;  4WX9 A;  5DNY A;  4X65 E;  4TUG A;  4DR5 I;  2EPA A;  1KIJ A;  2EL4 A;  2V89 A;  1YYW A;  2F4V E;  2EPO A;  2R3V A;  4FW6 A;  1NHH A;  3J80 C;  2YTP A;  2EOR A;  4BHC A;  1MU5 A;  2GO3 A;  3PYG A;  2GO4 A;  2EPZ A;  2EOI A;  2DSY A;  4JI2 I;  2H36 X;  2HHH I;  1A6F A;  4GZN C;  1ZBQ A;  4WUB A;  4LTY A;  2VE7 C;  2EPC A;  3ADJ A;  3C4B A;  5IWA E;  1A1G A;  4FWD A;  2A2D A;  4DV7 I;  4B3R E;  3T1Y I;  2RTX A;  4DUY I;  2EOE A;  2F4V I;  2ZBK B;  2DLK A;  2V8Q B;  3WU3 A;  2ELZ A;  4MLV A;  5AC5 A;  2PNL A;  1D6T A;  1EH6 A;  2EM4 A;  2RS7 A;  4F9B B;  2MKN A;  2EMW A;  4QNK A;  2JEA B;  2G7H A;  1UBD C;  3D4J A;  1B69 A;  4R03 A;  2YSP A;  4M0V A;  3P06 A;  1GZ6 A;  3LML A;  2Z5C A;  2M1S A;  3BID A;  5LMU I;  4LFA E;  4JI0 I;  4KHP I;  2GLI A;  4IFD F;  2WNR B;  4DPX A;  2YTO A;  2K7I A;  2L3J A;  4DV3 E;  1N32 E;  4P7D A;  1K47 A;  4R2Q A;  4JG4 A;  5DRO A;  4DR5 E;  5F3W A;  4FK5 C;  3LPS A;  4FW9 A;  2YRM A;  1MEY C;  4R2S A;  4X65 I;  4B3R I;  2BR2 A;  4JI7 I;  1T38 A;  1QZR A;  5KL2 A;  3DD6 A;  4MQY A;  2V83 A;  3C6M A;  2JE6 B;  1OYS A;  2WW4 A;  2MKD A;  2LUP B;  4DR1 I;  1UDQ A;  2FTX B;  4DR2 E;  4LFA I;  5K36 C;  4LF8 I;  4DV3 I;  1I94 E;  4DPY A;  1N32 I;  5IXM B;  4DV6 E;  1LLM C;  2JPA A;  4MU4 A;  2EMG A;  2JEA A;  3UK3 C;  4AM3 A;  3T1Y E;  2D9H A;  2O1V A;  2CTD A;  5LMU E;  3M85 D;  2CSH A;  5FLX C;  3F6H A;  3F6G A;  4O43 A;  5JEA D;  1X6H A;  1WRJ A;  1PJQ A;  4ZYG A;  1Z1B A;  2YSO A;  1YUJ A;  5A2Q C;  1ELO A;  1H7U A;  1I94 I;  1HK7 A;  3P1X A;  2V87 A;  4JI8 E;  4HAC B;  4LFC E;  2PRT A;  2EOH A;  4NXN E;  4DV4 I;  2JE6 A;  4X66 E;  4AID A;  1FNM A;  2IES A;  2NAB A;  2V88 A;  5GME A;  4USM A;  1BKN A;  2X36 A;  2FV4 B;  2PO1 A;  2UUA E;  2VES A;  2WP8 B;  3Q1Q A;  4FW3 A;  2UUC I;  1Z5B A;  4BC9 A;  1HR0 E;  5K36 A;  2JOB A;  1TF6 A;  3L00 A;  2JY9 A;  3H1C A;  3J7A G;  2BA1 D;  4LCF A;  4R2D A;  4DV1 E;  4DR1 E;  4B3S E;  2HFS A;  1Z0G A;  4DR2 I;  1N0V C;  1H74 A;  2C39 A;  1RC7 A;  4R2R A;  1U2R A;  2HK3 A;  1FJG I;  1N36 I;  2EL5 A;  2L3C A;  1T4L B;  4MU0 A;  4UTG A;  1TN9 A;  2BBG A;  2BA0 D;  4U3D A;  4I3H A;  5IT9 Q;  4X9J A;  4Z7C A;  2EPK X;  1YH8 A;  1YPN A;  3ZKB A;  4YY3 I;  2NN6 C;  1QNT A;  5IV8 B;  2LBS B;  2IOP A;  3RMP A;  1J5E E;  2VRD A;  4F9A B;  1UDS A;  4O4K A;  4OZE A;  1HNW I;  1Y4S A;  2YTJ A;  4OX9 E;  3QT7 A;  4LF7 I;  3KWR A;  2M7Q A;  4RPF A;  2KHX A;  3H09 A;  4BA1 A;  2NUF A;  2EPP A;  3IWB A;  5A6A A;  2JT2 A;  2LV2 A;  4GEQ B;  2O1W A;  3LTO A;  3Q6N A;  4DV1 I;  2ZM6 I;  4B3S I;  1XNR I;  2ENA A;  2I9I A;  4WFT A;  1UEK A;  5FWK A;  1P42 A;  2WBT A;  2UU9 I;  2EM0 A;  4X64 I;  2VQF I;  3QG5 C;  1BBG A;  2UUC E;  1N33 I;  1SR9 A;  2BB8 A;  5K36 F;  3PS1 A;  3CDI A;  1T4N A;  2GQ0 A;  3JU0 A;  4DMI A;  4DV0 E;  1EH8 A;  2YRK A;  4OKG A;  3J7A M;  2RSI A;  4MYT A;  1XHK A;  2DEI A;  1YYO A;  2IER A;  1OYP A;  4M9V C;  2VF3 A;  3U1K A;  2EWL A;  1T4O A;  4F6M A;  2EM9 A;  3EPH A;  1KKH A;  1UDO A;  1UDN A;  5DRR A;  1PDA A;  1Z0E A;  4FN5 A;  5C0X D;  4LFB E;  1Z5A A;  3EPJ A;  2NN6 A;  4HYM A;  4DV7 E;  4K0K I;  4BBY A;  1IBL E;  4FWG A;  4P52 A;  2LCE A;  2EPN A;  4L5N C;  1Y4U A;  2E5L I;  1X6F A;  4DR7 E;  2NN6 E;  2LTR A;  4OO1 D;  2A2C A;  3ECR A;  3C6K A;  3DF6 A;  3T1H E;  1XMO E;  1HNW E;  3B4T A;  2C38 A;  4WSG A;  2LMZ A;  1ZBT A;  1MGT A;  5JEA A;  1FKA E;  4LOM A;  2L2K B;  3LNU A;  1N3G A;  2B7T A;  2WBU A;  3P3E A;  2L8T A;  4DUZ I;  2EMI A;  2RS6 A;  2A25 A;  4P7A A;  4LFC I;  4WXD A;  4LF5 I;  2NN6 D;  4B3T E;  3L7Z A;  5AC4 A;  4F9C B;  3GON A;  3DJW A;  4R8O A;  4LPF A;  4ISA A;  2EN7 A;  2JWO A;  2ODR C;  1XMO I;  1NEI A;  2EMX A;  2L92 A;  3ADG A;  5ADZ A;  1VI7 A;  1XNQ I;  2M9A A;  1HNZ E;  2UXC E;  1B63 A;  2PO2 B;  4O5G A;  5CFF E;  1A1I A;  3TQM A;  1FWK A;  4LU9 A;  4MDT A;  1RMD A;  2WBS A;  1DGC A;  2DRP A;  4LF4 E;  1NHI A;  4JI3 I;  1YUI A;  4X62 E;  3M85 G;  2HC5 A;  2YT4 A;  5EKW A;  2BA1 G;  3QT8 A;  2MDR A;  5DRP A;  2UXD E;  3HJC A;  4LF7 E;  1Y5Y A;  1A1F A;  4USK A;  5KL4 A;  4DR4 I;  4MYU A;  1H72 C;  1IMU A;  2RPC A;  5FLX Q;  4F2J C;  4DV6 I;  2NN6 F;  4R2C A;  1WHQ A;  4IFD B;  1RR9 A;  4BS9 A;  4YY3 E;  1XMQ E;  1PJS A;  3VYX A;  5K36 E;  2EMH A;  1Z5C A;  4DR6 E;  3P3G A;  3J80 Q;  2CG9 A;  3WU4 A;  2YWQ A;  2HFU A;  4OX9 I;  1JK1 A;  1XNQ E;  4OO1 F;  2JOX A;  4DU8 A;  1N0U A;  4OO1 E;  1EH7 A;  2LRS A;  4JV5 E;  4WPY A;  3QT6 A;  2J7K A;  3P76 A;  2ELY A;  2PNZ B;  4LF8 E;  4AQY E;  2MDG A;  2B7V A;  1YYK A;  2EM8 A;  1YZ9 A;  2EZ6 A;  4J3D A;  5C0X F;  2LTS A;  4OO1 A;  3VYY A;  2EML A;  2NPF A;  2E1R A;  3HXL A;  4DPT A;  2IHR 1;  2JR1 A;  5AAS A;  5C0X E;  4MU3 A;  1X49 A;  1HNZ I;  1Z0T A;  2UXC I;  2BA0 G;  3ZM7 A;  2Z5B B;  2J7J A;  2EMF A;  4BC7 A;  1T39 A;  2PO0 B;  2EMK A;  2L2M A;  1OJ4 A;  2EOM A;  1ZM9 A;  3MSW A;  2PO0 A;  4BA2 B;  2EM3 A;  4DV5 E;  3GLL A;  2EMZ A;  2EN3 A;  4KZS A;  5ELW A;  5C0X A;  1EI1 A;  5K36 D;  2N3H A;  4KWY A;  4MU1 A;  2NA2 A;  2GHF A;  1PVG A;  3CDJ A;  1G2D C;  4XTJ A;  2ADR A;  4P78 A;  2EN8 A;  4K0K E;  3EQ1 A;  2BM0 A;  3HKM A;  4ED4 A;  2EPX A;  3UHM A;  4NXM I;  2GS8 A;  3PYD A;  1XMQ I;  2EN6 A;  4DV5 I;  2EOZ A;  2LE2 A;  1PKP A;  2R76 A;  3PS3 A;  2EPL X;  1X47 A;  1PJT A;  4OOG C;  1YSA C;  1XXE A;  2PNM A;  2N3G A;  1WXR A;  2LUQ A;  4WSP A;  4JI7 E;  1R6L A;  4DUZ E;  4DR4 E;  1HNX E;  3IWC A;  2NUE A;  1ZM3 A;  5DNL A;  1VIS A;  1O0W A;  4NBQ A;  3L7Z B;  2EPM X;  4B3T I;  4M30 A;  1L4S A;  5AE1 A;  4B3M E;  4FWH A;  1Y6Z A;  2EMB A;  1FJG E;  2Q2E B;  3J81 C;  2DMI A;  2JEB A;  4IZJ B;  1N36 E;  4IZJ A;  4IFD A;  2JP9 A;  1WJP A;  4R2A A;  1IQO A;  3JTZ A;  4JI5 I;  2YTD A;  4DPW A;  4BCA A;  2JEB B;  2XEX A;  2LJH A;  4IFD E;  3PYF A;  2BV3 A;  4JI6 I;  4LF4 I;  4LF6 E;  5KL7 A;  1E3H A;  1S4E A;  1J5E I;  5JEA E;  5LMN E;  1Z59 A;  4ZYD A;  1H73 A;  2Z5C B;  3JAM Q;  5KL5 A;  4R1F A;  2VQE E;  3ZOQ B;  3HUL A;  3K1J A;  3CWV A;  4HAC A;  3WU5 A;  1EKZ A;  1UN6 B;  2EOF A;  1KTV A;  2BM1 A;  3K85 A;  2EMY A;  4LCG A;  2X7I A;  3WU6 A;  4NXN I;  3OTO E;  1DQ3 A;  4TUI A;  4DV2 I;  2OI2 A;  4IZJ D;  4LF6 I;  4GKJ E;  2UXB I;  1P47 A;  4DR6 I;  2UU9 E;  2O3Z A;  3B8H A;  2DEJ A;  2V34 A;  5LL6 R;  1EA6 A;  3ZZT A;  3K17 A;  3EPK A;  2FGG A;  4FW4 A;  1HR0 I;  4X8W A;  5DRQ A;  3B82 A;  2HKJ A;  3GME A;  5JEA F;  2WZO A;  1ZR9 A;  4JI6 E;  4OO1 C;  1QU6 A;  1R6M A;  4JV5 I;  2F8B A;  2L33 A;  4N4R B;  4M2Z A;  4QNJ A;  1A1L A;  4EMD A;  2AE8 A;  2VQE I;  2V2Z A;  5IT9 C;  1KJK A;  2R42 A;  2CPN A;  5A6J A;  4OO1 B;  2CT1 A;  4MLQ A;  5A6B A;  5C0X C;  4LFB I;  2PNZ A;  2EMA A;  1A1J A;  3F0N A;  2EE8 A;  1YFH A;  1JK2 A;  2J65 A;  2HJJ A;  3THO B;  2MC5 A;  4GQU A;  4IZK B;  4U3B A;  4DV2 E;  4N3O A;  1ZM2 A;  3OML A;  1IBM I;  1Z0C A;  2I13 A;  5JEA C;  4PRV A;  5LLQ A;  2EMC A;  2O1U A;  1WHN A;  1DI2 A;  2GPI A;  4RH8 A;  2YTE A;  2CVE A;  2EFG A;  1X6E A;  4GKK I;  1J26 A;  4IFD D;  1N34 E;  4LF5 E;  4NXM E;  2UUB E;  4R2E A;  2V86 A;  3HTX A;  2V2V A;  3B78 A;  1XNR E;  4DPU A;  4ZYE A;  2DGC A;  2ZM6 E;  3BBG A;  4GKJ I;  2EPR A;  5A6B D;  2K4V A;  1RQ0 A;  2HK2 A;  2F1D A;  2YU5 A;  1TF3 A;  1ZAA C;  3KRN A;  2DLQ A;  1UIL A;  1B62 A;  2C38 B;  3KZY A;  2EP3 A;  4I8O A;  4AIM A;  1A1K A;  1Z0W A;  1NZ0 A;  4DV0 I;  1ZM4 A;  1GTK A;  1S16 A;  1G2F C;  5A2Q Q;  1MG7 A;  2YZT A;  2EOY A;  4M1K A;  4JI3 E;  2KON A;  4PU9 A;  3HQ1 A;  4JI4 E;  2YRH A;  3BGH A;  1WUU A;  3THN A;  2Z5E A;  4DXL A;  3VHT B;  5IWA I;  5BR8 E;  3LLH A;  1F2I G;  2YU8 A;  3K6Q A;  4JI5 E;  2EM5 A;  2ENC A;  2KOU A;  4DR3 E;  1A1H A;  4DU7 A;  2E5L E;  1ZXN A;  2IOQ A;  4DR7 I;  1Y60 A;  2Q8U A;  4JI4 I;  3GCM A;  2ENH A;  5LMN I;  4ZVI A;  4F54 A;  5L3J A;  5A6K A;  3AV0 A;  3QT5 A;  4GKK E;  3M7N G;  4HY1 A;  5JEA B;  2EOS A;  2BR2 B;  2AJ4 A;  2LO3 A;  4NHR A;  2EM2 A;  4ZYH A;  2R1F A;  2DMY A;  1IBK E;  3OTO I;  4JI1 I;  4F6N A;  1MX0 A;  2EQ3 A;  2EM6 A;  2YTQ A;  2E72 A;  1PIE A;  1RHY A;  2EJ4 A;  2EOQ A;  3M7N D;  2JVA A;  3MHS C;  3PS2 A;  4FW7 A;  2DB2 A;  4YHH I;  3M6A A;  3EPL A;  1ZU1 A;  2V2Q A;  4NZV A;  1HNX I;  1Z0V A;  3C4T A;  4IJD A;  4RHB B;  1FI4 A;  1KVK A;  5T6J A;  2WCC 3;  5KL3 A;  4J8Z A;  4JI1 E;  4X66 I;  4LCH A;  4Q35 B;  4JI2 E;  4B3M I;  2ODR D;  2VF1 A;  1X48 A;  4IS9 A;  4UT4 A;  1NHJ A;  3VK6 A;  5BR8 I;  2UXD I;  2EQ0 A;  2LT7 A;  3FIG A;  2YTI A;  4YHH E;  2DIX A;  4L8N A;  3HPZ A;  1KYQ A;  2V85 A;  4BMJ A;  3MHH C;  2HHH E;  1OYR A;  1NCS A;  4JYA E;  5C0X B;  3JAM C;  4BA2 A;  3AUZ A;  1BBO A;  5TSE A;  2B3T B;  2RQL A;  2Z5B A;  2EQ1 A;  3ADI A;  5A69 A;  2NN6 B;  3BF2 A;  2EOO A;  1DAR A;  1N34 I;  2YTF A;  2EN4 A;  1STU A;  1IBL I;  2M4I A;  5AE2 A;  2UUB I;  4IFD C;  4JYA I;  1RRE A;  4JI0 E;  4KHP E;  3V5R A;  3ADL A;  3H4L A;  4AQY I;  2UXB E;  4R2P A;  2UUA I;  3T1H I;  3HPS A;  2LVH A;  2HKE A;  1BB8 A;  4WUC A;  1FWL A;  3IWD A;  4URL A;  2LJP A;  2L2N A;  1UHZ A;  2B9D A;  2YPN A;  4BHB A;  3ZKD A;  4LF9 E;  1E3P A;  4DKK A;  2C37 A;  4FW5 A;  3M99 B;  4PRX A;  4HTG A;  1AAY A;  4Z7Y A;  1YHC A;  2LJU A;  5K36 B;  2JXP A;  2EN2 A;  3U1Y A;  2NUG A;  2EN1 A;  3P3C A;  3ZZ0 A;  2N8X A;  4X64 E;  2VQF E;  1N33 E;  5DNX A;  2PO1 B;  2EOJ A; 
#chains in the Genus database with same CATH homology
 4WUD A;  3Q6M A;  3J81 Q;  4DR3 I;  4HXZ A;  4IZK A;  3PYE A;  1GQE A;  1USU A;  5GMD A;  1H7S A;  5AE3 A;  2V8P A;  3ZZU A;  4X62 I;  2CGE A;  1ZXM A;  4WYQ B;  2MC6 A;  3J7Y p;  1IBM E;  1USV A;  4JI8 I;  4KQV A;  2RSM A;  2O1T A;  2L6M A;  4DUY E;  3PRY A;  4LF9 I;  2E1M A;  3V2U C;  1IBK I;  2ZIT A;  4DV4 E;  2CZ9 A;  1Z0B A;  4Q28 A;  5DNY A;  4X65 E;  4TUG A;  4DR5 I;  1KIJ A;  2V89 A;  1YYW A;  2F4V E;  2R3V A;  1NHH A;  3J80 C;  1MU5 A;  3PYG A;  2DSY A;  4JI2 I;  2H36 X;  1A6F A;  4WUB A;  1ZBQ A;  4LTY A;  2VE7 C;  3ADJ A;  3C4B A;  5IWA E;  4FWD A;  2A2D A;  4DV7 I;  4B3R E;  3T1Y I;  2RTX A;  4DUY I;  2F4V I;  2ZBK B;  2V8Q B;  3WU3 A;  2PNL A;  1D6T A;  2RS7 A;  4F9B B;  2G7H A;  3D4J A;  4R03 A;  4M0V A;  3P06 A;  1GZ6 A;  3LML A;  2Z5C A;  2M1S A;  5LMU I;  4LFA E;  4JI0 I;  4KHP I;  4DPX A;  2L3J A;  4JG4 A;  4DV3 E;  1N32 E;  1K47 A;  4P7D A;  4DR5 E;  5F3W A;  4FW9 A;  3LPS A;  4X65 I;  4B3R I;  4JI7 I;  1QZR A;  2V83 A;  4LFA I;  2WW4 A;  4DR1 I;  2LUP B;  2FTX B;  4DR2 E;  4LF8 I;  4DV3 I;  1I94 E;  4DPY A;  1N32 I;  4DV6 E;  3T1Y E;  2O1V A;  5LMU E;  5FLX C;  3F6H A;  3F6G A;  5A2Q C;  1ELO A;  1H7U A;  1I94 I;  1HK7 A;  3P1X A;  2V87 A;  4JI8 E;  4HAC B;  4LFC E;  4NXN E;  4DV4 I;  4X66 E;  1FNM A;  2V88 A;  5GME A;  4USM A;  1BKN A;  3Q1Q A;  2FV4 B;  2UUA E;  2UUC I;  1Z5B A;  4BC9 A;  1HR0 E;  2JOB A;  2JY9 A;  3J7A G;  4DV1 E;  4DR1 E;  4B3S E;  2HFS A;  1Z0G A;  4DR2 I;  1N0V C;  1H74 A;  2HK3 A;  1RC7 A;  1FJG I;  1U2R A;  1N36 I;  4LF7 I;  2L3C A;  1T4L B;  4UTG A;  4I3H A;  5IT9 Q;  4Z7C A;  3ZKB A;  4YY3 I;  2LBS B;  2IOP A;  3RMP A;  1J5E E;  4F9A B;  1HNW I;  1Y4S A;  4OX9 E;  3QT7 A;  3KWR A;  2M7Q A;  4RPF A;  2KHX A;  3H09 A;  2NUF A;  2O1W A;  3IWB A;  3Q6N A;  4GEQ B;  1XNR I;  3LTO A;  4DV1 I;  4B3S I;  2ZM6 I;  4WFT A;  1UEK A;  5FWK A;  2UU9 I;  4X64 I;  2VQF I;  1N33 I;  2UUC E;  1SR9 A;  1T4N A;  2GQ0 A;  3JU0 A;  4DMI A;  4DV0 E;  3J7A M;  4MYT A;  1XHK A;  2DEI A;  1YYO A;  2VF3 A;  2EWL A;  1T4O A;  1KKH A;  1Z0E A;  4FN5 A;  4LFB E;  1Z5A A;  4HYM A;  4DV7 E;  4K0K I;  4BBY A;  1IBL E;  4FWG A;  4P52 A;  4L5N C;  1Y4U A;  2E5L I;  4DR7 E;  2LTR A;  2A2C A;  3T1H E;  3DF6 A;  1HNW E;  1XMO E;  2LMZ A;  1ZBT A;  4DR4 I;  1FKA E;  2L2K B;  3LNU A;  4DUZ I;  2B7T A;  2L8T A;  4P7A A;  2RS6 A;  4LFC I;  4LF5 I;  4B3T E;  4F9C B;  3GON A;  3DJW A;  4R8O A;  2JWO A;  2ODR C;  1XMO I;  2L92 A;  3ADG A;  5ADZ A;  1XNQ I;  1HNZ E;  2UXC E;  1B63 A;  5CFF E;  1FWK A;  4LU9 A;  4LF4 E;  1NHI A;  4JI3 I;  4X62 E;  2YT4 A;  3QT8 A;  2MDR A;  2UXD E;  3HJC A;  4LF7 E;  4USK A;  4MYU A;  1H72 C;  5FLX Q;  1WHQ A;  1RR9 A;  4BS9 A;  4YY3 E;  1XMQ E;  3VYX A;  1Z5C A;  4DR6 E;  3J80 Q;  2CG9 A;  3WU4 A;  2HFU A;  4OX9 I;  1XNQ E;  2JOX A;  4DU8 A;  1N0U A;  2LRS A;  4JV5 E;  4WPY A;  3QT6 A;  2J7K A;  4LF8 E;  4AQY E;  2B7V A;  1YYK A;  1YZ9 A;  2EZ6 A;  4DV6 I;  2LTS A;  3VYY A;  2NPF A;  2E1R A;  3HXL A;  4DPT A;  2IHR 1;  2JR1 A;  5AAS A;  1X49 A;  1HNZ I;  1Z0T A;  2UXC I;  3ZM7 A;  2Z5B B;  4BC7 A;  2L2M A;  1OJ4 A;  1ZM9 A;  3MSW A;  4DV5 E;  4KZS A;  1EI1 A;  2N3H A;  2NA2 A;  1PVG A;  4XTJ A;  4P78 A;  4K0K E;  2BM0 A;  4NXM I;  4ED4 A;  2GS8 A;  3PYD A;  1XMQ I;  4DV5 I;  2LE2 A;  1PKP A;  1X47 A;  4OOG C;  2PNM A;  2N3G A;  1WXR A;  2LUQ A;  4WSP A;  4JI7 E;  4DUZ E;  4DR4 E;  1HNX E;  3IWC A;  2NUE A;  1ZM3 A;  1VIS A;  1O0W A;  4B3T I;  4M30 A;  5AE1 A;  4B3M E;  4FWH A;  1Y6Z A;  1FJG E;  2Q2E B;  3J81 C;  4IZJ B;  1N36 E;  4IZJ A;  3JTZ A;  4JI5 I;  4DPW A;  4BCA A;  2XEX A;  2LJH A;  3PYF A;  2BV3 A;  4JI6 I;  4LF4 I;  4LF6 E;  1S4E A;  1J5E I;  5LMN E;  1Z59 A;  1H73 A;  2Z5C B;  3JAM Q;  4R1F A;  2VQE E;  3ZOQ B;  3HUL A;  3K1J A;  3CWV A;  4HAC A;  3WU5 A;  1EKZ A;  1KTV A;  2BM1 A;  3K85 A;  2X7I A;  3WU6 A;  4NXN I;  3OTO E;  1DQ3 A;  4TUI A;  4DV2 I;  2OI2 A;  4IZJ D;  4LF6 I;  4GKJ E;  2UXB I;  4DR6 I;  2UU9 E;  3B8H A;  2DEJ A;  2V34 A;  5LL6 R;  1EA6 A;  3ZZT A;  3K17 A;  2FGG A;  1HR0 I;  4X8W A;  3B82 A;  2HKJ A;  2WZO A;  4JI6 E;  1QU6 A;  4JV5 I;  2F8B A;  2L33 A;  4M2Z A;  4EMD A;  2VQE I;  2V2Z A;  5IT9 C;  2R42 A;  2CPN A;  4LFB I;  3F0N A;  2HHH I;  2MC5 A;  4IZK B;  4DV2 E;  4N3O A;  1ZM2 A;  3OML A;  1Z0C A;  4PRV A;  2O1U A;  1WHN A;  1DI2 A;  2EFG A;  4GKK I;  1J26 A;  1N34 E;  4LF5 E;  4NXM E;  2UUB E;  2V2V A;  2V86 A;  3HTX A;  3B78 A;  1XNR E;  4DPU A;  2ZM6 E;  4GKJ I;  2K4V A;  1RQ0 A;  2HK2 A;  1UIL A;  1B62 A;  4I8O A;  1Z0W A;  1NZ0 A;  4DV0 I;  1ZM4 A;  5A2Q Q;  1S16 A;  1MG7 A;  2YZT A;  4M1K A;  4JI3 E;  2KON A;  4PU9 A;  3HQ1 A;  4JI4 E;  1WUU A;  4DXL A;  5IWA I;  5BR8 E;  3LLH A;  3K6Q A;  4JI5 E;  2KOU A;  4DR3 E;  4DU7 A;  2E5L E;  1ZXN A;  2IOQ A;  4DR7 I;  4JI4 I;  5LMN I;  4ZVI A;  4F54 A;  5L3J A;  3AV0 A;  3QT5 A;  4GKK E;  4HY1 A;  2AJ4 A;  2DMY A;  1IBK E;  3OTO I;  4JI1 I;  1MX0 A;  1PIE A;  2JVA A;  2DB2 A;  4YHH I;  3M6A A;  2V2Q A;  1HNX I;  1Z0V A;  3C4T A;  1FI4 A;  1KVK A;  5T6J A;  4J8Z A;  4JI1 E;  4X66 I;  4JI2 E;  4B3M I;  2ODR D;  2VF1 A;  1X48 A;  4UT4 A;  2UXD I;  1NHJ A;  3VK6 A;  5BR8 I;  2Z5E A;  3FIG A;  4YHH E;  2X36 A;  2DIX A;  3HPZ A;  4L8N A;  2V85 A;  4BMJ A;  2HHH E;  4JYA E;  3JAM C;  3AUZ A;  2B3T B;  2Z5B A;  3ADI A;  1DAR A;  1N34 I;  1STU A;  1IBL I;  2M4I A;  5AE2 A;  2UUB I;  4JYA I;  1RRE A;  4JI0 E;  4KHP E;  3V5R A;  3ADL A;  3H4L A;  4AQY I;  2UXB E;  2UUA I;  3T1H I;  3HPS A;  2HKE A;  4WUC A;  1FWL A;  3IWD A;  4URL A;  2LJP A;  2L2N A;  1UHZ A;  2B9D A;  3ZKD A;  4LF9 E;  4DKK A;  4PRX A;  4Z7Y A;  2NUG A;  3ZZ0 A;  4X64 E;  2VQF E;  1N33 E;  1IBM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...