2UXDE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxdE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxdE02
1IBKE 1HNXE 2YT4A 1HR0I 3ZZ0A 1YYKA 4EMDA 2UUBI 5BR8E 1N32E 4JI8I 5GMEA 4DPUA 3B82A 4JI4I 5IWAE 4P7AA 1ZXMA 3J81Q 4JI2I 4JI7I 3LPSA 3V2UC 1N34E 4JI3I 2HK2A 3C4TA 2N3HA 1Z0CA 4LF6E 4PU9A 1NHHA 4WFTA 4JYAI 2DMYA 4DR3I 2B3TB 1STUA 2JVAA 3PYFA 3QT5A 4NXMI 1Z59A 4B3SE 1K47A 1RC7A 1D6TA 1Z5BA 3V5RA 3F0NA 4JV5I 1NZ0A 4LFCI 1XMQI 4LF4I 2IHR1 3J7AM 4DV5I 5FLXQ 1XNQE 4DR6I 4DR4E 3ZKDA 1EI1A 2UU9E 1Z0VA 2ZBKB 2RSMA 3T1YI 1H73A 1O0WA 1KIJA 1IBKI 1HNXI 3HULA 1YYOA 2F4VE 2WW4A 4LF9E 2AJ4A 2GS8A 2ZM6I 2HKJA 2J7KA 5BR8I 1N32I 3LTOA 5IWAI 1EA6A 1N34I 1VISA 2UUCE 4LF6I 1T4NA 4YHHE 3T1HE 1XNRE 4DV4E 3JAMQ 2NUEA 4GKKE 5L3JA 2LJHA 3HTXA 4JI2E 2VQEE 4B3SI 2ZITA 4M30A 4AQYE 1IBLE 3PYGA 4KQVA 1NHIA 1HNWE 5A2QQ 4K0KE 4DR1E 4DR7E 1MX0A 4DV7E 2L2KB 3H4LA 4FW9A 4PRVA 3ZZUA 2BM0A 3WU4A 1XNQI 3J80Q 2LUQA 4DR4I 2UU9I 1N0UA 4FWDA 3ADGA 1XMQE 4LFCE 4B3RE 3Q1QA 1X47A 2LBSB 1WHQA 2F4VI 3ZKBA 4JI6E 4DR6E 1NHJA 2L3CA 2L2NA 2EZ6A 1DI2A 1XMOE 4JI0E 1KKHA 1KVKA 2UUCI 2CPNA 1H74A 2HKEA 4I3HA 2R3VA 4YY3I 4YHHI 3T1HI 1XNRI 4DV4I 5A2QC 5LMUE 2ZM6E 4GKKI 1WHNA 4DV6E 2B7VA 4FWHA 2VQEI 4AQYI 1IBLI 1A6FA 1HNWI 2N3GA 3VYXA 4X66I 4K0KI 4DR1I 4DR7I 4DR2E 4DV7I 4B3TE 3J7Yp 1MG7A 4X64E 1U2RA 1QZRA 1T4OA 4UTGA 5LL6R 4LFBE 2LUPB 2L33A 1FNMA 2OI2A 4DV2E 4DPTA 1T4LB 4LF5E 1B63A 1FKAE 3K1JA 4M1KA 3ZM7A 2LTRA 4B3RI 2BV3A 4FN5A 1FWKA 4Z7CA 2UXBE 3PYDA 1ZM3A 2HK3A 4JI6I 2V8PA 2V34A 5IT9Q 1EKZA 4NXNE 1HNZE 2UXCE 1XMOI 4JI0I 4FWGA 4HYMA 3P1XA 3J81C 4DPWA 4HACB 3J7AG 4JG4A 1S4EA 2BM1A 5LMUI 1XHKA 1I94E 3QT8A 4DV6I 2LRSA 2UUAE 4B3ME 1PIEA 4DR2I 4B3TI 4DV3E 4YY3E 4KHPE 4X64I 4GKJE 1RR9A 3CWVA 4LFBI 1FWLA 4X65E 4DV2I 5FLXC 3K17A 4LF5I 2HFSA 3B78A 5IT9C 1ZBTA 1J5EE 4X66E 4DV1E 2RS6A 2UXBI 1Z0WA 1UILA 2KHXA 1Z5AA 2NPFA 2DEJA 4LF8I 4M2ZA 1Z0GA 4NXNI 1HNZI 4OX9I 2UXCI 1YYWA 1H72C 4HACA 1FJGE 4Z7YA 2DEIA 1YZ9A 2LJPA 1X48A 1RQ0A 1N36E 1B62A 2DB2A 4JI1E 1N0VC 2V2QA 3ADJA 4ED4A 4HY1A 1PKPA 1I94I 3JAMC 4DV0I 5GMDA 4URLA 2UUAI 3D4JA 4B3MI 3OTOE 4DV3I 4KHPI 4R1FA 2UXDE 1PVGA 4GKJI 3ADIA 3LNUA 3QT7A 1ZM9A 4X65I 1Z0EA 4P52A 4DR5E 3B8HA 3LLHA 3QT6A 2HHHE 3J80C 1J5EI 4DV1I 2Q2EB 1ZM4A 4DUYE 3VYYA 4MYTA 2RS7A 4LF7E 1Z5CA 5LMNE 2V2ZA 4ZVIA 4LFAE 1RREA 1N33I 4WUCA 1WUUA 1OJ4A 4WUDA 2A2DA 4USKA 1GQEA 1FJGI 1J26A 4X62E 3ZZTA 4OOGC 2NUGA 3WU6A 1IBME 2L3JA 4LF8E 1N36I 4JI1I 4DPYA 1KTVA 2NA2A 4USMA 4OX9E 4UT4A 1S16A 1H7UA 2E5LE 1BKNA 3OTOI 2UXDI 3ADLA 2V2VA 2XEXA 4PRXA 4DV0E 2E1RA 4JI5E 4WUBA 4DR5I 2CZ9A 2HHHI 2VF3A 1ELOA 4DUYI 2VQFE 4MYUA 1Z0BA 2EFGA 4DKKA 4LF7I 5LMNI 4LFAI 4DUZE 2MDRA 1UHZA 4WYQB 3C4BA 2JY9A 4X62I 1HR0E 2HFUA 4X8WA 1IBMI 1FI4A 1N33E 3M6AA 1X49A 1Z0TA 2B7TA 2UUBE 4JI8E 3GONA 3WU3A 4JI4E 4DPXA 4JI7E 4RPFA 2E5LI 1UEKA 4JI3E 4JYAE 2A2CA 4DR3E 2R42A 3WU5A 5CFFE 4NXME 4DXLA 4JI5I 2L2MA 2LTSA 1DARA 4JV5E 1ZM2A 4LF4E 4XTJA 4DU8A 2VQFI 2DIXA 4DV5E 3PYEA 4LF9I 1QU6A 1MU5A 2X36A 2NUFA 4DUZI 4HXZA 1H7SA 4DU7A 1ZXNA 3T1YE 2RTXA 2X7IA
chains in the Genus database with same CATH superfamily
1DQ3A 4OKGA 1UDOA 2YTJA 4F9AB 1A1KA 4IZJA 2YPNA 1IBKE 2GHFA 2EM9A 1HNXE 4IJDA 4KQVA 2JEAA 3HQ1A 2YT4A 1HR0I 1WXRA 3HPSA 4F54A 1WRJA 2EE8A 2YRHA 4FW4A 3ZZ0A 1YYKA 2BA1G 3BF2A 4BS9A 2EPCA 2I9IA 4EMDA 2E1MA 2UUBI 5BR8E 3Q6NA 1N32E 4JI8I 2MKNA 4ZYGA 5GMEA 4BC7A 4DPUA 2YU8A 3B82A 2MKDA 4JI4I 5IWAE 4P7AA 1ZXMA 3J81Q 4JI2I 4JI7I 5JEAC 3LPSA 4OO1B 1PJSA 3K6QA 4MLQA 3V2UC 2EWLA 1N34E 5K36E 5ELWA 4JI3I 2EMXA 5C0XA 2HK2A 3C4TA 2EMHA 2N3HA 1Z0CA 4LF6E 2IOQA 4PU9A 1NHHA 4WFTA 2PO0A 1UDNA 4JYAI 2DMYA 4DR3I 1SFEA 2B3TB 3C6KA 1STUA 2JVAA 3L00A 1OYSA 3PYFA 3QT5A 2BA0D 3P3EA 4NXMI 1Z59A 2JE6B 4FW6A 3CDJA 1A1JA 5EKWA 4IFDD 2EMAA 4B3SE 3L7ZB 1K47A 1RC7A 1D6TA 1Z5BA 3V5RA 3ZOQB 2PO2A 3F0NA 2YWQA 4JV5I 1NZ0A 1OYRA 2V85A 4LFCI 2EORA 1XMQI 4LF4I 1ZR9A 2IHR1 4BA1A 2G7HA 2N8XA 3J7AM 4DV5I 3GLLA 2DLKA 2YRKA 2EM7A 1MEYC 4AIDA 5IV8B 5FLXQ 2DMIA 4F9CB 1XNQE 2EM6A 2EOQA 4DR6I 4DR4E 2F8BA 3IWDA 3ZKDA 5FWKA 1EI1A 2UU9E 1Z0VA 2O1UA 5C0XC 2EPAA 2ZBKB 4R2DA 2ODRD 4IFDE 2V89A 2RSMA 4BHBA 3T1YI 2JWOA 2EMYA 2YTQA 1H73A 4DV6I 2EOMA 5T6JA 2Q8UA 1O0WA 1GTKA 1KIJA 3U1KA 1IBKI 1Y4UA 4WXDA 1HNXI 4R2PA 1A1LA 3IWCA 1YYOA 4WSPA 2F4VE 3HULA 5DNLA 2WW4A 4LF9E 1USVA 4IZKB 2AJ4A 2GS8A 4J3DA 2ZM6I 2HKJA 2J7KA 5BR8I 1PJQA 1N32I 2EM5A 3DJWA 3LTOA 5IWAI 1EA6A 2EM2A 1RHYA 2CTDA 4R2QA 1N34I 1VISA 2JP9A 4FW7A 2C37B 4NZVA 2UUCE 4R2RA 4LF6I 1T4NA 4YHHE 3T1HE 1XNRE 2WBTA 1AH5A 2YTOA 5AE2A 4DV4E 4N3OA 3JAMQ 2E72A 4R2SA 2NUEA 4GKKE 5L3JA 1SR9A 3EPLA 2LJHA 3HTXA 2CVEA 2WBUA 4IZJD 4JI2E 2VQEE 5TSEA 2ZITA 2LO3A 4M30A 4AQYE 2YZTA 1IBLE 1B69A 1OYPA 3PYGA 2BB8A 4O4KA 1NHIA 5JEAE 1HNWE 1X6FA 2BBGA 5KL6A 5A2QQ 1X6EA 5DNYA 2EL6A 5AE3A 4DR1E 4K0KE 4DR7E 1MX0A 4DV7E 4OO1C 2EPKX 2L2KB 3H4LA 4FW9A 2R1FA 4PRVA 1ZAAC 1Y5YA 1UDSA 3ZZUA 1G2FC 1R6MA 2BM0A 3WU4A 1VI7A 1XNQI 3J80Q 2LUQA 4DR4I 2EOOA 2EMZA 4WPYA 3Q6MA 1UBDC 2UU9I 1YPNA 1N0UA 2PNLA 2V86A 2EQ3A 5LLQA 4FWDA 2LVHA 4BA2B 2WBSA 2EOZA 3ADGA 4J8ZA 3OMLA 2JPAA 1XMQE 4LFCE 1P47A 4B3RE 2F1DA 4IZKA 3Q1QA 1A1HA 1X47A 5DROA 4KZSA 2LBSB 1WHQA 4BCAA 5AC4A 2F4VI 3MHHC 2EPLX 3M85D 2NN6B 3EPHA 2M7QA 3KRNA 3ZKBA 4JI6E 4DR6E 2V83A 1NHJA 2LE2A 2L3CA 2L2NA 4LPFA 1E3HA 5C0XE 2C37A 2EZ6A 1EH8A 1DI2A 1XMOE 4JI0E 1KKHA 2GPIA 2BA0G 1KVKA 1WJPA 2L92A 2C39B 5K36D 4R03A 2VE7C 2GO4A 3MSWA 4ZYEA 2UUCI 3GMEA 2CPNA 1H74A 2HKEA 4ZYDA 4U3DA 2R3VA 4I3HA 4YY3I 4YHHI 3T1HI 1PJTA 1XNRI 4DV4I 2EMWA 5A2QC 5LMUE 2ADRA 3PS3A 2ZM6E 4GKKI 1WHNA 2JR1A 1IQOA 3P06A 2EOFA 1ZBQA 2M9AA 2EMFA 4R2CA 4DV6E 2B7VA 4FWHA 2EPNA 2VQEI 4AQYI 1IBLI 3EPKA 2IESA 2EJ4A 1A6FA 1HNWI 2N3GA 3BGHA 3VYXA 4X66I 4K0KI 4DR1I 4DR7I 4DR2E 4DV7I 4F6MA 4B3TE 3J7Yp 4FK5C 4X64E 1MG7A 2PNZB 1QNTA 1U2RA 2WP8B 3U1YA 4WX9A 2RSIA 1T4OA 4BC9A 5KL7A 5LL6R 4LFBE 4RH8A 2LUPB 1QZRA 4FW5A 5DRRA 2O3ZA 2EN6A 1L4SA 2EN1A 2L33A 1FNMA 2OI2A 4DV2E 1KJKA 4DPTA 1T4LB 4LF5E 2EOIA 1B63A 3QG5C 2EM8A 1FKAE 3K1JA 2YTGA 2DLQA 2RPCA 5DRQA 4L5NC 4M1KA 3ZM7A 2LTRA 3H09A 4B3RI 2BV3A 4FN5A 1FWKA 1YFHA 4Z7CA 4AIMA 2UXBE 3HXLA 2EM3A 1AAYA 2ELZA 3PYDA 2WZOA 4GQUA 1ZM3A 3PS1A 2R76A 2HK3A 4JI6I 2Z5CB 2V8PA 2LT7A 2V34A 5IT9Q 5ADZA 4IFDB 1EKZA 4NXNE 4P7DA 1HNZE 4NHRA 2UXCE 1P42A 2NN6F 1XMOI 2FGGA 2L6MA 4JI0I 2H36X 4BHCA 2JEBB 4FWGA 4HYMA 2J7JA 3P1XA 1KYQA 3J81C 4FW3A 2YSPA 2LMZA 2VF1A 3GCMA 4HACB 2EOJA 4DPWA 3J7AG 2EM0A 4JG4A 1S4EA 4ZYHA 2BM1A 4I8OA 5LMUI 2EOYA 4OO1A 2NN6C 4LCHA 2EMIA 1XHKA 1I94E 1N3GA 2EN2A 3RMPA 3QT8A 1T38A 4ISAA 2MC6A 2LRSA 3HPZA 3KWRA 2CSHA 3JU0A 5JEAD 1RMDA 1UN6B 3F6GA 4WXCA 2UUAE 4U3BA 4B3ME 1PIEA 4DR2I 1EH6A 2VRDA 2V88A 2WNRB 4B3TI 4DV3E 1ZU1A 4YY3E 4KHPE 2ELYA 4GKJE 1RR9A 2JE6A 2YU5A 4X64I 5K36F 3CDIA 3L7ZA 5KL5A 3CWVA 2EMCA 4LFBI 1FWLA 3UHMA 4X65E 5DNXA 3DD6A 3M85G 2JOBA 1A1GA 4X9JA 3UK3C 2EOEA 5FLXC 3K17A 4DV2I 1YUIA 2EN8A 2YTEA 2FTXB 4B3SI 4LF5I 2D9HA 2HFSA 5A6AA 3B78A 2Z5BB 5IT9C 3BIDA 1ZBTA 2EN3A 4GEQB 4X66E 4DV1E 1J5EE 3B4TA 2PO1B 3M7ND 2RS6A 2JOXA 1HK7A 2UXBI 1Z0WA 1UILA 2EQ1A 2KHXA 2MDGA 1Z5AA 2NPFA 1YH8A 1BBGA 4GZNC 2DEJA 4ED4A 5AASA 4LF8I 2EN4A 2M1SA 4M2ZA 1X3CA 2KONA 4IZJB 5A6BA 4MU0A 1Z0GA 2AE8A 5C0XD 4NXNI 1HNZI 2JEAB 4OX9I 2UXCI 1LLMC 1G2DC 1YYWA 1H72C 1YSAC 3HKMA 2YTIA 4HACA 1FJGE 2ENHA 3PRYA 2DGCA 2JXPA 4Z7YA 2DEIA 2V87A 4F6NA 1YZ9A 3P3CA 4IFDF 4Q35B 2LJPA 1X48A 4O43A 4R8OA 1RQ0A 2PNMA 1EH7A 1MGTA 1N36E 1B62A 2DB2A 1TF3A 4JI1E 1N0VC 3ADJA 2V2QA 3NZKA 4HY1A 1PKPA 4M9VC 1I94I 3JAMC 2PO0B 4DV0I 5GMDA 1BBOA 4IFDC 1PDAA 2YRMA 1IMUA 4QNJA 3ECRA 4URLA 2UUAI 3THNA 3BBGA 3D4JA 4M0VA 2M4IA 4B3MI 2RQLA 4RHBB 4LOMA 5KL2A 3OTOE 4DV3I 1R6LA 4KHPI 4R1FA 2UXDE 1PVGA 2EOHA 4GKJI 2LJUA 3ADIA 2PO2B 5AE1A 3LNUA 3QT7A 2NABA 1ZM9A 3EQ1A 4X65I 1Z0EA 4TUGA 1NEIA 2Z5BA 4MU1A 4P52A 4BA1B 2O1VA 3IWBA 4UTGA 4DR5E 3B8HA 2ODRC 3LLHA 4MDTA 5K36B 3QT6A 3J80C 2HHHE 4L8NA 1J5EI 4DV1I 3KZYA 1UDQA 2Q2EB 2EPMX 1ZM4A 4OO1D 2EPRA 4DUYE 1IQSA 3VYYA 4MYTA 2DRPA 5JEAF 2RS7A 1T39A 1XXEA 2KOUA 2JT2A 5DRPA 1DGCA 3KZZA 4NBQA 4LF7E 1Z5CA 5LMNE 2V2ZA 4BA2A 4ZVIA 4LFAE 1RREA 1N33I 4WUCA 1WUUA 2FV4B 4BBYA 4R2AA 1OJ4A 2YTNA 5A6KA 4F9BB 4WUDA 2A2DA 4OZEA 4IS9A 4USKA 1GQEA 1FJGI 2NN6A 3HJCA 4OO1E 2B9DA 2CT1A 4LU9A 5A69A 4O24A 2L8TA 1E3PA 2EPOA 1J26A 2YTDA 4X62E 3ZZTA 4OOGC 2CG9A 2NUGA 3WU6A 1IBME 2L3JA 4LF8E 1USUA 5KL4A 4JI1I 1N36I 4DPYA 3PS2A 1KTVA 4AM3A 2C39A 3K85A 2NA2A 1TN9A 4USMA 4OX9E 2EMLA 2C38B 4UT4A 3MHSC 5KL3A 1S16A 2HC5A 5C0XF 1H7UA 2E5LE 4QNKA 1BKNA 5A6BD 3OTOI 3C6MA 2BA1D 2UXDI 1TF6A 3ADLA 2HJJA 1A1FA 2V2VA 2XEXA 4PRXA 1A1IA 5EL9A 3M7NG 5K36A 5F3WA 4O5GA 2YTFA 1JK1A 3AV0A 1BB8A 4R2EA 4DV0E 2E1RA 4JI5E 4WUBA 5AC5A 2CZ9A 4DR5I 2LCEA 4HEIA 2PNZA 2HHHI 2JYAA 2WP8A 3M99B 2VF3A 4MU3A 1JK2A 1ELOA 4DUYI 2VQFE 2GO3A 2IOPA 2PRTA 4KWYA 4HTGA 4MYUA 1Z1BA 2CGEA 2EN7A 1Z0BA 2EFGA 4DKKA 4LF7I 1YUJA 5LMNI 4MLVA 2BR2B 2EPPA 4LFAI 2EMBA 3VK6A 4MQYA 4Q28A 2ENAA 5JEAB 4DUZE 1X5WA 2MDRA 2A25A 4P78A 2I13A 2YSOA 2MC5A 3AUZA 5K36C 3LMLA 2GQ0A 1UHZA 2EPZA 4WYQB 3C4BA 2Z5CA 2HGHA 1GZ6A 2IERA 2EOSA 2V8QB 4IFDA 2JY9A 3P76A 2WCC3 4X62I 1HR0E 2HFUA 2EOXA 4X8WA 1IBMI 4OO1F 2C38A 2EL5A 4LTYA 3VHTB 1FI4A 1N33E 1F2IG 2EM4A 3M6AA 1X49A 2JEBA 2EQ0A 1Z0TA 2B7TA 2UUBE 4JI8E 3GONA 3EPJA 4MU4A 4JI4E 3WU3A 4DPXA 4JI7E 2EPXA 4RPFA 3P3GA 2EMGA 2E5LI 1YHCA 1UEKA 4JI3E 4WSGA 4TUIA 3DF6A 2GLIA 4IS1C 2O1WA 5IXMB 5A6JA 4JYAE 1Y60A 2A2CA 4DR3E 5C0XB 3FIGA 4N4RB 2NN6D 2R42A 2DSYA 2EL4A 3WU5A 5CFFE 1Y4SA 4LCGA 4DMIA 4NXME 4DXLA 2EP3A 1Y6ZA 2K4VA 2WNRA 4JI5I 2L2MA 2LTSA 1NCSA 4BMJA 3THOB 1DARA 4JV5E 1ZM2A 4LF4E 4XTJA 4DU8A 2BR2A 3TQMA 2VQFI 2K7IA 2DIXA 4DV5E 3PYEA 2O1TA 2Z5EA 3H1CA 2VESA 2EPUA 5JEAA 4F2JC 4LF9I 1QU6A 1MU5A 2NN6E 2X36A 3F6HA 1X6HA 2NUFA 2ENCA 2EMKA 2PO1A 4DUZI 4HXZA 2LV2A 4LCFA 3JTZA 1H7SA 2YTPA 4DU7A 1ZXNA 2J65A 3T1YE 2RTXA 2X7IA
chains in the Genus database with same CATH topology
1DQ3A 4F9AB 4IZJA 1IBKE 1HNXE 3HQ1A 2YT4A 1HR0I 1WXRA 3HPSA 4F54A 3ZZ0A 1YYKA 4BS9A 4EMDA 2E1MA 2UUBI 5BR8E 3Q6NA 1N32E 4JI8I 5GMEA 4BC7A 4DPUA 3B82A 4JI4I 5IWAE 4P7AA 1ZXMA 3J81Q 4JI2I 4JI7I 3LPSA 3K6QA 3V2UC 2EWLA 1N34E 4JI3I 2HK2A 3C4TA 2N3HA 1Z0CA 4LF6E 2IOQA 4PU9A 1NHHA 4WFTA 4JYAI 2DMYA 4DR3I 2B3TB 1STUA 2JVAA 3PYFA 3QT5A 4NXMI 1Z59A 4B3SE 1K47A 1RC7A 1D6TA 1Z5BA 3V5RA 3ZOQB 3F0NA 4JV5I 1NZ0A 2V85A 4LFCI 1XMQI 4LF4I 2IHR1 2G7HA 3J7AM 4DV5I 5FLXQ 4F9CB 1XNQE 4DR6I 4DR4E 2F8BA 3IWDA 3ZKDA 5FWKA 1EI1A 2UU9E 1Z0VA 2O1UA 2ZBKB 2ODRD 2V89A 2RSMA 3T1YI 2JWOA 1H73A 5T6JA 1O0WA 1KIJA 1IBKI 1Y4UA 1HNXI 3IWCA 1YYOA 4WSPA 2F4VE 3HULA 2WW4A 4LF9E 1USVA 4IZKB 2AJ4A 2GS8A 2ZM6I 2HKJA 2J7KA 5BR8I 1N32I 3DJWA 3LTOA 5IWAI 1EA6A 1N34I 1VISA 2UUCE 4LF6I 1T4NA 4YHHE 3T1HE 1XNRE 4DV4E 5AE2A 4N3OA 3JAMQ 2NUEA 4GKKE 5L3JA 1SR9A 2LJHA 3HTXA 4IZJD 4JI2E 2VQEE 4B3SI 2ZITA 4M30A 4AQYE 1IBLE 2YZTA 3PYGA 4KQVA 1NHIA 1HNWE 5A2QQ 5DNYA 4K0KE 5AE3A 4DR1E 4DR7E 1MX0A 4DV7E 2L2KB 3H4LA 4FW9A 4PRVA 3ZZUA 2BM0A 3WU4A 1XNQI 3J80Q 2LUQA 4DR4I 4WPYA 3Q6MA 2UU9I 1N0UA 2PNLA 2V86A 4FWDA 3ADGA 4J8ZA 3OMLA 1XMQE 4LFCE 4B3RE 4IZKA 3Q1QA 1X47A 4KZSA 2LBSB 1WHQA 4BCAA 2F4VI 2M7QA 3ZKBA 4JI6E 4DR6E 2V83A 1NHJA 2LE2A 2L3CA 2L2NA 2EZ6A 1DI2A 1XMOE 4JI0E 1KKHA 1KVKA 2L92A 4R03A 2VE7C 3MSWA 2UUCI 2CPNA 1H74A 2HKEA 4I3HA 2R3VA 4YY3I 4YHHI 3T1HI 1XNRI 4DV4I 5A2QC 5LMUE 2ZM6E 4GKKI 1WHNA 2JR1A 3P06A 1ZBQA 4DV6E 2B7VA 4FWHA 2VQEI 4AQYI 1IBLI 1A6FA 1HNWI 2N3GA 3VYXA 4X66I 4K0KI 4DR1I 4DR7I 4DR2E 4DV7I 4B3TE 3J7Yp 1MG7A 4X64E 1U2RA 4BC9A 1T4OA 1QZRA 4UTGA 5LL6R 4LFBE 2LUPB 2L33A 1FNMA 2OI2A 4DV2E 4DPTA 1T4LB 4LF5E 1B63A 1FKAE 3K1JA 4L5NC 4M1KA 3ZM7A 2LTRA 3H09A 4B3RI 2BV3A 4FN5A 1FWKA 4Z7CA 2UXBE 3HXLA 3PYDA 2WZOA 1ZM3A 2HK3A 4JI6I 2Z5CB 2V8PA 2V34A 5IT9Q 5ADZA 1EKZA 4NXNE 4P7DA 1HNZE 2UXCE 1XMOI 2FGGA 2L6MA 4JI0I 2H36X 4FWGA 4HYMA 3P1XA 3J81C 4DPWA 2LMZA 2VF1A 4HACB 3J7AG 4JG4A 1S4EA 2BM1A 4I8OA 5LMUI 1XHKA 1I94E 3RMPA 3QT8A 4DV6I 2MC6A 2LRSA 3HPZA 3KWRA 3JU0A 3F6GA 2UUAE 4B3ME 1PIEA 4DR2I 4B3TI 2V88A 4DV3E 4YY3E 4KHPE 4X64I 4GKJE 1RR9A 3CWVA 4LFBI 1FWLA 4X65E 2JOBA 4DV2I 5FLXC 3K17A 2FTXB 4LF5I 2HFSA 3B78A 2Z5BB 5IT9C 1ZBTA 4GEQB 4X66E 4DV1E 1J5EE 2RS6A 2JOXA 1HK7A 2UXBI 1Z0WA 1UILA 2KHXA 1Z5AA 2NPFA 2DEJA 5AASA 4LF8I 2M1SA 4M2ZA 2KONA 4IZJB 1Z0GA 4NXNI 1HNZI 4OX9I 2UXCI 1YYWA 1H72C 4HACA 1FJGE 3PRYA 4Z7YA 2DEIA 2V87A 1YZ9A 2LJPA 1X48A 4R8OA 1RQ0A 2PNMA 1N36E 1B62A 2DB2A 4JI1E 1N0VC 2V2QA 3ADJA 4ED4A 4HY1A 1PKPA 1I94I 3JAMC 4DV0I 5GMDA 4URLA 2UUAI 3D4JA 4M0VA 2M4IA 4B3MI 3OTOE 4DV3I 4KHPI 4R1FA 2UXDE 1PVGA 4GKJI 3ADIA 3LNUA 5AE1A 3QT7A 1ZM9A 4X65I 1Z0EA 4TUGA 2Z5BA 4P52A 2O1VA 3IWBA 4DR5E 3B8HA 2ODRC 3LLHA 3QT6A 3J80C 2HHHE 4L8NA 1J5EI 4DV1I 2Q2EB 1ZM4A 4DUYE 3VYYA 4MYTA 2RS7A 2KOUA 4LF7E 1Z5CA 5LMNE 2V2ZA 4ZVIA 4LFAE 1RREA 1N33I 4WUCA 1WUUA 2FV4B 4BBYA 1OJ4A 4F9BB 4WUDA 2A2DA 4USKA 1GQEA 1FJGI 3HJCA 2B9DA 4LU9A 2L8TA 1J26A 4X62E 3ZZTA 4OOGC 2CG9A 2NUGA 3WU6A 1IBME 2L3JA 4LF8E 1USUA 1N36I 4JI1I 4DPYA 1KTVA 3K85A 2NA2A 4USMA 4OX9E 4UT4A 1S16A 1H7UA 2E5LE 1BKNA 3OTOI 2UXDI 3ADLA 2V2VA 2XEXA 4PRXA 5F3WA 3AV0A 4DV0E 2E1RA 4JI5E 4WUBA 4DR5I 2CZ9A 2HHHI 2VF3A 1ELOA 4DUYI 2VQFE 2IOPA 4MYUA 2CGEA 1Z0BA 2EFGA 4DKKA 4LF7I 5LMNI 4LFAI 3VK6A 4Q28A 4DUZE 2MDRA 4P78A 2MC5A 3AUZA 3LMLA 2GQ0A 1UHZA 4WYQB 3C4BA 2Z5CA 1GZ6A 2V8QB 2JY9A 4X62I 1HR0E 2HFUA 4X8WA 1IBMI 4LTYA 1FI4A 1N33E 3M6AA 1X49A 1Z0TA 2B7TA 2UUBE 4JI8E 3GONA 3WU3A 4JI4E 4DPXA 4JI7E 4RPFA 2E5LI 1UEKA 4JI3E 4TUIA 3DF6A 2O1WA 4JYAE 2A2CA 4DR3E 3FIGA 2R42A 2DSYA 3WU5A 5CFFE 1Y4SA 4DMIA 4NXME 4DXLA 1Y6ZA 2K4VA 4JI5I 2L2MA 2LTSA 4BMJA 1DARA 4JV5E 1ZM2A 4LF4E 4XTJA 4DU8A 2VQFI 2DIXA 4DV5E 3PYEA 2O1TA 2Z5EA 4LF9I 1QU6A 1MU5A 2X36A 3F6HA 2NUFA 4DUZI 4HXZA 3JTZA 1H7SA 4DU7A 1ZXNA 3T1YE 2RTXA 2X7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK E;  1HNX E;  2YT4 A;  1HR0 I;  3ZZ0 A;  1YYK A;  4EMD A;  2UUB I;  5BR8 E;  1N32 E;  4JI8 I;  5GME A;  4DPU A;  3B82 A;  4JI4 I;  5IWA E;  4P7A A;  1ZXM A;  3J81 Q;  4JI2 I;  4JI7 I;  3LPS A;  3V2U C;  1N34 E;  4JI3 I;  2HK2 A;  3C4T A;  2N3H A;  1Z0C A;  4LF6 E;  4PU9 A;  1NHH A;  4WFT A;  4JYA I;  2DMY A;  4DR3 I;  2B3T B;  1STU A;  2JVA A;  3PYF A;  3QT5 A;  4NXM I;  1Z59 A;  4B3S E;  1K47 A;  1RC7 A;  1D6T A;  1Z5B A;  3V5R A;  3F0N A;  4JV5 I;  1NZ0 A;  4LFC I;  1XMQ I;  4LF4 I;  2IHR 1;  3J7A M;  4DV5 I;  5FLX Q;  1XNQ E;  4DR6 I;  4DR4 E;  3ZKD A;  1EI1 A;  2UU9 E;  1Z0V A;  2ZBK B;  2RSM A;  3T1Y I;  1H73 A;  1O0W A;  1KIJ A;  1IBK I;  1HNX I;  3HUL A;  1YYO A;  2F4V E;  2WW4 A;  4LF9 E;  2AJ4 A;  2GS8 A;  2ZM6 I;  2HKJ A;  2J7K A;  5BR8 I;  1N32 I;  3LTO A;  5IWA I;  1EA6 A;  1N34 I;  1VIS A;  2UUC E;  4LF6 I;  1T4N A;  4YHH E;  3T1H E;  1XNR E;  4DV4 E;  3JAM Q;  2NUE A;  4GKK E;  5L3J A;  2LJH A;  3HTX A;  4JI2 E;  2VQE E;  4B3S I;  2ZIT A;  4M30 A;  4AQY E;  1IBL E;  3PYG A;  4KQV A;  1NHI A;  1HNW E;  5A2Q Q;  4K0K E;  4DR1 E;  4DR7 E;  1MX0 A;  4DV7 E;  2L2K B;  3H4L A;  4FW9 A;  4PRV A;  3ZZU A;  2BM0 A;  3WU4 A;  1XNQ I;  3J80 Q;  2LUQ A;  4DR4 I;  2UU9 I;  1N0U A;  4FWD A;  3ADG A;  1XMQ E;  4LFC E;  4B3R E;  3Q1Q A;  1X47 A;  2LBS B;  1WHQ A;  2F4V I;  3ZKB A;  4JI6 E;  4DR6 E;  1NHJ A;  2L3C A;  2L2N A;  2EZ6 A;  1DI2 A;  1XMO E;  4JI0 E;  1KKH A;  1KVK A;  2UUC I;  2CPN A;  1H74 A;  2HKE A;  4I3H A;  2R3V A;  4YY3 I;  4YHH I;  3T1H I;  1XNR I;  4DV4 I;  5A2Q C;  5LMU E;  2ZM6 E;  4GKK I;  1WHN A;  4DV6 E;  2B7V A;  4FWH A;  2VQE I;  4AQY I;  1IBL I;  1A6F A;  1HNW I;  2N3G A;  3VYX A;  4X66 I;  4K0K I;  4DR1 I;  4DR7 I;  4DR2 E;  4DV7 I;  4B3T E;  3J7Y p;  1MG7 A;  4X64 E;  1U2R A;  1QZR A;  1T4O A;  4UTG A;  5LL6 R;  4LFB E;  2LUP B;  2L33 A;  1FNM A;  2OI2 A;  4DV2 E;  4DPT A;  1T4L B;  4LF5 E;  1B63 A;  1FKA E;  3K1J A;  4M1K A;  3ZM7 A;  2LTR A;  4B3R I;  2BV3 A;  4FN5 A;  1FWK A;  4Z7C A;  2UXB E;  3PYD A;  1ZM3 A;  2HK3 A;  4JI6 I;  2V8P A;  2V34 A;  5IT9 Q;  1EKZ A;  4NXN E;  1HNZ E;  2UXC E;  1XMO I;  4JI0 I;  4FWG A;  4HYM A;  3P1X A;  3J81 C;  4DPW A;  4HAC B;  3J7A G;  4JG4 A;  1S4E A;  2BM1 A;  5LMU I;  1XHK A;  1I94 E;  3QT8 A;  4DV6 I;  2LRS A;  2UUA E;  4B3M E;  1PIE A;  4DR2 I;  4B3T I;  4DV3 E;  4YY3 E;  4KHP E;  4X64 I;  4GKJ E;  1RR9 A;  3CWV A;  4LFB I;  1FWL A;  4X65 E;  4DV2 I;  5FLX C;  3K17 A;  4LF5 I;  2HFS A;  3B78 A;  5IT9 C;  1ZBT A;  1J5E E;  4X66 E;  4DV1 E;  2RS6 A;  2UXB I;  1Z0W A;  1UIL A;  2KHX A;  1Z5A A;  2NPF A;  2DEJ A;  4LF8 I;  4M2Z A;  1Z0G A;  4NXN I;  1HNZ I;  4OX9 I;  2UXC I;  1YYW A;  1H72 C;  4HAC A;  1FJG E;  4Z7Y A;  2DEI A;  1YZ9 A;  2LJP A;  1X48 A;  1RQ0 A;  1N36 E;  1B62 A;  2DB2 A;  4JI1 E;  1N0V C;  2V2Q A;  3ADJ A;  4ED4 A;  4HY1 A;  1PKP A;  1I94 I;  3JAM C;  4DV0 I;  5GMD A;  4URL A;  2UUA I;  3D4J A;  4B3M I;  3OTO E;  4DV3 I;  4KHP I;  4R1F A;  2UXD E;  1PVG A;  4GKJ I;  3ADI A;  3LNU A;  3QT7 A;  1ZM9 A;  4X65 I;  1Z0E A;  4P52 A;  4DR5 E;  3B8H A;  3LLH A;  3QT6 A;  2HHH E;  3J80 C;  1J5E I;  4DV1 I;  2Q2E B;  1ZM4 A;  4DUY E;  3VYY A;  4MYT A;  2RS7 A;  4LF7 E;  1Z5C A;  5LMN E;  2V2Z A;  4ZVI A;  4LFA E;  1RRE A;  1N33 I;  4WUC A;  1WUU A;  1OJ4 A;  4WUD A;  2A2D A;  4USK A;  1GQE A;  1FJG I;  1J26 A;  4X62 E;  3ZZT A;  4OOG C;  2NUG A;  3WU6 A;  1IBM E;  2L3J A;  4LF8 E;  1N36 I;  4JI1 I;  4DPY A;  1KTV A;  2NA2 A;  4USM A;  4OX9 E;  4UT4 A;  1S16 A;  1H7U A;  2E5L E;  1BKN A;  3OTO I;  2UXD I;  3ADL A;  2V2V A;  2XEX A;  4PRX A;  4DV0 E;  2E1R A;  4JI5 E;  4WUB A;  4DR5 I;  2CZ9 A;  2HHH I;  2VF3 A;  1ELO A;  4DUY I;  2VQF E;  4MYU A;  1Z0B A;  2EFG A;  4DKK A;  4LF7 I;  5LMN I;  4LFA I;  4DUZ E;  2MDR A;  1UHZ A;  4WYQ B;  3C4B A;  2JY9 A;  4X62 I;  1HR0 E;  2HFU A;  4X8W A;  1IBM I;  1FI4 A;  1N33 E;  3M6A A;  1X49 A;  1Z0T A;  2B7T A;  2UUB E;  4JI8 E;  3GON A;  3WU3 A;  4JI4 E;  4DPX A;  4JI7 E;  4RPF A;  2E5L I;  1UEK A;  4JI3 E;  4JYA E;  2A2C A;  4DR3 E;  2R42 A;  3WU5 A;  5CFF E;  4NXM E;  4DXL A;  4JI5 I;  2L2M A;  2LTS A;  1DAR A;  4JV5 E;  1ZM2 A;  4LF4 E;  4XTJ A;  4DU8 A;  2VQF I;  2DIX A;  4DV5 E;  3PYE A;  4LF9 I;  1QU6 A;  1MU5 A;  2X36 A;  2NUF A;  4DUZ I;  4HXZ A;  1H7S A;  4DU7 A;  1ZXN A;  3T1Y E;  2RTX A;  2X7I A; 
#chains in the Genus database with same CATH topology
 1DQ3 A;  4OKG A;  1UDO A;  2YTJ A;  4F9A B;  1A1K A;  4IZJ A;  2YPN A;  1IBK E;  2GHF A;  2EM9 A;  1HNX E;  4IJD A;  4KQV A;  2JEA A;  3HQ1 A;  2YT4 A;  1HR0 I;  1WXR A;  3HPS A;  4F54 A;  1WRJ A;  2EE8 A;  2YRH A;  4FW4 A;  3ZZ0 A;  1YYK A;  2BA1 G;  3BF2 A;  4BS9 A;  2EPC A;  2I9I A;  4EMD A;  2E1M A;  2UUB I;  5BR8 E;  3Q6N A;  1N32 E;  4JI8 I;  2MKN A;  4ZYG A;  5GME A;  4BC7 A;  4DPU A;  2YU8 A;  3B82 A;  2MKD A;  4JI4 I;  5IWA E;  4P7A A;  1ZXM A;  3J81 Q;  4JI2 I;  4JI7 I;  5JEA C;  3LPS A;  4OO1 B;  1PJS A;  3K6Q A;  4MLQ A;  3V2U C;  2EWL A;  1N34 E;  5K36 E;  5ELW A;  4JI3 I;  2EMX A;  5C0X A;  2HK2 A;  3C4T A;  2EMH A;  2N3H A;  1Z0C A;  4LF6 E;  2IOQ A;  4PU9 A;  1NHH A;  4WFT A;  2PO0 A;  1UDN A;  4JYA I;  2DMY A;  4DR3 I;  1SFE A;  2B3T B;  3C6K A;  1STU A;  2JVA A;  3L00 A;  1OYS A;  3PYF A;  3QT5 A;  2BA0 D;  3P3E A;  4NXM I;  1Z59 A;  2JE6 B;  4FW6 A;  3CDJ A;  1A1J A;  5EKW A;  4IFD D;  2EMA A;  4B3S E;  3L7Z B;  1K47 A;  1RC7 A;  1D6T A;  1Z5B A;  3V5R A;  3ZOQ B;  2PO2 A;  3F0N A;  2YWQ A;  4JV5 I;  1NZ0 A;  1OYR A;  2V85 A;  4LFC I;  2EOR A;  1XMQ I;  4LF4 I;  1ZR9 A;  2IHR 1;  4BA1 A;  2G7H A;  2N8X A;  3J7A M;  4DV5 I;  3GLL A;  2DLK A;  2YRK A;  2EM7 A;  1MEY C;  4AID A;  5IV8 B;  5FLX Q;  2DMI A;  4F9C B;  1XNQ E;  2EM6 A;  2EOQ A;  4DR6 I;  4DR4 E;  2F8B A;  3IWD A;  3ZKD A;  5FWK A;  1EI1 A;  2UU9 E;  1Z0V A;  2O1U A;  5C0X C;  2EPA A;  2ZBK B;  4R2D A;  2ODR D;  4IFD E;  2V89 A;  2RSM A;  4BHB A;  3T1Y I;  2JWO A;  2EMY A;  2YTQ A;  1H73 A;  4DV6 I;  2EOM A;  5T6J A;  2Q8U A;  1O0W A;  1GTK A;  1KIJ A;  3U1K A;  1IBK I;  1Y4U A;  4WXD A;  1HNX I;  4R2P A;  1A1L A;  3IWC A;  1YYO A;  4WSP A;  2F4V E;  3HUL A;  5DNL A;  2WW4 A;  4LF9 E;  1USV A;  4IZK B;  2AJ4 A;  2GS8 A;  4J3D A;  2ZM6 I;  2HKJ A;  2J7K A;  5BR8 I;  1PJQ A;  1N32 I;  2EM5 A;  3DJW A;  3LTO A;  5IWA I;  1EA6 A;  2EM2 A;  1RHY A;  2CTD A;  4R2Q A;  1N34 I;  1VIS A;  2JP9 A;  4FW7 A;  2C37 B;  4NZV A;  2UUC E;  4R2R A;  4LF6 I;  1T4N A;  4YHH E;  3T1H E;  1XNR E;  2WBT A;  1AH5 A;  2YTO A;  5AE2 A;  4DV4 E;  4N3O A;  3JAM Q;  2E72 A;  4R2S A;  2NUE A;  4GKK E;  5L3J A;  1SR9 A;  3EPL A;  2LJH A;  3HTX A;  2CVE A;  2WBU A;  4IZJ D;  4JI2 E;  2VQE E;  5TSE A;  2ZIT A;  2LO3 A;  4M30 A;  4AQY E;  2YZT A;  1IBL E;  1B69 A;  1OYP A;  3PYG A;  2BB8 A;  4O4K A;  1NHI A;  5JEA E;  1HNW E;  1X6F A;  2BBG A;  5KL6 A;  5A2Q Q;  1X6E A;  5DNY A;  2EL6 A;  5AE3 A;  4DR1 E;  4K0K E;  4DR7 E;  1MX0 A;  4DV7 E;  4OO1 C;  2EPK X;  2L2K B;  3H4L A;  4FW9 A;  2R1F A;  4PRV A;  1ZAA C;  1Y5Y A;  1UDS A;  3ZZU A;  1G2F C;  1R6M A;  2BM0 A;  3WU4 A;  1VI7 A;  1XNQ I;  3J80 Q;  2LUQ A;  4DR4 I;  2EOO A;  2EMZ A;  4WPY A;  3Q6M A;  1UBD C;  2UU9 I;  1YPN A;  1N0U A;  2PNL A;  2V86 A;  2EQ3 A;  5LLQ A;  4FWD A;  2LVH A;  4BA2 B;  2WBS A;  2EOZ A;  3ADG A;  4J8Z A;  3OML A;  2JPA A;  1XMQ E;  4LFC E;  1P47 A;  4B3R E;  2F1D A;  4IZK A;  3Q1Q A;  1A1H A;  1X47 A;  5DRO A;  4KZS A;  2LBS B;  1WHQ A;  4BCA A;  5AC4 A;  2F4V I;  3MHH C;  2EPL X;  3M85 D;  2NN6 B;  3EPH A;  2M7Q A;  3KRN A;  3ZKB A;  4JI6 E;  4DR6 E;  2V83 A;  1NHJ A;  2LE2 A;  2L3C A;  2L2N A;  4LPF A;  1E3H A;  5C0X E;  2C37 A;  2EZ6 A;  1EH8 A;  1DI2 A;  1XMO E;  4JI0 E;  1KKH A;  2GPI A;  2BA0 G;  1KVK A;  1WJP A;  2L92 A;  2C39 B;  5K36 D;  4R03 A;  2VE7 C;  2GO4 A;  3MSW A;  4ZYE A;  2UUC I;  3GME A;  2CPN A;  1H74 A;  2HKE A;  4ZYD A;  4U3D A;  2R3V A;  4I3H A;  4YY3 I;  4YHH I;  3T1H I;  1PJT A;  1XNR I;  4DV4 I;  2EMW A;  5A2Q C;  5LMU E;  2ADR A;  3PS3 A;  2ZM6 E;  4GKK I;  1WHN A;  2JR1 A;  1IQO A;  3P06 A;  2EOF A;  1ZBQ A;  2M9A A;  2EMF A;  4R2C A;  4DV6 E;  2B7V A;  4FWH A;  2EPN A;  2VQE I;  4AQY I;  1IBL I;  3EPK A;  2IES A;  2EJ4 A;  1A6F A;  1HNW I;  2N3G A;  3BGH A;  3VYX A;  4X66 I;  4K0K I;  4DR1 I;  4DR7 I;  4DR2 E;  4DV7 I;  4F6M A;  4B3T E;  3J7Y p;  4FK5 C;  4X64 E;  1MG7 A;  2PNZ B;  1QNT A;  1U2R A;  2WP8 B;  3U1Y A;  4WX9 A;  2RSI A;  1T4O A;  4BC9 A;  5KL7 A;  5LL6 R;  4LFB E;  4RH8 A;  2LUP B;  1QZR A;  4FW5 A;  5DRR A;  2O3Z A;  2EN6 A;  1L4S A;  2EN1 A;  2L33 A;  1FNM A;  2OI2 A;  4DV2 E;  1KJK A;  4DPT A;  1T4L B;  4LF5 E;  2EOI A;  1B63 A;  3QG5 C;  2EM8 A;  1FKA E;  3K1J A;  2YTG A;  2DLQ A;  2RPC A;  5DRQ A;  4L5N C;  4M1K A;  3ZM7 A;  2LTR A;  3H09 A;  4B3R I;  2BV3 A;  4FN5 A;  1FWK A;  1YFH A;  4Z7C A;  4AIM A;  2UXB E;  3HXL A;  2EM3 A;  1AAY A;  2ELZ A;  3PYD A;  2WZO A;  4GQU A;  1ZM3 A;  3PS1 A;  2R76 A;  2HK3 A;  4JI6 I;  2Z5C B;  2V8P A;  2LT7 A;  2V34 A;  5IT9 Q;  5ADZ A;  4IFD B;  1EKZ A;  4NXN E;  4P7D A;  1HNZ E;  4NHR A;  2UXC E;  1P42 A;  2NN6 F;  1XMO I;  2FGG A;  2L6M A;  4JI0 I;  2H36 X;  4BHC A;  2JEB B;  4FWG A;  4HYM A;  2J7J A;  3P1X A;  1KYQ A;  3J81 C;  4FW3 A;  2YSP A;  2LMZ A;  2VF1 A;  3GCM A;  4HAC B;  2EOJ A;  4DPW A;  3J7A G;  2EM0 A;  4JG4 A;  1S4E A;  4ZYH A;  2BM1 A;  4I8O A;  5LMU I;  2EOY A;  4OO1 A;  2NN6 C;  4LCH A;  2EMI A;  1XHK A;  1I94 E;  1N3G A;  2EN2 A;  3RMP A;  3QT8 A;  1T38 A;  4ISA A;  2MC6 A;  2LRS A;  3HPZ A;  3KWR A;  2CSH A;  3JU0 A;  5JEA D;  1RMD A;  1UN6 B;  3F6G A;  4WXC A;  2UUA E;  4U3B A;  4B3M E;  1PIE A;  4DR2 I;  1EH6 A;  2VRD A;  2V88 A;  2WNR B;  4B3T I;  4DV3 E;  1ZU1 A;  4YY3 E;  4KHP E;  2ELY A;  4GKJ E;  1RR9 A;  2JE6 A;  2YU5 A;  4X64 I;  5K36 F;  3CDI A;  3L7Z A;  5KL5 A;  3CWV A;  2EMC A;  4LFB I;  1FWL A;  3UHM A;  4X65 E;  5DNX A;  3DD6 A;  3M85 G;  2JOB A;  1A1G A;  4X9J A;  3UK3 C;  2EOE A;  5FLX C;  3K17 A;  4DV2 I;  1YUI A;  2EN8 A;  2YTE A;  2FTX B;  4B3S I;  4LF5 I;  2D9H A;  2HFS A;  5A6A A;  3B78 A;  2Z5B B;  5IT9 C;  3BID A;  1ZBT A;  2EN3 A;  4GEQ B;  4X66 E;  4DV1 E;  1J5E E;  3B4T A;  2PO1 B;  3M7N D;  2RS6 A;  2JOX A;  1HK7 A;  2UXB I;  1Z0W A;  1UIL A;  2EQ1 A;  2KHX A;  2MDG A;  1Z5A A;  2NPF A;  1YH8 A;  1BBG A;  4GZN C;  2DEJ A;  4ED4 A;  5AAS A;  4LF8 I;  2EN4 A;  2M1S A;  4M2Z A;  1X3C A;  2KON A;  4IZJ B;  5A6B A;  4MU0 A;  1Z0G A;  2AE8 A;  5C0X D;  4NXN I;  1HNZ I;  2JEA B;  4OX9 I;  2UXC I;  1LLM C;  1G2D C;  1YYW A;  1H72 C;  1YSA C;  3HKM A;  2YTI A;  4HAC A;  1FJG E;  2ENH A;  3PRY A;  2DGC A;  2JXP A;  4Z7Y A;  2DEI A;  2V87 A;  4F6N A;  1YZ9 A;  3P3C A;  4IFD F;  4Q35 B;  2LJP A;  1X48 A;  4O43 A;  4R8O A;  1RQ0 A;  2PNM A;  1EH7 A;  1MGT A;  1N36 E;  1B62 A;  2DB2 A;  1TF3 A;  4JI1 E;  1N0V C;  3ADJ A;  2V2Q A;  3NZK A;  4HY1 A;  1PKP A;  4M9V C;  1I94 I;  3JAM C;  2PO0 B;  4DV0 I;  5GMD A;  1BBO A;  4IFD C;  1PDA A;  2YRM A;  1IMU A;  4QNJ A;  3ECR A;  4URL A;  2UUA I;  3THN A;  3BBG A;  3D4J A;  4M0V A;  2M4I A;  4B3M I;  2RQL A;  4RHB B;  4LOM A;  5KL2 A;  3OTO E;  4DV3 I;  1R6L A;  4KHP I;  4R1F A;  2UXD E;  1PVG A;  2EOH A;  4GKJ I;  2LJU A;  3ADI A;  2PO2 B;  5AE1 A;  3LNU A;  3QT7 A;  2NAB A;  1ZM9 A;  3EQ1 A;  4X65 I;  1Z0E A;  4TUG A;  1NEI A;  2Z5B A;  4MU1 A;  4P52 A;  4BA1 B;  2O1V A;  3IWB A;  4UTG A;  4DR5 E;  3B8H A;  2ODR C;  3LLH A;  4MDT A;  5K36 B;  3QT6 A;  3J80 C;  2HHH E;  4L8N A;  1J5E I;  4DV1 I;  3KZY A;  1UDQ A;  2Q2E B;  2EPM X;  1ZM4 A;  4OO1 D;  2EPR A;  4DUY E;  1IQS A;  3VYY A;  4MYT A;  2DRP A;  5JEA F;  2RS7 A;  1T39 A;  1XXE A;  2KOU A;  2JT2 A;  5DRP A;  1DGC A;  3KZZ A;  4NBQ A;  4LF7 E;  1Z5C A;  5LMN E;  2V2Z A;  4BA2 A;  4ZVI A;  4LFA E;  1RRE A;  1N33 I;  4WUC A;  1WUU A;  2FV4 B;  4BBY A;  4R2A A;  1OJ4 A;  2YTN A;  5A6K A;  4F9B B;  4WUD A;  2A2D A;  4OZE A;  4IS9 A;  4USK A;  1GQE A;  1FJG I;  2NN6 A;  3HJC A;  4OO1 E;  2B9D A;  2CT1 A;  4LU9 A;  5A69 A;  4O24 A;  2L8T A;  1E3P A;  2EPO A;  1J26 A;  2YTD A;  4X62 E;  3ZZT A;  4OOG C;  2CG9 A;  2NUG A;  3WU6 A;  1IBM E;  2L3J A;  4LF8 E;  1USU A;  5KL4 A;  4JI1 I;  1N36 I;  4DPY A;  3PS2 A;  1KTV A;  4AM3 A;  2C39 A;  3K85 A;  2NA2 A;  1TN9 A;  4USM A;  4OX9 E;  2EML A;  2C38 B;  4UT4 A;  3MHS C;  5KL3 A;  1S16 A;  2HC5 A;  5C0X F;  1H7U A;  2E5L E;  4QNK A;  1BKN A;  5A6B D;  3OTO I;  3C6M A;  2BA1 D;  2UXD I;  1TF6 A;  3ADL A;  2HJJ A;  1A1F A;  2V2V A;  2XEX A;  4PRX A;  1A1I A;  5EL9 A;  3M7N G;  5K36 A;  5F3W A;  4O5G A;  2YTF A;  1JK1 A;  3AV0 A;  1BB8 A;  4R2E A;  4DV0 E;  2E1R A;  4JI5 E;  4WUB A;  5AC5 A;  2CZ9 A;  4DR5 I;  2LCE A;  4HEI A;  2PNZ A;  2HHH I;  2JYA A;  2WP8 A;  3M99 B;  2VF3 A;  4MU3 A;  1JK2 A;  1ELO A;  4DUY I;  2VQF E;  2GO3 A;  2IOP A;  2PRT A;  4KWY A;  4HTG A;  4MYU A;  1Z1B A;  2CGE A;  2EN7 A;  1Z0B A;  2EFG A;  4DKK A;  4LF7 I;  1YUJ A;  5LMN I;  4MLV A;  2BR2 B;  2EPP A;  4LFA I;  2EMB A;  3VK6 A;  4MQY A;  4Q28 A;  2ENA A;  5JEA B;  4DUZ E;  1X5W A;  2MDR A;  2A25 A;  4P78 A;  2I13 A;  2YSO A;  2MC5 A;  3AUZ A;  5K36 C;  3LML A;  2GQ0 A;  1UHZ A;  2EPZ A;  4WYQ B;  3C4B A;  2Z5C A;  2HGH A;  1GZ6 A;  2IER A;  2EOS A;  2V8Q B;  4IFD A;  2JY9 A;  3P76 A;  2WCC 3;  4X62 I;  1HR0 E;  2HFU A;  2EOX A;  4X8W A;  1IBM I;  4OO1 F;  2C38 A;  2EL5 A;  4LTY A;  3VHT B;  1FI4 A;  1N33 E;  1F2I G;  2EM4 A;  3M6A A;  1X49 A;  2JEB A;  2EQ0 A;  1Z0T A;  2B7T A;  2UUB E;  4JI8 E;  3GON A;  3EPJ A;  4MU4 A;  4JI4 E;  3WU3 A;  4DPX A;  4JI7 E;  2EPX A;  4RPF A;  3P3G A;  2EMG A;  2E5L I;  1YHC A;  1UEK A;  4JI3 E;  4WSG A;  4TUI A;  3DF6 A;  2GLI A;  4IS1 C;  2O1W A;  5IXM B;  5A6J A;  4JYA E;  1Y60 A;  2A2C A;  4DR3 E;  5C0X B;  3FIG A;  4N4R B;  2NN6 D;  2R42 A;  2DSY A;  2EL4 A;  3WU5 A;  5CFF E;  1Y4S A;  4LCG A;  4DMI A;  4NXM E;  4DXL A;  2EP3 A;  1Y6Z A;  2K4V A;  2WNR A;  4JI5 I;  2L2M A;  2LTS A;  1NCS A;  4BMJ A;  3THO B;  1DAR A;  4JV5 E;  1ZM2 A;  4LF4 E;  4XTJ A;  4DU8 A;  2BR2 A;  3TQM A;  2VQF I;  2K7I A;  2DIX A;  4DV5 E;  3PYE A;  2O1T A;  2Z5E A;  3H1C A;  2VES A;  2EPU A;  5JEA A;  4F2J C;  4LF9 I;  1QU6 A;  1MU5 A;  2NN6 E;  2X36 A;  3F6H A;  1X6H A;  2NUF A;  2ENC A;  2EMK A;  2PO1 A;  4DUZ I;  4HXZ A;  2LV2 A;  4LCF A;  3JTZ A;  1H7S A;  2YTP A;  4DU7 A;  1ZXN A;  2J65 A;  3T1Y E;  2RTX A;  2X7I A; 
#chains in the Genus database with same CATH homology
 1DQ3 A;  4F9A B;  4IZJ A;  1IBK E;  1HNX E;  3HQ1 A;  2YT4 A;  1HR0 I;  1WXR A;  3HPS A;  4F54 A;  3ZZ0 A;  1YYK A;  4BS9 A;  4EMD A;  2E1M A;  2UUB I;  5BR8 E;  3Q6N A;  1N32 E;  4JI8 I;  5GME A;  4BC7 A;  4DPU A;  3B82 A;  4JI4 I;  5IWA E;  4P7A A;  1ZXM A;  3J81 Q;  4JI2 I;  4JI7 I;  3LPS A;  3K6Q A;  3V2U C;  2EWL A;  1N34 E;  4JI3 I;  2HK2 A;  3C4T A;  2N3H A;  1Z0C A;  4LF6 E;  2IOQ A;  4PU9 A;  1NHH A;  4WFT A;  4JYA I;  2DMY A;  4DR3 I;  2B3T B;  1STU A;  2JVA A;  3PYF A;  3QT5 A;  4NXM I;  1Z59 A;  4B3S E;  1K47 A;  1RC7 A;  1D6T A;  1Z5B A;  3V5R A;  3ZOQ B;  3F0N A;  4JV5 I;  1NZ0 A;  2V85 A;  4LFC I;  1XMQ I;  4LF4 I;  2IHR 1;  2G7H A;  3J7A M;  4DV5 I;  5FLX Q;  4F9C B;  1XNQ E;  4DR6 I;  4DR4 E;  2F8B A;  3IWD A;  3ZKD A;  5FWK A;  1EI1 A;  2UU9 E;  1Z0V A;  2O1U A;  2ZBK B;  2ODR D;  2V89 A;  2RSM A;  3T1Y I;  2JWO A;  1H73 A;  5T6J A;  1O0W A;  1KIJ A;  1IBK I;  1Y4U A;  1HNX I;  3IWC A;  1YYO A;  4WSP A;  2F4V E;  3HUL A;  2WW4 A;  4LF9 E;  1USV A;  4IZK B;  2AJ4 A;  2GS8 A;  2ZM6 I;  2HKJ A;  2J7K A;  5BR8 I;  1N32 I;  3DJW A;  3LTO A;  5IWA I;  1EA6 A;  1N34 I;  1VIS A;  2UUC E;  4LF6 I;  1T4N A;  4YHH E;  3T1H E;  1XNR E;  4DV4 E;  5AE2 A;  4N3O A;  3JAM Q;  2NUE A;  4GKK E;  5L3J A;  1SR9 A;  2LJH A;  3HTX A;  4IZJ D;  4JI2 E;  2VQE E;  4B3S I;  2ZIT A;  4M30 A;  4AQY E;  1IBL E;  2YZT A;  3PYG A;  4KQV A;  1NHI A;  1HNW E;  5A2Q Q;  5DNY A;  4K0K E;  5AE3 A;  4DR1 E;  4DR7 E;  1MX0 A;  4DV7 E;  2L2K B;  3H4L A;  4FW9 A;  4PRV A;  3ZZU A;  2BM0 A;  3WU4 A;  1XNQ I;  3J80 Q;  2LUQ A;  4DR4 I;  4WPY A;  3Q6M A;  2UU9 I;  1N0U A;  2PNL A;  2V86 A;  4FWD A;  3ADG A;  4J8Z A;  3OML A;  1XMQ E;  4LFC E;  4B3R E;  4IZK A;  3Q1Q A;  1X47 A;  4KZS A;  2LBS B;  1WHQ A;  4BCA A;  2F4V I;  2M7Q A;  3ZKB A;  4JI6 E;  4DR6 E;  2V83 A;  1NHJ A;  2LE2 A;  2L3C A;  2L2N A;  2EZ6 A;  1DI2 A;  1XMO E;  4JI0 E;  1KKH A;  1KVK A;  2L92 A;  4R03 A;  2VE7 C;  3MSW A;  2UUC I;  2CPN A;  1H74 A;  2HKE A;  4I3H A;  2R3V A;  4YY3 I;  4YHH I;  3T1H I;  1XNR I;  4DV4 I;  5A2Q C;  5LMU E;  2ZM6 E;  4GKK I;  1WHN A;  2JR1 A;  3P06 A;  1ZBQ A;  4DV6 E;  2B7V A;  4FWH A;  2VQE I;  4AQY I;  1IBL I;  1A6F A;  1HNW I;  2N3G A;  3VYX A;  4X66 I;  4K0K I;  4DR1 I;  4DR7 I;  4DR2 E;  4DV7 I;  4B3T E;  3J7Y p;  1MG7 A;  4X64 E;  1U2R A;  4BC9 A;  1T4O A;  1QZR A;  4UTG A;  5LL6 R;  4LFB E;  2LUP B;  2L33 A;  1FNM A;  2OI2 A;  4DV2 E;  4DPT A;  1T4L B;  4LF5 E;  1B63 A;  1FKA E;  3K1J A;  4L5N C;  4M1K A;  3ZM7 A;  2LTR A;  3H09 A;  4B3R I;  2BV3 A;  4FN5 A;  1FWK A;  4Z7C A;  2UXB E;  3HXL A;  3PYD A;  2WZO A;  1ZM3 A;  2HK3 A;  4JI6 I;  2Z5C B;  2V8P A;  2V34 A;  5IT9 Q;  5ADZ A;  1EKZ A;  4NXN E;  4P7D A;  1HNZ E;  2UXC E;  1XMO I;  2FGG A;  2L6M A;  4JI0 I;  2H36 X;  4FWG A;  4HYM A;  3P1X A;  3J81 C;  4DPW A;  2LMZ A;  2VF1 A;  4HAC B;  3J7A G;  4JG4 A;  1S4E A;  2BM1 A;  4I8O A;  5LMU I;  1XHK A;  1I94 E;  3RMP A;  3QT8 A;  4DV6 I;  2MC6 A;  2LRS A;  3HPZ A;  3KWR A;  3JU0 A;  3F6G A;  2UUA E;  4B3M E;  1PIE A;  4DR2 I;  4B3T I;  2V88 A;  4DV3 E;  4YY3 E;  4KHP E;  4X64 I;  4GKJ E;  1RR9 A;  3CWV A;  4LFB I;  1FWL A;  4X65 E;  2JOB A;  4DV2 I;  5FLX C;  3K17 A;  2FTX B;  4LF5 I;  2HFS A;  3B78 A;  2Z5B B;  5IT9 C;  1ZBT A;  4GEQ B;  4X66 E;  4DV1 E;  1J5E E;  2RS6 A;  2JOX A;  1HK7 A;  2UXB I;  1Z0W A;  1UIL A;  2KHX A;  1Z5A A;  2NPF A;  2DEJ A;  5AAS A;  4LF8 I;  2M1S A;  4M2Z A;  2KON A;  4IZJ B;  1Z0G A;  4NXN I;  1HNZ I;  4OX9 I;  2UXC I;  1YYW A;  1H72 C;  4HAC A;  1FJG E;  3PRY A;  4Z7Y A;  2DEI A;  2V87 A;  1YZ9 A;  2LJP A;  1X48 A;  4R8O A;  1RQ0 A;  2PNM A;  1N36 E;  1B62 A;  2DB2 A;  4JI1 E;  1N0V C;  2V2Q A;  3ADJ A;  4ED4 A;  4HY1 A;  1PKP A;  1I94 I;  3JAM C;  4DV0 I;  5GMD A;  4URL A;  2UUA I;  3D4J A;  4M0V A;  2M4I A;  4B3M I;  3OTO E;  4DV3 I;  4KHP I;  4R1F A;  2UXD E;  1PVG A;  4GKJ I;  3ADI A;  3LNU A;  5AE1 A;  3QT7 A;  1ZM9 A;  4X65 I;  1Z0E A;  4TUG A;  2Z5B A;  4P52 A;  2O1V A;  3IWB A;  4DR5 E;  3B8H A;  2ODR C;  3LLH A;  3QT6 A;  3J80 C;  2HHH E;  4L8N A;  1J5E I;  4DV1 I;  2Q2E B;  1ZM4 A;  4DUY E;  3VYY A;  4MYT A;  2RS7 A;  2KOU A;  4LF7 E;  1Z5C A;  5LMN E;  2V2Z A;  4ZVI A;  4LFA E;  1RRE A;  1N33 I;  4WUC A;  1WUU A;  2FV4 B;  4BBY A;  1OJ4 A;  4F9B B;  4WUD A;  2A2D A;  4USK A;  1GQE A;  1FJG I;  3HJC A;  2B9D A;  4LU9 A;  2L8T A;  1J26 A;  4X62 E;  3ZZT A;  4OOG C;  2CG9 A;  2NUG A;  3WU6 A;  1IBM E;  2L3J A;  4LF8 E;  1USU A;  1N36 I;  4JI1 I;  4DPY A;  1KTV A;  3K85 A;  2NA2 A;  4USM A;  4OX9 E;  4UT4 A;  1S16 A;  1H7U A;  2E5L E;  1BKN A;  3OTO I;  2UXD I;  3ADL A;  2V2V A;  2XEX A;  4PRX A;  5F3W A;  3AV0 A;  4DV0 E;  2E1R A;  4JI5 E;  4WUB A;  4DR5 I;  2CZ9 A;  2HHH I;  2VF3 A;  1ELO A;  4DUY I;  2VQF E;  2IOP A;  4MYU A;  2CGE A;  1Z0B A;  2EFG A;  4DKK A;  4LF7 I;  5LMN I;  4LFA I;  3VK6 A;  4Q28 A;  4DUZ E;  2MDR A;  4P78 A;  2MC5 A;  3AUZ A;  3LML A;  2GQ0 A;  1UHZ A;  4WYQ B;  3C4B A;  2Z5C A;  1GZ6 A;  2V8Q B;  2JY9 A;  4X62 I;  1HR0 E;  2HFU A;  4X8W A;  1IBM I;  4LTY A;  1FI4 A;  1N33 E;  3M6A A;  1X49 A;  1Z0T A;  2B7T A;  2UUB E;  4JI8 E;  3GON A;  3WU3 A;  4JI4 E;  4DPX A;  4JI7 E;  4RPF A;  2E5L I;  1UEK A;  4JI3 E;  4TUI A;  3DF6 A;  2O1W A;  4JYA E;  2A2C A;  4DR3 E;  3FIG A;  2R42 A;  2DSY A;  3WU5 A;  5CFF E;  1Y4S A;  4DMI A;  4NXM E;  4DXL A;  1Y6Z A;  2K4V A;  4JI5 I;  2L2M A;  2LTS A;  4BMJ A;  1DAR A;  4JV5 E;  1ZM2 A;  4LF4 E;  4XTJ A;  4DU8 A;  2VQF I;  2DIX A;  4DV5 E;  3PYE A;  2O1T A;  2Z5E A;  4LF9 I;  1QU6 A;  1MU5 A;  2X36 A;  3F6H A;  2NUF A;  4DUZ I;  4HXZ A;  3JTZ A;  1H7S A;  4DU7 A;  1ZXN A;  3T1Y E;  2RTX A;  2X7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...