4IFDE

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
267
structure length
267
Chain Sequence
GHMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 69
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdE00
3L7ZA 2WP8B 3H1CA 2C37B 4BA2A 5C0XF 2NN6E 2BA1D 4IFDF 1R6MA 3HKMA 3M7ND 2PO0A 2JEBA 4NBQA 5K36F 2JEAB 1OYSA 4IFDA 2WNRB 1E3PA 1E3HA 3B4TA 2C38B 4AM3A 2C37A 1OYRA 2JE6A 5K36A 3GMEA 1UDOA 4OO1B 2NN6C 1OYPA 5JEAC 2C39B 3CDJA 2PO2B 5C0XE 2WNRA 4BA1B 3M85D 2BA0D 2NN6B 4OO1C 4IFDE 2PNZA 3CDIA 5JEAB 2BR2B 2WP8A 3M7NG 1UDNA 5K36E 1R6LA 5JEAF 3KRNA 2PO1B 5C0XC 3L7ZB 4BA2B 2JEAA 3U1KA 5JEAD 5JEAA 4IFDC 4OO1F 2C38A 2PO0B 5K36C 5C0XB 2JEBB 3GLLA 2BA1G 4OO1A 4OO1D 2PO1A 3M85G 3DD6A 4IFDB 2BA0G 2C39A 2NN6F 2PO2A 2JE6B 5K36B 1UDSA 1UDQA 4BA1A 3GCMA 2NN6D 2NN6A 4AIDA 5JEAE 5C0XD 5C0XA 4AIMA 2BR2A 4IFDD 4OO1E 5K36D 2PNZB
chains in the Genus database with same CATH superfamily
3PRYA 4BA2A 2C37B 2VF3A 5C0XF 2Z5BB 2GS8A 2Q2EB 4J3DA 2UXCI 1ZM3A 3J80Q 4FW9A 2F4VE 4DV7E 2IERA 3CWVA 3HKMA 4X65I 4UT4A 3K1JA 4X64E 4AQYE 1XNQI 2JEBA 3Q6NA 1N0VC 2BM0A 1XNRI 2UUCE 1OYSA 2PNLA 4HYMA 4JYAI 2WNRB 1E3HA 4AM3A 2HKJA 1OYRA 4DR2E 5BR8I 4DV2I 3LTOA 1Z5CA 4IZJB 1FKAE 1N34I 4JI5E 3Q1QA 4DR3E 4DR6I 2NN6C 1FI4A 1Z0WA 4B3SI 1OYPA 1YHCA 2C39B 3CDJA 4MQYA 5DRPA 5C0XE 1HNXE 1S4EA 5A2QC 4XTJA 3K17A 3JAMQ 3Q6MA 2VQFE 4FN5A 1KIJA 1USUA 4DV1I 2WP8A 4NXNE 3J81Q 4URLA 1N36I 2A2CA 4FW5A 2IESA 4U3DA 5JEAF 3KRNA 4FW4A 2PO1B 4DR7E 4Z7YA 4X66I 5FLXQ 2O1UA 4BA2B 3P76A 2JEAA 1ZM4A 2BV3A 2ZITA 5JEAA 4OO1F 2UU9E 2E5LI 1K47A 2UXDI 5C0XB 2JEBB 3GLLA 1FWLA 1MU5A 4OO1A 3M85G 4MYUA 2BA0G 3T1YI 4GKKI 2NN6F 4JI3I 1Z0BA 4MU3A 1Z0CA 4DR1I 1H7SA 1VI7A 1RR9A 1FJGE 4AIDA 2NN6A 1OJ4A 2CVEA 5JEAE 5C0XD 4DV3E 4JI7E 1USVA 1IBKE 1NHJA 4WUCA 4OX9E 4DPXA 4DUZE 4KHPE 1IBLE 4LF8E 4OO1E 4YHHI 4DUYE 2Z5CA 2UUAI 4JI6E 2X7IA 1XMOI 1HR0I 2WP8B 1XHKA 3H1CA 1PVGA 4MYTA 3HULA 3PS1A 1Z0EA 4JI1E 4NXMI 2VESA 2NN6E 2BA1D 5FWKA 4GKJI 3F0NA 1R6MA 5GMEA 4HACB 4JG4A 3PS2A 3PYGA 1YH8A 2GQ0A 4NBQA 5DRQA 2JEAB 4JV5E 4DV7I 2VQEI 4DPTA 1E3PA 4DV6I 4PRVA 1MX0A 3ZZ0A 1B63A 2O1TA 2UUCI 1N33I 2HK2A 2V2QA 4OO1B 4LFAE 2WW4A 1Y4SA 1IBME 4DR2I 1Z0VA 4KQVA 2EFGA 5L3JA 5JEAC 2UXBE 4DR3I 5DROA 5IWAE 1H72C 4DPWA 1XMQI 3M85D 4UTGA 2BA0D 2NN6B 4OO1C 4B3TE 3GONA 1N32I 4LF6E 3T1HI 3V5RA 4MU0A 2VQFI 1Y60A 1BKNA 2HKEA 2HHHE 1FNMA 2J65A 2HFSA 4DU7A 1EI1A 5A2QQ 4K0KE 1QZRA 3J80C 4IFDC 4IZKB 5DRRA 1I94E 4DR7I 4QNKA 2V2VA 2ZM6E 5LMUE 2J7KA 4WUBA 1P42A 4DV0E 4IZJD 2IOPA 3PYFA 3WU4A 3WU3A 2BA1G 2NPFA 2UXCE 5GMDA 1NHIA 5LMNI 4X65E 3V2UC 2PO2A 5EL9A 3H4LA 4LF9E 1UDSA 1UDQA 4LCGA 4LOMA 4HY1A 4JI0I 4JYAE 1RHYA 3PS3A 4FW6A 1HNWE 4AIMA 3QT6A 4MU1A 4DV2E 1S16A 3JAMC 4LF7I 5ELWA 1N34E 1Y6ZA 4LF5I 5IT9C 4JI7I 4X62E 4ED4A 1IBKI 2X36A 3J81C 4OX9I 4JI4I 4DUZI 3J7AG 3L7ZA 1IBLI 4LF8I 4KHPI 2AJ4A 2O3ZA 4DUYI 1J5EE 4FW3A 1UEKA 5LL6R 3B8HA 4LPFA 4DR4E 2V2ZA 4IFDF 2PO0A 4MDTA 4MU4A 1Z5AA 2R3VA 2UUBI 4DR5E 4LF4I 2DEJA 4IFDA 4P52A 2HFUA 2C37A 3P3EA 3P3CA 2JE6A 1U2RA 4JV5I 3ZKDA 4LCHA 2PNMA 2OI2A 4R1FA 4B3MI 2DEIA 3M6AA 3HJCA 4N3OA 4USMA 3LNUA 4DV4E 2PO2B 2WNRA 1IBMI 1PIEA 4B3RE 3QT5A 1Z0TA 2UXBI 2O1WA 4IFDE 4GKKE 2O1VA 4OKGA 4HXZA 3WU5A 2F4VI 5JEAB 5EKWA 3M7NG 1UDNA 4X64I 4AQYI 3OTOE 3ZKBA 2V8PA 4LF6I 4LFCE 4JI8E 1R6LA 1XXEA 4WUDA 1FWKA 3L7ZB 1HNZE 3QT8A 4JI5I 4OZEA 1NHHA 1VISA 4DU8A 2E1RA 4YHHE 3U1KA 5JEAD 2CGEA 2C38A 3K85A 4FWHA 4YY3E 1Z59A 2GO4A 2PO0B 5K36C 2F1DA 1HNXI 4OO1D 5DNXA 1I94I 1H73A 1KVKA 5LMUI 3P3GA 1ZM9A 3ZM7A 4LFBE 1B62A 2PO1A 1HK7A 1ZXNA 4M1KA 3DD6A 4DV5E 4EMDA 4IFDB 4GKJE 3ZZUA 2Z5CB 4NXNI 4I3HA 2JE6B 1ZXMA 2CG9A 4P7AA 1A6FA 4BA1A 4IS9A 3GCMA 2NN6D 2VQEE 2AE8A 4DV6E 5C0XA 4GQUA 3B82A 4LF9I 2BR2A 1KTVA 4JI2E 3PYDA 1N33E 3P06A 4IFDD 4LCFA 1HNWI 2V34A 1ELOA 1N0UA 3D4JA 3QT7A 2UU9I 1D6TA 3WU6A 4X62I 4FWGA 1XMQE 1XNQE 1XNRE 1N32E 2IOQA 2A2DA 3T1HE 3M7ND 1J5EI 2XEXA 5BR8E 4RPFA 4DR4I 1FJGI 5K36F 5IT9Q 1Z5BA 1DARA 3B4TA 2C38B 4DV3I 4DR6E 2Z5EA 4B3SE 4DR5I 3J7AM 3GMEA 5K36A 1UDOA 4HACA 4JI6I 5FLXC 4DV1E 5DNLA 1NZ0A 4BA1B 2ZBKB 4JI1I 2PNZA 1KKHA 1PKPA 3B78A 4DV4I 4ISAA 3CDIA 4B3RI 1N36E 1H7UA 5LMNE 2BR2B 5K36E 4FW7A 4JI0E 2Z5BA 4X66E 3ZZTA 2BM1A 2JT2A 3OTOI 5C0XC 3UHMA 2E5LE 1Z0GA 4LF7E 4LFCI 4JI8I 2UXDE 4LF5E 4LFAI 1HNZI 3U1YA 2HK3A 4JI4E 4FWDA 4PRXA 4DPYA 2LJPA 2R42A 4IZJA 3T1YE 5IWAI 3NZKA 4JI3E 4DR1E 1Y5YA 4YY3I 3PYEA 4B3TI 2C39A 2CZ9A 1Y4UA 4LFBI 4IZKA 5K36B 4ZVIA 4DV5I 4U3BA 4DPUA 1EA6A 2UUBE 4LF4E 1H74A 1WUUA 4Z7CA 2HHHI 4PU9A 4USKA 4DXLA 1MG7A 2UUAE 2GO3A 1XMOE 3LPSA 4K0KI 1HR0E 4B3ME 1ZM2A 1RREA 4JI2I 5K36D 2ZM6I 4QNJA 2PNZB 4NXME 4DV0I
chains in the Genus database with same CATH topology
3L7ZA 2WP8B 3H1CA 2C37B 4BA2A 5C0XF 2NN6E 2BA1D 4IFDF 1R6MA 3HKMA 3M7ND 2PO0A 2JEBA 4NBQA 5K36F 2JEAB 1OYSA 4IFDA 2WNRB 1E3PA 1E3HA 3B4TA 2C38B 4AM3A 2C37A 1OYRA 2JE6A 5K36A 3GMEA 1UDOA 4OO1B 2NN6C 1OYPA 5JEAC 2C39B 3CDJA 2PO2B 5C0XE 2WNRA 4BA1B 3M85D 2BA0D 2NN6B 4OO1C 4IFDE 2PNZA 3CDIA 5JEAB 2BR2B 2WP8A 3M7NG 1UDNA 5K36E 1R6LA 5JEAF 3KRNA 2PO1B 5C0XC 3L7ZB 4BA2B 2JEAA 3U1KA 5JEAD 5JEAA 4IFDC 4OO1F 2C38A 2PO0B 5K36C 5C0XB 2JEBB 3GLLA 2BA1G 4OO1A 4OO1D 2PO1A 3M85G 3DD6A 4IFDB 2BA0G 2C39A 2NN6F 2PO2A 2JE6B 5K36B 1UDSA 1UDQA 4BA1A 3GCMA 2NN6D 2NN6A 4AIDA 5JEAE 5C0XD 5C0XA 4AIMA 2BR2A 4IFDD 4OO1E 5K36D 2PNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7Z A;  2WP8 B;  3H1C A;  2C37 B;  4BA2 A;  5C0X F;  2NN6 E;  2BA1 D;  4IFD F;  1R6M A;  3HKM A;  3M7N D;  2PO0 A;  2JEB A;  4NBQ A;  5K36 F;  2JEA B;  1OYS A;  4IFD A;  2WNR B;  1E3P A;  1E3H A;  3B4T A;  2C38 B;  4AM3 A;  2C37 A;  1OYR A;  2JE6 A;  5K36 A;  3GME A;  1UDO A;  4OO1 B;  2NN6 C;  1OYP A;  5JEA C;  2C39 B;  3CDJ A;  2PO2 B;  5C0X E;  2WNR A;  4BA1 B;  3M85 D;  2BA0 D;  2NN6 B;  4OO1 C;  4IFD E;  2PNZ A;  3CDI A;  5JEA B;  2BR2 B;  2WP8 A;  3M7N G;  1UDN A;  5K36 E;  1R6L A;  5JEA F;  3KRN A;  2PO1 B;  5C0X C;  3L7Z B;  4BA2 B;  2JEA A;  3U1K A;  5JEA D;  5JEA A;  4IFD C;  4OO1 F;  2C38 A;  2PO0 B;  5K36 C;  5C0X B;  2JEB B;  3GLL A;  2BA1 G;  4OO1 A;  4OO1 D;  2PO1 A;  3M85 G;  3DD6 A;  4IFD B;  2BA0 G;  2C39 A;  2NN6 F;  2PO2 A;  2JE6 B;  5K36 B;  1UDS A;  1UDQ A;  4BA1 A;  3GCM A;  2NN6 D;  2NN6 A;  4AID A;  5JEA E;  5C0X D;  5C0X A;  4AIM A;  2BR2 A;  4IFD D;  4OO1 E;  5K36 D;  2PNZ B; 
#chains in the Genus database with same CATH topology
 3PRY A;  4BA2 A;  2C37 B;  2VF3 A;  5C0X F;  2Z5B B;  2GS8 A;  2Q2E B;  4J3D A;  2UXC I;  1ZM3 A;  3J80 Q;  4FW9 A;  2F4V E;  4DV7 E;  2IER A;  3CWV A;  3HKM A;  4X65 I;  4UT4 A;  3K1J A;  4X64 E;  4AQY E;  1XNQ I;  2JEB A;  3Q6N A;  1N0V C;  2BM0 A;  1XNR I;  2UUC E;  1OYS A;  2PNL A;  4HYM A;  4JYA I;  2WNR B;  1E3H A;  4AM3 A;  2HKJ A;  1OYR A;  4DR2 E;  5BR8 I;  4DV2 I;  3LTO A;  1Z5C A;  4IZJ B;  1FKA E;  1N34 I;  4JI5 E;  3Q1Q A;  4DR3 E;  4DR6 I;  2NN6 C;  1FI4 A;  1Z0W A;  4B3S I;  1OYP A;  1YHC A;  2C39 B;  3CDJ A;  4MQY A;  5DRP A;  5C0X E;  1HNX E;  1S4E A;  5A2Q C;  4XTJ A;  3K17 A;  3JAM Q;  3Q6M A;  2VQF E;  4FN5 A;  1KIJ A;  1USU A;  4DV1 I;  2WP8 A;  4NXN E;  3J81 Q;  4URL A;  1N36 I;  2A2C A;  4FW5 A;  2IES A;  4U3D A;  5JEA F;  3KRN A;  4FW4 A;  2PO1 B;  4DR7 E;  4Z7Y A;  4X66 I;  5FLX Q;  2O1U A;  4BA2 B;  3P76 A;  2JEA A;  1ZM4 A;  2BV3 A;  2ZIT A;  5JEA A;  4OO1 F;  2UU9 E;  2E5L I;  1K47 A;  2UXD I;  5C0X B;  2JEB B;  3GLL A;  1FWL A;  1MU5 A;  4OO1 A;  3M85 G;  4MYU A;  2BA0 G;  3T1Y I;  4GKK I;  2NN6 F;  4JI3 I;  1Z0B A;  4MU3 A;  1Z0C A;  4DR1 I;  1H7S A;  1VI7 A;  1RR9 A;  1FJG E;  4AID A;  2NN6 A;  1OJ4 A;  2CVE A;  5JEA E;  5C0X D;  4DV3 E;  4JI7 E;  1USV A;  1IBK E;  1NHJ A;  4WUC A;  4OX9 E;  4DPX A;  4DUZ E;  4KHP E;  1IBL E;  4LF8 E;  4OO1 E;  4YHH I;  4DUY E;  2Z5C A;  2UUA I;  4JI6 E;  2X7I A;  1XMO I;  1HR0 I;  2WP8 B;  1XHK A;  3H1C A;  1PVG A;  4MYT A;  3HUL A;  3PS1 A;  1Z0E A;  4JI1 E;  4NXM I;  2VES A;  2NN6 E;  2BA1 D;  5FWK A;  4GKJ I;  3F0N A;  1R6M A;  5GME A;  4HAC B;  4JG4 A;  3PS2 A;  3PYG A;  1YH8 A;  2GQ0 A;  4NBQ A;  5DRQ A;  2JEA B;  4JV5 E;  4DV7 I;  2VQE I;  4DPT A;  1E3P A;  4DV6 I;  4PRV A;  1MX0 A;  3ZZ0 A;  1B63 A;  2O1T A;  2UUC I;  1N33 I;  2HK2 A;  2V2Q A;  4OO1 B;  4LFA E;  2WW4 A;  1Y4S A;  1IBM E;  4DR2 I;  1Z0V A;  4KQV A;  2EFG A;  5L3J A;  5JEA C;  2UXB E;  4DR3 I;  5DRO A;  5IWA E;  1H72 C;  4DPW A;  1XMQ I;  3M85 D;  4UTG A;  2BA0 D;  2NN6 B;  4OO1 C;  4B3T E;  3GON A;  1N32 I;  4LF6 E;  3T1H I;  3V5R A;  4MU0 A;  2VQF I;  1Y60 A;  1BKN A;  2HKE A;  2HHH E;  1FNM A;  2J65 A;  2HFS A;  4DU7 A;  1EI1 A;  5A2Q Q;  4K0K E;  1QZR A;  3J80 C;  4IFD C;  4IZK B;  5DRR A;  1I94 E;  4DR7 I;  4QNK A;  2V2V A;  2ZM6 E;  5LMU E;  2J7K A;  4WUB A;  1P42 A;  4DV0 E;  4IZJ D;  2IOP A;  3PYF A;  3WU4 A;  3WU3 A;  2BA1 G;  2NPF A;  2UXC E;  5GMD A;  1NHI A;  5LMN I;  4X65 E;  3V2U C;  2PO2 A;  5EL9 A;  3H4L A;  4LF9 E;  1UDS A;  1UDQ A;  4LCG A;  4LOM A;  4HY1 A;  4JI0 I;  4JYA E;  1RHY A;  3PS3 A;  4FW6 A;  1HNW E;  4AIM A;  3QT6 A;  4MU1 A;  4DV2 E;  1S16 A;  3JAM C;  4LF7 I;  5ELW A;  1N34 E;  1Y6Z A;  4LF5 I;  5IT9 C;  4JI7 I;  4X62 E;  4ED4 A;  1IBK I;  2X36 A;  3J81 C;  4OX9 I;  4JI4 I;  4DUZ I;  3J7A G;  3L7Z A;  1IBL I;  4LF8 I;  4KHP I;  2AJ4 A;  2O3Z A;  4DUY I;  1J5E E;  4FW3 A;  1UEK A;  5LL6 R;  3B8H A;  4LPF A;  4DR4 E;  2V2Z A;  4IFD F;  2PO0 A;  4MDT A;  4MU4 A;  1Z5A A;  2R3V A;  2UUB I;  4DR5 E;  4LF4 I;  2DEJ A;  4IFD A;  4P52 A;  2HFU A;  2C37 A;  3P3E A;  3P3C A;  2JE6 A;  1U2R A;  4JV5 I;  3ZKD A;  4LCH A;  2PNM A;  2OI2 A;  4R1F A;  4B3M I;  2DEI A;  3M6A A;  3HJC A;  4N3O A;  4USM A;  3LNU A;  4DV4 E;  2PO2 B;  2WNR A;  1IBM I;  1PIE A;  4B3R E;  3QT5 A;  1Z0T A;  2UXB I;  2O1W A;  4IFD E;  4GKK E;  2O1V A;  4OKG A;  4HXZ A;  3WU5 A;  2F4V I;  5JEA B;  5EKW A;  3M7N G;  1UDN A;  4X64 I;  4AQY I;  3OTO E;  3ZKB A;  2V8P A;  4LF6 I;  4LFC E;  4JI8 E;  1R6L A;  1XXE A;  4WUD A;  1FWK A;  3L7Z B;  1HNZ E;  3QT8 A;  4JI5 I;  4OZE A;  1NHH A;  1VIS A;  4DU8 A;  2E1R A;  4YHH E;  3U1K A;  5JEA D;  2CGE A;  2C38 A;  3K85 A;  4FWH A;  4YY3 E;  1Z59 A;  2GO4 A;  2PO0 B;  5K36 C;  2F1D A;  1HNX I;  4OO1 D;  5DNX A;  1I94 I;  1H73 A;  1KVK A;  5LMU I;  3P3G A;  1ZM9 A;  3ZM7 A;  4LFB E;  1B62 A;  2PO1 A;  1HK7 A;  1ZXN A;  4M1K A;  3DD6 A;  4DV5 E;  4EMD A;  4IFD B;  4GKJ E;  3ZZU A;  2Z5C B;  4NXN I;  4I3H A;  2JE6 B;  1ZXM A;  2CG9 A;  4P7A A;  1A6F A;  4BA1 A;  4IS9 A;  3GCM A;  2NN6 D;  2VQE E;  2AE8 A;  4DV6 E;  5C0X A;  4GQU A;  3B82 A;  4LF9 I;  2BR2 A;  1KTV A;  4JI2 E;  3PYD A;  1N33 E;  3P06 A;  4IFD D;  4LCF A;  1HNW I;  2V34 A;  1ELO A;  1N0U A;  3D4J A;  3QT7 A;  2UU9 I;  1D6T A;  3WU6 A;  4X62 I;  4FWG A;  1XMQ E;  1XNQ E;  1XNR E;  1N32 E;  2IOQ A;  2A2D A;  3T1H E;  3M7N D;  1J5E I;  2XEX A;  5BR8 E;  4RPF A;  4DR4 I;  1FJG I;  5K36 F;  5IT9 Q;  1Z5B A;  1DAR A;  3B4T A;  2C38 B;  4DV3 I;  4DR6 E;  2Z5E A;  4B3S E;  4DR5 I;  3J7A M;  3GME A;  5K36 A;  1UDO A;  4HAC A;  4JI6 I;  5FLX C;  4DV1 E;  5DNL A;  1NZ0 A;  4BA1 B;  2ZBK B;  4JI1 I;  2PNZ A;  1KKH A;  1PKP A;  3B78 A;  4DV4 I;  4ISA A;  3CDI A;  4B3R I;  1N36 E;  1H7U A;  5LMN E;  2BR2 B;  5K36 E;  4FW7 A;  4JI0 E;  2Z5B A;  4X66 E;  3ZZT A;  2BM1 A;  2JT2 A;  3OTO I;  5C0X C;  3UHM A;  2E5L E;  1Z0G A;  4LF7 E;  4LFC I;  4JI8 I;  2UXD E;  4LF5 E;  4LFA I;  1HNZ I;  3U1Y A;  2HK3 A;  4JI4 E;  4FWD A;  4PRX A;  4DPY A;  2LJP A;  2R42 A;  4IZJ A;  3T1Y E;  5IWA I;  3NZK A;  4JI3 E;  4DR1 E;  1Y5Y A;  4YY3 I;  3PYE A;  4B3T I;  2C39 A;  2CZ9 A;  1Y4U A;  4LFB I;  4IZK A;  5K36 B;  4ZVI A;  4DV5 I;  4U3B A;  4DPU A;  1EA6 A;  2UUB E;  4LF4 E;  1H74 A;  1WUU A;  4Z7C A;  2HHH I;  4PU9 A;  4USK A;  4DXL A;  1MG7 A;  2UUA E;  2GO3 A;  1XMO E;  3LPS A;  4K0K I;  1HR0 E;  4B3M E;  1ZM2 A;  1RRE A;  4JI2 I;  5K36 D;  2ZM6 I;  4QNJ A;  2PNZ B;  4NXM E;  4DV0 I; 
#chains in the Genus database with same CATH homology
 3L7Z A;  2WP8 B;  3H1C A;  2C37 B;  4BA2 A;  5C0X F;  2NN6 E;  2BA1 D;  4IFD F;  1R6M A;  3HKM A;  3M7N D;  2PO0 A;  2JEB A;  4NBQ A;  5K36 F;  2JEA B;  1OYS A;  4IFD A;  2WNR B;  1E3P A;  1E3H A;  3B4T A;  2C38 B;  4AM3 A;  2C37 A;  1OYR A;  2JE6 A;  5K36 A;  3GME A;  1UDO A;  4OO1 B;  2NN6 C;  1OYP A;  5JEA C;  2C39 B;  3CDJ A;  2PO2 B;  5C0X E;  2WNR A;  4BA1 B;  3M85 D;  2BA0 D;  2NN6 B;  4OO1 C;  4IFD E;  2PNZ A;  3CDI A;  5JEA B;  2BR2 B;  2WP8 A;  3M7N G;  1UDN A;  5K36 E;  1R6L A;  5JEA F;  3KRN A;  2PO1 B;  5C0X C;  3L7Z B;  4BA2 B;  2JEA A;  3U1K A;  5JEA D;  5JEA A;  4IFD C;  4OO1 F;  2C38 A;  2PO0 B;  5K36 C;  5C0X B;  2JEB B;  3GLL A;  2BA1 G;  4OO1 A;  4OO1 D;  2PO1 A;  3M85 G;  3DD6 A;  4IFD B;  2BA0 G;  2C39 A;  2NN6 F;  2PO2 A;  2JE6 B;  5K36 B;  1UDS A;  1UDQ A;  4BA1 A;  3GCM A;  2NN6 D;  2NN6 A;  4AID A;  5JEA E;  5C0X D;  5C0X A;  4AIM A;  2BR2 A;  4IFD D;  4OO1 E;  5K36 D;  2PNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...