4IFDE

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
267
structure length
267
Chain Sequence
GHMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 69
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdE00
2WP8A 1OYRA 4OO1B 3KRNA 2PO1A 5K36C 2BA0G 3CDIA 2WP8B 1OYPA 5JEAA 2NN6A 2C38B 2JEAA 2C38A 5JEAB 5JEAF 2PO2B 2NN6F 2PNZA 4OO1F 2PO1B 2JEBA 5JEAC 4IFDE 4OO1A 2C39B 2BR2B 4IFDD 1UDQA 5K36F 5JEAD 3L7ZA 3M85D 2BA0D 1OYSA 2WNRA 3GCMA 4BA2A 3GMEA 5C0XA 4IFDB 4BA1B 3CDJA 5C0XF 1UDSA 1R6LA 3M85G 5K36A 1UDOA 4OO1D 2C37B 2JE6A 2PO0B 4IFDC 4BA1A 4OO1E 1R6MA 2NN6D 5JEAE 3DD6A 2BA1D 2WNRB 4BA2B 2NN6C 3U1KA 5C0XD 2BA1G 2PO0A 2JE6B 3B4TA 2C37A 4NBQA 5K36B 2BR2A 1E3PA 2JEBB 5K36D 5K36E 3HKMA 4IFDA 3M7NG 2PNZB 4IFDF 2NN6E 5C0XB 2PO2A 3H1CA 3M7ND 1UDNA 3L7ZB 4AIDA 4OO1C 5C0XE 2JEAB 2NN6B 5C0XC 4AM3A 1E3HA 4AIMA 3GLLA 2C39A
chains in the Genus database with same CATH superfamily
1OYRA 4OO1B 2PO1A 4UT4A 5K36C 1NZ0A 1UEKA 4DPUA 4MQYA 2PNMA 4B3TE 4JI2E 4J3DA 1NHHA 4XTJA 3P3GA 2C38B 4DR5E 3OTOI 4JI1I 3V2UC 4YY3I 5L3JA 1B63A 1H74A 2Q2EB 2NN6F 4KQVA 4X65I 4LF9I 3M6AA 2E5LI 4MU1A 1XNRI 1HNXI 4DUZI 2ZBKB 3ZZTA 1Y4UA 4MU4A 1RHYA 4IFDE 4DR3I 1EA6A 2GS8A 1A6FA 1HNZI 4MDTA 2X36A 1HK7A 4JI7I 2UXBE 3K85A 2WNRA 5C0XA 4OZEA 1N33I 1B62A 1Z0TA 2ZM6E 4FW7A 1RREA 4FWGA 4LF7E 1KVKA 3CDJA 4URLA 4FW3A 4LFAI 1FJGI 1IBLE 3T1HE 3PYFA 3J80Q 2VESA 3QT6A 4PRXA 5DRQA 4BA1A 4GKKI 2NN6D 2VQFE 4DUYE 4JI3E 2IOQA 2UXBI 2UUCI 5DRRA 2NN6C 1I94E 4Z7CA 2OI2A 4R1FA 2Z5CB 5A2QC 2IOPA 4DV3I 1MU5A 4YHHI 4DR7I 2UUBI 3B4TA 4X64E 2ZITA 4DV5E 4FWDA 4NBQA 4B3ME 5LMNE 4JG4A 1E3PA 3NZKA 4DR6I 2R42A 1Z0EA 4DV4E 1Y5YA 4JI5E 4LFCI 2A2DA 5BR8I 4K0KE 1XMOI 2O1WA 4X66E 5C0XB 4DV6E 1Y6ZA 1XNQE 3PYGA 1KKHA 4LCGA 1HR0I 5C0XE 5EKWA 4GKJI 2NN6B 4B3TI 4YHHE 4DR7E 3PYEA 2HK2A 2WP8A 4IZJD 4LF4I 5IT9Q 3T1YI 4ED4A 4DR1E 4DR4E 4X65E 3H4LA 1Z0VA 2J65A 2HFUA 4LF7I 1OYPA 3T1HI 2UU9E 1PIEA 2C38A 1PKPA 2PO2B 3P06A 1N32I 4HYMA 1DARA 4GKKE 2PNZA 4LFBE 1D6TA 2PO1B 2JEBA 5JEAC 4OO1A 3T1YE 1Z5AA 2BR2B 1FNMA 3F0NA 4DV3E 1UDQA 5K36F 5JEAD 4DR2E 2BA0D 3B82A 5DROA 5FLXQ 1NHIA 1OJ4A 1XHKA 4BA2A 1ZM9A 2V2VA 1FI4A 4LOMA 3PRYA 4JI6I 2V2QA 2X7IA 3LNUA 4AQYE 4EMDA 3J81C 4IFDB 2E5LE 1UDSA 2VF3A 5C0XF 1YHCA 4IZJA 2UUCE 3M85G 4JI8I 5K36A 4OO1D 4JYAE 2C37B 4MYUA 4Z7YA 2UUAI 4IFDC 3WU6A 5ELWA 4X62I 3DD6A 2BA1D 2AE8A 1N33E 1EI1A 3ZKDA 4OX9E 4DR6E 1Y4SA 2VQEE 4X64I 1S4EA 3U1KA 5IWAI 2UXDE 1FWLA 2PO0A 4P7AA 3CWVA 4LFCE 1YH8A 4JI4I 4LF9E 1H7UA 5DNXA 1XNQI 1KIJA 3WU5A 2O1UA 1HNXE 3HKMA 1IBLI 4JI3I 5GMEA 2CZ9A 2DEJA 1IBME 1KTVA 4QNJA 4IFDF 1H7SA 2WW4A 2BM1A 4LPFA 2HKJA 2E1RA 5EL9A 4DV2E 4USMA 3B78A 2F1DA 1UDNA 1N0VC 4AIDA 4DU8A 5FLXC 3M7ND 4LF4E 4OO1C 2O1TA 4NXNE 3V5RA 2JEAB 4FW9A 2CVEA 4U3BA 4AM3A 4AIMA 3U1YA 2IERA 1VI7A 4JV5E 3GLLA 4DV4I 2C39A 1HNWI 3KRNA 4JI0I 2BA0G 1N36E 3CDIA 1XMQI 4KHPI 1FJGE 4N3OA 4K0KI 3ZM7A 3K1JA 5JEAA 4GKJE 4LF8E 2JEAA 5IT9C 4NXNI 4X66I 2Z5EA 1IBKE 1QZRA 2UXCI 4B3RE 4DR1I 5GMDA 1S16A 4OX9I 2VQEI 2J7KA 3LPSA 2A2CA 2HHHE 4DR2I 1NHJA 1Z0GA 3HJCA 4WUDA 1K47A 3HULA 4P52A 3PYDA 1VISA 4IZKA 4DR4I 4IS9A 2DEIA 3L7ZA 1H73A 3M85D 4WUCA 2F4VE 5FWKA 1OYSA 3GCMA 2GO4A 1J5EE 2UU9I 3WU4A 2HKEA 4DV6I 1IBMI 2O1VA 4JYAI 4DV0E 1N34E 3UHMA 1R6LA 4HACA 3QT7A 4DV1E 2JE6A 3J81Q 1USVA 4OO1E 2V2ZA 5JEAE 5IWAE 4LF5E 4FW4A 2V8PA 2Z5BB 3PS2A 4MU0A 3Q1QA 2Z5BA 4BA2B 1H72C 1Z0WA 4NXME 3P3CA 2IESA 3JAMC 2R3VA 4QNKA 4MU3A 4AQYI 4LCFA 2JE6B 4JI8E 4UTGA 2HK3A 4HACB 2UUAE 2BR2A 4USKA 2JEBB 3JAMQ 1PVGA 4DV2I 2GO3A 4DR5I 4U3DA 2PNZB 4X62E 4YY3E 4DPYA 2PO2A 2JT2A 3H1CA 4JI2I 1Z0CA 4DV7I 3ZZ0A 4B3SI 3L7ZB 2XEXA 4LFAE 1ZM2A 1HNWE 3D4JA 4IZKB 4DUZE 4M1KA 1MX0A 1ZM4A 2UXDI 5C0XC 4FW6A 1N36I 3P76A 1XMQE 4KHPE 4MYTA 1USUA 4HY1A 1Z59A 4DR3E 4ZVIA 1XNRE 3J7AG 4HXZA 4LF8I 2WP8B 1HNZE 3QT5A 1IBKI 1ELOA 2NN6A 4DV7E 1N34I 1WUUA 2UXCE 3P3EA 5JEAB 3ZZUA 5JEAF 4JV5I 4FWHA 5LMNI 3Q6NA 4OKGA 2ZM6I 5LMUI 4PRVA 4JI5I 1ZXMA 4DXLA 4OO1F 3PS3A 4JI0E 5A2QQ 2C39B 4DUYI 4JI4E 4IFDD 1N0UA 1ZXNA 4GQUA 1HR0E 1FWKA 1ZM3A 2V34A 2Z5CA 4LCHA 5LL6R 4RPFA 3GMEA 2CGEA 4I3HA 3J80C 4DV5I 4DPWA 3PS1A 1Z0BA 4BA1B 4B3SE 3WU3A 4JI1E 5DRPA 2UUBE 2EFGA 1UDOA 4B3RI 4ISAA 4DPXA 4B3MI 4LF5I 3ZKBA 2PO0B 3QT8A 3LTOA 3B8HA 2BM0A 5BR8E 4DU7A 1MG7A 5DNLA 4NXMI 3K17A 1R6MA 1Z5BA 1P42A 1Y60A 2PNLA 4DPTA 2WNRB 1J5EI 2LJPA 5C0XD 4DV0I 2O3ZA 1BKNA 2NPFA 2F4VI 2BA1G 1U2RA 3GONA 2GQ0A 2VQFI 4LF6E 4WUBA 1I94I 2C37A 5K36B 4IZJB 4JI7E 1Z5CA 5K36D 2CG9A 5K36E 2AJ4A 5LMUE 3M7NG 4IFDA 2BV3A 1RR9A 2NN6E 4DV1I 1XXEA 4JI6E 2HHHI 3OTOE 1N32E 3J7AM 4LFBI 4FN5A 3Q6MA 1XMOE 1E3HA 4PU9A 4LF6I 2HFSA 4FW5A 1FKAE
chains in the Genus database with same CATH topology
2WP8A 1OYRA 4OO1B 3KRNA 2PO1A 5K36C 2BA0G 3CDIA 2WP8B 1OYPA 5JEAA 2NN6A 2C38B 2JEAA 2C38A 5JEAB 5JEAF 2PO2B 2NN6F 2PNZA 4OO1F 2PO1B 2JEBA 5JEAC 4IFDE 4OO1A 2C39B 2BR2B 4IFDD 1UDQA 5K36F 5JEAD 3L7ZA 3M85D 2BA0D 1OYSA 2WNRA 3GCMA 4BA2A 3GMEA 5C0XA 4IFDB 4BA1B 3CDJA 5C0XF 1UDSA 1R6LA 3M85G 5K36A 1UDOA 4OO1D 2C37B 2JE6A 2PO0B 4IFDC 4BA1A 4OO1E 1R6MA 2NN6D 5JEAE 3DD6A 2BA1D 2WNRB 4BA2B 2NN6C 3U1KA 5C0XD 2BA1G 2PO0A 2JE6B 3B4TA 2C37A 4NBQA 5K36B 2BR2A 1E3PA 2JEBB 5K36D 5K36E 3HKMA 4IFDA 3M7NG 2PNZB 4IFDF 2NN6E 5C0XB 2PO2A 3H1CA 3M7ND 1UDNA 3L7ZB 4AIDA 4OO1C 5C0XE 2JEAB 2NN6B 5C0XC 4AM3A 1E3HA 4AIMA 3GLLA 2C39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP8 A;  1OYR A;  4OO1 B;  3KRN A;  2PO1 A;  5K36 C;  2BA0 G;  3CDI A;  2WP8 B;  1OYP A;  5JEA A;  2NN6 A;  2C38 B;  2JEA A;  2C38 A;  5JEA B;  5JEA F;  2PO2 B;  2NN6 F;  2PNZ A;  4OO1 F;  2PO1 B;  2JEB A;  5JEA C;  4IFD E;  4OO1 A;  2C39 B;  2BR2 B;  4IFD D;  1UDQ A;  5K36 F;  5JEA D;  3L7Z A;  3M85 D;  2BA0 D;  1OYS A;  2WNR A;  3GCM A;  4BA2 A;  3GME A;  5C0X A;  4IFD B;  4BA1 B;  3CDJ A;  5C0X F;  1UDS A;  1R6L A;  3M85 G;  5K36 A;  1UDO A;  4OO1 D;  2C37 B;  2JE6 A;  2PO0 B;  4IFD C;  4BA1 A;  4OO1 E;  1R6M A;  2NN6 D;  5JEA E;  3DD6 A;  2BA1 D;  2WNR B;  4BA2 B;  2NN6 C;  3U1K A;  5C0X D;  2BA1 G;  2PO0 A;  2JE6 B;  3B4T A;  2C37 A;  4NBQ A;  5K36 B;  2BR2 A;  1E3P A;  2JEB B;  5K36 D;  5K36 E;  3HKM A;  4IFD A;  3M7N G;  2PNZ B;  4IFD F;  2NN6 E;  5C0X B;  2PO2 A;  3H1C A;  3M7N D;  1UDN A;  3L7Z B;  4AID A;  4OO1 C;  5C0X E;  2JEA B;  2NN6 B;  5C0X C;  4AM3 A;  1E3H A;  4AIM A;  3GLL A;  2C39 A; 
#chains in the Genus database with same CATH topology
 1OYR A;  4OO1 B;  2PO1 A;  4UT4 A;  5K36 C;  1NZ0 A;  1UEK A;  4DPU A;  4MQY A;  2PNM A;  4B3T E;  4JI2 E;  4J3D A;  1NHH A;  4XTJ A;  3P3G A;  2C38 B;  4DR5 E;  3OTO I;  4JI1 I;  3V2U C;  4YY3 I;  5L3J A;  1B63 A;  1H74 A;  2Q2E B;  2NN6 F;  4KQV A;  4X65 I;  4LF9 I;  3M6A A;  2E5L I;  4MU1 A;  1XNR I;  1HNX I;  4DUZ I;  2ZBK B;  3ZZT A;  1Y4U A;  4MU4 A;  1RHY A;  4IFD E;  4DR3 I;  1EA6 A;  2GS8 A;  1A6F A;  1HNZ I;  4MDT A;  2X36 A;  1HK7 A;  4JI7 I;  2UXB E;  3K85 A;  2WNR A;  5C0X A;  4OZE A;  1N33 I;  1B62 A;  1Z0T A;  2ZM6 E;  4FW7 A;  1RRE A;  4FWG A;  4LF7 E;  1KVK A;  3CDJ A;  4URL A;  4FW3 A;  4LFA I;  1FJG I;  1IBL E;  3T1H E;  3PYF A;  3J80 Q;  2VES A;  3QT6 A;  4PRX A;  5DRQ A;  4BA1 A;  4GKK I;  2NN6 D;  2VQF E;  4DUY E;  4JI3 E;  2IOQ A;  2UXB I;  2UUC I;  5DRR A;  2NN6 C;  1I94 E;  4Z7C A;  2OI2 A;  4R1F A;  2Z5C B;  5A2Q C;  2IOP A;  4DV3 I;  1MU5 A;  4YHH I;  4DR7 I;  2UUB I;  3B4T A;  4X64 E;  2ZIT A;  4DV5 E;  4FWD A;  4NBQ A;  4B3M E;  5LMN E;  4JG4 A;  1E3P A;  3NZK A;  4DR6 I;  2R42 A;  1Z0E A;  4DV4 E;  1Y5Y A;  4JI5 E;  4LFC I;  2A2D A;  5BR8 I;  4K0K E;  1XMO I;  2O1W A;  4X66 E;  5C0X B;  4DV6 E;  1Y6Z A;  1XNQ E;  3PYG A;  1KKH A;  4LCG A;  1HR0 I;  5C0X E;  5EKW A;  4GKJ I;  2NN6 B;  4B3T I;  4YHH E;  4DR7 E;  3PYE A;  2HK2 A;  2WP8 A;  4IZJ D;  4LF4 I;  5IT9 Q;  3T1Y I;  4ED4 A;  4DR1 E;  4DR4 E;  4X65 E;  3H4L A;  1Z0V A;  2J65 A;  2HFU A;  4LF7 I;  1OYP A;  3T1H I;  2UU9 E;  1PIE A;  2C38 A;  1PKP A;  2PO2 B;  3P06 A;  1N32 I;  4HYM A;  1DAR A;  4GKK E;  2PNZ A;  4LFB E;  1D6T A;  2PO1 B;  2JEB A;  5JEA C;  4OO1 A;  3T1Y E;  1Z5A A;  2BR2 B;  1FNM A;  3F0N A;  4DV3 E;  1UDQ A;  5K36 F;  5JEA D;  4DR2 E;  2BA0 D;  3B82 A;  5DRO A;  5FLX Q;  1NHI A;  1OJ4 A;  1XHK A;  4BA2 A;  1ZM9 A;  2V2V A;  1FI4 A;  4LOM A;  3PRY A;  4JI6 I;  2V2Q A;  2X7I A;  3LNU A;  4AQY E;  4EMD A;  3J81 C;  4IFD B;  2E5L E;  1UDS A;  2VF3 A;  5C0X F;  1YHC A;  4IZJ A;  2UUC E;  3M85 G;  4JI8 I;  5K36 A;  4OO1 D;  4JYA E;  2C37 B;  4MYU A;  4Z7Y A;  2UUA I;  4IFD C;  3WU6 A;  5ELW A;  4X62 I;  3DD6 A;  2BA1 D;  2AE8 A;  1N33 E;  1EI1 A;  3ZKD A;  4OX9 E;  4DR6 E;  1Y4S A;  2VQE E;  4X64 I;  1S4E A;  3U1K A;  5IWA I;  2UXD E;  1FWL A;  2PO0 A;  4P7A A;  3CWV A;  4LFC E;  1YH8 A;  4JI4 I;  4LF9 E;  1H7U A;  5DNX A;  1XNQ I;  1KIJ A;  3WU5 A;  2O1U A;  1HNX E;  3HKM A;  1IBL I;  4JI3 I;  5GME A;  2CZ9 A;  2DEJ A;  1IBM E;  1KTV A;  4QNJ A;  4IFD F;  1H7S A;  2WW4 A;  2BM1 A;  4LPF A;  2HKJ A;  2E1R A;  5EL9 A;  4DV2 E;  4USM A;  3B78 A;  2F1D A;  1UDN A;  1N0V C;  4AID A;  4DU8 A;  5FLX C;  3M7N D;  4LF4 E;  4OO1 C;  2O1T A;  4NXN E;  3V5R A;  2JEA B;  4FW9 A;  2CVE A;  4U3B A;  4AM3 A;  4AIM A;  3U1Y A;  2IER A;  1VI7 A;  4JV5 E;  3GLL A;  4DV4 I;  2C39 A;  1HNW I;  3KRN A;  4JI0 I;  2BA0 G;  1N36 E;  3CDI A;  1XMQ I;  4KHP I;  1FJG E;  4N3O A;  4K0K I;  3ZM7 A;  3K1J A;  5JEA A;  4GKJ E;  4LF8 E;  2JEA A;  5IT9 C;  4NXN I;  4X66 I;  2Z5E A;  1IBK E;  1QZR A;  2UXC I;  4B3R E;  4DR1 I;  5GMD A;  1S16 A;  4OX9 I;  2VQE I;  2J7K A;  3LPS A;  2A2C A;  2HHH E;  4DR2 I;  1NHJ A;  1Z0G A;  3HJC A;  4WUD A;  1K47 A;  3HUL A;  4P52 A;  3PYD A;  1VIS A;  4IZK A;  4DR4 I;  4IS9 A;  2DEI A;  3L7Z A;  1H73 A;  3M85 D;  4WUC A;  2F4V E;  5FWK A;  1OYS A;  3GCM A;  2GO4 A;  1J5E E;  2UU9 I;  3WU4 A;  2HKE A;  4DV6 I;  1IBM I;  2O1V A;  4JYA I;  4DV0 E;  1N34 E;  3UHM A;  1R6L A;  4HAC A;  3QT7 A;  4DV1 E;  2JE6 A;  3J81 Q;  1USV A;  4OO1 E;  2V2Z A;  5JEA E;  5IWA E;  4LF5 E;  4FW4 A;  2V8P A;  2Z5B B;  3PS2 A;  4MU0 A;  3Q1Q A;  2Z5B A;  4BA2 B;  1H72 C;  1Z0W A;  4NXM E;  3P3C A;  2IES A;  3JAM C;  2R3V A;  4QNK A;  4MU3 A;  4AQY I;  4LCF A;  2JE6 B;  4JI8 E;  4UTG A;  2HK3 A;  4HAC B;  2UUA E;  2BR2 A;  4USK A;  2JEB B;  3JAM Q;  1PVG A;  4DV2 I;  2GO3 A;  4DR5 I;  4U3D A;  2PNZ B;  4X62 E;  4YY3 E;  4DPY A;  2PO2 A;  2JT2 A;  3H1C A;  4JI2 I;  1Z0C A;  4DV7 I;  3ZZ0 A;  4B3S I;  3L7Z B;  2XEX A;  4LFA E;  1ZM2 A;  1HNW E;  3D4J A;  4IZK B;  4DUZ E;  4M1K A;  1MX0 A;  1ZM4 A;  2UXD I;  5C0X C;  4FW6 A;  1N36 I;  3P76 A;  1XMQ E;  4KHP E;  4MYT A;  1USU A;  4HY1 A;  1Z59 A;  4DR3 E;  4ZVI A;  1XNR E;  3J7A G;  4HXZ A;  4LF8 I;  2WP8 B;  1HNZ E;  3QT5 A;  1IBK I;  1ELO A;  2NN6 A;  4DV7 E;  1N34 I;  1WUU A;  2UXC E;  3P3E A;  5JEA B;  3ZZU A;  5JEA F;  4JV5 I;  4FWH A;  5LMN I;  3Q6N A;  4OKG A;  2ZM6 I;  5LMU I;  4PRV A;  4JI5 I;  1ZXM A;  4DXL A;  4OO1 F;  3PS3 A;  4JI0 E;  5A2Q Q;  2C39 B;  4DUY I;  4JI4 E;  4IFD D;  1N0U A;  1ZXN A;  4GQU A;  1HR0 E;  1FWK A;  1ZM3 A;  2V34 A;  2Z5C A;  4LCH A;  5LL6 R;  4RPF A;  3GME A;  2CGE A;  4I3H A;  3J80 C;  4DV5 I;  4DPW A;  3PS1 A;  1Z0B A;  4BA1 B;  4B3S E;  3WU3 A;  4JI1 E;  5DRP A;  2UUB E;  2EFG A;  1UDO A;  4B3R I;  4ISA A;  4DPX A;  4B3M I;  4LF5 I;  3ZKB A;  2PO0 B;  3QT8 A;  3LTO A;  3B8H A;  2BM0 A;  5BR8 E;  4DU7 A;  1MG7 A;  5DNL A;  4NXM I;  3K17 A;  1R6M A;  1Z5B A;  1P42 A;  1Y60 A;  2PNL A;  4DPT A;  2WNR B;  1J5E I;  2LJP A;  5C0X D;  4DV0 I;  2O3Z A;  1BKN A;  2NPF A;  2F4V I;  2BA1 G;  1U2R A;  3GON A;  2GQ0 A;  2VQF I;  4LF6 E;  4WUB A;  1I94 I;  2C37 A;  5K36 B;  4IZJ B;  4JI7 E;  1Z5C A;  5K36 D;  2CG9 A;  5K36 E;  2AJ4 A;  5LMU E;  3M7N G;  4IFD A;  2BV3 A;  1RR9 A;  2NN6 E;  4DV1 I;  1XXE A;  4JI6 E;  2HHH I;  3OTO E;  1N32 E;  3J7A M;  4LFB I;  4FN5 A;  3Q6M A;  1XMO E;  1E3H A;  4PU9 A;  4LF6 I;  2HFS A;  4FW5 A;  1FKA E; 
#chains in the Genus database with same CATH homology
 2WP8 A;  1OYR A;  4OO1 B;  3KRN A;  2PO1 A;  5K36 C;  2BA0 G;  3CDI A;  2WP8 B;  1OYP A;  5JEA A;  2NN6 A;  2C38 B;  2JEA A;  2C38 A;  5JEA B;  5JEA F;  2PO2 B;  2NN6 F;  2PNZ A;  4OO1 F;  2PO1 B;  2JEB A;  5JEA C;  4IFD E;  4OO1 A;  2C39 B;  2BR2 B;  4IFD D;  1UDQ A;  5K36 F;  5JEA D;  3L7Z A;  3M85 D;  2BA0 D;  1OYS A;  2WNR A;  3GCM A;  4BA2 A;  3GME A;  5C0X A;  4IFD B;  4BA1 B;  3CDJ A;  5C0X F;  1UDS A;  1R6L A;  3M85 G;  5K36 A;  1UDO A;  4OO1 D;  2C37 B;  2JE6 A;  2PO0 B;  4IFD C;  4BA1 A;  4OO1 E;  1R6M A;  2NN6 D;  5JEA E;  3DD6 A;  2BA1 D;  2WNR B;  4BA2 B;  2NN6 C;  3U1K A;  5C0X D;  2BA1 G;  2PO0 A;  2JE6 B;  3B4T A;  2C37 A;  4NBQ A;  5K36 B;  2BR2 A;  1E3P A;  2JEB B;  5K36 D;  5K36 E;  3HKM A;  4IFD A;  3M7N G;  2PNZ B;  4IFD F;  2NN6 E;  5C0X B;  2PO2 A;  3H1C A;  3M7N D;  1UDN A;  3L7Z B;  4AID A;  4OO1 C;  5C0X E;  2JEA B;  2NN6 B;  5C0X C;  4AM3 A;  1E3H A;  4AIM A;  3GLL A;  2C39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...