4IFDE

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
267
structure length
267
Chain Sequence
GHMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 69
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdE00
2NN6A 5K36A 4IFDA 5K36B 1UDSA 5JEAE 2WNRB 1OYPA 2JE6A 5C0XD 2C39A 3H1CA 2PO1A 2JEBB 2PO1B 2NN6F 5JEAF 4BA1B 4IFDF 4AM3A 2NN6C 4OO1D 5JEAA 4NBQA 3M7ND 2C37B 2PO2A 2JEAA 4IFDC 1OYSA 2NN6B 1UDQA 2JEAB 1E3HA 4IFDB 3GCMA 5K36D 4IFDD 2JE6B 2C39B 3B4TA 1UDOA 3GLLA 3KRNA 4OO1E 3HKMA 3M85G 1R6MA 5JEAC 2PNZA 5JEAB 1UDNA 2PO2B 5C0XE 2WP8A 3DD6A 2NN6D 5JEAD 2BA1G 2WP8B 4BA2A 4OO1A 2BA0G 4BA2B 2BA0D 3CDIA 5C0XF 4AIMA 3M85D 5C0XC 5C0XA 1R6LA 2NN6E 1OYRA 2WNRA 5K36E 5C0XB 2PO0A 2BR2A 4IFDE 2PNZB 2PO0B 2BR2B 4OO1F 3CDJA 1E3PA 2JEBA 3L7ZA 4AIDA 2BA1D 2C38A 3U1KA 3GMEA 4OO1C 3L7ZB 4BA1A 2C38B 5K36F 4OO1B 2C37A 3M7NG 5K36C
chains in the Genus database with same CATH superfamily
4MU4A 1XHKA 1N34E 1Z0CA 4IFDA 2GS8A 1S16A 4JI5E 1Z0VA 1N32I 4FN5A 4DUZI 2JE6A 2C39A 4DU7A 3LTOA 4PU9A 4FW7A 2PO1A 2JEBB 2CG9A 1PIEA 2F1DA 4DV0I 2PO1B 2NN6F 3H4LA 3P76A 5IWAE 2O1WA 3J81C 1XNQI 2PNLA 4B3TI 2UXDE 4USKA 3P3GA 4YY3E 3J80C 4LF8E 4QNJA 4DV3I 1N0VC 4LF9I 4OKGA 2Z5CA 3T1HI 4DR1I 3V5RA 2X7IA 3PS2A 3P3EA 4DV4E 4FWDA 4DPUA 4JI6I 4KHPI 4KQVA 4DV6I 2EFGA 3HKMA 5L3JA 3QT5A 4DV7I 1K47A 4DV2E 1NZ0A 4LFAE 4FW9A 1KVKA 4WUCA 4YHHE 5FWKA 2NN6D 2Z5EA 3HULA 3QT8A 1N32E 2ZBKB 2VQEE 2F4VI 1ELOA 4BA2A 4OO1A 2ZM6E 2AE8A 2UU9I 2UXCE 2CGEA 4BA2B 1N36I 4QNKA 3ZZ0A 1IBMI 5LL6R 1NHHA 4IZJD 3GONA 1P42A 3Q6MA 3J80Q 3PYGA 1XNQE 4DR7E 4LF4E 1R6LA 1OYRA 3J7AG 4K0KI 4IFDE 2PNZB 5LMUI 1EA6A 2O3ZA 5DNLA 3U1KA 3T1HE 4USMA 4MU3A 4MYTA 4DR1E 4DR4I 3K85A 4JV5E 4DR2I 4LF6I 3T1YI 1HNZI 3HJCA 3ZKBA 4B3SE 5K36C 4UTGA 4LFCI 5K36A 2DEJA 4JI1I 1N0UA 3ZM7A 4DPTA 1H74A 3UHMA 5K36B 2E1RA 1XMQI 4U3DA 1HNWE 2WNRB 1DARA 1OYPA 1Z0EA 4DPXA 1FKAE 3PYDA 3H1CA 2VQFI 5LMNI 3PS1A 1XMOI 4DPWA 3JAMC 1ZM4A 1IBKE 1N33I 1A6FA 4OX9I 4BA1B 2UU9E 3WU6A 1N36E 5BR8E 4Z7YA 1XXEA 4P7AA 2IESA 2XEXA 2R3VA 2PO2A 2BM0A 4X65I 2JEAA 1OYSA 4MDTA 4DR6E 4IFDC 4JI8I 4NXNI 4DPYA 5A2QC 2JEAB 4HXZA 4X66I 4IFDB 4X62E 3GCMA 4IFDD 2X36A 1B63A 2IOPA 1RREA 1UEKA 2JE6B 4B3MI 2C39B 3J7AM 4DU8A 4OO1E 1KKHA 3ZZTA 1KIJA 4GKJI 4DUYI 3WU3A 1IBLE 4JI0E 4DR2E 1HNXE 2VESA 2E5LE 4LPFA 4LFCE 1UDNA 3V2UC 1ZXMA 3D4JA 3DD6A 4WUDA 2R42A 1J5EE 4IS9A 2HHHE 3LNUA 4LCGA 4Z7CA 3NZKA 2Z5CB 1XNRI 3LPSA 3JAMQ 2BA0G 2NPFA 2VQFE 2J65A 4JI7E 5LMNE 5DRPA 4X64I 2IOQA 2CVEA 2GO4A 4AIMA 1I94I 4JYAI 4LF7E 5EL9A 4LFBE 5C0XC 5C0XA 5A2QQ 4DR5I 4DV5E 5K36E 4MYUA 1XMOE 4MU1A 2PO0A 1VISA 5C0XB 2BR2A 5IT9Q 5ELWA 4J3DA 2PO0B 2BR2B 4GKKI 4IZKA 3L7ZA 1QZRA 1H7SA 4AQYI 4IZKB 2C38A 4JI3I 4OO1C 2UXBI 3L7ZB 4DUZE 2C38B 4HY1A 1NHIA 5K36F 4OO1B 4B3ME 2BM1A 4NXMI 2C37A 2UUBI 1HR0I 4JI2I 2NN6A 4DV0E 1FJGI 2O1VA 4B3TE 2BV3A 1FWKA 2VF3A 2A2DA 3F0NA 4DV3E 1FWLA 3QT6A 2A2CA 3OTOI 4LF9E 2Z5BA 2UUCI 4FW5A 1H73A 2O1UA 4IFDF 4JI6E 1EI1A 4DV6E 4JI5I 4KHPE 5JEAA 1ZM3A 1Y5YA 1H72C 1I94E 4FW4A 4JYAE 2OI2A 4DV7E 3K1JA 4GQUA 1E3HA 5K36D 2V8PA 1FI4A 4LF5I 4R1FA 4B3RI 4DR3I 2O1TA 5IWAI 1USUA 3GLLA 3KRNA 4N3OA 1Y4UA 4ZVIA 2F4VE 4LF8I 1S4EA 1NHJA 2LJPA 4HACA 1IBME 4HACB 4FW6A 1HR0E 4PRVA 5DRQA 2PO2B 5C0XE 4HYMA 5IT9C 1Z5CA 3B82A 4K0KE 1PKPA 5DROA 1VI7A 5GMDA 1MG7A 3PYEA 3K17A 5LMUE 4DXLA 4LFAI 5C0XF 1U2RA 1HK7A 1Z5BA 4UT4A 2PNMA 4DR4E 5EKWA 4YHHI 3M85D 4LF6E 2UUCE 3T1YE 1HNZE 3Q1QA 2NN6E 1Z0TA 5FLXC 3CWVA 2UUAI 2VQEI 4JI1E 3Q6NA 2ZM6I 2ZITA 2UXCI 2GO3A 4U3BA 1MX0A 4OO1F 3CDJA 1XMQE 2JEBA 4AIDA 4MQYA 3PS3A 3ZZUA 2BA1D 4LF5E 4B3RE 4DR3E 4DR7I 4LF4I 2HKEA 4P52A 1MU5A 1ZM9A 1YHCA 1N33E 1UDSA 4OX9E 4ED4A 2CZ9A 1Y60A 5JEAE 1Z59A 4X65E 5DRRA 2DEIA 5GMEA 3PRYA 4JI8E 3WU5A 5C0XD 4NXNE 4JV5I 3QT7A 1BKNA 4X66E 4B3SI 4XTJA 2V2ZA 5JEAF 1KTVA 2J7KA 2V2VA 4DV1I 2NN6C 4AM3A 4OO1D 1HNWI 1H7UA 4NBQA 3M7ND 2GQ0A 2C37B 4GKJE 4LCFA 2V34A 4FW3A 2AJ4A 4URLA 2NN6B 5FLXQ 4DUYE 4PRXA 4RPFA 1UDQA 4I3HA 4LOMA 2IERA 4M1KA 4JI4I 1YH8A 2UUAE 3B78A 1IBKI 4OZEA 1PVGA 4FWGA 3ZKDA 4IZJA 2HKJA 1ZM2A 1Y4SA 3B4TA 1UDOA 5BR8I 3M6AA 4IZJB 3J81Q 1N34I 4DR6I 2WW4A 2Z5BB 1XNRE 3M85G 1R6MA 2HK3A 5DNXA 3B8HA 5JEAC 4X62I 2PNZA 4X64E 5JEAB 1Z0BA 3WU4A 2WP8A 2HFUA 5JEAD 4DR5E 2BA1G 2WP8B 1Z0GA 1USVA 1B62A 1IBLI 2HFSA 4EMDA 1FNMA 4JI0I 4GKKE 1Z5AA 2UXDI 1Z0WA 2JT2A 1HNXI 2BA0D 3CDIA 4YY3I 4AQYE 4JI3E 1RHYA 2E5LI 2UXBE 4WUBA 2HK2A 1WUUA 1J5EI 4NXME 2WNRA 2HHHI 2UUBE 4DV1E 4JI2E 1FJGE 4LCHA 3P3CA 4DV4I 4FWHA 1OJ4A 1E3PA 1Y6ZA 1RR9A 4JI7I 4ISAA 2Q2EB 1ZXNA 3P06A 3GMEA 4JI4E 4BA1A 4MU0A 3PYFA 4LF7I 4DV2I 4LFBI 4JG4A 2V2QA 4DV5I 3OTOE 3M7NG 3U1YA 1D6TA
chains in the Genus database with same CATH topology
2NN6A 5K36A 4IFDA 5K36B 1UDSA 5JEAE 2WNRB 1OYPA 2JE6A 5C0XD 2C39A 3H1CA 2PO1A 2JEBB 2PO1B 2NN6F 5JEAF 4BA1B 4IFDF 4AM3A 2NN6C 4OO1D 5JEAA 4NBQA 3M7ND 2C37B 2PO2A 2JEAA 4IFDC 1OYSA 2NN6B 1UDQA 2JEAB 1E3HA 4IFDB 3GCMA 5K36D 4IFDD 2JE6B 2C39B 3B4TA 1UDOA 3GLLA 3KRNA 4OO1E 3HKMA 3M85G 1R6MA 5JEAC 2PNZA 5JEAB 1UDNA 2PO2B 5C0XE 2WP8A 3DD6A 2NN6D 5JEAD 2BA1G 2WP8B 4BA2A 4OO1A 2BA0G 4BA2B 2BA0D 3CDIA 5C0XF 4AIMA 3M85D 5C0XC 5C0XA 1R6LA 2NN6E 1OYRA 2WNRA 5K36E 5C0XB 2PO0A 2BR2A 4IFDE 2PNZB 2PO0B 2BR2B 4OO1F 3CDJA 1E3PA 2JEBA 3L7ZA 4AIDA 2BA1D 2C38A 3U1KA 3GMEA 4OO1C 3L7ZB 4BA1A 2C38B 5K36F 4OO1B 2C37A 3M7NG 5K36C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 A;  5K36 A;  4IFD A;  5K36 B;  1UDS A;  5JEA E;  2WNR B;  1OYP A;  2JE6 A;  5C0X D;  2C39 A;  3H1C A;  2PO1 A;  2JEB B;  2PO1 B;  2NN6 F;  5JEA F;  4BA1 B;  4IFD F;  4AM3 A;  2NN6 C;  4OO1 D;  5JEA A;  4NBQ A;  3M7N D;  2C37 B;  2PO2 A;  2JEA A;  4IFD C;  1OYS A;  2NN6 B;  1UDQ A;  2JEA B;  1E3H A;  4IFD B;  3GCM A;  5K36 D;  4IFD D;  2JE6 B;  2C39 B;  3B4T A;  1UDO A;  3GLL A;  3KRN A;  4OO1 E;  3HKM A;  3M85 G;  1R6M A;  5JEA C;  2PNZ A;  5JEA B;  1UDN A;  2PO2 B;  5C0X E;  2WP8 A;  3DD6 A;  2NN6 D;  5JEA D;  2BA1 G;  2WP8 B;  4BA2 A;  4OO1 A;  2BA0 G;  4BA2 B;  2BA0 D;  3CDI A;  5C0X F;  4AIM A;  3M85 D;  5C0X C;  5C0X A;  1R6L A;  2NN6 E;  1OYR A;  2WNR A;  5K36 E;  5C0X B;  2PO0 A;  2BR2 A;  4IFD E;  2PNZ B;  2PO0 B;  2BR2 B;  4OO1 F;  3CDJ A;  1E3P A;  2JEB A;  3L7Z A;  4AID A;  2BA1 D;  2C38 A;  3U1K A;  3GME A;  4OO1 C;  3L7Z B;  4BA1 A;  2C38 B;  5K36 F;  4OO1 B;  2C37 A;  3M7N G;  5K36 C; 
#chains in the Genus database with same CATH topology
 4MU4 A;  1XHK A;  1N34 E;  1Z0C A;  4IFD A;  2GS8 A;  1S16 A;  4JI5 E;  1Z0V A;  1N32 I;  4FN5 A;  4DUZ I;  2JE6 A;  2C39 A;  4DU7 A;  3LTO A;  4PU9 A;  4FW7 A;  2PO1 A;  2JEB B;  2CG9 A;  1PIE A;  2F1D A;  4DV0 I;  2PO1 B;  2NN6 F;  3H4L A;  3P76 A;  5IWA E;  2O1W A;  3J81 C;  1XNQ I;  2PNL A;  4B3T I;  2UXD E;  4USK A;  3P3G A;  4YY3 E;  3J80 C;  4LF8 E;  4QNJ A;  4DV3 I;  1N0V C;  4LF9 I;  4OKG A;  2Z5C A;  3T1H I;  4DR1 I;  3V5R A;  2X7I A;  3PS2 A;  3P3E A;  4DV4 E;  4FWD A;  4DPU A;  4JI6 I;  4KHP I;  4KQV A;  4DV6 I;  2EFG A;  3HKM A;  5L3J A;  3QT5 A;  4DV7 I;  1K47 A;  4DV2 E;  1NZ0 A;  4LFA E;  4FW9 A;  1KVK A;  4WUC A;  4YHH E;  5FWK A;  2NN6 D;  2Z5E A;  3HUL A;  3QT8 A;  1N32 E;  2ZBK B;  2VQE E;  2F4V I;  1ELO A;  4BA2 A;  4OO1 A;  2ZM6 E;  2AE8 A;  2UU9 I;  2UXC E;  2CGE A;  4BA2 B;  1N36 I;  4QNK A;  3ZZ0 A;  1IBM I;  5LL6 R;  1NHH A;  4IZJ D;  3GON A;  1P42 A;  3Q6M A;  3J80 Q;  3PYG A;  1XNQ E;  4DR7 E;  4LF4 E;  1R6L A;  1OYR A;  3J7A G;  4K0K I;  4IFD E;  2PNZ B;  5LMU I;  1EA6 A;  2O3Z A;  5DNL A;  3U1K A;  3T1H E;  4USM A;  4MU3 A;  4MYT A;  4DR1 E;  4DR4 I;  3K85 A;  4JV5 E;  4DR2 I;  4LF6 I;  3T1Y I;  1HNZ I;  3HJC A;  3ZKB A;  4B3S E;  5K36 C;  4UTG A;  4LFC I;  5K36 A;  2DEJ A;  4JI1 I;  1N0U A;  3ZM7 A;  4DPT A;  1H74 A;  3UHM A;  5K36 B;  2E1R A;  1XMQ I;  4U3D A;  1HNW E;  2WNR B;  1DAR A;  1OYP A;  1Z0E A;  4DPX A;  1FKA E;  3PYD A;  3H1C A;  2VQF I;  5LMN I;  3PS1 A;  1XMO I;  4DPW A;  3JAM C;  1ZM4 A;  1IBK E;  1N33 I;  1A6F A;  4OX9 I;  4BA1 B;  2UU9 E;  3WU6 A;  1N36 E;  5BR8 E;  4Z7Y A;  1XXE A;  4P7A A;  2IES A;  2XEX A;  2R3V A;  2PO2 A;  2BM0 A;  4X65 I;  2JEA A;  1OYS A;  4MDT A;  4DR6 E;  4IFD C;  4JI8 I;  4NXN I;  4DPY A;  5A2Q C;  2JEA B;  4HXZ A;  4X66 I;  4IFD B;  4X62 E;  3GCM A;  4IFD D;  2X36 A;  1B63 A;  2IOP A;  1RRE A;  1UEK A;  2JE6 B;  4B3M I;  2C39 B;  3J7A M;  4DU8 A;  4OO1 E;  1KKH A;  3ZZT A;  1KIJ A;  4GKJ I;  4DUY I;  3WU3 A;  1IBL E;  4JI0 E;  4DR2 E;  1HNX E;  2VES A;  2E5L E;  4LPF A;  4LFC E;  1UDN A;  3V2U C;  1ZXM A;  3D4J A;  3DD6 A;  4WUD A;  2R42 A;  1J5E E;  4IS9 A;  2HHH E;  3LNU A;  4LCG A;  4Z7C A;  3NZK A;  2Z5C B;  1XNR I;  3LPS A;  3JAM Q;  2BA0 G;  2NPF A;  2VQF E;  2J65 A;  4JI7 E;  5LMN E;  5DRP A;  4X64 I;  2IOQ A;  2CVE A;  2GO4 A;  4AIM A;  1I94 I;  4JYA I;  4LF7 E;  5EL9 A;  4LFB E;  5C0X C;  5C0X A;  5A2Q Q;  4DR5 I;  4DV5 E;  5K36 E;  4MYU A;  1XMO E;  4MU1 A;  2PO0 A;  1VIS A;  5C0X B;  2BR2 A;  5IT9 Q;  5ELW A;  4J3D A;  2PO0 B;  2BR2 B;  4GKK I;  4IZK A;  3L7Z A;  1QZR A;  1H7S A;  4AQY I;  4IZK B;  2C38 A;  4JI3 I;  4OO1 C;  2UXB I;  3L7Z B;  4DUZ E;  2C38 B;  4HY1 A;  1NHI A;  5K36 F;  4OO1 B;  4B3M E;  2BM1 A;  4NXM I;  2C37 A;  2UUB I;  1HR0 I;  4JI2 I;  2NN6 A;  4DV0 E;  1FJG I;  2O1V A;  4B3T E;  2BV3 A;  1FWK A;  2VF3 A;  2A2D A;  3F0N A;  4DV3 E;  1FWL A;  3QT6 A;  2A2C A;  3OTO I;  4LF9 E;  2Z5B A;  2UUC I;  4FW5 A;  1H73 A;  2O1U A;  4IFD F;  4JI6 E;  1EI1 A;  4DV6 E;  4JI5 I;  4KHP E;  5JEA A;  1ZM3 A;  1Y5Y A;  1H72 C;  1I94 E;  4FW4 A;  4JYA E;  2OI2 A;  4DV7 E;  3K1J A;  4GQU A;  1E3H A;  5K36 D;  2V8P A;  1FI4 A;  4LF5 I;  4R1F A;  4B3R I;  4DR3 I;  2O1T A;  5IWA I;  1USU A;  3GLL A;  3KRN A;  4N3O A;  1Y4U A;  4ZVI A;  2F4V E;  4LF8 I;  1S4E A;  1NHJ A;  2LJP A;  4HAC A;  1IBM E;  4HAC B;  4FW6 A;  1HR0 E;  4PRV A;  5DRQ A;  2PO2 B;  5C0X E;  4HYM A;  5IT9 C;  1Z5C A;  3B82 A;  4K0K E;  1PKP A;  5DRO A;  1VI7 A;  5GMD A;  1MG7 A;  3PYE A;  3K17 A;  5LMU E;  4DXL A;  4LFA I;  5C0X F;  1U2R A;  1HK7 A;  1Z5B A;  4UT4 A;  2PNM A;  4DR4 E;  5EKW A;  4YHH I;  3M85 D;  4LF6 E;  2UUC E;  3T1Y E;  1HNZ E;  3Q1Q A;  2NN6 E;  1Z0T A;  5FLX C;  3CWV A;  2UUA I;  2VQE I;  4JI1 E;  3Q6N A;  2ZM6 I;  2ZIT A;  2UXC I;  2GO3 A;  4U3B A;  1MX0 A;  4OO1 F;  3CDJ A;  1XMQ E;  2JEB A;  4AID A;  4MQY A;  3PS3 A;  3ZZU A;  2BA1 D;  4LF5 E;  4B3R E;  4DR3 E;  4DR7 I;  4LF4 I;  2HKE A;  4P52 A;  1MU5 A;  1ZM9 A;  1YHC A;  1N33 E;  1UDS A;  4OX9 E;  4ED4 A;  2CZ9 A;  1Y60 A;  5JEA E;  1Z59 A;  4X65 E;  5DRR A;  2DEI A;  5GME A;  3PRY A;  4JI8 E;  3WU5 A;  5C0X D;  4NXN E;  4JV5 I;  3QT7 A;  1BKN A;  4X66 E;  4B3S I;  4XTJ A;  2V2Z A;  5JEA F;  1KTV A;  2J7K A;  2V2V A;  4DV1 I;  2NN6 C;  4AM3 A;  4OO1 D;  1HNW I;  1H7U A;  4NBQ A;  3M7N D;  2GQ0 A;  2C37 B;  4GKJ E;  4LCF A;  2V34 A;  4FW3 A;  2AJ4 A;  4URL A;  2NN6 B;  5FLX Q;  4DUY E;  4PRX A;  4RPF A;  1UDQ A;  4I3H A;  4LOM A;  2IER A;  4M1K A;  4JI4 I;  1YH8 A;  2UUA E;  3B78 A;  1IBK I;  4OZE A;  1PVG A;  4FWG A;  3ZKD A;  4IZJ A;  2HKJ A;  1ZM2 A;  1Y4S A;  3B4T A;  1UDO A;  5BR8 I;  3M6A A;  4IZJ B;  3J81 Q;  1N34 I;  4DR6 I;  2WW4 A;  2Z5B B;  1XNR E;  3M85 G;  1R6M A;  2HK3 A;  5DNX A;  3B8H A;  5JEA C;  4X62 I;  2PNZ A;  4X64 E;  5JEA B;  1Z0B A;  3WU4 A;  2WP8 A;  2HFU A;  5JEA D;  4DR5 E;  2BA1 G;  2WP8 B;  1Z0G A;  1USV A;  1B62 A;  1IBL I;  2HFS A;  4EMD A;  1FNM A;  4JI0 I;  4GKK E;  1Z5A A;  2UXD I;  1Z0W A;  2JT2 A;  1HNX I;  2BA0 D;  3CDI A;  4YY3 I;  4AQY E;  4JI3 E;  1RHY A;  2E5L I;  2UXB E;  4WUB A;  2HK2 A;  1WUU A;  1J5E I;  4NXM E;  2WNR A;  2HHH I;  2UUB E;  4DV1 E;  4JI2 E;  1FJG E;  4LCH A;  3P3C A;  4DV4 I;  4FWH A;  1OJ4 A;  1E3P A;  1Y6Z A;  1RR9 A;  4JI7 I;  4ISA A;  2Q2E B;  1ZXN A;  3P06 A;  3GME A;  4JI4 E;  4BA1 A;  4MU0 A;  3PYF A;  4LF7 I;  4DV2 I;  4LFB I;  4JG4 A;  2V2Q A;  4DV5 I;  3OTO E;  3M7N G;  3U1Y A;  1D6T A; 
#chains in the Genus database with same CATH homology
 2NN6 A;  5K36 A;  4IFD A;  5K36 B;  1UDS A;  5JEA E;  2WNR B;  1OYP A;  2JE6 A;  5C0X D;  2C39 A;  3H1C A;  2PO1 A;  2JEB B;  2PO1 B;  2NN6 F;  5JEA F;  4BA1 B;  4IFD F;  4AM3 A;  2NN6 C;  4OO1 D;  5JEA A;  4NBQ A;  3M7N D;  2C37 B;  2PO2 A;  2JEA A;  4IFD C;  1OYS A;  2NN6 B;  1UDQ A;  2JEA B;  1E3H A;  4IFD B;  3GCM A;  5K36 D;  4IFD D;  2JE6 B;  2C39 B;  3B4T A;  1UDO A;  3GLL A;  3KRN A;  4OO1 E;  3HKM A;  3M85 G;  1R6M A;  5JEA C;  2PNZ A;  5JEA B;  1UDN A;  2PO2 B;  5C0X E;  2WP8 A;  3DD6 A;  2NN6 D;  5JEA D;  2BA1 G;  2WP8 B;  4BA2 A;  4OO1 A;  2BA0 G;  4BA2 B;  2BA0 D;  3CDI A;  5C0X F;  4AIM A;  3M85 D;  5C0X C;  5C0X A;  1R6L A;  2NN6 E;  1OYR A;  2WNR A;  5K36 E;  5C0X B;  2PO0 A;  2BR2 A;  4IFD E;  2PNZ B;  2PO0 B;  2BR2 B;  4OO1 F;  3CDJ A;  1E3P A;  2JEB A;  3L7Z A;  4AID A;  2BA1 D;  2C38 A;  3U1K A;  3GME A;  4OO1 C;  3L7Z B;  4BA1 A;  2C38 B;  5K36 F;  4OO1 B;  2C37 A;  3M7N G;  5K36 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...