1IBME

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ibmE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibmE02
3LPSA 3JAMQ 2LTRA 4K0KE 1YYOA 4P52A 1H72C 1H74A 1Z0BA 4DR2E 1H7UA 4DXLA 4GKKI 1T4OA 2LBSB 2BM0A 4DV5I 4URLA 4DR7E 1KVKA 1UEKA 4LF5E 4ZVIA 4JI1I 2HKEA 2N3HA 4LF4I 1RC7A 4DR6I 4JI2I 3F0NA 2RS6A 1WUUA 5FLXQ 2VQEE 4HXZA 2CPNA 1Z5BA 5LMUI 2ZITA 3T1HI 4DV0I 4KHPI 5IWAE 4DR4I 1HR0I 4OOGC 3ZKDA 4MYUA 4LFAI 4JI5I 2XEXA 4DV5E 4GKJE 3OTOI 1XNQI 1HNWI 4JI1E 2Q2EB 3WU3A 3J81C 2RS7A 4JI2E 4DPYA 3HTXA 1DARA 1N36E 1ZM4A 4I3HA 2E5LE 4P7AA 5CFFE 1B63A 1MG7A 4DR4E 2AJ4A 1WHNA 4LFAE 4JI8E 1ZM3A 2F4VE 4DV3I 1Z0GA 1Z0CA 3ADJA 2ZM6E 1HNWE 4YHHE 3PYGA 4LF8I 4JI0I 2L2KB 2E1RA 4PU9A 3ADGA 4AQYI 3VYXA 3PYDA 5LL6R 1PKPA 1N32I 1ZXNA 4DPTA 1XMQI 4HACB 2RSMA 3WU6A 2OI2A 1STUA 4LF9I 2J7KA 1I94I 2L3JA 2WW4A 2UXDI 1ZM2A 2DMYA 1RQ0A 4JYAE 1NHHA 4LF8E 5IT9C 4JI0E 2V8PA 1H7SA 4DU7A 2X36A 2A2CA 4B3MI 4LF7E 5BR8I 4PRVA 1N33E 4FWHA 2JVAA 4LF9E 1T4NA 3B78A 2B7TA 2BV3A 4LFBE 4DV6I 4NXMI 2R3VA 4JI3I 4B3TI 4B3RE 1MU5A 4RPFA 3K1JA 3J81Q 3ADIA 1HNZE 4DV1I 4M1KA 1NHJA 4UT4A 2IHR1 1WHQA 4JI7E 1Z0WA 1IBMI 1EA6A 1NZ0A 4YY3I 4B3SI 2NUFA 4LF6E 2L3CA 4MYTA 2NPFA 4JV5I 3JAMC 4DV6E 4KQVA 1UILA 1U2RA 4R1FA 5A2QC 2LRSA 3QT5A 2VQFI 1IBLI 1XMOI 3ZM7A 4DR3I 1QZRA 1XNRI 4DUZI 1KTVA 1K47A 4GKKE 2LJPA 2DIXA 2L2MA 4YY3E 4B3SE 2UUCI 1T4LB 2V2ZA 1OJ4A 3PYEA 3CWVA 4JV5E 2UUAI 2UXCI 1Z0TA 4LF4E 3T1YI 4DR6E 4DPXA 2UUBI 2DEJA 4JG4A 5LMUE 3T1HE 4DV0E 4KHPE 1HR0E 1ZXMA 3M6AA 2UU9I 2HK3A 1X49A 2B3TB 4DUZE 4DU8A 3LLHA 1ZM9A 4JI5E 4X62I 1YZ9A 3OTOE 1XNQE 4DR1I 4NXNI 3T1YE 3QT6A 4DR5I 2HK2A 4DKKA 1ELOA 1HNXI 2NA2A 3GONA 5GMDA 2L33A 4JI4I 4DV3E 2VF3A 1MX0A 1RREA 5IT9Q 5GMEA 1IBKI 1X48A 3J80C 4XTJA 4AQYE 1J5EI 2R42A 1FWKA 2LUPB 1N32E 1BKNA 2L2NA 2UXBI 1XMQE 1HNXE 4JI6I 4PRXA 3ZZTA 1EI1A 2HKJA 3WU5A 4DV4I 4DV7I 1S16A 1I94E 3ADLA 2X7IA 4X66I 3WU4A 4WUBA 2UXDE 4JI4E 4K0KI 2A2DA 1PIEA 4X64I 4ED4A 1S4EA 4FWGA 3J7AG 1D6TA 1FKAE 1EKZA 1QU6A 3J7AM 1KIJA 4DR7I 1Z0EA 4LF5I 4B3ME 3ZKBA 2UXBE 5BR8E 1FWLA 3B8HA 1O0WA 4DV7E 4USKA 1ZBTA 2VQEI 4DV2I 1B62A 4OX9I 4NXME 4JI3E 2NUEA 1Z0VA 4B3TE 4HACA 5IWAI 4X64E 4DPUA 2DEIA 4LFCI 4DV1E 5A2QQ 4USMA 1FJGI 4M2ZA 4GKJI 3LNUA 3J7Yp 1IBME 5FLXC 1YYWA 4HY1A 4DUYI 4DV2E 2LTSA 4OX9E 1N36I 3B82A 3VYYA 1VISA 2E5LI 4WYQB 2HFSA 3D4JA 2N3GA 4WUCA 2VQFE 1IBLE 4X8WA 1XMOE 4LFCE 4JI8I 1N34I 4DR3E 4FWDA 2F4VI 1FJGE 1NHIA 1Z5AA 1XNRE 2HHHI 2ZM6I 4YHHI 1PVGA 3V5RA 2DB2A 2UUCE 3C4BA 2EZ6A 4WFTA 4DUYE 2UUAE 2UXCE 2V2VA 4X65I 2CZ9A 3QT7A 5LMNI 2UUBE 3P1XA 3V2UC 2MDRA 3LTOA 3QT8A 4UTGA 2LJHA 1N34E 4FW9A 3HULA 3ZZUA 1UHZA 2UU9E 2HHHE 4JYAI 4X62E 3C4TA 3ZZ0A 1Z5CA 1H73A 1XHKA 4DR1E 4NXNE 4X65E 1J26A 2LUQA 4LF7I 1FNMA 2YT4A 5LMNE 1X47A 1YYKA 4DR5E 4M30A 1N33I 3J80Q 4Z7CA 1A6FA 4LFBI 4HYMA 2ZBKB 4WUDA 1FI4A 2V34A 4EMDA 1RR9A 2GS8A 4B3RI 2NUGA 2B7VA 4FN5A 1HNZI 3H4LA 1KKHA 2V2QA 5L3JA 4DR2I 4JI7I 3Q1QA 2KHXA 1IBKE 4Z7YA 3K17A 4LF6I 1J5EE 4DPWA 2RTXA 2EFGA 2BM1A 4JI6E 1GQEA 1N0VC 2HFUA 4DV4E 3PYFA 1Z59A 2JY9A 1N0UA 1DI2A 4X66E
chains in the Genus database with same CATH superfamily
3LPSA 2VRDA 2LTRA 4K0KE 1SFEA 1R6LA 1YYOA 3JAMQ 1NEIA 4OKGA 4P52A 3C6KA 1DGCA 1H72C 1H74A 2YTPA 2ELYA 2WCC3 2EN3A 1Z0BA 2EMWA 4DR2E 4IZJA 2EN2A 1H7UA 4DXLA 1SR9A 4GKKI 4TUGA 2EN4A 2EM5A 1T4OA 2LBSB 2BM0A 4DV5I 4O4KA 2M7QA 2MC6A 2ODRD 4DR7E 4URLA 1KVKA 1UEKA 4IFDE 4LF5E 1P42A 2EM0A 4ZVIA 4JI1I 3K85A 1AAYA 1EH6A 3VK6A 2HKEA 4LU9A 2N3HA 1RHYA 4LF4I 2PNMA 1RC7A 4DR6I 4JI2I 1PDAA 3F0NA 2RS6A 1WUUA 5FLXQ 2LV2A 2RSIA 2VQEE 2YU8A 4HXZA 4AM3A 2CPNA 1Z5BA 2J7JA 1VI7A 1BBGA 2JR1A 4M9VC 2ZITA 5LMUI 3T1HI 2UXBI 4DV0I 3HXLA 4KHPI 3PS2A 2YTEA 2V89A 5IWAE 4DR4I 2JP9A 1HR0I 2FGGA 2EPLX 2BR2A 4OOGC 4R2SA 2PNZA 3ZKDA 4MYUA 2C39A 4OO1C 4LFAI 2EOXA 5JEAC 2EOHA 2YTDA 4JI5I 2EP3A 3MSWA 5C0XB 2XEXA 4DV5E 4GKJE 3OTOI 4KWYA 5A6AA 1XNQI 5C0XF 1HNWI 4NHRA 4JI1E 2NN6B 2WBSA 2Q2EB 3WU3A 3J81C 2EM7A 3BF2A 3GMEA 2LMZA 5DRQA 3Q6MA 4OO1A 5JEAA 3L00A 2I9IA 2EE8A 2RS7A 4JI2E 4DPYA 2O3ZA 3MHHC 3UK3C 2PO0A 4MU0A 3HTXA 4BS9A 3FIGA 2DMIA 2C38B 1DARA 1N36E 5A6BD 4M0VA 2EMKA 2WBTA 2BA1G 2V88A 1ZM4A 4I3HA 2E5LE 4P7AA 5CFFE 5IV8B 4X9JA 1B63A 1MG7A 2EWLA 4DR4E 1Y5YA 4BMJA 3HPZA 1XXEA 2AJ4A 1WHNA 3HQ1A 4L5NC 4LFAE 4JI8E 1UDSA 4IFDC 2JWOA 1ZM3A 2F4VE 3QG5C 5KL5A 4F6MA 1Z0GA 2EMIA 1Z0CA 4NBQA 4DV3I 1MEYC 3ADJA 2ZM6E 1HNWE 4AIDA 5AE2A 3ECRA 4YHHE 1P47A 2YPNA 2V86A 1A1GA 3PYGA 1T38A 4LF8I 3M7ND 4JI0I 5KL6A 2L2KB 2E1RA 4IFDA 5AE3A 2V8QB 3ADGA 4PU9A 4AQYI 3VYXA 3PYDA 5LL6R 4MQYA 1PKPA 1USUA 1N32I 1ZXNA 4BCAA 3P76A 4DPTA 4HACB 2RSMA 1XMQI 3WU6A 2CTDA 2GQ0A 1STUA 2OI2A 1E3HA 2F1DA 4MDTA 1A1IA 4GQUA 2EOYA 2VF1A 1WJPA 3BGHA 4LF9I 1QNTA 2J7KA 2JOXA 1I94I 2IERA 3OMLA 2YTQA 2CT1A 2L3JA 2GHFA 2R1FA 5T6JA 2LO3A 2PO2B 2JXPA 2YTGA 2WW4A 2UXDI 1UDNA 1Y4SA 1ZM2A 4IFDD 2DMYA 2EPCA 4FW4A 1A1LA 1RQ0A 4JYAE 1NHHA 4LF8E 5IT9C 2EPMX 4WSGA 4JI0E 3C6MA 2V8PA 4KZSA 1H7SA 4R2DA 2EN7A 4DU7A 2L92A 2DLQA 2X36A 4L8NA 1IQSA 5C0XD 4BC9A 2ENCA 2A2CA 2IOPA 5AC5A 5ELWA 4B3MI 4LF7E 2JE6B 2YTFA 5BR8I 2EPNA 3IWCA 4PRVA 1N33E 4FWHA 1IMUA 2ENHA 3PS3A 2JVAA 4LF9E 1T4NA 3B78A 3ZOQB 2LT7A 2C39B 3CDJA 4ZYGA 4R03A 2B9DA 2B7TA 2BV3A 2ENAA 1AH5A 4LFBE 4DV6I 2EJ4A 4NXMI 2R3VA 3U1YA 4JI3I 1G2FC 4B3TI 2KONA 4WXDA 1JK2A 4B3RE 1G2DC 3L7ZA 2YTNA 2MDGA 1MU5A 4OZEA 1KYQA 2EMZA 2YTJA 3AV0A 3ADIA 3K1JA 4RPFA 1HNZE 3J81Q 4DV1I 5DRRA 2EMFA 4M1KA 4IS1C 4R2AA 1NHJA 4UT4A 4J8ZA 4OO1F 5JEAF 2IHR1 4R8OA 4R2QA 1WHQA 4JI7E 5AASA 1IQOA 1Z0WA 1IBMI 1Y4UA 1EA6A 1NZ0A 2JEBA 5A69A 4AIMA 4YY3I 4B3SI 5FWKA 3NZKA 2WP8B 2EPOA 2NUFA 5KL2A 4ZYDA 2L3CA 2EOIA 4LF6E 4N4RB 3VHTB 1OYRA 4MYTA 2NPFA 2HC5A 4Q28A 3JAMC 4JV5I 5K36E 4LCFA 4DV6E 5EL9A 4KQVA 4BA1A 1UILA 3HPSA 1BB8A 3EPJA 1U2RA 2H36X 1TN9A 4R1FA 2O1WA 5A2QC 2LRSA 3QT5A 4R2PA 2VQFI 1IBLI 1XMOI 4IFDB 2V83A 4HEIA 4LOMA 3ZM7A 2NABA 4DR3I 4F9BB 1X6HA 1QZRA 4IFDF 1NCSA 2FTXB 1R6MA 4DUZI 4MU3A 1XNRI 1KTVA 5DNLA 1K47A 2YSPA 4GKKE 3DD6A 2EM9A 3IWBA 2LJPA 2DIXA 2CSHA 2L2MA 4YY3E 2HJJA 4MU4A 4B3SE 2Z5CA 2UUCI 1T4LB 2V2ZA 1OJ4A 3PYEA 1GZ6A 3CWVA 5IXMB 4JV5E 5A6JA 2UUAI 2UXCI 1USVA 2Z5BB 5DNXA 1Z0TA 3TQMA 4BHCA 4LF4E 3HKMA 3T1YI 4DR6E 3RMPA 5KL4A 3EPKA 4DPXA 2NN6E 2JEAB 2UUBI 2YSOA 2EM2A 4RHBB 2DEJA 4JG4A 5LMUE 2EPAA 3T1HE 2BA1D 1A1JA 4BA2A 1E3PA 4DV0E 4R2RA 4KHPE 2EM6A 3MHSC 2R76A 3M85G 3M85D 2O1VA 1A1HA 1HR0E 1ZXMA 4Q35B 5F3WA 3M6AA 2UU9I 2PO1B 2HK3A 1X49A 2B3TB 4DUZE 1B69A 1TF3A 4DU8A 3LLHA 5KL3A 1ZM9A 4QNKA 4JI5E 4X62I 2EN1A 5K36C 4OO1D 1YZ9A 5JEAD 4WXCA 3OTOE 1XNQE 4QNJA 1YSAC 2JPAA 2V85A 4DR1I 4F54A 4NXNI 2MKDA 1Y6ZA 2D9HA 3IWDA 4LCGA 3T1YE 2L6MA 2JOBA 2EMBA 2EN8A 5K36A 5A6KA 3QT6A 4DR5I 2WNRA 2HK2A 3DJWA 2EOEA 1JK1A 1WRJA 4FW7A 2EOJA 2EORA 4DKKA 1ELOA 1HNXI 1YPNA 2EMXA 2NA2A 4P78A 3GONA 3PRYA 5GMDA 2EOSA 2L33A 1DQ3A 4JI4I 4DV3E 1BBOA 1YH8A 2VF3A 1MX0A 1GTKA 3P3GA 2EMLA 1RREA 2NN6C 2K4VA 1N3GA 2EPKX 2EMYA 2O1UA 5IT9Q 2AE8A 3F6GA 5GMEA 2DSYA 1IBKI 1X48A 2EM8A 3J80C 4XTJA 4AQYE 1ZU1A 1J5EI 2R42A 1FWKA 2LUPB 4WPYA 1N32E 2L2NA 1BKNA 1XMQE 1YUIA 2NN6A 1HNXE 4N3OA 3U1KA 4PRXA 4JI6I 3ZZTA 4ZYEA 1EI1A 2BR2B 2HKJA 5EKWA 3WU5A 4DV4I 4DV7I 2PNZB 2E72A 1S16A 1I94E 2C37A 3ADLA 4F2JC 3F6HA 1UBDC 2X7IA 4X66I 3WU4A 2EPPA 2C38A 2UXDE 4JI4E 4WUBA 4K0KI 4RH8A 4ZYHA 2A2DA 1HK7A 5AC4A 1PIEA 3M99B 4X64I 2EOZA 4ED4A 1S4EA 2EOMA 4FWGA 3J7AG 4F9CB 4OO1B 2KOUA 1FKAE 3KZYA 1EKZA 2GLIA 1Y60A 2IESA 5DRPA 1QU6A 5JEAB 5ADZA 1KJKA 2ODRC 3GLLA 2PO0B 3J7AM 1KIJA 5KL7A 4DR7I 1Z0EA 4LF5I 4B3ME 3ZKBA 3AUZA 2UXBE 5BR8E 1FWLA 2VE7C 2EN6A 3B8HA 4FW3A 1O0WA 4DV7E 4USKA 1ZBTA 2EQ1A 5LLQA 2VQEI 2N8XA 4DV2I 1B62A 4OX9I 1L4SA 2GO3A 2BA0G 2BA0D 4NXME 2F8BA 4JI3E 2NUEA 1UDOA 4B3TE 1Z0VA 4R2CA 4HACA 5IWAI 4X64E 2YZTA 2GPIA 4DPUA 4F9AB 2DEIA 4BHBA 4IZKA 3P3CA 2LJUA 4LFCI 4DV1E 2EL5A 5A2QQ 2Q8UA 4USMA 5K36B 1A1FA 4FW5A 1EH8A 2EOFA 4O43A 2WNRB 2PO2A 4M2ZA 3Q6NA 2WBUA 4IZJD 4GKJI 3THOB 1FJGI 2I13A 3LNUA 5K36F 2E1MA 1ZBQA 2EPXA 2YU5A 3THNA 3J7Yp 1IBME 3CDIA 3BBGA 2M4IA 5FLXC 2EMGA 2CG9A 1UDQA 4U3BA 2V87A 4DMIA 1YYWA 4HY1A 4DUYI 4DV2E 2LTSA 3EQ1A 4OX9E 2VESA 5C0XE 2JYAA 1N36I 3B82A 2YRHA 3VYYA 1VISA 2E5LI 4WYQB 2JE6A 4J3DA 4FK5C 2HFSA 1YUJA 2LCEA 3D4JA 5A6BA 2N3GA 4WUCA 2EOOA 2VQFE 1IBLE 2A25A 4X8WA 1XMOE 4LFCE 3KRNA 2EMCA 2YTOA 5DROA 2EQ0A 2YRKA 4JI8I 2DRPA 1N34I 4DR3E 1ZAAC 4FWDA 2F4VI 2MKNA 1FJGE 1NHIA 1Z5AA 2YRMA 2PNLA 1XNRE 2HHHI 2EL6A 4WX9A 1D6TA 2ZM6I 4YHHI 1PVGA 2YWQA 3V5RA 4HTGA 2Z5EA 2DB2A 2EQ3A 2UUCE 3C4BA 2EZ6A 2NN6F 4WFTA 2EMHA 5DNYA 4F6NA 2C37B 4DUYE 1PJSA 3KWRA 2UUAE 2UXCE 4GEQB 1X6FA 2V2VA 2EPUA 2RQLA 2CZ9A 2CGEA 4X65I 2BB8A 1A1KA 4LTYA 3QT7A 5LMNI 3L7ZB 2UUBE 3P1XA 2M9AA 3GCMA 2MDRA 3LTOA 3V2UC 1LLMC 3H09A 2WP8A 3B4TA 3QT8A 3LMLA 4UTGA 4MLQA 2G7HA 2LJHA 2HGHA 1N34E 2EPRA 4FW9A 3HULA 1Z1BA 1PJTA 4U3DA 3ZZUA 4MU1A 1UHZA 2ELZA 2UU9E 2HHHE 2M1SA 2J65A 4BBYA 2L8TA 4MLVA 4JYAI 3M7NG 4X62E 2JEBB 2O1TA 2LVHA 2FV4B 3C4TA 3K6QA 4IZJB 5C0XC 4R2EA 4BC7A 2EMAA 2GO4A 3ZZ0A 3P06A 5K36D 1X3CA 2BBGA 1Z5CA 1H73A 1XHKA 4DR1E 2EOQA 4FW6A 4NXNE 4O5GA 3PS1A 4X65E 4WSPA 1F2IG 1J26A 2LUQA 4LPFA 1FNMA 4LF7I 4BA1B 2YT4A 1EH7A 1YHCA 4NZVA 1X47A 5LMNE 1YYKA 5C0XA 4DR5E 2MC5A 4M30A 1N33I 3J80Q 3DF6A 4IS9A 4Z7CA 2EM3A 2WZOA 4IZKB 2K7IA 3BIDA 3JTZA 1A6FA 3UHMA 2Z5BA 4HYMA 2ZBKB 4WUDA 1FI4A 4LFBI 1WXRA 2V34A 1OYPA 4EMDA 1X6EA 1RR9A 2GS8A 4P7DA 4B3RI 1T39A 4I8OA 1TF6A 2NUGA 2JEAA 2B7VA 3JU0A 2CVEA 2EL4A 4GZNC 2Z5CB 5AE1A 2YTIA 2DLKA 4FN5A 2ADRA 1UN6B 1HNZI 3H4LA 2RPCA 2LE2A 1KKHA 2EM4A 2V2QA 3P3EA 4ISAA 5L3JA 1RMDA 4DR2I 4JI7I 4O24A 2PO1A 3Q1QA 2KHXA 2DGCA 5TSEA 1PJQA 1X5WA 1IBKE 2NN6D 4Z7YA 3EPHA 3K17A 4LCHA 4LF6I 2IOQA 1J5EE 3HJCA 4DPWA 5JEAE 4BA2B 4OO1E 2RTXA 2EPZA 2EFGA 2BM1A 4JI6E 1ZR9A 1GQEA 4IJDA 1N0VC 2HFUA 2JT2A 4DV4E 1OYSA 3PYFA 1MGTA 3H1CA 2PRTA 1Z59A 4TUIA 2JY9A 1N0UA 1DI2A 1YFHA 3KZZA 4X66E 3EPLA
chains in the Genus database with same CATH topology
3LPSA 3JAMQ 2LTRA 4K0KE 1YYOA 4P52A 1H72C 1H74A 1Z0BA 4DR2E 1H7UA 4DXLA 1SR9A 4GKKI 4TUGA 1T4OA 2LBSB 2BM0A 4DV5I 2M7QA 2MC6A 2ODRD 4DR7E 4URLA 1KVKA 1UEKA 4LF5E 4ZVIA 4JI1I 3K85A 3VK6A 2HKEA 4LU9A 2N3HA 4LF4I 2PNMA 1RC7A 4DR6I 4JI2I 3F0NA 2RS6A 1WUUA 5FLXQ 2VQEE 4HXZA 2CPNA 1Z5BA 2JR1A 5LMUI 2ZITA 3T1HI 4DV0I 3HXLA 4KHPI 2V89A 5IWAE 4DR4I 1HR0I 2FGGA 4OOGC 3ZKDA 4MYUA 4LFAI 4JI5I 3MSWA 2XEXA 4DV5E 4GKJE 3OTOI 1XNQI 1HNWI 4JI1E 2Q2EB 3WU3A 2LMZA 3Q6MA 2RS7A 4JI2E 4DPYA 3HTXA 4BS9A 3FIGA 1DARA 1N36E 4M0VA 2V88A 1ZM4A 4I3HA 2E5LE 4P7AA 5CFFE 1B63A 1MG7A 2EWLA 4DR4E 4BMJA 3HPZA 2AJ4A 1WHNA 3HQ1A 4L5NC 4LFAE 4JI8E 2JWOA 1ZM3A 2F4VE 4DV3I 1Z0GA 1Z0CA 3ADJA 2ZM6E 1HNWE 5AE2A 4YHHE 3PYGA 2V86A 4LF8I 4JI0I 2L2KB 2E1RA 5AE3A 2V8QB 3ADGA 4PU9A 4AQYI 3VYXA 3PYDA 5LL6R 1PKPA 1USUA 1N32I 1ZXNA 4BCAA 4DPTA 1XMQI 4HACB 2RSMA 3WU6A 2GQ0A 1STUA 2OI2A 2VF1A 4LF9I 2J7KA 2JOXA 1I94I 3OMLA 2L3JA 5T6JA 2WW4A 2UXDI 1Y4SA 1ZM2A 2DMYA 1RQ0A 4JYAE 1NHHA 4LF8E 5IT9C 4JI0E 2V8PA 4KZSA 1H7SA 4DU7A 2L92A 2X36A 4L8NA 4BC9A 2A2CA 2IOPA 4B3MI 4LF7E 5BR8I 3IWCA 4PRVA 1N33E 4FWHA 2JVAA 4LF9E 1T4NA 3B78A 3ZOQB 4R03A 2B9DA 2B7TA 2BV3A 4LFBE 4DV6I 4NXMI 2R3VA 4JI3I 4B3TI 2KONA 4B3RE 1MU5A 4RPFA 3K1JA 3J81Q 3AV0A 3ADIA 1HNZE 4DV1I 4M1KA 1NHJA 4UT4A 4J8ZA 2IHR1 4R8OA 1WHQA 4JI7E 5AASA 1Z0WA 1IBMI 1Y4UA 1EA6A 1NZ0A 4YY3I 4B3SI 5FWKA 4IZJA 2NUFA 4LF6E 2L3CA 4MYTA 2NPFA 4Q28A 4JV5I 3JAMC 4DV6E 4KQVA 1UILA 3HPSA 1U2RA 2H36X 4R1FA 2O1WA 5A2QC 2LRSA 3QT5A 2VQFI 1IBLI 1XMOI 2V83A 3ZM7A 4DR3I 4F9BB 1QZRA 2FTXB 1XNRI 4DUZI 1KTVA 1K47A 4GKKE 3IWBA 2LJPA 2DIXA 2L2MA 4YY3E 4B3SE 2Z5CA 2UUCI 1T4LB 2V2ZA 1OJ4A 3PYEA 1GZ6A 3CWVA 4JV5E 2UUAI 2UXCI 1USVA 2Z5BB 1Z0TA 4LF4E 3T1YI 4DR6E 3RMPA 4DPXA 2UUBI 2DEJA 4JG4A 5LMUE 3T1HE 4DV0E 4X66E 4KHPE 2O1VA 1HR0E 1ZXMA 5F3WA 3M6AA 2UU9I 2HK3A 1X49A 2B3TB 4DUZE 4DU8A 3LLHA 1ZM9A 4JI5E 4X62I 1YZ9A 3OTOE 1XNQE 2V85A 4DR1I 4F54A 4NXNI 1Y6ZA 3IWDA 3T1YE 2L6MA 2JOBA 3QT6A 4DR5I 2HK2A 3DJWA 4DKKA 1ELOA 1HNXI 2NA2A 4P78A 3GONA 3PRYA 5GMDA 2L33A 1DQ3A 4JI4I 4DV3E 2VF3A 1MX0A 1RREA 2K4VA 2O1UA 5IT9Q 3F6GA 5GMEA 2DSYA 1IBKI 1X48A 3J80C 4XTJA 4AQYE 1J5EI 2R42A 1FWKA 2LUPB 4WPYA 1N32E 2L2NA 1BKNA 1XMQE 4N3OA 2UXBI 1HNXE 4JI6I 4PRXA 3ZZTA 1EI1A 2HKJA 3WU5A 4DV4I 4DV7I 1S16A 1I94E 3ADLA 3F6HA 2X7IA 4X66I 3WU4A 4WUBA 2UXDE 4JI4E 4K0KI 2A2DA 1HK7A 1PIEA 4X64I 4ED4A 1S4EA 4FWGA 3J7AG 4F9CB 1D6TA 2KOUA 1FKAE 1EKZA 1QU6A 5ADZA 2ODRC 3J7AM 1KIJA 4DR7I 1Z0EA 4LF5I 4B3ME 3ZKBA 3AUZA 2UXBE 5BR8E 1FWLA 2VE7C 3B8HA 1O0WA 4DV7E 4USKA 1ZBTA 2VQEI 4DV2I 1B62A 4OX9I 4NXME 2F8BA 4JI3E 2NUEA 1Z0VA 4B3TE 4HACA 5IWAI 4X64E 2YZTA 4DPUA 4F9AB 2DEIA 4IZKA 4LFCI 4DV1E 5A2QQ 4USMA 1FJGI 4M2ZA 3Q6NA 4IZJD 4GKJI 3LNUA 2E1MA 1ZBQA 3J7Yp 1IBME 2M4IA 5FLXC 2CG9A 2V87A 4DMIA 1YYWA 4HY1A 4DUYI 4DV2E 2LTSA 4OX9E 1N36I 3B82A 3VYYA 1VISA 2E5LI 4WYQB 2HFSA 3D4JA 2N3GA 4WUCA 2VQFE 1IBLE 4X8WA 1XMOE 4LFCE 4JI8I 1N34I 4DR3E 4FWDA 2F4VI 1FJGE 1NHIA 1Z5AA 2PNLA 1XNRE 2HHHI 2ZM6I 4YHHI 1PVGA 3V5RA 2Z5EA 2DB2A 2UUCE 3C4BA 2EZ6A 4WFTA 5DNYA 4DUYE 3KWRA 2UUAE 2UXCE 4GEQB 2V2VA 4X65I 2CZ9A 2CGEA 4LTYA 3QT7A 5LMNI 2UUBE 3P1XA 3V2UC 2MDRA 3LTOA 3H09A 3QT8A 3LMLA 4UTGA 2G7HA 2LJHA 1N34E 4FW9A 3HULA 3ZZUA 1UHZA 2UU9E 2HHHE 2M1SA 4BBYA 2L8TA 4JYAI 4X62E 2O1TA 2FV4B 3C4TA 3K6QA 4IZJB 4BC7A 3ZZ0A 3P06A 1Z5CA 1H73A 1XHKA 4DR1E 4NXNE 4X65E 4WSPA 1J26A 2LUQA 4LF7I 1FNMA 2YT4A 5LMNE 1X47A 1YYKA 4DR5E 2MC5A 4M30A 1N33I 3J80Q 3DF6A 4Z7CA 2WZOA 4IZKB 3JTZA 1A6FA 2Z5BA 4HYMA 2ZBKB 4WUDA 1FI4A 4LFBI 1WXRA 2V34A 4EMDA 1RR9A 2GS8A 4P7DA 4B3RI 4I8OA 2NUGA 2B7VA 3JU0A 2Z5CB 5AE1A 4FN5A 1HNZI 3H4LA 2LE2A 1KKHA 2V2QA 5L3JA 4DR2I 4JI7I 3Q1QA 2KHXA 1IBKE 4Z7YA 3K17A 4LF6I 2IOQA 1J5EE 3HJCA 4DPWA 2RTXA 2EFGA 2BM1A 4JI6E 1GQEA 1N0VC 2HFUA 4DV4E 3PYFA 1Z59A 4TUIA 2JY9A 1N0UA 1DI2A 3J81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPS A;  3JAM Q;  2LTR A;  4K0K E;  1YYO A;  4P52 A;  1H72 C;  1H74 A;  1Z0B A;  4DR2 E;  1H7U A;  4DXL A;  4GKK I;  1T4O A;  2LBS B;  2BM0 A;  4DV5 I;  4URL A;  4DR7 E;  1KVK A;  1UEK A;  4LF5 E;  4ZVI A;  4JI1 I;  2HKE A;  2N3H A;  4LF4 I;  1RC7 A;  4DR6 I;  4JI2 I;  3F0N A;  2RS6 A;  1WUU A;  5FLX Q;  2VQE E;  4HXZ A;  2CPN A;  1Z5B A;  5LMU I;  2ZIT A;  3T1H I;  4DV0 I;  4KHP I;  5IWA E;  4DR4 I;  1HR0 I;  4OOG C;  3ZKD A;  4MYU A;  4LFA I;  4JI5 I;  2XEX A;  4DV5 E;  4GKJ E;  3OTO I;  1XNQ I;  1HNW I;  4JI1 E;  2Q2E B;  3WU3 A;  3J81 C;  2RS7 A;  4JI2 E;  4DPY A;  3HTX A;  1DAR A;  1N36 E;  1ZM4 A;  4I3H A;  2E5L E;  4P7A A;  5CFF E;  1B63 A;  1MG7 A;  4DR4 E;  2AJ4 A;  1WHN A;  4LFA E;  4JI8 E;  1ZM3 A;  2F4V E;  4DV3 I;  1Z0G A;  1Z0C A;  3ADJ A;  2ZM6 E;  1HNW E;  4YHH E;  3PYG A;  4LF8 I;  4JI0 I;  2L2K B;  2E1R A;  4PU9 A;  3ADG A;  4AQY I;  3VYX A;  3PYD A;  5LL6 R;  1PKP A;  1N32 I;  1ZXN A;  4DPT A;  1XMQ I;  4HAC B;  2RSM A;  3WU6 A;  2OI2 A;  1STU A;  4LF9 I;  2J7K A;  1I94 I;  2L3J A;  2WW4 A;  2UXD I;  1ZM2 A;  2DMY A;  1RQ0 A;  4JYA E;  1NHH A;  4LF8 E;  5IT9 C;  4JI0 E;  2V8P A;  1H7S A;  4DU7 A;  2X36 A;  2A2C A;  4B3M I;  4LF7 E;  5BR8 I;  4PRV A;  1N33 E;  4FWH A;  2JVA A;  4LF9 E;  1T4N A;  3B78 A;  2B7T A;  2BV3 A;  4LFB E;  4DV6 I;  4NXM I;  2R3V A;  4JI3 I;  4B3T I;  4B3R E;  1MU5 A;  4RPF A;  3K1J A;  3J81 Q;  3ADI A;  1HNZ E;  4DV1 I;  4M1K A;  1NHJ A;  4UT4 A;  2IHR 1;  1WHQ A;  4JI7 E;  1Z0W A;  1IBM I;  1EA6 A;  1NZ0 A;  4YY3 I;  4B3S I;  2NUF A;  4LF6 E;  2L3C A;  4MYT A;  2NPF A;  4JV5 I;  3JAM C;  4DV6 E;  4KQV A;  1UIL A;  1U2R A;  4R1F A;  5A2Q C;  2LRS A;  3QT5 A;  2VQF I;  1IBL I;  1XMO I;  3ZM7 A;  4DR3 I;  1QZR A;  1XNR I;  4DUZ I;  1KTV A;  1K47 A;  4GKK E;  2LJP A;  2DIX A;  2L2M A;  4YY3 E;  4B3S E;  2UUC I;  1T4L B;  2V2Z A;  1OJ4 A;  3PYE A;  3CWV A;  4JV5 E;  2UUA I;  2UXC I;  1Z0T A;  4LF4 E;  3T1Y I;  4DR6 E;  4DPX A;  2UUB I;  2DEJ A;  4JG4 A;  5LMU E;  3T1H E;  4DV0 E;  4KHP E;  1HR0 E;  1ZXM A;  3M6A A;  2UU9 I;  2HK3 A;  1X49 A;  2B3T B;  4DUZ E;  4DU8 A;  3LLH A;  1ZM9 A;  4JI5 E;  4X62 I;  1YZ9 A;  3OTO E;  1XNQ E;  4DR1 I;  4NXN I;  3T1Y E;  3QT6 A;  4DR5 I;  2HK2 A;  4DKK A;  1ELO A;  1HNX I;  2NA2 A;  3GON A;  5GMD A;  2L33 A;  4JI4 I;  4DV3 E;  2VF3 A;  1MX0 A;  1RRE A;  5IT9 Q;  5GME A;  1IBK I;  1X48 A;  3J80 C;  4XTJ A;  4AQY E;  1J5E I;  2R42 A;  1FWK A;  2LUP B;  1N32 E;  1BKN A;  2L2N A;  2UXB I;  1XMQ E;  1HNX E;  4JI6 I;  4PRX A;  3ZZT A;  1EI1 A;  2HKJ A;  3WU5 A;  4DV4 I;  4DV7 I;  1S16 A;  1I94 E;  3ADL A;  2X7I A;  4X66 I;  3WU4 A;  4WUB A;  2UXD E;  4JI4 E;  4K0K I;  2A2D A;  1PIE A;  4X64 I;  4ED4 A;  1S4E A;  4FWG A;  3J7A G;  1D6T A;  1FKA E;  1EKZ A;  1QU6 A;  3J7A M;  1KIJ A;  4DR7 I;  1Z0E A;  4LF5 I;  4B3M E;  3ZKB A;  2UXB E;  5BR8 E;  1FWL A;  3B8H A;  1O0W A;  4DV7 E;  4USK A;  1ZBT A;  2VQE I;  4DV2 I;  1B62 A;  4OX9 I;  4NXM E;  4JI3 E;  2NUE A;  1Z0V A;  4B3T E;  4HAC A;  5IWA I;  4X64 E;  4DPU A;  2DEI A;  4LFC I;  4DV1 E;  5A2Q Q;  4USM A;  1FJG I;  4M2Z A;  4GKJ I;  3LNU A;  3J7Y p;  1IBM E;  5FLX C;  1YYW A;  4HY1 A;  4DUY I;  4DV2 E;  2LTS A;  4OX9 E;  1N36 I;  3B82 A;  3VYY A;  1VIS A;  2E5L I;  4WYQ B;  2HFS A;  3D4J A;  2N3G A;  4WUC A;  2VQF E;  1IBL E;  4X8W A;  1XMO E;  4LFC E;  4JI8 I;  1N34 I;  4DR3 E;  4FWD A;  2F4V I;  1FJG E;  1NHI A;  1Z5A A;  1XNR E;  2HHH I;  2ZM6 I;  4YHH I;  1PVG A;  3V5R A;  2DB2 A;  2UUC E;  3C4B A;  2EZ6 A;  4WFT A;  4DUY E;  2UUA E;  2UXC E;  2V2V A;  4X65 I;  2CZ9 A;  3QT7 A;  5LMN I;  2UUB E;  3P1X A;  3V2U C;  2MDR A;  3LTO A;  3QT8 A;  4UTG A;  2LJH A;  1N34 E;  4FW9 A;  3HUL A;  3ZZU A;  1UHZ A;  2UU9 E;  2HHH E;  4JYA I;  4X62 E;  3C4T A;  3ZZ0 A;  1Z5C A;  1H73 A;  1XHK A;  4DR1 E;  4NXN E;  4X65 E;  1J26 A;  2LUQ A;  4LF7 I;  1FNM A;  2YT4 A;  5LMN E;  1X47 A;  1YYK A;  4DR5 E;  4M30 A;  1N33 I;  3J80 Q;  4Z7C A;  1A6F A;  4LFB I;  4HYM A;  2ZBK B;  4WUD A;  1FI4 A;  2V34 A;  4EMD A;  1RR9 A;  2GS8 A;  4B3R I;  2NUG A;  2B7V A;  4FN5 A;  1HNZ I;  3H4L A;  1KKH A;  2V2Q A;  5L3J A;  4DR2 I;  4JI7 I;  3Q1Q A;  2KHX A;  1IBK E;  4Z7Y A;  3K17 A;  4LF6 I;  1J5E E;  4DPW A;  2RTX A;  2EFG A;  2BM1 A;  4JI6 E;  1GQE A;  1N0V C;  2HFU A;  4DV4 E;  3PYF A;  1Z59 A;  2JY9 A;  1N0U A;  1DI2 A;  4X66 E; 
#chains in the Genus database with same CATH topology
 3LPS A;  2VRD A;  2LTR A;  4K0K E;  1SFE A;  1R6L A;  1YYO A;  3JAM Q;  1NEI A;  4OKG A;  4P52 A;  3C6K A;  1DGC A;  1H72 C;  1H74 A;  2YTP A;  2ELY A;  2WCC 3;  2EN3 A;  1Z0B A;  2EMW A;  4DR2 E;  4IZJ A;  2EN2 A;  1H7U A;  4DXL A;  1SR9 A;  4GKK I;  4TUG A;  2EN4 A;  2EM5 A;  1T4O A;  2LBS B;  2BM0 A;  4DV5 I;  4O4K A;  2M7Q A;  2MC6 A;  2ODR D;  4DR7 E;  4URL A;  1KVK A;  1UEK A;  4IFD E;  4LF5 E;  1P42 A;  2EM0 A;  4ZVI A;  4JI1 I;  3K85 A;  1AAY A;  1EH6 A;  3VK6 A;  2HKE A;  4LU9 A;  2N3H A;  1RHY A;  4LF4 I;  2PNM A;  1RC7 A;  4DR6 I;  4JI2 I;  1PDA A;  3F0N A;  2RS6 A;  1WUU A;  5FLX Q;  2LV2 A;  2RSI A;  2VQE E;  2YU8 A;  4HXZ A;  4AM3 A;  2CPN A;  1Z5B A;  2J7J A;  1VI7 A;  1BBG A;  2JR1 A;  4M9V C;  2ZIT A;  5LMU I;  3T1H I;  2UXB I;  4DV0 I;  3HXL A;  4KHP I;  3PS2 A;  2YTE A;  2V89 A;  5IWA E;  4DR4 I;  2JP9 A;  1HR0 I;  2FGG A;  2EPL X;  2BR2 A;  4OOG C;  4R2S A;  2PNZ A;  3ZKD A;  4MYU A;  2C39 A;  4OO1 C;  4LFA I;  2EOX A;  5JEA C;  2EOH A;  2YTD A;  4JI5 I;  2EP3 A;  3MSW A;  5C0X B;  2XEX A;  4DV5 E;  4GKJ E;  3OTO I;  4KWY A;  5A6A A;  1XNQ I;  5C0X F;  1HNW I;  4NHR A;  4JI1 E;  2NN6 B;  2WBS A;  2Q2E B;  3WU3 A;  3J81 C;  2EM7 A;  3BF2 A;  3GME A;  2LMZ A;  5DRQ A;  3Q6M A;  4OO1 A;  5JEA A;  3L00 A;  2I9I A;  2EE8 A;  2RS7 A;  4JI2 E;  4DPY A;  2O3Z A;  3MHH C;  3UK3 C;  2PO0 A;  4MU0 A;  3HTX A;  4BS9 A;  3FIG A;  2DMI A;  2C38 B;  1DAR A;  1N36 E;  5A6B D;  4M0V A;  2EMK A;  2WBT A;  2BA1 G;  2V88 A;  1ZM4 A;  4I3H A;  2E5L E;  4P7A A;  5CFF E;  5IV8 B;  4X9J A;  1B63 A;  1MG7 A;  2EWL A;  4DR4 E;  1Y5Y A;  4BMJ A;  3HPZ A;  1XXE A;  2AJ4 A;  1WHN A;  3HQ1 A;  4L5N C;  4LFA E;  4JI8 E;  1UDS A;  4IFD C;  2JWO A;  1ZM3 A;  2F4V E;  3QG5 C;  5KL5 A;  4F6M A;  1Z0G A;  2EMI A;  1Z0C A;  4NBQ A;  4DV3 I;  1MEY C;  3ADJ A;  2ZM6 E;  1HNW E;  4AID A;  5AE2 A;  3ECR A;  4YHH E;  1P47 A;  2YPN A;  2V86 A;  1A1G A;  3PYG A;  1T38 A;  4LF8 I;  3M7N D;  4JI0 I;  5KL6 A;  2L2K B;  2E1R A;  4IFD A;  5AE3 A;  2V8Q B;  3ADG A;  4PU9 A;  4AQY I;  3VYX A;  3PYD A;  5LL6 R;  4MQY A;  1PKP A;  1USU A;  1N32 I;  1ZXN A;  4BCA A;  3P76 A;  4DPT A;  4HAC B;  2RSM A;  1XMQ I;  3WU6 A;  2CTD A;  2GQ0 A;  1STU A;  2OI2 A;  1E3H A;  2F1D A;  4MDT A;  1A1I A;  4GQU A;  2EOY A;  2VF1 A;  1WJP A;  3BGH A;  4LF9 I;  1QNT A;  2J7K A;  2JOX A;  1I94 I;  2IER A;  3OML A;  2YTQ A;  2CT1 A;  2L3J A;  2GHF A;  2R1F A;  5T6J A;  2LO3 A;  2PO2 B;  2JXP A;  2YTG A;  2WW4 A;  2UXD I;  1UDN A;  1Y4S A;  1ZM2 A;  4IFD D;  2DMY A;  2EPC A;  4FW4 A;  1A1L A;  1RQ0 A;  4JYA E;  1NHH A;  4LF8 E;  5IT9 C;  2EPM X;  4WSG A;  4JI0 E;  3C6M A;  2V8P A;  4KZS A;  1H7S A;  4R2D A;  2EN7 A;  4DU7 A;  2L92 A;  2DLQ A;  2X36 A;  4L8N A;  1IQS A;  5C0X D;  4BC9 A;  2ENC A;  2A2C A;  2IOP A;  5AC5 A;  5ELW A;  4B3M I;  4LF7 E;  2JE6 B;  2YTF A;  5BR8 I;  2EPN A;  3IWC A;  4PRV A;  1N33 E;  4FWH A;  1IMU A;  2ENH A;  3PS3 A;  2JVA A;  4LF9 E;  1T4N A;  3B78 A;  3ZOQ B;  2LT7 A;  2C39 B;  3CDJ A;  4ZYG A;  4R03 A;  2B9D A;  2B7T A;  2BV3 A;  2ENA A;  1AH5 A;  4LFB E;  4DV6 I;  2EJ4 A;  4NXM I;  2R3V A;  3U1Y A;  4JI3 I;  1G2F C;  4B3T I;  2KON A;  4WXD A;  1JK2 A;  4B3R E;  1G2D C;  3L7Z A;  2YTN A;  2MDG A;  1MU5 A;  4OZE A;  1KYQ A;  2EMZ A;  2YTJ A;  3AV0 A;  3ADI A;  3K1J A;  4RPF A;  1HNZ E;  3J81 Q;  4DV1 I;  5DRR A;  2EMF A;  4M1K A;  4IS1 C;  4R2A A;  1NHJ A;  4UT4 A;  4J8Z A;  4OO1 F;  5JEA F;  2IHR 1;  4R8O A;  4R2Q A;  1WHQ A;  4JI7 E;  5AAS A;  1IQO A;  1Z0W A;  1IBM I;  1Y4U A;  1EA6 A;  1NZ0 A;  2JEB A;  5A69 A;  4AIM A;  4YY3 I;  4B3S I;  5FWK A;  3NZK A;  2WP8 B;  2EPO A;  2NUF A;  5KL2 A;  4ZYD A;  2L3C A;  2EOI A;  4LF6 E;  4N4R B;  3VHT B;  1OYR A;  4MYT A;  2NPF A;  2HC5 A;  4Q28 A;  3JAM C;  4JV5 I;  5K36 E;  4LCF A;  4DV6 E;  5EL9 A;  4KQV A;  4BA1 A;  1UIL A;  3HPS A;  1BB8 A;  3EPJ A;  1U2R A;  2H36 X;  1TN9 A;  4R1F A;  2O1W A;  5A2Q C;  2LRS A;  3QT5 A;  4R2P A;  2VQF I;  1IBL I;  1XMO I;  4IFD B;  2V83 A;  4HEI A;  4LOM A;  3ZM7 A;  2NAB A;  4DR3 I;  4F9B B;  1X6H A;  1QZR A;  4IFD F;  1NCS A;  2FTX B;  1R6M A;  4DUZ I;  4MU3 A;  1XNR I;  1KTV A;  5DNL A;  1K47 A;  2YSP A;  4GKK E;  3DD6 A;  2EM9 A;  3IWB A;  2LJP A;  2DIX A;  2CSH A;  2L2M A;  4YY3 E;  2HJJ A;  4MU4 A;  4B3S E;  2Z5C A;  2UUC I;  1T4L B;  2V2Z A;  1OJ4 A;  3PYE A;  1GZ6 A;  3CWV A;  5IXM B;  4JV5 E;  5A6J A;  2UUA I;  2UXC I;  1USV A;  2Z5B B;  5DNX A;  1Z0T A;  3TQM A;  4BHC A;  4LF4 E;  3HKM A;  3T1Y I;  4DR6 E;  3RMP A;  5KL4 A;  3EPK A;  4DPX A;  2NN6 E;  2JEA B;  2UUB I;  2YSO A;  2EM2 A;  4RHB B;  2DEJ A;  4JG4 A;  5LMU E;  2EPA A;  3T1H E;  2BA1 D;  1A1J A;  4BA2 A;  1E3P A;  4DV0 E;  4R2R A;  4KHP E;  2EM6 A;  3MHS C;  2R76 A;  3M85 G;  3M85 D;  2O1V A;  1A1H A;  1HR0 E;  1ZXM A;  4Q35 B;  5F3W A;  3M6A A;  2UU9 I;  2PO1 B;  2HK3 A;  1X49 A;  2B3T B;  4DUZ E;  1B69 A;  1TF3 A;  4DU8 A;  3LLH A;  5KL3 A;  1ZM9 A;  4QNK A;  4JI5 E;  4X62 I;  2EN1 A;  5K36 C;  4OO1 D;  1YZ9 A;  5JEA D;  4WXC A;  3OTO E;  1XNQ E;  4QNJ A;  1YSA C;  2JPA A;  2V85 A;  4DR1 I;  4F54 A;  4NXN I;  2MKD A;  1Y6Z A;  2D9H A;  3IWD A;  4LCG A;  3T1Y E;  2L6M A;  2JOB A;  2EMB A;  2EN8 A;  5K36 A;  5A6K A;  3QT6 A;  4DR5 I;  2WNR A;  2HK2 A;  3DJW A;  2EOE A;  1JK1 A;  1WRJ A;  4FW7 A;  2EOJ A;  2EOR A;  4DKK A;  1ELO A;  1HNX I;  1YPN A;  2EMX A;  2NA2 A;  4P78 A;  3GON A;  3PRY A;  5GMD A;  2EOS A;  2L33 A;  1DQ3 A;  4JI4 I;  4DV3 E;  1BBO A;  1YH8 A;  2VF3 A;  1MX0 A;  1GTK A;  3P3G A;  2EML A;  1RRE A;  2NN6 C;  2K4V A;  1N3G A;  2EPK X;  2EMY A;  2O1U A;  5IT9 Q;  2AE8 A;  3F6G A;  5GME A;  2DSY A;  1IBK I;  1X48 A;  2EM8 A;  3J80 C;  4XTJ A;  4AQY E;  1ZU1 A;  1J5E I;  2R42 A;  1FWK A;  2LUP B;  4WPY A;  1N32 E;  2L2N A;  1BKN A;  1XMQ E;  1YUI A;  2NN6 A;  1HNX E;  4N3O A;  3U1K A;  4PRX A;  4JI6 I;  3ZZT A;  4ZYE A;  1EI1 A;  2BR2 B;  2HKJ A;  5EKW A;  3WU5 A;  4DV4 I;  4DV7 I;  2PNZ B;  2E72 A;  1S16 A;  1I94 E;  2C37 A;  3ADL A;  4F2J C;  3F6H A;  1UBD C;  2X7I A;  4X66 I;  3WU4 A;  2EPP A;  2C38 A;  2UXD E;  4JI4 E;  4WUB A;  4K0K I;  4RH8 A;  4ZYH A;  2A2D A;  1HK7 A;  5AC4 A;  1PIE A;  3M99 B;  4X64 I;  2EOZ A;  4ED4 A;  1S4E A;  2EOM A;  4FWG A;  3J7A G;  4F9C B;  4OO1 B;  2KOU A;  1FKA E;  3KZY A;  1EKZ A;  2GLI A;  1Y60 A;  2IES A;  5DRP A;  1QU6 A;  5JEA B;  5ADZ A;  1KJK A;  2ODR C;  3GLL A;  2PO0 B;  3J7A M;  1KIJ A;  5KL7 A;  4DR7 I;  1Z0E A;  4LF5 I;  4B3M E;  3ZKB A;  3AUZ A;  2UXB E;  5BR8 E;  1FWL A;  2VE7 C;  2EN6 A;  3B8H A;  4FW3 A;  1O0W A;  4DV7 E;  4USK A;  1ZBT A;  2EQ1 A;  5LLQ A;  2VQE I;  2N8X A;  4DV2 I;  1B62 A;  4OX9 I;  1L4S A;  2GO3 A;  2BA0 G;  2BA0 D;  4NXM E;  2F8B A;  4JI3 E;  2NUE A;  1UDO A;  4B3T E;  1Z0V A;  4R2C A;  4HAC A;  5IWA I;  4X64 E;  2YZT A;  2GPI A;  4DPU A;  4F9A B;  2DEI A;  4BHB A;  4IZK A;  3P3C A;  2LJU A;  4LFC I;  4DV1 E;  2EL5 A;  5A2Q Q;  2Q8U A;  4USM A;  5K36 B;  1A1F A;  4FW5 A;  1EH8 A;  2EOF A;  4O43 A;  2WNR B;  2PO2 A;  4M2Z A;  3Q6N A;  2WBU A;  4IZJ D;  4GKJ I;  3THO B;  1FJG I;  2I13 A;  3LNU A;  5K36 F;  2E1M A;  1ZBQ A;  2EPX A;  2YU5 A;  3THN A;  3J7Y p;  1IBM E;  3CDI A;  3BBG A;  2M4I A;  5FLX C;  2EMG A;  2CG9 A;  1UDQ A;  4U3B A;  2V87 A;  4DMI A;  1YYW A;  4HY1 A;  4DUY I;  4DV2 E;  2LTS A;  3EQ1 A;  4OX9 E;  2VES A;  5C0X E;  2JYA A;  1N36 I;  3B82 A;  2YRH A;  3VYY A;  1VIS A;  2E5L I;  4WYQ B;  2JE6 A;  4J3D A;  4FK5 C;  2HFS A;  1YUJ A;  2LCE A;  3D4J A;  5A6B A;  2N3G A;  4WUC A;  2EOO A;  2VQF E;  1IBL E;  2A25 A;  4X8W A;  1XMO E;  4LFC E;  3KRN A;  2EMC A;  2YTO A;  5DRO A;  2EQ0 A;  2YRK A;  4JI8 I;  2DRP A;  1N34 I;  4DR3 E;  1ZAA C;  4FWD A;  2F4V I;  2MKN A;  1FJG E;  1NHI A;  1Z5A A;  2YRM A;  2PNL A;  1XNR E;  2HHH I;  2EL6 A;  4WX9 A;  1D6T A;  2ZM6 I;  4YHH I;  1PVG A;  2YWQ A;  3V5R A;  4HTG A;  2Z5E A;  2DB2 A;  2EQ3 A;  2UUC E;  3C4B A;  2EZ6 A;  2NN6 F;  4WFT A;  2EMH A;  5DNY A;  4F6N A;  2C37 B;  4DUY E;  1PJS A;  3KWR A;  2UUA E;  2UXC E;  4GEQ B;  1X6F A;  2V2V A;  2EPU A;  2RQL A;  2CZ9 A;  2CGE A;  4X65 I;  2BB8 A;  1A1K A;  4LTY A;  3QT7 A;  5LMN I;  3L7Z B;  2UUB E;  3P1X A;  2M9A A;  3GCM A;  2MDR A;  3LTO A;  3V2U C;  1LLM C;  3H09 A;  2WP8 A;  3B4T A;  3QT8 A;  3LML A;  4UTG A;  4MLQ A;  2G7H A;  2LJH A;  2HGH A;  1N34 E;  2EPR A;  4FW9 A;  3HUL A;  1Z1B A;  1PJT A;  4U3D A;  3ZZU A;  4MU1 A;  1UHZ A;  2ELZ A;  2UU9 E;  2HHH E;  2M1S A;  2J65 A;  4BBY A;  2L8T A;  4MLV A;  4JYA I;  3M7N G;  4X62 E;  2JEB B;  2O1T A;  2LVH A;  2FV4 B;  3C4T A;  3K6Q A;  4IZJ B;  5C0X C;  4R2E A;  4BC7 A;  2EMA A;  2GO4 A;  3ZZ0 A;  3P06 A;  5K36 D;  1X3C A;  2BBG A;  1Z5C A;  1H73 A;  1XHK A;  4DR1 E;  2EOQ A;  4FW6 A;  4NXN E;  4O5G A;  3PS1 A;  4X65 E;  4WSP A;  1F2I G;  1J26 A;  2LUQ A;  4LPF A;  1FNM A;  4LF7 I;  4BA1 B;  2YT4 A;  1EH7 A;  1YHC A;  4NZV A;  1X47 A;  5LMN E;  1YYK A;  5C0X A;  4DR5 E;  2MC5 A;  4M30 A;  1N33 I;  3J80 Q;  3DF6 A;  4IS9 A;  4Z7C A;  2EM3 A;  2WZO A;  4IZK B;  2K7I A;  3BID A;  3JTZ A;  1A6F A;  3UHM A;  2Z5B A;  4HYM A;  2ZBK B;  4WUD A;  1FI4 A;  4LFB I;  1WXR A;  2V34 A;  1OYP A;  4EMD A;  1X6E A;  1RR9 A;  2GS8 A;  4P7D A;  4B3R I;  1T39 A;  4I8O A;  1TF6 A;  2NUG A;  2JEA A;  2B7V A;  3JU0 A;  2CVE A;  2EL4 A;  4GZN C;  2Z5C B;  5AE1 A;  2YTI A;  2DLK A;  4FN5 A;  2ADR A;  1UN6 B;  1HNZ I;  3H4L A;  2RPC A;  2LE2 A;  1KKH A;  2EM4 A;  2V2Q A;  3P3E A;  4ISA A;  5L3J A;  1RMD A;  4DR2 I;  4JI7 I;  4O24 A;  2PO1 A;  3Q1Q A;  2KHX A;  2DGC A;  5TSE A;  1PJQ A;  1X5W A;  1IBK E;  2NN6 D;  4Z7Y A;  3EPH A;  3K17 A;  4LCH A;  4LF6 I;  2IOQ A;  1J5E E;  3HJC A;  4DPW A;  5JEA E;  4BA2 B;  4OO1 E;  2RTX A;  2EPZ A;  2EFG A;  2BM1 A;  4JI6 E;  1ZR9 A;  1GQE A;  4IJD A;  1N0V C;  2HFU A;  2JT2 A;  4DV4 E;  1OYS A;  3PYF A;  1MGT A;  3H1C A;  2PRT A;  1Z59 A;  4TUI A;  2JY9 A;  1N0U A;  1DI2 A;  1YFH A;  3KZZ A;  4X66 E;  3EPL A; 
#chains in the Genus database with same CATH homology
 3LPS A;  3JAM Q;  2LTR A;  4K0K E;  1YYO A;  4P52 A;  1H72 C;  1H74 A;  1Z0B A;  4DR2 E;  1H7U A;  4DXL A;  1SR9 A;  4GKK I;  4TUG A;  1T4O A;  2LBS B;  2BM0 A;  4DV5 I;  2M7Q A;  2MC6 A;  2ODR D;  4DR7 E;  4URL A;  1KVK A;  1UEK A;  4LF5 E;  4ZVI A;  4JI1 I;  3K85 A;  3VK6 A;  2HKE A;  4LU9 A;  2N3H A;  4LF4 I;  2PNM A;  1RC7 A;  4DR6 I;  4JI2 I;  3F0N A;  2RS6 A;  1WUU A;  5FLX Q;  2VQE E;  4HXZ A;  2CPN A;  1Z5B A;  2JR1 A;  5LMU I;  2ZIT A;  3T1H I;  4DV0 I;  3HXL A;  4KHP I;  2V89 A;  5IWA E;  4DR4 I;  1HR0 I;  2FGG A;  4OOG C;  3ZKD A;  4MYU A;  4LFA I;  4JI5 I;  3MSW A;  2XEX A;  4DV5 E;  4GKJ E;  3OTO I;  1XNQ I;  1HNW I;  4JI1 E;  2Q2E B;  3WU3 A;  2LMZ A;  3Q6M A;  2RS7 A;  4JI2 E;  4DPY A;  3HTX A;  4BS9 A;  3FIG A;  1DAR A;  1N36 E;  4M0V A;  2V88 A;  1ZM4 A;  4I3H A;  2E5L E;  4P7A A;  5CFF E;  1B63 A;  1MG7 A;  2EWL A;  4DR4 E;  4BMJ A;  3HPZ A;  2AJ4 A;  1WHN A;  3HQ1 A;  4L5N C;  4LFA E;  4JI8 E;  2JWO A;  1ZM3 A;  2F4V E;  4DV3 I;  1Z0G A;  1Z0C A;  3ADJ A;  2ZM6 E;  1HNW E;  5AE2 A;  4YHH E;  3PYG A;  2V86 A;  4LF8 I;  4JI0 I;  2L2K B;  2E1R A;  5AE3 A;  2V8Q B;  3ADG A;  4PU9 A;  4AQY I;  3VYX A;  3PYD A;  5LL6 R;  1PKP A;  1USU A;  1N32 I;  1ZXN A;  4BCA A;  4DPT A;  1XMQ I;  4HAC B;  2RSM A;  3WU6 A;  2GQ0 A;  1STU A;  2OI2 A;  2VF1 A;  4LF9 I;  2J7K A;  2JOX A;  1I94 I;  3OML A;  2L3J A;  5T6J A;  2WW4 A;  2UXD I;  1Y4S A;  1ZM2 A;  2DMY A;  1RQ0 A;  4JYA E;  1NHH A;  4LF8 E;  5IT9 C;  4JI0 E;  2V8P A;  4KZS A;  1H7S A;  4DU7 A;  2L92 A;  2X36 A;  4L8N A;  4BC9 A;  2A2C A;  2IOP A;  4B3M I;  4LF7 E;  5BR8 I;  3IWC A;  4PRV A;  1N33 E;  4FWH A;  2JVA A;  4LF9 E;  1T4N A;  3B78 A;  3ZOQ B;  4R03 A;  2B9D A;  2B7T A;  2BV3 A;  4LFB E;  4DV6 I;  4NXM I;  2R3V A;  4JI3 I;  4B3T I;  2KON A;  4B3R E;  1MU5 A;  4RPF A;  3K1J A;  3J81 Q;  3AV0 A;  3ADI A;  1HNZ E;  4DV1 I;  4M1K A;  1NHJ A;  4UT4 A;  4J8Z A;  2IHR 1;  4R8O A;  1WHQ A;  4JI7 E;  5AAS A;  1Z0W A;  1IBM I;  1Y4U A;  1EA6 A;  1NZ0 A;  4YY3 I;  4B3S I;  5FWK A;  4IZJ A;  2NUF A;  4LF6 E;  2L3C A;  4MYT A;  2NPF A;  4Q28 A;  4JV5 I;  3JAM C;  4DV6 E;  4KQV A;  1UIL A;  3HPS A;  1U2R A;  2H36 X;  4R1F A;  2O1W A;  5A2Q C;  2LRS A;  3QT5 A;  2VQF I;  1IBL I;  1XMO I;  2V83 A;  3ZM7 A;  4DR3 I;  4F9B B;  1QZR A;  2FTX B;  1XNR I;  4DUZ I;  1KTV A;  1K47 A;  4GKK E;  3IWB A;  2LJP A;  2DIX A;  2L2M A;  4YY3 E;  4B3S E;  2Z5C A;  2UUC I;  1T4L B;  2V2Z A;  1OJ4 A;  3PYE A;  1GZ6 A;  3CWV A;  4JV5 E;  2UUA I;  2UXC I;  1USV A;  2Z5B B;  1Z0T A;  4LF4 E;  3T1Y I;  4DR6 E;  3RMP A;  4DPX A;  2UUB I;  2DEJ A;  4JG4 A;  5LMU E;  3T1H E;  4DV0 E;  4X66 E;  4KHP E;  2O1V A;  1HR0 E;  1ZXM A;  5F3W A;  3M6A A;  2UU9 I;  2HK3 A;  1X49 A;  2B3T B;  4DUZ E;  4DU8 A;  3LLH A;  1ZM9 A;  4JI5 E;  4X62 I;  1YZ9 A;  3OTO E;  1XNQ E;  2V85 A;  4DR1 I;  4F54 A;  4NXN I;  1Y6Z A;  3IWD A;  3T1Y E;  2L6M A;  2JOB A;  3QT6 A;  4DR5 I;  2HK2 A;  3DJW A;  4DKK A;  1ELO A;  1HNX I;  2NA2 A;  4P78 A;  3GON A;  3PRY A;  5GMD A;  2L33 A;  1DQ3 A;  4JI4 I;  4DV3 E;  2VF3 A;  1MX0 A;  1RRE A;  2K4V A;  2O1U A;  5IT9 Q;  3F6G A;  5GME A;  2DSY A;  1IBK I;  1X48 A;  3J80 C;  4XTJ A;  4AQY E;  1J5E I;  2R42 A;  1FWK A;  2LUP B;  4WPY A;  1N32 E;  2L2N A;  1BKN A;  1XMQ E;  4N3O A;  2UXB I;  1HNX E;  4JI6 I;  4PRX A;  3ZZT A;  1EI1 A;  2HKJ A;  3WU5 A;  4DV4 I;  4DV7 I;  1S16 A;  1I94 E;  3ADL A;  3F6H A;  2X7I A;  4X66 I;  3WU4 A;  4WUB A;  2UXD E;  4JI4 E;  4K0K I;  2A2D A;  1HK7 A;  1PIE A;  4X64 I;  4ED4 A;  1S4E A;  4FWG A;  3J7A G;  4F9C B;  1D6T A;  2KOU A;  1FKA E;  1EKZ A;  1QU6 A;  5ADZ A;  2ODR C;  3J7A M;  1KIJ A;  4DR7 I;  1Z0E A;  4LF5 I;  4B3M E;  3ZKB A;  3AUZ A;  2UXB E;  5BR8 E;  1FWL A;  2VE7 C;  3B8H A;  1O0W A;  4DV7 E;  4USK A;  1ZBT A;  2VQE I;  4DV2 I;  1B62 A;  4OX9 I;  4NXM E;  2F8B A;  4JI3 E;  2NUE A;  1Z0V A;  4B3T E;  4HAC A;  5IWA I;  4X64 E;  2YZT A;  4DPU A;  4F9A B;  2DEI A;  4IZK A;  4LFC I;  4DV1 E;  5A2Q Q;  4USM A;  1FJG I;  4M2Z A;  3Q6N A;  4IZJ D;  4GKJ I;  3LNU A;  2E1M A;  1ZBQ A;  3J7Y p;  1IBM E;  2M4I A;  5FLX C;  2CG9 A;  2V87 A;  4DMI A;  1YYW A;  4HY1 A;  4DUY I;  4DV2 E;  2LTS A;  4OX9 E;  1N36 I;  3B82 A;  3VYY A;  1VIS A;  2E5L I;  4WYQ B;  2HFS A;  3D4J A;  2N3G A;  4WUC A;  2VQF E;  1IBL E;  4X8W A;  1XMO E;  4LFC E;  4JI8 I;  1N34 I;  4DR3 E;  4FWD A;  2F4V I;  1FJG E;  1NHI A;  1Z5A A;  2PNL A;  1XNR E;  2HHH I;  2ZM6 I;  4YHH I;  1PVG A;  3V5R A;  2Z5E A;  2DB2 A;  2UUC E;  3C4B A;  2EZ6 A;  4WFT A;  5DNY A;  4DUY E;  3KWR A;  2UUA E;  2UXC E;  4GEQ B;  2V2V A;  4X65 I;  2CZ9 A;  2CGE A;  4LTY A;  3QT7 A;  5LMN I;  2UUB E;  3P1X A;  3V2U C;  2MDR A;  3LTO A;  3H09 A;  3QT8 A;  3LML A;  4UTG A;  2G7H A;  2LJH A;  1N34 E;  4FW9 A;  3HUL A;  3ZZU A;  1UHZ A;  2UU9 E;  2HHH E;  2M1S A;  4BBY A;  2L8T A;  4JYA I;  4X62 E;  2O1T A;  2FV4 B;  3C4T A;  3K6Q A;  4IZJ B;  4BC7 A;  3ZZ0 A;  3P06 A;  1Z5C A;  1H73 A;  1XHK A;  4DR1 E;  4NXN E;  4X65 E;  4WSP A;  1J26 A;  2LUQ A;  4LF7 I;  1FNM A;  2YT4 A;  5LMN E;  1X47 A;  1YYK A;  4DR5 E;  2MC5 A;  4M30 A;  1N33 I;  3J80 Q;  3DF6 A;  4Z7C A;  2WZO A;  4IZK B;  3JTZ A;  1A6F A;  2Z5B A;  4HYM A;  2ZBK B;  4WUD A;  1FI4 A;  4LFB I;  1WXR A;  2V34 A;  4EMD A;  1RR9 A;  2GS8 A;  4P7D A;  4B3R I;  4I8O A;  2NUG A;  2B7V A;  3JU0 A;  2Z5C B;  5AE1 A;  4FN5 A;  1HNZ I;  3H4L A;  2LE2 A;  1KKH A;  2V2Q A;  5L3J A;  4DR2 I;  4JI7 I;  3Q1Q A;  2KHX A;  1IBK E;  4Z7Y A;  3K17 A;  4LF6 I;  2IOQ A;  1J5E E;  3HJC A;  4DPW A;  2RTX A;  2EFG A;  2BM1 A;  4JI6 E;  1GQE A;  1N0V C;  2HFU A;  4DV4 E;  3PYF A;  1Z59 A;  4TUI A;  2JY9 A;  1N0U A;  1DI2 A;  3J81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...