1IBME

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ibmE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibmE02
1PVGA 4DV2I 2J7KA 4I3HA 4AQYE 4DR7I 4FN5A 3B8HA 4USKA 2HKJA 5BR8E 3B78A 3V5RA 2CZ9A 2F4VI 5FLXC 4DR3I 4DKKA 3LNUA 1IBLE 2VQEE 1IBMI 4NXMI 1I94I 4JI1E 4B3ME 3ADLA 4DV4E 2N3HA 4X62E 5LL6R 4DV0I 1RREA 1XMOI 1H7SA 2ZM6I 4JI8I 4MYUA 1ZM9A 1NHHA 4FWDA 3C4TA 3J80C 1J5EI 1EA6A 4X65I 5IT9C 4DV2E 2NUEA 2L2KB 3WU5A 4PRXA 4LF6I 3J81Q 3QT6A 3D4JA 2V2VA 3QT5A 2DEIA 4OOGC 3T1HI 1T4LB 4URLA 2F4VE 4DR3E 4LFBI 4DV5I 4DPUA 1NHIA 3B82A 2HKEA 2RTXA 1NZ0A 1IBME 4NXME 4DV3I 4B3TI 4B3RE 2ZITA 4DV0E 1YYKA 1XMOE 2KHXA 1HNWI 2ZM6E 4JI8E 2JY9A 2RS7A 4LFAI 1FKAE 1FI4A 2LJPA 1Z0GA 4P52A 1VISA 1J5EE 1RC7A 4X65E 2MDRA 2WW4A 2LRSA 1XNRI 2V2ZA 3ZKBA 2R42A 3ADGA 2EZ6A 1MG7A 3T1HE 1QU6A 1U2RA 1XHKA 4LFBE 1ELOA 4DV5E 3ZKDA 1FWKA 3ZZTA 5A2QC 4DV3E 2B3TB 2BM0A 4B3TE 5LMUI 1FNMA 1RR9A 4JI0I 2B7TA 1ZM4A 2R3VA 4USMA 4B3MI 4EMDA 2UXDE 1Z5CA 2DB2A 1HNWE 2LTSA 3CWVA 2UU9I 3M6AA 4JI5I 4LFAE 4Z7YA 5GMDA 1HNZI 2L3CA 4ZVIA 1WUUA 3PYDA 1XNRE 2L2MA 2Q2EB 4M2ZA 3P1XA 1Z0EA 2X36A 2CPNA 4JI4I 4DPTA 2HFSA 1BKNA 1HNXE 3WU6A 3J7AG 1N33I 3LLHA 1WHNA 2NA2A 4DUYI 1H7UA 1MX0A 2UXBI 2B7VA 1FWLA 4WUBA 4HYMA 1S16A 4HACA 4JI2E 1B63A 5LMUE 3C4BA 4JI0E 2LUQA 2V2QA 4B3RI 4GKKI 2BV3A 4DR5I 2UU9E 1N0VC 1DI2A 2N3GA 4JI5E 4HY1A 1EI1A 4WUCA 1HNZE 5A2QQ 4NXNI 1ZM3A 3K17A 4Z7CA 1HR0I 2UUAI 4DUZI 2VQFI 2DIXA 1KVKA 4XTJA 4JI7I 3ADJA 4OX9I 4JI4E 1S4EA 1N33E 2A2CA 2ZBKB 2UUCI 3JAMC 2AJ4A 4DUYE 3OTOI 1NHJA 2UXBE 1MU5A 2OI2A 1H73A 2A2DA 3HULA 4PU9A 1A6FA 4DR2I 5LMNI 2UXDI 4GKKE 3GONA 5FLXQ 4JYAI 1Z0CA 4DR5E 2L3JA 3K1JA 1RQ0A 4RPFA 4KHPI 4NXNE 4LF9I 4R1FA 2GS8A 1HR0E 4DR6I 4X66I 1Z5AA 2UUAE 2E5LI 4DUZE 2VQFE 4DU8A 4JI7E 4OX9E 1Z0BA 1Z0TA 3J80Q 1O0WA 1HNXI 2UUCE 1Z5BA 2LJHA 5IWAI 5IT9Q 4LF7I 3OTOE 1N0UA 2UXCI 2HK3A 1N36I 4JI2I 4DR2E 1N34I 4DV1I 5LMNE 4JYAE 1H74A 4K0KE 1ZM2A 4JI6I 5GMEA 1XMQI 3ZZ0A 1QZRA 4KHPE 4DV7I 4LF9E 4LF5I 1YYOA 4DR6E 4X66E 3V2UC 1ZBTA 2E5LE 1Z0WA 1X47A 4WYQB 1FJGI 4LF4I 3H4LA 4YY3I 4JG4A 1EKZA 1N32I 3LTOA 3J81C 2UUBI 5IWAE 2RS6A 1ZXNA 2HFUA 4LF7E 1Z59A 1T4OA 2UXCE 2DMYA 2YT4A 1N36E 1H72C 4GKJI 1OJ4A 3PYFA 2EFGA 2HHHI 1YYWA 2IHR1 1B62A 3T1YI 1N34E 4DV1E 1IBKI 3ZM7A 4DXLA 1KIJA 4DPWA 4X64I 3ADIA 3VYXA 4DR1I 4WUDA 4FWGA 4JI6E 3Q1QA 1XMQE 4JV5I 3F0NA 4B3SI 2RSMA 4DV7E 4JI3I 4LF5E 1K47A 2JVAA 1FJGE 4LF4E 4YY3E 1N32E 2UUBE 3WU3A 4LFCI 1Z0VA 4DV6I 1PIEA 4P7AA 3ZZUA 1D6TA 2NUGA 1XNQI 3PYGA 4M1KA 4GKJE 2LTRA 2HHHE 4DR7E 1ZXMA 3T1YE 2BM1A 3LPSA 2DEJA 1IBKE 2HK2A 4X8WA 3J7Yp 1UEKA 3VYYA 2E1RA 4X64E 4DR1E 4K0KI 3J7AM 4LF8I 4ED4A 4JV5E 4B3SE 4FW9A 4YHHI 2L2NA 4FWHA 4JI3E 1T4NA 4UT4A 2NUFA 1KKHA 1I94E 1DARA 1X48A 4M30A 2V34A 3QT8A 5L3JA 4LFCE 3QT7A 1STUA 3PYEA 4DV6E 4WFTA 4UTGA 1XNQE 2LUPB 1J26A 4DR4I 1UHZA 4AQYI 1GQEA 4LF6E 5CFFE 3JAMQ 3HTXA 4LF8E 5BR8I 4KQVA 4YHHE 1X49A 1KTVA 4DPXA 1IBLI 2V8PA 2VQEI 4DPYA 2XEXA 1PKPA 4PRVA 4JI1I 4MYTA 2NPFA 1YZ9A 4DV4I 4X62I 2L33A 3WU4A 4HACB 1UILA 4DU7A 2VF3A 2X7IA 4DR4E 1WHQA 2LBSB 4HXZA
chains in the Genus database with same CATH superfamily
2JOXA 1PVGA 2BB8A 4DV2I 4I8OA 2J7KA 4I3HA 4ZYEA 4AQYE 4DR7I 2VRDA 5DRPA 1MGTA 1WRJA 2DMIA 3H09A 2EN1A 2C37A 4FN5A 2JR1A 3B8HA 4ZYDA 4USKA 5T6JA 5LLQA 2LCEA 5BR8E 2HKJA 2NN6B 3B78A 3V5RA 2CZ9A 3L7ZA 5FLXC 2F4VI 2BA0G 2YRMA 1BBOA 1MEYC 2ENCA 4DR3I 2VF1A 5A6JA 5K36F 4DKKA 2WNRB 5KL5A 2EMBA 4KWYA 3LNUA 1A1IA 1IBLE 2YSPA 2CSHA 2GLIA 2VQEE 5JEAF 1IBMI 4NXMI 2LT7A 2CG9A 1I94I 2YTIA 4JI1E 1EH8A 1ZR9A 4B3ME 3ADLA 4R2RA 4DV4E 2WCC3 2N3HA 5LL6R 4X62E 4DV0I 1R6LA 4BS9A 1E3HA 2GHFA 5KL4A 1RREA 1UDNA 1XMOI 1H7SA 3KRNA 1GTKA 2EMCA 2EM6A 4JI8I 2ZM6I 4MYUA 4M0VA 1ZM9A 1NHHA 4FWDA 3C4TA 2EPAA 2EPOA 3J80C 2O1VA 4IS9A 1J5EI 2ELZA 1EA6A 4X65I 2EOOA 2IOPA 5IT9C 2EPRA 1T38A 3PS1A 1RHYA 4DV2E 3K85A 2NUEA 2BBGA 2L2KB 4BA1B 1A1HA 3WU5A 2Z5BA 2YU8A 4PRXA 4LF6I 2EM4A 2EMKA 3J81Q 2EMHA 3QT6A 3D4JA 3F6GA 4R2CA 2JP9A 2V2VA 3QT5A 2DEIA 4OOGC 3EPHA 3T1HI 1T4LB 4OO1D 2NN6F 4R2QA 4URLA 2F4VE 2ADRA 1KYQA 2RPCA 4MU1A 2EMWA 4DR3E 1YH8A 4LFBI 1Z1BA 2EQ1A 3P3EA 4DV5I 4DPUA 1NHIA 3B82A 1WJPA 1BB8A 2HKEA 2RTXA 1G2FC 3CDJA 5AE2A 1NZ0A 1IBME 4NXME 4DV3I 5LMUI 2JEAA 3NZKA 4B3TI 2DLQA 4B3RE 2FV4B 2V87A 2ZITA 3UK3C 4DV0E 2PO1A 2PNZB 1YYKA 5KL6A 1XMOE 2KHXA 1UN6B 1P42A 1HNWI 2L8TA 2ZM6E 4OO1C 4R2AA 4JI8E 2ELYA 1IQOA 2JY9A 2RS7A 4BA1A 4LFAI 3L00A 4LCHA 1FKAE 4O43A 2JYAA 1FI4A 2LJPA 1Z0GA 4P52A 1VISA 1J5EE 1RC7A 4X65E 2CGEA 2Z5EA 3PS2A 2YZTA 2MDRA 5AC5A 4BHBA 4IFDC 2I9IA 2WW4A 2LRSA 3AV0A 1XNRI 2V2ZA 3ZKBA 2R42A 4MU4A 3ADGA 2EZ6A 1MG7A 4MDTA 3T1HE 2EPPA 1JK2A 1UDOA 5K36E 3MHHC 2EOFA 2EOIA 3OMLA 1QU6A 4ISAA 2BA1D 1U2RA 2PO0B 3DF6A 1XHKA 2WBUA 5C0XC 3JU0A 4WXCA 2HJJA 4LFBE 1ELOA 2H36X 1USUA 5JEAE 4DV5E 1YUIA 4QNJA 5C0XF 3HKMA 3ZKDA 1FWKA 1WXRA 1TN9A 3ZZTA 4FW7A 4LTYA 4WX9A 1N3GA 2LV2A 4O4KA 4RH8A 2B3TB 5A2QC 4DV3E 4B3TE 1XXEA 2LJUA 2BM0A 2VESA 1FNMA 2RQLA 1RR9A 2IESA 1EH7A 2B7TA 3C6KA 1IMUA 1ZM4A 2R3VA 4JI0I 4USMA 4EMDA 2R76A 2UXDE 4HEIA 2EOSA 1Z5CA 4B3MI 1Y60A 2DB2A 1HNWE 1DGCA 2LTSA 3CWVA 2UU9I 2PO2B 3M6AA 2EMYA 5TSEA 4JI5I 2V83A 1F2IG 4LFAE 3M85D 5A69A 4Z7YA 2EMLA 5GMDA 1HNZI 4JYAI 5KL7A 2L3CA 4R2SA 3KZZA 4NHRA 2JEBB 4ZVIA 1P47A 4FK5C 3EPJA 1WUUA 3PYDA 1XNRE 2L2MA 2Q2EB 4MU3A 2NN6E 4J8ZA 4M2ZA 2V85A 5ELWA 2GQ0A 2JOBA 3IWCA 2EMGA 4F9AB 3P1XA 1Z0EA 2X36A 2EOQA 2R1FA 2CPNA 5AE1A 2Z5CA 4NBQA 4JI4I 5K36A 2M4IA 4DPTA 2HFSA 1BKNA 1HNXE 1UBDC 3WU6A 3J7AG 1N33I 3CDIA 3JTZA 1X6HA 2MDGA 3LLHA 1WHNA 5K36D 2EM0A 2NA2A 5JEAA 2DGCA 3IWDA 4QNKA 3Q6NA 2EPKX 1H7UA 1MX0A 4DUYI 2UXBI 2B7VA 1FWLA 3GCMA 4WUBA 1AH5A 2UXDI 4HYMA 1DQ3A 5A6KA 1S16A 2BR2B 5ADZA 2ENAA 4HACA 4JI2E 2PO2A 1B63A 5LMUE 3C4BA 4JI0E 3P76A 2LUQA 2V2QA 4P78A 3HXLA 4B3RI 4GKKI 2V86A 1PJSA 2EOYA 4O24A 2LVHA 4F9BB 2BV3A 4DR5I 3F6HA 2UU9E 2JE6A 1N0VC 5DNYA 1DI2A 4TUGA 4AIMA 2GO3A 4IZJB 2N3GA 4JI5E 4HY1A 3C6MA 1EI1A 3BF2A 2EOXA 2PNLA 4WUCA 4OO1B 1R6MA 1HNZE 5A2QQ 4WSGA 4NXNI 4AIDA 1ZM3A 2EN6A 3K17A 4Z7CA 5EL9A 4O5GA 1HR0I 2UUAI 4GZNC 2NN6A 4DUZI 2VQFI 4IFDB 1UDSA 4R8OA 2DIXA 1KVKA 4XTJA 4JI7I 3ADJA 4OX9I 4JI4E 2WNRA 4N3OA 4BMJA 2YTFA 4ZYHA 1S4EA 1N33E 2A2CA 2ZBKB 2EWLA 2G7HA 2UUCI 3JAMC 2LO3A 2YRKA 4MLVA 2AJ4A 1SR9A 4DUYE 1Y4SA 5C0XB 1NHJA 1JK1A 3OTOI 2EQ3A 2UXBE 2J7JA 1MU5A 2DRPA 2V89A 2OI2A 3QG5C 1H73A 2A2DA 3HULA 4J3DA 4PU9A 3H1CA 1A6FA 4BA2B 1TF6A 4DR2I 4MQYA 4R2DA 3P3CA 2FGGA 4GKKE 3GONA 5FLXQ 1Z0CA 4DR5E 5LMNI 2WBTA 2L3JA 2EPCA 3K1JA 4LCGA 2EMFA 1RQ0A 4RPFA 1YPNA 2NABA 2M9AA 1E3PA 3GLLA 4OO1F 2HGHA 2ENHA 5KL3A 2EOZA 3B4TA 4KHPI 4NXNE 2RSIA 4LF9I 4R1FA 2GS8A 2V88A 1HR0E 4DR6I 4X66I 1Z5AA 2UUAE 3BIDA 2K4VA 2E5LI 4DUZE 2VQFE 5DNXA 2EN4A 2JWOA 4IFDF 4DU8A 2BA0D 4LCFA 4RHBB 4JI7E 4F6MA 4OX9E 2WP8B 1Z0BA 1Z0TA 3J80Q 4MLQA 1IQSA 1O0WA 4IZKB 2UUCE 1HNXI 2EORA 4L5NC 1OYPA 2LJHA 1Z5BA 5IWAI 2PRTA 2MC6A 2JPAA 2F1DA 5IT9Q 4LF7I 2EM3A 2M1SA 3OTOE 1N0UA 2UXCI 2K7IA 2HK3A 1LLMC 4FW4A 2PNZA 3UHMA 1N36I 4AM3A 2DLKA 2EN3A 1YSAC 4OKGA 3LMLA 2EM9A 2D9HA 2EJ4A 3DJWA 2EPUA 4JI2I 4DR2E 4IJDA 1KJKA 2VE7C 4DV1I 1N34I 1HK7A 5LMNE 4JYAE 1YHCA 3GMEA 3Q6MA 1H74A 2L6MA 4K0KE 1ZM2A 3FIGA 4NZVA 3EPKA 5GMEA 1XMQI 2L92A 3ZZ0A 4JI6I 1QZRA 2C39B 2HC5A 2C37B 3HJCA 2EM2A 4KHPE 1OYSA 3U1YA 4DV7I 1Y6ZA 4LF9E 4LF5I 2EOMA 1YYOA 4DR6E 4X66E 3L7ZB 3V2UC 2MKNA 1ZBTA 2E5LE 1Z0WA 1X3CA 3KWRA 1X47A 4WYQB 3ZOQB 2A25A 2PO0A 1X6EA 2YTJA 3EPLA 1FJGI 4LF4I 2EN8A 3H4LA 4YY3I 4JG4A 1EKZA 2AE8A 1N32I 3LTOA 3J81C 2UUBI 5A6BA 2YU5A 2CT1A 4R2PA 3TQMA 4R2EA 5IWAE 3BBGA 4F2JC 2RS6A 1ZXNA 2HFUA 4LF7E 1Z59A 2YTPA 1PJQA 5A6BD 2EPMX 1Y4UA 2M7QA 2FTXB 3HPZA 1T4OA 2E1MA 2UXCE 5A6AA 2DMYA 2YT4A 2EM8A 3ECRA 1N36E 4HTGA 1AAYA 1H72C 1OJ4A 2EOHA 5JEAD 4GKJI 3PYFA 2EFGA 4BBYA 2HHHI 1YYWA 2IHR1 1B62A 3P06A 3T1YI 1BBGA 1A1GA 2WBSA 1N34E 4DV1E 1IBKI 4P7DA 3ZM7A 4MU0A 4DXLA 2V8QB 4LPFA 3KZYA 4L8NA 1KIJA 2C39A 5DNLA 4DPWA 4X64I 3ADIA 3VYXA 4F54A 4DR1I 4WUDA 2MC5A 4FWGA 4TUIA 2JEBA 2Z5BB 4JI6E 3Q1QA 1XMQE 4LU9A 4OO1E 5K36C 2YTQA 4JV5I 3F0NA 4F9CB 4B3SI 4IFDE 1TF3A 2RSMA 3M7NG 4BC7A 4DV7E 2BA1G 2EE8A 2MKDA 1YFHA 4LF5E 1GZ6A 5JEAC 4JI3I 5AE3A 2EQ0A 5KL2A 1K47A 1Y5YA 2ODRD 2CTDA 2EMXA 5DRRA 2JVAA 2N8XA 5F3WA 4LF4E 1FJGE 4GQUA 4YY3E 4R03A 2NN6D 2E72A 2YTNA 4KZSA 1N32E 1VI7A 2O1TA 5DRQA 3AUZA 2UUBE 3WU3A 5C0XE 4FW3A 4LFCI 3EQ1A 2JEAB 1Z0VA 1RMDA 2BR2A 4FW6A 4DV6I 2YPNA 3HPSA 1PIEA 5EKWA 4P7AA 3ZZUA 1D6TA 2NUGA 1XNQI 2YRHA 2PO1B 3PYGA 4M1KA 2EL5A 2Q8UA 1L4SA 4U3DA 4GKJE 1NEIA 2EL4A 2LTRA 3M85G 4N4RB 4DMIA 1A1KA 2HHHE 2YTGA 2ODRC 3T1YE 2LMZA 3RMPA 4DR7E 1ZXMA 2BM1A 2O3ZA 2O1UA 3LPSA 4IZJA 2YWQA 2DEJA 1IBKE 2YSOA 2HK2A 4OO1A 5DROA 4X8WA 5IV8B 3J7Yp 1UEKA 3VYYA 4IS1C 1UDQA 2E1RA 4X64E 1A1LA 2NN6C 4IZJD 4DR1E 4K0KI 3J7AM 3MHSC 2C38B 4LF8I 1OYRA 4ED4A 1X5WA 2EMIA 3HQ1A 4JV5E 3THNA 3VK6A 4B3SE 2WZOA 4IFDA 4FW9A 4YHHI 2L2NA 2EPNA 4FWHA 3BGHA 1T4NA 2EPZA 4JI3E 4UT4A 2IOQA 2NUFA 4WSPA 1KKHA 4IFDD 4BHCA 4GEQB 2YTEA 1I94E 2JT2A 1ZBQA 3K6QA 4FW5A 1DARA 1X48A 1PDAA 2EP3A 1ZAAC 1NCSA 4M30A 4Q28A 2I13A 2CVEA 2V34A 1SFEA 5C0XA 3QT8A 5L3JA 1EH6A 2B9DA 4LFCE 5AC4A 3QT7A 1STUA 3PYEA 2YTDA 4LOMA 4DV6E 4WFTA 4UTGA 5C0XD 1XNQE 2LUPB 1J26A 4BA2A 4DR4I 1ZU1A 2EM5A 2EPXA 1A1JA 2J65A 1B69A 1UHZA 2EL6A 2EMAA 2C38A 4AQYI 2LE2A 1GQEA 4LF6E 4ZYGA 2EOJA 2DSYA 3PS3A 1G2DC 2EN2A 5CFFE 3DD6A 4BC9A 4BCAA 2EOEA 3THOB 1USVA 3P3GA 3JAMQ 3HTXA 2F8BA 4LF8E 3M7ND 4F6NA 1QNTA 5BR8I 2PNMA 1X6FA 2O1WA 5FWKA 4KQVA 1T39A 1A1FA 3VHTB 4YHHE 4M9VC 2Z5CB 5K36B 1X49A 1KTVA 4DPXA 2JXPA 1IBLI 4WPYA 2EM7A 2EN7A 2WP8A 2V8PA 5AASA 4U3BA 5JEAB 2VQEI 4IZKA 1YUJA 4OZEA 4DPYA 2XEXA 1PKPA 4PRVA 4JI1I 1PJTA 2EPLX 4MYTA 2NPFA 1YZ9A 4DV4I 4X62I 2L33A 2GO4A 4WXDA 3MSWA 2IERA 2GPIA 3IWBA 3WU4A 3M99B 2EMZA 4HACB 4X9JA 2KOUA 3PRYA 1UILA 2KONA 4DU7A 2VF3A 2X7IA 4DR4E 3U1KA 1WHQA 5IXMB 4Q35B 4HXZA 2LBSB 2YTOA 2JE6B
chains in the Genus database with same CATH topology
2JOXA 1PVGA 4DV2I 4I8OA 2J7KA 4I3HA 4AQYE 4DR7I 3H09A 4FN5A 2JR1A 3B8HA 4USKA 5T6JA 2HKJA 5BR8E 3B78A 3V5RA 2CZ9A 2F4VI 5FLXC 4DR3I 2VF1A 4DKKA 3LNUA 1IBLE 2VQEE 1IBMI 4NXMI 2CG9A 1I94I 4JI1E 4B3ME 3ADLA 4DV4E 2N3HA 5LL6R 4X62E 4DV0I 4BS9A 1RREA 1XMOI 1H7SA 2ZM6I 4JI8I 4MYUA 4M0VA 1ZM9A 1NHHA 4FWDA 3C4TA 3J80C 2O1VA 1J5EI 1EA6A 4X65I 2IOPA 5IT9C 4DV2E 3K85A 2NUEA 2L2KB 3WU5A 2Z5BA 4PRXA 4LF6I 3J81Q 3QT6A 3D4JA 3F6GA 2V2VA 3QT5A 2DEIA 4OOGC 3T1HI 1T4LB 4URLA 2F4VE 4DR3E 4LFBI 4DV5I 4DPUA 1NHIA 3B82A 2HKEA 2RTXA 5AE2A 1NZ0A 1IBME 4NXME 4DV3I 4B3TI 4B3RE 2FV4B 2V87A 2ZITA 4DV0E 1YYKA 1XMOE 2KHXA 1HNWI 2L8TA 2ZM6E 4JI8E 2JY9A 2RS7A 4LFAI 1FKAE 1FI4A 2LJPA 1Z0GA 4P52A 1VISA 1J5EE 1RC7A 4X65E 2CGEA 2Z5EA 2YZTA 2MDRA 2WW4A 2LRSA 3AV0A 1XNRI 2V2ZA 3ZKBA 2R42A 3ADGA 2EZ6A 1MG7A 3T1HE 3OMLA 1QU6A 1U2RA 3DF6A 1XHKA 3JU0A 4LFBE 1ELOA 1USUA 2H36X 4DV5E 3ZKDA 1FWKA 1WXRA 3ZZTA 4LTYA 5A2QC 4DV3E 2B3TB 2BM0A 4B3TE 5LMUI 1FNMA 1RR9A 4JI0I 2B7TA 1ZM4A 2R3VA 4USMA 4B3MI 4EMDA 2UXDE 1Z5CA 2DB2A 1HNWE 2LTSA 3CWVA 2UU9I 3M6AA 4JI5I 2V83A 4LFAE 4Z7YA 5GMDA 1HNZI 2L3CA 4ZVIA 1WUUA 3PYDA 1XNRE 2L2MA 2Q2EB 4J8ZA 4M2ZA 2V85A 2GQ0A 2JOBA 3IWCA 4F9AB 3P1XA 1Z0EA 2X36A 2CPNA 5AE1A 2Z5CA 4JI4I 2M4IA 4DPTA 2HFSA 1BKNA 1HNXE 3WU6A 3J7AG 1N33I 3JTZA 3LLHA 1WHNA 2NA2A 3IWDA 4DUYI 3Q6NA 1H7UA 1MX0A 2UXBI 2B7VA 1FWLA 4WUBA 4HYMA 1DQ3A 1S16A 5ADZA 4HACA 4JI2E 1B63A 5LMUE 3C4BA 4JI0E 2LUQA 2V2QA 4P78A 3HXLA 4B3RI 4GKKI 2V86A 4F9BB 2BV3A 4DR5I 3F6HA 2UU9E 1N0VC 5DNYA 1DI2A 4TUGA 4IZJB 2N3GA 4JI5E 4HY1A 1EI1A 2PNLA 4WUCA 1HNZE 5A2QQ 4NXNI 1ZM3A 3K17A 4Z7CA 1HR0I 2UUAI 4DUZI 2VQFI 4R8OA 2DIXA 1KVKA 4XTJA 4JI7I 3ADJA 4OX9I 4JI4E 4N3OA 4BMJA 1S4EA 1N33E 2A2CA 2ZBKB 2EWLA 2G7HA 2UUCI 3JAMC 2AJ4A 1SR9A 4DUYE 1Y4SA 3OTOI 1NHJA 2UXBE 1MU5A 2V89A 2OI2A 1H73A 2A2DA 3HULA 4PU9A 1A6FA 4DR2I 5LMNI 2UXDI 2FGGA 4GKKE 3GONA 5FLXQ 1Z0CA 4DR5E 4JYAI 2L3JA 3K1JA 1RQ0A 4RPFA 4KHPI 4NXNE 4LF9I 4R1FA 2GS8A 2V88A 1HR0E 4DR6I 4X66I 1Z5AA 2UUAE 2K4VA 2E5LI 4DUZE 2VQFE 2JWOA 4DU8A 4JI7E 4OX9E 1Z0BA 1Z0TA 3J80Q 1O0WA 4IZKB 2UUCE 1HNXI 1Z5BA 4L5NC 2LJHA 5IWAI 5IT9Q 2MC6A 4LF7I 2M1SA 3OTOE 1N0UA 2UXCI 2HK3A 1N36I 3LMLA 3DJWA 4JI2I 4DR2E 1N34I 2VE7C 4DV1I 1HK7A 5LMNE 4JYAE 3Q6MA 1H74A 2L6MA 4K0KE 1ZM2A 3FIGA 4JI6I 5GMEA 1XMQI 2L92A 3ZZ0A 1QZRA 3HJCA 4KHPE 4DV7I 1Y6ZA 4LF9E 4LF5I 1YYOA 4DR6E 4X66E 3V2UC 1ZBTA 2E5LE 1Z0WA 3KWRA 1X47A 4WYQB 3ZOQB 1FJGI 4LF4I 3H4LA 4YY3I 4JG4A 1EKZA 1N32I 3LTOA 3J81C 2UUBI 5IWAE 2RS6A 1ZXNA 2HFUA 4LF7E 1Z59A 1Y4UA 2M7QA 2FTXB 3HPZA 1T4OA 2E1MA 2UXCE 2DMYA 2YT4A 1N36E 1H72C 4GKJI 1OJ4A 3PYFA 2EFGA 4BBYA 2HHHI 1YYWA 2IHR1 1B62A 3P06A 3T1YI 1N34E 4DV1E 1IBKI 4P7DA 3ZM7A 4DXLA 2V8QB 4L8NA 1KIJA 4DPWA 4X64I 3ADIA 3VYXA 4F54A 4DR1I 4WUDA 2MC5A 4FWGA 4TUIA 2Z5BB 4JI6E 3Q1QA 1XMQE 4LU9A 4JV5I 3F0NA 4F9CB 4B3SI 2RSMA 4BC7A 4DV7E 4JI3I 4LF5E 1GZ6A 5AE3A 1K47A 2ODRD 2JVAA 1FJGE 5F3WA 4LF4E 4YY3E 4R03A 1N32E 4KZSA 2O1TA 3AUZA 2UUBE 3WU3A 4LFCI 1Z0VA 4DV6I 3HPSA 1PIEA 4P7AA 3ZZUA 1D6TA 2NUGA 1XNQI 3PYGA 4M1KA 4GKJE 2LTRA 4DMIA 2HHHE 4DR7E 2ODRC 3T1YE 2LMZA 3RMPA 1ZXMA 2BM1A 2O1UA 3LPSA 4IZJA 2DEJA 1IBKE 2HK2A 4X8WA 3J7Yp 1UEKA 3VYYA 2E1RA 4X64E 4IZJD 4DR1E 4K0KI 3J7AM 4LF8I 4ED4A 3HQ1A 4JV5E 3VK6A 4B3SE 2WZOA 4FW9A 4YHHI 2L2NA 4FWHA 4JI3E 1T4NA 4UT4A 2IOQA 2NUFA 4WSPA 1KKHA 4GEQB 1I94E 1ZBQA 3K6QA 1DARA 1X48A 4M30A 2V34A 4Q28A 3QT8A 5L3JA 2B9DA 4LFCE 3QT7A 1STUA 3PYEA 4DV6E 4WFTA 4UTGA 1XNQE 2LUPB 1J26A 4DR4I 1UHZA 4AQYI 2LE2A 1GQEA 4LF6E 2DSYA 5CFFE 4BC9A 4BCAA 1USVA 3JAMQ 3HTXA 2F8BA 4LF8E 5BR8I 2PNMA 2O1WA 5FWKA 4KQVA 4YHHE 2Z5CB 1X49A 1KTVA 4DPXA 1IBLI 4WPYA 2V8PA 5AASA 2VQEI 4IZKA 4DPYA 2XEXA 1PKPA 4PRVA 4JI1I 4MYTA 2NPFA 1YZ9A 4DV4I 4X62I 2L33A 3MSWA 3IWBA 3WU4A 4HACB 2KOUA 3PRYA 1UILA 2KONA 4DU7A 2VF3A 2X7IA 4DR4E 1WHQA 2LBSB 4HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVG A;  4DV2 I;  2J7K A;  4I3H A;  4AQY E;  4DR7 I;  4FN5 A;  3B8H A;  4USK A;  2HKJ A;  5BR8 E;  3B78 A;  3V5R A;  2CZ9 A;  2F4V I;  5FLX C;  4DR3 I;  4DKK A;  3LNU A;  1IBL E;  2VQE E;  1IBM I;  4NXM I;  1I94 I;  4JI1 E;  4B3M E;  3ADL A;  4DV4 E;  2N3H A;  4X62 E;  5LL6 R;  4DV0 I;  1RRE A;  1XMO I;  1H7S A;  2ZM6 I;  4JI8 I;  4MYU A;  1ZM9 A;  1NHH A;  4FWD A;  3C4T A;  3J80 C;  1J5E I;  1EA6 A;  4X65 I;  5IT9 C;  4DV2 E;  2NUE A;  2L2K B;  3WU5 A;  4PRX A;  4LF6 I;  3J81 Q;  3QT6 A;  3D4J A;  2V2V A;  3QT5 A;  2DEI A;  4OOG C;  3T1H I;  1T4L B;  4URL A;  2F4V E;  4DR3 E;  4LFB I;  4DV5 I;  4DPU A;  1NHI A;  3B82 A;  2HKE A;  2RTX A;  1NZ0 A;  1IBM E;  4NXM E;  4DV3 I;  4B3T I;  4B3R E;  2ZIT A;  4DV0 E;  1YYK A;  1XMO E;  2KHX A;  1HNW I;  2ZM6 E;  4JI8 E;  2JY9 A;  2RS7 A;  4LFA I;  1FKA E;  1FI4 A;  2LJP A;  1Z0G A;  4P52 A;  1VIS A;  1J5E E;  1RC7 A;  4X65 E;  2MDR A;  2WW4 A;  2LRS A;  1XNR I;  2V2Z A;  3ZKB A;  2R42 A;  3ADG A;  2EZ6 A;  1MG7 A;  3T1H E;  1QU6 A;  1U2R A;  1XHK A;  4LFB E;  1ELO A;  4DV5 E;  3ZKD A;  1FWK A;  3ZZT A;  5A2Q C;  4DV3 E;  2B3T B;  2BM0 A;  4B3T E;  5LMU I;  1FNM A;  1RR9 A;  4JI0 I;  2B7T A;  1ZM4 A;  2R3V A;  4USM A;  4B3M I;  4EMD A;  2UXD E;  1Z5C A;  2DB2 A;  1HNW E;  2LTS A;  3CWV A;  2UU9 I;  3M6A A;  4JI5 I;  4LFA E;  4Z7Y A;  5GMD A;  1HNZ I;  2L3C A;  4ZVI A;  1WUU A;  3PYD A;  1XNR E;  2L2M A;  2Q2E B;  4M2Z A;  3P1X A;  1Z0E A;  2X36 A;  2CPN A;  4JI4 I;  4DPT A;  2HFS A;  1BKN A;  1HNX E;  3WU6 A;  3J7A G;  1N33 I;  3LLH A;  1WHN A;  2NA2 A;  4DUY I;  1H7U A;  1MX0 A;  2UXB I;  2B7V A;  1FWL A;  4WUB A;  4HYM A;  1S16 A;  4HAC A;  4JI2 E;  1B63 A;  5LMU E;  3C4B A;  4JI0 E;  2LUQ A;  2V2Q A;  4B3R I;  4GKK I;  2BV3 A;  4DR5 I;  2UU9 E;  1N0V C;  1DI2 A;  2N3G A;  4JI5 E;  4HY1 A;  1EI1 A;  4WUC A;  1HNZ E;  5A2Q Q;  4NXN I;  1ZM3 A;  3K17 A;  4Z7C A;  1HR0 I;  2UUA I;  4DUZ I;  2VQF I;  2DIX A;  1KVK A;  4XTJ A;  4JI7 I;  3ADJ A;  4OX9 I;  4JI4 E;  1S4E A;  1N33 E;  2A2C A;  2ZBK B;  2UUC I;  3JAM C;  2AJ4 A;  4DUY E;  3OTO I;  1NHJ A;  2UXB E;  1MU5 A;  2OI2 A;  1H73 A;  2A2D A;  3HUL A;  4PU9 A;  1A6F A;  4DR2 I;  5LMN I;  2UXD I;  4GKK E;  3GON A;  5FLX Q;  4JYA I;  1Z0C A;  4DR5 E;  2L3J A;  3K1J A;  1RQ0 A;  4RPF A;  4KHP I;  4NXN E;  4LF9 I;  4R1F A;  2GS8 A;  1HR0 E;  4DR6 I;  4X66 I;  1Z5A A;  2UUA E;  2E5L I;  4DUZ E;  2VQF E;  4DU8 A;  4JI7 E;  4OX9 E;  1Z0B A;  1Z0T A;  3J80 Q;  1O0W A;  1HNX I;  2UUC E;  1Z5B A;  2LJH A;  5IWA I;  5IT9 Q;  4LF7 I;  3OTO E;  1N0U A;  2UXC I;  2HK3 A;  1N36 I;  4JI2 I;  4DR2 E;  1N34 I;  4DV1 I;  5LMN E;  4JYA E;  1H74 A;  4K0K E;  1ZM2 A;  4JI6 I;  5GME A;  1XMQ I;  3ZZ0 A;  1QZR A;  4KHP E;  4DV7 I;  4LF9 E;  4LF5 I;  1YYO A;  4DR6 E;  4X66 E;  3V2U C;  1ZBT A;  2E5L E;  1Z0W A;  1X47 A;  4WYQ B;  1FJG I;  4LF4 I;  3H4L A;  4YY3 I;  4JG4 A;  1EKZ A;  1N32 I;  3LTO A;  3J81 C;  2UUB I;  5IWA E;  2RS6 A;  1ZXN A;  2HFU A;  4LF7 E;  1Z59 A;  1T4O A;  2UXC E;  2DMY A;  2YT4 A;  1N36 E;  1H72 C;  4GKJ I;  1OJ4 A;  3PYF A;  2EFG A;  2HHH I;  1YYW A;  2IHR 1;  1B62 A;  3T1Y I;  1N34 E;  4DV1 E;  1IBK I;  3ZM7 A;  4DXL A;  1KIJ A;  4DPW A;  4X64 I;  3ADI A;  3VYX A;  4DR1 I;  4WUD A;  4FWG A;  4JI6 E;  3Q1Q A;  1XMQ E;  4JV5 I;  3F0N A;  4B3S I;  2RSM A;  4DV7 E;  4JI3 I;  4LF5 E;  1K47 A;  2JVA A;  1FJG E;  4LF4 E;  4YY3 E;  1N32 E;  2UUB E;  3WU3 A;  4LFC I;  1Z0V A;  4DV6 I;  1PIE A;  4P7A A;  3ZZU A;  1D6T A;  2NUG A;  1XNQ I;  3PYG A;  4M1K A;  4GKJ E;  2LTR A;  2HHH E;  4DR7 E;  1ZXM A;  3T1Y E;  2BM1 A;  3LPS A;  2DEJ A;  1IBK E;  2HK2 A;  4X8W A;  3J7Y p;  1UEK A;  3VYY A;  2E1R A;  4X64 E;  4DR1 E;  4K0K I;  3J7A M;  4LF8 I;  4ED4 A;  4JV5 E;  4B3S E;  4FW9 A;  4YHH I;  2L2N A;  4FWH A;  4JI3 E;  1T4N A;  4UT4 A;  2NUF A;  1KKH A;  1I94 E;  1DAR A;  1X48 A;  4M30 A;  2V34 A;  3QT8 A;  5L3J A;  4LFC E;  3QT7 A;  1STU A;  3PYE A;  4DV6 E;  4WFT A;  4UTG A;  1XNQ E;  2LUP B;  1J26 A;  4DR4 I;  1UHZ A;  4AQY I;  1GQE A;  4LF6 E;  5CFF E;  3JAM Q;  3HTX A;  4LF8 E;  5BR8 I;  4KQV A;  4YHH E;  1X49 A;  1KTV A;  4DPX A;  1IBL I;  2V8P A;  2VQE I;  4DPY A;  2XEX A;  1PKP A;  4PRV A;  4JI1 I;  4MYT A;  2NPF A;  1YZ9 A;  4DV4 I;  4X62 I;  2L33 A;  3WU4 A;  4HAC B;  1UIL A;  4DU7 A;  2VF3 A;  2X7I A;  4DR4 E;  1WHQ A;  2LBS B;  4HXZ A; 
#chains in the Genus database with same CATH topology
 2JOX A;  1PVG A;  2BB8 A;  4DV2 I;  4I8O A;  2J7K A;  4I3H A;  4ZYE A;  4AQY E;  4DR7 I;  2VRD A;  5DRP A;  1MGT A;  1WRJ A;  2DMI A;  3H09 A;  2EN1 A;  2C37 A;  4FN5 A;  2JR1 A;  3B8H A;  4ZYD A;  4USK A;  5T6J A;  5LLQ A;  2LCE A;  5BR8 E;  2HKJ A;  2NN6 B;  3B78 A;  3V5R A;  2CZ9 A;  3L7Z A;  5FLX C;  2F4V I;  2BA0 G;  2YRM A;  1BBO A;  1MEY C;  2ENC A;  4DR3 I;  2VF1 A;  5A6J A;  5K36 F;  4DKK A;  2WNR B;  5KL5 A;  2EMB A;  4KWY A;  3LNU A;  1A1I A;  1IBL E;  2YSP A;  2CSH A;  2GLI A;  2VQE E;  5JEA F;  1IBM I;  4NXM I;  2LT7 A;  2CG9 A;  1I94 I;  2YTI A;  4JI1 E;  1EH8 A;  1ZR9 A;  4B3M E;  3ADL A;  4R2R A;  4DV4 E;  2WCC 3;  2N3H A;  5LL6 R;  4X62 E;  4DV0 I;  1R6L A;  4BS9 A;  1E3H A;  2GHF A;  5KL4 A;  1RRE A;  1UDN A;  1XMO I;  1H7S A;  3KRN A;  1GTK A;  2EMC A;  2EM6 A;  4JI8 I;  2ZM6 I;  4MYU A;  4M0V A;  1ZM9 A;  1NHH A;  4FWD A;  3C4T A;  2EPA A;  2EPO A;  3J80 C;  2O1V A;  4IS9 A;  1J5E I;  2ELZ A;  1EA6 A;  4X65 I;  2EOO A;  2IOP A;  5IT9 C;  2EPR A;  1T38 A;  3PS1 A;  1RHY A;  4DV2 E;  3K85 A;  2NUE A;  2BBG A;  2L2K B;  4BA1 B;  1A1H A;  3WU5 A;  2Z5B A;  2YU8 A;  4PRX A;  4LF6 I;  2EM4 A;  2EMK A;  3J81 Q;  2EMH A;  3QT6 A;  3D4J A;  3F6G A;  4R2C A;  2JP9 A;  2V2V A;  3QT5 A;  2DEI A;  4OOG C;  3EPH A;  3T1H I;  1T4L B;  4OO1 D;  2NN6 F;  4R2Q A;  4URL A;  2F4V E;  2ADR A;  1KYQ A;  2RPC A;  4MU1 A;  2EMW A;  4DR3 E;  1YH8 A;  4LFB I;  1Z1B A;  2EQ1 A;  3P3E A;  4DV5 I;  4DPU A;  1NHI A;  3B82 A;  1WJP A;  1BB8 A;  2HKE A;  2RTX A;  1G2F C;  3CDJ A;  5AE2 A;  1NZ0 A;  1IBM E;  4NXM E;  4DV3 I;  5LMU I;  2JEA A;  3NZK A;  4B3T I;  2DLQ A;  4B3R E;  2FV4 B;  2V87 A;  2ZIT A;  3UK3 C;  4DV0 E;  2PO1 A;  2PNZ B;  1YYK A;  5KL6 A;  1XMO E;  2KHX A;  1UN6 B;  1P42 A;  1HNW I;  2L8T A;  2ZM6 E;  4OO1 C;  4R2A A;  4JI8 E;  2ELY A;  1IQO A;  2JY9 A;  2RS7 A;  4BA1 A;  4LFA I;  3L00 A;  4LCH A;  1FKA E;  4O43 A;  2JYA A;  1FI4 A;  2LJP A;  1Z0G A;  4P52 A;  1VIS A;  1J5E E;  1RC7 A;  4X65 E;  2CGE A;  2Z5E A;  3PS2 A;  2YZT A;  2MDR A;  5AC5 A;  4BHB A;  4IFD C;  2I9I A;  2WW4 A;  2LRS A;  3AV0 A;  1XNR I;  2V2Z A;  3ZKB A;  2R42 A;  4MU4 A;  3ADG A;  2EZ6 A;  1MG7 A;  4MDT A;  3T1H E;  2EPP A;  1JK2 A;  1UDO A;  5K36 E;  3MHH C;  2EOF A;  2EOI A;  3OML A;  1QU6 A;  4ISA A;  2BA1 D;  1U2R A;  2PO0 B;  3DF6 A;  1XHK A;  2WBU A;  5C0X C;  3JU0 A;  4WXC A;  2HJJ A;  4LFB E;  1ELO A;  2H36 X;  1USU A;  5JEA E;  4DV5 E;  1YUI A;  4QNJ A;  5C0X F;  3HKM A;  3ZKD A;  1FWK A;  1WXR A;  1TN9 A;  3ZZT A;  4FW7 A;  4LTY A;  4WX9 A;  1N3G A;  2LV2 A;  4O4K A;  4RH8 A;  2B3T B;  5A2Q C;  4DV3 E;  4B3T E;  1XXE A;  2LJU A;  2BM0 A;  2VES A;  1FNM A;  2RQL A;  1RR9 A;  2IES A;  1EH7 A;  2B7T A;  3C6K A;  1IMU A;  1ZM4 A;  2R3V A;  4JI0 I;  4USM A;  4EMD A;  2R76 A;  2UXD E;  4HEI A;  2EOS A;  1Z5C A;  4B3M I;  1Y60 A;  2DB2 A;  1HNW E;  1DGC A;  2LTS A;  3CWV A;  2UU9 I;  2PO2 B;  3M6A A;  2EMY A;  5TSE A;  4JI5 I;  2V83 A;  1F2I G;  4LFA E;  3M85 D;  5A69 A;  4Z7Y A;  2EML A;  5GMD A;  1HNZ I;  4JYA I;  5KL7 A;  2L3C A;  4R2S A;  3KZZ A;  4NHR A;  2JEB B;  4ZVI A;  1P47 A;  4FK5 C;  3EPJ A;  1WUU A;  3PYD A;  1XNR E;  2L2M A;  2Q2E B;  4MU3 A;  2NN6 E;  4J8Z A;  4M2Z A;  2V85 A;  5ELW A;  2GQ0 A;  2JOB A;  3IWC A;  2EMG A;  4F9A B;  3P1X A;  1Z0E A;  2X36 A;  2EOQ A;  2R1F A;  2CPN A;  5AE1 A;  2Z5C A;  4NBQ A;  4JI4 I;  5K36 A;  2M4I A;  4DPT A;  2HFS A;  1BKN A;  1HNX E;  1UBD C;  3WU6 A;  3J7A G;  1N33 I;  3CDI A;  3JTZ A;  1X6H A;  2MDG A;  3LLH A;  1WHN A;  5K36 D;  2EM0 A;  2NA2 A;  5JEA A;  2DGC A;  3IWD A;  4QNK A;  3Q6N A;  2EPK X;  1H7U A;  1MX0 A;  4DUY I;  2UXB I;  2B7V A;  1FWL A;  3GCM A;  4WUB A;  1AH5 A;  2UXD I;  4HYM A;  1DQ3 A;  5A6K A;  1S16 A;  2BR2 B;  5ADZ A;  2ENA A;  4HAC A;  4JI2 E;  2PO2 A;  1B63 A;  5LMU E;  3C4B A;  4JI0 E;  3P76 A;  2LUQ A;  2V2Q A;  4P78 A;  3HXL A;  4B3R I;  4GKK I;  2V86 A;  1PJS A;  2EOY A;  4O24 A;  2LVH A;  4F9B B;  2BV3 A;  4DR5 I;  3F6H A;  2UU9 E;  2JE6 A;  1N0V C;  5DNY A;  1DI2 A;  4TUG A;  4AIM A;  2GO3 A;  4IZJ B;  2N3G A;  4JI5 E;  4HY1 A;  3C6M A;  1EI1 A;  3BF2 A;  2EOX A;  2PNL A;  4WUC A;  4OO1 B;  1R6M A;  1HNZ E;  5A2Q Q;  4WSG A;  4NXN I;  4AID A;  1ZM3 A;  2EN6 A;  3K17 A;  4Z7C A;  5EL9 A;  4O5G A;  1HR0 I;  2UUA I;  4GZN C;  2NN6 A;  4DUZ I;  2VQF I;  4IFD B;  1UDS A;  4R8O A;  2DIX A;  1KVK A;  4XTJ A;  4JI7 I;  3ADJ A;  4OX9 I;  4JI4 E;  2WNR A;  4N3O A;  4BMJ A;  2YTF A;  4ZYH A;  1S4E A;  1N33 E;  2A2C A;  2ZBK B;  2EWL A;  2G7H A;  2UUC I;  3JAM C;  2LO3 A;  2YRK A;  4MLV A;  2AJ4 A;  1SR9 A;  4DUY E;  1Y4S A;  5C0X B;  1NHJ A;  1JK1 A;  3OTO I;  2EQ3 A;  2UXB E;  2J7J A;  1MU5 A;  2DRP A;  2V89 A;  2OI2 A;  3QG5 C;  1H73 A;  2A2D A;  3HUL A;  4J3D A;  4PU9 A;  3H1C A;  1A6F A;  4BA2 B;  1TF6 A;  4DR2 I;  4MQY A;  4R2D A;  3P3C A;  2FGG A;  4GKK E;  3GON A;  5FLX Q;  1Z0C A;  4DR5 E;  5LMN I;  2WBT A;  2L3J A;  2EPC A;  3K1J A;  4LCG A;  2EMF A;  1RQ0 A;  4RPF A;  1YPN A;  2NAB A;  2M9A A;  1E3P A;  3GLL A;  4OO1 F;  2HGH A;  2ENH A;  5KL3 A;  2EOZ A;  3B4T A;  4KHP I;  4NXN E;  2RSI A;  4LF9 I;  4R1F A;  2GS8 A;  2V88 A;  1HR0 E;  4DR6 I;  4X66 I;  1Z5A A;  2UUA E;  3BID A;  2K4V A;  2E5L I;  4DUZ E;  2VQF E;  5DNX A;  2EN4 A;  2JWO A;  4IFD F;  4DU8 A;  2BA0 D;  4LCF A;  4RHB B;  4JI7 E;  4F6M A;  4OX9 E;  2WP8 B;  1Z0B A;  1Z0T A;  3J80 Q;  4MLQ A;  1IQS A;  1O0W A;  4IZK B;  2UUC E;  1HNX I;  2EOR A;  4L5N C;  1OYP A;  2LJH A;  1Z5B A;  5IWA I;  2PRT A;  2MC6 A;  2JPA A;  2F1D A;  5IT9 Q;  4LF7 I;  2EM3 A;  2M1S A;  3OTO E;  1N0U A;  2UXC I;  2K7I A;  2HK3 A;  1LLM C;  4FW4 A;  2PNZ A;  3UHM A;  1N36 I;  4AM3 A;  2DLK A;  2EN3 A;  1YSA C;  4OKG A;  3LML A;  2EM9 A;  2D9H A;  2EJ4 A;  3DJW A;  2EPU A;  4JI2 I;  4DR2 E;  4IJD A;  1KJK A;  2VE7 C;  4DV1 I;  1N34 I;  1HK7 A;  5LMN E;  4JYA E;  1YHC A;  3GME A;  3Q6M A;  1H74 A;  2L6M A;  4K0K E;  1ZM2 A;  3FIG A;  4NZV A;  3EPK A;  5GME A;  1XMQ I;  2L92 A;  3ZZ0 A;  4JI6 I;  1QZR A;  2C39 B;  2HC5 A;  2C37 B;  3HJC A;  2EM2 A;  4KHP E;  1OYS A;  3U1Y A;  4DV7 I;  1Y6Z A;  4LF9 E;  4LF5 I;  2EOM A;  1YYO A;  4DR6 E;  4X66 E;  3L7Z B;  3V2U C;  2MKN A;  1ZBT A;  2E5L E;  1Z0W A;  1X3C A;  3KWR A;  1X47 A;  4WYQ B;  3ZOQ B;  2A25 A;  2PO0 A;  1X6E A;  2YTJ A;  3EPL A;  1FJG I;  4LF4 I;  2EN8 A;  3H4L A;  4YY3 I;  4JG4 A;  1EKZ A;  2AE8 A;  1N32 I;  3LTO A;  3J81 C;  2UUB I;  5A6B A;  2YU5 A;  2CT1 A;  4R2P A;  3TQM A;  4R2E A;  5IWA E;  3BBG A;  4F2J C;  2RS6 A;  1ZXN A;  2HFU A;  4LF7 E;  1Z59 A;  2YTP A;  1PJQ A;  5A6B D;  2EPM X;  1Y4U A;  2M7Q A;  2FTX B;  3HPZ A;  1T4O A;  2E1M A;  2UXC E;  5A6A A;  2DMY A;  2YT4 A;  2EM8 A;  3ECR A;  1N36 E;  4HTG A;  1AAY A;  1H72 C;  1OJ4 A;  2EOH A;  5JEA D;  4GKJ I;  3PYF A;  2EFG A;  4BBY A;  2HHH I;  1YYW A;  2IHR 1;  1B62 A;  3P06 A;  3T1Y I;  1BBG A;  1A1G A;  2WBS A;  1N34 E;  4DV1 E;  1IBK I;  4P7D A;  3ZM7 A;  4MU0 A;  4DXL A;  2V8Q B;  4LPF A;  3KZY A;  4L8N A;  1KIJ A;  2C39 A;  5DNL A;  4DPW A;  4X64 I;  3ADI A;  3VYX A;  4F54 A;  4DR1 I;  4WUD A;  2MC5 A;  4FWG A;  4TUI A;  2JEB A;  2Z5B B;  4JI6 E;  3Q1Q A;  1XMQ E;  4LU9 A;  4OO1 E;  5K36 C;  2YTQ A;  4JV5 I;  3F0N A;  4F9C B;  4B3S I;  4IFD E;  1TF3 A;  2RSM A;  3M7N G;  4BC7 A;  4DV7 E;  2BA1 G;  2EE8 A;  2MKD A;  1YFH A;  4LF5 E;  1GZ6 A;  5JEA C;  4JI3 I;  5AE3 A;  2EQ0 A;  5KL2 A;  1K47 A;  1Y5Y A;  2ODR D;  2CTD A;  2EMX A;  5DRR A;  2JVA A;  2N8X A;  5F3W A;  4LF4 E;  1FJG E;  4GQU A;  4YY3 E;  4R03 A;  2NN6 D;  2E72 A;  2YTN A;  4KZS A;  1N32 E;  1VI7 A;  2O1T A;  5DRQ A;  3AUZ A;  2UUB E;  3WU3 A;  5C0X E;  4FW3 A;  4LFC I;  3EQ1 A;  2JEA B;  1Z0V A;  1RMD A;  2BR2 A;  4FW6 A;  4DV6 I;  2YPN A;  3HPS A;  1PIE A;  5EKW A;  4P7A A;  3ZZU A;  1D6T A;  2NUG A;  1XNQ I;  2YRH A;  2PO1 B;  3PYG A;  4M1K A;  2EL5 A;  2Q8U A;  1L4S A;  4U3D A;  4GKJ E;  1NEI A;  2EL4 A;  2LTR A;  3M85 G;  4N4R B;  4DMI A;  1A1K A;  2HHH E;  2YTG A;  2ODR C;  3T1Y E;  2LMZ A;  3RMP A;  4DR7 E;  1ZXM A;  2BM1 A;  2O3Z A;  2O1U A;  3LPS A;  4IZJ A;  2YWQ A;  2DEJ A;  1IBK E;  2YSO A;  2HK2 A;  4OO1 A;  5DRO A;  4X8W A;  5IV8 B;  3J7Y p;  1UEK A;  3VYY A;  4IS1 C;  1UDQ A;  2E1R A;  4X64 E;  1A1L A;  2NN6 C;  4IZJ D;  4DR1 E;  4K0K I;  3J7A M;  3MHS C;  2C38 B;  4LF8 I;  1OYR A;  4ED4 A;  1X5W A;  2EMI A;  3HQ1 A;  4JV5 E;  3THN A;  3VK6 A;  4B3S E;  2WZO A;  4IFD A;  4FW9 A;  4YHH I;  2L2N A;  2EPN A;  4FWH A;  3BGH A;  1T4N A;  2EPZ A;  4JI3 E;  4UT4 A;  2IOQ A;  2NUF A;  4WSP A;  1KKH A;  4IFD D;  4BHC A;  4GEQ B;  2YTE A;  1I94 E;  2JT2 A;  1ZBQ A;  3K6Q A;  4FW5 A;  1DAR A;  1X48 A;  1PDA A;  2EP3 A;  1ZAA C;  1NCS A;  4M30 A;  4Q28 A;  2I13 A;  2CVE A;  2V34 A;  1SFE A;  5C0X A;  3QT8 A;  5L3J A;  1EH6 A;  2B9D A;  4LFC E;  5AC4 A;  3QT7 A;  1STU A;  3PYE A;  2YTD A;  4LOM A;  4DV6 E;  4WFT A;  4UTG A;  5C0X D;  1XNQ E;  2LUP B;  1J26 A;  4BA2 A;  4DR4 I;  1ZU1 A;  2EM5 A;  2EPX A;  1A1J A;  2J65 A;  1B69 A;  1UHZ A;  2EL6 A;  2EMA A;  2C38 A;  4AQY I;  2LE2 A;  1GQE A;  4LF6 E;  4ZYG A;  2EOJ A;  2DSY A;  3PS3 A;  1G2D C;  2EN2 A;  5CFF E;  3DD6 A;  4BC9 A;  4BCA A;  2EOE A;  3THO B;  1USV A;  3P3G A;  3JAM Q;  3HTX A;  2F8B A;  4LF8 E;  3M7N D;  4F6N A;  1QNT A;  5BR8 I;  2PNM A;  1X6F A;  2O1W A;  5FWK A;  4KQV A;  1T39 A;  1A1F A;  3VHT B;  4YHH E;  4M9V C;  2Z5C B;  5K36 B;  1X49 A;  1KTV A;  4DPX A;  2JXP A;  1IBL I;  4WPY A;  2EM7 A;  2EN7 A;  2WP8 A;  2V8P A;  5AAS A;  4U3B A;  5JEA B;  2VQE I;  4IZK A;  1YUJ A;  4OZE A;  4DPY A;  2XEX A;  1PKP A;  4PRV A;  4JI1 I;  1PJT A;  2EPL X;  4MYT A;  2NPF A;  1YZ9 A;  4DV4 I;  4X62 I;  2L33 A;  2GO4 A;  4WXD A;  3MSW A;  2IER A;  2GPI A;  3IWB A;  3WU4 A;  3M99 B;  2EMZ A;  4HAC B;  4X9J A;  2KOU A;  3PRY A;  1UIL A;  2KON A;  4DU7 A;  2VF3 A;  2X7I A;  4DR4 E;  3U1K A;  1WHQ A;  5IXM B;  4Q35 B;  4HXZ A;  2LBS B;  2YTO A;  2JE6 B; 
#chains in the Genus database with same CATH homology
 2JOX A;  1PVG A;  4DV2 I;  4I8O A;  2J7K A;  4I3H A;  4AQY E;  4DR7 I;  3H09 A;  4FN5 A;  2JR1 A;  3B8H A;  4USK A;  5T6J A;  2HKJ A;  5BR8 E;  3B78 A;  3V5R A;  2CZ9 A;  2F4V I;  5FLX C;  4DR3 I;  2VF1 A;  4DKK A;  3LNU A;  1IBL E;  2VQE E;  1IBM I;  4NXM I;  2CG9 A;  1I94 I;  4JI1 E;  4B3M E;  3ADL A;  4DV4 E;  2N3H A;  5LL6 R;  4X62 E;  4DV0 I;  4BS9 A;  1RRE A;  1XMO I;  1H7S A;  2ZM6 I;  4JI8 I;  4MYU A;  4M0V A;  1ZM9 A;  1NHH A;  4FWD A;  3C4T A;  3J80 C;  2O1V A;  1J5E I;  1EA6 A;  4X65 I;  2IOP A;  5IT9 C;  4DV2 E;  3K85 A;  2NUE A;  2L2K B;  3WU5 A;  2Z5B A;  4PRX A;  4LF6 I;  3J81 Q;  3QT6 A;  3D4J A;  3F6G A;  2V2V A;  3QT5 A;  2DEI A;  4OOG C;  3T1H I;  1T4L B;  4URL A;  2F4V E;  4DR3 E;  4LFB I;  4DV5 I;  4DPU A;  1NHI A;  3B82 A;  2HKE A;  2RTX A;  5AE2 A;  1NZ0 A;  1IBM E;  4NXM E;  4DV3 I;  4B3T I;  4B3R E;  2FV4 B;  2V87 A;  2ZIT A;  4DV0 E;  1YYK A;  1XMO E;  2KHX A;  1HNW I;  2L8T A;  2ZM6 E;  4JI8 E;  2JY9 A;  2RS7 A;  4LFA I;  1FKA E;  1FI4 A;  2LJP A;  1Z0G A;  4P52 A;  1VIS A;  1J5E E;  1RC7 A;  4X65 E;  2CGE A;  2Z5E A;  2YZT A;  2MDR A;  2WW4 A;  2LRS A;  3AV0 A;  1XNR I;  2V2Z A;  3ZKB A;  2R42 A;  3ADG A;  2EZ6 A;  1MG7 A;  3T1H E;  3OML A;  1QU6 A;  1U2R A;  3DF6 A;  1XHK A;  3JU0 A;  4LFB E;  1ELO A;  1USU A;  2H36 X;  4DV5 E;  3ZKD A;  1FWK A;  1WXR A;  3ZZT A;  4LTY A;  5A2Q C;  4DV3 E;  2B3T B;  2BM0 A;  4B3T E;  5LMU I;  1FNM A;  1RR9 A;  4JI0 I;  2B7T A;  1ZM4 A;  2R3V A;  4USM A;  4B3M I;  4EMD A;  2UXD E;  1Z5C A;  2DB2 A;  1HNW E;  2LTS A;  3CWV A;  2UU9 I;  3M6A A;  4JI5 I;  2V83 A;  4LFA E;  4Z7Y A;  5GMD A;  1HNZ I;  2L3C A;  4ZVI A;  1WUU A;  3PYD A;  1XNR E;  2L2M A;  2Q2E B;  4J8Z A;  4M2Z A;  2V85 A;  2GQ0 A;  2JOB A;  3IWC A;  4F9A B;  3P1X A;  1Z0E A;  2X36 A;  2CPN A;  5AE1 A;  2Z5C A;  4JI4 I;  2M4I A;  4DPT A;  2HFS A;  1BKN A;  1HNX E;  3WU6 A;  3J7A G;  1N33 I;  3JTZ A;  3LLH A;  1WHN A;  2NA2 A;  3IWD A;  4DUY I;  3Q6N A;  1H7U A;  1MX0 A;  2UXB I;  2B7V A;  1FWL A;  4WUB A;  4HYM A;  1DQ3 A;  1S16 A;  5ADZ A;  4HAC A;  4JI2 E;  1B63 A;  5LMU E;  3C4B A;  4JI0 E;  2LUQ A;  2V2Q A;  4P78 A;  3HXL A;  4B3R I;  4GKK I;  2V86 A;  4F9B B;  2BV3 A;  4DR5 I;  3F6H A;  2UU9 E;  1N0V C;  5DNY A;  1DI2 A;  4TUG A;  4IZJ B;  2N3G A;  4JI5 E;  4HY1 A;  1EI1 A;  2PNL A;  4WUC A;  1HNZ E;  5A2Q Q;  4NXN I;  1ZM3 A;  3K17 A;  4Z7C A;  1HR0 I;  2UUA I;  4DUZ I;  2VQF I;  4R8O A;  2DIX A;  1KVK A;  4XTJ A;  4JI7 I;  3ADJ A;  4OX9 I;  4JI4 E;  4N3O A;  4BMJ A;  1S4E A;  1N33 E;  2A2C A;  2ZBK B;  2EWL A;  2G7H A;  2UUC I;  3JAM C;  2AJ4 A;  1SR9 A;  4DUY E;  1Y4S A;  3OTO I;  1NHJ A;  2UXB E;  1MU5 A;  2V89 A;  2OI2 A;  1H73 A;  2A2D A;  3HUL A;  4PU9 A;  1A6F A;  4DR2 I;  5LMN I;  2UXD I;  2FGG A;  4GKK E;  3GON A;  5FLX Q;  1Z0C A;  4DR5 E;  4JYA I;  2L3J A;  3K1J A;  1RQ0 A;  4RPF A;  4KHP I;  4NXN E;  4LF9 I;  4R1F A;  2GS8 A;  2V88 A;  1HR0 E;  4DR6 I;  4X66 I;  1Z5A A;  2UUA E;  2K4V A;  2E5L I;  4DUZ E;  2VQF E;  2JWO A;  4DU8 A;  4JI7 E;  4OX9 E;  1Z0B A;  1Z0T A;  3J80 Q;  1O0W A;  4IZK B;  2UUC E;  1HNX I;  1Z5B A;  4L5N C;  2LJH A;  5IWA I;  5IT9 Q;  2MC6 A;  4LF7 I;  2M1S A;  3OTO E;  1N0U A;  2UXC I;  2HK3 A;  1N36 I;  3LML A;  3DJW A;  4JI2 I;  4DR2 E;  1N34 I;  2VE7 C;  4DV1 I;  1HK7 A;  5LMN E;  4JYA E;  3Q6M A;  1H74 A;  2L6M A;  4K0K E;  1ZM2 A;  3FIG A;  4JI6 I;  5GME A;  1XMQ I;  2L92 A;  3ZZ0 A;  1QZR A;  3HJC A;  4KHP E;  4DV7 I;  1Y6Z A;  4LF9 E;  4LF5 I;  1YYO A;  4DR6 E;  4X66 E;  3V2U C;  1ZBT A;  2E5L E;  1Z0W A;  3KWR A;  1X47 A;  4WYQ B;  3ZOQ B;  1FJG I;  4LF4 I;  3H4L A;  4YY3 I;  4JG4 A;  1EKZ A;  1N32 I;  3LTO A;  3J81 C;  2UUB I;  5IWA E;  2RS6 A;  1ZXN A;  2HFU A;  4LF7 E;  1Z59 A;  1Y4U A;  2M7Q A;  2FTX B;  3HPZ A;  1T4O A;  2E1M A;  2UXC E;  2DMY A;  2YT4 A;  1N36 E;  1H72 C;  4GKJ I;  1OJ4 A;  3PYF A;  2EFG A;  4BBY A;  2HHH I;  1YYW A;  2IHR 1;  1B62 A;  3P06 A;  3T1Y I;  1N34 E;  4DV1 E;  1IBK I;  4P7D A;  3ZM7 A;  4DXL A;  2V8Q B;  4L8N A;  1KIJ A;  4DPW A;  4X64 I;  3ADI A;  3VYX A;  4F54 A;  4DR1 I;  4WUD A;  2MC5 A;  4FWG A;  4TUI A;  2Z5B B;  4JI6 E;  3Q1Q A;  1XMQ E;  4LU9 A;  4JV5 I;  3F0N A;  4F9C B;  4B3S I;  2RSM A;  4BC7 A;  4DV7 E;  4JI3 I;  4LF5 E;  1GZ6 A;  5AE3 A;  1K47 A;  2ODR D;  2JVA A;  1FJG E;  5F3W A;  4LF4 E;  4YY3 E;  4R03 A;  1N32 E;  4KZS A;  2O1T A;  3AUZ A;  2UUB E;  3WU3 A;  4LFC I;  1Z0V A;  4DV6 I;  3HPS A;  1PIE A;  4P7A A;  3ZZU A;  1D6T A;  2NUG A;  1XNQ I;  3PYG A;  4M1K A;  4GKJ E;  2LTR A;  4DMI A;  2HHH E;  4DR7 E;  2ODR C;  3T1Y E;  2LMZ A;  3RMP A;  1ZXM A;  2BM1 A;  2O1U A;  3LPS A;  4IZJ A;  2DEJ A;  1IBK E;  2HK2 A;  4X8W A;  3J7Y p;  1UEK A;  3VYY A;  2E1R A;  4X64 E;  4IZJ D;  4DR1 E;  4K0K I;  3J7A M;  4LF8 I;  4ED4 A;  3HQ1 A;  4JV5 E;  3VK6 A;  4B3S E;  2WZO A;  4FW9 A;  4YHH I;  2L2N A;  4FWH A;  4JI3 E;  1T4N A;  4UT4 A;  2IOQ A;  2NUF A;  4WSP A;  1KKH A;  4GEQ B;  1I94 E;  1ZBQ A;  3K6Q A;  1DAR A;  1X48 A;  4M30 A;  2V34 A;  4Q28 A;  3QT8 A;  5L3J A;  2B9D A;  4LFC E;  3QT7 A;  1STU A;  3PYE A;  4DV6 E;  4WFT A;  4UTG A;  1XNQ E;  2LUP B;  1J26 A;  4DR4 I;  1UHZ A;  4AQY I;  2LE2 A;  1GQE A;  4LF6 E;  2DSY A;  5CFF E;  4BC9 A;  4BCA A;  1USV A;  3JAM Q;  3HTX A;  2F8B A;  4LF8 E;  5BR8 I;  2PNM A;  2O1W A;  5FWK A;  4KQV A;  4YHH E;  2Z5C B;  1X49 A;  1KTV A;  4DPX A;  1IBL I;  4WPY A;  2V8P A;  5AAS A;  2VQE I;  4IZK A;  4DPY A;  2XEX A;  1PKP A;  4PRV A;  4JI1 I;  4MYT A;  2NPF A;  1YZ9 A;  4DV4 I;  4X62 I;  2L33 A;  3MSW A;  3IWB A;  3WU4 A;  4HAC B;  2KOU A;  3PRY A;  1UIL A;  2KON A;  4DU7 A;  2VF3 A;  2X7I A;  4DR4 E;  1WHQ A;  2LBS B;  4HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...