1IBME

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ibmE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibmE02
1Z59A 4WFTA 4LF4I 3D4JA 3ADGA 4P52A 5FLXC 3JAMQ 2UXDI 1HR0E 2B7VA 2LJHA 4GKJE 1N34E 4HXZA 4LF7I 1BKNA 4WUBA 1XMOI 3T1YE 1Z0VA 2GS8A 4R1FA 4JG4A 4FW9A 1MG7A 3QT5A 4UTGA 2XEXA 3ZM7A 2R3VA 2AJ4A 2UUAI 1IBKI 3WU5A 1DARA 4JI1E 4JI5E 3PYFA 2V2ZA 1FJGI 4LF9I 2Q2EB 3VYXA 1N34I 4LF9E 4RPFA 1FJGE 3T1HI 4GKKE 4YY3I 2L2MA 1RREA 2LRSA 1KIJA 2RTXA 4KHPE 2EFGA 3LTOA 2HK3A 1Z0BA 3HULA 4DV2I 4DV6E 4JI6E 3PYEA 4JI5I 4LFAE 4B3RE 3J80Q 4Z7CA 4JI3I 1KTVA 2L2NA 3B8HA 4DR1E 4DV7E 1NZ0A 3V5RA 2HK2A 1XNQE 2NUEA 1XMQE 4M30A 4WUCA 3H4LA 1PKPA 1H74A 3V2UC 2F4VE 4B3SI 4FWHA 5IWAE 2CZ9A 2DEIA 1XMQI 5LMUE 4P7AA 2RS6A 5GMEA 1H72C 2DEJA 1D6TA 1ZM3A 1IBME 1HNZE 4WUDA 1WHQA 2LUPB 1Z0EA 3J81C 4LFAI 5IWAI 4KQVA 2LJPA 4DV0E 1N33E 4JI1I 1N36E 3WU6A 4Z7YA 5L3JA 4KHPI 5IT9Q 1H73A 2B3TB 1NHHA 1KKHA 1N33I 2IHR1 2UXCI 4X62I 4X66E 4NXNI 4JV5E 3K1JA 1EKZA 4JI4E 5A2QC 2HKEA 1IBMI 2L2KB 1N0VC 1I94I 4B3ME 1FKAE 1Z5AA 3M6AA 4LF6E 1ZM2A 4X66I 4JI2E 2LUQA 3J7AM 1GQEA 4K0KI 2UU9I 1X49A 4DPYA 2HFUA 2EZ6A 1FNMA 1XNRE 4HY1A 4GKJI 1KVKA 1QZRA 1J5EI 4DV1I 1EI1A 3B82A 4MYTA 2N3HA 3ZZUA 3VYYA 1S4EA 3CWVA 1ZXNA 4LF4E 1XHKA 4FWDA 4UT4A 1ZBTA 1N32E 1IBLI 1N0UA 2UXBI 2E1RA 4DUZE 1UILA 4DV3I 1B63A 2HHHE 4M2ZA 4ED4A 2LBSB 4DR3I 2N3GA 3ADIA 4DR7E 2F4VI 4DR3E 2V8PA 4DUYE 4B3MI 4YHHE 2BM0A 3QT6A 2KHXA 4JV5I 5BR8E 1FWLA 3J81Q 2E5LI 4DV7I 2DB2A 2UUAE 5CFFE 1WHNA 4B3TI 2UUCI 4LFBE 2VQFE 3LLHA 3J7Yp 4JI6I 4M1KA 4XTJA 2L33A 3QT7A 1X48A 2CPNA 3ZKDA 1Z0WA 4LF7E 4X65E 1YZ9A 3QT8A 4JI0I 2ZM6I 1H7UA 4HACB 3T1HE 3ADJA 4JI2I 4NXMI 1J26A 1U2RA 4DR4E 1YYWA 4DPXA 4DV4E 2R42A 2E5LE 1I94E 1YYKA 4DR6E 2JVAA 4DPTA 3HTXA 1HNXI 1NHJA 4DUYI 2UUBE 4LFCI 5LMNI 2VF3A 4JYAE 1T4OA 4LF5E 4JI7E 4DR5E 2ZM6E 4LF8E 2VQEI 3T1YI 5LMNE 2HFSA 5IT9C 2MDRA 4DPWA 1IBLE 1N36I 1UHZA 2YT4A 4DU7A 4DR5I 1MX0A 4DV4I 3J7AG 4DV5E 2V2QA 3LNUA 1ELOA 1Z0GA 4DPUA 4USMA 4LFCE 4X64E 4DR2I 4DV5I 2UUBI 1HNXE 3ZZTA 4EMDA 4DV3E 5FLXQ 4OX9I 4DR2E 3LPSA 4DR7I 4DR4I 5LL6R 2V2VA 2NA2A 1IBKE 1RR9A 4FN5A 4JI0E 4JI4I 4NXNE 1YYOA 4FWGA 2VQEE 4LF8I 1FI4A 1Z5CA 1ZM4A 4JI7I 2ZBKB 5GMDA 1A6FA 1ZM9A 1Z5BA 4X64I 4LFBI 4DV1E 1B62A 4JI8E 4URLA 3OTOI 4YY3E 4OX9E 2X36A 2B7TA 2HHHI 2UU9E 1OJ4A 4DUZI 4DV0I 3JAMC 1FWKA 4X62E 3OTOE 4JI8I 1NHIA 4PU9A 1T4NA 1PVGA 4WYQB 4JYAI 2RS7A 2V34A 4DR1I 4JI3E 3C4TA 2WW4A 1STUA 1X47A 4DXLA 1S16A 2UUCE 1J5EE 4LF6I 1UEKA 1HNZI 1O0WA 1HR0I 2L3CA 3K17A 4AQYE 4K0KE 1H7SA 1Z0CA 2NUGA 2UXBE 2LTSA 4DV6I 4ZVIA 1EA6A 1Z0TA 1RC7A 4NXME 3WU4A 4MYUA 2DMYA 4I3HA 2VQFI 1MU5A 3ZZ0A 2A2DA 4OOGC 4B3TE 4DU8A 2X7IA 1K47A 3GONA 5A2QQ 2OI2A 1N32I 5BR8I 1HNWI 3J80C 2DIXA 1QU6A 1XMOE 4LF5I 1RQ0A 3WU3A 4USKA 2UXDE 1T4LB 4GKKI 4DR6I 3Q1QA 4X8WA 4PRVA 3ADLA 4X65I 2RSMA 4B3SE 2UXCE 2J7KA 2JY9A 2BM1A 4AQYI 3ZKBA 1DI2A 4PRXA 3B78A 2ZITA 2NPFA 5LMUI 4DKKA 1WUUA 3C4BA 1ZXMA 2LTRA 4YHHI 1XNQI 4DV2E 2NUFA 2HKJA 3PYGA 1HNWE 4HYMA 2L3JA 3F0NA 2A2CA 4HACA 3P1XA 1VISA 2BV3A 4B3RI 1XNRI 3PYDA 1PIEA
chains in the Genus database with same CATH superfamily
1BB8A 4R2AA 4OO1B 1Z59A 4WFTA 4FW6A 2YRHA 1A1GA 4LF4I 3D4JA 4WPYA 4OO1C 3ADGA 1QNTA 2EQ0A 2LO3A 1Z1BA 4P52A 4QNJA 5FLXC 3JAMQ 1A1JA 4M9VC 2UXDI 4IS1C 1HR0E 2B7VA 2LJHA 3RMPA 4Q28A 1ZAAC 2F8BA 1YUIA 4FW7A 5ELWA 4MU3A 2C38A 4GKJE 1ZR9A 2E1MA 4IFDE 1N34E 4HXZA 4LF7I 2EOFA 1BKNA 1X6HA 3HPZA 4WUBA 4F9AB 1XMOI 3T1YE 5DROA 2EMCA 1Z0VA 2WZOA 2GS8A 4BA1B 4R1FA 4BC9A 4WX9A 4JG4A 4FW9A 1MG7A 3QT5A 4UTGA 2WBSA 3UHMA 2XEXA 5JEAB 2V89A 2NN6A 3ZM7A 2R3VA 2H36X 2AJ4A 2UUAI 1IBKI 1L4SA 5KL2A 2DMIA 4JI1E 1DARA 3WU5A 4JI5E 3PS3A 3PYFA 2V2ZA 4OKGA 3EPKA 1FJGI 5DRPA 2VE7C 4LF9I 4IZKB 3TQMA 2Q2EB 4R2QA 3VYXA 1N34I 3M85G 5DNLA 4LF9E 2JEAB 3L00A 4RPFA 2EQ1A 4F9BB 3FIGA 2MKDA 1FJGE 1A1LA 3T1HI 4GKKE 4HEIA 5C0XD 2V87A 2LE2A 5AE3A 4YY3I 4BA2A 2L2MA 1RREA 2FGGA 2LRSA 1KIJA 4OZEA 2RTXA 4KHPE 2EFGA 3LTOA 4LTYA 2NABA 2RQLA 2HK3A 2J65A 1Z0BA 3HULA 4DV2I 4F54A 4DV6E 4JI6E 4N3OA 3PYEA 2MC6A 2YTJA 4AIDA 4JI5I 2Z5BB 2BA0G 4LFAE 4B3RE 3K85A 2WNRB 3J80Q 2EOHA 2EN1A 2M9AA 3EPJA 4Z7CA 4JI3I 1KTVA 2YTEA 2L2NA 4O5GA 2C37A 3B8HA 5TSEA 4DR1E 4DV7E 1NZ0A 5IXMB 4J3DA 2EE8A 3V5RA 3JTZA 2PO1B 2YTFA 3U1KA 2HK2A 3P06A 1XNQE 4R2CA 1XMQE 3M99B 4M30A 2NUEA 2ADRA 4OO1D 2C39B 3H4LA 1N3GA 3QG5C 1X6FA 3Q6NA 4WUCA 1PKPA 2L8TA 4M0VA 2F4VE 1H74A 3V2UC 4B3SI 1MEYC 4FWHA 5IWAE 2CZ9A 2PO1A 2DEIA 3L7ZB 4IFDC 3K6QA 4R2RA 3U1YA 4LCFA 1YPNA 1XMQI 5LMUE 2CT1A 2RS6A 4P7AA 5GMEA 1H72C 5A6BA 1UDQA 2EPKX 4FW3A 4R2SA 2DEJA 5JEAE 1D6TA 1PDAA 3HXLA 1YUJA 1ZM3A 1IBME 5AC4A 1HNZE 4WUDA 3IWBA 1WHQA 2LUPB 1Z0EA 3J81C 4LFAI 4FK5C 2EOEA 5IWAI 2YWQA 4KQVA 3HPSA 2PNZB 4N4RB 2LJPA 2YTDA 5FWKA 4R2PA 4DV0E 1N33E 2WNRA 4JI1I 5C0XA 1N36E 2EMWA 3WU6A 4Z7YA 4IZJD 5L3JA 2DSYA 3IWCA 4IZJB 4KHPI 1Y5YA 5IT9Q 2ODRC 1IQSA 3MSWA 1H73A 2BA1D 2B3TB 5DNXA 1NHHA 4LCHA 1KKHA 3B4TA 1N33I 4KZSA 2YRKA 2WBUA 2V86A 3P3CA 2LV2A 2IHR1 2C39A 4MLVA 2R76A 3GLLA 2UXCI 2I13A 1YHCA 2IESA 4X62I 4X66E 4ZYDA 4NXNI 4WSPA 5A2QC 1EKZA 4JI4E 4JV5E 1GZ6A 3MHSC 2HKEA 3K1JA 2EPZA 2JE6B 1IBMI 2L2KB 1N0VC 1I94I 2Q8UA 5K36D 4B3ME 4IFDD 2YU5A 1FKAE 4F6NA 4I8OA 2PRTA 1Z5AA 3C6MA 2JWOA 2VF1A 2N8XA 4P7DA 3M6AA 4OO1F 2Z5BA 4LF6E 1BBOA 1WXRA 1ZM2A 3DD6A 4X66I 4JI2E 2O1TA 1JK2A 3L7ZA 2EM8A 4ZYEA 2LUQA 5A6KA 3J7AM 1GQEA 3HQ1A 3M7ND 4K0KI 2UU9I 1X49A 1E3HA 4DPYA 2YZTA 1TF6A 2HFUA 2EZ6A 1FNMA 1XNRE 2LCEA 2HGHA 4HY1A 4GKJI 4O43A 1KVKA 1QZRA 4IS9A 4BA1A 1J5EI 3BBGA 1EI1A 3AUZA 2C37B 3B82A 4BS9A 2N3HA 4MYTA 4DV1I 3ZZUA 3VYYA 4R8OA 1S4EA 2HC5A 2WP8B 2EOMA 3CWVA 1ZXNA 4LF4E 1AAYA 1WRJA 1XHKA 4FWDA 1P42A 1PJQA 4UT4A 1ZBTA 2JYAA 1N32E 1IBLI 1E3PA 4HTGA 1N0UA 2UXBI 2E1RA 4DUZE 2JXPA 1UILA 4DV3I 1B63A 2EPNA 2HHHE 5C0XC 4M2ZA 4ED4A 2EN8A 2LBSB 3GCMA 2YTQA 2O3ZA 3HKMA 3H1CA 2DLKA 4DR3I 3VHTB 3GMEA 2N3GA 1F2IG 3F6GA 4MLQA 3ADIA 1UN6B 4DR7E 2F1DA 2JEBB 4WXDA 4DR3E 1OYSA 2EMKA 2JPAA 2AE8A 2V8PA 4DUYE 4NBQA 1MGTA 3AV0A 1G2FC 4B3MI 4YHHE 2ENHA 3KRNA 4IFDB 2BM0A 3QT6A 4IFDF 2KHXA 4JV5I 5BR8E 1IQOA 1FWLA 3J81Q 4DV7I 2DB2A 2E5LI 2UUAE 3ECRA 1A1IA 1Y4SA 1USUA 3PS1A 3F6HA 2WP8A 2PO0B 2MDGA 5CFFE 1WHNA 4B3TI 2UUCI 4LFBE 3NZKA 2WBTA 2CSHA 2VQFE 2YTGA 3LLHA 3LMLA 2RSIA 5JEAF 3J7Yp 2IERA 2EN2A 4JI6I 4M1KA 4XTJA 4OO1E 5AASA 4AM3A 2L33A 3QT7A 2EM0A 1X48A 2DGCA 1Y6ZA 2CPNA 3ZKDA 2EN4A 1Z0WA 4LF7E 2F4VI 2JE6A 4X65E 2EL4A 2EPPA 1YZ9A 3QT8A 5DNYA 2EP3A 2RPCA 4NZVA 1IMUA 4U3DA 2BA1G 4JI0I 2ZM6I 2MC5A 1H7UA 2EPUA 5AE1A 4HACB 1NEIA 4MU0A 2BR2A 3OMLA 3ADJA 3T1HE 4JI2I 1HK7A 3BIDA 5KL6A 1J26A 1U2RA 4NXMI 4DR4E 2KOUA 1YYWA 4DPXA 2EMYA 2LVHA 3EQ1A 2M1SA 2O1UA 4KWYA 4DV4E 2R42A 4ISAA 2A25A 2E5LE 2V83A 1I94E 2VRDA 2ENCA 1YYKA 2EN6A 2EL5A 4DR6E 4GEQB 2JVAA 2JP9A 2ELYA 1WJPA 3HTXA 4DPTA 1HNXI 1NHJA 4DUYI 2UUBE 5C0XE 3DJWA 2M7QA 4LFCI 5LMNI 2PO2B 5KL4A 2EMLA 2LMZA 2JEBA 3PRYA 1A1KA 2VF3A 4JYAE 2ENAA 1T4OA 1YSAC 4LF5E 2V8QB 4JI7E 1EH8A 3M7NG 4DR5E 2GO3A 2VESA 2ZM6E 2EM6A 4LF8E 2VQEI 3T1YI 5LMNE 2HFSA 5IT9C 2MDRA 4LPFA 1IBLE 4DPWA 1OYPA 1N36I 2JEAA 1UHZA 2YT4A 4DU7A 3C6KA 4DR5I 1MX0A 2EPLX 3J7AG 4DV4I 4MDTA 4F2JC 4DV5E 3PS2A 5JEAA 2BA0D 2V2QA 3LNUA 1ELOA 1Z0GA 4DPUA 4USMA 4LFCE 4X64E 4DR2I 4DV5I 1UDNA 2IOPA 2UUBI 2EJ4A 1HNXE 3ZZTA 4IZJA 4FW4A 1ZBQA 2NN6B 4EMDA 4BHCA 4DV3E 2JOBA 1RHYA 5FLXQ 4BHBA 5A69A 2EOOA 1P47A 3P76A 3CDJA 5C0XB 4OX9I 2NN6C 2O1VA 4J8ZA 1X5WA 1X6EA 2PNMA 4DR2E 1LLMC 3LPSA 4DR7I 2GQ0A 4X9JA 2O1WA 5LL6R 4DR4I 2V2VA 2Z5EA 5DRQA 2EORA 2NA2A 3EPLA 1Y4UA 5JEAC 1IBKE 2EMBA 3EPHA 1RR9A 4FN5A 1EH7A 2EMHA 4JI0E 4JI4I 2CTDA 4NXNE 2V85A 1YYOA 4F9CB 2YSPA 4FWGA 2EN3A 2VQEE 4LF8I 1FI4A 2YTIA 2EPMX 1Z5CA 1ZM4A 5EKWA 4JI7I 4OO1A 2V88A 2ZBKB 5GMDA 1A6FA 5K36B 1ZM9A 1Z5BA 4X64I 1A1FA 4LFBI 4DV1E 2M4IA 1B62A 2FV4B 4JI8E 2CGEA 4URLA 3OTOI 1YH8A 2R1FA 2GPIA 4WXCA 4LCGA 4YY3E 1T39A 4OX9E 2X36A 2B7TA 2EMXA 1DGCA 2HHHI 1DQ3A 2UU9E 1OJ4A 4DUZI 2FTXB 1GTKA 4DV0I 1USVA 1T38A 3JAMC 1G2DC 1UDSA 4BMJA 1FWKA 4X62E 3VK6A 2Z5CA 3OTOE 4JI8I 4DMIA 5EL9A 1NHIA 4LOMA 4PU9A 3THNA 1T4NA 2L6MA 3BF2A 4WYQB 1PVGA 4JYAI 2RS7A 2V34A 3M85D 2G7HA 2C38B 3CDIA 4DR1I 4WSGA 4JI3E 4FW5A 2EOXA 3C4TA 2WW4A 5A6BD 2DLQA 5ADZA 4GQUA 2ELZA 1STUA 2YTNA 2YRMA 4ZYGA 1X47A 5IV8B 2EM3A 1TN9A 2EMIA 1R6LA 2EMFA 4BCAA 4MU4A 2HJJA 5KL5A 4DXLA 2EM5A 1TF3A 1S16A 2UUCE 1J5EE 4LF6I 4BC7A 1UEKA 2EM9A 2EPRA 4BBYA 1O0WA 4MU1A 1HNZI 2EL6A 1HR0I 5KL7A 2L3CA 2YTOA 3Q6MA 3K17A 2NN6D 4GZNC 2L92A 4Q35B 1UBDC 2DRPA 2Z5CB 4AQYE 2YTPA 2YSOA 4K0KE 1H7SA 1Z0CA 2NUGA 2UXBE 4O24A 4BA2B 2EM4A 2LTSA 2LJUA 4DV6I 4ZVIA 1EA6A 2JR1A 1Z0TA 2JT2A 1RC7A 4R2DA 1AH5A 1B69A 5A6JA 2YU8A 3IWDA 4IJDA 2EMGA 4NXME 2B9DA 2EPAA 3WU4A 2K4VA 2EPOA 4MYUA 2EM7A 2PO2A 2DMYA 3ZOQB 2PNLA 4I3HA 1XXEA 2VQFI 1MU5A 4IZKA 1NCSA 2E72A 2EPXA 2JOXA 4OOGC 4B3TE 2A2DA 3ZZ0A 5DRRA 2BBGA 2EM2A 4DU8A 2X7IA 1K47A 4RHBB 3GONA 5A2QQ 2OI2A 2EWLA 2NN6E 1N32I 5BR8I 1HNWI 1RMDA 3J80C 1SFEA 3DF6A 2DIXA 3THOB 1KYQA 1QU6A 2EOZA 2WCC3 2GLIA 2I9IA 2EPCA 4L5NC 1XMOE 4LF5I 2KONA 2EOYA 1RQ0A 3WU3A 2BB8A 2GHFA 4USKA 5A6AA 1Y60A 2UXDE 4O4KA 2CVEA 1T4LB 4GKKI 4QNKA 3Q1QA 1PJTA 2EOSA 3MHHC 4DR6I 4X8WA 2EMAA 4R2EA 4PRVA 3ADLA 4X65I 5K36E 2EOJA 4TUGA 2RSMA 1YFHA 4B3SE 2BR2B 2UXCE 3P3EA 2CG9A 5AE2A 2J7KA 2J7JA 2JY9A 2MKNA 1PJSA 4F6MA 2BM1A 4L8NA 4AQYI 4LU9A 5KL3A 2NN6F 3ZKBA 3BGHA 5AC5A 1DI2A 2GO4A 5K36F 1BBGA 5C0XF 3UK3C 3HJCA 3B78A 4PRXA 3KZZA 4AIMA 1JK1A 2ZITA 2YPNA 2NPFA 5LMUI 3P3GA 5K36A 4R03A 4DKKA 1WUUA 4IFDA 3C4BA 1R6MA 1ZXMA 2LTRA 5K36C 4YHHI 2PNZA 1SR9A 5F3WA 1XNQI 2K7IA 4DV2E 2EOQA 2PO0A 2NUFA 2HKJA 3PYGA 4RH8A 1HNWE 1VI7A 4NHRA 1ZU1A 4HYMA 1X3CA 2L3JA 1A1HA 1UDOA 1KJKA 1OYRA 2A2CA 2LT7A 3H09A 3P1XA 3F0NA 1VISA 4HACA 2BV3A 3KWRA 3KZYA 4B3RI 2EN7A 1XNRI 1EH6A 2EMZA 3PYDA 2D9HA 4P78A 4ZYHA 5LLQA 2EQ3A 2EOIA 2IOQA 2ODRD 1PIEA 5JEAD 4TUIA 4MQYA 4U3BA 3JU0A 5T6JA
chains in the Genus database with same CATH topology
1Z59A 4WFTA 4LF4I 3D4JA 4WPYA 3ADGA 4P52A 5FLXC 3JAMQ 2UXDI 1HR0E 2B7VA 2LJHA 3RMPA 4Q28A 2F8BA 4GKJE 2E1MA 1N34E 4HXZA 4LF7I 1BKNA 3HPZA 4WUBA 4F9AB 1XMOI 3T1YE 1Z0VA 2WZOA 2GS8A 4R1FA 4BC9A 4JG4A 4FW9A 1MG7A 3QT5A 4UTGA 2XEXA 2V89A 3ZM7A 2R3VA 2H36X 2AJ4A 2UUAI 1IBKI 3WU5A 1DARA 4JI1E 4JI5E 3PYFA 2V2ZA 1FJGI 2VE7C 4LF9I 4IZKB 2Q2EB 3VYXA 1N34I 4LF9E 4RPFA 4F9BB 3FIGA 1FJGE 3T1HI 4GKKE 2V87A 2LE2A 5AE3A 4YY3I 2L2MA 1RREA 2FGGA 2LRSA 1KIJA 2RTXA 4KHPE 2EFGA 3LTOA 4LTYA 2HK3A 1Z0BA 3HULA 4DV2I 4F54A 4DV6E 4JI6E 4N3OA 3PYEA 2MC6A 4JI5I 2Z5BB 4LFAE 4B3RE 3K85A 3J80Q 4Z7CA 4JI3I 1KTVA 2L2NA 3B8HA 4DR1E 4DV7E 1NZ0A 3V5RA 3JTZA 2HK2A 3P06A 1XNQE 2NUEA 1XMQE 4M30A 4WUCA 3H4LA 3Q6NA 1PKPA 2L8TA 4M0VA 2F4VE 1H74A 3V2UC 4B3SI 4FWHA 5IWAE 2CZ9A 2DEIA 3K6QA 1XMQI 5LMUE 4P7AA 2RS6A 5GMEA 1H72C 2DEJA 1D6TA 3HXLA 1ZM3A 1IBME 1HNZE 4WUDA 3IWBA 1WHQA 2LUPB 1Z0EA 3J81C 4LFAI 5IWAI 4KQVA 3HPSA 2LJPA 5FWKA 4DV0E 1N33E 4JI1I 1N36E 3WU6A 4Z7YA 4IZJD 5L3JA 2DSYA 3IWCA 4IZJB 4KHPI 5IT9Q 2ODRC 3MSWA 1H73A 2B3TB 1NHHA 1KKHA 1N33I 4KZSA 2V86A 2IHR1 2UXCI 4X62I 4X66E 4NXNI 4WSPA 5A2QC 1EKZA 4JI4E 4JV5E 1GZ6A 2HKEA 3K1JA 1IBMI 2L2KB 1N0VC 1I94I 4B3ME 1FKAE 4I8OA 1Z5AA 4P7DA 2JWOA 2VF1A 3M6AA 2Z5BA 4LF6E 1ZM2A 1WXRA 4X66I 4JI2E 2O1TA 2LUQA 3J7AM 1GQEA 3HQ1A 4K0KI 2UU9I 1X49A 4DPYA 2YZTA 2HFUA 2EZ6A 1FNMA 1XNRE 4HY1A 4GKJI 1KVKA 1QZRA 1J5EI 4DV1I 1EI1A 3AUZA 3B82A 4BS9A 2N3HA 4MYTA 3ZZUA 3VYYA 4R8OA 1S4EA 3CWVA 1ZXNA 4LF4E 1XHKA 4FWDA 4UT4A 1ZBTA 1N32E 1IBLI 1N0UA 2UXBI 2E1RA 4DUZE 1UILA 4DV3I 1B63A 2HHHE 4M2ZA 4ED4A 2LBSB 4DR3I 2N3GA 3F6GA 3ADIA 4DR7E 2F4VI 4DR3E 2V8PA 4DUYE 3AV0A 4B3MI 4YHHE 2BM0A 3QT6A 2KHXA 4JV5I 5BR8E 1FWLA 3J81Q 2E5LI 4DV7I 2DB2A 2UUAE 1Y4SA 1USUA 3F6HA 5CFFE 1WHNA 4B3TI 2UUCI 4LFBE 2VQFE 3LLHA 3LMLA 3J7Yp 4JI6I 4M1KA 4XTJA 5AASA 2L33A 3QT7A 1Y6ZA 1X48A 2CPNA 3ZKDA 1Z0WA 4LF7E 4X65E 1YZ9A 3QT8A 5DNYA 4JI0I 2ZM6I 2MC5A 1H7UA 5AE1A 4HACB 3OMLA 3T1HE 3ADJA 4JI2I 1HK7A 4NXMI 1J26A 1U2RA 4DR4E 2KOUA 1YYWA 4DPXA 2M1SA 2O1UA 4DV4E 2R42A 2E5LE 2V83A 1I94E 1YYKA 4DR6E 4GEQB 2JVAA 4DPTA 3HTXA 1HNXI 1NHJA 4DUYI 2UUBE 3DJWA 2M7QA 4LFCI 5LMNI 2LMZA 3PRYA 2VF3A 4JYAE 1T4OA 4LF5E 2V8QB 4JI7E 4DR5E 2ZM6E 4LF8E 2VQEI 3T1YI 5LMNE 2HFSA 5IT9C 2MDRA 4DPWA 1IBLE 1N36I 1UHZA 2YT4A 4DU7A 4DR5I 1MX0A 3J7AG 4DV4I 4DV5E 2V2QA 3LNUA 1ELOA 1Z0GA 4DPUA 4USMA 4LFCE 4X64E 4DR2I 4DV5I 2UUBI 2IOPA 1HNXE 3ZZTA 4IZJA 1ZBQA 4EMDA 4DV3E 2JOBA 5FLXQ 4OX9I 2O1VA 4J8ZA 2PNMA 4DR2E 3LPSA 4DR7I 2GQ0A 2O1WA 5LL6R 4DR4I 2V2VA 2Z5EA 2NA2A 1Y4UA 1IBKE 1RR9A 4FN5A 4JI0E 4JI4I 4NXNE 2V85A 1YYOA 4F9CB 4FWGA 2VQEE 4LF8I 1FI4A 1Z5CA 1ZM4A 4JI7I 2V88A 2ZBKB 5GMDA 1A6FA 1ZM9A 1Z5BA 4X64I 4LFBI 4DV1E 2M4IA 1B62A 2FV4B 4JI8E 2CGEA 4URLA 3OTOI 4YY3E 4OX9E 2X36A 2B7TA 2HHHI 1DQ3A 2UU9E 1OJ4A 4DUZI 2FTXB 4DV0I 1USVA 3JAMC 4BMJA 1FWKA 4X62E 3VK6A 2Z5CA 3OTOE 4JI8I 4DMIA 1NHIA 4PU9A 1T4NA 2L6MA 1PVGA 4WYQB 4JYAI 2RS7A 2V34A 2G7HA 4DR1I 4JI3E 3C4TA 2WW4A 5ADZA 1STUA 1X47A 4BCAA 4DXLA 1S16A 2UUCE 1J5EE 4LF6I 4BC7A 1UEKA 1HNZI 4BBYA 1O0WA 1HR0I 2L3CA 3Q6MA 3K17A 2L92A 2Z5CB 4AQYE 4K0KE 1H7SA 1Z0CA 2NUGA 2UXBE 2LTSA 4DV6I 4ZVIA 1EA6A 2JR1A 1Z0TA 1RC7A 3IWDA 4NXME 3WU4A 2B9DA 2K4VA 4MYUA 2DMYA 3ZOQB 2PNLA 4I3HA 2VQFI 1MU5A 4IZKA 3ZZ0A 2A2DA 2JOXA 4OOGC 4B3TE 4DU8A 2X7IA 1K47A 3GONA 5A2QQ 2OI2A 2EWLA 1N32I 5BR8I 1HNWI 3J80C 3DF6A 2DIXA 1QU6A 4L5NC 1XMOE 4LF5I 2KONA 1RQ0A 3WU3A 4USKA 2UXDE 1T4LB 4GKKI 4DR6I 3Q1QA 4X8WA 4PRVA 3ADLA 4X65I 4TUGA 2RSMA 4B3SE 2UXCE 2CG9A 5AE2A 2J7KA 2JY9A 2BM1A 4L8NA 4AQYI 4LU9A 3ZKBA 1DI2A 3HJCA 3B78A 4PRXA 2ZITA 2NPFA 5LMUI 4R03A 4DKKA 1WUUA 3C4BA 1ZXMA 2LTRA 4YHHI 1XNQI 1SR9A 5F3WA 4DV2E 2NUFA 2HKJA 3PYGA 1HNWE 4HYMA 2L3JA 3F0NA 2A2CA 4HACA 3H09A 3P1XA 1VISA 2BV3A 3KWRA 4B3RI 1XNRI 3PYDA 4P78A 2IOQA 2ODRD 1PIEA 4TUIA 3JU0A 5T6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z59 A;  4WFT A;  4LF4 I;  3D4J A;  3ADG A;  4P52 A;  5FLX C;  3JAM Q;  2UXD I;  1HR0 E;  2B7V A;  2LJH A;  4GKJ E;  1N34 E;  4HXZ A;  4LF7 I;  1BKN A;  4WUB A;  1XMO I;  3T1Y E;  1Z0V A;  2GS8 A;  4R1F A;  4JG4 A;  4FW9 A;  1MG7 A;  3QT5 A;  4UTG A;  2XEX A;  3ZM7 A;  2R3V A;  2AJ4 A;  2UUA I;  1IBK I;  3WU5 A;  1DAR A;  4JI1 E;  4JI5 E;  3PYF A;  2V2Z A;  1FJG I;  4LF9 I;  2Q2E B;  3VYX A;  1N34 I;  4LF9 E;  4RPF A;  1FJG E;  3T1H I;  4GKK E;  4YY3 I;  2L2M A;  1RRE A;  2LRS A;  1KIJ A;  2RTX A;  4KHP E;  2EFG A;  3LTO A;  2HK3 A;  1Z0B A;  3HUL A;  4DV2 I;  4DV6 E;  4JI6 E;  3PYE A;  4JI5 I;  4LFA E;  4B3R E;  3J80 Q;  4Z7C A;  4JI3 I;  1KTV A;  2L2N A;  3B8H A;  4DR1 E;  4DV7 E;  1NZ0 A;  3V5R A;  2HK2 A;  1XNQ E;  2NUE A;  1XMQ E;  4M30 A;  4WUC A;  3H4L A;  1PKP A;  1H74 A;  3V2U C;  2F4V E;  4B3S I;  4FWH A;  5IWA E;  2CZ9 A;  2DEI A;  1XMQ I;  5LMU E;  4P7A A;  2RS6 A;  5GME A;  1H72 C;  2DEJ A;  1D6T A;  1ZM3 A;  1IBM E;  1HNZ E;  4WUD A;  1WHQ A;  2LUP B;  1Z0E A;  3J81 C;  4LFA I;  5IWA I;  4KQV A;  2LJP A;  4DV0 E;  1N33 E;  4JI1 I;  1N36 E;  3WU6 A;  4Z7Y A;  5L3J A;  4KHP I;  5IT9 Q;  1H73 A;  2B3T B;  1NHH A;  1KKH A;  1N33 I;  2IHR 1;  2UXC I;  4X62 I;  4X66 E;  4NXN I;  4JV5 E;  3K1J A;  1EKZ A;  4JI4 E;  5A2Q C;  2HKE A;  1IBM I;  2L2K B;  1N0V C;  1I94 I;  4B3M E;  1FKA E;  1Z5A A;  3M6A A;  4LF6 E;  1ZM2 A;  4X66 I;  4JI2 E;  2LUQ A;  3J7A M;  1GQE A;  4K0K I;  2UU9 I;  1X49 A;  4DPY A;  2HFU A;  2EZ6 A;  1FNM A;  1XNR E;  4HY1 A;  4GKJ I;  1KVK A;  1QZR A;  1J5E I;  4DV1 I;  1EI1 A;  3B82 A;  4MYT A;  2N3H A;  3ZZU A;  3VYY A;  1S4E A;  3CWV A;  1ZXN A;  4LF4 E;  1XHK A;  4FWD A;  4UT4 A;  1ZBT A;  1N32 E;  1IBL I;  1N0U A;  2UXB I;  2E1R A;  4DUZ E;  1UIL A;  4DV3 I;  1B63 A;  2HHH E;  4M2Z A;  4ED4 A;  2LBS B;  4DR3 I;  2N3G A;  3ADI A;  4DR7 E;  2F4V I;  4DR3 E;  2V8P A;  4DUY E;  4B3M I;  4YHH E;  2BM0 A;  3QT6 A;  2KHX A;  4JV5 I;  5BR8 E;  1FWL A;  3J81 Q;  2E5L I;  4DV7 I;  2DB2 A;  2UUA E;  5CFF E;  1WHN A;  4B3T I;  2UUC I;  4LFB E;  2VQF E;  3LLH A;  3J7Y p;  4JI6 I;  4M1K A;  4XTJ A;  2L33 A;  3QT7 A;  1X48 A;  2CPN A;  3ZKD A;  1Z0W A;  4LF7 E;  4X65 E;  1YZ9 A;  3QT8 A;  4JI0 I;  2ZM6 I;  1H7U A;  4HAC B;  3T1H E;  3ADJ A;  4JI2 I;  4NXM I;  1J26 A;  1U2R A;  4DR4 E;  1YYW A;  4DPX A;  4DV4 E;  2R42 A;  2E5L E;  1I94 E;  1YYK A;  4DR6 E;  2JVA A;  4DPT A;  3HTX A;  1HNX I;  1NHJ A;  4DUY I;  2UUB E;  4LFC I;  5LMN I;  2VF3 A;  4JYA E;  1T4O A;  4LF5 E;  4JI7 E;  4DR5 E;  2ZM6 E;  4LF8 E;  2VQE I;  3T1Y I;  5LMN E;  2HFS A;  5IT9 C;  2MDR A;  4DPW A;  1IBL E;  1N36 I;  1UHZ A;  2YT4 A;  4DU7 A;  4DR5 I;  1MX0 A;  4DV4 I;  3J7A G;  4DV5 E;  2V2Q A;  3LNU A;  1ELO A;  1Z0G A;  4DPU A;  4USM A;  4LFC E;  4X64 E;  4DR2 I;  4DV5 I;  2UUB I;  1HNX E;  3ZZT A;  4EMD A;  4DV3 E;  5FLX Q;  4OX9 I;  4DR2 E;  3LPS A;  4DR7 I;  4DR4 I;  5LL6 R;  2V2V A;  2NA2 A;  1IBK E;  1RR9 A;  4FN5 A;  4JI0 E;  4JI4 I;  4NXN E;  1YYO A;  4FWG A;  2VQE E;  4LF8 I;  1FI4 A;  1Z5C A;  1ZM4 A;  4JI7 I;  2ZBK B;  5GMD A;  1A6F A;  1ZM9 A;  1Z5B A;  4X64 I;  4LFB I;  4DV1 E;  1B62 A;  4JI8 E;  4URL A;  3OTO I;  4YY3 E;  4OX9 E;  2X36 A;  2B7T A;  2HHH I;  2UU9 E;  1OJ4 A;  4DUZ I;  4DV0 I;  3JAM C;  1FWK A;  4X62 E;  3OTO E;  4JI8 I;  1NHI A;  4PU9 A;  1T4N A;  1PVG A;  4WYQ B;  4JYA I;  2RS7 A;  2V34 A;  4DR1 I;  4JI3 E;  3C4T A;  2WW4 A;  1STU A;  1X47 A;  4DXL A;  1S16 A;  2UUC E;  1J5E E;  4LF6 I;  1UEK A;  1HNZ I;  1O0W A;  1HR0 I;  2L3C A;  3K17 A;  4AQY E;  4K0K E;  1H7S A;  1Z0C A;  2NUG A;  2UXB E;  2LTS A;  4DV6 I;  4ZVI A;  1EA6 A;  1Z0T A;  1RC7 A;  4NXM E;  3WU4 A;  4MYU A;  2DMY A;  4I3H A;  2VQF I;  1MU5 A;  3ZZ0 A;  2A2D A;  4OOG C;  4B3T E;  4DU8 A;  2X7I A;  1K47 A;  3GON A;  5A2Q Q;  2OI2 A;  1N32 I;  5BR8 I;  1HNW I;  3J80 C;  2DIX A;  1QU6 A;  1XMO E;  4LF5 I;  1RQ0 A;  3WU3 A;  4USK A;  2UXD E;  1T4L B;  4GKK I;  4DR6 I;  3Q1Q A;  4X8W A;  4PRV A;  3ADL A;  4X65 I;  2RSM A;  4B3S E;  2UXC E;  2J7K A;  2JY9 A;  2BM1 A;  4AQY I;  3ZKB A;  1DI2 A;  4PRX A;  3B78 A;  2ZIT A;  2NPF A;  5LMU I;  4DKK A;  1WUU A;  3C4B A;  1ZXM A;  2LTR A;  4YHH I;  1XNQ I;  4DV2 E;  2NUF A;  2HKJ A;  3PYG A;  1HNW E;  4HYM A;  2L3J A;  3F0N A;  2A2C A;  4HAC A;  3P1X A;  1VIS A;  2BV3 A;  4B3R I;  1XNR I;  3PYD A;  1PIE A; 
#chains in the Genus database with same CATH topology
 1BB8 A;  4R2A A;  4OO1 B;  1Z59 A;  4WFT A;  4FW6 A;  2YRH A;  1A1G A;  4LF4 I;  3D4J A;  4WPY A;  4OO1 C;  3ADG A;  1QNT A;  2EQ0 A;  2LO3 A;  1Z1B A;  4P52 A;  4QNJ A;  5FLX C;  3JAM Q;  1A1J A;  4M9V C;  2UXD I;  4IS1 C;  1HR0 E;  2B7V A;  2LJH A;  3RMP A;  4Q28 A;  1ZAA C;  2F8B A;  1YUI A;  4FW7 A;  5ELW A;  4MU3 A;  2C38 A;  4GKJ E;  1ZR9 A;  2E1M A;  4IFD E;  1N34 E;  4HXZ A;  4LF7 I;  2EOF A;  1BKN A;  1X6H A;  3HPZ A;  4WUB A;  4F9A B;  1XMO I;  3T1Y E;  5DRO A;  2EMC A;  1Z0V A;  2WZO A;  2GS8 A;  4BA1 B;  4R1F A;  4BC9 A;  4WX9 A;  4JG4 A;  4FW9 A;  1MG7 A;  3QT5 A;  4UTG A;  2WBS A;  3UHM A;  2XEX A;  5JEA B;  2V89 A;  2NN6 A;  3ZM7 A;  2R3V A;  2H36 X;  2AJ4 A;  2UUA I;  1IBK I;  1L4S A;  5KL2 A;  2DMI A;  4JI1 E;  1DAR A;  3WU5 A;  4JI5 E;  3PS3 A;  3PYF A;  2V2Z A;  4OKG A;  3EPK A;  1FJG I;  5DRP A;  2VE7 C;  4LF9 I;  4IZK B;  3TQM A;  2Q2E B;  4R2Q A;  3VYX A;  1N34 I;  3M85 G;  5DNL A;  4LF9 E;  2JEA B;  3L00 A;  4RPF A;  2EQ1 A;  4F9B B;  3FIG A;  2MKD A;  1FJG E;  1A1L A;  3T1H I;  4GKK E;  4HEI A;  5C0X D;  2V87 A;  2LE2 A;  5AE3 A;  4YY3 I;  4BA2 A;  2L2M A;  1RRE A;  2FGG A;  2LRS A;  1KIJ A;  4OZE A;  2RTX A;  4KHP E;  2EFG A;  3LTO A;  4LTY A;  2NAB A;  2RQL A;  2HK3 A;  2J65 A;  1Z0B A;  3HUL A;  4DV2 I;  4F54 A;  4DV6 E;  4JI6 E;  4N3O A;  3PYE A;  2MC6 A;  2YTJ A;  4AID A;  4JI5 I;  2Z5B B;  2BA0 G;  4LFA E;  4B3R E;  3K85 A;  2WNR B;  3J80 Q;  2EOH A;  2EN1 A;  2M9A A;  3EPJ A;  4Z7C A;  4JI3 I;  1KTV A;  2YTE A;  2L2N A;  4O5G A;  2C37 A;  3B8H A;  5TSE A;  4DR1 E;  4DV7 E;  1NZ0 A;  5IXM B;  4J3D A;  2EE8 A;  3V5R A;  3JTZ A;  2PO1 B;  2YTF A;  3U1K A;  2HK2 A;  3P06 A;  1XNQ E;  4R2C A;  1XMQ E;  3M99 B;  4M30 A;  2NUE A;  2ADR A;  4OO1 D;  2C39 B;  3H4L A;  1N3G A;  3QG5 C;  1X6F A;  3Q6N A;  4WUC A;  1PKP A;  2L8T A;  4M0V A;  2F4V E;  1H74 A;  3V2U C;  4B3S I;  1MEY C;  4FWH A;  5IWA E;  2CZ9 A;  2PO1 A;  2DEI A;  3L7Z B;  4IFD C;  3K6Q A;  4R2R A;  3U1Y A;  4LCF A;  1YPN A;  1XMQ I;  5LMU E;  2CT1 A;  2RS6 A;  4P7A A;  5GME A;  1H72 C;  5A6B A;  1UDQ A;  2EPK X;  4FW3 A;  4R2S A;  2DEJ A;  5JEA E;  1D6T A;  1PDA A;  3HXL A;  1YUJ A;  1ZM3 A;  1IBM E;  5AC4 A;  1HNZ E;  4WUD A;  3IWB A;  1WHQ A;  2LUP B;  1Z0E A;  3J81 C;  4LFA I;  4FK5 C;  2EOE A;  5IWA I;  2YWQ A;  4KQV A;  3HPS A;  2PNZ B;  4N4R B;  2LJP A;  2YTD A;  5FWK A;  4R2P A;  4DV0 E;  1N33 E;  2WNR A;  4JI1 I;  5C0X A;  1N36 E;  2EMW A;  3WU6 A;  4Z7Y A;  4IZJ D;  5L3J A;  2DSY A;  3IWC A;  4IZJ B;  4KHP I;  1Y5Y A;  5IT9 Q;  2ODR C;  1IQS A;  3MSW A;  1H73 A;  2BA1 D;  2B3T B;  5DNX A;  1NHH A;  4LCH A;  1KKH A;  3B4T A;  1N33 I;  4KZS A;  2YRK A;  2WBU A;  2V86 A;  3P3C A;  2LV2 A;  2IHR 1;  2C39 A;  4MLV A;  2R76 A;  3GLL A;  2UXC I;  2I13 A;  1YHC A;  2IES A;  4X62 I;  4X66 E;  4ZYD A;  4NXN I;  4WSP A;  5A2Q C;  1EKZ A;  4JI4 E;  4JV5 E;  1GZ6 A;  3MHS C;  2HKE A;  3K1J A;  2EPZ A;  2JE6 B;  1IBM I;  2L2K B;  1N0V C;  1I94 I;  2Q8U A;  5K36 D;  4B3M E;  4IFD D;  2YU5 A;  1FKA E;  4F6N A;  4I8O A;  2PRT A;  1Z5A A;  3C6M A;  2JWO A;  2VF1 A;  2N8X A;  4P7D A;  3M6A A;  4OO1 F;  2Z5B A;  4LF6 E;  1BBO A;  1WXR A;  1ZM2 A;  3DD6 A;  4X66 I;  4JI2 E;  2O1T A;  1JK2 A;  3L7Z A;  2EM8 A;  4ZYE A;  2LUQ A;  5A6K A;  3J7A M;  1GQE A;  3HQ1 A;  3M7N D;  4K0K I;  2UU9 I;  1X49 A;  1E3H A;  4DPY A;  2YZT A;  1TF6 A;  2HFU A;  2EZ6 A;  1FNM A;  1XNR E;  2LCE A;  2HGH A;  4HY1 A;  4GKJ I;  4O43 A;  1KVK A;  1QZR A;  4IS9 A;  4BA1 A;  1J5E I;  3BBG A;  1EI1 A;  3AUZ A;  2C37 B;  3B82 A;  4BS9 A;  2N3H A;  4MYT A;  4DV1 I;  3ZZU A;  3VYY A;  4R8O A;  1S4E A;  2HC5 A;  2WP8 B;  2EOM A;  3CWV A;  1ZXN A;  4LF4 E;  1AAY A;  1WRJ A;  1XHK A;  4FWD A;  1P42 A;  1PJQ A;  4UT4 A;  1ZBT A;  2JYA A;  1N32 E;  1IBL I;  1E3P A;  4HTG A;  1N0U A;  2UXB I;  2E1R A;  4DUZ E;  2JXP A;  1UIL A;  4DV3 I;  1B63 A;  2EPN A;  2HHH E;  5C0X C;  4M2Z A;  4ED4 A;  2EN8 A;  2LBS B;  3GCM A;  2YTQ A;  2O3Z A;  3HKM A;  3H1C A;  2DLK A;  4DR3 I;  3VHT B;  3GME A;  2N3G A;  1F2I G;  3F6G A;  4MLQ A;  3ADI A;  1UN6 B;  4DR7 E;  2F1D A;  2JEB B;  4WXD A;  4DR3 E;  1OYS A;  2EMK A;  2JPA A;  2AE8 A;  2V8P A;  4DUY E;  4NBQ A;  1MGT A;  3AV0 A;  1G2F C;  4B3M I;  4YHH E;  2ENH A;  3KRN A;  4IFD B;  2BM0 A;  3QT6 A;  4IFD F;  2KHX A;  4JV5 I;  5BR8 E;  1IQO A;  1FWL A;  3J81 Q;  4DV7 I;  2DB2 A;  2E5L I;  2UUA E;  3ECR A;  1A1I A;  1Y4S A;  1USU A;  3PS1 A;  3F6H A;  2WP8 A;  2PO0 B;  2MDG A;  5CFF E;  1WHN A;  4B3T I;  2UUC I;  4LFB E;  3NZK A;  2WBT A;  2CSH A;  2VQF E;  2YTG A;  3LLH A;  3LML A;  2RSI A;  5JEA F;  3J7Y p;  2IER A;  2EN2 A;  4JI6 I;  4M1K A;  4XTJ A;  4OO1 E;  5AAS A;  4AM3 A;  2L33 A;  3QT7 A;  2EM0 A;  1X48 A;  2DGC A;  1Y6Z A;  2CPN A;  3ZKD A;  2EN4 A;  1Z0W A;  4LF7 E;  2F4V I;  2JE6 A;  4X65 E;  2EL4 A;  2EPP A;  1YZ9 A;  3QT8 A;  5DNY A;  2EP3 A;  2RPC A;  4NZV A;  1IMU A;  4U3D A;  2BA1 G;  4JI0 I;  2ZM6 I;  2MC5 A;  1H7U A;  2EPU A;  5AE1 A;  4HAC B;  1NEI A;  4MU0 A;  2BR2 A;  3OML A;  3ADJ A;  3T1H E;  4JI2 I;  1HK7 A;  3BID A;  5KL6 A;  1J26 A;  1U2R A;  4NXM I;  4DR4 E;  2KOU A;  1YYW A;  4DPX A;  2EMY A;  2LVH A;  3EQ1 A;  2M1S A;  2O1U A;  4KWY A;  4DV4 E;  2R42 A;  4ISA A;  2A25 A;  2E5L E;  2V83 A;  1I94 E;  2VRD A;  2ENC A;  1YYK A;  2EN6 A;  2EL5 A;  4DR6 E;  4GEQ B;  2JVA A;  2JP9 A;  2ELY A;  1WJP A;  3HTX A;  4DPT A;  1HNX I;  1NHJ A;  4DUY I;  2UUB E;  5C0X E;  3DJW A;  2M7Q A;  4LFC I;  5LMN I;  2PO2 B;  5KL4 A;  2EML A;  2LMZ A;  2JEB A;  3PRY A;  1A1K A;  2VF3 A;  4JYA E;  2ENA A;  1T4O A;  1YSA C;  4LF5 E;  2V8Q B;  4JI7 E;  1EH8 A;  3M7N G;  4DR5 E;  2GO3 A;  2VES A;  2ZM6 E;  2EM6 A;  4LF8 E;  2VQE I;  3T1Y I;  5LMN E;  2HFS A;  5IT9 C;  2MDR A;  4LPF A;  1IBL E;  4DPW A;  1OYP A;  1N36 I;  2JEA A;  1UHZ A;  2YT4 A;  4DU7 A;  3C6K A;  4DR5 I;  1MX0 A;  2EPL X;  3J7A G;  4DV4 I;  4MDT A;  4F2J C;  4DV5 E;  3PS2 A;  5JEA A;  2BA0 D;  2V2Q A;  3LNU A;  1ELO A;  1Z0G A;  4DPU A;  4USM A;  4LFC E;  4X64 E;  4DR2 I;  4DV5 I;  1UDN A;  2IOP A;  2UUB I;  2EJ4 A;  1HNX E;  3ZZT A;  4IZJ A;  4FW4 A;  1ZBQ A;  2NN6 B;  4EMD A;  4BHC A;  4DV3 E;  2JOB A;  1RHY A;  5FLX Q;  4BHB A;  5A69 A;  2EOO A;  1P47 A;  3P76 A;  3CDJ A;  5C0X B;  4OX9 I;  2NN6 C;  2O1V A;  4J8Z A;  1X5W A;  1X6E A;  2PNM A;  4DR2 E;  1LLM C;  3LPS A;  4DR7 I;  2GQ0 A;  4X9J A;  2O1W A;  5LL6 R;  4DR4 I;  2V2V A;  2Z5E A;  5DRQ A;  2EOR A;  2NA2 A;  3EPL A;  1Y4U A;  5JEA C;  1IBK E;  2EMB A;  3EPH A;  1RR9 A;  4FN5 A;  1EH7 A;  2EMH A;  4JI0 E;  4JI4 I;  2CTD A;  4NXN E;  2V85 A;  1YYO A;  4F9C B;  2YSP A;  4FWG A;  2EN3 A;  2VQE E;  4LF8 I;  1FI4 A;  2YTI A;  2EPM X;  1Z5C A;  1ZM4 A;  5EKW A;  4JI7 I;  4OO1 A;  2V88 A;  2ZBK B;  5GMD A;  1A6F A;  5K36 B;  1ZM9 A;  1Z5B A;  4X64 I;  1A1F A;  4LFB I;  4DV1 E;  2M4I A;  1B62 A;  2FV4 B;  4JI8 E;  2CGE A;  4URL A;  3OTO I;  1YH8 A;  2R1F A;  2GPI A;  4WXC A;  4LCG A;  4YY3 E;  1T39 A;  4OX9 E;  2X36 A;  2B7T A;  2EMX A;  1DGC A;  2HHH I;  1DQ3 A;  2UU9 E;  1OJ4 A;  4DUZ I;  2FTX B;  1GTK A;  4DV0 I;  1USV A;  1T38 A;  3JAM C;  1G2D C;  1UDS A;  4BMJ A;  1FWK A;  4X62 E;  3VK6 A;  2Z5C A;  3OTO E;  4JI8 I;  4DMI A;  5EL9 A;  1NHI A;  4LOM A;  4PU9 A;  3THN A;  1T4N A;  2L6M A;  3BF2 A;  4WYQ B;  1PVG A;  4JYA I;  2RS7 A;  2V34 A;  3M85 D;  2G7H A;  2C38 B;  3CDI A;  4DR1 I;  4WSG A;  4JI3 E;  4FW5 A;  2EOX A;  3C4T A;  2WW4 A;  5A6B D;  2DLQ A;  5ADZ A;  4GQU A;  2ELZ A;  1STU A;  2YTN A;  2YRM A;  4ZYG A;  1X47 A;  5IV8 B;  2EM3 A;  1TN9 A;  2EMI A;  1R6L A;  2EMF A;  4BCA A;  4MU4 A;  2HJJ A;  5KL5 A;  4DXL A;  2EM5 A;  1TF3 A;  1S16 A;  2UUC E;  1J5E E;  4LF6 I;  4BC7 A;  1UEK A;  2EM9 A;  2EPR A;  4BBY A;  1O0W A;  4MU1 A;  1HNZ I;  2EL6 A;  1HR0 I;  5KL7 A;  2L3C A;  2YTO A;  3Q6M A;  3K17 A;  2NN6 D;  4GZN C;  2L92 A;  4Q35 B;  1UBD C;  2DRP A;  2Z5C B;  4AQY E;  2YTP A;  2YSO A;  4K0K E;  1H7S A;  1Z0C A;  2NUG A;  2UXB E;  4O24 A;  4BA2 B;  2EM4 A;  2LTS A;  2LJU A;  4DV6 I;  4ZVI A;  1EA6 A;  2JR1 A;  1Z0T A;  2JT2 A;  1RC7 A;  4R2D A;  1AH5 A;  1B69 A;  5A6J A;  2YU8 A;  3IWD A;  4IJD A;  2EMG A;  4NXM E;  2B9D A;  2EPA A;  3WU4 A;  2K4V A;  2EPO A;  4MYU A;  2EM7 A;  2PO2 A;  2DMY A;  3ZOQ B;  2PNL A;  4I3H A;  1XXE A;  2VQF I;  1MU5 A;  4IZK A;  1NCS A;  2E72 A;  2EPX A;  2JOX A;  4OOG C;  4B3T E;  2A2D A;  3ZZ0 A;  5DRR A;  2BBG A;  2EM2 A;  4DU8 A;  2X7I A;  1K47 A;  4RHB B;  3GON A;  5A2Q Q;  2OI2 A;  2EWL A;  2NN6 E;  1N32 I;  5BR8 I;  1HNW I;  1RMD A;  3J80 C;  1SFE A;  3DF6 A;  2DIX A;  3THO B;  1KYQ A;  1QU6 A;  2EOZ A;  2WCC 3;  2GLI A;  2I9I A;  2EPC A;  4L5N C;  1XMO E;  4LF5 I;  2KON A;  2EOY A;  1RQ0 A;  3WU3 A;  2BB8 A;  2GHF A;  4USK A;  5A6A A;  1Y60 A;  2UXD E;  4O4K A;  2CVE A;  1T4L B;  4GKK I;  4QNK A;  3Q1Q A;  1PJT A;  2EOS A;  3MHH C;  4DR6 I;  4X8W A;  2EMA A;  4R2E A;  4PRV A;  3ADL A;  4X65 I;  5K36 E;  2EOJ A;  4TUG A;  2RSM A;  1YFH A;  4B3S E;  2BR2 B;  2UXC E;  3P3E A;  2CG9 A;  5AE2 A;  2J7K A;  2J7J A;  2JY9 A;  2MKN A;  1PJS A;  4F6M A;  2BM1 A;  4L8N A;  4AQY I;  4LU9 A;  5KL3 A;  2NN6 F;  3ZKB A;  3BGH A;  5AC5 A;  1DI2 A;  2GO4 A;  5K36 F;  1BBG A;  5C0X F;  3UK3 C;  3HJC A;  3B78 A;  4PRX A;  3KZZ A;  4AIM A;  1JK1 A;  2ZIT A;  2YPN A;  2NPF A;  5LMU I;  3P3G A;  5K36 A;  4R03 A;  4DKK A;  1WUU A;  4IFD A;  3C4B A;  1R6M A;  1ZXM A;  2LTR A;  5K36 C;  4YHH I;  2PNZ A;  1SR9 A;  5F3W A;  1XNQ I;  2K7I A;  4DV2 E;  2EOQ A;  2PO0 A;  2NUF A;  2HKJ A;  3PYG A;  4RH8 A;  1HNW E;  1VI7 A;  4NHR A;  1ZU1 A;  4HYM A;  1X3C A;  2L3J A;  1A1H A;  1UDO A;  1KJK A;  1OYR A;  2A2C A;  2LT7 A;  3H09 A;  3P1X A;  3F0N A;  1VIS A;  4HAC A;  2BV3 A;  3KWR A;  3KZY A;  4B3R I;  2EN7 A;  1XNR I;  1EH6 A;  2EMZ A;  3PYD A;  2D9H A;  4P78 A;  4ZYH A;  5LLQ A;  2EQ3 A;  2EOI A;  2IOQ A;  2ODR D;  1PIE A;  5JEA D;  4TUI A;  4MQY A;  4U3B A;  3JU0 A;  5T6J A; 
#chains in the Genus database with same CATH homology
 1Z59 A;  4WFT A;  4LF4 I;  3D4J A;  4WPY A;  3ADG A;  4P52 A;  5FLX C;  3JAM Q;  2UXD I;  1HR0 E;  2B7V A;  2LJH A;  3RMP A;  4Q28 A;  2F8B A;  4GKJ E;  2E1M A;  1N34 E;  4HXZ A;  4LF7 I;  1BKN A;  3HPZ A;  4WUB A;  4F9A B;  1XMO I;  3T1Y E;  1Z0V A;  2WZO A;  2GS8 A;  4R1F A;  4BC9 A;  4JG4 A;  4FW9 A;  1MG7 A;  3QT5 A;  4UTG A;  2XEX A;  2V89 A;  3ZM7 A;  2R3V A;  2H36 X;  2AJ4 A;  2UUA I;  1IBK I;  3WU5 A;  1DAR A;  4JI1 E;  4JI5 E;  3PYF A;  2V2Z A;  1FJG I;  2VE7 C;  4LF9 I;  4IZK B;  2Q2E B;  3VYX A;  1N34 I;  4LF9 E;  4RPF A;  4F9B B;  3FIG A;  1FJG E;  3T1H I;  4GKK E;  2V87 A;  2LE2 A;  5AE3 A;  4YY3 I;  2L2M A;  1RRE A;  2FGG A;  2LRS A;  1KIJ A;  2RTX A;  4KHP E;  2EFG A;  3LTO A;  4LTY A;  2HK3 A;  1Z0B A;  3HUL A;  4DV2 I;  4F54 A;  4DV6 E;  4JI6 E;  4N3O A;  3PYE A;  2MC6 A;  4JI5 I;  2Z5B B;  4LFA E;  4B3R E;  3K85 A;  3J80 Q;  4Z7C A;  4JI3 I;  1KTV A;  2L2N A;  3B8H A;  4DR1 E;  4DV7 E;  1NZ0 A;  3V5R A;  3JTZ A;  2HK2 A;  3P06 A;  1XNQ E;  2NUE A;  1XMQ E;  4M30 A;  4WUC A;  3H4L A;  3Q6N A;  1PKP A;  2L8T A;  4M0V A;  2F4V E;  1H74 A;  3V2U C;  4B3S I;  4FWH A;  5IWA E;  2CZ9 A;  2DEI A;  3K6Q A;  1XMQ I;  5LMU E;  4P7A A;  2RS6 A;  5GME A;  1H72 C;  2DEJ A;  1D6T A;  3HXL A;  1ZM3 A;  1IBM E;  1HNZ E;  4WUD A;  3IWB A;  1WHQ A;  2LUP B;  1Z0E A;  3J81 C;  4LFA I;  5IWA I;  4KQV A;  3HPS A;  2LJP A;  5FWK A;  4DV0 E;  1N33 E;  4JI1 I;  1N36 E;  3WU6 A;  4Z7Y A;  4IZJ D;  5L3J A;  2DSY A;  3IWC A;  4IZJ B;  4KHP I;  5IT9 Q;  2ODR C;  3MSW A;  1H73 A;  2B3T B;  1NHH A;  1KKH A;  1N33 I;  4KZS A;  2V86 A;  2IHR 1;  2UXC I;  4X62 I;  4X66 E;  4NXN I;  4WSP A;  5A2Q C;  1EKZ A;  4JI4 E;  4JV5 E;  1GZ6 A;  2HKE A;  3K1J A;  1IBM I;  2L2K B;  1N0V C;  1I94 I;  4B3M E;  1FKA E;  4I8O A;  1Z5A A;  4P7D A;  2JWO A;  2VF1 A;  3M6A A;  2Z5B A;  4LF6 E;  1ZM2 A;  1WXR A;  4X66 I;  4JI2 E;  2O1T A;  2LUQ A;  3J7A M;  1GQE A;  3HQ1 A;  4K0K I;  2UU9 I;  1X49 A;  4DPY A;  2YZT A;  2HFU A;  2EZ6 A;  1FNM A;  1XNR E;  4HY1 A;  4GKJ I;  1KVK A;  1QZR A;  1J5E I;  4DV1 I;  1EI1 A;  3AUZ A;  3B82 A;  4BS9 A;  2N3H A;  4MYT A;  3ZZU A;  3VYY A;  4R8O A;  1S4E A;  3CWV A;  1ZXN A;  4LF4 E;  1XHK A;  4FWD A;  4UT4 A;  1ZBT A;  1N32 E;  1IBL I;  1N0U A;  2UXB I;  2E1R A;  4DUZ E;  1UIL A;  4DV3 I;  1B63 A;  2HHH E;  4M2Z A;  4ED4 A;  2LBS B;  4DR3 I;  2N3G A;  3F6G A;  3ADI A;  4DR7 E;  2F4V I;  4DR3 E;  2V8P A;  4DUY E;  3AV0 A;  4B3M I;  4YHH E;  2BM0 A;  3QT6 A;  2KHX A;  4JV5 I;  5BR8 E;  1FWL A;  3J81 Q;  2E5L I;  4DV7 I;  2DB2 A;  2UUA E;  1Y4S A;  1USU A;  3F6H A;  5CFF E;  1WHN A;  4B3T I;  2UUC I;  4LFB E;  2VQF E;  3LLH A;  3LML A;  3J7Y p;  4JI6 I;  4M1K A;  4XTJ A;  5AAS A;  2L33 A;  3QT7 A;  1Y6Z A;  1X48 A;  2CPN A;  3ZKD A;  1Z0W A;  4LF7 E;  4X65 E;  1YZ9 A;  3QT8 A;  5DNY A;  4JI0 I;  2ZM6 I;  2MC5 A;  1H7U A;  5AE1 A;  4HAC B;  3OML A;  3T1H E;  3ADJ A;  4JI2 I;  1HK7 A;  4NXM I;  1J26 A;  1U2R A;  4DR4 E;  2KOU A;  1YYW A;  4DPX A;  2M1S A;  2O1U A;  4DV4 E;  2R42 A;  2E5L E;  2V83 A;  1I94 E;  1YYK A;  4DR6 E;  4GEQ B;  2JVA A;  4DPT A;  3HTX A;  1HNX I;  1NHJ A;  4DUY I;  2UUB E;  3DJW A;  2M7Q A;  4LFC I;  5LMN I;  2LMZ A;  3PRY A;  2VF3 A;  4JYA E;  1T4O A;  4LF5 E;  2V8Q B;  4JI7 E;  4DR5 E;  2ZM6 E;  4LF8 E;  2VQE I;  3T1Y I;  5LMN E;  2HFS A;  5IT9 C;  2MDR A;  4DPW A;  1IBL E;  1N36 I;  1UHZ A;  2YT4 A;  4DU7 A;  4DR5 I;  1MX0 A;  3J7A G;  4DV4 I;  4DV5 E;  2V2Q A;  3LNU A;  1ELO A;  1Z0G A;  4DPU A;  4USM A;  4LFC E;  4X64 E;  4DR2 I;  4DV5 I;  2UUB I;  2IOP A;  1HNX E;  3ZZT A;  4IZJ A;  1ZBQ A;  4EMD A;  4DV3 E;  2JOB A;  5FLX Q;  4OX9 I;  2O1V A;  4J8Z A;  2PNM A;  4DR2 E;  3LPS A;  4DR7 I;  2GQ0 A;  2O1W A;  5LL6 R;  4DR4 I;  2V2V A;  2Z5E A;  2NA2 A;  1Y4U A;  1IBK E;  1RR9 A;  4FN5 A;  4JI0 E;  4JI4 I;  4NXN E;  2V85 A;  1YYO A;  4F9C B;  4FWG A;  2VQE E;  4LF8 I;  1FI4 A;  1Z5C A;  1ZM4 A;  4JI7 I;  2V88 A;  2ZBK B;  5GMD A;  1A6F A;  1ZM9 A;  1Z5B A;  4X64 I;  4LFB I;  4DV1 E;  2M4I A;  1B62 A;  2FV4 B;  4JI8 E;  2CGE A;  4URL A;  3OTO I;  4YY3 E;  4OX9 E;  2X36 A;  2B7T A;  2HHH I;  1DQ3 A;  2UU9 E;  1OJ4 A;  4DUZ I;  2FTX B;  4DV0 I;  1USV A;  3JAM C;  4BMJ A;  1FWK A;  4X62 E;  3VK6 A;  2Z5C A;  3OTO E;  4JI8 I;  4DMI A;  1NHI A;  4PU9 A;  1T4N A;  2L6M A;  1PVG A;  4WYQ B;  4JYA I;  2RS7 A;  2V34 A;  2G7H A;  4DR1 I;  4JI3 E;  3C4T A;  2WW4 A;  5ADZ A;  1STU A;  1X47 A;  4BCA A;  4DXL A;  1S16 A;  2UUC E;  1J5E E;  4LF6 I;  4BC7 A;  1UEK A;  1HNZ I;  4BBY A;  1O0W A;  1HR0 I;  2L3C A;  3Q6M A;  3K17 A;  2L92 A;  2Z5C B;  4AQY E;  4K0K E;  1H7S A;  1Z0C A;  2NUG A;  2UXB E;  2LTS A;  4DV6 I;  4ZVI A;  1EA6 A;  2JR1 A;  1Z0T A;  1RC7 A;  3IWD A;  4NXM E;  3WU4 A;  2B9D A;  2K4V A;  4MYU A;  2DMY A;  3ZOQ B;  2PNL A;  4I3H A;  2VQF I;  1MU5 A;  4IZK A;  3ZZ0 A;  2A2D A;  2JOX A;  4OOG C;  4B3T E;  4DU8 A;  2X7I A;  1K47 A;  3GON A;  5A2Q Q;  2OI2 A;  2EWL A;  1N32 I;  5BR8 I;  1HNW I;  3J80 C;  3DF6 A;  2DIX A;  1QU6 A;  4L5N C;  1XMO E;  4LF5 I;  2KON A;  1RQ0 A;  3WU3 A;  4USK A;  2UXD E;  1T4L B;  4GKK I;  4DR6 I;  3Q1Q A;  4X8W A;  4PRV A;  3ADL A;  4X65 I;  4TUG A;  2RSM A;  4B3S E;  2UXC E;  2CG9 A;  5AE2 A;  2J7K A;  2JY9 A;  2BM1 A;  4L8N A;  4AQY I;  4LU9 A;  3ZKB A;  1DI2 A;  3HJC A;  3B78 A;  4PRX A;  2ZIT A;  2NPF A;  5LMU I;  4R03 A;  4DKK A;  1WUU A;  3C4B A;  1ZXM A;  2LTR A;  4YHH I;  1XNQ I;  1SR9 A;  5F3W A;  4DV2 E;  2NUF A;  2HKJ A;  3PYG A;  1HNW E;  4HYM A;  2L3J A;  3F0N A;  2A2C A;  4HAC A;  3H09 A;  3P1X A;  1VIS A;  2BV3 A;  3KWR A;  4B3R I;  1XNR I;  3PYD A;  4P78 A;  2IOQ A;  2ODR D;  1PIE A;  4TUI A;  3JU0 A;  5T6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...