1IBME

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ibmE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibmE02
4KHPI 1IBME 4DPWA 4KQVA 2N3GA 4JG4A 1Z59A 1Z0GA 1EI1A 4DR1E 1H7UA 1A6FA 1XMQI 2UUBI 3GONA 3OTOE 4P7AA 3H4LA 1X47A 2HK2A 1U2RA 1NZ0A 2RS6A 1FKAE 3JAMQ 4FWHA 3WU5A 2B7VA 1IBLE 4JI2I 1J5EI 5FLXQ 1N36I 2RTXA 2JY9A 1RC7A 4JI0I 1MG7A 4DV2I 4FWDA 2X36A 4OOGC 4UT4A 4JYAE 1HNWE 1NHJA 3K1JA 4NXNI 4LFCE 2A2CA 1XNQE 4DV3E 3ADIA 4LF8E 3LNUA 1MX0A 2JVAA 1Z5CA 1MU5A 1VISA 2UXCI 5A2QQ 4X66E 1N33E 4WUDA 1KKHA 4DV7E 1OJ4A 1HR0I 4JI5I 2L3CA 2ZM6E 1I94E 1RREA 3PYDA 2V34A 1YYOA 2IHR1 1DI2A 3J80C 4JI3I 1FWKA 4EMDA 4B3SI 1IBMI 5BR8E 2E5LE 1Z0EA 3F0NA 1UHZA 3ZKBA 1YZ9A 4AQYE 4LF4E 2VQFE 4DV1E 2WW4A 2LRSA 4DPTA 1ZBTA 2DMYA 2HKJA 2ZBKB 4FN5A 2HFSA 2CPNA 3QT6A 4DV5E 1J5EE 5LL6R 4DXLA 4JI0E 1RR9A 3B78A 1XMOI 1H73A 3WU4A 2V2VA 5LMNE 4X62I 4MYUA 4DR2E 1HNWI 4HY1A 4JI1I 5GMEA 4ED4A 4DV6I 3HTXA 1BKNA 2HK3A 5IWAE 2UXDE 4JI6E 4NXNE 1KVKA 4MYTA 4PU9A 4LF5I 1XNQI 4DV3I 1T4OA 2V2ZA 1B62A 1J26A 4YY3I 2UUAE 4DPXA 4GKJI 5CFFE 1Z5AA 1HR0E 4DU8A 1ZM3A 4JI5E 4ZVIA 1NHIA 2ZM6I 1FI4A 3QT8A 2VF3A 2E1RA 2XEXA 4HACB 3D4JA 3T1HE 4WYQB 2VQEI 4DUYI 4LF9I 4JI8E 2E5LI 3C4TA 1N34I 3ADGA 2ZITA 2LJPA 3J7Yp 4DV0E 1YYWA 1PVGA 4OX9E 1S16A 2DEJA 2L33A 4DV1I 4GKKI 4K0KI 2V2QA 2NUEA 1D6TA 1XNRE 4DV4I 4X64E 3VYXA 4HACA 1HNXI 2UXBI 4KHPE 1ZM2A 4NXME 3LTOA 2DIXA 2KHXA 3ZZTA 4B3MI 4DR4I 1WHNA 4I3HA 4DR1I 1Z0TA 2UUBE 1FNMA 3LLHA 4DR2I 1Z0WA 3WU6A 2RSMA 5FLXC 1HNZI 4JI6I 3Q1QA 2L3JA 4DR7I 4Z7YA 2B3TB 4B3RE 1H72C 4LFAE 5A2QC 2DEIA 4JI4I 3QT5A 1N36E 4XTJA 1DARA 4JV5E 2BV3A 3J7AG 3C4BA 4DV2E 1H74A 2R3VA 1GQEA 4YHHE 1FJGE 4DR6E 5IT9C 4LFCI 3P1XA 3ADLA 1Z5BA 4LF8I 2YT4A 2VQEE 5LMUE 4DKKA 4LFBE 4JI8I 2Q2EB 4DR5E 2J7KA 3J80Q 4DV0I 3T1YE 1ZXNA 1WHQA 2EFGA 1Z0CA 1I94I 1ZM9A 1NHHA 4LF7I 1XNRI 4DV4E 3PYGA 2F4VI 1HNXE 1O0WA 4NXMI 4Z7CA 4DR3I 4JI2E 4WFTA 1K47A 1X48A 4DUZI 4RPFA 3B8HA 1EKZA 1PIEA 2UU9E 4LF6E 4DPYA 1UILA 4B3TE 4DR7E 1QZRA 2EZ6A 4M30A 3WU3A 3B82A 4B3RI 2RS7A 3K17A 4DV5I 4JI4E 2UXCE 1PKPA 1N32I 4JV5I 4X66I 3ZZ0A 1N33I 1YYKA 3V2UC 3CWVA 4DV7I 1X49A 4JI1E 4DV6E 5IWAI 1N0UA 2UUCE 1KTVA 3VYYA 4FW9A 4JI3E 2LUPB 3J81Q 2HHHI 1EA6A 4B3SE 1ELOA 2MDRA 4X65I 5IT9Q 5LMUI 5BR8I 4LFBI 4M1KA 4YY3E 4GKJE 4DR5I 2NPFA 2HFUA 4JI7I 4PRXA 2L2KB 4AQYI 4LF4I 3T1YI 2VQFI 3J7AM 2DB2A 1FWLA 3ZM7A 1IBKE 3PYEA 4M2ZA 2LBSB 4LF7E 1UEKA 4R1FA 1ZXMA 2F4VE 5GMDA 2NUGA 5L3JA 2AJ4A 1ZM4A 2N3HA 4DR3E 4DU7A 4WUBA 2LTRA 4HXZA 1XMQE 2LJHA 1XMOE 4OX9I 3OTOI 4DUZE 5LMNI 4PRVA 4X62E 2HKEA 2BM1A 3V5RA 4GKKE 4K0KE 3M6AA 3ZKDA 2CZ9A 2UU9I 1XHKA 4LF6I 1QU6A 2UXDI 2GS8A 4USMA 1RQ0A 4B3TI 3PYFA 4LF5E 4X64I 1IBLI 4P52A 4X8WA 2UXBE 1Z0BA 1N32E 2UUAI 4B3ME 3ADJA 3J81C 4DR4E 1KIJA 4WUCA 1T4LB 4JYAI 2B7TA 3ZZUA 3QT7A 1STUA 2R42A 1HNZE 1T4NA 1B63A 1Z0VA 2UUCI 4USKA 4HYMA 2BM0A 2L2NA 2A2DA 3T1HI 2LTSA 2HHHE 3LPSA 4LFAI 4X65E 4DUYE 1WUUA 4LF9E 1N0VC 1N34E 2NUFA 2L2MA 4FWGA 3HULA 4JI7E 4YHHI 1FJGI 4URLA 4DR6I 2LUQA 1IBKI 2NA2A 1S4EA 4DPUA 2X7IA 4UTGA 3JAMC 2OI2A 2V8PA 1H7SA
chains in the Genus database with same CATH superfamily
1QNTA 4KHPI 5TSEA 1IBME 1PJSA 5K36F 4DPWA 5LLQA 5KL5A 5DNYA 4KQVA 2N3GA 4JG4A 1Z59A 2EPMX 1Z0GA 2LJUA 1A1KA 1EI1A 4NBQA 2EMFA 1AAYA 4DR1E 1H7UA 4TUGA 2F8BA 1A6FA 1XMQI 2UUBI 4F9CB 2V83A 2EMGA 3OTOE 1YHCA 3GONA 2CTDA 1X47A 2V8QB 3BGHA 2HK2A 3H4LA 3HPZA 4O43A 1EH8A 1DQ3A 1U2RA 2Z5EA 1NZ0A 4FW7A 2PO0A 4J3DA 1X6FA 2RS6A 4IFDE 4RH8A 1FKAE 1DGCA 2YRKA 5AC5A 2CT1A 2RSIA 3JAMQ 2LVHA 4FWHA 3QG5C 3WU5A 2B7VA 3PS2A 1IBLE 2DRPA 5C0XD 1YSAC 5K36B 1MEYC 3P3CA 5AE2A 1YUJA 4JI2I 1TF6A 1J5EI 1OYRA 5FLXQ 1N36I 2RTXA 2JY9A 1RC7A 4JI0I 1MG7A 4DV2I 4FWDA 2EL4A 2EMBA 2EN2A 2X36A 2YPNA 4OOGC 5IXMB 2FTXB 2KOUA 4UT4A 4JYAE 1HNWE 2F1DA 4R2CA 2JEBB 1NHJA 2BA0G 3K1JA 1UDOA 5DRRA 2ELYA 1Y6ZA 2C38B 2YTNA 5T6JA 1RHYA 3OMLA 4NXNI 4LFCE 1MGTA 2C37B 2EOFA 4QNJA 1PJQA 3THOB 2A2CA 1XNQE 2LCEA 2EQ0A 4DV3E 3ADIA 2DLKA 4LF8E 3LNUA 2EP3A 4GZNC 1MX0A 2JVAA 4BCAA 1Z5CA 3LMLA 1MU5A 2EM2A 1HK7A 1VISA 1X6EA 2UXCI 3AUZA 1JK2A 5A2QQ 4X66E 4R2SA 3JU0A 2GHFA 1N33E 3RMPA 2HGHA 4M0VA 4LOMA 4WUDA 5A6JA 2ODRD 2Q8UA 1KKHA 2MKDA 4DV7E 1A1LA 1OJ4A 2BA0D 2YTDA 4U3DA 2EMXA 2DMIA 2JEBA 1HR0I 4JI5I 2WP8A 4F6MA 2MC6A 2L3CA 2WBUA 2BA1G 2PNZA 2ZM6E 4TUIA 2LT7A 1I94E 1RREA 3Q6MA 3PYDA 2V34A 1N3GA 3GCMA 1YYOA 2IHR1 1DI2A 3J80C 1Z1BA 4BA1A 4JI3I 5A6KA 2EOYA 2M9AA 3K85A 1FWKA 1WJPA 4EMDA 4B3SI 4OKGA 1IBMI 1UDNA 5BR8E 2EOJA 2EM0A 2V87A 2E5LE 4IFDC 2JXPA 1Z0EA 2NN6B 2EM6A 4I8OA 2PO0B 1UDQA 3F0NA 2DGCA 4FW4A 4BBYA 4O5GA 2JEAA 1UHZA 1USVA 3ZKBA 4P7DA 2LMZA 4AQYE 4LF4E 1YZ9A 2M1SA 2V88A 3CDIA 2VQFE 4DV1E 1UN6B 3TQMA 2WW4A 2LRSA 2EM3A 3VHTB 4DPTA 2YRMA 1ZBTA 2DSYA 2YU5A 4MU4A 2DMYA 3KZZA 2HKJA 2ZBKB 3HPSA 4FN5A 1YFHA 2PNZB 2YZTA 4R2EA 3IWDA 4Q35B 2HFSA 1SFEA 5F3WA 2LV2A 2EPNA 2B9DA 2JE6A 2CPNA 2YSOA 4DV5E 3QT6A 4R2QA 2WP8B 3JTZA 1J5EE 3HKMA 2EM4A 2RPCA 5LL6R 2PO2A 4DXLA 4BMJA 4ZYGA 2EOIA 3KWRA 4JI0E 2NN6A 1Y5YA 1RR9A 3B78A 2YTGA 5A6AA 4BA1B 3EPJA 1XMOI 3IWCA 4ZYHA 1H73A 2V2VA 3WU4A 5LMNE 2EOSA 2EPUA 4X62I 2I9IA 4ZYDA 4DR2E 4MYUA 1HNWI 3K6QA 4HY1A 2EOZA 4IZJD 4JI1I 1KJKA 5GMEA 4ED4A 2O1TA 3HTXA 1BKNA 3EPKA 2HK3A 4DV6I 5IWAE 4QNKA 4BHCA 2UXDE 5JEAC 4JI6E 4NXNE 3ECRA 2EM9A 1KVKA 4MYTA 4PU9A 4LF5I 1XNQI 4L8NA 4DV3I 2JE6B 2EOMA 4P7AA 1T4OA 1E3PA 2V2ZA 1B62A 1RMDA 4LTYA 1J26A 2PO2B 4YY3I 2UUAE 4DPXA 4GKJI 2K7IA 1A1GA 5AE1A 2YTFA 3EQ1A 1WXRA 3MHHC 5CFFE 4WSPA 2YTQA 1F2IG 1Z5AA 1HR0E 4DU8A 1ZM3A 4JI5E 1R6MA 4ZVIA 1BB8A 1NHIA 2ZM6I 2NABA 2RQLA 3GMEA 1FI4A 3Q6NA 3QT8A 3M85D 2VF3A 2E1RA 2XEXA 4HACB 4R2RA 3D4JA 3T1HE 4WYQB 2VQEI 5C0XC 4DUYI 4R2AA 2EPAA 4R2DA 2EOEA 2BA1D 4JI8E 2E5LI 4LF9I 3C4TA 1N34I 2EORA 3ADGA 4F6NA 4IJDA 2Z5BA 2ZITA 4MU1A 1X5WA 2EQ1A 2LJPA 3J7Yp 4DV0E 1YYWA 2A25A 4OX9E 2KONA 1PVGA 1S16A 2DEJA 4LPFA 2PNLA 2K4VA 4U3BA 5DRQA 2L33A 3THNA 2IESA 2PRTA 4DV1I 4GKKI 2V2QA 4K0KI 1OYPA 1VI7A 2BBGA 4IZJB 2NUEA 5C0XE 2EQ3A 1D6TA 3U1YA 2N8XA 1OYSA 1NEIA 2EMKA 1XNRE 4DV4I 1E3HA 4WSGA 4X64E 2EMZA 3VYXA 4HACA 2DLQA 5KL2A 1HNXI 2UXBI 3P06A 2JPAA 4KHPE 1ZM2A 4NXME 3LTOA 2DIXA 4IS9A 2CVEA 2KHXA 2EM8A 3GLLA 5A6BA 3ZZTA 4B3MI 4DR4I 1WHNA 4I3HA 4DR1I 2VESA 3H09A 1XXEA 1Z0TA 2UUBE 2EN1A 2EMYA 1FNMA 3LLHA 2FV4B 2GLIA 1Z0WA 4DR2I 3EPLA 3WU6A 4OO1B 2RSMA 3KZYA 4Q28A 5FLXC 2Z5BB 1HNZI 2EPXA 5DROA 2EPLX 4HTGA 1USUA 3L00A 2L92A 4JI6I 3Q1QA 2L3JA 4F54A 3CDJA 1Y4SA 4DR7I 4Z7YA 2B3TB 5JEAD 2ADRA 1NCSA 4B3RE 5DRPA 1EH7A 3UK3C 2R1FA 1H72C 5A2QC 4LFAE 2DEIA 4JI4I 2JR1A 3QT5A 1N36E 5K36C 4LCGA 4XTJA 1DARA 4JV5E 3J7AG 2BV3A 3C4BA 5A69A 4DV2E 2HC5A 2H36X 3MHSC 1B69A 1H74A 2R3VA 2JEAB 3ZOQB 1GQEA 2LE2A 3P3GA 2EE8A 2EM5A 4YHHE 4OZEA 4OO1C 1YPNA 1FJGE 2GPIA 4DR6E 5IT9C 2EMLA 1IQSA 4WXCA 3IWBA 2M4IA 4F2JC 2EPPA 5IV8B 4BHBA 1UDSA 4LFCI 4AIMA 4R2PA 3P1XA 1T38A 2NN6D 4IFDA 5DNLA 5EL9A 3ADLA 2YU8A 2EWLA 1Z5BA 4LF8I 2YT4A 3MSWA 2VQEE 2NN6C 5KL6A 2FGGA 5LMUE 3U1KA 4O4KA 4DKKA 1A1JA 4LFBE 4JI8I 3BIDA 4BC7A 2ENAA 4AIDA 2Q2EB 1BBGA 4DR5E 4O24A 2CG9A 2J7KA 3L7ZB 2YTJA 3BBGA 4FW5A 4NZVA 4J8ZA 3J80Q 2V85A 4DV0I 3P3EA 3T1YE 1ZXNA 2YTIA 3F6GA 1WHQA 3DJWA 2MC5A 1GZ6A 4IS1C 2NN6E 2EFGA 3F6HA 4HEIA 1Z0CA 1R6LA 1I94I 1ZM9A 1NHHA 4GEQB 4LF7I 1XNRI 4DV4E 2YWQA 2EN7A 3PYGA 2F4VI 2IOPA 1HNXE 5JEAB 1O0WA 2EPKX 2BR2A 4M9VC 4NXMI 4Z7CA 2VE7C 4DR3I 4JI2E 1LLMC 4OO1A 1IQOA 2O1VA 2J7JA 4WFTA 3HXLA 1K47A 4IFDB 2E1MA 2EM7A 4L5NC 1X48A 5AC4A 4DUZI 2EN4A 4RPFA 3M99B 3B8HA 2IOQA 1EKZA 1PIEA 5K36E 4LU9A 4ISAA 4MQYA 2UU9E 4LF6E 2V86A 4FK5C 2PNMA 2EMHA 4DPYA 1UILA 4B3TE 4DR7E 1QZRA 2YRHA 2EZ6A 4M30A 2GQ0A 4ZYEA 3B82A 3DF6A 2EN3A 1PJTA 2RS7A 3K17A 3WU3A 4DV5I 1G2FC 4B3RI 3AV0A 2JOBA 4FW6A 4JI4E 2J65A 2UXCE 1PKPA 1KYQA 1ZR9A 4JV5I 1N32I 4X66I 1BBOA 2JP9A 3ZZ0A 1N33I 2BB8A 1YYKA 1JK1A 3V2UC 1Y4UA 1UBDC 2JYAA 3CWVA 4LCHA 4DV7I 1PDAA 1IMUA 4F9AB 1X49A 4AM3A 1ZU1A 4BC9A 4JI1E 5ELWA 3NZKA 4DV6E 4IZJA 5IWAI 2V89A 4OO1D 1N0UA 2UUCE 1KTVA 2EL5A 1A1IA 3VYYA 4FW9A 3L7ZA 5KL7A 4JI3E 2LUPB 1L4SA 2ODRC 3J81Q 2HHHI 2ENCA 1EA6A 4N3OA 4B3SE 1ELOA 2L8TA 2MDRA 4X65I 5LMUI 5IT9Q 5BR8I 4BA2B 4LFBI 1X6HA 4WPYA 4M1KA 2EOXA 2EOHA 4YY3E 4GKJE 4RHBB 4DR5I 2NPFA 2HFUA 1WRJA 2EMCA 4KWYA 1AH5A 4P78A 5C0XA 2WBTA 4JI7I 4PRXA 2L2KB 4AQYI 4LF4I 3T1YI 2MKNA 4IZKA 2VQFI 3J7AM 2DB2A 1FWLA 2EN6A 3ZM7A 2LO3A 1IBKE 2C38A 3PYEA 2C39A 4OO1F 5A6BD 3H1CA 2EMIA 4M2ZA 2LBSB 4LF7E 3PS1A 1UEKA 4R1FA 5K36D 2L6MA 2YTOA 1ZXMA 2EMWA 2F4VE 5ADZA 5GMDA 2VRDA 2JOXA 2YTEA 1Y60A 1YH8A 2GO4A 1SR9A 2NUGA 5L3JA 2AJ4A 1ZM4A 3C6MA 4MLVA 2PO1B 2N3HA 4DR3E 1TF3A 4DU7A 1X3CA 3KRNA 2Z5CA 4BA2A 1TN9A 5AASA 2EPRA 4WUBA 2LTRA 4F9BB 2EOQA 4HXZA 1XMQE 2R76A 2LJHA 1XMOE 3BF2A 4BS9A 2IERA 3OTOI 4DUZE 5LMNI 4OX9I 2CSHA 1P42A 5KL4A 4PRVA 5KL3A 4X62E 2HKEA 4R8OA 2BM1A 3V5RA 4IZKB 4GKKE 1T39A 4K0KE 3M6AA 4MDTA 4MU0A 3ZKDA 2CZ9A 2EOOA 2UU9I 1XHKA 2JWOA 4LF6I 1QU6A 2C39B 2UXDI 2GS8A 4USMA 1RQ0A 2M7QA 4B3TI 2O1WA 2WNRB 2O1UA 3PYFA 3EPHA 4R03A 1ZAAC 4LF5E 4X64I 1IBLI 2VF1A 4X8WA 2UXBE 4P52A 5C0XF 4OO1E 2WBSA 3FIGA 3B4TA 2EN8A 3M85G 1Z0BA 3C6KA 3UHMA 2Z5CB 1GTKA 1N32E 2UUAI 4B3ME 3HJCA 3ADJA 2EL6A 3J81C 4DR4E 2D9HA 1KIJA 3VK6A 4WUCA 1T4LB 2EPZA 1A1FA 5K36A 2E72A 4LCFA 4JYAI 3P76A 2B7TA 1A1HA 5EKWA 2ELZA 3ZZUA 4MU3A 3PRYA 3QT7A 2NN6F 1STUA 2ENHA 1HNZE 4MLQA 2R42A 1T4NA 1B63A 2WCC3 1Z0VA 2I13A 5FWKA 2UUCI 4WXDA 4KZSA 3DD6A 2JT2A 4USKA 2MDGA 2CGEA 4HYMA 2BM0A 2AE8A 2L2NA 5C0XB 3HQ1A 2A2DA 2YSPA 2LTSA 3T1HI 5JEAA 2HHHE 2G7HA 2BR2B 3LPSA 4LFAI 4X65E 4X9JA 4DUYE 1WUUA 4LF9E 1N0VC 2GO3A 5JEAF 5JEAE 1N34E 2NUFA 4GQUA 2L2MA 2C37A 2WNRA 2YTPA 2EJ4A 4FWGA 3HULA 4JI7E 2EPOA 2WZOA 1EH6A 4YHHI 2O3ZA 1FJGI 4N4RB 4URLA 4DR6I 5AE3A 4DMIA 2PO1A 2LUQA 1YUIA 1ZBQA 2NA2A 3PS3A 4FW3A 2EMAA 1S4EA 5DNXA 1IBKI 4DPUA 3M7NG 1G2DC 2X7IA 3JAMC 4UTGA 4WX9A 2EPCA 2OI2A 2V8PA 3M7ND 1H7SA 2HJJA 1P47A 4IFDD 4NHRA 4IFDF
chains in the Genus database with same CATH topology
4KHPI 1IBME 4DPWA 5DNYA 4KQVA 2N3GA 4JG4A 1Z59A 1Z0GA 1EI1A 4DR1E 1H7UA 4TUGA 2F8BA 1A6FA 1XMQI 2UUBI 4F9CB 2V83A 3OTOE 3GONA 4P7AA 3H4LA 1X47A 2V8QB 2HK2A 3HPZA 1DQ3A 1U2RA 2Z5EA 1NZ0A 2RS6A 1FKAE 3JAMQ 4FWHA 3WU5A 2B7VA 1IBLE 5AE2A 4JI2I 1J5EI 5FLXQ 1N36I 2RTXA 2JY9A 1RC7A 4JI0I 1MG7A 4DV2I 4FWDA 2X36A 4OOGC 2FTXB 2KOUA 4UT4A 4JYAE 1HNWE 1NHJA 3K1JA 1Y6ZA 5T6JA 3OMLA 4NXNI 4LFCE 2A2CA 1XNQE 4DV3E 3ADIA 4LF8E 3LNUA 1MX0A 2JVAA 4BCAA 1Z5CA 3LMLA 1MU5A 1HK7A 1VISA 2UXCI 3AUZA 5A2QQ 4X66E 3JU0A 1N33E 3RMPA 4M0VA 4WUDA 2ODRD 1KKHA 4DV7E 1OJ4A 1HR0I 4JI5I 2MC6A 2L3CA 2ZM6E 4TUIA 1I94E 1RREA 3Q6MA 3PYDA 2V34A 1YYOA 2IHR1 1DI2A 3J80C 4JI3I 3K85A 1FWKA 4EMDA 4B3SI 1IBMI 5BR8E 2V87A 2E5LE 1Z0EA 4I8OA 3F0NA 4BBYA 1UHZA 1USVA 3ZKBA 4P7DA 2LMZA 4AQYE 4LF4E 1YZ9A 2M1SA 2V88A 2VQFE 4DV1E 2WW4A 2LRSA 4DPTA 1ZBTA 2DSYA 2DMYA 2HKJA 2ZBKB 4FN5A 3HPSA 2YZTA 3IWDA 2HFSA 5F3WA 2B9DA 2CPNA 3QT6A 4DV5E 3JTZA 1J5EE 5LL6R 4DXLA 4BMJA 4JI0E 3KWRA 1RR9A 3B78A 1XMOI 1H73A 3IWCA 3WU4A 2V2VA 5LMNE 4X62I 4MYUA 4DR2E 1HNWI 3K6QA 4HY1A 4IZJD 4JI1I 5GMEA 4ED4A 2O1TA 3HTXA 1BKNA 4DV6I 2HK3A 5IWAE 2UXDE 4JI6E 4NXNE 1KVKA 4MYTA 4PU9A 4LF5I 1XNQI 4L8NA 4DV3I 1T4OA 2V2ZA 1B62A 4LTYA 1J26A 4YY3I 2UUAE 4DPXA 4GKJI 5AE1A 1WXRA 5CFFE 4WSPA 1Z5AA 1HR0E 4DU8A 1ZM3A 4JI5E 4ZVIA 1NHIA 2ZM6I 1FI4A 3Q6NA 3QT8A 2VF3A 2E1RA 2XEXA 4HACB 3D4JA 3T1HE 4WYQB 2VQEI 4DUYI 4LF9I 4JI8E 2E5LI 3C4TA 1N34I 3ADGA 2Z5BA 2ZITA 2LJPA 3J7Yp 4DV0E 1YYWA 1PVGA 4OX9E 2KONA 1S16A 2DEJA 2PNLA 2K4VA 2L33A 4DV1I 4GKKI 4K0KI 2V2QA 4IZJB 2NUEA 1D6TA 1XNRE 4DV4I 4X64E 3VYXA 4HACA 1HNXI 2UXBI 3P06A 4KHPE 1ZM2A 4NXME 3LTOA 2DIXA 2KHXA 3ZZTA 4B3MI 4DR4I 1WHNA 4I3HA 4DR1I 3H09A 1Z0TA 2UUBE 1FNMA 3LLHA 2FV4B 4DR2I 1Z0WA 3WU6A 2RSMA 5FLXC 4Q28A 2Z5BB 1HNZI 1USUA 2L92A 4JI6I 3Q1QA 2L3JA 4F54A 1Y4SA 4DR7I 4Z7YA 2B3TB 4B3RE 1H72C 5A2QC 4LFAE 2DEIA 4JI4I 2JR1A 3QT5A 1N36E 4XTJA 1DARA 4JV5E 3J7AG 2BV3A 3C4BA 4DV2E 2H36X 1H74A 2R3VA 3ZOQB 1GQEA 2LE2A 4YHHE 1FJGE 4DR6E 5IT9C 3IWBA 2M4IA 4LFCI 3P1XA 3ADLA 2EWLA 1Z5BA 4LF8I 2YT4A 3MSWA 2VQEE 2FGGA 5LMUE 4DKKA 4LFBE 4JI8I 4BC7A 2Q2EB 4DR5E 2CG9A 2J7KA 4J8ZA 3J80Q 2V85A 4DV0I 3T1YE 1ZXNA 3F6GA 1WHQA 3DJWA 2MC5A 1GZ6A 2EFGA 3F6HA 1Z0CA 1I94I 1ZM9A 1NHHA 4GEQB 4LF7I 1XNRI 4DV4E 3PYGA 2F4VI 2IOPA 1HNXE 1O0WA 4NXMI 4Z7CA 2VE7C 4DR3I 4JI2E 2O1VA 4WFTA 3HXLA 1K47A 2E1MA 4L5NC 1X48A 4DUZI 4RPFA 3B8HA 2IOQA 1EKZA 1PIEA 4LU9A 2UU9E 4LF6E 2V86A 2PNMA 4DPYA 1UILA 4B3TE 4DR7E 1QZRA 2GQ0A 2EZ6A 4M30A 3WU3A 3B82A 3DF6A 2RS7A 3K17A 4B3RI 4DV5I 3AV0A 2JOBA 4JI4E 2UXCE 1PKPA 1N32I 4JV5I 4X66I 3ZZ0A 1N33I 1YYKA 3V2UC 1Y4UA 3CWVA 4DV7I 4F9AB 1X49A 4BC9A 4JI1E 4DV6E 4IZJA 5IWAI 2V89A 1N0UA 2UUCE 1KTVA 3VYYA 4FW9A 4JI3E 2LUPB 2ODRC 3J81Q 2HHHI 1EA6A 4N3OA 4B3SE 1ELOA 2L8TA 2MDRA 4X65I 5LMUI 5IT9Q 5BR8I 4LFBI 4WPYA 4M1KA 4YY3E 4GKJE 4DR5I 2NPFA 2HFUA 4P78A 4JI7I 4PRXA 2L2KB 4AQYI 4LF4I 3T1YI 4IZKA 2VQFI 3J7AM 2DB2A 1FWLA 3ZM7A 1IBKE 3PYEA 4M2ZA 2LBSB 4LF7E 1UEKA 4R1FA 2L6MA 1ZXMA 2F4VE 5ADZA 5GMDA 2JOXA 1SR9A 2NUGA 5L3JA 2AJ4A 1ZM4A 2N3HA 4DR3E 4DU7A 2Z5CA 5AASA 4WUBA 2LTRA 4F9BB 4HXZA 1XMQE 2LJHA 1XMOE 4OX9I 4BS9A 3OTOI 4DUZE 5LMNI 4PRVA 4X62E 2HKEA 4R8OA 2BM1A 3V5RA 4IZKB 4GKKE 4K0KE 3M6AA 3ZKDA 2CZ9A 2UU9I 1XHKA 2JWOA 4LF6I 1QU6A 2UXDI 2GS8A 4USMA 1RQ0A 2M7QA 4B3TI 2O1WA 3PYFA 2O1UA 4R03A 4LF5E 4X64I 1IBLI 2VF1A 4X8WA 2UXBE 4P52A 3FIGA 1Z0BA 2Z5CB 1N32E 2UUAI 4B3ME 3HJCA 3ADJA 3J81C 4DR4E 1KIJA 3VK6A 4WUCA 1T4LB 4JYAI 2B7TA 3ZZUA 3PRYA 3QT7A 1STUA 2R42A 1HNZE 5FWKA 1T4NA 1B63A 1Z0VA 2UUCI 4KZSA 4USKA 4HYMA 2CGEA 2BM0A 2L2NA 3HQ1A 2A2DA 3T1HI 2LTSA 2HHHE 2G7HA 3LPSA 4LFAI 4X65E 4DUYE 1WUUA 4LF9E 1N0VC 1N34E 2NUFA 2L2MA 4FWGA 3HULA 4JI7E 2WZOA 4YHHI 1FJGI 4URLA 4DR6I 5AE3A 4DMIA 2LUQA 1IBKI 1ZBQA 2NA2A 1S4EA 4DPUA 2X7IA 3JAMC 4UTGA 2OI2A 2V8PA 1H7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP I;  1IBM E;  4DPW A;  4KQV A;  2N3G A;  4JG4 A;  1Z59 A;  1Z0G A;  1EI1 A;  4DR1 E;  1H7U A;  1A6F A;  1XMQ I;  2UUB I;  3GON A;  3OTO E;  4P7A A;  3H4L A;  1X47 A;  2HK2 A;  1U2R A;  1NZ0 A;  2RS6 A;  1FKA E;  3JAM Q;  4FWH A;  3WU5 A;  2B7V A;  1IBL E;  4JI2 I;  1J5E I;  5FLX Q;  1N36 I;  2RTX A;  2JY9 A;  1RC7 A;  4JI0 I;  1MG7 A;  4DV2 I;  4FWD A;  2X36 A;  4OOG C;  4UT4 A;  4JYA E;  1HNW E;  1NHJ A;  3K1J A;  4NXN I;  4LFC E;  2A2C A;  1XNQ E;  4DV3 E;  3ADI A;  4LF8 E;  3LNU A;  1MX0 A;  2JVA A;  1Z5C A;  1MU5 A;  1VIS A;  2UXC I;  5A2Q Q;  4X66 E;  1N33 E;  4WUD A;  1KKH A;  4DV7 E;  1OJ4 A;  1HR0 I;  4JI5 I;  2L3C A;  2ZM6 E;  1I94 E;  1RRE A;  3PYD A;  2V34 A;  1YYO A;  2IHR 1;  1DI2 A;  3J80 C;  4JI3 I;  1FWK A;  4EMD A;  4B3S I;  1IBM I;  5BR8 E;  2E5L E;  1Z0E A;  3F0N A;  1UHZ A;  3ZKB A;  1YZ9 A;  4AQY E;  4LF4 E;  2VQF E;  4DV1 E;  2WW4 A;  2LRS A;  4DPT A;  1ZBT A;  2DMY A;  2HKJ A;  2ZBK B;  4FN5 A;  2HFS A;  2CPN A;  3QT6 A;  4DV5 E;  1J5E E;  5LL6 R;  4DXL A;  4JI0 E;  1RR9 A;  3B78 A;  1XMO I;  1H73 A;  3WU4 A;  2V2V A;  5LMN E;  4X62 I;  4MYU A;  4DR2 E;  1HNW I;  4HY1 A;  4JI1 I;  5GME A;  4ED4 A;  4DV6 I;  3HTX A;  1BKN A;  2HK3 A;  5IWA E;  2UXD E;  4JI6 E;  4NXN E;  1KVK A;  4MYT A;  4PU9 A;  4LF5 I;  1XNQ I;  4DV3 I;  1T4O A;  2V2Z A;  1B62 A;  1J26 A;  4YY3 I;  2UUA E;  4DPX A;  4GKJ I;  5CFF E;  1Z5A A;  1HR0 E;  4DU8 A;  1ZM3 A;  4JI5 E;  4ZVI A;  1NHI A;  2ZM6 I;  1FI4 A;  3QT8 A;  2VF3 A;  2E1R A;  2XEX A;  4HAC B;  3D4J A;  3T1H E;  4WYQ B;  2VQE I;  4DUY I;  4LF9 I;  4JI8 E;  2E5L I;  3C4T A;  1N34 I;  3ADG A;  2ZIT A;  2LJP A;  3J7Y p;  4DV0 E;  1YYW A;  1PVG A;  4OX9 E;  1S16 A;  2DEJ A;  2L33 A;  4DV1 I;  4GKK I;  4K0K I;  2V2Q A;  2NUE A;  1D6T A;  1XNR E;  4DV4 I;  4X64 E;  3VYX A;  4HAC A;  1HNX I;  2UXB I;  4KHP E;  1ZM2 A;  4NXM E;  3LTO A;  2DIX A;  2KHX A;  3ZZT A;  4B3M I;  4DR4 I;  1WHN A;  4I3H A;  4DR1 I;  1Z0T A;  2UUB E;  1FNM A;  3LLH A;  4DR2 I;  1Z0W A;  3WU6 A;  2RSM A;  5FLX C;  1HNZ I;  4JI6 I;  3Q1Q A;  2L3J A;  4DR7 I;  4Z7Y A;  2B3T B;  4B3R E;  1H72 C;  4LFA E;  5A2Q C;  2DEI A;  4JI4 I;  3QT5 A;  1N36 E;  4XTJ A;  1DAR A;  4JV5 E;  2BV3 A;  3J7A G;  3C4B A;  4DV2 E;  1H74 A;  2R3V A;  1GQE A;  4YHH E;  1FJG E;  4DR6 E;  5IT9 C;  4LFC I;  3P1X A;  3ADL A;  1Z5B A;  4LF8 I;  2YT4 A;  2VQE E;  5LMU E;  4DKK A;  4LFB E;  4JI8 I;  2Q2E B;  4DR5 E;  2J7K A;  3J80 Q;  4DV0 I;  3T1Y E;  1ZXN A;  1WHQ A;  2EFG A;  1Z0C A;  1I94 I;  1ZM9 A;  1NHH A;  4LF7 I;  1XNR I;  4DV4 E;  3PYG A;  2F4V I;  1HNX E;  1O0W A;  4NXM I;  4Z7C A;  4DR3 I;  4JI2 E;  4WFT A;  1K47 A;  1X48 A;  4DUZ I;  4RPF A;  3B8H A;  1EKZ A;  1PIE A;  2UU9 E;  4LF6 E;  4DPY A;  1UIL A;  4B3T E;  4DR7 E;  1QZR A;  2EZ6 A;  4M30 A;  3WU3 A;  3B82 A;  4B3R I;  2RS7 A;  3K17 A;  4DV5 I;  4JI4 E;  2UXC E;  1PKP A;  1N32 I;  4JV5 I;  4X66 I;  3ZZ0 A;  1N33 I;  1YYK A;  3V2U C;  3CWV A;  4DV7 I;  1X49 A;  4JI1 E;  4DV6 E;  5IWA I;  1N0U A;  2UUC E;  1KTV A;  3VYY A;  4FW9 A;  4JI3 E;  2LUP B;  3J81 Q;  2HHH I;  1EA6 A;  4B3S E;  1ELO A;  2MDR A;  4X65 I;  5IT9 Q;  5LMU I;  5BR8 I;  4LFB I;  4M1K A;  4YY3 E;  4GKJ E;  4DR5 I;  2NPF A;  2HFU A;  4JI7 I;  4PRX A;  2L2K B;  4AQY I;  4LF4 I;  3T1Y I;  2VQF I;  3J7A M;  2DB2 A;  1FWL A;  3ZM7 A;  1IBK E;  3PYE A;  4M2Z A;  2LBS B;  4LF7 E;  1UEK A;  4R1F A;  1ZXM A;  2F4V E;  5GMD A;  2NUG A;  5L3J A;  2AJ4 A;  1ZM4 A;  2N3H A;  4DR3 E;  4DU7 A;  4WUB A;  2LTR A;  4HXZ A;  1XMQ E;  2LJH A;  1XMO E;  4OX9 I;  3OTO I;  4DUZ E;  5LMN I;  4PRV A;  4X62 E;  2HKE A;  2BM1 A;  3V5R A;  4GKK E;  4K0K E;  3M6A A;  3ZKD A;  2CZ9 A;  2UU9 I;  1XHK A;  4LF6 I;  1QU6 A;  2UXD I;  2GS8 A;  4USM A;  1RQ0 A;  4B3T I;  3PYF A;  4LF5 E;  4X64 I;  1IBL I;  4P52 A;  4X8W A;  2UXB E;  1Z0B A;  1N32 E;  2UUA I;  4B3M E;  3ADJ A;  3J81 C;  4DR4 E;  1KIJ A;  4WUC A;  1T4L B;  4JYA I;  2B7T A;  3ZZU A;  3QT7 A;  1STU A;  2R42 A;  1HNZ E;  1T4N A;  1B63 A;  1Z0V A;  2UUC I;  4USK A;  4HYM A;  2BM0 A;  2L2N A;  2A2D A;  3T1H I;  2LTS A;  2HHH E;  3LPS A;  4LFA I;  4X65 E;  4DUY E;  1WUU A;  4LF9 E;  1N0V C;  1N34 E;  2NUF A;  2L2M A;  4FWG A;  3HUL A;  4JI7 E;  4YHH I;  1FJG I;  4URL A;  4DR6 I;  2LUQ A;  1IBK I;  2NA2 A;  1S4E A;  4DPU A;  2X7I A;  4UTG A;  3JAM C;  2OI2 A;  2V8P A;  1H7S A; 
#chains in the Genus database with same CATH topology
 1QNT A;  4KHP I;  5TSE A;  1IBM E;  1PJS A;  5K36 F;  4DPW A;  5LLQ A;  5KL5 A;  5DNY A;  4KQV A;  2N3G A;  4JG4 A;  1Z59 A;  2EPM X;  1Z0G A;  2LJU A;  1A1K A;  1EI1 A;  4NBQ A;  2EMF A;  1AAY A;  4DR1 E;  1H7U A;  4TUG A;  2F8B A;  1A6F A;  1XMQ I;  2UUB I;  4F9C B;  2V83 A;  2EMG A;  3OTO E;  1YHC A;  3GON A;  2CTD A;  1X47 A;  2V8Q B;  3BGH A;  2HK2 A;  3H4L A;  3HPZ A;  4O43 A;  1EH8 A;  1DQ3 A;  1U2R A;  2Z5E A;  1NZ0 A;  4FW7 A;  2PO0 A;  4J3D A;  1X6F A;  2RS6 A;  4IFD E;  4RH8 A;  1FKA E;  1DGC A;  2YRK A;  5AC5 A;  2CT1 A;  2RSI A;  3JAM Q;  2LVH A;  4FWH A;  3QG5 C;  3WU5 A;  2B7V A;  3PS2 A;  1IBL E;  2DRP A;  5C0X D;  1YSA C;  5K36 B;  1MEY C;  3P3C A;  5AE2 A;  1YUJ A;  4JI2 I;  1TF6 A;  1J5E I;  1OYR A;  5FLX Q;  1N36 I;  2RTX A;  2JY9 A;  1RC7 A;  4JI0 I;  1MG7 A;  4DV2 I;  4FWD A;  2EL4 A;  2EMB A;  2EN2 A;  2X36 A;  2YPN A;  4OOG C;  5IXM B;  2FTX B;  2KOU A;  4UT4 A;  4JYA E;  1HNW E;  2F1D A;  4R2C A;  2JEB B;  1NHJ A;  2BA0 G;  3K1J A;  1UDO A;  5DRR A;  2ELY A;  1Y6Z A;  2C38 B;  2YTN A;  5T6J A;  1RHY A;  3OML A;  4NXN I;  4LFC E;  1MGT A;  2C37 B;  2EOF A;  4QNJ A;  1PJQ A;  3THO B;  2A2C A;  1XNQ E;  2LCE A;  2EQ0 A;  4DV3 E;  3ADI A;  2DLK A;  4LF8 E;  3LNU A;  2EP3 A;  4GZN C;  1MX0 A;  2JVA A;  4BCA A;  1Z5C A;  3LML A;  1MU5 A;  2EM2 A;  1HK7 A;  1VIS A;  1X6E A;  2UXC I;  3AUZ A;  1JK2 A;  5A2Q Q;  4X66 E;  4R2S A;  3JU0 A;  2GHF A;  1N33 E;  3RMP A;  2HGH A;  4M0V A;  4LOM A;  4WUD A;  5A6J A;  2ODR D;  2Q8U A;  1KKH A;  2MKD A;  4DV7 E;  1A1L A;  1OJ4 A;  2BA0 D;  2YTD A;  4U3D A;  2EMX A;  2DMI A;  2JEB A;  1HR0 I;  4JI5 I;  2WP8 A;  4F6M A;  2MC6 A;  2L3C A;  2WBU A;  2BA1 G;  2PNZ A;  2ZM6 E;  4TUI A;  2LT7 A;  1I94 E;  1RRE A;  3Q6M A;  3PYD A;  2V34 A;  1N3G A;  3GCM A;  1YYO A;  2IHR 1;  1DI2 A;  3J80 C;  1Z1B A;  4BA1 A;  4JI3 I;  5A6K A;  2EOY A;  2M9A A;  3K85 A;  1FWK A;  1WJP A;  4EMD A;  4B3S I;  4OKG A;  1IBM I;  1UDN A;  5BR8 E;  2EOJ A;  2EM0 A;  2V87 A;  2E5L E;  4IFD C;  2JXP A;  1Z0E A;  2NN6 B;  2EM6 A;  4I8O A;  2PO0 B;  1UDQ A;  3F0N A;  2DGC A;  4FW4 A;  4BBY A;  4O5G A;  2JEA A;  1UHZ A;  1USV A;  3ZKB A;  4P7D A;  2LMZ A;  4AQY E;  4LF4 E;  1YZ9 A;  2M1S A;  2V88 A;  3CDI A;  2VQF E;  4DV1 E;  1UN6 B;  3TQM A;  2WW4 A;  2LRS A;  2EM3 A;  3VHT B;  4DPT A;  2YRM A;  1ZBT A;  2DSY A;  2YU5 A;  4MU4 A;  2DMY A;  3KZZ A;  2HKJ A;  2ZBK B;  3HPS A;  4FN5 A;  1YFH A;  2PNZ B;  2YZT A;  4R2E A;  3IWD A;  4Q35 B;  2HFS A;  1SFE A;  5F3W A;  2LV2 A;  2EPN A;  2B9D A;  2JE6 A;  2CPN A;  2YSO A;  4DV5 E;  3QT6 A;  4R2Q A;  2WP8 B;  3JTZ A;  1J5E E;  3HKM A;  2EM4 A;  2RPC A;  5LL6 R;  2PO2 A;  4DXL A;  4BMJ A;  4ZYG A;  2EOI A;  3KWR A;  4JI0 E;  2NN6 A;  1Y5Y A;  1RR9 A;  3B78 A;  2YTG A;  5A6A A;  4BA1 B;  3EPJ A;  1XMO I;  3IWC A;  4ZYH A;  1H73 A;  2V2V A;  3WU4 A;  5LMN E;  2EOS A;  2EPU A;  4X62 I;  2I9I A;  4ZYD A;  4DR2 E;  4MYU A;  1HNW I;  3K6Q A;  4HY1 A;  2EOZ A;  4IZJ D;  4JI1 I;  1KJK A;  5GME A;  4ED4 A;  2O1T A;  3HTX A;  1BKN A;  3EPK A;  2HK3 A;  4DV6 I;  5IWA E;  4QNK A;  4BHC A;  2UXD E;  5JEA C;  4JI6 E;  4NXN E;  3ECR A;  2EM9 A;  1KVK A;  4MYT A;  4PU9 A;  4LF5 I;  1XNQ I;  4L8N A;  4DV3 I;  2JE6 B;  2EOM A;  4P7A A;  1T4O A;  1E3P A;  2V2Z A;  1B62 A;  1RMD A;  4LTY A;  1J26 A;  2PO2 B;  4YY3 I;  2UUA E;  4DPX A;  4GKJ I;  2K7I A;  1A1G A;  5AE1 A;  2YTF A;  3EQ1 A;  1WXR A;  3MHH C;  5CFF E;  4WSP A;  2YTQ A;  1F2I G;  1Z5A A;  1HR0 E;  4DU8 A;  1ZM3 A;  4JI5 E;  1R6M A;  4ZVI A;  1BB8 A;  1NHI A;  2ZM6 I;  2NAB A;  2RQL A;  3GME A;  1FI4 A;  3Q6N A;  3QT8 A;  3M85 D;  2VF3 A;  2E1R A;  2XEX A;  4HAC B;  4R2R A;  3D4J A;  3T1H E;  4WYQ B;  2VQE I;  5C0X C;  4DUY I;  4R2A A;  2EPA A;  4R2D A;  2EOE A;  2BA1 D;  4JI8 E;  2E5L I;  4LF9 I;  3C4T A;  1N34 I;  2EOR A;  3ADG A;  4F6N A;  4IJD A;  2Z5B A;  2ZIT A;  4MU1 A;  1X5W A;  2EQ1 A;  2LJP A;  3J7Y p;  4DV0 E;  1YYW A;  2A25 A;  4OX9 E;  2KON A;  1PVG A;  1S16 A;  2DEJ A;  4LPF A;  2PNL A;  2K4V A;  4U3B A;  5DRQ A;  2L33 A;  3THN A;  2IES A;  2PRT A;  4DV1 I;  4GKK I;  2V2Q A;  4K0K I;  1OYP A;  1VI7 A;  2BBG A;  4IZJ B;  2NUE A;  5C0X E;  2EQ3 A;  1D6T A;  3U1Y A;  2N8X A;  1OYS A;  1NEI A;  2EMK A;  1XNR E;  4DV4 I;  1E3H A;  4WSG A;  4X64 E;  2EMZ A;  3VYX A;  4HAC A;  2DLQ A;  5KL2 A;  1HNX I;  2UXB I;  3P06 A;  2JPA A;  4KHP E;  1ZM2 A;  4NXM E;  3LTO A;  2DIX A;  4IS9 A;  2CVE A;  2KHX A;  2EM8 A;  3GLL A;  5A6B A;  3ZZT A;  4B3M I;  4DR4 I;  1WHN A;  4I3H A;  4DR1 I;  2VES A;  3H09 A;  1XXE A;  1Z0T A;  2UUB E;  2EN1 A;  2EMY A;  1FNM A;  3LLH A;  2FV4 B;  2GLI A;  1Z0W A;  4DR2 I;  3EPL A;  3WU6 A;  4OO1 B;  2RSM A;  3KZY A;  4Q28 A;  5FLX C;  2Z5B B;  1HNZ I;  2EPX A;  5DRO A;  2EPL X;  4HTG A;  1USU A;  3L00 A;  2L92 A;  4JI6 I;  3Q1Q A;  2L3J A;  4F54 A;  3CDJ A;  1Y4S A;  4DR7 I;  4Z7Y A;  2B3T B;  5JEA D;  2ADR A;  1NCS A;  4B3R E;  5DRP A;  1EH7 A;  3UK3 C;  2R1F A;  1H72 C;  5A2Q C;  4LFA E;  2DEI A;  4JI4 I;  2JR1 A;  3QT5 A;  1N36 E;  5K36 C;  4LCG A;  4XTJ A;  1DAR A;  4JV5 E;  3J7A G;  2BV3 A;  3C4B A;  5A69 A;  4DV2 E;  2HC5 A;  2H36 X;  3MHS C;  1B69 A;  1H74 A;  2R3V A;  2JEA B;  3ZOQ B;  1GQE A;  2LE2 A;  3P3G A;  2EE8 A;  2EM5 A;  4YHH E;  4OZE A;  4OO1 C;  1YPN A;  1FJG E;  2GPI A;  4DR6 E;  5IT9 C;  2EML A;  1IQS A;  4WXC A;  3IWB A;  2M4I A;  4F2J C;  2EPP A;  5IV8 B;  4BHB A;  1UDS A;  4LFC I;  4AIM A;  4R2P A;  3P1X A;  1T38 A;  2NN6 D;  4IFD A;  5DNL A;  5EL9 A;  3ADL A;  2YU8 A;  2EWL A;  1Z5B A;  4LF8 I;  2YT4 A;  3MSW A;  2VQE E;  2NN6 C;  5KL6 A;  2FGG A;  5LMU E;  3U1K A;  4O4K A;  4DKK A;  1A1J A;  4LFB E;  4JI8 I;  3BID A;  4BC7 A;  2ENA A;  4AID A;  2Q2E B;  1BBG A;  4DR5 E;  4O24 A;  2CG9 A;  2J7K A;  3L7Z B;  2YTJ A;  3BBG A;  4FW5 A;  4NZV A;  4J8Z A;  3J80 Q;  2V85 A;  4DV0 I;  3P3E A;  3T1Y E;  1ZXN A;  2YTI A;  3F6G A;  1WHQ A;  3DJW A;  2MC5 A;  1GZ6 A;  4IS1 C;  2NN6 E;  2EFG A;  3F6H A;  4HEI A;  1Z0C A;  1R6L A;  1I94 I;  1ZM9 A;  1NHH A;  4GEQ B;  4LF7 I;  1XNR I;  4DV4 E;  2YWQ A;  2EN7 A;  3PYG A;  2F4V I;  2IOP A;  1HNX E;  5JEA B;  1O0W A;  2EPK X;  2BR2 A;  4M9V C;  4NXM I;  4Z7C A;  2VE7 C;  4DR3 I;  4JI2 E;  1LLM C;  4OO1 A;  1IQO A;  2O1V A;  2J7J A;  4WFT A;  3HXL A;  1K47 A;  4IFD B;  2E1M A;  2EM7 A;  4L5N C;  1X48 A;  5AC4 A;  4DUZ I;  2EN4 A;  4RPF A;  3M99 B;  3B8H A;  2IOQ A;  1EKZ A;  1PIE A;  5K36 E;  4LU9 A;  4ISA A;  4MQY A;  2UU9 E;  4LF6 E;  2V86 A;  4FK5 C;  2PNM A;  2EMH A;  4DPY A;  1UIL A;  4B3T E;  4DR7 E;  1QZR A;  2YRH A;  2EZ6 A;  4M30 A;  2GQ0 A;  4ZYE A;  3B82 A;  3DF6 A;  2EN3 A;  1PJT A;  2RS7 A;  3K17 A;  3WU3 A;  4DV5 I;  1G2F C;  4B3R I;  3AV0 A;  2JOB A;  4FW6 A;  4JI4 E;  2J65 A;  2UXC E;  1PKP A;  1KYQ A;  1ZR9 A;  4JV5 I;  1N32 I;  4X66 I;  1BBO A;  2JP9 A;  3ZZ0 A;  1N33 I;  2BB8 A;  1YYK A;  1JK1 A;  3V2U C;  1Y4U A;  1UBD C;  2JYA A;  3CWV A;  4LCH A;  4DV7 I;  1PDA A;  1IMU A;  4F9A B;  1X49 A;  4AM3 A;  1ZU1 A;  4BC9 A;  4JI1 E;  5ELW A;  3NZK A;  4DV6 E;  4IZJ A;  5IWA I;  2V89 A;  4OO1 D;  1N0U A;  2UUC E;  1KTV A;  2EL5 A;  1A1I A;  3VYY A;  4FW9 A;  3L7Z A;  5KL7 A;  4JI3 E;  2LUP B;  1L4S A;  2ODR C;  3J81 Q;  2HHH I;  2ENC A;  1EA6 A;  4N3O A;  4B3S E;  1ELO A;  2L8T A;  2MDR A;  4X65 I;  5LMU I;  5IT9 Q;  5BR8 I;  4BA2 B;  4LFB I;  1X6H A;  4WPY A;  4M1K A;  2EOX A;  2EOH A;  4YY3 E;  4GKJ E;  4RHB B;  4DR5 I;  2NPF A;  2HFU A;  1WRJ A;  2EMC A;  4KWY A;  1AH5 A;  4P78 A;  5C0X A;  2WBT A;  4JI7 I;  4PRX A;  2L2K B;  4AQY I;  4LF4 I;  3T1Y I;  2MKN A;  4IZK A;  2VQF I;  3J7A M;  2DB2 A;  1FWL A;  2EN6 A;  3ZM7 A;  2LO3 A;  1IBK E;  2C38 A;  3PYE A;  2C39 A;  4OO1 F;  5A6B D;  3H1C A;  2EMI A;  4M2Z A;  2LBS B;  4LF7 E;  3PS1 A;  1UEK A;  4R1F A;  5K36 D;  2L6M A;  2YTO A;  1ZXM A;  2EMW A;  2F4V E;  5ADZ A;  5GMD A;  2VRD A;  2JOX A;  2YTE A;  1Y60 A;  1YH8 A;  2GO4 A;  1SR9 A;  2NUG A;  5L3J A;  2AJ4 A;  1ZM4 A;  3C6M A;  4MLV A;  2PO1 B;  2N3H A;  4DR3 E;  1TF3 A;  4DU7 A;  1X3C A;  3KRN A;  2Z5C A;  4BA2 A;  1TN9 A;  5AAS A;  2EPR A;  4WUB A;  2LTR A;  4F9B B;  2EOQ A;  4HXZ A;  1XMQ E;  2R76 A;  2LJH A;  1XMO E;  3BF2 A;  4BS9 A;  2IER A;  3OTO I;  4DUZ E;  5LMN I;  4OX9 I;  2CSH A;  1P42 A;  5KL4 A;  4PRV A;  5KL3 A;  4X62 E;  2HKE A;  4R8O A;  2BM1 A;  3V5R A;  4IZK B;  4GKK E;  1T39 A;  4K0K E;  3M6A A;  4MDT A;  4MU0 A;  3ZKD A;  2CZ9 A;  2EOO A;  2UU9 I;  1XHK A;  2JWO A;  4LF6 I;  1QU6 A;  2C39 B;  2UXD I;  2GS8 A;  4USM A;  1RQ0 A;  2M7Q A;  4B3T I;  2O1W A;  2WNR B;  2O1U A;  3PYF A;  3EPH A;  4R03 A;  1ZAA C;  4LF5 E;  4X64 I;  1IBL I;  2VF1 A;  4X8W A;  2UXB E;  4P52 A;  5C0X F;  4OO1 E;  2WBS A;  3FIG A;  3B4T A;  2EN8 A;  3M85 G;  1Z0B A;  3C6K A;  3UHM A;  2Z5C B;  1GTK A;  1N32 E;  2UUA I;  4B3M E;  3HJC A;  3ADJ A;  2EL6 A;  3J81 C;  4DR4 E;  2D9H A;  1KIJ A;  3VK6 A;  4WUC A;  1T4L B;  2EPZ A;  1A1F A;  5K36 A;  2E72 A;  4LCF A;  4JYA I;  3P76 A;  2B7T A;  1A1H A;  5EKW A;  2ELZ A;  3ZZU A;  4MU3 A;  3PRY A;  3QT7 A;  2NN6 F;  1STU A;  2ENH A;  1HNZ E;  4MLQ A;  2R42 A;  1T4N A;  1B63 A;  2WCC 3;  1Z0V A;  2I13 A;  5FWK A;  2UUC I;  4WXD A;  4KZS A;  3DD6 A;  2JT2 A;  4USK A;  2MDG A;  2CGE A;  4HYM A;  2BM0 A;  2AE8 A;  2L2N A;  5C0X B;  3HQ1 A;  2A2D A;  2YSP A;  2LTS A;  3T1H I;  5JEA A;  2HHH E;  2G7H A;  2BR2 B;  3LPS A;  4LFA I;  4X65 E;  4X9J A;  4DUY E;  1WUU A;  4LF9 E;  1N0V C;  2GO3 A;  5JEA F;  5JEA E;  1N34 E;  2NUF A;  4GQU A;  2L2M A;  2C37 A;  2WNR A;  2YTP A;  2EJ4 A;  4FWG A;  3HUL A;  4JI7 E;  2EPO A;  2WZO A;  1EH6 A;  4YHH I;  2O3Z A;  1FJG I;  4N4R B;  4URL A;  4DR6 I;  5AE3 A;  4DMI A;  2PO1 A;  2LUQ A;  1YUI A;  1ZBQ A;  2NA2 A;  3PS3 A;  4FW3 A;  2EMA A;  1S4E A;  5DNX A;  1IBK I;  4DPU A;  3M7N G;  1G2D C;  2X7I A;  3JAM C;  4UTG A;  4WX9 A;  2EPC A;  2OI2 A;  2V8P A;  3M7N D;  1H7S A;  2HJJ A;  1P47 A;  4IFD D;  4NHR A;  4IFD F; 
#chains in the Genus database with same CATH homology
 4KHP I;  1IBM E;  4DPW A;  5DNY A;  4KQV A;  2N3G A;  4JG4 A;  1Z59 A;  1Z0G A;  1EI1 A;  4DR1 E;  1H7U A;  4TUG A;  2F8B A;  1A6F A;  1XMQ I;  2UUB I;  4F9C B;  2V83 A;  3OTO E;  3GON A;  4P7A A;  3H4L A;  1X47 A;  2V8Q B;  2HK2 A;  3HPZ A;  1DQ3 A;  1U2R A;  2Z5E A;  1NZ0 A;  2RS6 A;  1FKA E;  3JAM Q;  4FWH A;  3WU5 A;  2B7V A;  1IBL E;  5AE2 A;  4JI2 I;  1J5E I;  5FLX Q;  1N36 I;  2RTX A;  2JY9 A;  1RC7 A;  4JI0 I;  1MG7 A;  4DV2 I;  4FWD A;  2X36 A;  4OOG C;  2FTX B;  2KOU A;  4UT4 A;  4JYA E;  1HNW E;  1NHJ A;  3K1J A;  1Y6Z A;  5T6J A;  3OML A;  4NXN I;  4LFC E;  2A2C A;  1XNQ E;  4DV3 E;  3ADI A;  4LF8 E;  3LNU A;  1MX0 A;  2JVA A;  4BCA A;  1Z5C A;  3LML A;  1MU5 A;  1HK7 A;  1VIS A;  2UXC I;  3AUZ A;  5A2Q Q;  4X66 E;  3JU0 A;  1N33 E;  3RMP A;  4M0V A;  4WUD A;  2ODR D;  1KKH A;  4DV7 E;  1OJ4 A;  1HR0 I;  4JI5 I;  2MC6 A;  2L3C A;  2ZM6 E;  4TUI A;  1I94 E;  1RRE A;  3Q6M A;  3PYD A;  2V34 A;  1YYO A;  2IHR 1;  1DI2 A;  3J80 C;  4JI3 I;  3K85 A;  1FWK A;  4EMD A;  4B3S I;  1IBM I;  5BR8 E;  2V87 A;  2E5L E;  1Z0E A;  4I8O A;  3F0N A;  4BBY A;  1UHZ A;  1USV A;  3ZKB A;  4P7D A;  2LMZ A;  4AQY E;  4LF4 E;  1YZ9 A;  2M1S A;  2V88 A;  2VQF E;  4DV1 E;  2WW4 A;  2LRS A;  4DPT A;  1ZBT A;  2DSY A;  2DMY A;  2HKJ A;  2ZBK B;  4FN5 A;  3HPS A;  2YZT A;  3IWD A;  2HFS A;  5F3W A;  2B9D A;  2CPN A;  3QT6 A;  4DV5 E;  3JTZ A;  1J5E E;  5LL6 R;  4DXL A;  4BMJ A;  4JI0 E;  3KWR A;  1RR9 A;  3B78 A;  1XMO I;  1H73 A;  3IWC A;  3WU4 A;  2V2V A;  5LMN E;  4X62 I;  4MYU A;  4DR2 E;  1HNW I;  3K6Q A;  4HY1 A;  4IZJ D;  4JI1 I;  5GME A;  4ED4 A;  2O1T A;  3HTX A;  1BKN A;  4DV6 I;  2HK3 A;  5IWA E;  2UXD E;  4JI6 E;  4NXN E;  1KVK A;  4MYT A;  4PU9 A;  4LF5 I;  1XNQ I;  4L8N A;  4DV3 I;  1T4O A;  2V2Z A;  1B62 A;  4LTY A;  1J26 A;  4YY3 I;  2UUA E;  4DPX A;  4GKJ I;  5AE1 A;  1WXR A;  5CFF E;  4WSP A;  1Z5A A;  1HR0 E;  4DU8 A;  1ZM3 A;  4JI5 E;  4ZVI A;  1NHI A;  2ZM6 I;  1FI4 A;  3Q6N A;  3QT8 A;  2VF3 A;  2E1R A;  2XEX A;  4HAC B;  3D4J A;  3T1H E;  4WYQ B;  2VQE I;  4DUY I;  4LF9 I;  4JI8 E;  2E5L I;  3C4T A;  1N34 I;  3ADG A;  2Z5B A;  2ZIT A;  2LJP A;  3J7Y p;  4DV0 E;  1YYW A;  1PVG A;  4OX9 E;  2KON A;  1S16 A;  2DEJ A;  2PNL A;  2K4V A;  2L33 A;  4DV1 I;  4GKK I;  4K0K I;  2V2Q A;  4IZJ B;  2NUE A;  1D6T A;  1XNR E;  4DV4 I;  4X64 E;  3VYX A;  4HAC A;  1HNX I;  2UXB I;  3P06 A;  4KHP E;  1ZM2 A;  4NXM E;  3LTO A;  2DIX A;  2KHX A;  3ZZT A;  4B3M I;  4DR4 I;  1WHN A;  4I3H A;  4DR1 I;  3H09 A;  1Z0T A;  2UUB E;  1FNM A;  3LLH A;  2FV4 B;  4DR2 I;  1Z0W A;  3WU6 A;  2RSM A;  5FLX C;  4Q28 A;  2Z5B B;  1HNZ I;  1USU A;  2L92 A;  4JI6 I;  3Q1Q A;  2L3J A;  4F54 A;  1Y4S A;  4DR7 I;  4Z7Y A;  2B3T B;  4B3R E;  1H72 C;  5A2Q C;  4LFA E;  2DEI A;  4JI4 I;  2JR1 A;  3QT5 A;  1N36 E;  4XTJ A;  1DAR A;  4JV5 E;  3J7A G;  2BV3 A;  3C4B A;  4DV2 E;  2H36 X;  1H74 A;  2R3V A;  3ZOQ B;  1GQE A;  2LE2 A;  4YHH E;  1FJG E;  4DR6 E;  5IT9 C;  3IWB A;  2M4I A;  4LFC I;  3P1X A;  3ADL A;  2EWL A;  1Z5B A;  4LF8 I;  2YT4 A;  3MSW A;  2VQE E;  2FGG A;  5LMU E;  4DKK A;  4LFB E;  4JI8 I;  4BC7 A;  2Q2E B;  4DR5 E;  2CG9 A;  2J7K A;  4J8Z A;  3J80 Q;  2V85 A;  4DV0 I;  3T1Y E;  1ZXN A;  3F6G A;  1WHQ A;  3DJW A;  2MC5 A;  1GZ6 A;  2EFG A;  3F6H A;  1Z0C A;  1I94 I;  1ZM9 A;  1NHH A;  4GEQ B;  4LF7 I;  1XNR I;  4DV4 E;  3PYG A;  2F4V I;  2IOP A;  1HNX E;  1O0W A;  4NXM I;  4Z7C A;  2VE7 C;  4DR3 I;  4JI2 E;  2O1V A;  4WFT A;  3HXL A;  1K47 A;  2E1M A;  4L5N C;  1X48 A;  4DUZ I;  4RPF A;  3B8H A;  2IOQ A;  1EKZ A;  1PIE A;  4LU9 A;  2UU9 E;  4LF6 E;  2V86 A;  2PNM A;  4DPY A;  1UIL A;  4B3T E;  4DR7 E;  1QZR A;  2GQ0 A;  2EZ6 A;  4M30 A;  3WU3 A;  3B82 A;  3DF6 A;  2RS7 A;  3K17 A;  4B3R I;  4DV5 I;  3AV0 A;  2JOB A;  4JI4 E;  2UXC E;  1PKP A;  1N32 I;  4JV5 I;  4X66 I;  3ZZ0 A;  1N33 I;  1YYK A;  3V2U C;  1Y4U A;  3CWV A;  4DV7 I;  4F9A B;  1X49 A;  4BC9 A;  4JI1 E;  4DV6 E;  4IZJ A;  5IWA I;  2V89 A;  1N0U A;  2UUC E;  1KTV A;  3VYY A;  4FW9 A;  4JI3 E;  2LUP B;  2ODR C;  3J81 Q;  2HHH I;  1EA6 A;  4N3O A;  4B3S E;  1ELO A;  2L8T A;  2MDR A;  4X65 I;  5LMU I;  5IT9 Q;  5BR8 I;  4LFB I;  4WPY A;  4M1K A;  4YY3 E;  4GKJ E;  4DR5 I;  2NPF A;  2HFU A;  4P78 A;  4JI7 I;  4PRX A;  2L2K B;  4AQY I;  4LF4 I;  3T1Y I;  4IZK A;  2VQF I;  3J7A M;  2DB2 A;  1FWL A;  3ZM7 A;  1IBK E;  3PYE A;  4M2Z A;  2LBS B;  4LF7 E;  1UEK A;  4R1F A;  2L6M A;  1ZXM A;  2F4V E;  5ADZ A;  5GMD A;  2JOX A;  1SR9 A;  2NUG A;  5L3J A;  2AJ4 A;  1ZM4 A;  2N3H A;  4DR3 E;  4DU7 A;  2Z5C A;  5AAS A;  4WUB A;  2LTR A;  4F9B B;  4HXZ A;  1XMQ E;  2LJH A;  1XMO E;  4OX9 I;  4BS9 A;  3OTO I;  4DUZ E;  5LMN I;  4PRV A;  4X62 E;  2HKE A;  4R8O A;  2BM1 A;  3V5R A;  4IZK B;  4GKK E;  4K0K E;  3M6A A;  3ZKD A;  2CZ9 A;  2UU9 I;  1XHK A;  2JWO A;  4LF6 I;  1QU6 A;  2UXD I;  2GS8 A;  4USM A;  1RQ0 A;  2M7Q A;  4B3T I;  2O1W A;  3PYF A;  2O1U A;  4R03 A;  4LF5 E;  4X64 I;  1IBL I;  2VF1 A;  4X8W A;  2UXB E;  4P52 A;  3FIG A;  1Z0B A;  2Z5C B;  1N32 E;  2UUA I;  4B3M E;  3HJC A;  3ADJ A;  3J81 C;  4DR4 E;  1KIJ A;  3VK6 A;  4WUC A;  1T4L B;  4JYA I;  2B7T A;  3ZZU A;  3PRY A;  3QT7 A;  1STU A;  2R42 A;  1HNZ E;  5FWK A;  1T4N A;  1B63 A;  1Z0V A;  2UUC I;  4KZS A;  4USK A;  4HYM A;  2CGE A;  2BM0 A;  2L2N A;  3HQ1 A;  2A2D A;  3T1H I;  2LTS A;  2HHH E;  2G7H A;  3LPS A;  4LFA I;  4X65 E;  4DUY E;  1WUU A;  4LF9 E;  1N0V C;  1N34 E;  2NUF A;  2L2M A;  4FWG A;  3HUL A;  4JI7 E;  2WZO A;  4YHH I;  1FJG I;  4URL A;  4DR6 I;  5AE3 A;  4DMI A;  2LUQ A;  1IBK I;  1ZBQ A;  2NA2 A;  1S4E A;  4DPU A;  2X7I A;  3JAM C;  4UTG A;  2OI2 A;  2V8P A;  1H7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...