1IBKI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibkI00
4JI0E 1H72C 2UUAE 3F0NA 4JI6E 3H4LA 1I94E 1FJGI 5LMNE 1ZM2A 3J81C 4GKKE 1HNZI 1XMOE 1S16A 3M6AA 1H74A 4PU9A 4DR7E 1PVGA 1EA6A 4JV5E 4B3SE 3J80Q 1Z0GA 1XMQE 3V5RA 4DR1I 2V2ZA 4DXLA 4XTJA 2HKJA 3JAMQ 3ZM7A 3B8HA 4DV6E 4JI5I 4I3HA 2E5LI 1OJ4A 4B3TI 4DV2I 3OTOE 3PYEA 2X36A 3J7AM 1Z0VA 4K0KI 4JYAI 2UU9E 4LF7I 4DV3E 1WUUA 4AQYE 1U2RA 2UUCI 4DR2E 1FNMA 1N32I 4JI1E 2HK2A 3T1YI 3QT6A 1NHHA 4ZVIA 1ZM9A 4X66I 2V2VA 2VQFI 4ED4A 5FLXQ 4DUYE 4X62I 5GMEA 3WU4A 1FWKA 4X65E 4DUZI 4JI7I 1RR9A 2ZM6I 3ZZUA 2NPFA 1HR0E 4KQVA 4LFAE 4Z7CA 4DV5E 4DPUA 1PIEA 4DR4I 1BKNA 1PKPA 1D6TA 1IBMI 4JI8I 4WUDA 4LF5E 4YHHI 1EI1A 4DPTA 3V2UC 2XEXA 2R42A 3B78A 2UUBI 4OX9I 1MU5A 4Z7YA 4P52A 2HHHE 3T1HE 5L3JA 1ELOA 1FKAE 4JG4A 3QT8A 4NXME 5IWAI 1N33E 2UXDE 4HYMA 1XNRI 4DU8A 1N34E 1KKHA 2E1RA 3WU3A 1H7UA 1MG7A 4KHPI 1HNWE 1Z5AA 4JI0I 1K47A 3J81Q 2UUAI 4LFBE 1NHIA 4UT4A 4JI6I 4LF6E 2F4VE 1Z5CA 5LMNI 1S4EA 2BM0A 4PRVA 2VF3A 4GKKI 1KVKA 4YY3I 4JI3E 3QT7A 3K17A 3LNUA 2V34A 1XMOI 3PYFA 4DR3E 4DR7I 1VISA 4JV5I 1IBKE 1N0VC 4B3SI 5IT9C 4LF8E 2WW4A 1XMQI 4JI5E 1HNXE 2UXCE 4HY1A 4LF9E 1ZXNA 2BV3A 2A2DA 2HKEA 4HXZA 1KIJA 4DV2E 1FI4A 3GONA 4DR6E 2VQEE 4DV6I 4DV4I 4GKJE 1XNQE 3B82A 2EFGA 3ZZTA 2J7KA 5LMUE 2R3VA 2UUCE 2UXBE 1N32E 4WUBA 3OTOI 2VQFE 4DV7E 2UU9I 4LF4E 4B3ME 2V8PA 5BR8E 4AQYI 4DR2I 1Z0EA 5LL6R 4JI1I 2Q2EB 1IBLE 4JI2E 4X64E 1Z0WA 3LPSA 2HFSA 1NZ0A 4LFCE 1Z59A 4DR4E 4DUYI 1N36E 4JI4I 3QT5A 1IBME 4DPXA 1ZXMA 4LFAI 3ZKBA 4B3RE 2A2CA 2HK3A 1J5EE 4NXNE 4DV0E 4DR5E 2UUBE 1B62A 4DV1E 4LF5I 1KTVA 2GS8A 4R1FA 4P7AA 1ZM3A 3Q1QA 4RPFA 1FJGE 1A6FA 3T1HI 3CWVA 4HACA 4KHPE 1HNZE 4FWHA 1H7SA 1Z5BA 4NXMI 4USKA 1ZM4A 1N33I 2UXDI 1I94I 1N34I 3J7AG 2DEJA 4DR1E 1HNWI 1B63A 4YY3E 4LFBI 4DPWA 1Z0BA 3J80C 4LF6I 2F4VI 2DEIA 4JI3I 3K1JA 3JAMC 2E5LE 4FWGA 5IT9Q 4DU7A 4DR3I 4B3TE 3PYDA 1IBKI 4USMA 2HFUA 4K0KE 1NHJA 2OI2A 4LF8I 4JYAE 4DV4E 4LF7E 1Z0CA 4FWDA 1HNXI 2UXCI 2AJ4A 4LF9I 1H73A 1UEKA 3T1YE 4M1KA 4X66E 4DR6I 1N0UA 2VQEI 4DV3I 4X62E 4GKJI 1XNQI 4DUZE 4JI7E 5LMUI 2ZM6E 4MYUA 2UXBI 5GMDA 1RREA 5FLXC 3ZKDA 1FWLA 4DV7I 4LF4I 1DARA 1QZRA 4URLA 2ZITA 4X65I 4B3MI 5A2QC 5BR8I 3PYGA 4UTGA 2CZ9A 4JI4E 1HR0I 3HULA 4JI8E 4WUCA 3WU5A 4DV5I 5A2QQ 4MYTA 4YHHE 1IBLI 4JI2I 2V2QA 3LTOA 4X64I 4LFCI 1MX0A 2BM1A 1N36I 4OX9E 4FN5A 2LJPA 4HACB 3ZZ0A 3WU6A 4B3RI 4EMDA 1J5EI 4NXNI 4DV0I 2X7IA 4DR5I 1XHKA 5IWAE 4DPYA 3D4JA 1Z0TA 2HHHI 1XNRE 2ZBKB 4FW9A 4DV1I 4PRXA
chains in the Genus database with same CATH superfamily
4JI0E 1H72C 2UUAE 2PO0B 3F0NA 4JI6E 3H1CA 3H4LA 4OZEA 1I94E 1FJGI 5LMNE 1ZM2A 3J81C 3HJCA 4GKKE 4AIDA 1HNZI 4IFDC 2JEAB 2JEBA 1XMOE 1S16A 3M6AA 1H74A 4FW5A 4PU9A 5DNLA 4DR7E 1PVGA 1EA6A 4JV5E 4B3SE 3J80Q 1Z0GA 1XMQE 3V5RA 4DR1I 2V2ZA 4OO1A 4DXLA 4XTJA 2HKJA 3JAMQ 3ZM7A 5C0XD 1UDSA 3B8HA 2IOPA 4DV6E 4JI5I 1RHYA 4I3HA 2Z5EA 2C37A 5ELWA 2E5LI 2CG9A 1OJ4A 3UHMA 2AE8A 2PO1B 4B3TI 5K36F 4DV2I 3OTOE 1OYRA 3PYEA 2X36A 4LCGA 3J7AM 1Z0VA 4K0KI 4JYAI 2UU9E 4LF7I 3GCMA 4DV3E 1WUUA 4AQYE 1U2RA 2UUCI 4DR2E 1FNMA 1N32I 4JI1E 5K36E 2HK2A 3T1YI 3QT6A 1Y4SA 1NHHA 2BR2A 4ZVIA 1ZM9A 4X66I 2V2VA 2VQFI 4ED4A 3L7ZB 5FLXQ 3P3EA 4DUYE 4X62I 3PS1A 5GMEA 3WU4A 1FWKA 4X65E 4DUZI 5C0XF 1RR9A 4JI7I 2ZM6I 3ZZUA 2NPFA 1HR0E 1XXEA 4KQVA 4LFAE 4Z7CA 4DV5E 3PS3A 4IZKB 4OO1C 4DPUA 1PIEA 4DR4I 4LOMA 1BKNA 3L7ZA 1PKPA 1D6TA 5C0XE 1IBMI 3CDIA 4JI8I 2NN6D 4WUDA 4LF5E 4YHHI 2BA0D 1EI1A 4DPTA 3V2UC 2XEXA 2R42A 3B78A 2UUBI 4OX9I 4MU3A 1MU5A 4Z7YA 2BA0G 4P52A 2HHHE 5K36A 3T1HE 3GMEA 2JEBB 4LCHA 5L3JA 1ELOA 1FKAE 5C0XB 1Y4UA 2BA1D 4JG4A 3M85G 3QT8A 4NXME 5IWAI 1N33E 2UXDE 4HYMA 1XNRI 3GLLA 5K36D 4DU8A 1N34E 1KKHA 2E1RA 3WU3A 1H7UA 1MG7A 4KHPI 4OO1B 1HNWE 1Z5AA 4JI0I 1K47A 3J81Q 2UUAI 3U1KA 4LFBE 1NHIA 4UT4A 4JI6I 5C0XA 4LF6E 2F4VE 2NN6F 1Z5CA 5JEAF 2IESA 5LMNI 5DRRA 1S4EA 2BM0A 2C37B 4PRVA 2VF3A 3U1YA 4GKKI 1KVKA 2PNLA 4YY3I 4JI3E 3QT7A 3K17A 3LNUA 1E3HA 2V34A 1XMOI 4FW7A 4FW3A 3PYFA 4DR3E 5DROA 2NN6E 5JEAE 4QNJA 4DR7I 1VISA 4JV5I 1IBKE 1N0VC 4B3SI 5IT9C 4LF8E 1UDNA 2WW4A 4NBQA 1XMQI 4JI5E 5K36C 2O1WA 1HNXE 2UXCE 2BR2B 1YH8A 4HY1A 4LF9E 1ZXNA 2BV3A 2A2DA 2HKEA 4HXZA 1KIJA 4DV2E 1FI4A 3GONA 4DR6E 1R6LA 2VQEE 4DV6I 4DV4I 5EL9A 4GKJE 2PNZA 1XNQE 3B82A 2EFGA 3ZZTA 2J7KA 2NN6B 1E3PA 5LMUE 2R3VA 2UUCE 2Z5BA 4BA2B 2UXBE 4FW4A 3P76A 1N32E 4WUBA 3OTOI 5C0XC 2VQFE 4DV7E 1VI7A 2UU9I 4LF4E 2J65A 4B3ME 2V8PA 1USVA 5BR8E 4AQYI 4DR2I 2NN6A 1Z0EA 5LL6R 5JEAA 4JI1I 2Q2EB 4MU0A 4BA2A 1IBLE 4JI2E 4X64E 1Z0WA 3P3GA 3LPSA 2HFSA 1NZ0A 1Y60A 4LFCE 1Z59A 5DRPA 4DR4E 4MQYA 4DUYI 1N36E 2O1TA 4IS9A 5K36B 4JI4I 3QT5A 4IZJA 1USUA 1OYSA 1IBME 4DPXA 5JEAD 2Z5CA 1ZXMA 4LFAI 3ZKBA 4B3RE 4ISAA 4AM3A 2A2CA 2HK3A 1J5EE 4NXNE 4DV0E 4DR5E 2UUBE 1B62A 4BA1A 5FWKA 4IZJD 2JT2A 4IFDD 2CVEA 1Y6ZA 4DV1E 4U3BA 4LF5I 3PS2A 2O3ZA 4MU1A 1KTVA 2GS8A 4OKGA 4R1FA 4P7AA 1ZM3A 3Q1QA 4RPFA 1FJGE 1A6FA 2BA1G 4LPFA 3T1HI 3CWVA 3Q6NA 4HACA 4LCFA 2WP8A 4KHPE 2C39A 1HNZE 5DNXA 2NN6C 4FWHA 2PNMA 5JEAC 1H7SA 3CDJA 1Z5BA 4NXMI 4USKA 1ZM4A 1N33I 2UXDI 2GO4A 1I94I 3M7ND 1N34I 3J7AG 2C38B 2DEJA 4U3DA 4J3DA 4DR1E 1HNWI 1B63A 4YY3E 3M7NG 4LFBI 1YHCA 4DPWA 1Z0BA 2PO0A 4IFDF 3J80C 4LF6I 1HK7A 2F4VI 1OYPA 2CGEA 2PNZB 2DEIA 2IERA 2C38A 4JI3I 3K1JA 3JAMC 2E5LE 4FWGA 1UDQA 2Z5BB 5IT9Q 2JEAA 4DU7A 4DR3I 4IFDE 4B3TE 3PYDA 1IBKI 4USMA 2HFUA 4K0KE 1NHJA 2OI2A 4LF8I 3DD6A 4JYAE 4DV4E 4LF7E 1Z0CA 3Q6MA 4FWDA 5JEAB 3P3CA 1HNXI 2GO3A 2UXCI 4OO1D 2AJ4A 4LF9I 1H73A 1R6MA 1UEKA 3T1YE 3K85A 4M1KA 4X66E 4DR6I 1N0UA 2VQEI 2F1DA 4DV3I 4X62E 4GKJI 1XNQI 4IZJB 4IFDB 4DUZE 4JI7E 5LMUI 2Z5CB 2ZM6E 4MYUA 2UXBI 5GMDA 2WNRB 1RREA 2JE6B 5FLXC 2PO1A 3ZKDA 4BA1B 2PO2B 1FWLA 4DV7I 1P42A 4LF4I 1DARA 1QZRA 4URLA 2ZITA 3PRYA 4X65I 5A2QC 4B3MI 5BR8I 3PYGA 4UTGA 2CZ9A 4JI4E 4IFDA 1Y5YA 3P06A 1HR0I 3HULA 4JI8E 4WUCA 3WU5A 4DV5I 2WNRA 5A2QQ 4MYTA 4YHHE 1IBLI 4JI2I 2V2QA 3LTOA 4X64I 1UDOA 2JE6A 4N3OA 4MU4A 1MX0A 4LFCI 3HKMA 4QNKA 2BM1A 1N36I 4OX9E 4OO1F 2PO2A 4FW6A 2O1UA 4FN5A 2LJPA 5DRQA 4HACB 3ZZ0A 2WP8B 2GQ0A 2C39B 4MDTA 4GQUA 5EKWA 3NZKA 2IOQA 2VESA 3WU6A 4B3RI 2O1VA 4EMDA 1J5EI 4NXNI 4IZKA 4DV0I 2X7IA 3B4TA 4DR5I 1XHKA 5IWAE 4OO1E 4DPYA 3D4JA 1Z0TA 2HHHI 1XNRE 2ZBKB 4AIMA 4FW9A 4DV1I 3M85D 4PRXA 3KRNA
chains in the Genus database with same CATH topology
4JI0E 1H72C 2UUAE 3F0NA 4JI6E 3H4LA 1I94E 1FJGI 5LMNE 1ZM2A 3J81C 3HJCA 4GKKE 1HNZI 1XMOE 1S16A 3M6AA 1H74A 4PU9A 4DR7E 1PVGA 1EA6A 4JV5E 4B3SE 3J80Q 1Z0GA 1XMQE 3V5RA 4DR1I 2V2ZA 4DXLA 4XTJA 2HKJA 3JAMQ 3ZM7A 3B8HA 2IOPA 4DV6E 4JI5I 4I3HA 2Z5EA 2E5LI 2CG9A 1OJ4A 4B3TI 4DV2I 3OTOE 3PYEA 2X36A 3J7AM 1Z0VA 4K0KI 4JYAI 2UU9E 4LF7I 4DV3E 1WUUA 4AQYE 1U2RA 2UUCI 4DR2E 1FNMA 1N32I 4JI1E 2HK2A 3T1YI 3QT6A 1Y4SA 1NHHA 4ZVIA 1ZM9A 4X66I 2V2VA 2VQFI 4ED4A 5FLXQ 4DUYE 4X62I 5GMEA 3WU4A 1FWKA 4X65E 4DUZI 4JI7I 1RR9A 2ZM6I 3ZZUA 2NPFA 1HR0E 4KQVA 4LFAE 4Z7CA 4DV5E 4IZKB 4DPUA 1PIEA 4DR4I 1BKNA 1PKPA 1D6TA 1IBMI 4JI8I 4WUDA 4LF5E 4YHHI 1EI1A 4DPTA 3V2UC 2XEXA 2R42A 3B78A 2UUBI 4OX9I 1MU5A 4Z7YA 4P52A 2HHHE 3T1HE 5L3JA 1ELOA 1FKAE 1Y4UA 4JG4A 3QT8A 4NXME 5IWAI 1N33E 2UXDE 4HYMA 1XNRI 4DU8A 1N34E 1KKHA 2E1RA 3WU3A 1H7UA 1MG7A 4KHPI 1HNWE 1Z5AA 4JI0I 1K47A 3J81Q 2UUAI 4LFBE 1NHIA 4UT4A 4JI6I 4LF6E 2F4VE 1Z5CA 5LMNI 1S4EA 2BM0A 4PRVA 2VF3A 4GKKI 1KVKA 2PNLA 4YY3I 4JI3E 3QT7A 3K17A 3LNUA 2V34A 1XMOI 3PYFA 4DR3E 4DR7I 1VISA 4JV5I 1IBKE 1N0VC 4B3SI 5IT9C 4LF8E 2WW4A 1XMQI 4JI5E 2O1WA 1HNXE 2UXCE 4HY1A 4LF9E 1ZXNA 2BV3A 2A2DA 2HKEA 4HXZA 1KIJA 4DV2E 1FI4A 3GONA 4DR6E 2VQEE 4DV6I 4DV4I 4GKJE 1XNQE 3B82A 2EFGA 3ZZTA 2J7KA 5LMUE 2R3VA 2UUCE 2Z5BA 2UXBE 1N32E 4WUBA 3OTOI 2VQFE 4DV7E 2UU9I 4LF4E 4B3ME 2V8PA 1USVA 5BR8E 4AQYI 4DR2I 1Z0EA 5LL6R 4JI1I 2Q2EB 1IBLE 4JI2E 4X64E 1Z0WA 3LPSA 2HFSA 1NZ0A 4LFCE 1Z59A 4DR4E 4DUYI 1N36E 2O1TA 4JI4I 3QT5A 4IZJA 1USUA 1IBME 4DPXA 2Z5CA 1ZXMA 4LFAI 3ZKBA 4B3RE 2A2CA 2HK3A 1J5EE 4NXNE 4DV0E 4DR5E 2UUBE 1B62A 5FWKA 4IZJD 1Y6ZA 4DV1E 4LF5I 1KTVA 2GS8A 4R1FA 4P7AA 1ZM3A 3Q1QA 4RPFA 1FJGE 1A6FA 3T1HI 3CWVA 3Q6NA 4HACA 4KHPE 1HNZE 4FWHA 2PNMA 1H7SA 1Z5BA 4NXMI 4USKA 1ZM4A 1N33I 2UXDI 1I94I 1N34I 3J7AG 2DEJA 4DR1E 1HNWI 1B63A 4YY3E 4LFBI 4DPWA 1Z0BA 3J80C 4LF6I 1HK7A 2F4VI 2CGEA 2DEIA 4JI3I 3K1JA 3JAMC 2E5LE 4FWGA 2Z5BB 5IT9Q 4DU7A 4DR3I 4B3TE 3PYDA 1IBKI 4USMA 2HFUA 4K0KE 1NHJA 2OI2A 4LF8I 4JYAE 4DV4E 4LF7E 1Z0CA 3Q6MA 4FWDA 1HNXI 2UXCI 2AJ4A 4LF9I 1H73A 1UEKA 3T1YE 3K85A 4M1KA 4X66E 4DR6I 1N0UA 2VQEI 4DV3I 4X62E 4GKJI 1XNQI 4IZJB 4DUZE 4JI7E 5LMUI 2Z5CB 2ZM6E 4MYUA 2UXBI 5GMDA 1RREA 5FLXC 3ZKDA 1FWLA 4DV7I 4LF4I 1DARA 1QZRA 4URLA 2ZITA 3PRYA 4X65I 5A2QC 4B3MI 5BR8I 3PYGA 4UTGA 2CZ9A 4JI4E 3P06A 1HR0I 3HULA 4JI8E 4WUCA 3WU5A 4DV5I 5A2QQ 4MYTA 4YHHE 1IBLI 4JI2I 2V2QA 3LTOA 4X64I 4N3OA 4LFCI 1MX0A 2BM1A 1N36I 4OX9E 2O1UA 4FN5A 2LJPA 4HACB 3ZZ0A 2GQ0A 2IOQA 3WU6A 4B3RI 2O1VA 4EMDA 1J5EI 4NXNI 4IZKA 4DV0I 2X7IA 4DR5I 1XHKA 5IWAE 4DPYA 3D4JA 1Z0TA 2HHHI 1XNRE 2ZBKB 4FW9A 4DV1I 4PRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 E;  1H72 C;  2UUA E;  3F0N A;  4JI6 E;  3H4L A;  1I94 E;  1FJG I;  5LMN E;  1ZM2 A;  3J81 C;  4GKK E;  1HNZ I;  1XMO E;  1S16 A;  3M6A A;  1H74 A;  4PU9 A;  4DR7 E;  1PVG A;  1EA6 A;  4JV5 E;  4B3S E;  3J80 Q;  1Z0G A;  1XMQ E;  3V5R A;  4DR1 I;  2V2Z A;  4DXL A;  4XTJ A;  2HKJ A;  3JAM Q;  3ZM7 A;  3B8H A;  4DV6 E;  4JI5 I;  4I3H A;  2E5L I;  1OJ4 A;  4B3T I;  4DV2 I;  3OTO E;  3PYE A;  2X36 A;  3J7A M;  1Z0V A;  4K0K I;  4JYA I;  2UU9 E;  4LF7 I;  4DV3 E;  1WUU A;  4AQY E;  1U2R A;  2UUC I;  4DR2 E;  1FNM A;  1N32 I;  4JI1 E;  2HK2 A;  3T1Y I;  3QT6 A;  1NHH A;  4ZVI A;  1ZM9 A;  4X66 I;  2V2V A;  2VQF I;  4ED4 A;  5FLX Q;  4DUY E;  4X62 I;  5GME A;  3WU4 A;  1FWK A;  4X65 E;  4DUZ I;  4JI7 I;  1RR9 A;  2ZM6 I;  3ZZU A;  2NPF A;  1HR0 E;  4KQV A;  4LFA E;  4Z7C A;  4DV5 E;  4DPU A;  1PIE A;  4DR4 I;  1BKN A;  1PKP A;  1D6T A;  1IBM I;  4JI8 I;  4WUD A;  4LF5 E;  4YHH I;  1EI1 A;  4DPT A;  3V2U C;  2XEX A;  2R42 A;  3B78 A;  2UUB I;  4OX9 I;  1MU5 A;  4Z7Y A;  4P52 A;  2HHH E;  3T1H E;  5L3J A;  1ELO A;  1FKA E;  4JG4 A;  3QT8 A;  4NXM E;  5IWA I;  1N33 E;  2UXD E;  4HYM A;  1XNR I;  4DU8 A;  1N34 E;  1KKH A;  2E1R A;  3WU3 A;  1H7U A;  1MG7 A;  4KHP I;  1HNW E;  1Z5A A;  4JI0 I;  1K47 A;  3J81 Q;  2UUA I;  4LFB E;  1NHI A;  4UT4 A;  4JI6 I;  4LF6 E;  2F4V E;  1Z5C A;  5LMN I;  1S4E A;  2BM0 A;  4PRV A;  2VF3 A;  4GKK I;  1KVK A;  4YY3 I;  4JI3 E;  3QT7 A;  3K17 A;  3LNU A;  2V34 A;  1XMO I;  3PYF A;  4DR3 E;  4DR7 I;  1VIS A;  4JV5 I;  1IBK E;  1N0V C;  4B3S I;  5IT9 C;  4LF8 E;  2WW4 A;  1XMQ I;  4JI5 E;  1HNX E;  2UXC E;  4HY1 A;  4LF9 E;  1ZXN A;  2BV3 A;  2A2D A;  2HKE A;  4HXZ A;  1KIJ A;  4DV2 E;  1FI4 A;  3GON A;  4DR6 E;  2VQE E;  4DV6 I;  4DV4 I;  4GKJ E;  1XNQ E;  3B82 A;  2EFG A;  3ZZT A;  2J7K A;  5LMU E;  2R3V A;  2UUC E;  2UXB E;  1N32 E;  4WUB A;  3OTO I;  2VQF E;  4DV7 E;  2UU9 I;  4LF4 E;  4B3M E;  2V8P A;  5BR8 E;  4AQY I;  4DR2 I;  1Z0E A;  5LL6 R;  4JI1 I;  2Q2E B;  1IBL E;  4JI2 E;  4X64 E;  1Z0W A;  3LPS A;  2HFS A;  1NZ0 A;  4LFC E;  1Z59 A;  4DR4 E;  4DUY I;  1N36 E;  4JI4 I;  3QT5 A;  1IBM E;  4DPX A;  1ZXM A;  4LFA I;  3ZKB A;  4B3R E;  2A2C A;  2HK3 A;  1J5E E;  4NXN E;  4DV0 E;  4DR5 E;  2UUB E;  1B62 A;  4DV1 E;  4LF5 I;  1KTV A;  2GS8 A;  4R1F A;  4P7A A;  1ZM3 A;  3Q1Q A;  4RPF A;  1FJG E;  1A6F A;  3T1H I;  3CWV A;  4HAC A;  4KHP E;  1HNZ E;  4FWH A;  1H7S A;  1Z5B A;  4NXM I;  4USK A;  1ZM4 A;  1N33 I;  2UXD I;  1I94 I;  1N34 I;  3J7A G;  2DEJ A;  4DR1 E;  1HNW I;  1B63 A;  4YY3 E;  4LFB I;  4DPW A;  1Z0B A;  3J80 C;  4LF6 I;  2F4V I;  2DEI A;  4JI3 I;  3K1J A;  3JAM C;  2E5L E;  4FWG A;  5IT9 Q;  4DU7 A;  4DR3 I;  4B3T E;  3PYD A;  1IBK I;  4USM A;  2HFU A;  4K0K E;  1NHJ A;  2OI2 A;  4LF8 I;  4JYA E;  4DV4 E;  4LF7 E;  1Z0C A;  4FWD A;  1HNX I;  2UXC I;  2AJ4 A;  4LF9 I;  1H73 A;  1UEK A;  3T1Y E;  4M1K A;  4X66 E;  4DR6 I;  1N0U A;  2VQE I;  4DV3 I;  4X62 E;  4GKJ I;  1XNQ I;  4DUZ E;  4JI7 E;  5LMU I;  2ZM6 E;  4MYU A;  2UXB I;  5GMD A;  1RRE A;  5FLX C;  3ZKD A;  1FWL A;  4DV7 I;  4LF4 I;  1DAR A;  1QZR A;  4URL A;  2ZIT A;  4X65 I;  4B3M I;  5A2Q C;  5BR8 I;  3PYG A;  4UTG A;  2CZ9 A;  4JI4 E;  1HR0 I;  3HUL A;  4JI8 E;  4WUC A;  3WU5 A;  4DV5 I;  5A2Q Q;  4MYT A;  4YHH E;  1IBL I;  4JI2 I;  2V2Q A;  3LTO A;  4X64 I;  4LFC I;  1MX0 A;  2BM1 A;  1N36 I;  4OX9 E;  4FN5 A;  2LJP A;  4HAC B;  3ZZ0 A;  3WU6 A;  4B3R I;  4EMD A;  1J5E I;  4NXN I;  4DV0 I;  2X7I A;  4DR5 I;  1XHK A;  5IWA E;  4DPY A;  3D4J A;  1Z0T A;  2HHH I;  1XNR E;  2ZBK B;  4FW9 A;  4DV1 I;  4PRX A; 
#chains in the Genus database with same CATH topology
 4JI0 E;  1H72 C;  2UUA E;  2PO0 B;  3F0N A;  4JI6 E;  3H1C A;  3H4L A;  4OZE A;  1I94 E;  1FJG I;  5LMN E;  1ZM2 A;  3J81 C;  3HJC A;  4GKK E;  4AID A;  1HNZ I;  4IFD C;  2JEA B;  2JEB A;  1XMO E;  1S16 A;  3M6A A;  1H74 A;  4FW5 A;  4PU9 A;  5DNL A;  4DR7 E;  1PVG A;  1EA6 A;  4JV5 E;  4B3S E;  3J80 Q;  1Z0G A;  1XMQ E;  3V5R A;  4DR1 I;  2V2Z A;  4OO1 A;  4DXL A;  4XTJ A;  2HKJ A;  3JAM Q;  3ZM7 A;  5C0X D;  1UDS A;  3B8H A;  2IOP A;  4DV6 E;  4JI5 I;  1RHY A;  4I3H A;  2Z5E A;  2C37 A;  5ELW A;  2E5L I;  2CG9 A;  1OJ4 A;  3UHM A;  2AE8 A;  2PO1 B;  4B3T I;  5K36 F;  4DV2 I;  3OTO E;  1OYR A;  3PYE A;  2X36 A;  4LCG A;  3J7A M;  1Z0V A;  4K0K I;  4JYA I;  2UU9 E;  4LF7 I;  3GCM A;  4DV3 E;  1WUU A;  4AQY E;  1U2R A;  2UUC I;  4DR2 E;  1FNM A;  1N32 I;  4JI1 E;  5K36 E;  2HK2 A;  3T1Y I;  3QT6 A;  1Y4S A;  1NHH A;  2BR2 A;  4ZVI A;  1ZM9 A;  4X66 I;  2V2V A;  2VQF I;  4ED4 A;  3L7Z B;  5FLX Q;  3P3E A;  4DUY E;  4X62 I;  3PS1 A;  5GME A;  3WU4 A;  1FWK A;  4X65 E;  4DUZ I;  5C0X F;  1RR9 A;  4JI7 I;  2ZM6 I;  3ZZU A;  2NPF A;  1HR0 E;  1XXE A;  4KQV A;  4LFA E;  4Z7C A;  4DV5 E;  3PS3 A;  4IZK B;  4OO1 C;  4DPU A;  1PIE A;  4DR4 I;  4LOM A;  1BKN A;  3L7Z A;  1PKP A;  1D6T A;  5C0X E;  1IBM I;  3CDI A;  4JI8 I;  2NN6 D;  4WUD A;  4LF5 E;  4YHH I;  2BA0 D;  1EI1 A;  4DPT A;  3V2U C;  2XEX A;  2R42 A;  3B78 A;  2UUB I;  4OX9 I;  4MU3 A;  1MU5 A;  4Z7Y A;  2BA0 G;  4P52 A;  2HHH E;  5K36 A;  3T1H E;  3GME A;  2JEB B;  4LCH A;  5L3J A;  1ELO A;  1FKA E;  5C0X B;  1Y4U A;  2BA1 D;  4JG4 A;  3M85 G;  3QT8 A;  4NXM E;  5IWA I;  1N33 E;  2UXD E;  4HYM A;  1XNR I;  3GLL A;  5K36 D;  4DU8 A;  1N34 E;  1KKH A;  2E1R A;  3WU3 A;  1H7U A;  1MG7 A;  4KHP I;  4OO1 B;  1HNW E;  1Z5A A;  4JI0 I;  1K47 A;  3J81 Q;  2UUA I;  3U1K A;  4LFB E;  1NHI A;  4UT4 A;  4JI6 I;  5C0X A;  4LF6 E;  2F4V E;  2NN6 F;  1Z5C A;  5JEA F;  2IES A;  5LMN I;  5DRR A;  1S4E A;  2BM0 A;  2C37 B;  4PRV A;  2VF3 A;  3U1Y A;  4GKK I;  1KVK A;  2PNL A;  4YY3 I;  4JI3 E;  3QT7 A;  3K17 A;  3LNU A;  1E3H A;  2V34 A;  1XMO I;  4FW7 A;  4FW3 A;  3PYF A;  4DR3 E;  5DRO A;  2NN6 E;  5JEA E;  4QNJ A;  4DR7 I;  1VIS A;  4JV5 I;  1IBK E;  1N0V C;  4B3S I;  5IT9 C;  4LF8 E;  1UDN A;  2WW4 A;  4NBQ A;  1XMQ I;  4JI5 E;  5K36 C;  2O1W A;  1HNX E;  2UXC E;  2BR2 B;  1YH8 A;  4HY1 A;  4LF9 E;  1ZXN A;  2BV3 A;  2A2D A;  2HKE A;  4HXZ A;  1KIJ A;  4DV2 E;  1FI4 A;  3GON A;  4DR6 E;  1R6L A;  2VQE E;  4DV6 I;  4DV4 I;  5EL9 A;  4GKJ E;  2PNZ A;  1XNQ E;  3B82 A;  2EFG A;  3ZZT A;  2J7K A;  2NN6 B;  1E3P A;  5LMU E;  2R3V A;  2UUC E;  2Z5B A;  4BA2 B;  2UXB E;  4FW4 A;  3P76 A;  1N32 E;  4WUB A;  3OTO I;  5C0X C;  2VQF E;  4DV7 E;  1VI7 A;  2UU9 I;  4LF4 E;  2J65 A;  4B3M E;  2V8P A;  1USV A;  5BR8 E;  4AQY I;  4DR2 I;  2NN6 A;  1Z0E A;  5LL6 R;  5JEA A;  4JI1 I;  2Q2E B;  4MU0 A;  4BA2 A;  1IBL E;  4JI2 E;  4X64 E;  1Z0W A;  3P3G A;  3LPS A;  2HFS A;  1NZ0 A;  1Y60 A;  4LFC E;  1Z59 A;  5DRP A;  4DR4 E;  4MQY A;  4DUY I;  1N36 E;  2O1T A;  4IS9 A;  5K36 B;  4JI4 I;  3QT5 A;  4IZJ A;  1USU A;  1OYS A;  1IBM E;  4DPX A;  5JEA D;  2Z5C A;  1ZXM A;  4LFA I;  3ZKB A;  4B3R E;  4ISA A;  4AM3 A;  2A2C A;  2HK3 A;  1J5E E;  4NXN E;  4DV0 E;  4DR5 E;  2UUB E;  1B62 A;  4BA1 A;  5FWK A;  4IZJ D;  2JT2 A;  4IFD D;  2CVE A;  1Y6Z A;  4DV1 E;  4U3B A;  4LF5 I;  3PS2 A;  2O3Z A;  4MU1 A;  1KTV A;  2GS8 A;  4OKG A;  4R1F A;  4P7A A;  1ZM3 A;  3Q1Q A;  4RPF A;  1FJG E;  1A6F A;  2BA1 G;  4LPF A;  3T1H I;  3CWV A;  3Q6N A;  4HAC A;  4LCF A;  2WP8 A;  4KHP E;  2C39 A;  1HNZ E;  5DNX A;  2NN6 C;  4FWH A;  2PNM A;  5JEA C;  1H7S A;  3CDJ A;  1Z5B A;  4NXM I;  4USK A;  1ZM4 A;  1N33 I;  2UXD I;  2GO4 A;  1I94 I;  3M7N D;  1N34 I;  3J7A G;  2C38 B;  2DEJ A;  4U3D A;  4J3D A;  4DR1 E;  1HNW I;  1B63 A;  4YY3 E;  3M7N G;  4LFB I;  1YHC A;  4DPW A;  1Z0B A;  2PO0 A;  4IFD F;  3J80 C;  4LF6 I;  1HK7 A;  2F4V I;  1OYP A;  2CGE A;  2PNZ B;  2DEI A;  2IER A;  2C38 A;  4JI3 I;  3K1J A;  3JAM C;  2E5L E;  4FWG A;  1UDQ A;  2Z5B B;  5IT9 Q;  2JEA A;  4DU7 A;  4DR3 I;  4IFD E;  4B3T E;  3PYD A;  1IBK I;  4USM A;  2HFU A;  4K0K E;  1NHJ A;  2OI2 A;  4LF8 I;  3DD6 A;  4JYA E;  4DV4 E;  4LF7 E;  1Z0C A;  3Q6M A;  4FWD A;  5JEA B;  3P3C A;  1HNX I;  2GO3 A;  2UXC I;  4OO1 D;  2AJ4 A;  4LF9 I;  1H73 A;  1R6M A;  1UEK A;  3T1Y E;  3K85 A;  4M1K A;  4X66 E;  4DR6 I;  1N0U A;  2VQE I;  2F1D A;  4DV3 I;  4X62 E;  4GKJ I;  1XNQ I;  4IZJ B;  4IFD B;  4DUZ E;  4JI7 E;  5LMU I;  2Z5C B;  2ZM6 E;  4MYU A;  2UXB I;  5GMD A;  2WNR B;  1RRE A;  2JE6 B;  5FLX C;  2PO1 A;  3ZKD A;  4BA1 B;  2PO2 B;  1FWL A;  4DV7 I;  1P42 A;  4LF4 I;  1DAR A;  1QZR A;  4URL A;  2ZIT A;  3PRY A;  4X65 I;  5A2Q C;  4B3M I;  5BR8 I;  3PYG A;  4UTG A;  2CZ9 A;  4JI4 E;  4IFD A;  1Y5Y A;  3P06 A;  1HR0 I;  3HUL A;  4JI8 E;  4WUC A;  3WU5 A;  4DV5 I;  2WNR A;  5A2Q Q;  4MYT A;  4YHH E;  1IBL I;  4JI2 I;  2V2Q A;  3LTO A;  4X64 I;  1UDO A;  2JE6 A;  4N3O A;  4MU4 A;  1MX0 A;  4LFC I;  3HKM A;  4QNK A;  2BM1 A;  1N36 I;  4OX9 E;  4OO1 F;  2PO2 A;  4FW6 A;  2O1U A;  4FN5 A;  2LJP A;  5DRQ A;  4HAC B;  3ZZ0 A;  2WP8 B;  2GQ0 A;  2C39 B;  4MDT A;  4GQU A;  5EKW A;  3NZK A;  2IOQ A;  2VES A;  3WU6 A;  4B3R I;  2O1V A;  4EMD A;  1J5E I;  4NXN I;  4IZK A;  4DV0 I;  2X7I A;  3B4T A;  4DR5 I;  1XHK A;  5IWA E;  4OO1 E;  4DPY A;  3D4J A;  1Z0T A;  2HHH I;  1XNR E;  2ZBK B;  4AIM A;  4FW9 A;  4DV1 I;  3M85 D;  4PRX A;  3KRN A; 
#chains in the Genus database with same CATH homology
 4JI0 E;  1H72 C;  2UUA E;  3F0N A;  4JI6 E;  3H4L A;  1I94 E;  1FJG I;  5LMN E;  1ZM2 A;  3J81 C;  3HJC A;  4GKK E;  1HNZ I;  1XMO E;  1S16 A;  3M6A A;  1H74 A;  4PU9 A;  4DR7 E;  1PVG A;  1EA6 A;  4JV5 E;  4B3S E;  3J80 Q;  1Z0G A;  1XMQ E;  3V5R A;  4DR1 I;  2V2Z A;  4DXL A;  4XTJ A;  2HKJ A;  3JAM Q;  3ZM7 A;  3B8H A;  2IOP A;  4DV6 E;  4JI5 I;  4I3H A;  2Z5E A;  2E5L I;  2CG9 A;  1OJ4 A;  4B3T I;  4DV2 I;  3OTO E;  3PYE A;  2X36 A;  3J7A M;  1Z0V A;  4K0K I;  4JYA I;  2UU9 E;  4LF7 I;  4DV3 E;  1WUU A;  4AQY E;  1U2R A;  2UUC I;  4DR2 E;  1FNM A;  1N32 I;  4JI1 E;  2HK2 A;  3T1Y I;  3QT6 A;  1Y4S A;  1NHH A;  4ZVI A;  1ZM9 A;  4X66 I;  2V2V A;  2VQF I;  4ED4 A;  5FLX Q;  4DUY E;  4X62 I;  5GME A;  3WU4 A;  1FWK A;  4X65 E;  4DUZ I;  4JI7 I;  1RR9 A;  2ZM6 I;  3ZZU A;  2NPF A;  1HR0 E;  4KQV A;  4LFA E;  4Z7C A;  4DV5 E;  4IZK B;  4DPU A;  1PIE A;  4DR4 I;  1BKN A;  1PKP A;  1D6T A;  1IBM I;  4JI8 I;  4WUD A;  4LF5 E;  4YHH I;  1EI1 A;  4DPT A;  3V2U C;  2XEX A;  2R42 A;  3B78 A;  2UUB I;  4OX9 I;  1MU5 A;  4Z7Y A;  4P52 A;  2HHH E;  3T1H E;  5L3J A;  1ELO A;  1FKA E;  1Y4U A;  4JG4 A;  3QT8 A;  4NXM E;  5IWA I;  1N33 E;  2UXD E;  4HYM A;  1XNR I;  4DU8 A;  1N34 E;  1KKH A;  2E1R A;  3WU3 A;  1H7U A;  1MG7 A;  4KHP I;  1HNW E;  1Z5A A;  4JI0 I;  1K47 A;  3J81 Q;  2UUA I;  4LFB E;  1NHI A;  4UT4 A;  4JI6 I;  4LF6 E;  2F4V E;  1Z5C A;  5LMN I;  1S4E A;  2BM0 A;  4PRV A;  2VF3 A;  4GKK I;  1KVK A;  2PNL A;  4YY3 I;  4JI3 E;  3QT7 A;  3K17 A;  3LNU A;  2V34 A;  1XMO I;  3PYF A;  4DR3 E;  4DR7 I;  1VIS A;  4JV5 I;  1IBK E;  1N0V C;  4B3S I;  5IT9 C;  4LF8 E;  2WW4 A;  1XMQ I;  4JI5 E;  2O1W A;  1HNX E;  2UXC E;  4HY1 A;  4LF9 E;  1ZXN A;  2BV3 A;  2A2D A;  2HKE A;  4HXZ A;  1KIJ A;  4DV2 E;  1FI4 A;  3GON A;  4DR6 E;  2VQE E;  4DV6 I;  4DV4 I;  4GKJ E;  1XNQ E;  3B82 A;  2EFG A;  3ZZT A;  2J7K A;  5LMU E;  2R3V A;  2UUC E;  2Z5B A;  2UXB E;  1N32 E;  4WUB A;  3OTO I;  2VQF E;  4DV7 E;  2UU9 I;  4LF4 E;  4B3M E;  2V8P A;  1USV A;  5BR8 E;  4AQY I;  4DR2 I;  1Z0E A;  5LL6 R;  4JI1 I;  2Q2E B;  1IBL E;  4JI2 E;  4X64 E;  1Z0W A;  3LPS A;  2HFS A;  1NZ0 A;  4LFC E;  1Z59 A;  4DR4 E;  4DUY I;  1N36 E;  2O1T A;  4JI4 I;  3QT5 A;  4IZJ A;  1USU A;  1IBM E;  4DPX A;  2Z5C A;  1ZXM A;  4LFA I;  3ZKB A;  4B3R E;  2A2C A;  2HK3 A;  1J5E E;  4NXN E;  4DV0 E;  4DR5 E;  2UUB E;  1B62 A;  5FWK A;  4IZJ D;  1Y6Z A;  4DV1 E;  4LF5 I;  1KTV A;  2GS8 A;  4R1F A;  4P7A A;  1ZM3 A;  3Q1Q A;  4RPF A;  1FJG E;  1A6F A;  3T1H I;  3CWV A;  3Q6N A;  4HAC A;  4KHP E;  1HNZ E;  4FWH A;  2PNM A;  1H7S A;  1Z5B A;  4NXM I;  4USK A;  1ZM4 A;  1N33 I;  2UXD I;  1I94 I;  1N34 I;  3J7A G;  2DEJ A;  4DR1 E;  1HNW I;  1B63 A;  4YY3 E;  4LFB I;  4DPW A;  1Z0B A;  3J80 C;  4LF6 I;  1HK7 A;  2F4V I;  2CGE A;  2DEI A;  4JI3 I;  3K1J A;  3JAM C;  2E5L E;  4FWG A;  2Z5B B;  5IT9 Q;  4DU7 A;  4DR3 I;  4B3T E;  3PYD A;  1IBK I;  4USM A;  2HFU A;  4K0K E;  1NHJ A;  2OI2 A;  4LF8 I;  4JYA E;  4DV4 E;  4LF7 E;  1Z0C A;  3Q6M A;  4FWD A;  1HNX I;  2UXC I;  2AJ4 A;  4LF9 I;  1H73 A;  1UEK A;  3T1Y E;  3K85 A;  4M1K A;  4X66 E;  4DR6 I;  1N0U A;  2VQE I;  4DV3 I;  4X62 E;  4GKJ I;  1XNQ I;  4IZJ B;  4DUZ E;  4JI7 E;  5LMU I;  2Z5C B;  2ZM6 E;  4MYU A;  2UXB I;  5GMD A;  1RRE A;  5FLX C;  3ZKD A;  1FWL A;  4DV7 I;  4LF4 I;  1DAR A;  1QZR A;  4URL A;  2ZIT A;  3PRY A;  4X65 I;  5A2Q C;  4B3M I;  5BR8 I;  3PYG A;  4UTG A;  2CZ9 A;  4JI4 E;  3P06 A;  1HR0 I;  3HUL A;  4JI8 E;  4WUC A;  3WU5 A;  4DV5 I;  5A2Q Q;  4MYT A;  4YHH E;  1IBL I;  4JI2 I;  2V2Q A;  3LTO A;  4X64 I;  4N3O A;  4LFC I;  1MX0 A;  2BM1 A;  1N36 I;  4OX9 E;  2O1U A;  4FN5 A;  2LJP A;  4HAC B;  3ZZ0 A;  2GQ0 A;  2IOQ A;  3WU6 A;  4B3R I;  2O1V A;  4EMD A;  1J5E I;  4NXN I;  4IZK A;  4DV0 I;  2X7I A;  4DR5 I;  1XHK A;  5IWA E;  4DPY A;  3D4J A;  1Z0T A;  2HHH I;  1XNR E;  2ZBK B;  4FW9 A;  4DV1 I;  4PRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...