1IBKI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibkI00
1Z0TA 3PYDA 4DR2E 1FWLA 4DR2I 5IT9C 1XHKA 3ZKBA 4DPWA 4LF6E 4LF6I 4DV0E 2A2CA 4DV0I 3J7AM 1NZ0A 3HULA 1NHJA 3ZZ0A 1EA6A 1MX0A 2HFSA 4KQVA 1ZM4A 3LPSA 4ZVIA 5GMEA 5LL6R 3J80C 2ZBKB 4DR3E 5LMUE 1Z59A 4DR3I 5LMUI 4MYTA 2HK2A 4DUZE 4DUZI 3B82A 3Q1QA 2E5LE 1ZXNA 2E5LI 4DR1E 2X36A 1N34E 4DR1I 5LMNE 1N0UA 4DU8A 1N34I 5LMNI 2UXDE 2UXDI 1VISA 4JYAE 4JYAI 4WUDA 3B78A 3K17A 4JV5E 3OTOE 4JV5I 3CWVA 2DEJA 3OTOI 3QT8A 3ZKDA 1XMOE 4LFBE 3T1HE 4GKJE 2HKJA 1XMOI 4LFBI 3T1HI 4GKJI 2UXCE 3JAMQ 2UXCI 2DEIA 3PYGA 4HACB 1B63A 2V8PA 5FLXQ 1UEKA 1S16A 1I94E 4DR6E 1I94I 4DR6I 3V5RA 4DU7A 2A2DA 5A2QC 1FKAE 4DR5E 1D6TA 2AJ4A 4MYUA 4DR5I 4HYMA 4LFAE 4LFAI 3QT6A 2UU9E 1H72C 3QT7A 2UU9I 4DV5E 4DV5I 1RR9A 2V34A 2NPFA 3M6AA 1PIEA 4KHPE 1MG7A 4KHPI 1Z5BA 4NXME 4LF4E 1H7SA 4NXMI 4HXZA 4LF4I 2XEXA 2E1RA 4B3SE 4LF8E 4B3SI 4LF8I 5IWAE 5IWAI 3J80Q 4URLA 1PKPA 2UUCE 2UUCI 4FWGA 4XTJA 1ELOA 1N32E 1HNXE 1N32I 2EFGA 1HNXI 2V2VA 2F4VE 2F4VI 1IBLE 4FWDA 1IBLI 1BKNA 3WU5A 4JI2E 3LTOA 4JI2I 1Z0GA 3J81Q 4PRVA 4X64E 4X64I 3T1YE 1OJ4A 4PRXA 3T1YI 5L3JA 1Z0EA 4JI5E 4K0KE 4JI5I 4K0KI 4USKA 4DV2E 2HFUA 4YHHE 4DV2I 4JI8E 4YHHI 4RPFA 4JI8I 1H74A 4UT4A 2CZ9A 4WUCA 2GS8A 1H73A 1B62A 2UUAE 2UUAI 2X7IA 1FWKA 4LF9E 2R42A 4DPTA 4LF9I 1ZM9A 1Z0CA 1QZRA 4DV1E 2VF3A 4DV1I 2HKEA 1N0VC 4FW9A 3JAMC 1A6FA 3F0NA 1Z5AA 2BM0A 5A2QQ 1HNZE 3PYFA 4Z7YA 4JI4E 4I3HA 1HNZI 1IBME 4JI4I 3PYEA 1IBMI 3ZZUA 4LF5E 4DUYE 4LF5I 4HY1A 4USMA 4DUYI 1PVGA 3WU6A 1EI1A 4OX9E 4OX9I 3V2UC 2V2ZA 4P52A 5FLXC 5IT9Q 1U2RA 5BR8E 2VQEE 5BR8I 2VQEI 4JI3E 4DV6E 4JI3I 4DV6I 4JG4A 2LJPA 1HR0E 3WU3A 1N36E 1HR0I 4M1KA 1H7UA 4UTGA 2UUBE 2BM1A 2UUBI 4LFCE 4LFCI 4B3TE 4DPXA 4B3TI 2VQFE 4JI1E 2VQFI 2V2QA 4JI1I 3B8HA 4JI6E 4FN5A 4JI6I 4LF7E 4LF7I 4NXNE 1ZXMA 4NXNI 4R1FA 4WUBA 2UXBE 2UXBI 1FJGE 1FJGI 4DR7E 4DR7I 1DARA 3LNUA 1N33E 1N33I 4X66E 1KTVA 4B3RE 4X66I 4B3RI 2J7KA 1KVKA 3ZZTA 2R3VA 5GMDA 1Z0BA 4X62E 1XNRE 4X62I 1XNRI 3J81C 4DV3E 1ZM3A 4DV7E 4DV3I 4DV7I 2WW4A 4PU9A 4DV4E 4Z7CA 4DV4I 4X65E 3WU4A 4X65I 1FNMA 4ED4A 1S4EA 1NHHA 2HHHE 2HK3A 1KIJA 4AQYE 2HHHI 4HACA 4AQYI 4DR4E 3ZM7A 4DR4I 1J5EE 1ZM2A 1J5EI 1Z5CA 3H4LA 4JI7E 2Q2EB 1Z0WA 4JI7I 3J7AG 1IBKE 4P7AA 3QT5A 4DPYA 4B3ME 4JI0E 1K47A 1IBKI 2ZM6E 4FWHA 4JI0I 4B3MI 1HNWE 2ZM6I 1HNWI 3D4JA 4EMDA 1Z0VA 2ZITA 4YY3E 4YY3I 4GKKE 1WUUA 4GKKI 2BV3A 1XMQE 1XMQI 1NHIA 4DPUA 3GONA 3K1JA 1FI4A 1XNQE 1KKHA 4DXLA 1XNQI 2OI2A 1MU5A 1N36I 1RREA
chains in the Genus database with same CATH superfamily
5C0XF 1Z0TA 1Y60A 3PYDA 4DR2E 1FWLA 4DR2I 5DNXA 5IT9C 1XHKA 3ZKBA 4DPWA 4LF6E 4LF6I 4DV0E 5C0XA 2A2CA 4DV0I 3J7AM 1NZ0A 2PO2B 5K36C 4BA1B 3HULA 4IFDE 1NHJA 3ZZ0A 1EA6A 1MX0A 1UDQA 2HFSA 3KRNA 4KQVA 1ZM4A 3LPSA 4ZVIA 5EL9A 5GMEA 5LL6R 3J80C 2ZBKB 4DR3E 5LMUE 1Z59A 4DR3I 5LMUI 4MYTA 2HK2A 1E3PA 4DUZE 4DUZI 3B82A 5DNLA 3Q1QA 2E5LE 1ZXNA 2WNRA 1XXEA 3UHMA 2E5LI 4GQUA 2C39B 2JEBA 5ELWA 2VESA 5C0XE 1USVA 4U3DA 1Y5YA 4DR1E 2X36A 1N34E 4DR1I 5LMNE 1N0UA 4DU8A 1N34I 5LMNI 2JE6B 2UXDE 2UXDI 4IZJA 3B4TA 1VISA 4JYAE 4JYAI 3P3EA 4WUDA 1Y4UA 3B78A 3HJCA 3K17A 4JV5E 1P42A 3OTOE 1HK7A 4JV5I 3CWVA 2DEJA 3OTOI 3QT8A 3ZKDA 2GO3A 1XMOE 2BR2A 4LFBE 3T1HE 4GKJE 2HKJA 4J3DA 1XMOI 4LFBI 3T1HI 4GKJI 2Z5BA 2UXCE 3JAMQ 2UXCI 2DEIA 2IERA 1RHYA 3PYGA 5EKWA 2IOPA 4HACB 2O1VA 1B63A 1USUA 3P3GA 4IS9A 1Y4SA 4LCFA 2V8PA 5DROA 5FLXQ 2GQ0A 4ISAA 1UEKA 1S16A 4IFDA 4LCHA 1I94E 4DR6E 1I94I 5JEAF 2PO0B 3V5RA 4DR6I 2IOQA 4DU7A 2A2DA 5A2QC 4U3BA 5FWKA 1FKAE 4DR5E 1D6TA 2AJ4A 2NN6F 3HKMA 2C38A 4MYUA 4DR5I 4HYMA 4AM3A 4LFAE 3M7NG 4LFAI 4FW4A 3QT6A 2UU9E 2WP8A 1H72C 3QT7A 2UU9I 4DV5E 4MQYA 4DV5I 1RR9A 2NN6A 2V34A 2NPFA 4OO1F 5DRPA 2BA0D 3M6AA 4FW3A 1PIEA 4KHPE 1MG7A 4LCGA 4KHPI 1Z5BA 2IESA 4NXME 2PO1A 4LF4E 1H7SA 4NXMI 4HXZA 4LF4I 4OO1A 1R6MA 2XEXA 2E1RA 4B3SE 4LF8E 2Z5CA 4B3SI 4LF8I 4LPFA 5IWAE 5IWAI 3M85D 3J80Q 3Q6NA 4IFDC 4URLA 5C0XB 1PKPA 2UUCE 3M85G 2UUCI 2PO1B 4FWGA 5C0XD 4XTJA 1VI7A 1ELOA 5JEAE 1Y6ZA 1N32E 1HNXE 1N32I 3NZKA 2EFGA 1HNXI 2V2VA 2F4VE 2NN6E 2F4VI 1IBLE 4FWDA 1IBLI 4MU3A 1BKNA 3WU5A 4JI2E 2O1WA 3LTOA 2AE8A 4JI2I 3L7ZA 1Z0GA 3J81Q 5C0XC 1OYPA 4PRVA 4OO1E 4X64E 3Q6MA 4X64I 3T1YE 1OJ4A 4PRXA 2WNRB 3T1YI 5L3JA 1Z0EA 2C37A 4JI5E 4K0KE 2JEBB 4JI5I 4K0KI 4QNJA 4USKA 3PRYA 4DV2E 2HFUA 4YHHE 4DV2I 4JI8E 4YHHI 4RPFA 4JI8I 3GCMA 1H74A 2CGEA 4UT4A 4IZJB 2CZ9A 4WUCA 2GS8A 1H73A 1B62A 4IZJD 4MU0A 1E3HA 2UUAE 2UUAI 2X7IA 1FWKA 4LF9E 2R42A 4DPTA 4LF9I 1ZM9A 1Z0CA 2PNZA 1QZRA 2BR2B 4DV1E 2VF3A 4DV1I 2HKEA 2Z5BB 1R6LA 2BA1D 1N0VC 4FW9A 5K36F 3CDIA 1UDSA 3JAMC 1A6FA 4FW6A 3F0NA 1Z5AA 2BM0A 5A2QQ 1HNZE 3PYFA 4Z7YA 3K85A 3P3CA 4I3HA 2PNZB 1HNZI 1IBME 4JI4E 4JI4I 3PYEA 1IBMI 2PNMA 3ZZUA 4LF5E 4DUYE 4LF5I 4HY1A 4BA2A 4USMA 4DUYI 5K36A 1UDNA 1PVGA 2JEAA 3WU6A 2GO4A 1EI1A 2CG9A 4OX9E 5JEAA 4OX9I 3V2UC 4IFDB 2V2ZA 3PS1A 4P52A 5FLXC 5IT9Q 4IFDD 1U2RA 5BR8E 2VQEE 5BR8I 2VQEI 3GMEA 2C38B 4JI3E 4DV6E 4JI3I 2JEAB 4FW5A 3GLLA 4DV6I 4JG4A 2LJPA 1HR0E 2O1UA 3WU3A 5JEAB 1N36E 2BA0G 2WP8B 3CDJA 2CVEA 4OKGA 4M1KA 1HR0I 1H7UA 2PO2A 4N3OA 4UTGA 4BA1A 5JEAD 2UUBE 2BM1A 2NN6B 2UUBI 4LFCE 4LFCI 4B3TE 4DPXA 4B3TI 2VQFE 2NN6D 4JI1E 2VQFI 2V2QA 4JI1I 5K36E 3B8HA 4JI6E 4FN5A 4JI6I 4OO1B 4LF7E 4LF7I 4NXNE 4IZKA 2Z5CB 1ZXMA 4NXNI 4R1FA 3PS3A 4WUBA 5JEAC 2UXBE 4OO1D 2UXBI 4NBQA 1FJGE 1FJGI 4DR7E 4DR7I 2NN6C 1DARA 2C39A 3LNUA 3H1CA 4IZKB 1N33E 2JE6A 1N33I 4X66E 1KTVA 4B3RE 4X66I 4B3RI 2J7KA 4OO1C 1KVKA 3ZZTA 2Z5EA 2R3VA 5GMDA 1Z0BA 3L7ZB 4X62E 1XNRE 4X62I 1XNRI 1YH8A 3PS2A 3J81C 5DRRA 4DV3E 1ZM3A 4DV7E 4DV3I 2JT2A 4DV7I 2WW4A 4PU9A 4DV4E 2C37B 4MU4A 2PNLA 4Z7CA 4DV4I 4X65E 3WU4A 1OYRA 4X65I 1FNMA 4ED4A 4MDTA 4MU1A 3U1YA 1S4EA 1NHHA 2HHHE 2HK3A 1KIJA 4AQYE 2HHHI 4HACA 4AQYI 3P06A 4AIMA 4DR4E 3ZM7A 4DR4I 3P76A 1UDOA 1J5EE 1ZM2A 1J5EI 1Z5CA 3H4LA 4JI7E 2Q2EB 1Z0WA 4JI7I 3J7AG 1IBKE 4P7AA 3QT5A 4DPYA 4B3ME 4JI0E 1K47A 1IBKI 2ZM6E 2J65A 4FWHA 4JI0I 4B3MI 2ZM6I 1HNWE 1HNWI 2BA1G 2O1TA 3D4JA 3U1KA 4EMDA 1YHCA 5DRQA 2F1DA 1Z0VA 4OZEA 2PO0A 4IFDF 2ZITA 4LOMA 4YY3E 4YY3I 4GKKE 4QNKA 1WUUA 4GKKI 2O3ZA 4AIDA 2BV3A 1XMQE 1XMQI 1OYSA 1NHIA 4DPUA 4FW7A 3GONA 3K1JA 1FI4A 1XNQE 3M7ND 1KKHA 4DXLA 1XNQI 4BA2B 5K36B 2OI2A 1MU5A 3DD6A 5K36D 1N36I 1RREA
chains in the Genus database with same CATH topology
1Z0TA 3PYDA 4DR2E 1FWLA 4DR2I 5IT9C 1XHKA 3ZKBA 4DPWA 4LF6E 4LF6I 4DV0E 2A2CA 4DV0I 3J7AM 1NZ0A 3HULA 1NHJA 3ZZ0A 1EA6A 1MX0A 2HFSA 4KQVA 1ZM4A 3LPSA 4ZVIA 5GMEA 5LL6R 3J80C 2ZBKB 4DR3E 5LMUE 1Z59A 4DR3I 5LMUI 4MYTA 2HK2A 4DUZE 4DUZI 3B82A 3Q1QA 2E5LE 1ZXNA 2E5LI 1USVA 4DR1E 2X36A 1N34E 4DR1I 5LMNE 1N0UA 4DU8A 1N34I 5LMNI 2UXDE 2UXDI 4IZJA 1VISA 4JYAE 4JYAI 4WUDA 1Y4UA 3B78A 3HJCA 3K17A 4JV5E 3OTOE 1HK7A 4JV5I 3CWVA 2DEJA 3OTOI 3QT8A 3ZKDA 1XMOE 4LFBE 3T1HE 4GKJE 2HKJA 1XMOI 4LFBI 3T1HI 4GKJI 2Z5BA 2UXCE 3JAMQ 2UXCI 2DEIA 3PYGA 2IOPA 4HACB 2O1VA 1B63A 1USUA 1Y4SA 2V8PA 5FLXQ 2GQ0A 1UEKA 1S16A 1I94E 4DR6E 1I94I 4DR6I 3V5RA 2IOQA 4DU7A 2A2DA 5A2QC 5FWKA 1FKAE 4DR5E 1D6TA 2AJ4A 4MYUA 4DR5I 4HYMA 4LFAE 4LFAI 3QT6A 2UU9E 1H72C 3QT7A 2UU9I 4DV5E 4DV5I 1RR9A 2V34A 2NPFA 3M6AA 1PIEA 4KHPE 1MG7A 4KHPI 1Z5BA 4NXME 4LF4E 1H7SA 4NXMI 4HXZA 4LF4I 2XEXA 2E1RA 4B3SE 4LF8E 2Z5CA 4B3SI 4LF8I 5IWAE 5IWAI 3J80Q 3Q6NA 4URLA 1PKPA 2UUCE 2UUCI 4FWGA 4XTJA 1ELOA 1Y6ZA 1N32E 1HNXE 1N32I 2EFGA 1HNXI 2V2VA 2F4VE 2F4VI 1IBLE 4FWDA 1IBLI 1BKNA 3WU5A 4JI2E 2O1WA 3LTOA 4JI2I 1Z0GA 3J81Q 4PRVA 4X64E 3Q6MA 4X64I 3T1YE 1OJ4A 4PRXA 3T1YI 5L3JA 1Z0EA 4JI5E 4K0KE 4JI5I 4K0KI 4USKA 3PRYA 4DV2E 2HFUA 4YHHE 4DV2I 4JI8E 4YHHI 4RPFA 4JI8I 1H74A 2CGEA 4UT4A 4IZJB 2CZ9A 4WUCA 2GS8A 1H73A 1B62A 4IZJD 2UUAE 2UUAI 2X7IA 1FWKA 4LF9E 2R42A 4DPTA 4LF9I 1ZM9A 1Z0CA 1QZRA 4DV1E 2VF3A 4DV1I 2HKEA 2Z5BB 1N0VC 4FW9A 3JAMC 1A6FA 3F0NA 1Z5AA 2BM0A 5A2QQ 1HNZE 3PYFA 4Z7YA 3K85A 4JI4E 4I3HA 1HNZI 1IBME 4JI4I 3PYEA 1IBMI 2PNMA 3ZZUA 4LF5E 4DUYE 4LF5I 4HY1A 4USMA 4DUYI 1PVGA 3WU6A 1EI1A 2CG9A 4OX9E 4OX9I 3V2UC 2V2ZA 4P52A 5FLXC 5IT9Q 1U2RA 5BR8E 2VQEE 5BR8I 2VQEI 4JI3E 4DV6E 4JI3I 4DV6I 4JG4A 2LJPA 1HR0E 2O1UA 3WU3A 1N36E 1HR0I 4M1KA 1H7UA 4N3OA 4UTGA 2UUBE 2BM1A 2UUBI 4LFCE 4LFCI 4B3TE 4DPXA 4B3TI 2VQFE 4JI1E 2VQFI 2V2QA 4JI1I 3B8HA 4JI6E 4FN5A 4JI6I 4LF7E 4LF7I 4NXNE 4IZKA 2Z5CB 1ZXMA 4NXNI 4R1FA 4WUBA 2UXBE 2UXBI 1FJGE 1FJGI 4DR7E 4DR7I 1DARA 3LNUA 4IZKB 1N33E 1N33I 4X66E 1KTVA 4B3RE 4X66I 4B3RI 2J7KA 1KVKA 3ZZTA 2Z5EA 2R3VA 5GMDA 1Z0BA 4X62E 1XNRE 4X62I 1XNRI 3J81C 4DV3E 1ZM3A 4DV7E 4DV3I 4DV7I 2WW4A 4PU9A 4DV4E 2PNLA 4Z7CA 4DV4I 4X65E 3WU4A 4X65I 1FNMA 4ED4A 1S4EA 1NHHA 2HHHE 2HK3A 1KIJA 4AQYE 2HHHI 4HACA 4AQYI 3P06A 4DR4E 3ZM7A 4DR4I 1J5EE 1ZM2A 1J5EI 1Z5CA 3H4LA 4JI7E 2Q2EB 1Z0WA 4JI7I 3J7AG 1IBKE 4P7AA 3QT5A 4DPYA 4B3ME 4JI0E 1K47A 1IBKI 2ZM6E 4FWHA 4JI0I 4B3MI 1HNWE 2ZM6I 1HNWI 2O1TA 3D4JA 4EMDA 1Z0VA 2ZITA 4YY3E 4YY3I 4GKKE 1WUUA 4GKKI 2BV3A 1XMQE 1XMQI 1NHIA 4DPUA 3GONA 3K1JA 1FI4A 1XNQE 1KKHA 4DXLA 1XNQI 2OI2A 1MU5A 1N36I 1RREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0T A;  3PYD A;  4DR2 E;  1FWL A;  4DR2 I;  5IT9 C;  1XHK A;  3ZKB A;  4DPW A;  4LF6 E;  4LF6 I;  4DV0 E;  2A2C A;  4DV0 I;  3J7A M;  1NZ0 A;  3HUL A;  1NHJ A;  3ZZ0 A;  1EA6 A;  1MX0 A;  2HFS A;  4KQV A;  1ZM4 A;  3LPS A;  4ZVI A;  5GME A;  5LL6 R;  3J80 C;  2ZBK B;  4DR3 E;  5LMU E;  1Z59 A;  4DR3 I;  5LMU I;  4MYT A;  2HK2 A;  4DUZ E;  4DUZ I;  3B82 A;  3Q1Q A;  2E5L E;  1ZXN A;  2E5L I;  4DR1 E;  2X36 A;  1N34 E;  4DR1 I;  5LMN E;  1N0U A;  4DU8 A;  1N34 I;  5LMN I;  2UXD E;  2UXD I;  1VIS A;  4JYA E;  4JYA I;  4WUD A;  3B78 A;  3K17 A;  4JV5 E;  3OTO E;  4JV5 I;  3CWV A;  2DEJ A;  3OTO I;  3QT8 A;  3ZKD A;  1XMO E;  4LFB E;  3T1H E;  4GKJ E;  2HKJ A;  1XMO I;  4LFB I;  3T1H I;  4GKJ I;  2UXC E;  3JAM Q;  2UXC I;  2DEI A;  3PYG A;  4HAC B;  1B63 A;  2V8P A;  5FLX Q;  1UEK A;  1S16 A;  1I94 E;  4DR6 E;  1I94 I;  4DR6 I;  3V5R A;  4DU7 A;  2A2D A;  5A2Q C;  1FKA E;  4DR5 E;  1D6T A;  2AJ4 A;  4MYU A;  4DR5 I;  4HYM A;  4LFA E;  4LFA I;  3QT6 A;  2UU9 E;  1H72 C;  3QT7 A;  2UU9 I;  4DV5 E;  4DV5 I;  1RR9 A;  2V34 A;  2NPF A;  3M6A A;  1PIE A;  4KHP E;  1MG7 A;  4KHP I;  1Z5B A;  4NXM E;  4LF4 E;  1H7S A;  4NXM I;  4HXZ A;  4LF4 I;  2XEX A;  2E1R A;  4B3S E;  4LF8 E;  4B3S I;  4LF8 I;  5IWA E;  5IWA I;  3J80 Q;  4URL A;  1PKP A;  2UUC E;  2UUC I;  4FWG A;  4XTJ A;  1ELO A;  1N32 E;  1HNX E;  1N32 I;  2EFG A;  1HNX I;  2V2V A;  2F4V E;  2F4V I;  1IBL E;  4FWD A;  1IBL I;  1BKN A;  3WU5 A;  4JI2 E;  3LTO A;  4JI2 I;  1Z0G A;  3J81 Q;  4PRV A;  4X64 E;  4X64 I;  3T1Y E;  1OJ4 A;  4PRX A;  3T1Y I;  5L3J A;  1Z0E A;  4JI5 E;  4K0K E;  4JI5 I;  4K0K I;  4USK A;  4DV2 E;  2HFU A;  4YHH E;  4DV2 I;  4JI8 E;  4YHH I;  4RPF A;  4JI8 I;  1H74 A;  4UT4 A;  2CZ9 A;  4WUC A;  2GS8 A;  1H73 A;  1B62 A;  2UUA E;  2UUA I;  2X7I A;  1FWK A;  4LF9 E;  2R42 A;  4DPT A;  4LF9 I;  1ZM9 A;  1Z0C A;  1QZR A;  4DV1 E;  2VF3 A;  4DV1 I;  2HKE A;  1N0V C;  4FW9 A;  3JAM C;  1A6F A;  3F0N A;  1Z5A A;  2BM0 A;  5A2Q Q;  1HNZ E;  3PYF A;  4Z7Y A;  4JI4 E;  4I3H A;  1HNZ I;  1IBM E;  4JI4 I;  3PYE A;  1IBM I;  3ZZU A;  4LF5 E;  4DUY E;  4LF5 I;  4HY1 A;  4USM A;  4DUY I;  1PVG A;  3WU6 A;  1EI1 A;  4OX9 E;  4OX9 I;  3V2U C;  2V2Z A;  4P52 A;  5FLX C;  5IT9 Q;  1U2R A;  5BR8 E;  2VQE E;  5BR8 I;  2VQE I;  4JI3 E;  4DV6 E;  4JI3 I;  4DV6 I;  4JG4 A;  2LJP A;  1HR0 E;  3WU3 A;  1N36 E;  1HR0 I;  4M1K A;  1H7U A;  4UTG A;  2UUB E;  2BM1 A;  2UUB I;  4LFC E;  4LFC I;  4B3T E;  4DPX A;  4B3T I;  2VQF E;  4JI1 E;  2VQF I;  2V2Q A;  4JI1 I;  3B8H A;  4JI6 E;  4FN5 A;  4JI6 I;  4LF7 E;  4LF7 I;  4NXN E;  1ZXM A;  4NXN I;  4R1F A;  4WUB A;  2UXB E;  2UXB I;  1FJG E;  1FJG I;  4DR7 E;  4DR7 I;  1DAR A;  3LNU A;  1N33 E;  1N33 I;  4X66 E;  1KTV A;  4B3R E;  4X66 I;  4B3R I;  2J7K A;  1KVK A;  3ZZT A;  2R3V A;  5GMD A;  1Z0B A;  4X62 E;  1XNR E;  4X62 I;  1XNR I;  3J81 C;  4DV3 E;  1ZM3 A;  4DV7 E;  4DV3 I;  4DV7 I;  2WW4 A;  4PU9 A;  4DV4 E;  4Z7C A;  4DV4 I;  4X65 E;  3WU4 A;  4X65 I;  1FNM A;  4ED4 A;  1S4E A;  1NHH A;  2HHH E;  2HK3 A;  1KIJ A;  4AQY E;  2HHH I;  4HAC A;  4AQY I;  4DR4 E;  3ZM7 A;  4DR4 I;  1J5E E;  1ZM2 A;  1J5E I;  1Z5C A;  3H4L A;  4JI7 E;  2Q2E B;  1Z0W A;  4JI7 I;  3J7A G;  1IBK E;  4P7A A;  3QT5 A;  4DPY A;  4B3M E;  4JI0 E;  1K47 A;  1IBK I;  2ZM6 E;  4FWH A;  4JI0 I;  4B3M I;  1HNW E;  2ZM6 I;  1HNW I;  3D4J A;  4EMD A;  1Z0V A;  2ZIT A;  4YY3 E;  4YY3 I;  4GKK E;  1WUU A;  4GKK I;  2BV3 A;  1XMQ E;  1XMQ I;  1NHI A;  4DPU A;  3GON A;  3K1J A;  1FI4 A;  1XNQ E;  1KKH A;  4DXL A;  1XNQ I;  2OI2 A;  1MU5 A;  1N36 I;  1RRE A; 
#chains in the Genus database with same CATH topology
 5C0X F;  1Z0T A;  1Y60 A;  3PYD A;  4DR2 E;  1FWL A;  4DR2 I;  5DNX A;  5IT9 C;  1XHK A;  3ZKB A;  4DPW A;  4LF6 E;  4LF6 I;  4DV0 E;  5C0X A;  2A2C A;  4DV0 I;  3J7A M;  1NZ0 A;  2PO2 B;  5K36 C;  4BA1 B;  3HUL A;  4IFD E;  1NHJ A;  3ZZ0 A;  1EA6 A;  1MX0 A;  1UDQ A;  2HFS A;  3KRN A;  4KQV A;  1ZM4 A;  3LPS A;  4ZVI A;  5EL9 A;  5GME A;  5LL6 R;  3J80 C;  2ZBK B;  4DR3 E;  5LMU E;  1Z59 A;  4DR3 I;  5LMU I;  4MYT A;  2HK2 A;  1E3P A;  4DUZ E;  4DUZ I;  3B82 A;  5DNL A;  3Q1Q A;  2E5L E;  1ZXN A;  2WNR A;  1XXE A;  3UHM A;  2E5L I;  4GQU A;  2C39 B;  2JEB A;  5ELW A;  2VES A;  5C0X E;  1USV A;  4U3D A;  1Y5Y A;  4DR1 E;  2X36 A;  1N34 E;  4DR1 I;  5LMN E;  1N0U A;  4DU8 A;  1N34 I;  5LMN I;  2JE6 B;  2UXD E;  2UXD I;  4IZJ A;  3B4T A;  1VIS A;  4JYA E;  4JYA I;  3P3E A;  4WUD A;  1Y4U A;  3B78 A;  3HJC A;  3K17 A;  4JV5 E;  1P42 A;  3OTO E;  1HK7 A;  4JV5 I;  3CWV A;  2DEJ A;  3OTO I;  3QT8 A;  3ZKD A;  2GO3 A;  1XMO E;  2BR2 A;  4LFB E;  3T1H E;  4GKJ E;  2HKJ A;  4J3D A;  1XMO I;  4LFB I;  3T1H I;  4GKJ I;  2Z5B A;  2UXC E;  3JAM Q;  2UXC I;  2DEI A;  2IER A;  1RHY A;  3PYG A;  5EKW A;  2IOP A;  4HAC B;  2O1V A;  1B63 A;  1USU A;  3P3G A;  4IS9 A;  1Y4S A;  4LCF A;  2V8P A;  5DRO A;  5FLX Q;  2GQ0 A;  4ISA A;  1UEK A;  1S16 A;  4IFD A;  4LCH A;  1I94 E;  4DR6 E;  1I94 I;  5JEA F;  2PO0 B;  3V5R A;  4DR6 I;  2IOQ A;  4DU7 A;  2A2D A;  5A2Q C;  4U3B A;  5FWK A;  1FKA E;  4DR5 E;  1D6T A;  2AJ4 A;  2NN6 F;  3HKM A;  2C38 A;  4MYU A;  4DR5 I;  4HYM A;  4AM3 A;  4LFA E;  3M7N G;  4LFA I;  4FW4 A;  3QT6 A;  2UU9 E;  2WP8 A;  1H72 C;  3QT7 A;  2UU9 I;  4DV5 E;  4MQY A;  4DV5 I;  1RR9 A;  2NN6 A;  2V34 A;  2NPF A;  4OO1 F;  5DRP A;  2BA0 D;  3M6A A;  4FW3 A;  1PIE A;  4KHP E;  1MG7 A;  4LCG A;  4KHP I;  1Z5B A;  2IES A;  4NXM E;  2PO1 A;  4LF4 E;  1H7S A;  4NXM I;  4HXZ A;  4LF4 I;  4OO1 A;  1R6M A;  2XEX A;  2E1R A;  4B3S E;  4LF8 E;  2Z5C A;  4B3S I;  4LF8 I;  4LPF A;  5IWA E;  5IWA I;  3M85 D;  3J80 Q;  3Q6N A;  4IFD C;  4URL A;  5C0X B;  1PKP A;  2UUC E;  3M85 G;  2UUC I;  2PO1 B;  4FWG A;  5C0X D;  4XTJ A;  1VI7 A;  1ELO A;  5JEA E;  1Y6Z A;  1N32 E;  1HNX E;  1N32 I;  3NZK A;  2EFG A;  1HNX I;  2V2V A;  2F4V E;  2NN6 E;  2F4V I;  1IBL E;  4FWD A;  1IBL I;  4MU3 A;  1BKN A;  3WU5 A;  4JI2 E;  2O1W A;  3LTO A;  2AE8 A;  4JI2 I;  3L7Z A;  1Z0G A;  3J81 Q;  5C0X C;  1OYP A;  4PRV A;  4OO1 E;  4X64 E;  3Q6M A;  4X64 I;  3T1Y E;  1OJ4 A;  4PRX A;  2WNR B;  3T1Y I;  5L3J A;  1Z0E A;  2C37 A;  4JI5 E;  4K0K E;  2JEB B;  4JI5 I;  4K0K I;  4QNJ A;  4USK A;  3PRY A;  4DV2 E;  2HFU A;  4YHH E;  4DV2 I;  4JI8 E;  4YHH I;  4RPF A;  4JI8 I;  3GCM A;  1H74 A;  2CGE A;  4UT4 A;  4IZJ B;  2CZ9 A;  4WUC A;  2GS8 A;  1H73 A;  1B62 A;  4IZJ D;  4MU0 A;  1E3H A;  2UUA E;  2UUA I;  2X7I A;  1FWK A;  4LF9 E;  2R42 A;  4DPT A;  4LF9 I;  1ZM9 A;  1Z0C A;  2PNZ A;  1QZR A;  2BR2 B;  4DV1 E;  2VF3 A;  4DV1 I;  2HKE A;  2Z5B B;  1R6L A;  2BA1 D;  1N0V C;  4FW9 A;  5K36 F;  3CDI A;  1UDS A;  3JAM C;  1A6F A;  4FW6 A;  3F0N A;  1Z5A A;  2BM0 A;  5A2Q Q;  1HNZ E;  3PYF A;  4Z7Y A;  3K85 A;  3P3C A;  4I3H A;  2PNZ B;  1HNZ I;  1IBM E;  4JI4 E;  4JI4 I;  3PYE A;  1IBM I;  2PNM A;  3ZZU A;  4LF5 E;  4DUY E;  4LF5 I;  4HY1 A;  4BA2 A;  4USM A;  4DUY I;  5K36 A;  1UDN A;  1PVG A;  2JEA A;  3WU6 A;  2GO4 A;  1EI1 A;  2CG9 A;  4OX9 E;  5JEA A;  4OX9 I;  3V2U C;  4IFD B;  2V2Z A;  3PS1 A;  4P52 A;  5FLX C;  5IT9 Q;  4IFD D;  1U2R A;  5BR8 E;  2VQE E;  5BR8 I;  2VQE I;  3GME A;  2C38 B;  4JI3 E;  4DV6 E;  4JI3 I;  2JEA B;  4FW5 A;  3GLL A;  4DV6 I;  4JG4 A;  2LJP A;  1HR0 E;  2O1U A;  3WU3 A;  5JEA B;  1N36 E;  2BA0 G;  2WP8 B;  3CDJ A;  2CVE A;  4OKG A;  4M1K A;  1HR0 I;  1H7U A;  2PO2 A;  4N3O A;  4UTG A;  4BA1 A;  5JEA D;  2UUB E;  2BM1 A;  2NN6 B;  2UUB I;  4LFC E;  4LFC I;  4B3T E;  4DPX A;  4B3T I;  2VQF E;  2NN6 D;  4JI1 E;  2VQF I;  2V2Q A;  4JI1 I;  5K36 E;  3B8H A;  4JI6 E;  4FN5 A;  4JI6 I;  4OO1 B;  4LF7 E;  4LF7 I;  4NXN E;  4IZK A;  2Z5C B;  1ZXM A;  4NXN I;  4R1F A;  3PS3 A;  4WUB A;  5JEA C;  2UXB E;  4OO1 D;  2UXB I;  4NBQ A;  1FJG E;  1FJG I;  4DR7 E;  4DR7 I;  2NN6 C;  1DAR A;  2C39 A;  3LNU A;  3H1C A;  4IZK B;  1N33 E;  2JE6 A;  1N33 I;  4X66 E;  1KTV A;  4B3R E;  4X66 I;  4B3R I;  2J7K A;  4OO1 C;  1KVK A;  3ZZT A;  2Z5E A;  2R3V A;  5GMD A;  1Z0B A;  3L7Z B;  4X62 E;  1XNR E;  4X62 I;  1XNR I;  1YH8 A;  3PS2 A;  3J81 C;  5DRR A;  4DV3 E;  1ZM3 A;  4DV7 E;  4DV3 I;  2JT2 A;  4DV7 I;  2WW4 A;  4PU9 A;  4DV4 E;  2C37 B;  4MU4 A;  2PNL A;  4Z7C A;  4DV4 I;  4X65 E;  3WU4 A;  1OYR A;  4X65 I;  1FNM A;  4ED4 A;  4MDT A;  4MU1 A;  3U1Y A;  1S4E A;  1NHH A;  2HHH E;  2HK3 A;  1KIJ A;  4AQY E;  2HHH I;  4HAC A;  4AQY I;  3P06 A;  4AIM A;  4DR4 E;  3ZM7 A;  4DR4 I;  3P76 A;  1UDO A;  1J5E E;  1ZM2 A;  1J5E I;  1Z5C A;  3H4L A;  4JI7 E;  2Q2E B;  1Z0W A;  4JI7 I;  3J7A G;  1IBK E;  4P7A A;  3QT5 A;  4DPY A;  4B3M E;  4JI0 E;  1K47 A;  1IBK I;  2ZM6 E;  2J65 A;  4FWH A;  4JI0 I;  4B3M I;  2ZM6 I;  1HNW E;  1HNW I;  2BA1 G;  2O1T A;  3D4J A;  3U1K A;  4EMD A;  1YHC A;  5DRQ A;  2F1D A;  1Z0V A;  4OZE A;  2PO0 A;  4IFD F;  2ZIT A;  4LOM A;  4YY3 E;  4YY3 I;  4GKK E;  4QNK A;  1WUU A;  4GKK I;  2O3Z A;  4AID A;  2BV3 A;  1XMQ E;  1XMQ I;  1OYS A;  1NHI A;  4DPU A;  4FW7 A;  3GON A;  3K1J A;  1FI4 A;  1XNQ E;  3M7N D;  1KKH A;  4DXL A;  1XNQ I;  4BA2 B;  5K36 B;  2OI2 A;  1MU5 A;  3DD6 A;  5K36 D;  1N36 I;  1RRE A; 
#chains in the Genus database with same CATH homology
 1Z0T A;  3PYD A;  4DR2 E;  1FWL A;  4DR2 I;  5IT9 C;  1XHK A;  3ZKB A;  4DPW A;  4LF6 E;  4LF6 I;  4DV0 E;  2A2C A;  4DV0 I;  3J7A M;  1NZ0 A;  3HUL A;  1NHJ A;  3ZZ0 A;  1EA6 A;  1MX0 A;  2HFS A;  4KQV A;  1ZM4 A;  3LPS A;  4ZVI A;  5GME A;  5LL6 R;  3J80 C;  2ZBK B;  4DR3 E;  5LMU E;  1Z59 A;  4DR3 I;  5LMU I;  4MYT A;  2HK2 A;  4DUZ E;  4DUZ I;  3B82 A;  3Q1Q A;  2E5L E;  1ZXN A;  2E5L I;  1USV A;  4DR1 E;  2X36 A;  1N34 E;  4DR1 I;  5LMN E;  1N0U A;  4DU8 A;  1N34 I;  5LMN I;  2UXD E;  2UXD I;  4IZJ A;  1VIS A;  4JYA E;  4JYA I;  4WUD A;  1Y4U A;  3B78 A;  3HJC A;  3K17 A;  4JV5 E;  3OTO E;  1HK7 A;  4JV5 I;  3CWV A;  2DEJ A;  3OTO I;  3QT8 A;  3ZKD A;  1XMO E;  4LFB E;  3T1H E;  4GKJ E;  2HKJ A;  1XMO I;  4LFB I;  3T1H I;  4GKJ I;  2Z5B A;  2UXC E;  3JAM Q;  2UXC I;  2DEI A;  3PYG A;  2IOP A;  4HAC B;  2O1V A;  1B63 A;  1USU A;  1Y4S A;  2V8P A;  5FLX Q;  2GQ0 A;  1UEK A;  1S16 A;  1I94 E;  4DR6 E;  1I94 I;  4DR6 I;  3V5R A;  2IOQ A;  4DU7 A;  2A2D A;  5A2Q C;  5FWK A;  1FKA E;  4DR5 E;  1D6T A;  2AJ4 A;  4MYU A;  4DR5 I;  4HYM A;  4LFA E;  4LFA I;  3QT6 A;  2UU9 E;  1H72 C;  3QT7 A;  2UU9 I;  4DV5 E;  4DV5 I;  1RR9 A;  2V34 A;  2NPF A;  3M6A A;  1PIE A;  4KHP E;  1MG7 A;  4KHP I;  1Z5B A;  4NXM E;  4LF4 E;  1H7S A;  4NXM I;  4HXZ A;  4LF4 I;  2XEX A;  2E1R A;  4B3S E;  4LF8 E;  2Z5C A;  4B3S I;  4LF8 I;  5IWA E;  5IWA I;  3J80 Q;  3Q6N A;  4URL A;  1PKP A;  2UUC E;  2UUC I;  4FWG A;  4XTJ A;  1ELO A;  1Y6Z A;  1N32 E;  1HNX E;  1N32 I;  2EFG A;  1HNX I;  2V2V A;  2F4V E;  2F4V I;  1IBL E;  4FWD A;  1IBL I;  1BKN A;  3WU5 A;  4JI2 E;  2O1W A;  3LTO A;  4JI2 I;  1Z0G A;  3J81 Q;  4PRV A;  4X64 E;  3Q6M A;  4X64 I;  3T1Y E;  1OJ4 A;  4PRX A;  3T1Y I;  5L3J A;  1Z0E A;  4JI5 E;  4K0K E;  4JI5 I;  4K0K I;  4USK A;  3PRY A;  4DV2 E;  2HFU A;  4YHH E;  4DV2 I;  4JI8 E;  4YHH I;  4RPF A;  4JI8 I;  1H74 A;  2CGE A;  4UT4 A;  4IZJ B;  2CZ9 A;  4WUC A;  2GS8 A;  1H73 A;  1B62 A;  4IZJ D;  2UUA E;  2UUA I;  2X7I A;  1FWK A;  4LF9 E;  2R42 A;  4DPT A;  4LF9 I;  1ZM9 A;  1Z0C A;  1QZR A;  4DV1 E;  2VF3 A;  4DV1 I;  2HKE A;  2Z5B B;  1N0V C;  4FW9 A;  3JAM C;  1A6F A;  3F0N A;  1Z5A A;  2BM0 A;  5A2Q Q;  1HNZ E;  3PYF A;  4Z7Y A;  3K85 A;  4JI4 E;  4I3H A;  1HNZ I;  1IBM E;  4JI4 I;  3PYE A;  1IBM I;  2PNM A;  3ZZU A;  4LF5 E;  4DUY E;  4LF5 I;  4HY1 A;  4USM A;  4DUY I;  1PVG A;  3WU6 A;  1EI1 A;  2CG9 A;  4OX9 E;  4OX9 I;  3V2U C;  2V2Z A;  4P52 A;  5FLX C;  5IT9 Q;  1U2R A;  5BR8 E;  2VQE E;  5BR8 I;  2VQE I;  4JI3 E;  4DV6 E;  4JI3 I;  4DV6 I;  4JG4 A;  2LJP A;  1HR0 E;  2O1U A;  3WU3 A;  1N36 E;  1HR0 I;  4M1K A;  1H7U A;  4N3O A;  4UTG A;  2UUB E;  2BM1 A;  2UUB I;  4LFC E;  4LFC I;  4B3T E;  4DPX A;  4B3T I;  2VQF E;  4JI1 E;  2VQF I;  2V2Q A;  4JI1 I;  3B8H A;  4JI6 E;  4FN5 A;  4JI6 I;  4LF7 E;  4LF7 I;  4NXN E;  4IZK A;  2Z5C B;  1ZXM A;  4NXN I;  4R1F A;  4WUB A;  2UXB E;  2UXB I;  1FJG E;  1FJG I;  4DR7 E;  4DR7 I;  1DAR A;  3LNU A;  4IZK B;  1N33 E;  1N33 I;  4X66 E;  1KTV A;  4B3R E;  4X66 I;  4B3R I;  2J7K A;  1KVK A;  3ZZT A;  2Z5E A;  2R3V A;  5GMD A;  1Z0B A;  4X62 E;  1XNR E;  4X62 I;  1XNR I;  3J81 C;  4DV3 E;  1ZM3 A;  4DV7 E;  4DV3 I;  4DV7 I;  2WW4 A;  4PU9 A;  4DV4 E;  2PNL A;  4Z7C A;  4DV4 I;  4X65 E;  3WU4 A;  4X65 I;  1FNM A;  4ED4 A;  1S4E A;  1NHH A;  2HHH E;  2HK3 A;  1KIJ A;  4AQY E;  2HHH I;  4HAC A;  4AQY I;  3P06 A;  4DR4 E;  3ZM7 A;  4DR4 I;  1J5E E;  1ZM2 A;  1J5E I;  1Z5C A;  3H4L A;  4JI7 E;  2Q2E B;  1Z0W A;  4JI7 I;  3J7A G;  1IBK E;  4P7A A;  3QT5 A;  4DPY A;  4B3M E;  4JI0 E;  1K47 A;  1IBK I;  2ZM6 E;  4FWH A;  4JI0 I;  4B3M I;  1HNW E;  2ZM6 I;  1HNW I;  2O1T A;  3D4J A;  4EMD A;  1Z0V A;  2ZIT A;  4YY3 E;  4YY3 I;  4GKK E;  1WUU A;  4GKK I;  2BV3 A;  1XMQ E;  1XMQ I;  1NHI A;  4DPU A;  3GON A;  3K1J A;  1FI4 A;  1XNQ E;  1KKH A;  4DXL A;  1XNQ I;  2OI2 A;  1MU5 A;  1N36 I;  1RRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...