1IBKI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibkI00
4K0KI 4WUCA 1Z59A 1IBLE 4DR1I 4DV3E 1Z0VA 4I3HA 2UUCE 2DEIA 4USMA 2R42A 3V5RA 5L3JA 4WUBA 1VISA 4B3TE 4DR6E 5GMEA 3H4LA 3OTOE 4OX9E 2VQFI 2V2ZA 3HULA 4UTGA 1Z5AA 5IT9C 2UUBI 4LF9E 5GMDA 2ZITA 5BR8E 4DR5E 4YHHI 2CZ9A 4JI8I 1HNWE 4JV5E 4DXLA 2ZM6E 4P52A 1XMQE 1ZM9A 2E5LE 4DV5I 4DUYI 4LF4E 1HNXI 4Z7CA 5A2QQ 4WUDA 3T1HE 1K47A 4LFAI 2UUAE 1I94I 3ZKDA 4JI6I 5IWAI 4JI2E 3J7AM 4KQVA 3GONA 4JG4A 4DV2E 4YY3E 1ZM2A 3PYFA 2V2VA 2NPFA 3K17A 4X66E 4DUZE 4DPUA 4LFCI 3B82A 4X62I 3B8HA 4M1KA 2BV3A 3J81C 4LF5I 4LF7E 1BKNA 5LMNE 1N36E 4NXMI 4DR3I 4DR4E 4LF6E 4JI7E 5FLXC 2V8PA 4JI1I 2UXCI 4DV3I 1H72C 4HY1A 1Z5BA 4GKKE 2X7IA 4EMDA 1EA6A 1ZM3A 4FW9A 4DU7A 4X65I 2HHHI 3PYDA 4B3SE 4JYAI 4DR2I 4DR6I 1IBMI 3J80Q 2LJPA 1N34E 4OX9I 1FWLA 1N0VC 1XNRE 5LMUI 4DV1E 1EI1A 1FJGE 1H73A 4DR5I 1MX0A 4DPWA 1MG7A 2UXBE 4HACA 2UU9I 4FWHA 4DV0I 5IT9Q 4KHPE 2E5LI 1ELOA 4JI4I 3J80C 1IBKE 1H74A 3WU4A 1NHHA 4JI3E 1Z0CA 2EFGA 3V2UC 1KIJA 4LF8I 1FKAE 4LFBI 1H7UA 3QT8A 3T1HI 1N33I 1FI4A 3M6AA 1QZRA 4JI0E 1DARA 1N0UA 1J5EI 1B62A 2V2QA 4HACB 4DV4E 4GKJE 1H7SA 4UT4A 4AQYI 1PVGA 4DV7E 4DU8A 2DEJA 4DPXA 3T1YI 1HR0E 2UXDI 4DV6E 3WU6A 4JI5E 4JI7I 3J81Q 4X64E 1N32E 4DR1E 2HK3A 4NXNI 4ZVIA 3LTOA 5FLXQ 1MU5A 1Z0EA 3ZZUA 4DPTA 4XTJA 1S4EA 2VQFE 1XNQI 2UUBE 2WW4A 4ED4A 3ZZTA 4YHHE 4JI8E 4DR7E 2R3VA 4KHPI 1IBLI 1FWKA 4P7AA 3Q1QA 1FNMA 3ZZ0A 2UUCI 4DV5E 3QT6A 4DUYE 4B3RE 4B3TI 3LNUA 3OTOI 1KKHA 4B3ME 4LF9I 1ZXMA 2X36A 4LFAE 2OI2A 1I94E 5IWAE 3ZKBA 1NHIA 5BR8I 1HNWI 4GKJI 2HFSA 4JV5I 4MYTA 2ZM6I 4PRVA 1XMQI 1KVKA 1ZXNA 4LFCE 4USKA 4X62E 2VQEE 1UEKA 2V34A 4LF4I 4PU9A 1ZM4A 4NXME 1D6TA 1A6FA 4DR3E 4URLA 2AJ4A 3K1JA 4X64I 1N32I 1Z0BA 4JI1E 2UUAI 2UXCE 1U2RA 2HK2A 1HNZE 2F4VE 4JI2I 3B78A 1NZ0A 1XMOE 4X65E 2HHHE 4DV2I 4YY3I 3J7AG 4JYAE 4X66I 4MYUA 4DUZI 3F0NA 4DR2E 1IBME 3PYGA 5LMUE 2HKJA 4LF7I 2HFUA 5LMNI 1N36I 2HKEA 4R1FA 4DR4I 3D4JA 4LF6I 4FWDA 4K0KE 4DR7I 1KTVA 2UU9E 4DV0E 3CWVA 1Z5CA 4GKKI 4Z7YA 4PRXA 4JI4E 4RPFA 4B3SI 1XHKA 3ZM7A 4B3RI 4FN5A 2XEXA 4LF8E 1NHJA 1N34I 4B3MI 1XNRI 1OJ4A 4LFBE 2A2DA 4DV1I 1Z0GA 1N33E 1FJGI 4DPYA 2Q2EB 2ZBKB 2E1RA 2UXBI 2J7KA 1J5EE 2BM0A 1B63A 1PIEA 4FWGA 4AQYE 3PYEA 3WU5A 1IBKI 2GS8A 3JAMQ 4JI3I 5A2QC 2BM1A 2VQEI 3QT7A 3T1YE 1HNXE 2UXDE 3LPSA 4HYMA 3QT5A 2VF3A 1Z0TA 1HNZI 2F4VI 2A2CA 4JI6E 1RREA 4NXNE 4JI0I 1XMOI 3JAMC 3WU3A 1RR9A 4DV4I 4DV7I 5LL6R 4LF5E 1PKPA 1XNQE 4HXZA 1WUUA 4DV6I 1HR0I 1S16A 4JI5I 1Z0WA
chains in the Genus database with same CATH superfamily
4K0KI 1UDQA 4FW7A 2AE8A 4IS9A 4WUCA 1Z59A 2PNMA 1IBLE 4DR1I 4DV3E 1Z0VA 4I3HA 2UUCE 2DEIA 4USMA 1OYSA 2R42A 3V5RA 5L3JA 4WUBA 1VISA 4B3TE 4DR6E 5GMEA 3H4LA 4MU4A 3OTOE 4OX9E 2VQFI 2V2ZA 3HULA 3PS2A 1Z5AA 4UTGA 5IT9C 2UUBI 4LF9E 3Q6MA 2PNZB 4QNJA 5GMDA 3P76A 2ZITA 5BR8E 4DR5E 1OYPA 4YHHI 2CZ9A 4JI8I 1HNWE 1Y6ZA 3HJCA 4JV5E 3P06A 4DXLA 2ZM6E 4P52A 1XMQE 1ZM9A 2E5LE 2O1VA 2CVEA 4DV5I 4DUYI 2NN6D 4LF4E 1HNXI 1E3HA 5DNXA 4Z7CA 5A2QQ 3M85G 4WUDA 3T1HE 1K47A 4LFAI 2UUAE 1I94I 3ZKDA 4JI6I 5IWAI 4JI2E 4BA1B 3J7AM 4OZEA 4KQVA 3GONA 4JG4A 3KRNA 2WNRB 2O1UA 4DV2E 4YY3E 1ZM2A 4IFDA 3PYFA 2V2VA 2NPFA 3K17A 2PO2B 4X66E 4DUZE 4DPUA 4LFCI 3DD6A 3B82A 4X62I 2IOPA 3B8HA 4M1KA 3P3GA 2BV3A 2GQ0A 3J81C 4LF5I 4LF7E 4OO1A 1BKNA 5LMNE 1N36E 4NXMI 4IZKA 3M7ND 4DR3I 4LCHA 4AM3A 4DR4E 4LF6E 4JI7E 5FLXC 4MQYA 2V8PA 4JI1I 2UXCI 1R6MA 4DV3I 1H72C 4HY1A 1Z5BA 4GKKE 2NN6C 2X7IA 4EMDA 2Z5CB 1EA6A 1ZM3A 5C0XB 4FW9A 4DU7A 4X65I 2HHHI 2C39A 4LCFA 3P3EA 3PYDA 4B3SE 4JYAI 4IFDB 1R6LA 4DR2I 4DR6I 1UDSA 4IZJA 2PNLA 1IBMI 3J80Q 2LJPA 1N34E 2JEAA 2BR2A 4OX9I 1FWLA 1N0VC 1XNRE 5LMUI 4DV1E 1EI1A 4OO1B 4FW6A 1FJGE 1H73A 2O1WA 4IZKB 4DR5I 3CDJA 1MX0A 4DPWA 1MG7A 2UXBE 4HACA 2UU9I 4FWHA 4DV0I 3GMEA 3PS1A 5IT9Q 2GO4A 4LCGA 4AIDA 4KHPE 1HK7A 2E5LI 1ELOA 4JI4I 3J80C 1IBKE 1H74A 3WU4A 1NHHA 4JI3E 1Z0CA 2C39B 2GO3A 2EFGA 3V2UC 4LPFA 1KIJA 4LF8I 4IZJB 4AIMA 1FKAE 5DRQA 4LFBI 2JEAB 1H7UA 2BR2B 3QT8A 3T1HI 2JE6A 5FWKA 1N33I 5JEAA 3L7ZA 2Z5EA 1FI4A 1YH8A 2C37A 3M6AA 1QZRA 2BA1G 3UHMA 4JI0E 1DARA 1N0UA 1J5EI 1B62A 2V2QA 4HACB 4DV4E 4GKJE 1H7SA 4UT4A 4AQYI 5DRPA 1PVGA 4DV7E 5EKWA 4DU8A 2DEJA 4DPXA 3T1YI 1Y60A 5K36A 1HR0E 2CGEA 4DV6E 2UXDI 3WU6A 4JI5E 2WP8A 4JI7I 3J81Q 3U1YA 4X64E 1N32E 5JEAB 4DR1E 3P3CA 4FW4A 2HK3A 2C37B 4NXNI 4ZVIA 2NN6A 3LTOA 3NZKA 5FLXQ 1MU5A 2BA0G 5C0XD 5DRRA 1Z0EA 3ZZUA 5C0XE 3PRYA 4DPTA 2O1TA 4XTJA 1S4EA 1UDNA 3K85A 2IERA 4FW5A 2VQFE 4MU1A 4IFDE 1XNQI 2UUBE 5K36B 2WW4A 4ED4A 2WP8B 3ZZTA 4YHHE 2JT2A 4MU3A 2PO0A 4JI8E 4OO1E 4DR7E 2R3VA 5C0XF 1IBLI 4KHPI 1FWKA 1UDOA 4P7AA 1VI7A 3Q1QA 3HKMA 4IFDF 1FNMA 2NN6B 3ZZ0A 1E3PA 2IOQA 4DV5E 2UUCI 3QT6A 4DUYE 4B3RE 5DNLA 4B3TI 4OO1F 3LNUA 4QNKA 3OTOI 1KKHA 4B3ME 2C38A 4IZJD 4LF9I 1ZXMA 2IESA 2X36A 3M85D 2VESA 4LFAE 2OI2A 1I94E 5C0XC 5IWAE 3ZKBA 1NHIA 5BR8I 3U1KA 4IFDC 1HNWI 4GKJI 2HFSA 5ELWA 4JV5I 4MYTA 2ZM6I 4PRVA 1XMQI 1KVKA 1ZXNA 4LFCE 4USKA 4X62E 4OO1C 2VQEE 1UEKA 2V34A 4LF4I 4PU9A 1ZM4A 4NXME 1D6TA 1A6FA 4DR3E 4URLA 2AJ4A 3K1JA 3B4TA 2C38B 4X64I 1N32I 1Z0BA 4JI1E 2UUAI 2UXCE 1U2RA 2HK2A 1HNZE 2F4VE 4JI2I 3B78A 5JEAD 4ISAA 1NZ0A 2JEBA 4X65E 1XMOE 2HHHE 4DV2I 4YY3I 5JEAE 3J7AG 4JYAE 4X66I 4MYUA 4OKGA 4DUZI 3F0NA 4DR2E 2Z5BA 1IBME 3PYGA 5LMUE 2HKJA 4LF7I 2HFUA 1USUA 5LMNI 1N36I 3M7NG 2HKEA 2F1DA 4R1FA 4BA1A 4DR4I 1Y4UA 5JEAF 3D4JA 4LF6I 2WNRA 4FWDA 5DROA 4K0KE 2O3ZA 5K36D 1USVA 4DR7I 1KTVA 2UU9E 4DV0E 2PO2A 2JE6B 5K36E 3CWVA 1Z5CA 4GKKI 4Z7YA 3L7ZB 4PRXA 4JI4E 3Q6NA 4RPFA 1XXEA 4B3SI 1XHKA 2JEBB 3ZM7A 4B3RI 4U3BA 4FN5A 2XEXA 4LF8E 2NN6E 1NHJA 1N34I 2Z5BB 1OYRA 4B3MI 1OJ4A 1XNRI 2PO1A 4IFDD 4LFBE 2A2DA 5K36F 5JEAC 4DV1I 1Z0GA 2CG9A 1N33E 1FJGI 4DPYA 2Q2EB 2Z5CA 2ZBKB 4J3DA 5C0XA 2E1RA 4OO1D 2BA1D 2UXBI 2J7KA 4MDTA 1J5EE 2BM0A 1B63A 1PIEA 2NN6F 3H1CA 4BA2A 4FWGA 4AQYE 3PYEA 3WU5A 4NBQA 1IBKI 2GS8A 4U3DA 3JAMQ 5A2QC 4JI3I 4FW3A 2BM1A 5K36C 2VQEI 1Y5YA 3QT7A 3T1YE 1P42A 1HNXE 2UXDE 3LPSA 1Y4SA 4HYMA 3QT5A 2PO1B 2VF3A 1Z0TA 1RHYA 1HNZI 2F4VI 2A2CA 3PS3A 4JI6E 1RREA 4NXNE 4JI0I 4MU0A 1XMOI 3JAMC 3WU3A 1RR9A 3GLLA 4DV4I 4LOMA 2PO0B 3CDIA 4GQUA 2BA0D 4BA2B 5EL9A 3GCMA 4DV7I 1YHCA 5LL6R 4LF5E 1PKPA 1XNQE 2PNZA 4HXZA 1WUUA 4DV6I 2J65A 1HR0I 1S16A 4JI5I 1Z0WA 4N3OA
chains in the Genus database with same CATH topology
4K0KI 4WUCA 1Z59A 2PNMA 1IBLE 4DR1I 4DV3E 1Z0VA 4I3HA 2UUCE 2DEIA 4USMA 2R42A 3V5RA 5L3JA 4WUBA 1VISA 4B3TE 4DR6E 5GMEA 3H4LA 3OTOE 4OX9E 2VQFI 2V2ZA 3HULA 4UTGA 1Z5AA 5IT9C 2UUBI 4LF9E 3Q6MA 5GMDA 2ZITA 5BR8E 4DR5E 4YHHI 2CZ9A 4JI8I 1HNWE 1Y6ZA 3HJCA 4JV5E 3P06A 4DXLA 2ZM6E 4P52A 1XMQE 1ZM9A 2E5LE 2O1VA 4DV5I 4DUYI 4LF4E 1HNXI 4Z7CA 5A2QQ 4WUDA 3T1HE 1K47A 4LFAI 2UUAE 1I94I 3ZKDA 4JI6I 5IWAI 4JI2E 3J7AM 4KQVA 3GONA 4JG4A 2O1UA 4DV2E 4YY3E 1ZM2A 3PYFA 2V2VA 2NPFA 3K17A 4X66E 4DUZE 4DPUA 4LFCI 3B82A 4X62I 2IOPA 3B8HA 4M1KA 2BV3A 2GQ0A 3J81C 4LF5I 4LF7E 1BKNA 5LMNE 1N36E 4NXMI 4IZKA 4DR3I 4DR4E 4LF6E 4JI7E 5FLXC 2V8PA 4JI1I 2UXCI 4DV3I 1H72C 4HY1A 1Z5BA 4GKKE 2X7IA 4EMDA 2Z5CB 1EA6A 1ZM3A 4FW9A 4DU7A 4X65I 2HHHI 3PYDA 4B3SE 4JYAI 4DR2I 4DR6I 4IZJA 2PNLA 1IBMI 3J80Q 2LJPA 1N34E 4OX9I 1FWLA 1N0VC 1XNRE 5LMUI 4DV1E 1EI1A 1FJGE 1H73A 2O1WA 4IZKB 4DR5I 1MX0A 4DPWA 1MG7A 2UXBE 4HACA 2UU9I 4FWHA 4DV0I 5IT9Q 4KHPE 1HK7A 2E5LI 1ELOA 4JI4I 3J80C 1IBKE 1H74A 3WU4A 1NHHA 4JI3E 1Z0CA 2EFGA 3V2UC 1KIJA 4LF8I 4IZJB 1FKAE 4LFBI 1H7UA 3QT8A 3T1HI 5FWKA 1N33I 2Z5EA 1FI4A 3M6AA 1QZRA 4JI0E 1DARA 1N0UA 1J5EI 1B62A 2V2QA 4HACB 4DV4E 4GKJE 1H7SA 4UT4A 4AQYI 1PVGA 4DV7E 4DU8A 2DEJA 4DPXA 3T1YI 1HR0E 2CGEA 4DV6E 2UXDI 3WU6A 4JI5E 4JI7I 3J81Q 4X64E 1N32E 4DR1E 2HK3A 4NXNI 4ZVIA 3LTOA 5FLXQ 1MU5A 1Z0EA 3ZZUA 3PRYA 4DPTA 2O1TA 4XTJA 1S4EA 3K85A 2VQFE 1XNQI 2UUBE 2WW4A 4ED4A 3ZZTA 4YHHE 4JI8E 4DR7E 2R3VA 4KHPI 1IBLI 1FWKA 4P7AA 3Q1QA 1FNMA 3ZZ0A 2UUCI 2IOQA 4DV5E 3QT6A 4DUYE 4B3RE 4B3TI 3LNUA 3OTOI 1KKHA 4B3ME 4IZJD 4LF9I 1ZXMA 2X36A 4LFAE 2OI2A 1I94E 5IWAE 3ZKBA 1NHIA 5BR8I 1HNWI 4GKJI 2HFSA 4JV5I 4MYTA 2ZM6I 4PRVA 1XMQI 1KVKA 1ZXNA 4LFCE 4USKA 4X62E 2VQEE 1UEKA 2V34A 4LF4I 4PU9A 1ZM4A 4NXME 1D6TA 1A6FA 4DR3E 4URLA 2AJ4A 3K1JA 4X64I 1N32I 1Z0BA 4JI1E 2UUAI 2UXCE 1U2RA 2HK2A 1HNZE 2F4VE 4JI2I 3B78A 1NZ0A 1XMOE 4X65E 2HHHE 4DV2I 4YY3I 3J7AG 4JYAE 4X66I 4MYUA 4DUZI 3F0NA 4DR2E 2Z5BA 1IBME 3PYGA 5LMUE 2HKJA 4LF7I 2HFUA 1USUA 5LMNI 1N36I 2HKEA 4R1FA 4DR4I 1Y4UA 3D4JA 4LF6I 4FWDA 4K0KE 1USVA 4DR7I 1KTVA 2UU9E 4DV0E 3CWVA 1Z5CA 4GKKI 4Z7YA 4PRXA 4JI4E 3Q6NA 4RPFA 4B3SI 1XHKA 3ZM7A 4B3RI 4FN5A 2XEXA 4LF8E 1NHJA 1N34I 2Z5BB 4B3MI 1XNRI 1OJ4A 4LFBE 2A2DA 4DV1I 1Z0GA 2CG9A 1N33E 1FJGI 4DPYA 2Q2EB 2Z5CA 2ZBKB 2E1RA 2UXBI 2J7KA 1J5EE 2BM0A 1B63A 1PIEA 4FWGA 4AQYE 3PYEA 3WU5A 1IBKI 2GS8A 3JAMQ 4JI3I 5A2QC 2BM1A 2VQEI 3QT7A 3T1YE 1HNXE 2UXDE 3LPSA 1Y4SA 4HYMA 3QT5A 2VF3A 1Z0TA 1HNZI 2F4VI 2A2CA 4JI6E 1RREA 4NXNE 4JI0I 1XMOI 3JAMC 3WU3A 1RR9A 4DV4I 4DV7I 5LL6R 4LF5E 1PKPA 1XNQE 4HXZA 1WUUA 4DV6I 1HR0I 1S16A 4JI5I 1Z0WA 4N3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K I;  4WUC A;  1Z59 A;  1IBL E;  4DR1 I;  4DV3 E;  1Z0V A;  4I3H A;  2UUC E;  2DEI A;  4USM A;  2R42 A;  3V5R A;  5L3J A;  4WUB A;  1VIS A;  4B3T E;  4DR6 E;  5GME A;  3H4L A;  3OTO E;  4OX9 E;  2VQF I;  2V2Z A;  3HUL A;  4UTG A;  1Z5A A;  5IT9 C;  2UUB I;  4LF9 E;  5GMD A;  2ZIT A;  5BR8 E;  4DR5 E;  4YHH I;  2CZ9 A;  4JI8 I;  1HNW E;  4JV5 E;  4DXL A;  2ZM6 E;  4P52 A;  1XMQ E;  1ZM9 A;  2E5L E;  4DV5 I;  4DUY I;  4LF4 E;  1HNX I;  4Z7C A;  5A2Q Q;  4WUD A;  3T1H E;  1K47 A;  4LFA I;  2UUA E;  1I94 I;  3ZKD A;  4JI6 I;  5IWA I;  4JI2 E;  3J7A M;  4KQV A;  3GON A;  4JG4 A;  4DV2 E;  4YY3 E;  1ZM2 A;  3PYF A;  2V2V A;  2NPF A;  3K17 A;  4X66 E;  4DUZ E;  4DPU A;  4LFC I;  3B82 A;  4X62 I;  3B8H A;  4M1K A;  2BV3 A;  3J81 C;  4LF5 I;  4LF7 E;  1BKN A;  5LMN E;  1N36 E;  4NXM I;  4DR3 I;  4DR4 E;  4LF6 E;  4JI7 E;  5FLX C;  2V8P A;  4JI1 I;  2UXC I;  4DV3 I;  1H72 C;  4HY1 A;  1Z5B A;  4GKK E;  2X7I A;  4EMD A;  1EA6 A;  1ZM3 A;  4FW9 A;  4DU7 A;  4X65 I;  2HHH I;  3PYD A;  4B3S E;  4JYA I;  4DR2 I;  4DR6 I;  1IBM I;  3J80 Q;  2LJP A;  1N34 E;  4OX9 I;  1FWL A;  1N0V C;  1XNR E;  5LMU I;  4DV1 E;  1EI1 A;  1FJG E;  1H73 A;  4DR5 I;  1MX0 A;  4DPW A;  1MG7 A;  2UXB E;  4HAC A;  2UU9 I;  4FWH A;  4DV0 I;  5IT9 Q;  4KHP E;  2E5L I;  1ELO A;  4JI4 I;  3J80 C;  1IBK E;  1H74 A;  3WU4 A;  1NHH A;  4JI3 E;  1Z0C A;  2EFG A;  3V2U C;  1KIJ A;  4LF8 I;  1FKA E;  4LFB I;  1H7U A;  3QT8 A;  3T1H I;  1N33 I;  1FI4 A;  3M6A A;  1QZR A;  4JI0 E;  1DAR A;  1N0U A;  1J5E I;  1B62 A;  2V2Q A;  4HAC B;  4DV4 E;  4GKJ E;  1H7S A;  4UT4 A;  4AQY I;  1PVG A;  4DV7 E;  4DU8 A;  2DEJ A;  4DPX A;  3T1Y I;  1HR0 E;  2UXD I;  4DV6 E;  3WU6 A;  4JI5 E;  4JI7 I;  3J81 Q;  4X64 E;  1N32 E;  4DR1 E;  2HK3 A;  4NXN I;  4ZVI A;  3LTO A;  5FLX Q;  1MU5 A;  1Z0E A;  3ZZU A;  4DPT A;  4XTJ A;  1S4E A;  2VQF E;  1XNQ I;  2UUB E;  2WW4 A;  4ED4 A;  3ZZT A;  4YHH E;  4JI8 E;  4DR7 E;  2R3V A;  4KHP I;  1IBL I;  1FWK A;  4P7A A;  3Q1Q A;  1FNM A;  3ZZ0 A;  2UUC I;  4DV5 E;  3QT6 A;  4DUY E;  4B3R E;  4B3T I;  3LNU A;  3OTO I;  1KKH A;  4B3M E;  4LF9 I;  1ZXM A;  2X36 A;  4LFA E;  2OI2 A;  1I94 E;  5IWA E;  3ZKB A;  1NHI A;  5BR8 I;  1HNW I;  4GKJ I;  2HFS A;  4JV5 I;  4MYT A;  2ZM6 I;  4PRV A;  1XMQ I;  1KVK A;  1ZXN A;  4LFC E;  4USK A;  4X62 E;  2VQE E;  1UEK A;  2V34 A;  4LF4 I;  4PU9 A;  1ZM4 A;  4NXM E;  1D6T A;  1A6F A;  4DR3 E;  4URL A;  2AJ4 A;  3K1J A;  4X64 I;  1N32 I;  1Z0B A;  4JI1 E;  2UUA I;  2UXC E;  1U2R A;  2HK2 A;  1HNZ E;  2F4V E;  4JI2 I;  3B78 A;  1NZ0 A;  1XMO E;  4X65 E;  2HHH E;  4DV2 I;  4YY3 I;  3J7A G;  4JYA E;  4X66 I;  4MYU A;  4DUZ I;  3F0N A;  4DR2 E;  1IBM E;  3PYG A;  5LMU E;  2HKJ A;  4LF7 I;  2HFU A;  5LMN I;  1N36 I;  2HKE A;  4R1F A;  4DR4 I;  3D4J A;  4LF6 I;  4FWD A;  4K0K E;  4DR7 I;  1KTV A;  2UU9 E;  4DV0 E;  3CWV A;  1Z5C A;  4GKK I;  4Z7Y A;  4PRX A;  4JI4 E;  4RPF A;  4B3S I;  1XHK A;  3ZM7 A;  4B3R I;  4FN5 A;  2XEX A;  4LF8 E;  1NHJ A;  1N34 I;  4B3M I;  1XNR I;  1OJ4 A;  4LFB E;  2A2D A;  4DV1 I;  1Z0G A;  1N33 E;  1FJG I;  4DPY A;  2Q2E B;  2ZBK B;  2E1R A;  2UXB I;  2J7K A;  1J5E E;  2BM0 A;  1B63 A;  1PIE A;  4FWG A;  4AQY E;  3PYE A;  3WU5 A;  1IBK I;  2GS8 A;  3JAM Q;  4JI3 I;  5A2Q C;  2BM1 A;  2VQE I;  3QT7 A;  3T1Y E;  1HNX E;  2UXD E;  3LPS A;  4HYM A;  3QT5 A;  2VF3 A;  1Z0T A;  1HNZ I;  2F4V I;  2A2C A;  4JI6 E;  1RRE A;  4NXN E;  4JI0 I;  1XMO I;  3JAM C;  3WU3 A;  1RR9 A;  4DV4 I;  4DV7 I;  5LL6 R;  4LF5 E;  1PKP A;  1XNQ E;  4HXZ A;  1WUU A;  4DV6 I;  1HR0 I;  1S16 A;  4JI5 I;  1Z0W A; 
#chains in the Genus database with same CATH topology
 4K0K I;  1UDQ A;  4FW7 A;  2AE8 A;  4IS9 A;  4WUC A;  1Z59 A;  2PNM A;  1IBL E;  4DR1 I;  4DV3 E;  1Z0V A;  4I3H A;  2UUC E;  2DEI A;  4USM A;  1OYS A;  2R42 A;  3V5R A;  5L3J A;  4WUB A;  1VIS A;  4B3T E;  4DR6 E;  5GME A;  3H4L A;  4MU4 A;  3OTO E;  4OX9 E;  2VQF I;  2V2Z A;  3HUL A;  3PS2 A;  1Z5A A;  4UTG A;  5IT9 C;  2UUB I;  4LF9 E;  3Q6M A;  2PNZ B;  4QNJ A;  5GMD A;  3P76 A;  2ZIT A;  5BR8 E;  4DR5 E;  1OYP A;  4YHH I;  2CZ9 A;  4JI8 I;  1HNW E;  1Y6Z A;  3HJC A;  4JV5 E;  3P06 A;  4DXL A;  2ZM6 E;  4P52 A;  1XMQ E;  1ZM9 A;  2E5L E;  2O1V A;  2CVE A;  4DV5 I;  4DUY I;  2NN6 D;  4LF4 E;  1HNX I;  1E3H A;  5DNX A;  4Z7C A;  5A2Q Q;  3M85 G;  4WUD A;  3T1H E;  1K47 A;  4LFA I;  2UUA E;  1I94 I;  3ZKD A;  4JI6 I;  5IWA I;  4JI2 E;  4BA1 B;  3J7A M;  4OZE A;  4KQV A;  3GON A;  4JG4 A;  3KRN A;  2WNR B;  2O1U A;  4DV2 E;  4YY3 E;  1ZM2 A;  4IFD A;  3PYF A;  2V2V A;  2NPF A;  3K17 A;  2PO2 B;  4X66 E;  4DUZ E;  4DPU A;  4LFC I;  3DD6 A;  3B82 A;  4X62 I;  2IOP A;  3B8H A;  4M1K A;  3P3G A;  2BV3 A;  2GQ0 A;  3J81 C;  4LF5 I;  4LF7 E;  4OO1 A;  1BKN A;  5LMN E;  1N36 E;  4NXM I;  4IZK A;  3M7N D;  4DR3 I;  4LCH A;  4AM3 A;  4DR4 E;  4LF6 E;  4JI7 E;  5FLX C;  4MQY A;  2V8P A;  4JI1 I;  2UXC I;  1R6M A;  4DV3 I;  1H72 C;  4HY1 A;  1Z5B A;  4GKK E;  2NN6 C;  2X7I A;  4EMD A;  2Z5C B;  1EA6 A;  1ZM3 A;  5C0X B;  4FW9 A;  4DU7 A;  4X65 I;  2HHH I;  2C39 A;  4LCF A;  3P3E A;  3PYD A;  4B3S E;  4JYA I;  4IFD B;  1R6L A;  4DR2 I;  4DR6 I;  1UDS A;  4IZJ A;  2PNL A;  1IBM I;  3J80 Q;  2LJP A;  1N34 E;  2JEA A;  2BR2 A;  4OX9 I;  1FWL A;  1N0V C;  1XNR E;  5LMU I;  4DV1 E;  1EI1 A;  4OO1 B;  4FW6 A;  1FJG E;  1H73 A;  2O1W A;  4IZK B;  4DR5 I;  3CDJ A;  1MX0 A;  4DPW A;  1MG7 A;  2UXB E;  4HAC A;  2UU9 I;  4FWH A;  4DV0 I;  3GME A;  3PS1 A;  5IT9 Q;  2GO4 A;  4LCG A;  4AID A;  4KHP E;  1HK7 A;  2E5L I;  1ELO A;  4JI4 I;  3J80 C;  1IBK E;  1H74 A;  3WU4 A;  1NHH A;  4JI3 E;  1Z0C A;  2C39 B;  2GO3 A;  2EFG A;  3V2U C;  4LPF A;  1KIJ A;  4LF8 I;  4IZJ B;  4AIM A;  1FKA E;  5DRQ A;  4LFB I;  2JEA B;  1H7U A;  2BR2 B;  3QT8 A;  3T1H I;  2JE6 A;  5FWK A;  1N33 I;  5JEA A;  3L7Z A;  2Z5E A;  1FI4 A;  1YH8 A;  2C37 A;  3M6A A;  1QZR A;  2BA1 G;  3UHM A;  4JI0 E;  1DAR A;  1N0U A;  1J5E I;  1B62 A;  2V2Q A;  4HAC B;  4DV4 E;  4GKJ E;  1H7S A;  4UT4 A;  4AQY I;  5DRP A;  1PVG A;  4DV7 E;  5EKW A;  4DU8 A;  2DEJ A;  4DPX A;  3T1Y I;  1Y60 A;  5K36 A;  1HR0 E;  2CGE A;  4DV6 E;  2UXD I;  3WU6 A;  4JI5 E;  2WP8 A;  4JI7 I;  3J81 Q;  3U1Y A;  4X64 E;  1N32 E;  5JEA B;  4DR1 E;  3P3C A;  4FW4 A;  2HK3 A;  2C37 B;  4NXN I;  4ZVI A;  2NN6 A;  3LTO A;  3NZK A;  5FLX Q;  1MU5 A;  2BA0 G;  5C0X D;  5DRR A;  1Z0E A;  3ZZU A;  5C0X E;  3PRY A;  4DPT A;  2O1T A;  4XTJ A;  1S4E A;  1UDN A;  3K85 A;  2IER A;  4FW5 A;  2VQF E;  4MU1 A;  4IFD E;  1XNQ I;  2UUB E;  5K36 B;  2WW4 A;  4ED4 A;  2WP8 B;  3ZZT A;  4YHH E;  2JT2 A;  4MU3 A;  2PO0 A;  4JI8 E;  4OO1 E;  4DR7 E;  2R3V A;  5C0X F;  1IBL I;  4KHP I;  1FWK A;  1UDO A;  4P7A A;  1VI7 A;  3Q1Q A;  3HKM A;  4IFD F;  1FNM A;  2NN6 B;  3ZZ0 A;  1E3P A;  2IOQ A;  4DV5 E;  2UUC I;  3QT6 A;  4DUY E;  4B3R E;  5DNL A;  4B3T I;  4OO1 F;  3LNU A;  4QNK A;  3OTO I;  1KKH A;  4B3M E;  2C38 A;  4IZJ D;  4LF9 I;  1ZXM A;  2IES A;  2X36 A;  3M85 D;  2VES A;  4LFA E;  2OI2 A;  1I94 E;  5C0X C;  5IWA E;  3ZKB A;  1NHI A;  5BR8 I;  3U1K A;  4IFD C;  1HNW I;  4GKJ I;  2HFS A;  5ELW A;  4JV5 I;  4MYT A;  2ZM6 I;  4PRV A;  1XMQ I;  1KVK A;  1ZXN A;  4LFC E;  4USK A;  4X62 E;  4OO1 C;  2VQE E;  1UEK A;  2V34 A;  4LF4 I;  4PU9 A;  1ZM4 A;  4NXM E;  1D6T A;  1A6F A;  4DR3 E;  4URL A;  2AJ4 A;  3K1J A;  3B4T A;  2C38 B;  4X64 I;  1N32 I;  1Z0B A;  4JI1 E;  2UUA I;  2UXC E;  1U2R A;  2HK2 A;  1HNZ E;  2F4V E;  4JI2 I;  3B78 A;  5JEA D;  4ISA A;  1NZ0 A;  2JEB A;  4X65 E;  1XMO E;  2HHH E;  4DV2 I;  4YY3 I;  5JEA E;  3J7A G;  4JYA E;  4X66 I;  4MYU A;  4OKG A;  4DUZ I;  3F0N A;  4DR2 E;  2Z5B A;  1IBM E;  3PYG A;  5LMU E;  2HKJ A;  4LF7 I;  2HFU A;  1USU A;  5LMN I;  1N36 I;  3M7N G;  2HKE A;  2F1D A;  4R1F A;  4BA1 A;  4DR4 I;  1Y4U A;  5JEA F;  3D4J A;  4LF6 I;  2WNR A;  4FWD A;  5DRO A;  4K0K E;  2O3Z A;  5K36 D;  1USV A;  4DR7 I;  1KTV A;  2UU9 E;  4DV0 E;  2PO2 A;  2JE6 B;  5K36 E;  3CWV A;  1Z5C A;  4GKK I;  4Z7Y A;  3L7Z B;  4PRX A;  4JI4 E;  3Q6N A;  4RPF A;  1XXE A;  4B3S I;  1XHK A;  2JEB B;  3ZM7 A;  4B3R I;  4U3B A;  4FN5 A;  2XEX A;  4LF8 E;  2NN6 E;  1NHJ A;  1N34 I;  2Z5B B;  1OYR A;  4B3M I;  1OJ4 A;  1XNR I;  2PO1 A;  4IFD D;  4LFB E;  2A2D A;  5K36 F;  5JEA C;  4DV1 I;  1Z0G A;  2CG9 A;  1N33 E;  1FJG I;  4DPY A;  2Q2E B;  2Z5C A;  2ZBK B;  4J3D A;  5C0X A;  2E1R A;  4OO1 D;  2BA1 D;  2UXB I;  2J7K A;  4MDT A;  1J5E E;  2BM0 A;  1B63 A;  1PIE A;  2NN6 F;  3H1C A;  4BA2 A;  4FWG A;  4AQY E;  3PYE A;  3WU5 A;  4NBQ A;  1IBK I;  2GS8 A;  4U3D A;  3JAM Q;  5A2Q C;  4JI3 I;  4FW3 A;  2BM1 A;  5K36 C;  2VQE I;  1Y5Y A;  3QT7 A;  3T1Y E;  1P42 A;  1HNX E;  2UXD E;  3LPS A;  1Y4S A;  4HYM A;  3QT5 A;  2PO1 B;  2VF3 A;  1Z0T A;  1RHY A;  1HNZ I;  2F4V I;  2A2C A;  3PS3 A;  4JI6 E;  1RRE A;  4NXN E;  4JI0 I;  4MU0 A;  1XMO I;  3JAM C;  3WU3 A;  1RR9 A;  3GLL A;  4DV4 I;  4LOM A;  2PO0 B;  3CDI A;  4GQU A;  2BA0 D;  4BA2 B;  5EL9 A;  3GCM A;  4DV7 I;  1YHC A;  5LL6 R;  4LF5 E;  1PKP A;  1XNQ E;  2PNZ A;  4HXZ A;  1WUU A;  4DV6 I;  2J65 A;  1HR0 I;  1S16 A;  4JI5 I;  1Z0W A;  4N3O A; 
#chains in the Genus database with same CATH homology
 4K0K I;  4WUC A;  1Z59 A;  2PNM A;  1IBL E;  4DR1 I;  4DV3 E;  1Z0V A;  4I3H A;  2UUC E;  2DEI A;  4USM A;  2R42 A;  3V5R A;  5L3J A;  4WUB A;  1VIS A;  4B3T E;  4DR6 E;  5GME A;  3H4L A;  3OTO E;  4OX9 E;  2VQF I;  2V2Z A;  3HUL A;  4UTG A;  1Z5A A;  5IT9 C;  2UUB I;  4LF9 E;  3Q6M A;  5GMD A;  2ZIT A;  5BR8 E;  4DR5 E;  4YHH I;  2CZ9 A;  4JI8 I;  1HNW E;  1Y6Z A;  3HJC A;  4JV5 E;  3P06 A;  4DXL A;  2ZM6 E;  4P52 A;  1XMQ E;  1ZM9 A;  2E5L E;  2O1V A;  4DV5 I;  4DUY I;  4LF4 E;  1HNX I;  4Z7C A;  5A2Q Q;  4WUD A;  3T1H E;  1K47 A;  4LFA I;  2UUA E;  1I94 I;  3ZKD A;  4JI6 I;  5IWA I;  4JI2 E;  3J7A M;  4KQV A;  3GON A;  4JG4 A;  2O1U A;  4DV2 E;  4YY3 E;  1ZM2 A;  3PYF A;  2V2V A;  2NPF A;  3K17 A;  4X66 E;  4DUZ E;  4DPU A;  4LFC I;  3B82 A;  4X62 I;  2IOP A;  3B8H A;  4M1K A;  2BV3 A;  2GQ0 A;  3J81 C;  4LF5 I;  4LF7 E;  1BKN A;  5LMN E;  1N36 E;  4NXM I;  4IZK A;  4DR3 I;  4DR4 E;  4LF6 E;  4JI7 E;  5FLX C;  2V8P A;  4JI1 I;  2UXC I;  4DV3 I;  1H72 C;  4HY1 A;  1Z5B A;  4GKK E;  2X7I A;  4EMD A;  2Z5C B;  1EA6 A;  1ZM3 A;  4FW9 A;  4DU7 A;  4X65 I;  2HHH I;  3PYD A;  4B3S E;  4JYA I;  4DR2 I;  4DR6 I;  4IZJ A;  2PNL A;  1IBM I;  3J80 Q;  2LJP A;  1N34 E;  4OX9 I;  1FWL A;  1N0V C;  1XNR E;  5LMU I;  4DV1 E;  1EI1 A;  1FJG E;  1H73 A;  2O1W A;  4IZK B;  4DR5 I;  1MX0 A;  4DPW A;  1MG7 A;  2UXB E;  4HAC A;  2UU9 I;  4FWH A;  4DV0 I;  5IT9 Q;  4KHP E;  1HK7 A;  2E5L I;  1ELO A;  4JI4 I;  3J80 C;  1IBK E;  1H74 A;  3WU4 A;  1NHH A;  4JI3 E;  1Z0C A;  2EFG A;  3V2U C;  1KIJ A;  4LF8 I;  4IZJ B;  1FKA E;  4LFB I;  1H7U A;  3QT8 A;  3T1H I;  5FWK A;  1N33 I;  2Z5E A;  1FI4 A;  3M6A A;  1QZR A;  4JI0 E;  1DAR A;  1N0U A;  1J5E I;  1B62 A;  2V2Q A;  4HAC B;  4DV4 E;  4GKJ E;  1H7S A;  4UT4 A;  4AQY I;  1PVG A;  4DV7 E;  4DU8 A;  2DEJ A;  4DPX A;  3T1Y I;  1HR0 E;  2CGE A;  4DV6 E;  2UXD I;  3WU6 A;  4JI5 E;  4JI7 I;  3J81 Q;  4X64 E;  1N32 E;  4DR1 E;  2HK3 A;  4NXN I;  4ZVI A;  3LTO A;  5FLX Q;  1MU5 A;  1Z0E A;  3ZZU A;  3PRY A;  4DPT A;  2O1T A;  4XTJ A;  1S4E A;  3K85 A;  2VQF E;  1XNQ I;  2UUB E;  2WW4 A;  4ED4 A;  3ZZT A;  4YHH E;  4JI8 E;  4DR7 E;  2R3V A;  4KHP I;  1IBL I;  1FWK A;  4P7A A;  3Q1Q A;  1FNM A;  3ZZ0 A;  2UUC I;  2IOQ A;  4DV5 E;  3QT6 A;  4DUY E;  4B3R E;  4B3T I;  3LNU A;  3OTO I;  1KKH A;  4B3M E;  4IZJ D;  4LF9 I;  1ZXM A;  2X36 A;  4LFA E;  2OI2 A;  1I94 E;  5IWA E;  3ZKB A;  1NHI A;  5BR8 I;  1HNW I;  4GKJ I;  2HFS A;  4JV5 I;  4MYT A;  2ZM6 I;  4PRV A;  1XMQ I;  1KVK A;  1ZXN A;  4LFC E;  4USK A;  4X62 E;  2VQE E;  1UEK A;  2V34 A;  4LF4 I;  4PU9 A;  1ZM4 A;  4NXM E;  1D6T A;  1A6F A;  4DR3 E;  4URL A;  2AJ4 A;  3K1J A;  4X64 I;  1N32 I;  1Z0B A;  4JI1 E;  2UUA I;  2UXC E;  1U2R A;  2HK2 A;  1HNZ E;  2F4V E;  4JI2 I;  3B78 A;  1NZ0 A;  1XMO E;  4X65 E;  2HHH E;  4DV2 I;  4YY3 I;  3J7A G;  4JYA E;  4X66 I;  4MYU A;  4DUZ I;  3F0N A;  4DR2 E;  2Z5B A;  1IBM E;  3PYG A;  5LMU E;  2HKJ A;  4LF7 I;  2HFU A;  1USU A;  5LMN I;  1N36 I;  2HKE A;  4R1F A;  4DR4 I;  1Y4U A;  3D4J A;  4LF6 I;  4FWD A;  4K0K E;  1USV A;  4DR7 I;  1KTV A;  2UU9 E;  4DV0 E;  3CWV A;  1Z5C A;  4GKK I;  4Z7Y A;  4PRX A;  4JI4 E;  3Q6N A;  4RPF A;  4B3S I;  1XHK A;  3ZM7 A;  4B3R I;  4FN5 A;  2XEX A;  4LF8 E;  1NHJ A;  1N34 I;  2Z5B B;  4B3M I;  1XNR I;  1OJ4 A;  4LFB E;  2A2D A;  4DV1 I;  1Z0G A;  2CG9 A;  1N33 E;  1FJG I;  4DPY A;  2Q2E B;  2Z5C A;  2ZBK B;  2E1R A;  2UXB I;  2J7K A;  1J5E E;  2BM0 A;  1B63 A;  1PIE A;  4FWG A;  4AQY E;  3PYE A;  3WU5 A;  1IBK I;  2GS8 A;  3JAM Q;  4JI3 I;  5A2Q C;  2BM1 A;  2VQE I;  3QT7 A;  3T1Y E;  1HNX E;  2UXD E;  3LPS A;  1Y4S A;  4HYM A;  3QT5 A;  2VF3 A;  1Z0T A;  1HNZ I;  2F4V I;  2A2C A;  4JI6 E;  1RRE A;  4NXN E;  4JI0 I;  1XMO I;  3JAM C;  3WU3 A;  1RR9 A;  4DV4 I;  4DV7 I;  5LL6 R;  4LF5 E;  1PKP A;  1XNQ E;  4HXZ A;  1WUU A;  4DV6 I;  1HR0 I;  1S16 A;  4JI5 I;  1Z0W A;  4N3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...