1IBKI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibkI00
1KIJA 4JI8I 4URLA 2VQEI 4LF5E 2CZ9A 4LF7I 1B63A 2HK3A 2VF3A 4LF9E 1N32I 2V2VA 1XNRI 4LFCE 4DR2I 4HY1A 1UEKA 1FNMA 4NXNI 4DV5I 4X65E 2XEXA 3K17A 1HR0E 2ZM6I 4JI6E 4USMA 1ZM9A 2WW4A 4UT4A 4OX9E 4DV2E 1DARA 5A2QQ 1KKHA 2ZBKB 4WUBA 4DPXA 1FWLA 2UXDE 2X36A 2UU9I 3OTOI 2Q2EB 4DR7E 4DR4I 1KTVA 4DUYI 4JI2E 1S4EA 4DR2E 4DR3E 1K47A 3B8HA 4YY3E 4X62I 1IBLE 4Z7CA 3ZKBA 1N34I 2BM1A 2ZITA 3PYEA 4X64E 3T1YI 1RREA 4WUCA 4EMDA 4JYAE 1NHJA 4LFBI 4KHPI 4P52A 4DV7E 2UUBE 5BR8E 1HNZE 4JI5E 1ZM2A 1PIEA 2UUAE 1FJGE 1QZRA 3T1HI 4DV0E 4FWDA 1MU5A 4DUZE 4PU9A 5L3JA 3PYGA 4RPFA 4GKKI 4LF8E 5GMDA 1J5EE 4JV5I 1RR9A 4B3SE 1ZM4A 1Z0VA 1MG7A 4KQVA 4P7AA 4DV3I 1NHHA 4DR5E 3H4LA 1N36E 1EA6A 2VQFE 2OI2A 2HKEA 1I94E 3CWVA 4R1FA 3WU3A 3WU4A 4KHPE 4PRVA 2LJPA 1ZXNA 3JAMQ 2UXCI 4Z7YA 4LF4I 2DEIA 1ZXMA 4JI0E 4JI7I 4DV4I 2UXBE 1B62A 4I3HA 4B3RI 4JI1I 1HNXI 4DPYA 4JI4I 4USKA 1PKPA 5FLXC 5LMUE 2E5LE 2F4VI 1KVKA 4NXMI 4PRXA 4ED4A 4DR1I 4B3TI 4DV6E 4AQYE 2R3VA 2UUCE 3QT7A 4DR6I 3WU5A 4LFAI 4X66I 3LPSA 1H72C 1NHIA 2HFSA 5IT9C 2A2DA 1A6FA 4K0KE 1IBMI 3J7AG 3J80Q 1XMOE 4JI8E 2VQEE 2R42A 4DU7A 4LF7E 3M6AA 1N33I 3B78A 4DV4E 1N32E 5LL6R 3PYFA 1XNRE 4JI4E 1HNWI 5GMEA 4MYTA 3ZM7A 2V34A 2AJ4A 1XNQI 4GKJI 4NXNE 2HHHI 4NXME 4ZVIA 5LMNI 4DV5E 4B3TE 2HFUA 3ZZ0A 4LFAE 4DV1I 2E1RA 2HK2A 2ZM6E 1PVGA 1VISA 5IWAI 3QT5A 1IBKI 1Z5BA 1FKAE 4HACA 1EI1A 4HYMA 5FLXQ 1XMQI 4B3MI 3D4JA 4FWGA 4YHHI 2V2QA 2UU9E 2A2CA 3OTOE 4WUDA 4LF5I 4DR4E 4DUYE 3F0NA 3ZZTA 4LF9I 4X62E 4XTJA 2X7IA 5IT9Q 3K1JA 1H74A 2BM0A 4LFCI 1N34E 3T1YE 4DU8A 3Q1QA 3WU6A 4DXLA 4JG4A 1H73A 4LFBE 2V8PA 1Z59A 1Z5CA 5IWAE 1U2RA 1MX0A 1HR0I 1S16A 4JI6I 1XMQE 1Z0WA 3T1HE 1Z0GA 4OX9I 4DV2I 1Z0EA 2GS8A 2HKJA 1D6TA 4FN5A 4GKKE 4JV5E 2UXDI 3B82A 4DV3E 3LTOA 2EFGA 3J81C 4DR7I 4FW9A 4JI2I 1WUUA 4DR3I 4JI3I 4YY3I 1IBLI 2V2ZA 4X64I 2BV3A 2UXCE 4JYAI 4LF4E 4LF6I 3GONA 4JI7E 3V2UC 4DV7I 2UUBI 4B3RE 4JI1E 5BR8I 1HNZI 1HNXE 4JI5I 2UUAI 1FJGI 1Z5AA 2F4VE 1NZ0A 2NPFA 3ZZUA 4DV0I 4DR1E 4DUZI 2DEJA 4DR6E 3QT8A 3JAMC 4LF8I 4X66E 1Z0CA 1J5EI 1N0VC 1ZM3A 3LNUA 4B3SI 4DPWA 4JI3E 4DPUA 2J7KA 4DR5I 1N36I 1IBME 2VQFI 4MYUA 4LF6E 3HULA 1I94I 1FWKA 4M1KA 4FWHA 4UTGA 1N33E 1H7UA 3J81Q 3QT6A 1HNWE 4JI0I 2UXBI 3V5RA 1XHKA 1XNQE 4GKJE 2HHHE 5LMNE 1Z0TA 1OJ4A 3ZKDA 5A2QC 3J80C 5LMUI 2E5LI 4DV1E 4DPTA 4X65I 1BKNA 4DV6I 4AQYI 2UUCI 3J7AM 1FI4A 1Z0BA 3PYDA 1IBKE 1H7SA 1ELOA 4HACB 4B3ME 4YHHE 4K0KI 4HXZA 1N0UA 1XMOI
chains in the Genus database with same CATH superfamily
1KIJA 4JI8I 4URLA 4MU4A 2BR2B 2VQEI 4LF5E 2CZ9A 2Z5CA 4LF7I 1B63A 2Z5BA 2HK3A 2VF3A 4LF9E 1N32I 5JEAA 2V2VA 1XXEA 2JE6B 1XNRI 5DRRA 1OYPA 4LFCE 2J65A 4DR2I 1VI7A 4HY1A 1UEKA 1RHYA 1FNMA 4NXNI 4DV5I 3B4TA 4X65E 5EL9A 2NN6B 2XEXA 2IOQA 2PO1B 4IFDD 3K17A 3P3EA 5C0XC 1HR0E 2ZM6I 5K36F 4JI6E 4USMA 1ZM9A 2WW4A 4UT4A 4OX9E 4DV2E 4BA1B 1DARA 3K85A 5A2QQ 4BA2A 1KKHA 2ZBKB 4FW6A 4WUBA 4DPXA 2PO2B 1FWLA 2UXDE 2X36A 5JEAD 2UU9I 4OO1A 3OTOI 2Q2EB 4U3BA 2C37B 4DR7E 4FW3A 1UDSA 2GO3A 4DR4I 1KTVA 4DUYI 4JI2E 1S4EA 4DR2E 1Y6ZA 4DR3E 1R6LA 1K47A 3B8HA 4YY3E 4FW7A 4X62I 1IBLE 4Z7CA 3ZKBA 2BA1D 3PS3A 1N34I 2BM1A 2ZITA 3PYEA 4AIMA 4X64E 4IFDC 3T1YI 1RREA 2CG9A 4WUCA 2O1VA 4EMDA 4JYAE 5C0XE 4FW5A 3UHMA 4QNJA 2C39B 1NHJA 4LFBI 4OKGA 4KHPI 4P52A 4DV7E 2UUBE 1OYRA 4ISAA 5BR8E 3U1KA 1HNZE 4JI5E 4U3DA 1ZM2A 1PIEA 2UUAE 4IZKB 1FJGE 1QZRA 3T1HI 5JEAC 4DV0E 4MU1A 4FWDA 2Z5EA 1MU5A 4DUZE 4PU9A 5L3JA 4MDTA 3PYGA 4RPFA 4GKKI 2BR2A 4LF8E 5GMDA 1J5EE 4JV5I 1RR9A 4B3SE 1ZM4A 1Z0VA 2CVEA 1MG7A 4KQVA 4P7AA 4DV3I 1NHHA 4DR5E 3H4LA 1N36E 4IFDE 1USVA 1EA6A 2VQFE 2NN6F 4QNKA 2OI2A 5DNLA 2JEBB 2HKEA 1I94E 4AIDA 3CWVA 4R1FA 1YH8A 3WU3A 5C0XB 3WU4A 2O1TA 4KHPE 3PS1A 4PRVA 2LJPA 1ZXNA 3JAMQ 2UXCI 4Z7YA 4LF4I 2DEIA 1ZXMA 4LOMA 4JI0E 4JI7I 4DV4I 2UXBE 1USUA 2C38A 5JEAE 1B62A 3NZKA 4I3HA 4B3RI 4JI1I 1HNXI 4DPYA 4JI4I 1Y4SA 4USKA 1PKPA 5FLXC 3M7NG 5LMUE 2E5LE 5FWKA 2F4VI 1KVKA 4NXMI 2PO2A 4PRXA 4ED4A 4DR1I 4B3TI 4DV6E 4AQYE 2R3VA 2UUCE 3QT7A 3HKMA 4DR6I 3WU5A 3M85G 4LFAI 2O1WA 4X66I 2O1UA 2PNLA 3LPSA 1H72C 1OYSA 4IFDB 1NHIA 2HFSA 5IT9C 5K36A 5K36E 3Q6MA 2A2DA 1A6FA 4K0KE 1IBMI 3J7AG 3U1YA 3J80Q 1XMOE 4JI8E 2VQEE 2C39A 3Q6NA 2R42A 4DU7A 4LF7E 3M6AA 1N33I 3B78A 3L7ZA 4DV4E 2Z5CB 1N32E 4OO1E 5LL6R 5JEAB 3PYFA 2PO0B 1XNRE 4JI4E 1HNWI 5GMEA 2IOPA 4IZKA 4MYTA 3ZM7A 2V34A 2PNZA 2AJ4A 1XNQI 4GKJI 4NXNE 2HHHI 2IERA 4NXME 4ZVIA 5LMNI 4DV5E 4B3TE 1UDNA 2HFUA 1HK7A 3ZZ0A 2WNRA 4LFAE 4LCGA 4DV1I 1Y5YA 2E1RA 2HK2A 2F1DA 2ZM6E 1P42A 2JEAB 1PVGA 1VISA 4IZJA 5IWAI 3QT5A 5K36D 1IBKI 1Z5BA 2JT2A 2GQ0A 2WP8A 4HACA 1FKAE 1EI1A 4HYMA 5C0XF 5ELWA 5EKWA 5FLXQ 1XMQI 4GQUA 4B3MI 4BA2B 3D4JA 4FWGA 4OO1D 4YHHI 2V2QA 2UU9E 2A2CA 3OTOE 4WUDA 3CDJA 4LF5I 4DR4E 3KRNA 4DUYE 3F0NA 3ZZTA 4LF9I 1UDQA 4X62E 2JE6A 4XTJA 2X7IA 5IT9Q 3K1JA 1H74A 2BM0A 4LFCI 1N34E 3T1YE 4AM3A 1UDOA 4DU8A 3Q1QA 3WU6A 2NN6A 4DXLA 4JG4A 5K36C 3GLLA 1H73A 2PO1A 4LFBE 4IZJD 2V8PA 1Z59A 4IFDF 1Z5CA 5IWAE 1U2RA 1MX0A 1HR0I 4J3DA 1S16A 4JI6I 4OO1C 1XMQE 1Z0WA 4BA1A 3T1HE 1Z0GA 4OX9I 4DV2I 3GCMA 1Z0EA 4MU3A 2GS8A 2HKJA 3PS2A 1D6TA 2IESA 4FN5A 4GKKE 4FW4A 5JEAF 4JV5E 2UXDI 1YHCA 2C37A 3B82A 4DV3E 3LTOA 2EFGA 3J81C 2PO0A 4DR7I 4FW9A 1Y4UA 4JI2I 1WUUA 4DR3I 4JI3I 4YY3I 1IBLI 3P06A 2V2ZA 2NN6D 4X64I 4N3OA 2BV3A 2UXCE 4IS9A 4JYAI 4LF4E 4LF6I 2JEAA 2BA1G 3GONA 4JI7E 5DRQA 3V2UC 2Z5BB 3M7ND 4DV7I 2UUBI 2C38B 4B3RE 4JI1E 5BR8I 1HNZI 2AE8A 1HNXE 4JI5I 2VESA 2UUAI 3M85D 1FJGI 1Z5AA 2F4VE 1NZ0A 2NPFA 4MU0A 3ZZUA 4DV0I 4DR1E 4OO1F 3GMEA 4DUZI 2DEJA 4DR6E 2BA0G 3P3GA 3QT8A 1E3HA 3JAMC 4LF8I 4X66E 1Z0CA 1J5EI 1N0VC 1ZM3A 3LNUA 5DNXA 4B3SI 2NN6C 4DPWA 4JI3E 1Y60A 4DPUA 2J7KA 2CGEA 4DR5I 5DROA 1N36I 3P3CA 5K36B 1IBME 2VQFI 2JEBA 4MYUA 5C0XA 4LF6E 3HULA 1I94I 1FWKA 4M1KA 4FWHA 4OZEA 2O3ZA 4UTGA 4LCHA 1N33E 4NBQA 1H7UA 4OO1B 3J81Q 3L7ZB 3QT6A 1HNWE 4JI0I 2UXBI 4LCFA 3V5RA 1XHKA 2BA0D 2GO4A 1XNQE 4GKJE 2PNZB 2HHHE 4MQYA 4LPFA 5LMNE 1R6MA 3HJCA 1Z0TA 1OJ4A 3ZKDA 5A2QC 3J80C 5LMUI 2E5LI 2WNRB 4DV1E 3CDIA 4DPTA 2NN6E 4X65I 1BKNA 5DRPA 4DV6I 4AQYI 2UUCI 3J7AM 1FI4A 1Z0BA 3PYDA 1IBKE 1H7SA 4IZJB 1ELOA 4IFDA 1E3PA 3P76A 3H1CA 2WP8B 4HACB 2PNMA 5C0XD 4B3ME 4YHHE 3DD6A 4K0KI 3PRYA 4HXZA 1N0UA 1XMOI
chains in the Genus database with same CATH topology
1KIJA 4JI8I 4URLA 2VQEI 4LF5E 2CZ9A 2Z5CA 4LF7I 1B63A 2Z5BA 2HK3A 2VF3A 4LF9E 1N32I 2V2VA 1XNRI 4LFCE 4DR2I 4HY1A 1UEKA 1FNMA 4NXNI 4DV5I 4X65E 2XEXA 2IOQA 3K17A 1HR0E 2ZM6I 4JI6E 4USMA 1ZM9A 2WW4A 4UT4A 4OX9E 4DV2E 1DARA 3K85A 5A2QQ 1KKHA 2ZBKB 4WUBA 4DPXA 1FWLA 2UXDE 2X36A 2UU9I 3OTOI 2Q2EB 4DR7E 4DR4I 1KTVA 4DUYI 4JI2E 1S4EA 4DR2E 1Y6ZA 4DR3E 1K47A 3B8HA 4YY3E 4X62I 1IBLE 4Z7CA 3ZKBA 1N34I 2BM1A 2ZITA 3PYEA 4X64E 3T1YI 1RREA 2CG9A 4WUCA 2O1VA 4EMDA 4JYAE 1NHJA 4LFBI 4KHPI 4P52A 4DV7E 2UUBE 5BR8E 1HNZE 4JI5E 1ZM2A 1PIEA 2UUAE 4IZKB 1FJGE 1QZRA 3T1HI 4DV0E 4FWDA 2Z5EA 1MU5A 4DUZE 4PU9A 5L3JA 3PYGA 4RPFA 4GKKI 4LF8E 5GMDA 1J5EE 4JV5I 1RR9A 4B3SE 1ZM4A 1Z0VA 1MG7A 4KQVA 4P7AA 4DV3I 1NHHA 4DR5E 3H4LA 1N36E 1USVA 1EA6A 2VQFE 2OI2A 2HKEA 1I94E 3CWVA 4R1FA 3WU3A 3WU4A 2O1TA 4KHPE 4PRVA 2LJPA 1ZXNA 3JAMQ 2UXCI 4Z7YA 4LF4I 2DEIA 1ZXMA 4JI0E 4JI7I 4DV4I 2UXBE 1USUA 1B62A 4I3HA 4B3RI 4JI1I 1HNXI 4DPYA 4JI4I 1Y4SA 4USKA 1PKPA 5FLXC 5LMUE 2E5LE 5FWKA 2F4VI 1KVKA 4NXMI 4PRXA 4ED4A 4DR1I 4B3TI 4DV6E 4AQYE 2R3VA 2UUCE 3QT7A 4DR6I 3WU5A 4LFAI 2O1WA 4X66I 2O1UA 2PNLA 3LPSA 1H72C 1NHIA 2HFSA 5IT9C 3Q6MA 2A2DA 1A6FA 4K0KE 1IBMI 3J7AG 3J80Q 1XMOE 4JI8E 2VQEE 3Q6NA 2R42A 4DU7A 4LF7E 3M6AA 1N33I 3B78A 4DV4E 1N32E 2Z5CB 5LL6R 3PYFA 1XNRE 4JI4E 1HNWI 5GMEA 2IOPA 4IZKA 4MYTA 3ZM7A 2V34A 2AJ4A 1XNQI 4GKJI 4NXNE 2HHHI 4NXME 4ZVIA 5LMNI 4DV5E 4B3TE 2HFUA 1HK7A 3ZZ0A 4LFAE 4DV1I 2E1RA 2HK2A 2ZM6E 1PVGA 1VISA 4IZJA 5IWAI 3QT5A 1IBKI 1Z5BA 2GQ0A 1FKAE 4HACA 1EI1A 4HYMA 5FLXQ 1XMQI 4B3MI 3D4JA 4FWGA 4YHHI 2V2QA 2UU9E 2A2CA 3OTOE 4WUDA 4LF5I 4DR4E 4DUYE 3F0NA 3ZZTA 4LF9I 4X62E 4XTJA 2X7IA 5IT9Q 3K1JA 1H74A 2BM0A 4LFCI 1N34E 3T1YE 4DU8A 3Q1QA 3WU6A 4DXLA 4JG4A 1H73A 4LFBE 4IZJD 2V8PA 1Z59A 1Z5CA 5IWAE 1U2RA 1MX0A 1HR0I 1S16A 4JI6I 1XMQE 1Z0WA 3T1HE 1Z0GA 4OX9I 4DV2I 1Z0EA 2GS8A 2HKJA 1D6TA 4FN5A 4GKKE 4JV5E 2UXDI 3B82A 4DV3E 3LTOA 2EFGA 3J81C 4DR7I 4FW9A 1Y4UA 4JI2I 1WUUA 4DR3I 4JI3I 4YY3I 1IBLI 3P06A 2V2ZA 4X64I 4N3OA 2BV3A 2UXCE 4JYAI 4LF4E 4LF6I 3GONA 4JI7E 3V2UC 2Z5BB 4DV7I 2UUBI 4B3RE 4JI1E 5BR8I 1HNZI 1HNXE 4JI5I 2UUAI 1FJGI 1Z5AA 2F4VE 1NZ0A 2NPFA 3ZZUA 4DV0I 4DR1E 4DUZI 2DEJA 4DR6E 3QT8A 3JAMC 4LF8I 4X66E 1Z0CA 1J5EI 1N0VC 1ZM3A 3LNUA 4B3SI 4DPWA 4JI3E 4DPUA 2J7KA 2CGEA 4DR5I 1N36I 1IBME 2VQFI 4MYUA 4LF6E 3HULA 1I94I 1FWKA 4M1KA 4FWHA 4UTGA 1N33E 1H7UA 3J81Q 3QT6A 1HNWE 4JI0I 2UXBI 3V5RA 1XHKA 1XNQE 4GKJE 2HHHE 5LMNE 3HJCA 1Z0TA 1OJ4A 3ZKDA 5A2QC 3J80C 5LMUI 2E5LI 4DV1E 4DPTA 4X65I 1BKNA 4DV6I 4AQYI 2UUCI 3J7AM 1FI4A 1Z0BA 3PYDA 1IBKE 1H7SA 4IZJB 1ELOA 4HACB 2PNMA 4B3ME 4YHHE 4K0KI 3PRYA 4HXZA 1N0UA 1XMOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIJ A;  4JI8 I;  4URL A;  2VQE I;  4LF5 E;  2CZ9 A;  4LF7 I;  1B63 A;  2HK3 A;  2VF3 A;  4LF9 E;  1N32 I;  2V2V A;  1XNR I;  4LFC E;  4DR2 I;  4HY1 A;  1UEK A;  1FNM A;  4NXN I;  4DV5 I;  4X65 E;  2XEX A;  3K17 A;  1HR0 E;  2ZM6 I;  4JI6 E;  4USM A;  1ZM9 A;  2WW4 A;  4UT4 A;  4OX9 E;  4DV2 E;  1DAR A;  5A2Q Q;  1KKH A;  2ZBK B;  4WUB A;  4DPX A;  1FWL A;  2UXD E;  2X36 A;  2UU9 I;  3OTO I;  2Q2E B;  4DR7 E;  4DR4 I;  1KTV A;  4DUY I;  4JI2 E;  1S4E A;  4DR2 E;  4DR3 E;  1K47 A;  3B8H A;  4YY3 E;  4X62 I;  1IBL E;  4Z7C A;  3ZKB A;  1N34 I;  2BM1 A;  2ZIT A;  3PYE A;  4X64 E;  3T1Y I;  1RRE A;  4WUC A;  4EMD A;  4JYA E;  1NHJ A;  4LFB I;  4KHP I;  4P52 A;  4DV7 E;  2UUB E;  5BR8 E;  1HNZ E;  4JI5 E;  1ZM2 A;  1PIE A;  2UUA E;  1FJG E;  1QZR A;  3T1H I;  4DV0 E;  4FWD A;  1MU5 A;  4DUZ E;  4PU9 A;  5L3J A;  3PYG A;  4RPF A;  4GKK I;  4LF8 E;  5GMD A;  1J5E E;  4JV5 I;  1RR9 A;  4B3S E;  1ZM4 A;  1Z0V A;  1MG7 A;  4KQV A;  4P7A A;  4DV3 I;  1NHH A;  4DR5 E;  3H4L A;  1N36 E;  1EA6 A;  2VQF E;  2OI2 A;  2HKE A;  1I94 E;  3CWV A;  4R1F A;  3WU3 A;  3WU4 A;  4KHP E;  4PRV A;  2LJP A;  1ZXN A;  3JAM Q;  2UXC I;  4Z7Y A;  4LF4 I;  2DEI A;  1ZXM A;  4JI0 E;  4JI7 I;  4DV4 I;  2UXB E;  1B62 A;  4I3H A;  4B3R I;  4JI1 I;  1HNX I;  4DPY A;  4JI4 I;  4USK A;  1PKP A;  5FLX C;  5LMU E;  2E5L E;  2F4V I;  1KVK A;  4NXM I;  4PRX A;  4ED4 A;  4DR1 I;  4B3T I;  4DV6 E;  4AQY E;  2R3V A;  2UUC E;  3QT7 A;  4DR6 I;  3WU5 A;  4LFA I;  4X66 I;  3LPS A;  1H72 C;  1NHI A;  2HFS A;  5IT9 C;  2A2D A;  1A6F A;  4K0K E;  1IBM I;  3J7A G;  3J80 Q;  1XMO E;  4JI8 E;  2VQE E;  2R42 A;  4DU7 A;  4LF7 E;  3M6A A;  1N33 I;  3B78 A;  4DV4 E;  1N32 E;  5LL6 R;  3PYF A;  1XNR E;  4JI4 E;  1HNW I;  5GME A;  4MYT A;  3ZM7 A;  2V34 A;  2AJ4 A;  1XNQ I;  4GKJ I;  4NXN E;  2HHH I;  4NXM E;  4ZVI A;  5LMN I;  4DV5 E;  4B3T E;  2HFU A;  3ZZ0 A;  4LFA E;  4DV1 I;  2E1R A;  2HK2 A;  2ZM6 E;  1PVG A;  1VIS A;  5IWA I;  3QT5 A;  1IBK I;  1Z5B A;  1FKA E;  4HAC A;  1EI1 A;  4HYM A;  5FLX Q;  1XMQ I;  4B3M I;  3D4J A;  4FWG A;  4YHH I;  2V2Q A;  2UU9 E;  2A2C A;  3OTO E;  4WUD A;  4LF5 I;  4DR4 E;  4DUY E;  3F0N A;  3ZZT A;  4LF9 I;  4X62 E;  4XTJ A;  2X7I A;  5IT9 Q;  3K1J A;  1H74 A;  2BM0 A;  4LFC I;  1N34 E;  3T1Y E;  4DU8 A;  3Q1Q A;  3WU6 A;  4DXL A;  4JG4 A;  1H73 A;  4LFB E;  2V8P A;  1Z59 A;  1Z5C A;  5IWA E;  1U2R A;  1MX0 A;  1HR0 I;  1S16 A;  4JI6 I;  1XMQ E;  1Z0W A;  3T1H E;  1Z0G A;  4OX9 I;  4DV2 I;  1Z0E A;  2GS8 A;  2HKJ A;  1D6T A;  4FN5 A;  4GKK E;  4JV5 E;  2UXD I;  3B82 A;  4DV3 E;  3LTO A;  2EFG A;  3J81 C;  4DR7 I;  4FW9 A;  4JI2 I;  1WUU A;  4DR3 I;  4JI3 I;  4YY3 I;  1IBL I;  2V2Z A;  4X64 I;  2BV3 A;  2UXC E;  4JYA I;  4LF4 E;  4LF6 I;  3GON A;  4JI7 E;  3V2U C;  4DV7 I;  2UUB I;  4B3R E;  4JI1 E;  5BR8 I;  1HNZ I;  1HNX E;  4JI5 I;  2UUA I;  1FJG I;  1Z5A A;  2F4V E;  1NZ0 A;  2NPF A;  3ZZU A;  4DV0 I;  4DR1 E;  4DUZ I;  2DEJ A;  4DR6 E;  3QT8 A;  3JAM C;  4LF8 I;  4X66 E;  1Z0C A;  1J5E I;  1N0V C;  1ZM3 A;  3LNU A;  4B3S I;  4DPW A;  4JI3 E;  4DPU A;  2J7K A;  4DR5 I;  1N36 I;  1IBM E;  2VQF I;  4MYU A;  4LF6 E;  3HUL A;  1I94 I;  1FWK A;  4M1K A;  4FWH A;  4UTG A;  1N33 E;  1H7U A;  3J81 Q;  3QT6 A;  1HNW E;  4JI0 I;  2UXB I;  3V5R A;  1XHK A;  1XNQ E;  4GKJ E;  2HHH E;  5LMN E;  1Z0T A;  1OJ4 A;  3ZKD A;  5A2Q C;  3J80 C;  5LMU I;  2E5L I;  4DV1 E;  4DPT A;  4X65 I;  1BKN A;  4DV6 I;  4AQY I;  2UUC I;  3J7A M;  1FI4 A;  1Z0B A;  3PYD A;  1IBK E;  1H7S A;  1ELO A;  4HAC B;  4B3M E;  4YHH E;  4K0K I;  4HXZ A;  1N0U A;  1XMO I; 
#chains in the Genus database with same CATH topology
 1KIJ A;  4JI8 I;  4URL A;  4MU4 A;  2BR2 B;  2VQE I;  4LF5 E;  2CZ9 A;  2Z5C A;  4LF7 I;  1B63 A;  2Z5B A;  2HK3 A;  2VF3 A;  4LF9 E;  1N32 I;  5JEA A;  2V2V A;  1XXE A;  2JE6 B;  1XNR I;  5DRR A;  1OYP A;  4LFC E;  2J65 A;  4DR2 I;  1VI7 A;  4HY1 A;  1UEK A;  1RHY A;  1FNM A;  4NXN I;  4DV5 I;  3B4T A;  4X65 E;  5EL9 A;  2NN6 B;  2XEX A;  2IOQ A;  2PO1 B;  4IFD D;  3K17 A;  3P3E A;  5C0X C;  1HR0 E;  2ZM6 I;  5K36 F;  4JI6 E;  4USM A;  1ZM9 A;  2WW4 A;  4UT4 A;  4OX9 E;  4DV2 E;  4BA1 B;  1DAR A;  3K85 A;  5A2Q Q;  4BA2 A;  1KKH A;  2ZBK B;  4FW6 A;  4WUB A;  4DPX A;  2PO2 B;  1FWL A;  2UXD E;  2X36 A;  5JEA D;  2UU9 I;  4OO1 A;  3OTO I;  2Q2E B;  4U3B A;  2C37 B;  4DR7 E;  4FW3 A;  1UDS A;  2GO3 A;  4DR4 I;  1KTV A;  4DUY I;  4JI2 E;  1S4E A;  4DR2 E;  1Y6Z A;  4DR3 E;  1R6L A;  1K47 A;  3B8H A;  4YY3 E;  4FW7 A;  4X62 I;  1IBL E;  4Z7C A;  3ZKB A;  2BA1 D;  3PS3 A;  1N34 I;  2BM1 A;  2ZIT A;  3PYE A;  4AIM A;  4X64 E;  4IFD C;  3T1Y I;  1RRE A;  2CG9 A;  4WUC A;  2O1V A;  4EMD A;  4JYA E;  5C0X E;  4FW5 A;  3UHM A;  4QNJ A;  2C39 B;  1NHJ A;  4LFB I;  4OKG A;  4KHP I;  4P52 A;  4DV7 E;  2UUB E;  1OYR A;  4ISA A;  5BR8 E;  3U1K A;  1HNZ E;  4JI5 E;  4U3D A;  1ZM2 A;  1PIE A;  2UUA E;  4IZK B;  1FJG E;  1QZR A;  3T1H I;  5JEA C;  4DV0 E;  4MU1 A;  4FWD A;  2Z5E A;  1MU5 A;  4DUZ E;  4PU9 A;  5L3J A;  4MDT A;  3PYG A;  4RPF A;  4GKK I;  2BR2 A;  4LF8 E;  5GMD A;  1J5E E;  4JV5 I;  1RR9 A;  4B3S E;  1ZM4 A;  1Z0V A;  2CVE A;  1MG7 A;  4KQV A;  4P7A A;  4DV3 I;  1NHH A;  4DR5 E;  3H4L A;  1N36 E;  4IFD E;  1USV A;  1EA6 A;  2VQF E;  2NN6 F;  4QNK A;  2OI2 A;  5DNL A;  2JEB B;  2HKE A;  1I94 E;  4AID A;  3CWV A;  4R1F A;  1YH8 A;  3WU3 A;  5C0X B;  3WU4 A;  2O1T A;  4KHP E;  3PS1 A;  4PRV A;  2LJP A;  1ZXN A;  3JAM Q;  2UXC I;  4Z7Y A;  4LF4 I;  2DEI A;  1ZXM A;  4LOM A;  4JI0 E;  4JI7 I;  4DV4 I;  2UXB E;  1USU A;  2C38 A;  5JEA E;  1B62 A;  3NZK A;  4I3H A;  4B3R I;  4JI1 I;  1HNX I;  4DPY A;  4JI4 I;  1Y4S A;  4USK A;  1PKP A;  5FLX C;  3M7N G;  5LMU E;  2E5L E;  5FWK A;  2F4V I;  1KVK A;  4NXM I;  2PO2 A;  4PRX A;  4ED4 A;  4DR1 I;  4B3T I;  4DV6 E;  4AQY E;  2R3V A;  2UUC E;  3QT7 A;  3HKM A;  4DR6 I;  3WU5 A;  3M85 G;  4LFA I;  2O1W A;  4X66 I;  2O1U A;  2PNL A;  3LPS A;  1H72 C;  1OYS A;  4IFD B;  1NHI A;  2HFS A;  5IT9 C;  5K36 A;  5K36 E;  3Q6M A;  2A2D A;  1A6F A;  4K0K E;  1IBM I;  3J7A G;  3U1Y A;  3J80 Q;  1XMO E;  4JI8 E;  2VQE E;  2C39 A;  3Q6N A;  2R42 A;  4DU7 A;  4LF7 E;  3M6A A;  1N33 I;  3B78 A;  3L7Z A;  4DV4 E;  2Z5C B;  1N32 E;  4OO1 E;  5LL6 R;  5JEA B;  3PYF A;  2PO0 B;  1XNR E;  4JI4 E;  1HNW I;  5GME A;  2IOP A;  4IZK A;  4MYT A;  3ZM7 A;  2V34 A;  2PNZ A;  2AJ4 A;  1XNQ I;  4GKJ I;  4NXN E;  2HHH I;  2IER A;  4NXM E;  4ZVI A;  5LMN I;  4DV5 E;  4B3T E;  1UDN A;  2HFU A;  1HK7 A;  3ZZ0 A;  2WNR A;  4LFA E;  4LCG A;  4DV1 I;  1Y5Y A;  2E1R A;  2HK2 A;  2F1D A;  2ZM6 E;  1P42 A;  2JEA B;  1PVG A;  1VIS A;  4IZJ A;  5IWA I;  3QT5 A;  5K36 D;  1IBK I;  1Z5B A;  2JT2 A;  2GQ0 A;  2WP8 A;  4HAC A;  1FKA E;  1EI1 A;  4HYM A;  5C0X F;  5ELW A;  5EKW A;  5FLX Q;  1XMQ I;  4GQU A;  4B3M I;  4BA2 B;  3D4J A;  4FWG A;  4OO1 D;  4YHH I;  2V2Q A;  2UU9 E;  2A2C A;  3OTO E;  4WUD A;  3CDJ A;  4LF5 I;  4DR4 E;  3KRN A;  4DUY E;  3F0N A;  3ZZT A;  4LF9 I;  1UDQ A;  4X62 E;  2JE6 A;  4XTJ A;  2X7I A;  5IT9 Q;  3K1J A;  1H74 A;  2BM0 A;  4LFC I;  1N34 E;  3T1Y E;  4AM3 A;  1UDO A;  4DU8 A;  3Q1Q A;  3WU6 A;  2NN6 A;  4DXL A;  4JG4 A;  5K36 C;  3GLL A;  1H73 A;  2PO1 A;  4LFB E;  4IZJ D;  2V8P A;  1Z59 A;  4IFD F;  1Z5C A;  5IWA E;  1U2R A;  1MX0 A;  1HR0 I;  4J3D A;  1S16 A;  4JI6 I;  4OO1 C;  1XMQ E;  1Z0W A;  4BA1 A;  3T1H E;  1Z0G A;  4OX9 I;  4DV2 I;  3GCM A;  1Z0E A;  4MU3 A;  2GS8 A;  2HKJ A;  3PS2 A;  1D6T A;  2IES A;  4FN5 A;  4GKK E;  4FW4 A;  5JEA F;  4JV5 E;  2UXD I;  1YHC A;  2C37 A;  3B82 A;  4DV3 E;  3LTO A;  2EFG A;  3J81 C;  2PO0 A;  4DR7 I;  4FW9 A;  1Y4U A;  4JI2 I;  1WUU A;  4DR3 I;  4JI3 I;  4YY3 I;  1IBL I;  3P06 A;  2V2Z A;  2NN6 D;  4X64 I;  4N3O A;  2BV3 A;  2UXC E;  4IS9 A;  4JYA I;  4LF4 E;  4LF6 I;  2JEA A;  2BA1 G;  3GON A;  4JI7 E;  5DRQ A;  3V2U C;  2Z5B B;  3M7N D;  4DV7 I;  2UUB I;  2C38 B;  4B3R E;  4JI1 E;  5BR8 I;  1HNZ I;  2AE8 A;  1HNX E;  4JI5 I;  2VES A;  2UUA I;  3M85 D;  1FJG I;  1Z5A A;  2F4V E;  1NZ0 A;  2NPF A;  4MU0 A;  3ZZU A;  4DV0 I;  4DR1 E;  4OO1 F;  3GME A;  4DUZ I;  2DEJ A;  4DR6 E;  2BA0 G;  3P3G A;  3QT8 A;  1E3H A;  3JAM C;  4LF8 I;  4X66 E;  1Z0C A;  1J5E I;  1N0V C;  1ZM3 A;  3LNU A;  5DNX A;  4B3S I;  2NN6 C;  4DPW A;  4JI3 E;  1Y60 A;  4DPU A;  2J7K A;  2CGE A;  4DR5 I;  5DRO A;  1N36 I;  3P3C A;  5K36 B;  1IBM E;  2VQF I;  2JEB A;  4MYU A;  5C0X A;  4LF6 E;  3HUL A;  1I94 I;  1FWK A;  4M1K A;  4FWH A;  4OZE A;  2O3Z A;  4UTG A;  4LCH A;  1N33 E;  4NBQ A;  1H7U A;  4OO1 B;  3J81 Q;  3L7Z B;  3QT6 A;  1HNW E;  4JI0 I;  2UXB I;  4LCF A;  3V5R A;  1XHK A;  2BA0 D;  2GO4 A;  1XNQ E;  4GKJ E;  2PNZ B;  2HHH E;  4MQY A;  4LPF A;  5LMN E;  1R6M A;  3HJC A;  1Z0T A;  1OJ4 A;  3ZKD A;  5A2Q C;  3J80 C;  5LMU I;  2E5L I;  2WNR B;  4DV1 E;  3CDI A;  4DPT A;  2NN6 E;  4X65 I;  1BKN A;  5DRP A;  4DV6 I;  4AQY I;  2UUC I;  3J7A M;  1FI4 A;  1Z0B A;  3PYD A;  1IBK E;  1H7S A;  4IZJ B;  1ELO A;  4IFD A;  1E3P A;  3P76 A;  3H1C A;  2WP8 B;  4HAC B;  2PNM A;  5C0X D;  4B3M E;  4YHH E;  3DD6 A;  4K0K I;  3PRY A;  4HXZ A;  1N0U A;  1XMO I; 
#chains in the Genus database with same CATH homology
 1KIJ A;  4JI8 I;  4URL A;  2VQE I;  4LF5 E;  2CZ9 A;  2Z5C A;  4LF7 I;  1B63 A;  2Z5B A;  2HK3 A;  2VF3 A;  4LF9 E;  1N32 I;  2V2V A;  1XNR I;  4LFC E;  4DR2 I;  4HY1 A;  1UEK A;  1FNM A;  4NXN I;  4DV5 I;  4X65 E;  2XEX A;  2IOQ A;  3K17 A;  1HR0 E;  2ZM6 I;  4JI6 E;  4USM A;  1ZM9 A;  2WW4 A;  4UT4 A;  4OX9 E;  4DV2 E;  1DAR A;  3K85 A;  5A2Q Q;  1KKH A;  2ZBK B;  4WUB A;  4DPX A;  1FWL A;  2UXD E;  2X36 A;  2UU9 I;  3OTO I;  2Q2E B;  4DR7 E;  4DR4 I;  1KTV A;  4DUY I;  4JI2 E;  1S4E A;  4DR2 E;  1Y6Z A;  4DR3 E;  1K47 A;  3B8H A;  4YY3 E;  4X62 I;  1IBL E;  4Z7C A;  3ZKB A;  1N34 I;  2BM1 A;  2ZIT A;  3PYE A;  4X64 E;  3T1Y I;  1RRE A;  2CG9 A;  4WUC A;  2O1V A;  4EMD A;  4JYA E;  1NHJ A;  4LFB I;  4KHP I;  4P52 A;  4DV7 E;  2UUB E;  5BR8 E;  1HNZ E;  4JI5 E;  1ZM2 A;  1PIE A;  2UUA E;  4IZK B;  1FJG E;  1QZR A;  3T1H I;  4DV0 E;  4FWD A;  2Z5E A;  1MU5 A;  4DUZ E;  4PU9 A;  5L3J A;  3PYG A;  4RPF A;  4GKK I;  4LF8 E;  5GMD A;  1J5E E;  4JV5 I;  1RR9 A;  4B3S E;  1ZM4 A;  1Z0V A;  1MG7 A;  4KQV A;  4P7A A;  4DV3 I;  1NHH A;  4DR5 E;  3H4L A;  1N36 E;  1USV A;  1EA6 A;  2VQF E;  2OI2 A;  2HKE A;  1I94 E;  3CWV A;  4R1F A;  3WU3 A;  3WU4 A;  2O1T A;  4KHP E;  4PRV A;  2LJP A;  1ZXN A;  3JAM Q;  2UXC I;  4Z7Y A;  4LF4 I;  2DEI A;  1ZXM A;  4JI0 E;  4JI7 I;  4DV4 I;  2UXB E;  1USU A;  1B62 A;  4I3H A;  4B3R I;  4JI1 I;  1HNX I;  4DPY A;  4JI4 I;  1Y4S A;  4USK A;  1PKP A;  5FLX C;  5LMU E;  2E5L E;  5FWK A;  2F4V I;  1KVK A;  4NXM I;  4PRX A;  4ED4 A;  4DR1 I;  4B3T I;  4DV6 E;  4AQY E;  2R3V A;  2UUC E;  3QT7 A;  4DR6 I;  3WU5 A;  4LFA I;  2O1W A;  4X66 I;  2O1U A;  2PNL A;  3LPS A;  1H72 C;  1NHI A;  2HFS A;  5IT9 C;  3Q6M A;  2A2D A;  1A6F A;  4K0K E;  1IBM I;  3J7A G;  3J80 Q;  1XMO E;  4JI8 E;  2VQE E;  3Q6N A;  2R42 A;  4DU7 A;  4LF7 E;  3M6A A;  1N33 I;  3B78 A;  4DV4 E;  1N32 E;  2Z5C B;  5LL6 R;  3PYF A;  1XNR E;  4JI4 E;  1HNW I;  5GME A;  2IOP A;  4IZK A;  4MYT A;  3ZM7 A;  2V34 A;  2AJ4 A;  1XNQ I;  4GKJ I;  4NXN E;  2HHH I;  4NXM E;  4ZVI A;  5LMN I;  4DV5 E;  4B3T E;  2HFU A;  1HK7 A;  3ZZ0 A;  4LFA E;  4DV1 I;  2E1R A;  2HK2 A;  2ZM6 E;  1PVG A;  1VIS A;  4IZJ A;  5IWA I;  3QT5 A;  1IBK I;  1Z5B A;  2GQ0 A;  1FKA E;  4HAC A;  1EI1 A;  4HYM A;  5FLX Q;  1XMQ I;  4B3M I;  3D4J A;  4FWG A;  4YHH I;  2V2Q A;  2UU9 E;  2A2C A;  3OTO E;  4WUD A;  4LF5 I;  4DR4 E;  4DUY E;  3F0N A;  3ZZT A;  4LF9 I;  4X62 E;  4XTJ A;  2X7I A;  5IT9 Q;  3K1J A;  1H74 A;  2BM0 A;  4LFC I;  1N34 E;  3T1Y E;  4DU8 A;  3Q1Q A;  3WU6 A;  4DXL A;  4JG4 A;  1H73 A;  4LFB E;  4IZJ D;  2V8P A;  1Z59 A;  1Z5C A;  5IWA E;  1U2R A;  1MX0 A;  1HR0 I;  1S16 A;  4JI6 I;  1XMQ E;  1Z0W A;  3T1H E;  1Z0G A;  4OX9 I;  4DV2 I;  1Z0E A;  2GS8 A;  2HKJ A;  1D6T A;  4FN5 A;  4GKK E;  4JV5 E;  2UXD I;  3B82 A;  4DV3 E;  3LTO A;  2EFG A;  3J81 C;  4DR7 I;  4FW9 A;  1Y4U A;  4JI2 I;  1WUU A;  4DR3 I;  4JI3 I;  4YY3 I;  1IBL I;  3P06 A;  2V2Z A;  4X64 I;  4N3O A;  2BV3 A;  2UXC E;  4JYA I;  4LF4 E;  4LF6 I;  3GON A;  4JI7 E;  3V2U C;  2Z5B B;  4DV7 I;  2UUB I;  4B3R E;  4JI1 E;  5BR8 I;  1HNZ I;  1HNX E;  4JI5 I;  2UUA I;  1FJG I;  1Z5A A;  2F4V E;  1NZ0 A;  2NPF A;  3ZZU A;  4DV0 I;  4DR1 E;  4DUZ I;  2DEJ A;  4DR6 E;  3QT8 A;  3JAM C;  4LF8 I;  4X66 E;  1Z0C A;  1J5E I;  1N0V C;  1ZM3 A;  3LNU A;  4B3S I;  4DPW A;  4JI3 E;  4DPU A;  2J7K A;  2CGE A;  4DR5 I;  1N36 I;  1IBM E;  2VQF I;  4MYU A;  4LF6 E;  3HUL A;  1I94 I;  1FWK A;  4M1K A;  4FWH A;  4UTG A;  1N33 E;  1H7U A;  3J81 Q;  3QT6 A;  1HNW E;  4JI0 I;  2UXB I;  3V5R A;  1XHK A;  1XNQ E;  4GKJ E;  2HHH E;  5LMN E;  3HJC A;  1Z0T A;  1OJ4 A;  3ZKD A;  5A2Q C;  3J80 C;  5LMU I;  2E5L I;  4DV1 E;  4DPT A;  4X65 I;  1BKN A;  4DV6 I;  4AQY I;  2UUC I;  3J7A M;  1FI4 A;  1Z0B A;  3PYD A;  1IBK E;  1H7S A;  4IZJ B;  1ELO A;  4HAC B;  2PNM A;  4B3M E;  4YHH E;  4K0K I;  3PRY A;  4HXZ A;  1N0U A;  1XMO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...