1IBKI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ibkI00
3QT7A 1ZXNA 1ZM3A 3ZKBA 2UXDE 1WUUA 2EFGA 4JI2E 2HHHI 2WW4A 4URLA 2V2QA 1N36E 4FN5A 4WUDA 4JI5I 2E1RA 4DV4E 1FI4A 3T1HI 4ED4A 4USMA 1FWLA 4LFCE 3GONA 4JI8E 2Q2EB 4X66E 3LTOA 2LJPA 4DUYE 4DV5I 2UUCE 1DARA 4DR3E 4RPFA 1RR9A 2UUBI 2E5LE 3OTOE 5LMUE 1PIEA 4JI0E 1ELOA 3PYEA 5GMEA 1N32E 4DV6E 1KIJA 4HACB 1U2RA 3Q1QA 1Z5AA 4WUBA 4DU7A 4MYTA 4FWHA 1I94E 3PYGA 3OTOI 2E5LI 1FWKA 1D6TA 4LF4E 1IBLE 2NPFA 3B8HA 1ZXMA 3ZZ0A 4K0KE 2UUAE 1RREA 4X64I 1A6FA 2HKJA 2HFSA 4DR5I 4GKKE 2V2VA 3H4LA 2UU9E 4JI8I 3PYFA 4UT4A 4M1KA 1H72C 2XEXA 3T1HE 4YHHI 4JI5E 4P52A 4DUZI 4HY1A 5GMDA 4USKA 2BM1A 4NXMI 4X65I 4B3RE 2UXCI 2UU9I 1Z0GA 1UEKA 4JI4I 1N0VC 4B3SE 3QT6A 4X64E 4DR1E 4K0KI 4LF8I 4NXNE 3LNUA 5BR8E 5A2QC 1IBLI 1XMOI 4LF4I 4DR6E 4UTGA 4JI7I 1I94I 4Z7CA 1XNRE 4Z7YA 4DR2E 1FJGI 3T1YI 2BV3A 4DV7I 1N32I 3JAMC 3B82A 4HACA 3CWVA 4EMDA 2HFUA 1N0UA 4DV0I 4DPXA 4KHPE 3JAMQ 2VQEI 4X62E 5IWAE 1Z0TA 4DR7E 2ZM6I 1ZM4A 1NHHA 1EA6A 2DEIA 4DPYA 4LF6I 3ZZUA 4OX9E 1FNMA 4I3HA 3F0NA 4PRVA 4B3TI 3J81C 1MX0A 2UXBI 1HNZI 5L3JA 1N36I 2HK2A 4PRXA 1HR0E 4LF7I 1NHJA 3WU5A 2HHHE 4JV5E 1B62A 4MYUA 4JI2I 3J7AG 1J5EE 4PU9A 4AQYE 4LF7E 4LF9E 4JYAE 4LFBE 4B3TE 3J7AM 4KQVA 2V34A 1HNWI 4LFAI 5FLXC 1Z0BA 4JG4A 1MU5A 1N34E 4JI3I 1IBME 1VISA 3D4JA 2ZM6E 3QT8A 3M6AA 3WU6A 1OJ4A 2F4VE 4DV0E 3J80C 1NZ0A 1H7SA 4DV1I 4DV7E 1QZRA 3T1YE 2J7KA 2V8PA 4LFAE 2V2ZA 1HNWE 1MG7A 3WU3A 1XNRI 1XMQE 3V5RA 4JI7E 4DR6I 1N33E 4JI1I 5LMNE 1K47A 4JI6I 4LF5I 4LF8E 3J80Q 1Z59A 2ZITA 4B3ME 4JV5I 4GKJE 4ZVIA 1ZM9A 4DUZE 1HR0I 1KVKA 1KKHA 2VQFE 5LMNI 1N33I 1HNZE 2UXBE 1XMQI 1NHIA 1HNXE 1H74A 2OI2A 2X7IA 1IBKE 4DV1E 4HYMA 4XTJA 4DV2I 4KHPI 4DU8A 3HULA 3ZM7A 2BM0A 2R42A 4DV2E 1IBMI 2HKEA 1N34I 1IBKI 3B78A 1KTVA 2CZ9A 3QT5A 4DV6I 4DR2I 1HNXI 1Z0WA 1FJGE 1Z0VA 1FKAE 1XMOE 4FWDA 1Z0CA 2VQFI 2DEJA 2A2CA 4DR3I 4LF9I 4GKJI 4B3MI 3V2UC 4X66I 1B63A 4JI4E 1J5EI 3ZZTA 1PVGA 4FW9A 4P7AA 4X65E 4NXME 4B3RI 2UXCE 2R3VA 4LFCI 3K1JA 4LF5E 3J81Q 4JI6E 4YHHE 2HK3A 1S4EA 4JI1E 4DV4I 4HXZA 5A2QQ 4DPTA 2X36A 4OX9I 1Z0EA 4LF6E 1Z5BA 2UXDI 4DR5E 4GKKI 1BKNA 4FWGA 2UUAI 4DR7I 5IWAI 3PYDA 4X62I 2GS8A 2VQEE 4DV3E 4DR4I 2F4VI 5IT9C 2A2DA 4WUCA 4R1FA 1XNQE 4YY3E 1XHKA 4JI3E 5FLXQ 1H7UA 2ZBKB 3K17A 1Z5CA 3WU4A 2AJ4A 3LPSA 4YY3I 1PKPA 4DPWA 1XNQI 1EI1A 4JI0I 1ZM2A 5LMUI 2VF3A 4DPUA 4LFBI 2UUBE 3ZKDA 1H73A 4DR4E 4DV3I 5BR8I 4JYAI 5LL6R 4NXNI 5IT9Q 4DXLA 2UUCI 1S16A 4DUYI 4DV5E 4DR1I 4AQYI 4B3SI
chains in the Genus database with same CATH superfamily
3QT7A 1ZXNA 1ZM3A 3ZKBA 2UXDE 1WUUA 3Q6NA 2C38A 2EFGA 4JI2E 4MU3A 2HHHI 2O3ZA 2BA1D 2WW4A 4URLA 2V2QA 1N36E 4FN5A 4WUDA 4JI5I 2E1RA 4DV4E 1FI4A 3T1HI 4ED4A 4OZEA 4USMA 2JEBB 1FWLA 4LFCE 3GONA 1Y4UA 4JI8E 2Q2EB 4X66E 4BA1B 4AIMA 3LTOA 2LJPA 4DUYE 1RHYA 4DV5I 2UUCE 4OO1D 4OO1F 1DARA 4DR3E 4BA2B 4RPFA 1RR9A 2UUBI 2E5LE 3OTOE 3CDIA 5LMUE 1PIEA 4JI0E 1ELOA 3PYEA 5GMEA 3HJCA 4N3OA 1N32E 1HK7A 5DRQA 2PNZB 2NN6B 5C0XD 4DV6E 1KIJA 1Y5YA 4HACB 1U2RA 3Q1QA 1Z5AA 4WUBA 4DU7A 4MYTA 5EL9A 5C0XE 4FWHA 1I94E 3PYGA 3OTOI 2E5LI 1FWKA 1D6TA 4LF4E 5C0XB 2C37A 1IBLE 2NPFA 1YHCA 3B8HA 4OO1B 1ZXMA 3H1CA 3ZZ0A 2UUAE 4K0KE 1RREA 4X64I 1A6FA 2HKJA 2HFSA 4DR5I 1USVA 4GKKE 1OYRA 2V2VA 3H4LA 4IFDA 2BR2B 1R6MA 2UU9E 3DD6A 4JI8I 4MU4A 3PYFA 4UT4A 4M1KA 1H72C 2XEXA 3T1HE 4NBQA 4YHHI 2CG9A 4JI5E 3P06A 4P52A 5ELWA 5EKWA 4DUZI 4HY1A 5GMDA 4USKA 2BM1A 4X65I 2PO0B 4NXMI 4B3RE 2UXCI 2UU9I 1Z0GA 2F1DA 1UEKA 3P3GA 4U3DA 4JI4I 3CDJA 1N0VC 4B3SE 3QT6A 4X64E 4DR1E 2CGEA 4K0KI 4LF8I 2AE8A 4NXNE 3LNUA 5BR8E 5A2QC 1IBLI 2CVEA 1XMOI 4LF4I 4DR6E 4OO1C 4UTGA 4JI7I 2PO1B 1I94I 4Z7CA 1XNRE 4MQYA 3U1KA 2C38B 5FWKA 4Z7YA 4DR2E 4OO1E 1FJGI 3T1YI 2BV3A 4DV7I 1Y6ZA 2NN6A 1N32I 3JAMC 4FW6A 3B82A 4HACA 3CWVA 5C0XC 4FW5A 3U1YA 4EMDA 2HFUA 1N0UA 4DV0I 3Q6MA 4DPXA 4KHPE 3JAMQ 2VQEI 4X62E 4MU0A 3B4TA 1Z0TA 5IWAE 5C0XA 4DR7E 4LCGA 2ZM6I 1ZM4A 5DROA 3M7NG 4BA1A 5JEAC 1NHHA 1EA6A 2DEIA 3M85D 2VESA 4DPYA 4LF6I 3ZZUA 4OX9E 1FNMA 4I3HA 4BA2A 3F0NA 4U3BA 4IFDB 1E3HA 1R6LA 5JEAD 1UDQA 4PRVA 4B3TI 4AIDA 3J81C 1MX0A 2UXBI 1HNZI 5L3JA 3K85A 1Y4SA 1N36I 2HK2A 4PRXA 1HR0E 4LF7I 4FW4A 2IESA 1NHJA 3WU5A 2HHHE 4IFDD 4JV5E 1B62A 4MYUA 4JI2I 3J7AG 1J5EE 1XXEA 3NZKA 4PU9A 4LCFA 4AQYE 4IS9A 4LF7E 3P3CA 4LF9E 4JYAE 4OO1A 1E3PA 4LFBE 4B3TE 3J7AM 4KQVA 4MDTA 2WNRB 2V34A 1HNWI 4LFAI 4MU1A 5FLXC 1Z0BA 1OYSA 2GO4A 2JE6B 4JG4A 5DRPA 1MU5A 1N34E 4JI3I 1IBME 1VISA 3D4JA 2ZM6E 3QT8A 4IZJD 3M6AA 3WU6A 1OJ4A 5DNLA 2F4VE 4DV0E 1UDSA 2JT2A 2PNLA 4FW3A 3J80C 3PS2A 5JEAA 1NZ0A 1H7SA 4DV1I 2NN6F 4DV7E 1QZRA 3P3EA 2WP8B 3T1YE 2J7KA 2V8PA 4LFAE 2V2ZA 1HNWE 1MG7A 5K36C 3WU3A 1YH8A 3KRNA 1XNRI 3UHMA 1XMQE 3V5RA 4JI7E 4DR6I 1N33E 4JI1I 2NN6C 5LMNE 1K47A 4JI6I 4LF5I 4LF8E 3J80Q 1Z59A 4J3DA 4IFDC 1VI7A 5K36F 4FW7A 2ZITA 4B3ME 2PO1A 4JV5I 4GKJE 4ZVIA 2O1WA 3L7ZA 1ZM9A 4DUZE 1HR0I 1KVKA 1KKHA 2VQFE 3P76A 5K36B 2IOQA 5LMNI 4ISAA 2Z5EA 1N33I 1HNZE 1UDNA 2UXBE 4LOMA 4IFDE 3PRYA 1XMQI 1NHIA 2Z5CA 4IZJA 3GCMA 1HNXE 1H74A 1P42A 2BA1G 2PO2B 2OI2A 5K36D 2X7IA 2GQ0A 2Z5BA 1IBKE 4DV1E 4HYMA 4XTJA 4DV2I 4KHPI 1UDOA 4DU8A 5JEAE 3HULA 4LCHA 3ZM7A 2BM0A 2R42A 4DV2E 2IERA 1IBMI 2HKEA 1N34I 2O1UA 5C0XF 1IBKI 2IOPA 3B78A 1KTVA 2CZ9A 3QT5A 4DV6I 4DR2I 1HNXI 1Z0WA 1FJGE 2WP8A 5K36E 2JEAB 2C39B 1Z0VA 2BA0G 4QNKA 5JEAF 4IZKA 4GQUA 1FKAE 1XMOE 4FWDA 2WNRA 2O1VA 1Z0CA 4AM3A 2VQFI 2DEJA 2A2CA 4DR3I 4LF9I 4GKJI 2JE6A 4B3MI 3V2UC 4X66I 1B63A 4JI4E 1J5EI 3GLLA 3ZZTA 1PVGA 2PNZA 4FW9A 4P7AA 4X65E 4NXME 4B3RI 2UXCE 2R3VA 4LFCI 3K1JA 4LF5E 3J81Q 4JI6E 4QNJA 4YHHE 2HK3A 1S4EA 2BA0D 3M7ND 4JI1E 3L7ZB 5JEAB 2JEBA 4DV4I 4HXZA 5A2QQ 1OYPA 5K36A 4DPTA 2NN6D 3PS1A 2X36A 4OX9I 2NN6E 3PS3A 1Z0EA 4LF6E 1Z5BA 2UXDI 2Z5CB 4DR5E 4GKKI 2O1TA 1BKNA 4FWGA 2UUAI 4DR7I 2PNMA 5IWAI 3PYDA 4X62I 2GS8A 5DNXA 4OKGA 2VQEE 4DV3E 4DR4I 2F4VI 2J65A 3GMEA 5IT9C 5DRRA 2A2DA 4WUCA 4R1FA 4LPFA 1XNQE 3HKMA 4YY3E 1XHKA 4JI3E 5FLXQ 1H7UA 2ZBKB 3K17A 1Z5CA 2PO0A 3WU4A 2AJ4A 3LPSA 4YY3I 1PKPA 4DPWA 2GO3A 1XNQI 1EI1A 2C37B 1Y60A 4JI0I 1ZM2A 5LMUI 2VF3A 4IFDF 4DPUA 4LFBI 2UUBE 3M85G 3ZKDA 2JEAA 2C39A 1H73A 4IZJB 4DR4E 1USUA 4DV3I 5BR8I 4JYAI 5LL6R 4NXNI 4IZKB 5IT9Q 4DXLA 2PO2A 1S16A 2BR2A 4DUYI 4DV5E 4DR1I 4AQYI 2UUCI 4B3SI 2Z5BB
chains in the Genus database with same CATH topology
3QT7A 1ZXNA 1ZM3A 3ZKBA 2UXDE 1WUUA 3Q6NA 2EFGA 4JI2E 2HHHI 2WW4A 4URLA 2V2QA 1N36E 4FN5A 4WUDA 4JI5I 2E1RA 4DV4E 1FI4A 3T1HI 4ED4A 4USMA 1FWLA 4LFCE 3GONA 1Y4UA 4JI8E 2Q2EB 4X66E 3LTOA 2LJPA 4DUYE 4DV5I 2UUCE 1DARA 4DR3E 4RPFA 1RR9A 2UUBI 2E5LE 3OTOE 5LMUE 1PIEA 4JI0E 1ELOA 3PYEA 5GMEA 3HJCA 4N3OA 1N32E 1HK7A 4DV6E 1KIJA 4HACB 1U2RA 3Q1QA 1Z5AA 4WUBA 4DU7A 4MYTA 4FWHA 1I94E 3PYGA 3OTOI 2E5LI 1FWKA 1D6TA 4LF4E 1IBLE 2NPFA 3B8HA 1ZXMA 3ZZ0A 4K0KE 2UUAE 1RREA 4X64I 1A6FA 2HKJA 2HFSA 4DR5I 1USVA 4GKKE 2V2VA 3H4LA 2UU9E 4JI8I 3PYFA 4UT4A 4M1KA 1H72C 2XEXA 3T1HE 4YHHI 2CG9A 4JI5E 3P06A 4P52A 4DUZI 4HY1A 5GMDA 4USKA 2BM1A 4X65I 4NXMI 4B3RE 2UXCI 2UU9I 1Z0GA 1UEKA 4JI4I 1N0VC 4B3SE 3QT6A 4X64E 4DR1E 2CGEA 4K0KI 4LF8I 4NXNE 3LNUA 5BR8E 5A2QC 1IBLI 1XMOI 4LF4I 4DR6E 4UTGA 4JI7I 1I94I 4Z7CA 1XNRE 5FWKA 4Z7YA 4DR2E 1FJGI 3T1YI 2BV3A 4DV7I 1Y6ZA 1N32I 3JAMC 3B82A 4HACA 3CWVA 4EMDA 2HFUA 1N0UA 4DV0I 3Q6MA 4DPXA 4KHPE 3JAMQ 2VQEI 4X62E 5IWAE 1Z0TA 4DR7E 2ZM6I 1ZM4A 1NHHA 1EA6A 2DEIA 4DPYA 4LF6I 3ZZUA 4OX9E 1FNMA 4I3HA 3F0NA 4PRVA 4B3TI 3J81C 1MX0A 2UXBI 1HNZI 5L3JA 3K85A 1Y4SA 1N36I 2HK2A 4PRXA 1HR0E 4LF7I 1NHJA 3WU5A 2HHHE 4JV5E 1B62A 4MYUA 4JI2I 3J7AG 1J5EE 4PU9A 4AQYE 4LF7E 4LF9E 4JYAE 4LFBE 4B3TE 3J7AM 4KQVA 2V34A 1HNWI 4LFAI 5FLXC 1Z0BA 4JG4A 1MU5A 1N34E 4JI3I 1IBME 1VISA 3D4JA 2ZM6E 3QT8A 4IZJD 3M6AA 3WU6A 1OJ4A 2F4VE 4DV0E 2PNLA 3J80C 1NZ0A 1H7SA 4DV1I 4DV7E 1QZRA 3T1YE 2J7KA 2V8PA 4LFAE 2V2ZA 1HNWE 1MG7A 3WU3A 1XNRI 1XMQE 3V5RA 4JI7E 4DR6I 1N33E 4JI1I 5LMNE 1K47A 4JI6I 4LF5I 4LF8E 3J80Q 1Z59A 2ZITA 4B3ME 4JV5I 4GKJE 4ZVIA 2O1WA 1ZM9A 4DUZE 1HR0I 1KVKA 1KKHA 2VQFE 2IOQA 5LMNI 2Z5EA 1N33I 1HNZE 2UXBE 3PRYA 1XMQI 1NHIA 2Z5CA 4IZJA 1HNXE 1H74A 2OI2A 2X7IA 2GQ0A 2Z5BA 1IBKE 4DV1E 4HYMA 4XTJA 4DV2I 4KHPI 4DU8A 3HULA 3ZM7A 2BM0A 2R42A 4DV2E 1IBMI 2HKEA 1N34I 1IBKI 2O1UA 2IOPA 3B78A 1KTVA 2CZ9A 3QT5A 4DV6I 4DR2I 1HNXI 1Z0WA 1FJGE 1Z0VA 4IZKA 1FKAE 1XMOE 4FWDA 2O1VA 1Z0CA 2VQFI 2DEJA 2A2CA 4DR3I 4LF9I 4GKJI 4B3MI 3V2UC 4X66I 1B63A 4JI4E 1J5EI 3ZZTA 1PVGA 4FW9A 4P7AA 4X65E 4NXME 4B3RI 2UXCE 2R3VA 4LFCI 3K1JA 4LF5E 3J81Q 4JI6E 4YHHE 2HK3A 1S4EA 4JI1E 4DV4I 4HXZA 5A2QQ 4DPTA 2X36A 4OX9I 1Z0EA 4LF6E 1Z5BA 2UXDI 2Z5CB 4DR5E 4GKKI 2O1TA 1BKNA 4FWGA 2UUAI 4DR7I 2PNMA 5IWAI 3PYDA 4X62I 2GS8A 2VQEE 4DV3E 4DR4I 2F4VI 5IT9C 2A2DA 4WUCA 4R1FA 1XNQE 4YY3E 1XHKA 4JI3E 5FLXQ 1H7UA 2ZBKB 3K17A 1Z5CA 3WU4A 2AJ4A 3LPSA 4YY3I 1PKPA 4DPWA 1XNQI 1EI1A 4JI0I 1ZM2A 5LMUI 2VF3A 4DPUA 4LFBI 2UUBE 3ZKDA 1H73A 4IZJB 4DR4E 1USUA 4DV3I 5BR8I 4JYAI 5LL6R 4NXNI 4IZKB 5IT9Q 4DXLA 2UUCI 1S16A 4DUYI 4DV5E 4DR1I 4AQYI 4B3SI 2Z5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT7 A;  1ZXN A;  1ZM3 A;  3ZKB A;  2UXD E;  1WUU A;  2EFG A;  4JI2 E;  2HHH I;  2WW4 A;  4URL A;  2V2Q A;  1N36 E;  4FN5 A;  4WUD A;  4JI5 I;  2E1R A;  4DV4 E;  1FI4 A;  3T1H I;  4ED4 A;  4USM A;  1FWL A;  4LFC E;  3GON A;  4JI8 E;  2Q2E B;  4X66 E;  3LTO A;  2LJP A;  4DUY E;  4DV5 I;  2UUC E;  1DAR A;  4DR3 E;  4RPF A;  1RR9 A;  2UUB I;  2E5L E;  3OTO E;  5LMU E;  1PIE A;  4JI0 E;  1ELO A;  3PYE A;  5GME A;  1N32 E;  4DV6 E;  1KIJ A;  4HAC B;  1U2R A;  3Q1Q A;  1Z5A A;  4WUB A;  4DU7 A;  4MYT A;  4FWH A;  1I94 E;  3PYG A;  3OTO I;  2E5L I;  1FWK A;  1D6T A;  4LF4 E;  1IBL E;  2NPF A;  3B8H A;  1ZXM A;  3ZZ0 A;  4K0K E;  2UUA E;  1RRE A;  4X64 I;  1A6F A;  2HKJ A;  2HFS A;  4DR5 I;  4GKK E;  2V2V A;  3H4L A;  2UU9 E;  4JI8 I;  3PYF A;  4UT4 A;  4M1K A;  1H72 C;  2XEX A;  3T1H E;  4YHH I;  4JI5 E;  4P52 A;  4DUZ I;  4HY1 A;  5GMD A;  4USK A;  2BM1 A;  4NXM I;  4X65 I;  4B3R E;  2UXC I;  2UU9 I;  1Z0G A;  1UEK A;  4JI4 I;  1N0V C;  4B3S E;  3QT6 A;  4X64 E;  4DR1 E;  4K0K I;  4LF8 I;  4NXN E;  3LNU A;  5BR8 E;  5A2Q C;  1IBL I;  1XMO I;  4LF4 I;  4DR6 E;  4UTG A;  4JI7 I;  1I94 I;  4Z7C A;  1XNR E;  4Z7Y A;  4DR2 E;  1FJG I;  3T1Y I;  2BV3 A;  4DV7 I;  1N32 I;  3JAM C;  3B82 A;  4HAC A;  3CWV A;  4EMD A;  2HFU A;  1N0U A;  4DV0 I;  4DPX A;  4KHP E;  3JAM Q;  2VQE I;  4X62 E;  5IWA E;  1Z0T A;  4DR7 E;  2ZM6 I;  1ZM4 A;  1NHH A;  1EA6 A;  2DEI A;  4DPY A;  4LF6 I;  3ZZU A;  4OX9 E;  1FNM A;  4I3H A;  3F0N A;  4PRV A;  4B3T I;  3J81 C;  1MX0 A;  2UXB I;  1HNZ I;  5L3J A;  1N36 I;  2HK2 A;  4PRX A;  1HR0 E;  4LF7 I;  1NHJ A;  3WU5 A;  2HHH E;  4JV5 E;  1B62 A;  4MYU A;  4JI2 I;  3J7A G;  1J5E E;  4PU9 A;  4AQY E;  4LF7 E;  4LF9 E;  4JYA E;  4LFB E;  4B3T E;  3J7A M;  4KQV A;  2V34 A;  1HNW I;  4LFA I;  5FLX C;  1Z0B A;  4JG4 A;  1MU5 A;  1N34 E;  4JI3 I;  1IBM E;  1VIS A;  3D4J A;  2ZM6 E;  3QT8 A;  3M6A A;  3WU6 A;  1OJ4 A;  2F4V E;  4DV0 E;  3J80 C;  1NZ0 A;  1H7S A;  4DV1 I;  4DV7 E;  1QZR A;  3T1Y E;  2J7K A;  2V8P A;  4LFA E;  2V2Z A;  1HNW E;  1MG7 A;  3WU3 A;  1XNR I;  1XMQ E;  3V5R A;  4JI7 E;  4DR6 I;  1N33 E;  4JI1 I;  5LMN E;  1K47 A;  4JI6 I;  4LF5 I;  4LF8 E;  3J80 Q;  1Z59 A;  2ZIT A;  4B3M E;  4JV5 I;  4GKJ E;  4ZVI A;  1ZM9 A;  4DUZ E;  1HR0 I;  1KVK A;  1KKH A;  2VQF E;  5LMN I;  1N33 I;  1HNZ E;  2UXB E;  1XMQ I;  1NHI A;  1HNX E;  1H74 A;  2OI2 A;  2X7I A;  1IBK E;  4DV1 E;  4HYM A;  4XTJ A;  4DV2 I;  4KHP I;  4DU8 A;  3HUL A;  3ZM7 A;  2BM0 A;  2R42 A;  4DV2 E;  1IBM I;  2HKE A;  1N34 I;  1IBK I;  3B78 A;  1KTV A;  2CZ9 A;  3QT5 A;  4DV6 I;  4DR2 I;  1HNX I;  1Z0W A;  1FJG E;  1Z0V A;  1FKA E;  1XMO E;  4FWD A;  1Z0C A;  2VQF I;  2DEJ A;  2A2C A;  4DR3 I;  4LF9 I;  4GKJ I;  4B3M I;  3V2U C;  4X66 I;  1B63 A;  4JI4 E;  1J5E I;  3ZZT A;  1PVG A;  4FW9 A;  4P7A A;  4X65 E;  4NXM E;  4B3R I;  2UXC E;  2R3V A;  4LFC I;  3K1J A;  4LF5 E;  3J81 Q;  4JI6 E;  4YHH E;  2HK3 A;  1S4E A;  4JI1 E;  4DV4 I;  4HXZ A;  5A2Q Q;  4DPT A;  2X36 A;  4OX9 I;  1Z0E A;  4LF6 E;  1Z5B A;  2UXD I;  4DR5 E;  4GKK I;  1BKN A;  4FWG A;  2UUA I;  4DR7 I;  5IWA I;  3PYD A;  4X62 I;  2GS8 A;  2VQE E;  4DV3 E;  4DR4 I;  2F4V I;  5IT9 C;  2A2D A;  4WUC A;  4R1F A;  1XNQ E;  4YY3 E;  1XHK A;  4JI3 E;  5FLX Q;  1H7U A;  2ZBK B;  3K17 A;  1Z5C A;  3WU4 A;  2AJ4 A;  3LPS A;  4YY3 I;  1PKP A;  4DPW A;  1XNQ I;  1EI1 A;  4JI0 I;  1ZM2 A;  5LMU I;  2VF3 A;  4DPU A;  4LFB I;  2UUB E;  3ZKD A;  1H73 A;  4DR4 E;  4DV3 I;  5BR8 I;  4JYA I;  5LL6 R;  4NXN I;  5IT9 Q;  4DXL A;  2UUC I;  1S16 A;  4DUY I;  4DV5 E;  4DR1 I;  4AQY I;  4B3S I; 
#chains in the Genus database with same CATH topology
 3QT7 A;  1ZXN A;  1ZM3 A;  3ZKB A;  2UXD E;  1WUU A;  3Q6N A;  2C38 A;  2EFG A;  4JI2 E;  4MU3 A;  2HHH I;  2O3Z A;  2BA1 D;  2WW4 A;  4URL A;  2V2Q A;  1N36 E;  4FN5 A;  4WUD A;  4JI5 I;  2E1R A;  4DV4 E;  1FI4 A;  3T1H I;  4ED4 A;  4OZE A;  4USM A;  2JEB B;  1FWL A;  4LFC E;  3GON A;  1Y4U A;  4JI8 E;  2Q2E B;  4X66 E;  4BA1 B;  4AIM A;  3LTO A;  2LJP A;  4DUY E;  1RHY A;  4DV5 I;  2UUC E;  4OO1 D;  4OO1 F;  1DAR A;  4DR3 E;  4BA2 B;  4RPF A;  1RR9 A;  2UUB I;  2E5L E;  3OTO E;  3CDI A;  5LMU E;  1PIE A;  4JI0 E;  1ELO A;  3PYE A;  5GME A;  3HJC A;  4N3O A;  1N32 E;  1HK7 A;  5DRQ A;  2PNZ B;  2NN6 B;  5C0X D;  4DV6 E;  1KIJ A;  1Y5Y A;  4HAC B;  1U2R A;  3Q1Q A;  1Z5A A;  4WUB A;  4DU7 A;  4MYT A;  5EL9 A;  5C0X E;  4FWH A;  1I94 E;  3PYG A;  3OTO I;  2E5L I;  1FWK A;  1D6T A;  4LF4 E;  5C0X B;  2C37 A;  1IBL E;  2NPF A;  1YHC A;  3B8H A;  4OO1 B;  1ZXM A;  3H1C A;  3ZZ0 A;  2UUA E;  4K0K E;  1RRE A;  4X64 I;  1A6F A;  2HKJ A;  2HFS A;  4DR5 I;  1USV A;  4GKK E;  1OYR A;  2V2V A;  3H4L A;  4IFD A;  2BR2 B;  1R6M A;  2UU9 E;  3DD6 A;  4JI8 I;  4MU4 A;  3PYF A;  4UT4 A;  4M1K A;  1H72 C;  2XEX A;  3T1H E;  4NBQ A;  4YHH I;  2CG9 A;  4JI5 E;  3P06 A;  4P52 A;  5ELW A;  5EKW A;  4DUZ I;  4HY1 A;  5GMD A;  4USK A;  2BM1 A;  4X65 I;  2PO0 B;  4NXM I;  4B3R E;  2UXC I;  2UU9 I;  1Z0G A;  2F1D A;  1UEK A;  3P3G A;  4U3D A;  4JI4 I;  3CDJ A;  1N0V C;  4B3S E;  3QT6 A;  4X64 E;  4DR1 E;  2CGE A;  4K0K I;  4LF8 I;  2AE8 A;  4NXN E;  3LNU A;  5BR8 E;  5A2Q C;  1IBL I;  2CVE A;  1XMO I;  4LF4 I;  4DR6 E;  4OO1 C;  4UTG A;  4JI7 I;  2PO1 B;  1I94 I;  4Z7C A;  1XNR E;  4MQY A;  3U1K A;  2C38 B;  5FWK A;  4Z7Y A;  4DR2 E;  4OO1 E;  1FJG I;  3T1Y I;  2BV3 A;  4DV7 I;  1Y6Z A;  2NN6 A;  1N32 I;  3JAM C;  4FW6 A;  3B82 A;  4HAC A;  3CWV A;  5C0X C;  4FW5 A;  3U1Y A;  4EMD A;  2HFU A;  1N0U A;  4DV0 I;  3Q6M A;  4DPX A;  4KHP E;  3JAM Q;  2VQE I;  4X62 E;  4MU0 A;  3B4T A;  1Z0T A;  5IWA E;  5C0X A;  4DR7 E;  4LCG A;  2ZM6 I;  1ZM4 A;  5DRO A;  3M7N G;  4BA1 A;  5JEA C;  1NHH A;  1EA6 A;  2DEI A;  3M85 D;  2VES A;  4DPY A;  4LF6 I;  3ZZU A;  4OX9 E;  1FNM A;  4I3H A;  4BA2 A;  3F0N A;  4U3B A;  4IFD B;  1E3H A;  1R6L A;  5JEA D;  1UDQ A;  4PRV A;  4B3T I;  4AID A;  3J81 C;  1MX0 A;  2UXB I;  1HNZ I;  5L3J A;  3K85 A;  1Y4S A;  1N36 I;  2HK2 A;  4PRX A;  1HR0 E;  4LF7 I;  4FW4 A;  2IES A;  1NHJ A;  3WU5 A;  2HHH E;  4IFD D;  4JV5 E;  1B62 A;  4MYU A;  4JI2 I;  3J7A G;  1J5E E;  1XXE A;  3NZK A;  4PU9 A;  4LCF A;  4AQY E;  4IS9 A;  4LF7 E;  3P3C A;  4LF9 E;  4JYA E;  4OO1 A;  1E3P A;  4LFB E;  4B3T E;  3J7A M;  4KQV A;  4MDT A;  2WNR B;  2V34 A;  1HNW I;  4LFA I;  4MU1 A;  5FLX C;  1Z0B A;  1OYS A;  2GO4 A;  2JE6 B;  4JG4 A;  5DRP A;  1MU5 A;  1N34 E;  4JI3 I;  1IBM E;  1VIS A;  3D4J A;  2ZM6 E;  3QT8 A;  4IZJ D;  3M6A A;  3WU6 A;  1OJ4 A;  5DNL A;  2F4V E;  4DV0 E;  1UDS A;  2JT2 A;  2PNL A;  4FW3 A;  3J80 C;  3PS2 A;  5JEA A;  1NZ0 A;  1H7S A;  4DV1 I;  2NN6 F;  4DV7 E;  1QZR A;  3P3E A;  2WP8 B;  3T1Y E;  2J7K A;  2V8P A;  4LFA E;  2V2Z A;  1HNW E;  1MG7 A;  5K36 C;  3WU3 A;  1YH8 A;  3KRN A;  1XNR I;  3UHM A;  1XMQ E;  3V5R A;  4JI7 E;  4DR6 I;  1N33 E;  4JI1 I;  2NN6 C;  5LMN E;  1K47 A;  4JI6 I;  4LF5 I;  4LF8 E;  3J80 Q;  1Z59 A;  4J3D A;  4IFD C;  1VI7 A;  5K36 F;  4FW7 A;  2ZIT A;  4B3M E;  2PO1 A;  4JV5 I;  4GKJ E;  4ZVI A;  2O1W A;  3L7Z A;  1ZM9 A;  4DUZ E;  1HR0 I;  1KVK A;  1KKH A;  2VQF E;  3P76 A;  5K36 B;  2IOQ A;  5LMN I;  4ISA A;  2Z5E A;  1N33 I;  1HNZ E;  1UDN A;  2UXB E;  4LOM A;  4IFD E;  3PRY A;  1XMQ I;  1NHI A;  2Z5C A;  4IZJ A;  3GCM A;  1HNX E;  1H74 A;  1P42 A;  2BA1 G;  2PO2 B;  2OI2 A;  5K36 D;  2X7I A;  2GQ0 A;  2Z5B A;  1IBK E;  4DV1 E;  4HYM A;  4XTJ A;  4DV2 I;  4KHP I;  1UDO A;  4DU8 A;  5JEA E;  3HUL A;  4LCH A;  3ZM7 A;  2BM0 A;  2R42 A;  4DV2 E;  2IER A;  1IBM I;  2HKE A;  1N34 I;  2O1U A;  5C0X F;  1IBK I;  2IOP A;  3B78 A;  1KTV A;  2CZ9 A;  3QT5 A;  4DV6 I;  4DR2 I;  1HNX I;  1Z0W A;  1FJG E;  2WP8 A;  5K36 E;  2JEA B;  2C39 B;  1Z0V A;  2BA0 G;  4QNK A;  5JEA F;  4IZK A;  4GQU A;  1FKA E;  1XMO E;  4FWD A;  2WNR A;  2O1V A;  1Z0C A;  4AM3 A;  2VQF I;  2DEJ A;  2A2C A;  4DR3 I;  4LF9 I;  4GKJ I;  2JE6 A;  4B3M I;  3V2U C;  4X66 I;  1B63 A;  4JI4 E;  1J5E I;  3GLL A;  3ZZT A;  1PVG A;  2PNZ A;  4FW9 A;  4P7A A;  4X65 E;  4NXM E;  4B3R I;  2UXC E;  2R3V A;  4LFC I;  3K1J A;  4LF5 E;  3J81 Q;  4JI6 E;  4QNJ A;  4YHH E;  2HK3 A;  1S4E A;  2BA0 D;  3M7N D;  4JI1 E;  3L7Z B;  5JEA B;  2JEB A;  4DV4 I;  4HXZ A;  5A2Q Q;  1OYP A;  5K36 A;  4DPT A;  2NN6 D;  3PS1 A;  2X36 A;  4OX9 I;  2NN6 E;  3PS3 A;  1Z0E A;  4LF6 E;  1Z5B A;  2UXD I;  2Z5C B;  4DR5 E;  4GKK I;  2O1T A;  1BKN A;  4FWG A;  2UUA I;  4DR7 I;  2PNM A;  5IWA I;  3PYD A;  4X62 I;  2GS8 A;  5DNX A;  4OKG A;  2VQE E;  4DV3 E;  4DR4 I;  2F4V I;  2J65 A;  3GME A;  5IT9 C;  5DRR A;  2A2D A;  4WUC A;  4R1F A;  4LPF A;  1XNQ E;  3HKM A;  4YY3 E;  1XHK A;  4JI3 E;  5FLX Q;  1H7U A;  2ZBK B;  3K17 A;  1Z5C A;  2PO0 A;  3WU4 A;  2AJ4 A;  3LPS A;  4YY3 I;  1PKP A;  4DPW A;  2GO3 A;  1XNQ I;  1EI1 A;  2C37 B;  1Y60 A;  4JI0 I;  1ZM2 A;  5LMU I;  2VF3 A;  4IFD F;  4DPU A;  4LFB I;  2UUB E;  3M85 G;  3ZKD A;  2JEA A;  2C39 A;  1H73 A;  4IZJ B;  4DR4 E;  1USU A;  4DV3 I;  5BR8 I;  4JYA I;  5LL6 R;  4NXN I;  4IZK B;  5IT9 Q;  4DXL A;  2PO2 A;  1S16 A;  2BR2 A;  4DUY I;  4DV5 E;  4DR1 I;  4AQY I;  2UUC I;  4B3S I;  2Z5B B; 
#chains in the Genus database with same CATH homology
 3QT7 A;  1ZXN A;  1ZM3 A;  3ZKB A;  2UXD E;  1WUU A;  3Q6N A;  2EFG A;  4JI2 E;  2HHH I;  2WW4 A;  4URL A;  2V2Q A;  1N36 E;  4FN5 A;  4WUD A;  4JI5 I;  2E1R A;  4DV4 E;  1FI4 A;  3T1H I;  4ED4 A;  4USM A;  1FWL A;  4LFC E;  3GON A;  1Y4U A;  4JI8 E;  2Q2E B;  4X66 E;  3LTO A;  2LJP A;  4DUY E;  4DV5 I;  2UUC E;  1DAR A;  4DR3 E;  4RPF A;  1RR9 A;  2UUB I;  2E5L E;  3OTO E;  5LMU E;  1PIE A;  4JI0 E;  1ELO A;  3PYE A;  5GME A;  3HJC A;  4N3O A;  1N32 E;  1HK7 A;  4DV6 E;  1KIJ A;  4HAC B;  1U2R A;  3Q1Q A;  1Z5A A;  4WUB A;  4DU7 A;  4MYT A;  4FWH A;  1I94 E;  3PYG A;  3OTO I;  2E5L I;  1FWK A;  1D6T A;  4LF4 E;  1IBL E;  2NPF A;  3B8H A;  1ZXM A;  3ZZ0 A;  4K0K E;  2UUA E;  1RRE A;  4X64 I;  1A6F A;  2HKJ A;  2HFS A;  4DR5 I;  1USV A;  4GKK E;  2V2V A;  3H4L A;  2UU9 E;  4JI8 I;  3PYF A;  4UT4 A;  4M1K A;  1H72 C;  2XEX A;  3T1H E;  4YHH I;  2CG9 A;  4JI5 E;  3P06 A;  4P52 A;  4DUZ I;  4HY1 A;  5GMD A;  4USK A;  2BM1 A;  4X65 I;  4NXM I;  4B3R E;  2UXC I;  2UU9 I;  1Z0G A;  1UEK A;  4JI4 I;  1N0V C;  4B3S E;  3QT6 A;  4X64 E;  4DR1 E;  2CGE A;  4K0K I;  4LF8 I;  4NXN E;  3LNU A;  5BR8 E;  5A2Q C;  1IBL I;  1XMO I;  4LF4 I;  4DR6 E;  4UTG A;  4JI7 I;  1I94 I;  4Z7C A;  1XNR E;  5FWK A;  4Z7Y A;  4DR2 E;  1FJG I;  3T1Y I;  2BV3 A;  4DV7 I;  1Y6Z A;  1N32 I;  3JAM C;  3B82 A;  4HAC A;  3CWV A;  4EMD A;  2HFU A;  1N0U A;  4DV0 I;  3Q6M A;  4DPX A;  4KHP E;  3JAM Q;  2VQE I;  4X62 E;  5IWA E;  1Z0T A;  4DR7 E;  2ZM6 I;  1ZM4 A;  1NHH A;  1EA6 A;  2DEI A;  4DPY A;  4LF6 I;  3ZZU A;  4OX9 E;  1FNM A;  4I3H A;  3F0N A;  4PRV A;  4B3T I;  3J81 C;  1MX0 A;  2UXB I;  1HNZ I;  5L3J A;  3K85 A;  1Y4S A;  1N36 I;  2HK2 A;  4PRX A;  1HR0 E;  4LF7 I;  1NHJ A;  3WU5 A;  2HHH E;  4JV5 E;  1B62 A;  4MYU A;  4JI2 I;  3J7A G;  1J5E E;  4PU9 A;  4AQY E;  4LF7 E;  4LF9 E;  4JYA E;  4LFB E;  4B3T E;  3J7A M;  4KQV A;  2V34 A;  1HNW I;  4LFA I;  5FLX C;  1Z0B A;  4JG4 A;  1MU5 A;  1N34 E;  4JI3 I;  1IBM E;  1VIS A;  3D4J A;  2ZM6 E;  3QT8 A;  4IZJ D;  3M6A A;  3WU6 A;  1OJ4 A;  2F4V E;  4DV0 E;  2PNL A;  3J80 C;  1NZ0 A;  1H7S A;  4DV1 I;  4DV7 E;  1QZR A;  3T1Y E;  2J7K A;  2V8P A;  4LFA E;  2V2Z A;  1HNW E;  1MG7 A;  3WU3 A;  1XNR I;  1XMQ E;  3V5R A;  4JI7 E;  4DR6 I;  1N33 E;  4JI1 I;  5LMN E;  1K47 A;  4JI6 I;  4LF5 I;  4LF8 E;  3J80 Q;  1Z59 A;  2ZIT A;  4B3M E;  4JV5 I;  4GKJ E;  4ZVI A;  2O1W A;  1ZM9 A;  4DUZ E;  1HR0 I;  1KVK A;  1KKH A;  2VQF E;  2IOQ A;  5LMN I;  2Z5E A;  1N33 I;  1HNZ E;  2UXB E;  3PRY A;  1XMQ I;  1NHI A;  2Z5C A;  4IZJ A;  1HNX E;  1H74 A;  2OI2 A;  2X7I A;  2GQ0 A;  2Z5B A;  1IBK E;  4DV1 E;  4HYM A;  4XTJ A;  4DV2 I;  4KHP I;  4DU8 A;  3HUL A;  3ZM7 A;  2BM0 A;  2R42 A;  4DV2 E;  1IBM I;  2HKE A;  1N34 I;  1IBK I;  2O1U A;  2IOP A;  3B78 A;  1KTV A;  2CZ9 A;  3QT5 A;  4DV6 I;  4DR2 I;  1HNX I;  1Z0W A;  1FJG E;  1Z0V A;  4IZK A;  1FKA E;  1XMO E;  4FWD A;  2O1V A;  1Z0C A;  2VQF I;  2DEJ A;  2A2C A;  4DR3 I;  4LF9 I;  4GKJ I;  4B3M I;  3V2U C;  4X66 I;  1B63 A;  4JI4 E;  1J5E I;  3ZZT A;  1PVG A;  4FW9 A;  4P7A A;  4X65 E;  4NXM E;  4B3R I;  2UXC E;  2R3V A;  4LFC I;  3K1J A;  4LF5 E;  3J81 Q;  4JI6 E;  4YHH E;  2HK3 A;  1S4E A;  4JI1 E;  4DV4 I;  4HXZ A;  5A2Q Q;  4DPT A;  2X36 A;  4OX9 I;  1Z0E A;  4LF6 E;  1Z5B A;  2UXD I;  2Z5C B;  4DR5 E;  4GKK I;  2O1T A;  1BKN A;  4FWG A;  2UUA I;  4DR7 I;  2PNM A;  5IWA I;  3PYD A;  4X62 I;  2GS8 A;  2VQE E;  4DV3 E;  4DR4 I;  2F4V I;  5IT9 C;  2A2D A;  4WUC A;  4R1F A;  1XNQ E;  4YY3 E;  1XHK A;  4JI3 E;  5FLX Q;  1H7U A;  2ZBK B;  3K17 A;  1Z5C A;  3WU4 A;  2AJ4 A;  3LPS A;  4YY3 I;  1PKP A;  4DPW A;  1XNQ I;  1EI1 A;  4JI0 I;  1ZM2 A;  5LMU I;  2VF3 A;  4DPU A;  4LFB I;  2UUB E;  3ZKD A;  1H73 A;  4IZJ B;  4DR4 E;  1USU A;  4DV3 I;  5BR8 I;  4JYA I;  5LL6 R;  4NXN I;  4IZK B;  5IT9 Q;  4DXL A;  2UUC I;  1S16 A;  4DUY I;  4DV5 E;  4DR1 I;  4AQY I;  4B3S I;  2Z5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...