1N33E

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n33E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n33E02
2L3JA 4GKJE 1EA6A 2B3TB 1Z5BA 4LF6E 2V34A 1FWLA 1NHJA 2VQEI 3ADJA 2L2MA 1HNXE 1ZM2A 3M6AA 4NXNI 4JI2I 4LFBI 4DR2I 2UXCE 2NA2A 5A2QQ 4M1KA 2LJPA 4YHHI 5L3JA 5CFFE 5IWAI 4LFCE 4DU7A 5LMUI 2DEJA 1NHHA 1U2RA 1H74A 1FKAE 1N34I 4LF8I 2LUQA 1S4EA 1PIEA 4DUYE 2R3VA 1HNZI 2KHXA 4JI3E 1ZXMA 4HACA 2UXDE 1A6FA 1NZ0A 2LRSA 2MDRA 1MG7A 1Z0GA 1XMQE 4GKJI 2YT4A 1YYWA 4UT4A 1J26A 4LF6I 2EZ6A 4FN5A 2A2CA 1HNXI 1XNQE 1J5EE 3ADIA 2NUGA 1Z0WA 2UXCI 1RR9A 1IBLE 4DUZE 4DR4E 3H4LA 4FW9A 2HHHE 2GS8A 1RC7A 2UU9E 4DPXA 4UTGA 3CWVA 4X8WA 2X36A 1UILA 4B3RE 4LFCI 4PRXA 3JAMQ 1N32E 2LJHA 3ZZ0A 1FNMA 1Z0CA 4LF4E 5FLXQ 4DUYI 1BKNA 1B62A 3ZZTA 4USKA 4JI3I 4LF5E 1Z0TA 4JI1E 3QT7A 1XHKA 2UXDI 4DV7E 1XMQI 4P7AA 2LUPB 4M2ZA 1HNWE 2DIXA 3VYXA 3J7AM 2BV3A 4WFTA 4ZVIA 3JAMC 2UXBE 1XNQI 1K47A 1J5EI 1RREA 1UEKA 1IBLI 4DUZI 4DR4I 1MU5A 2XEXA 2HHHI 2UU9I 2HFUA 4LFAE 4Z7CA 3HULA 1QU6A 1KKHA 1Z0VA 2CZ9A 4HY1A 1EKZA 3F0NA 4B3RI 4WUBA 1WUUA 2J7KA 4X64E 1XMOE 1N32I 2JVAA 1WHQA 2VF3A 2EFGA 3B78A 2RS7A 1IBME 4LF4I 2L2NA 3D4JA 4JI7E 3V2UC 4LF5I 4JI1I 1I94E 4DV7I 3WU4A 4DR5E 1YYKA 1RQ0A 1HNWI 1WHNA 1ZXNA 1N0UA 4B3ME 1Z5CA 2UXBI 3PYFA 4X65E 3J80C 3WU5A 4B3SE 3J81C 1N36E 4JG4A 3WU3A 4LFAI 2WW4A 4HYMA 4NXME 3PYGA 4DR7E 4FWDA 2NUEA 1Z0EA 2OI2A 2E5LE 4DV5E 4X64I 1XMOI 4DV3E 1NHIA 4YY3E 1UHZA 3VYYA 4DXLA 1IBMI 4WUCA 4JI8E 4JI7I 3J7Yp 4DU8A 2NPFA 1YYOA 1I94I 1X48A 4KHPE 4JI4E 4X62E 4X66E 3K17A 4DR5I 4DV2E 1S16A 4B3MI 1N33E 4DPYA 3ZKDA 4LF7E 3ADGA 4EMDA 2DEIA 4X65I 3J7AG 1Z59A 3ZKBA 1N0VC 4B3SI 2F4VE 4DKKA 4P52A 5IT9Q 1FJGE 1N36I 1ZBTA 1T4LB 4B3TE 2DB2A 4LF9E 4DV1E 1H73A 1DARA 4NXMI 4DR7I 2L3CA 5LL6R 2E5LI 4DV5I 4OX9E 2UUBE 4DV3I 1MX0A 4YY3I 1B63A 4PRVA 2BM0A 2E1RA 4JI8I 4JI5E 2R42A 3ZZUA 4KQVA 5IT9C 3QT8A 2ZM6E 4KHPI 2DMYA 4X62I 4JI4I 4X66I 4DV2I 1D6TA 4AQYE 1XNRE 1ZM9A 4DR1E 4JI0E 1N33I 4PU9A 1OJ4A 1VISA 4LF7I 1EI1A 3J80Q 3ZM7A 2V2ZA 3Q1QA 3J81Q 4JYAE 4MYTA 1Z5AA 2F4VI 1KIJA 1FJGI 3LTOA 4HXZA 4B3TI 2Q2EB 4DV1I 4LF9I 3PYDA 3LLHA 4OX9I 1IBKE 2UUBI 3V5RA 3WU6A 5GMEA 4DPWA 5GMDA 1QZRA 4XTJA 2UUAE 4JI5I 1PKPA 2LTRA 1ELOA 1PVGA 1FWKA 2VQFE 2LBSB 4WUDA 2ZM6I 1ZM3A 2UUCE 2L2KB 4I3HA 2CPNA 4AQYI 1XNRI 3C4TA 4JI0I 4DR1I 4GKKE 1T4OA 5LMNE 4DR3E 1KVKA 3P1XA 2B7VA 4DV4E 1HR0E 4JYAI 1KTVA 1H7UA 4R1FA 4DPTA 3QT5A 2HKEA 4USMA 4OOGC 4JV5E 2RTXA 2IHR1 1GQEA 5A2QC 2ZBKB 1IBKI 3T1HE 5BR8E 1H72C 2L33A 2N3HA 3C4BA 2RSMA 3PYEA 4DR6E 2NUFA 3GONA 4WYQB 4DV6E 2UUAI 3T1YE 1YZ9A 4JI6E 4K0KE 2X7IA 4MYUA 4DV0E 3ADLA 3K1JA 4Z7YA 2HK3A 3LPSA 2VQFI 2N3GA 2UUCI 2AJ4A 3OTOE 4GKKI 5LMNI 1O0WA 4DR3I 3B82A 4DPUA 2V2QA 3QT6A 4DV4I 1HR0I 1FI4A 3B8HA 2VQEE 2A2DA 4NXNE 2RS6A 4JI2E 4LFBE 4DR2E 3LNUA 1ZM4A 4JV5I 2ZITA 2HFSA 4YHHE 3T1HI 4HACB 5IWAE 1Z0BA 4FWHA 5BR8I 1STUA 4RPFA 1T4NA 1H7SA 4DR6I 5LMUE 4URLA 2B7TA 2HKJA 4DV6I 2V2VA 2HK2A 3T1YI 2BM1A 4JI6I 4K0KI 1N34E 4LF8E 4DV0I 4ED4A 4FWGA 2JY9A 2LTSA 4M30A 5FLXC 1HNZE 1X47A 3OTOI 2V8PA 1DI2A 1X49A 3HTXA
chains in the Genus database with same CATH superfamily
2M7QA 3P3GA 2L3JA 4GKJE 1EA6A 2B3TB 1Y60A 5K36B 1PJSA 1LLMC 1TF6A 2BBGA 4LF6E 1Z5BA 4OO1F 2V34A 5F3WA 2MDGA 1FWLA 2ELYA 1NHJA 1IQSA 3Q6NA 2VQEI 3ADJA 3EPLA 1WJPA 2K4VA 2L2MA 1HNXE 2BA1D 2NN6B 2EOQA 1ZM2A 3M6AA 4NXNI 4AIMA 4JI2I 1IQOA 4LFBI 4DR2I 5C0XF 2UXCE 3THOB 2NA2A 2EOSA 3ECRA 3JU0A 2VESA 4LCGA 4AIDA 5A2QQ 1ZR9A 4M1KA 5JEAA 2LJPA 4QNJA 2JEAA 2FGGA 4U3DA 1X6FA 4HTGA 5ADZA 4YHHI 3M99B 2Z5EA 4IFDB 2EE8A 5CFFE 5L3JA 5IWAI 1GZ6A 4LFCE 4DU7A 2HJJA 2GO4A 2EMCA 2PNZB 4N3OA 5LMUI 1F2IG 2DEJA 2Z5CB 3KZYA 1NHHA 1U2RA 1H74A 3P06A 2L92A 2EPPA 2WNRA 2EL6A 4X9JA 3BBGA 1FKAE 5T6JA 3PS2A 1N34I 2EM6A 2LUQA 4LF8I 5K36F 3RMPA 1R6MA 2EPUA 1NCSA 1S4EA 3H1CA 4DMIA 5JEAE 1PIEA 4DUYE 2R3VA 1BBGA 1HNZI 2NN6F 2KHXA 2ADRA 4JI3E 4Q35B 1ZXMA 4HACA 2UXDE 1A6FA 1NZ0A 2LRSA 2MDRA 2CTDA 4OO1A 1MG7A 1Z0GA 3F6GA 1XMQE 1E3PA 2EOYA 2EMXA 2YT4A 1YYWA 2YTQA 3U1KA 4UT4A 1EH8A 2JXPA 3M85G 1J26A 4LF6I 2EL4A 2MC6A 4IFDF 2EZ6A 4FN5A 5C0XA 2LE2A 4BC9A 2A2CA 5AASA 2JT2A 2EL5A 1HNXI 1XNQE 1KYQA 2EQ1A 1J5EE 3ADIA 2NUGA 1Z0WA 2UXCI 1RR9A 5KL7A 3EQ1A 4DUZE 1IBLE 4DR4E 1BBOA 2CGEA 2O1TA 3H4LA 4FW9A 2YTPA 1WRJA 4GEQB 2DGCA 1RC7A 2HHHE 2UU9E 2KONA 1SR9A 2GS8A 4B3RI 4DPXA 4UTGA 3CWVA 2EMBA 3EPHA 4OO1E 4X8WA 4IZJD 2EM5A 2CT1A 1Z1BA 2X36A 1UILA 1MEYC 3JTZA 4B3RE 4NBQA 4LFCI 5K36A 2M1SA 1G2DC 3TQMA 2HC5A 4PRXA 3JAMQ 5C0XE 1X3CA 3IWDA 1N32E 2LJHA 5DNLA 1ZAAC 4GQUA 2NN6A 1X6EA 2PRTA 3ZZ0A 4BCAA 1FNMA 1Z0CA 4LF4E 5FLXQ 4DUYI 1BKNA 1B62A 3ZZTA 4USKA 1RHYA 2GO3A 4JI3I 4LF5E 1Z0TA 4JI1E 2ODRD 3PRYA 3QT7A 4IFDA 1XHKA 2UXDI 3PS3A 2Q8UA 2FV4B 1EH6A 4O4KA 4DV7E 1XMQI 4P7AA 2LO3A 2LUPB 4IS1C 4M2ZA 5K36E 2K7IA 3L00A 2PNZA 1HNWE 4IJDA 2Z5CA 3KWRA 2DIXA 3VYXA 2EPNA 2EQ0A 2JOBA 3J7AM 2BV3A 4WFTA 2IESA 2NN6E 3JAMC 4ZVIA 2CSHA 5AE3A 2LJUA 2UXBE 1K47A 1XNQI 1Y6ZA 1J5EI 4TUGA 2JOXA 1RREA 1UEKA 1IBLI 4DUZI 4DR4I 2O1WA 1MU5A 5A6BD 2JR1A 2EPRA 2XEXA 2HHHI 2PO1B 2EOJA 2UU9I 2DMIA 4IFDE 2HFUA 2F8BA 4LFAE 4Z7CA 2EM4A 2EN3A 3IWBA 2J65A 4MU3A 3HULA 1QU6A 1USVA 1KKHA 1Z0VA 2CZ9A 4MLQA 1EKZA 3F0NA 4HY1A 4WUBA 4WXCA 2A25A 1OYPA 1WUUA 2IOPA 2J7KA 2ODRC 2JYAA 2V83A 4X64E 1XMOE 1N32I 2O1VA 2JVAA 2R76A 1WHQA 2VF3A 5DRRA 1R6LA 2EFGA 2V8QB 2EOIA 1T38A 3B78A 2RS7A 1X6HA 3P3CA 4L8NA 1UBDC 1YSAC 1IBME 4LF4I 1NEIA 3F6HA 2L2NA 4ZYHA 4FW7A 5AC4A 3D4JA 4JI7E 4WPYA 3V2UC 4RH8A 1A1IA 4LF5I 4JI1I 1YHCA 1I94E 1HK7A 4LOMA 2B9DA 2EN4A 2EMFA 4DV7I 3WU4A 2EM3A 4HEIA 2IOQA 5DRPA 4DR5E 4F6MA 2EOHA 1YYKA 4R8OA 1RQ0A 4LPFA 1WHNA 2EMZA 1ZXNA 1HNWI 1YUIA 2ELZA 1N0UA 4OKGA 4R2QA 4B3ME 1Z5CA 1IMUA 4R2AA 1UDOA 1Y4UA 4F6NA 2UXBI 2O1UA 3PYFA 2EPLX 2DSYA 4X65E 1G2FC 4WSGA 3J80C 2C39B 2BB8A 3WU5A 1AH5A 4B3SE 2EM9A 3J81C 1Y5YA 2CVEA 4R2CA 3ZOQB 1DGCA 2YTOA 1UDSA 3NZKA 1VI7A 3CDJA 1N36E 4LCHA 4JG4A 3WU3A 4LFAI 2WW4A 2WBSA 2EM8A 4I8OA 4HYMA 2PNLA 4L5NC 4NXME 3K6QA 4DR7E 3PYGA 4FWDA 1PJTA 1GTKA 3HPSA 2NUEA 1Z0EA 2OI2A 2E5LE 4DV5E 4X64I 1XMOI 1E3HA 1EH7A 2EPCA 4R2RA 2EM2A 4DV3E 1T39A 2GLIA 2ENAA 1UDNA 3GCMA 2L6MA 1NHIA 2DLKA 4KZSA 4YY3E 2PO0B 1UHZA 5JEAD 2EMIA 3VYYA 4DXLA 4M9VC 1IBMI 2WZOA 4JI8E 3BIDA 1A1GA 4WUCA 3M7NG 5DROA 5A6AA 2MC5A 2YRMA 3K85A 3DD6A 4JI7I 3BGHA 2PO1A 3CDIA 5TSEA 3J7Yp 4DU8A 2EN1A 2EMWA 2ENHA 1YYOA 4FK5C 2NPFA 1X48A 1I94I 4WSPA 4KHPE 4JI4E 4X62E 2V85A 4N4RB 3VHTB 4X66E 3K17A 4DR5I 4DV2E 2L8TA 2EPXA 2YTGA 4KWYA 1JK2A 5EL9A 2EPKX 1S16A 2JPAA 4B3MI 1N33E 2GQ0A 4DPYA 1A1JA 2BA0G 5KL3A 1A1KA 5KL5A 2LT7A 4BA1B 3DJWA 3ZKDA 4LF7E 2GPIA 3OMLA 2YTEA 3ADGA 1WXRA 3J7AG 2DEIA 4EMDA 4X65I 4F9AB 3HKMA 1Z59A 2JE6B 3ZKBA 3M85D 3GLLA 1N0VC 1YUJA 4B3SI 2F4VE 4DKKA 2EN7A 4P52A 2LCEA 5IT9Q 4FW3A 4OO1D 1FJGE 3C6KA 3EPJA 2F1DA 2N8XA 1N36I 1ZBTA 2WP8B 5JEAC 3GMEA 1YH8A 1T4LB 1B69A 4MQYA 3MSWA 4BBYA 2DB2A 2EOMA 4RHBB 4DV1E 4P78A 1A1HA 4B3TE 4LF9E 1DARA 1H73A 4NXMI 3U1YA 4DR7I 2L3CA 5LL6R 2E5LI 4DV5I 4OX9E 3IWCA 4R2SA 2EJ4A 2UUBE 4DV3I 1MX0A 2YWQA 1ZBQA 4YY3I 2RQLA 1B63A 2YTDA 4IZJB 4PRVA 1MGTA 3VK6A 5AE1A 2BM0A 2C39A 2E1RA 4ZYDA 4JI8I 4JI5E 2R42A 3ZZUA 2D9HA 4KQVA 3QG5C 1YFHA 4LU9A 4NZVA 3HJCA 4BS9A 5IT9C 2V89A 2ZM6E 2JP9A 3QT8A 5K36D 4KHPI 2DMYA 4WXDA 4X62I 4JI4I 5DRQA 4X66I 2EN6A 2LMZA 4DV2I 2BR2B 2NABA 2EN2A 2EOEA 4OO1C 2C37B 2V87A 1D6TA 2I13A 4AQYE 1XNRE 4R03A 1ZM9A 4DR1E 4JI0E 2NN6D 1N33I 2EOFA 4PU9A 1OJ4A 2J7JA 2YRKA 1USUA 2EMHA 4R2PA 2BA1G 4LCFA 1VISA 5C0XC 3HPZA 1EI1A 2DLQA 4FW4A 2PO0A 4LF7I 4O43A 1ZU1A 3J80Q 1PJQA 3ZM7A 2V2ZA 3HXLA 3J81Q 3Q1QA 4JYAE 4MYTA 1Z5AA 2F4VI 4IFDD 3L7ZB 1KIJA 1FJGI 2AE8A 5DNYA 2Z5BB 1XXEA 1SFEA 4F2JC 3LTOA 4HXZA 4BMJA 4B3TI 2Q2EB 4DV1I 1QNTA 3PYDA 4LF9I 3LLHA 3BF2A 2WBTA 4ZYGA 1P47A 5AC5A 4OX9I 4AM3A 2VRDA 1IBKE 2UUBI 2ENCA 5K36C 2YTIA 4IS9A 3V5RA 5KL6A 2JEBB 4IZKB 4BA1A 4GKJI 3WU6A 5GMEA 2YTFA 5DNXA 1UDQA 4DPWA 5GMDA 5IXMB 2JE6A 1QZRA 2NN6C 1X5WA 2UUAE 4XTJA 4JI5I 1Y4SA 5A6JA 5KL2A 1PKPA 4F9CB 1TF3A 2LTRA 4OZEA 1RMDA 1AAYA 2WP8A 2WCC3 2EOXA 1ELOA 2H36X 1PVGA 1FWKA 2KOUA 5A6KA 5LLQA 4O5GA 2VQFE 2MKDA 2LBSB 4MDTA 4WUDA 2ZM6I 4F9BB 2GHFA 2UUCE 1ZM3A 4IFDC 4BA2B 2L2KB 1TN9A 4NHRA 4I3HA 2CPNA 2LVHA 3AUZA 4AQYI 1XNRI 3C4TA 2EMKA 4JI0I 4DR1I 1T4OA 5LMNE 4GKKE 4DR3E 4BHCA 4WX9A 1KVKA 3P1XA 2B7VA 4IZJA 1P42A 4DV4E 1HR0E 2EQ3A 2YTJA 4FW6A 4GZNC 4JYAI 2C38B 2I9IA 1KTVA 2EM0A 1H7UA 4R1FA 2E72A 4DPTA 3HQ1A 4QNKA 3QT5A 2HKEA 4USMA 2EORA 4R2EA 4OOGC 1OYSA 4JV5E 2RTXA 4O24A 2IHR1 2BR2A 1GQEA 2C37A 2V88A 5A2QC 3P76A 2ZBKB 3PS1A 2HGHA 2EMGA 1IBKI 2M9AA 3T1HE 1UN6B 3THNA 3LMLA 5BR8E 4MU1A 4P7DA 2CG9A 1H72C 2L33A 2N3HA 3C4BA 2RSMA 3PYEA 2M4IA 4DR6E 2EM7A 2RPCA 4ZYEA 2NUFA 1BB8A 3GONA 4WYQB 4DV6E 1PDAA 5FWKA 2UUAI 3T1YE 2FTXB 1YZ9A 3L7ZA 4JI6E 4K0KE 2X7IA 2EPAA 1JK1A 4MYUA 4MLVA 4DV0E 3ADLA 2Z5BA 3K1JA 4Z7YA 2HK3A 3LPSA 2E1MA 3EPKA 5A69A 2VQFI 2N3GA 2UUCI 4Q28A 3AV0A 2AJ4A 3M7ND 5JEAB 5ELWA 2JEAB 2EWLA 3P3EA 2PO2A 5A6BA 3OTOE 4J3DA 5C0XD 4GKKI 2JEBA 5IV8B 1O0WA 4IZKA 4MU0A 5LMNI 4DR3I 2LV2A 2EOOA 3MHHC 3C6MA 2EN8A 3B82A 4DPUA 2V2QA 3QT6A 4DV4I 4J8ZA 2VE7C 1FI4A 1HR0I 3FIGA 3B8HA 2EPZA 4ISAA 2WNRB 2G7HA 2BA0D 5AE2A 2VQEE 2A2DA 2YU5A 4M0VA 1KJKA 3UHMA 4BHBA 2RS6A 3MHSC 4JI2E 4NXNE 2DRPA 1DQ3A 2YTNA 4DR2E 4LFBE 1YPNA 2YRHA 4BC7A 3LNUA 1ZM4A 4BA2A 4JV5I 2IERA 2ZITA 2EMLA 4MU4A 4F54A 2HFSA 2YPNA 4YHHE 4U3BA 3Q6MA 3KRNA 4HACB 5EKWA 3T1HI 4FW5A 5IWAE 2YU8A 4OO1B 5KL4A 1Z0BA 4FWHA 4R2DA 2JWOA 5JEAF 5BR8I 1STUA 4RPFA 1T4NA 1H7SA 4DR6I 5LMUE 4URLA 2B7TA 2HKJA 1A1FA 3UK3C 2V2VA 2HK2A 5C0XB 4DV6I 3T1YI 2BM1A 2EOZA 2YSOA 4JI6I 2C38A 4K0KI 2MKNA 1N34E 2EPOA 4LF8E 4DV0I 1A1LA 4ED4A 2YSPA 2O3ZA 4FWGA 3DF6A 2EP3A 2R1FA 2JY9A 2EMAA 2LTSA 2RSIA 4M30A 3KZZA 2EPMX 5FLXC 4TUIA 1HNZE 4LTYA 3B4TA 1X47A 1OYRA 1L4SA 3H09A 1N3GA 2PNMA 3OTOI 2WBUA 2YZTA 2EMYA 2VF1A 2V86A 2V8PA 1DI2A 1X49A 2PO2B 3HTXA
chains in the Genus database with same CATH topology
2M7QA 2L3JA 4GKJE 1EA6A 2B3TB 1Z5BA 4LF6E 2V34A 5F3WA 1FWLA 1NHJA 3Q6NA 2VQEI 3ADJA 2L2MA 2K4VA 1HNXE 1ZM2A 3M6AA 4NXNI 4JI2I 4LFBI 4DR2I 2UXCE 2NA2A 3JU0A 5A2QQ 4M1KA 2LJPA 2FGGA 5ADZA 4YHHI 2Z5EA 5L3JA 5CFFE 5IWAI 1GZ6A 4LFCE 4DU7A 4N3OA 5LMUI 2DEJA 2Z5CB 1NHHA 1U2RA 1H74A 3P06A 2L92A 1FKAE 5T6JA 1N34I 4LF8I 2LUQA 3RMPA 1S4EA 4DMIA 1PIEA 4DUYE 2R3VA 1HNZI 2KHXA 4JI3E 1ZXMA 4HACA 2UXDE 1X49A 1A6FA 1NZ0A 2LRSA 2MDRA 1MG7A 1Z0GA 3F6GA 1XMQE 4GKJI 2YT4A 1YYWA 4UT4A 1J26A 4LF6I 2MC6A 2EZ6A 4FN5A 2LE2A 4BC9A 2A2CA 5AASA 1HNXI 1XNQE 1J5EE 3ADIA 2NUGA 1Z0WA 2UXCI 1RR9A 1IBLE 4DUZE 4DR4E 3H4LA 2O1TA 2CGEA 4FW9A 4GEQB 2HHHE 1RC7A 2GS8A 2UU9E 2KONA 1SR9A 4DPXA 4UTGA 3CWVA 4X8WA 4IZJD 2X36A 1UILA 3JTZA 4B3RE 4LFCI 2M1SA 4PRXA 3JAMQ 3IWDA 1N32E 2LJHA 3ZZ0A 4BCAA 1FNMA 1Z0CA 4LF4E 5FLXQ 4DUYI 1BKNA 1B62A 3ZZTA 4USKA 4JI3I 4LF5E 1Z0TA 4JI1E 2ODRD 3PRYA 3QT7A 1XHKA 2UXDI 2FV4B 4DV7E 1XMQI 4P7AA 2LUPB 4M2ZA 1HNWE 2Z5CA 3KWRA 2DIXA 3VYXA 2JOBA 3J7AM 2BV3A 4WFTA 3JAMC 4ZVIA 2UXBE 5AE3A 1XNQI 1K47A 1Y6ZA 1J5EI 4TUGA 2JOXA 1RREA 1UEKA 1IBLI 4DUZI 4DR4I 2O1WA 1MU5A 2JR1A 2XEXA 2HHHI 2UU9I 2HFUA 2F8BA 4LFAE 4Z7CA 3IWBA 3HULA 1QU6A 1USVA 1KKHA 1Z0VA 2CZ9A 4HY1A 1EKZA 3F0NA 4B3RI 4WUBA 1WUUA 2IOPA 2J7KA 2ODRC 2V83A 4X64E 1XMOE 1N32I 2O1VA 2JVAA 1WHQA 2VF3A 2EFGA 2V8QB 3B78A 2RS7A 4L8NA 1IBME 4LF4I 3F6HA 2L2NA 3D4JA 4JI7E 4WPYA 3V2UC 4LF5I 4JI1I 1I94E 1HK7A 2B9DA 4DV7I 3WU4A 2IOQA 4DR5E 1YYKA 4R8OA 1RQ0A 1HNWI 1WHNA 1ZXNA 1N0UA 4B3ME 1Z5CA 1Y4UA 2UXBI 2O1UA 3PYFA 2DSYA 4X65E 3J80C 3WU5A 4B3SE 3J81C 3ZOQB 1N36E 4JG4A 3WU3A 4LFAI 2WW4A 4I8OA 4HYMA 2PNLA 4L5NC 4NXME 3K6QA 4DR7E 3PYGA 4FWDA 2NUEA 1Z0EA 3HPSA 2OI2A 2E5LE 4DV5E 4X64I 1XMOI 4DV3E 2L6MA 1NHIA 4KZSA 4YY3E 1UHZA 3VYYA 4DXLA 1IBMI 2WZOA 4JI8E 4WUCA 2MC5A 3K85A 4JI7I 3J7Yp 4DU8A 2NPFA 1YYOA 1I94I 1X48A 4WSPA 4KHPE 4JI4E 4X62E 2V85A 4X66E 3K17A 4DR5I 4DV2E 2L8TA 1S16A 4B3MI 1N33E 2GQ0A 4DPYA 3DJWA 3ZKDA 4LF7E 3OMLA 1WXRA 3ADGA 3J7AG 2DEIA 4EMDA 4X65I 4F9AB 1Z59A 3ZKBA 1N0VC 4B3SI 2F4VE 4DKKA 4P52A 5IT9Q 1FJGE 1N36I 1ZBTA 1T4LB 3MSWA 4BBYA 2DB2A 4LF9E 4DV1E 1H73A 4P78A 1DARA 4B3TE 4NXMI 4DR7I 2L3CA 5LL6R 2E5LI 4DV5I 4OX9E 3IWCA 2UUBE 4DV3I 1MX0A 1ZBQA 4YY3I 1B63A 4IZJB 4PRVA 3VK6A 5AE1A 2BM0A 2E1RA 4JI8I 4JI5E 2R42A 3ZZUA 4KQVA 4LU9A 3HJCA 4BS9A 5IT9C 2V89A 2ZM6E 3QT8A 4KHPI 2DMYA 4X62I 4JI4I 4X66I 4DV2I 2V87A 1D6TA 4AQYE 1XNRE 4R03A 1ZM9A 4DR1E 4JI0E 1N33I 4PU9A 1OJ4A 1USUA 1VISA 3HPZA 1EI1A 4LF7I 3J80Q 3ZM7A 2V2ZA 3HXLA 3J81Q 3Q1QA 4JYAE 4MYTA 1Z5AA 2F4VI 1KIJA 1FJGI 5DNYA 2Z5BB 3LTOA 4HXZA 4BMJA 4B3TI 2Q2EB 4DV1I 4LF9I 3PYDA 3LLHA 4OX9I 1IBKE 2UUBI 3V5RA 4IZKB 3WU6A 5GMEA 4DPWA 5GMDA 1QZRA 4XTJA 2UUAE 4JI5I 1Y4SA 1PKPA 4F9CB 2LTRA 1ELOA 2H36X 1PVGA 1FWKA 2KOUA 2VQFE 2LBSB 4WUDA 2ZM6I 4F9BB 1ZM3A 2UUCE 2L2KB 4I3HA 2CPNA 4AQYI 3AUZA 1XNRI 3C4TA 4JI0I 4DR1I 4GKKE 1T4OA 5LMNE 4DR3E 1KVKA 3P1XA 2B7VA 4IZJA 4DV4E 1HR0E 4JYAI 1KTVA 1H7UA 4R1FA 4DPTA 3HQ1A 3QT5A 2HKEA 4USMA 4OOGC 4JV5E 2RTXA 2IHR1 1GQEA 2V88A 5A2QC 2ZBKB 1IBKI 3T1HE 3LMLA 5BR8E 4P7DA 2CG9A 1H72C 2L33A 2N3HA 3C4BA 2RSMA 3PYEA 2M4IA 4DR6E 2NUFA 3GONA 4WYQB 4DV6E 5FWKA 2UUAI 3T1YE 2FTXB 1YZ9A 4JI6E 4K0KE 2X7IA 4MYUA 4DV0E 3ADLA 2Z5BA 3K1JA 4Z7YA 2HK3A 3LPSA 2E1MA 2VQFI 2N3GA 2UUCI 4Q28A 3AV0A 2AJ4A 2EWLA 3OTOE 4GKKI 5LMNI 1O0WA 4IZKA 4DR3I 3B82A 4DPUA 2V2QA 3QT6A 4DV4I 4J8ZA 2VE7C 1FI4A 1HR0I 3FIGA 3B8HA 2G7HA 5AE2A 2VQEE 2A2DA 4M0VA 4NXNE 2RS6A 4JI2E 4LFBE 1DQ3A 4DR2E 3LNUA 4BC7A 1ZM4A 4JV5I 2ZITA 4F54A 2HFSA 4YHHE 3T1HI 3Q6MA 4HACB 5IWAE 1Z0BA 4FWHA 5BR8I 2JWOA 1STUA 4RPFA 1T4NA 1H7SA 4DR6I 5LMUE 4URLA 2B7TA 2HKJA 4DV6I 2V2VA 2HK2A 3T1YI 2BM1A 4JI6I 4K0KI 1N34E 4LF8E 4DV0I 4ED4A 4FWGA 3DF6A 2JY9A 2LTSA 4M30A 5FLXC 4TUIA 1HNZE 4LTYA 1X47A 3H09A 2PNMA 3OTOI 2YZTA 2VF1A 2V86A 2V8PA 1DI2A 2LMZA 3HTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3J A;  4GKJ E;  1EA6 A;  2B3T B;  1Z5B A;  4LF6 E;  2V34 A;  1FWL A;  1NHJ A;  2VQE I;  3ADJ A;  2L2M A;  1HNX E;  1ZM2 A;  3M6A A;  4NXN I;  4JI2 I;  4LFB I;  4DR2 I;  2UXC E;  2NA2 A;  5A2Q Q;  4M1K A;  2LJP A;  4YHH I;  5L3J A;  5CFF E;  5IWA I;  4LFC E;  4DU7 A;  5LMU I;  2DEJ A;  1NHH A;  1U2R A;  1H74 A;  1FKA E;  1N34 I;  4LF8 I;  2LUQ A;  1S4E A;  1PIE A;  4DUY E;  2R3V A;  1HNZ I;  2KHX A;  4JI3 E;  1ZXM A;  4HAC A;  2UXD E;  1A6F A;  1NZ0 A;  2LRS A;  2MDR A;  1MG7 A;  1Z0G A;  1XMQ E;  4GKJ I;  2YT4 A;  1YYW A;  4UT4 A;  1J26 A;  4LF6 I;  2EZ6 A;  4FN5 A;  2A2C A;  1HNX I;  1XNQ E;  1J5E E;  3ADI A;  2NUG A;  1Z0W A;  2UXC I;  1RR9 A;  1IBL E;  4DUZ E;  4DR4 E;  3H4L A;  4FW9 A;  2HHH E;  2GS8 A;  1RC7 A;  2UU9 E;  4DPX A;  4UTG A;  3CWV A;  4X8W A;  2X36 A;  1UIL A;  4B3R E;  4LFC I;  4PRX A;  3JAM Q;  1N32 E;  2LJH A;  3ZZ0 A;  1FNM A;  1Z0C A;  4LF4 E;  5FLX Q;  4DUY I;  1BKN A;  1B62 A;  3ZZT A;  4USK A;  4JI3 I;  4LF5 E;  1Z0T A;  4JI1 E;  3QT7 A;  1XHK A;  2UXD I;  4DV7 E;  1XMQ I;  4P7A A;  2LUP B;  4M2Z A;  1HNW E;  2DIX A;  3VYX A;  3J7A M;  2BV3 A;  4WFT A;  4ZVI A;  3JAM C;  2UXB E;  1XNQ I;  1K47 A;  1J5E I;  1RRE A;  1UEK A;  1IBL I;  4DUZ I;  4DR4 I;  1MU5 A;  2XEX A;  2HHH I;  2UU9 I;  2HFU A;  4LFA E;  4Z7C A;  3HUL A;  1QU6 A;  1KKH A;  1Z0V A;  2CZ9 A;  4HY1 A;  1EKZ A;  3F0N A;  4B3R I;  4WUB A;  1WUU A;  2J7K A;  4X64 E;  1XMO E;  1N32 I;  2JVA A;  1WHQ A;  2VF3 A;  2EFG A;  3B78 A;  2RS7 A;  1IBM E;  4LF4 I;  2L2N A;  3D4J A;  4JI7 E;  3V2U C;  4LF5 I;  4JI1 I;  1I94 E;  4DV7 I;  3WU4 A;  4DR5 E;  1YYK A;  1RQ0 A;  1HNW I;  1WHN A;  1ZXN A;  1N0U A;  4B3M E;  1Z5C A;  2UXB I;  3PYF A;  4X65 E;  3J80 C;  3WU5 A;  4B3S E;  3J81 C;  1N36 E;  4JG4 A;  3WU3 A;  4LFA I;  2WW4 A;  4HYM A;  4NXM E;  3PYG A;  4DR7 E;  4FWD A;  2NUE A;  1Z0E A;  2OI2 A;  2E5L E;  4DV5 E;  4X64 I;  1XMO I;  4DV3 E;  1NHI A;  4YY3 E;  1UHZ A;  3VYY A;  4DXL A;  1IBM I;  4WUC A;  4JI8 E;  4JI7 I;  3J7Y p;  4DU8 A;  2NPF A;  1YYO A;  1I94 I;  1X48 A;  4KHP E;  4JI4 E;  4X62 E;  4X66 E;  3K17 A;  4DR5 I;  4DV2 E;  1S16 A;  4B3M I;  1N33 E;  4DPY A;  3ZKD A;  4LF7 E;  3ADG A;  4EMD A;  2DEI A;  4X65 I;  3J7A G;  1Z59 A;  3ZKB A;  1N0V C;  4B3S I;  2F4V E;  4DKK A;  4P52 A;  5IT9 Q;  1FJG E;  1N36 I;  1ZBT A;  1T4L B;  4B3T E;  2DB2 A;  4LF9 E;  4DV1 E;  1H73 A;  1DAR A;  4NXM I;  4DR7 I;  2L3C A;  5LL6 R;  2E5L I;  4DV5 I;  4OX9 E;  2UUB E;  4DV3 I;  1MX0 A;  4YY3 I;  1B63 A;  4PRV A;  2BM0 A;  2E1R A;  4JI8 I;  4JI5 E;  2R42 A;  3ZZU A;  4KQV A;  5IT9 C;  3QT8 A;  2ZM6 E;  4KHP I;  2DMY A;  4X62 I;  4JI4 I;  4X66 I;  4DV2 I;  1D6T A;  4AQY E;  1XNR E;  1ZM9 A;  4DR1 E;  4JI0 E;  1N33 I;  4PU9 A;  1OJ4 A;  1VIS A;  4LF7 I;  1EI1 A;  3J80 Q;  3ZM7 A;  2V2Z A;  3Q1Q A;  3J81 Q;  4JYA E;  4MYT A;  1Z5A A;  2F4V I;  1KIJ A;  1FJG I;  3LTO A;  4HXZ A;  4B3T I;  2Q2E B;  4DV1 I;  4LF9 I;  3PYD A;  3LLH A;  4OX9 I;  1IBK E;  2UUB I;  3V5R A;  3WU6 A;  5GME A;  4DPW A;  5GMD A;  1QZR A;  4XTJ A;  2UUA E;  4JI5 I;  1PKP A;  2LTR A;  1ELO A;  1PVG A;  1FWK A;  2VQF E;  2LBS B;  4WUD A;  2ZM6 I;  1ZM3 A;  2UUC E;  2L2K B;  4I3H A;  2CPN A;  4AQY I;  1XNR I;  3C4T A;  4JI0 I;  4DR1 I;  4GKK E;  1T4O A;  5LMN E;  4DR3 E;  1KVK A;  3P1X A;  2B7V A;  4DV4 E;  1HR0 E;  4JYA I;  1KTV A;  1H7U A;  4R1F A;  4DPT A;  3QT5 A;  2HKE A;  4USM A;  4OOG C;  4JV5 E;  2RTX A;  2IHR 1;  1GQE A;  5A2Q C;  2ZBK B;  1IBK I;  3T1H E;  5BR8 E;  1H72 C;  2L33 A;  2N3H A;  3C4B A;  2RSM A;  3PYE A;  4DR6 E;  2NUF A;  3GON A;  4WYQ B;  4DV6 E;  2UUA I;  3T1Y E;  1YZ9 A;  4JI6 E;  4K0K E;  2X7I A;  4MYU A;  4DV0 E;  3ADL A;  3K1J A;  4Z7Y A;  2HK3 A;  3LPS A;  2VQF I;  2N3G A;  2UUC I;  2AJ4 A;  3OTO E;  4GKK I;  5LMN I;  1O0W A;  4DR3 I;  3B82 A;  4DPU A;  2V2Q A;  3QT6 A;  4DV4 I;  1HR0 I;  1FI4 A;  3B8H A;  2VQE E;  2A2D A;  4NXN E;  2RS6 A;  4JI2 E;  4LFB E;  4DR2 E;  3LNU A;  1ZM4 A;  4JV5 I;  2ZIT A;  2HFS A;  4YHH E;  3T1H I;  4HAC B;  5IWA E;  1Z0B A;  4FWH A;  5BR8 I;  1STU A;  4RPF A;  1T4N A;  1H7S A;  4DR6 I;  5LMU E;  4URL A;  2B7T A;  2HKJ A;  4DV6 I;  2V2V A;  2HK2 A;  3T1Y I;  2BM1 A;  4JI6 I;  4K0K I;  1N34 E;  4LF8 E;  4DV0 I;  4ED4 A;  4FWG A;  2JY9 A;  2LTS A;  4M30 A;  5FLX C;  1HNZ E;  1X47 A;  3OTO I;  2V8P A;  1DI2 A;  1X49 A;  3HTX A; 
#chains in the Genus database with same CATH topology
 2M7Q A;  3P3G A;  2L3J A;  4GKJ E;  1EA6 A;  2B3T B;  1Y60 A;  5K36 B;  1PJS A;  1LLM C;  1TF6 A;  2BBG A;  4LF6 E;  1Z5B A;  4OO1 F;  2V34 A;  5F3W A;  2MDG A;  1FWL A;  2ELY A;  1NHJ A;  1IQS A;  3Q6N A;  2VQE I;  3ADJ A;  3EPL A;  1WJP A;  2K4V A;  2L2M A;  1HNX E;  2BA1 D;  2NN6 B;  2EOQ A;  1ZM2 A;  3M6A A;  4NXN I;  4AIM A;  4JI2 I;  1IQO A;  4LFB I;  4DR2 I;  5C0X F;  2UXC E;  3THO B;  2NA2 A;  2EOS A;  3ECR A;  3JU0 A;  2VES A;  4LCG A;  4AID A;  5A2Q Q;  1ZR9 A;  4M1K A;  5JEA A;  2LJP A;  4QNJ A;  2JEA A;  2FGG A;  4U3D A;  1X6F A;  4HTG A;  5ADZ A;  4YHH I;  3M99 B;  2Z5E A;  4IFD B;  2EE8 A;  5CFF E;  5L3J A;  5IWA I;  1GZ6 A;  4LFC E;  4DU7 A;  2HJJ A;  2GO4 A;  2EMC A;  2PNZ B;  4N3O A;  5LMU I;  1F2I G;  2DEJ A;  2Z5C B;  3KZY A;  1NHH A;  1U2R A;  1H74 A;  3P06 A;  2L92 A;  2EPP A;  2WNR A;  2EL6 A;  4X9J A;  3BBG A;  1FKA E;  5T6J A;  3PS2 A;  1N34 I;  2EM6 A;  2LUQ A;  4LF8 I;  5K36 F;  3RMP A;  1R6M A;  2EPU A;  1NCS A;  1S4E A;  3H1C A;  4DMI A;  5JEA E;  1PIE A;  4DUY E;  2R3V A;  1BBG A;  1HNZ I;  2NN6 F;  2KHX A;  2ADR A;  4JI3 E;  4Q35 B;  1ZXM A;  4HAC A;  2UXD E;  1A6F A;  1NZ0 A;  2LRS A;  2MDR A;  2CTD A;  4OO1 A;  1MG7 A;  1Z0G A;  3F6G A;  1XMQ E;  1E3P A;  2EOY A;  2EMX A;  2YT4 A;  1YYW A;  2YTQ A;  3U1K A;  4UT4 A;  1EH8 A;  2JXP A;  3M85 G;  1J26 A;  4LF6 I;  2EL4 A;  2MC6 A;  4IFD F;  2EZ6 A;  4FN5 A;  5C0X A;  2LE2 A;  4BC9 A;  2A2C A;  5AAS A;  2JT2 A;  2EL5 A;  1HNX I;  1XNQ E;  1KYQ A;  2EQ1 A;  1J5E E;  3ADI A;  2NUG A;  1Z0W A;  2UXC I;  1RR9 A;  5KL7 A;  3EQ1 A;  4DUZ E;  1IBL E;  4DR4 E;  1BBO A;  2CGE A;  2O1T A;  3H4L A;  4FW9 A;  2YTP A;  1WRJ A;  4GEQ B;  2DGC A;  1RC7 A;  2HHH E;  2UU9 E;  2KON A;  1SR9 A;  2GS8 A;  4B3R I;  4DPX A;  4UTG A;  3CWV A;  2EMB A;  3EPH A;  4OO1 E;  4X8W A;  4IZJ D;  2EM5 A;  2CT1 A;  1Z1B A;  2X36 A;  1UIL A;  1MEY C;  3JTZ A;  4B3R E;  4NBQ A;  4LFC I;  5K36 A;  2M1S A;  1G2D C;  3TQM A;  2HC5 A;  4PRX A;  3JAM Q;  5C0X E;  1X3C A;  3IWD A;  1N32 E;  2LJH A;  5DNL A;  1ZAA C;  4GQU A;  2NN6 A;  1X6E A;  2PRT A;  3ZZ0 A;  4BCA A;  1FNM A;  1Z0C A;  4LF4 E;  5FLX Q;  4DUY I;  1BKN A;  1B62 A;  3ZZT A;  4USK A;  1RHY A;  2GO3 A;  4JI3 I;  4LF5 E;  1Z0T A;  4JI1 E;  2ODR D;  3PRY A;  3QT7 A;  4IFD A;  1XHK A;  2UXD I;  3PS3 A;  2Q8U A;  2FV4 B;  1EH6 A;  4O4K A;  4DV7 E;  1XMQ I;  4P7A A;  2LO3 A;  2LUP B;  4IS1 C;  4M2Z A;  5K36 E;  2K7I A;  3L00 A;  2PNZ A;  1HNW E;  4IJD A;  2Z5C A;  3KWR A;  2DIX A;  3VYX A;  2EPN A;  2EQ0 A;  2JOB A;  3J7A M;  2BV3 A;  4WFT A;  2IES A;  2NN6 E;  3JAM C;  4ZVI A;  2CSH A;  5AE3 A;  2LJU A;  2UXB E;  1K47 A;  1XNQ I;  1Y6Z A;  1J5E I;  4TUG A;  2JOX A;  1RRE A;  1UEK A;  1IBL I;  4DUZ I;  4DR4 I;  2O1W A;  1MU5 A;  5A6B D;  2JR1 A;  2EPR A;  2XEX A;  2HHH I;  2PO1 B;  2EOJ A;  2UU9 I;  2DMI A;  4IFD E;  2HFU A;  2F8B A;  4LFA E;  4Z7C A;  2EM4 A;  2EN3 A;  3IWB A;  2J65 A;  4MU3 A;  3HUL A;  1QU6 A;  1USV A;  1KKH A;  1Z0V A;  2CZ9 A;  4MLQ A;  1EKZ A;  3F0N A;  4HY1 A;  4WUB A;  4WXC A;  2A25 A;  1OYP A;  1WUU A;  2IOP A;  2J7K A;  2ODR C;  2JYA A;  2V83 A;  4X64 E;  1XMO E;  1N32 I;  2O1V A;  2JVA A;  2R76 A;  1WHQ A;  2VF3 A;  5DRR A;  1R6L A;  2EFG A;  2V8Q B;  2EOI A;  1T38 A;  3B78 A;  2RS7 A;  1X6H A;  3P3C A;  4L8N A;  1UBD C;  1YSA C;  1IBM E;  4LF4 I;  1NEI A;  3F6H A;  2L2N A;  4ZYH A;  4FW7 A;  5AC4 A;  3D4J A;  4JI7 E;  4WPY A;  3V2U C;  4RH8 A;  1A1I A;  4LF5 I;  4JI1 I;  1YHC A;  1I94 E;  1HK7 A;  4LOM A;  2B9D A;  2EN4 A;  2EMF A;  4DV7 I;  3WU4 A;  2EM3 A;  4HEI A;  2IOQ A;  5DRP A;  4DR5 E;  4F6M A;  2EOH A;  1YYK A;  4R8O A;  1RQ0 A;  4LPF A;  1WHN A;  2EMZ A;  1ZXN A;  1HNW I;  1YUI A;  2ELZ A;  1N0U A;  4OKG A;  4R2Q A;  4B3M E;  1Z5C A;  1IMU A;  4R2A A;  1UDO A;  1Y4U A;  4F6N A;  2UXB I;  2O1U A;  3PYF A;  2EPL X;  2DSY A;  4X65 E;  1G2F C;  4WSG A;  3J80 C;  2C39 B;  2BB8 A;  3WU5 A;  1AH5 A;  4B3S E;  2EM9 A;  3J81 C;  1Y5Y A;  2CVE A;  4R2C A;  3ZOQ B;  1DGC A;  2YTO A;  1UDS A;  3NZK A;  1VI7 A;  3CDJ A;  1N36 E;  4LCH A;  4JG4 A;  3WU3 A;  4LFA I;  2WW4 A;  2WBS A;  2EM8 A;  4I8O A;  4HYM A;  2PNL A;  4L5N C;  4NXM E;  3K6Q A;  4DR7 E;  3PYG A;  4FWD A;  1PJT A;  1GTK A;  3HPS A;  2NUE A;  1Z0E A;  2OI2 A;  2E5L E;  4DV5 E;  4X64 I;  1XMO I;  1E3H A;  1EH7 A;  2EPC A;  4R2R A;  2EM2 A;  4DV3 E;  1T39 A;  2GLI A;  2ENA A;  1UDN A;  3GCM A;  2L6M A;  1NHI A;  2DLK A;  4KZS A;  4YY3 E;  2PO0 B;  1UHZ A;  5JEA D;  2EMI A;  3VYY A;  4DXL A;  4M9V C;  1IBM I;  2WZO A;  4JI8 E;  3BID A;  1A1G A;  4WUC A;  3M7N G;  5DRO A;  5A6A A;  2MC5 A;  2YRM A;  3K85 A;  3DD6 A;  4JI7 I;  3BGH A;  2PO1 A;  3CDI A;  5TSE A;  3J7Y p;  4DU8 A;  2EN1 A;  2EMW A;  2ENH A;  1YYO A;  4FK5 C;  2NPF A;  1X48 A;  1I94 I;  4WSP A;  4KHP E;  4JI4 E;  4X62 E;  2V85 A;  4N4R B;  3VHT B;  4X66 E;  3K17 A;  4DR5 I;  4DV2 E;  2L8T A;  2EPX A;  2YTG A;  4KWY A;  1JK2 A;  5EL9 A;  2EPK X;  1S16 A;  2JPA A;  4B3M I;  1N33 E;  2GQ0 A;  4DPY A;  1A1J A;  2BA0 G;  5KL3 A;  1A1K A;  5KL5 A;  2LT7 A;  4BA1 B;  3DJW A;  3ZKD A;  4LF7 E;  2GPI A;  3OML A;  2YTE A;  3ADG A;  1WXR A;  3J7A G;  2DEI A;  4EMD A;  4X65 I;  4F9A B;  3HKM A;  1Z59 A;  2JE6 B;  3ZKB A;  3M85 D;  3GLL A;  1N0V C;  1YUJ A;  4B3S I;  2F4V E;  4DKK A;  2EN7 A;  4P52 A;  2LCE A;  5IT9 Q;  4FW3 A;  4OO1 D;  1FJG E;  3C6K A;  3EPJ A;  2F1D A;  2N8X A;  1N36 I;  1ZBT A;  2WP8 B;  5JEA C;  3GME A;  1YH8 A;  1T4L B;  1B69 A;  4MQY A;  3MSW A;  4BBY A;  2DB2 A;  2EOM A;  4RHB B;  4DV1 E;  4P78 A;  1A1H A;  4B3T E;  4LF9 E;  1DAR A;  1H73 A;  4NXM I;  3U1Y A;  4DR7 I;  2L3C A;  5LL6 R;  2E5L I;  4DV5 I;  4OX9 E;  3IWC A;  4R2S A;  2EJ4 A;  2UUB E;  4DV3 I;  1MX0 A;  2YWQ A;  1ZBQ A;  4YY3 I;  2RQL A;  1B63 A;  2YTD A;  4IZJ B;  4PRV A;  1MGT A;  3VK6 A;  5AE1 A;  2BM0 A;  2C39 A;  2E1R A;  4ZYD A;  4JI8 I;  4JI5 E;  2R42 A;  3ZZU A;  2D9H A;  4KQV A;  3QG5 C;  1YFH A;  4LU9 A;  4NZV A;  3HJC A;  4BS9 A;  5IT9 C;  2V89 A;  2ZM6 E;  2JP9 A;  3QT8 A;  5K36 D;  4KHP I;  2DMY A;  4WXD A;  4X62 I;  4JI4 I;  5DRQ A;  4X66 I;  2EN6 A;  2LMZ A;  4DV2 I;  2BR2 B;  2NAB A;  2EN2 A;  2EOE A;  4OO1 C;  2C37 B;  2V87 A;  1D6T A;  2I13 A;  4AQY E;  1XNR E;  4R03 A;  1ZM9 A;  4DR1 E;  4JI0 E;  2NN6 D;  1N33 I;  2EOF A;  4PU9 A;  1OJ4 A;  2J7J A;  2YRK A;  1USU A;  2EMH A;  4R2P A;  2BA1 G;  4LCF A;  1VIS A;  5C0X C;  3HPZ A;  1EI1 A;  2DLQ A;  4FW4 A;  2PO0 A;  4LF7 I;  4O43 A;  1ZU1 A;  3J80 Q;  1PJQ A;  3ZM7 A;  2V2Z A;  3HXL A;  3J81 Q;  3Q1Q A;  4JYA E;  4MYT A;  1Z5A A;  2F4V I;  4IFD D;  3L7Z B;  1KIJ A;  1FJG I;  2AE8 A;  5DNY A;  2Z5B B;  1XXE A;  1SFE A;  4F2J C;  3LTO A;  4HXZ A;  4BMJ A;  4B3T I;  2Q2E B;  4DV1 I;  1QNT A;  3PYD A;  4LF9 I;  3LLH A;  3BF2 A;  2WBT A;  4ZYG A;  1P47 A;  5AC5 A;  4OX9 I;  4AM3 A;  2VRD A;  1IBK E;  2UUB I;  2ENC A;  5K36 C;  2YTI A;  4IS9 A;  3V5R A;  5KL6 A;  2JEB B;  4IZK B;  4BA1 A;  4GKJ I;  3WU6 A;  5GME A;  2YTF A;  5DNX A;  1UDQ A;  4DPW A;  5GMD A;  5IXM B;  2JE6 A;  1QZR A;  2NN6 C;  1X5W A;  2UUA E;  4XTJ A;  4JI5 I;  1Y4S A;  5A6J A;  5KL2 A;  1PKP A;  4F9C B;  1TF3 A;  2LTR A;  4OZE A;  1RMD A;  1AAY A;  2WP8 A;  2WCC 3;  2EOX A;  1ELO A;  2H36 X;  1PVG A;  1FWK A;  2KOU A;  5A6K A;  5LLQ A;  4O5G A;  2VQF E;  2MKD A;  2LBS B;  4MDT A;  4WUD A;  2ZM6 I;  4F9B B;  2GHF A;  2UUC E;  1ZM3 A;  4IFD C;  4BA2 B;  2L2K B;  1TN9 A;  4NHR A;  4I3H A;  2CPN A;  2LVH A;  3AUZ A;  4AQY I;  1XNR I;  3C4T A;  2EMK A;  4JI0 I;  4DR1 I;  1T4O A;  5LMN E;  4GKK E;  4DR3 E;  4BHC A;  4WX9 A;  1KVK A;  3P1X A;  2B7V A;  4IZJ A;  1P42 A;  4DV4 E;  1HR0 E;  2EQ3 A;  2YTJ A;  4FW6 A;  4GZN C;  4JYA I;  2C38 B;  2I9I A;  1KTV A;  2EM0 A;  1H7U A;  4R1F A;  2E72 A;  4DPT A;  3HQ1 A;  4QNK A;  3QT5 A;  2HKE A;  4USM A;  2EOR A;  4R2E A;  4OOG C;  1OYS A;  4JV5 E;  2RTX A;  4O24 A;  2IHR 1;  2BR2 A;  1GQE A;  2C37 A;  2V88 A;  5A2Q C;  3P76 A;  2ZBK B;  3PS1 A;  2HGH A;  2EMG A;  1IBK I;  2M9A A;  3T1H E;  1UN6 B;  3THN A;  3LML A;  5BR8 E;  4MU1 A;  4P7D A;  2CG9 A;  1H72 C;  2L33 A;  2N3H A;  3C4B A;  2RSM A;  3PYE A;  2M4I A;  4DR6 E;  2EM7 A;  2RPC A;  4ZYE A;  2NUF A;  1BB8 A;  3GON A;  4WYQ B;  4DV6 E;  1PDA A;  5FWK A;  2UUA I;  3T1Y E;  2FTX B;  1YZ9 A;  3L7Z A;  4JI6 E;  4K0K E;  2X7I A;  2EPA A;  1JK1 A;  4MYU A;  4MLV A;  4DV0 E;  3ADL A;  2Z5B A;  3K1J A;  4Z7Y A;  2HK3 A;  3LPS A;  2E1M A;  3EPK A;  5A69 A;  2VQF I;  2N3G A;  2UUC I;  4Q28 A;  3AV0 A;  2AJ4 A;  3M7N D;  5JEA B;  5ELW A;  2JEA B;  2EWL A;  3P3E A;  2PO2 A;  5A6B A;  3OTO E;  4J3D A;  5C0X D;  4GKK I;  2JEB A;  5IV8 B;  1O0W A;  4IZK A;  4MU0 A;  5LMN I;  4DR3 I;  2LV2 A;  2EOO A;  3MHH C;  3C6M A;  2EN8 A;  3B82 A;  4DPU A;  2V2Q A;  3QT6 A;  4DV4 I;  4J8Z A;  2VE7 C;  1FI4 A;  1HR0 I;  3FIG A;  3B8H A;  2EPZ A;  4ISA A;  2WNR B;  2G7H A;  2BA0 D;  5AE2 A;  2VQE E;  2A2D A;  2YU5 A;  4M0V A;  1KJK A;  3UHM A;  4BHB A;  2RS6 A;  3MHS C;  4JI2 E;  4NXN E;  2DRP A;  1DQ3 A;  2YTN A;  4DR2 E;  4LFB E;  1YPN A;  2YRH A;  4BC7 A;  3LNU A;  1ZM4 A;  4BA2 A;  4JV5 I;  2IER A;  2ZIT A;  2EML A;  4MU4 A;  4F54 A;  2HFS A;  2YPN A;  4YHH E;  4U3B A;  3Q6M A;  3KRN A;  4HAC B;  5EKW A;  3T1H I;  4FW5 A;  5IWA E;  2YU8 A;  4OO1 B;  5KL4 A;  1Z0B A;  4FWH A;  4R2D A;  2JWO A;  5JEA F;  5BR8 I;  1STU A;  4RPF A;  1T4N A;  1H7S A;  4DR6 I;  5LMU E;  4URL A;  2B7T A;  2HKJ A;  1A1F A;  3UK3 C;  2V2V A;  2HK2 A;  5C0X B;  4DV6 I;  3T1Y I;  2BM1 A;  2EOZ A;  2YSO A;  4JI6 I;  2C38 A;  4K0K I;  2MKN A;  1N34 E;  2EPO A;  4LF8 E;  4DV0 I;  1A1L A;  4ED4 A;  2YSP A;  2O3Z A;  4FWG A;  3DF6 A;  2EP3 A;  2R1F A;  2JY9 A;  2EMA A;  2LTS A;  2RSI A;  4M30 A;  3KZZ A;  2EPM X;  5FLX C;  4TUI A;  1HNZ E;  4LTY A;  3B4T A;  1X47 A;  1OYR A;  1L4S A;  3H09 A;  1N3G A;  2PNM A;  3OTO I;  2WBU A;  2YZT A;  2EMY A;  2VF1 A;  2V86 A;  2V8P A;  1DI2 A;  1X49 A;  2PO2 B;  3HTX A; 
#chains in the Genus database with same CATH homology
 2M7Q A;  2L3J A;  4GKJ E;  1EA6 A;  2B3T B;  1Z5B A;  4LF6 E;  2V34 A;  5F3W A;  1FWL A;  1NHJ A;  3Q6N A;  2VQE I;  3ADJ A;  2L2M A;  2K4V A;  1HNX E;  1ZM2 A;  3M6A A;  4NXN I;  4JI2 I;  4LFB I;  4DR2 I;  2UXC E;  2NA2 A;  3JU0 A;  5A2Q Q;  4M1K A;  2LJP A;  2FGG A;  5ADZ A;  4YHH I;  2Z5E A;  5L3J A;  5CFF E;  5IWA I;  1GZ6 A;  4LFC E;  4DU7 A;  4N3O A;  5LMU I;  2DEJ A;  2Z5C B;  1NHH A;  1U2R A;  1H74 A;  3P06 A;  2L92 A;  1FKA E;  5T6J A;  1N34 I;  4LF8 I;  2LUQ A;  3RMP A;  1S4E A;  4DMI A;  1PIE A;  4DUY E;  2R3V A;  1HNZ I;  2KHX A;  4JI3 E;  1ZXM A;  4HAC A;  2UXD E;  1X49 A;  1A6F A;  1NZ0 A;  2LRS A;  2MDR A;  1MG7 A;  1Z0G A;  3F6G A;  1XMQ E;  4GKJ I;  2YT4 A;  1YYW A;  4UT4 A;  1J26 A;  4LF6 I;  2MC6 A;  2EZ6 A;  4FN5 A;  2LE2 A;  4BC9 A;  2A2C A;  5AAS A;  1HNX I;  1XNQ E;  1J5E E;  3ADI A;  2NUG A;  1Z0W A;  2UXC I;  1RR9 A;  1IBL E;  4DUZ E;  4DR4 E;  3H4L A;  2O1T A;  2CGE A;  4FW9 A;  4GEQ B;  2HHH E;  1RC7 A;  2GS8 A;  2UU9 E;  2KON A;  1SR9 A;  4DPX A;  4UTG A;  3CWV A;  4X8W A;  4IZJ D;  2X36 A;  1UIL A;  3JTZ A;  4B3R E;  4LFC I;  2M1S A;  4PRX A;  3JAM Q;  3IWD A;  1N32 E;  2LJH A;  3ZZ0 A;  4BCA A;  1FNM A;  1Z0C A;  4LF4 E;  5FLX Q;  4DUY I;  1BKN A;  1B62 A;  3ZZT A;  4USK A;  4JI3 I;  4LF5 E;  1Z0T A;  4JI1 E;  2ODR D;  3PRY A;  3QT7 A;  1XHK A;  2UXD I;  2FV4 B;  4DV7 E;  1XMQ I;  4P7A A;  2LUP B;  4M2Z A;  1HNW E;  2Z5C A;  3KWR A;  2DIX A;  3VYX A;  2JOB A;  3J7A M;  2BV3 A;  4WFT A;  3JAM C;  4ZVI A;  2UXB E;  5AE3 A;  1XNQ I;  1K47 A;  1Y6Z A;  1J5E I;  4TUG A;  2JOX A;  1RRE A;  1UEK A;  1IBL I;  4DUZ I;  4DR4 I;  2O1W A;  1MU5 A;  2JR1 A;  2XEX A;  2HHH I;  2UU9 I;  2HFU A;  2F8B A;  4LFA E;  4Z7C A;  3IWB A;  3HUL A;  1QU6 A;  1USV A;  1KKH A;  1Z0V A;  2CZ9 A;  4HY1 A;  1EKZ A;  3F0N A;  4B3R I;  4WUB A;  1WUU A;  2IOP A;  2J7K A;  2ODR C;  2V83 A;  4X64 E;  1XMO E;  1N32 I;  2O1V A;  2JVA A;  1WHQ A;  2VF3 A;  2EFG A;  2V8Q B;  3B78 A;  2RS7 A;  4L8N A;  1IBM E;  4LF4 I;  3F6H A;  2L2N A;  3D4J A;  4JI7 E;  4WPY A;  3V2U C;  4LF5 I;  4JI1 I;  1I94 E;  1HK7 A;  2B9D A;  4DV7 I;  3WU4 A;  2IOQ A;  4DR5 E;  1YYK A;  4R8O A;  1RQ0 A;  1HNW I;  1WHN A;  1ZXN A;  1N0U A;  4B3M E;  1Z5C A;  1Y4U A;  2UXB I;  2O1U A;  3PYF A;  2DSY A;  4X65 E;  3J80 C;  3WU5 A;  4B3S E;  3J81 C;  3ZOQ B;  1N36 E;  4JG4 A;  3WU3 A;  4LFA I;  2WW4 A;  4I8O A;  4HYM A;  2PNL A;  4L5N C;  4NXM E;  3K6Q A;  4DR7 E;  3PYG A;  4FWD A;  2NUE A;  1Z0E A;  3HPS A;  2OI2 A;  2E5L E;  4DV5 E;  4X64 I;  1XMO I;  4DV3 E;  2L6M A;  1NHI A;  4KZS A;  4YY3 E;  1UHZ A;  3VYY A;  4DXL A;  1IBM I;  2WZO A;  4JI8 E;  4WUC A;  2MC5 A;  3K85 A;  4JI7 I;  3J7Y p;  4DU8 A;  2NPF A;  1YYO A;  1I94 I;  1X48 A;  4WSP A;  4KHP E;  4JI4 E;  4X62 E;  2V85 A;  4X66 E;  3K17 A;  4DR5 I;  4DV2 E;  2L8T A;  1S16 A;  4B3M I;  1N33 E;  2GQ0 A;  4DPY A;  3DJW A;  3ZKD A;  4LF7 E;  3OML A;  1WXR A;  3ADG A;  3J7A G;  2DEI A;  4EMD A;  4X65 I;  4F9A B;  1Z59 A;  3ZKB A;  1N0V C;  4B3S I;  2F4V E;  4DKK A;  4P52 A;  5IT9 Q;  1FJG E;  1N36 I;  1ZBT A;  1T4L B;  3MSW A;  4BBY A;  2DB2 A;  4LF9 E;  4DV1 E;  1H73 A;  4P78 A;  1DAR A;  4B3T E;  4NXM I;  4DR7 I;  2L3C A;  5LL6 R;  2E5L I;  4DV5 I;  4OX9 E;  3IWC A;  2UUB E;  4DV3 I;  1MX0 A;  1ZBQ A;  4YY3 I;  1B63 A;  4IZJ B;  4PRV A;  3VK6 A;  5AE1 A;  2BM0 A;  2E1R A;  4JI8 I;  4JI5 E;  2R42 A;  3ZZU A;  4KQV A;  4LU9 A;  3HJC A;  4BS9 A;  5IT9 C;  2V89 A;  2ZM6 E;  3QT8 A;  4KHP I;  2DMY A;  4X62 I;  4JI4 I;  4X66 I;  4DV2 I;  2V87 A;  1D6T A;  4AQY E;  1XNR E;  4R03 A;  1ZM9 A;  4DR1 E;  4JI0 E;  1N33 I;  4PU9 A;  1OJ4 A;  1USU A;  1VIS A;  3HPZ A;  1EI1 A;  4LF7 I;  3J80 Q;  3ZM7 A;  2V2Z A;  3HXL A;  3J81 Q;  3Q1Q A;  4JYA E;  4MYT A;  1Z5A A;  2F4V I;  1KIJ A;  1FJG I;  5DNY A;  2Z5B B;  3LTO A;  4HXZ A;  4BMJ A;  4B3T I;  2Q2E B;  4DV1 I;  4LF9 I;  3PYD A;  3LLH A;  4OX9 I;  1IBK E;  2UUB I;  3V5R A;  4IZK B;  3WU6 A;  5GME A;  4DPW A;  5GMD A;  1QZR A;  4XTJ A;  2UUA E;  4JI5 I;  1Y4S A;  1PKP A;  4F9C B;  2LTR A;  1ELO A;  2H36 X;  1PVG A;  1FWK A;  2KOU A;  2VQF E;  2LBS B;  4WUD A;  2ZM6 I;  4F9B B;  1ZM3 A;  2UUC E;  2L2K B;  4I3H A;  2CPN A;  4AQY I;  3AUZ A;  1XNR I;  3C4T A;  4JI0 I;  4DR1 I;  4GKK E;  1T4O A;  5LMN E;  4DR3 E;  1KVK A;  3P1X A;  2B7V A;  4IZJ A;  4DV4 E;  1HR0 E;  4JYA I;  1KTV A;  1H7U A;  4R1F A;  4DPT A;  3HQ1 A;  3QT5 A;  2HKE A;  4USM A;  4OOG C;  4JV5 E;  2RTX A;  2IHR 1;  1GQE A;  2V88 A;  5A2Q C;  2ZBK B;  1IBK I;  3T1H E;  3LML A;  5BR8 E;  4P7D A;  2CG9 A;  1H72 C;  2L33 A;  2N3H A;  3C4B A;  2RSM A;  3PYE A;  2M4I A;  4DR6 E;  2NUF A;  3GON A;  4WYQ B;  4DV6 E;  5FWK A;  2UUA I;  3T1Y E;  2FTX B;  1YZ9 A;  4JI6 E;  4K0K E;  2X7I A;  4MYU A;  4DV0 E;  3ADL A;  2Z5B A;  3K1J A;  4Z7Y A;  2HK3 A;  3LPS A;  2E1M A;  2VQF I;  2N3G A;  2UUC I;  4Q28 A;  3AV0 A;  2AJ4 A;  2EWL A;  3OTO E;  4GKK I;  5LMN I;  1O0W A;  4IZK A;  4DR3 I;  3B82 A;  4DPU A;  2V2Q A;  3QT6 A;  4DV4 I;  4J8Z A;  2VE7 C;  1FI4 A;  1HR0 I;  3FIG A;  3B8H A;  2G7H A;  5AE2 A;  2VQE E;  2A2D A;  4M0V A;  4NXN E;  2RS6 A;  4JI2 E;  4LFB E;  1DQ3 A;  4DR2 E;  3LNU A;  4BC7 A;  1ZM4 A;  4JV5 I;  2ZIT A;  4F54 A;  2HFS A;  4YHH E;  3T1H I;  3Q6M A;  4HAC B;  5IWA E;  1Z0B A;  4FWH A;  5BR8 I;  2JWO A;  1STU A;  4RPF A;  1T4N A;  1H7S A;  4DR6 I;  5LMU E;  4URL A;  2B7T A;  2HKJ A;  4DV6 I;  2V2V A;  2HK2 A;  3T1Y I;  2BM1 A;  4JI6 I;  4K0K I;  1N34 E;  4LF8 E;  4DV0 I;  4ED4 A;  4FWG A;  3DF6 A;  2JY9 A;  2LTS A;  4M30 A;  5FLX C;  4TUI A;  1HNZ E;  4LTY A;  1X47 A;  3H09 A;  2PNM A;  3OTO I;  2YZT A;  2VF1 A;  2V86 A;  2V8P A;  1DI2 A;  2LMZ A;  3HTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...