1N33E

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n33E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n33E02
4DUZE 4DR3E 4JI5E 2UUCI 3T1YI 4HXZA 4LF6I 3K17A 4R1FA 1XMQE 4FW9A 4RPFA 4DR7E 4WUDA 5GMDA 1ZXMA 1RREA 1NZ0A 3WU4A 5A2QQ 1FNMA 5BR8I 1ZM4A 1XMOE 1VISA 1Z0TA 3ZM7A 1J5EI 4LF7I 4DV6I 4USMA 4UT4A 2L33A 2LUPB 3QT6A 1Z0EA 1Z59A 1QZRA 4DR7I 1FKAE 1Z0VA 1YYKA 3ZZ0A 4DR5E 1STUA 1MX0A 1RC7A 1GQEA 1H74A 1Z5CA 4FWGA 4NXNE 5L3JA 1Z5AA 1RR9A 4JI6E 3ADJA 1PVGA 2V8PA 1FJGI 4DU7A 1J26A 2NUFA 1EI1A 4DV7E 1S4EA 5IT9Q 1H73A 3F0NA 4K0KI 1IBKE 4DR1E 4LF6E 4DV5I 1XHKA 3LPSA 2VQFI 3M6AA 4GKJI 2DMYA 2UXBI 4I3HA 3PYDA 4PRVA 4DV7I 1I94I 4B3ME 2R3VA 3WU5A 2N3GA 5LL6R 4JV5E 1D6TA 1HNWE 1KIJA 4KHPE 1XNRI 1ZBTA 2UU9I 1A6FA 1MG7A 2RTXA 4JI2E 2V2QA 4DU8A 4B3MI 2NUGA 4AQYE 4LFCI 4HACA 2UXBE 4X66I 2F4VI 2LJPA 2AJ4A 2VQEE 3ADGA 4FWHA 4FN5A 4JI3E 1FI4A 2KHXA 4DR2E 4X65E 2CPNA 2NUEA 1HNZI 2E5LI 2OI2A 4URLA 4X66E 2RSMA 1IBLE 4DV3I 4LFBI 1HR0I 1WHQA 1IBME 4LF8I 4DUYE 2UUBI 2NPFA 4PU9A 4JI0I 4LF9I 4DKKA 1N36I 4FWDA 2DEIA 3V2UC 4DR4E 2N3HA 2L3CA 1BKNA 1XNQI 1YZ9A 2HFUA 3ADLA 2R42A 3K1JA 2UXCI 4MYUA 1O0WA 2A2CA 1N0VC 1QU6A 2YT4A 4Z7CA 4LF5I 4DUZI 4DR3I 4LF4E 5LMNE 1I94E 1B62A 4DV0I 1PKPA 1NHHA 4DV4I 2B3TB 4JG4A 2DIXA 4WYQB 3B8HA 1Z5BA 2J7KA 4GKKE 5BR8E 1N34E 1T4OA 1XMOI 2IHR1 2BV3A 3ZKBA 4DV0E 4DV6E 1NHIA 2MDRA 4MYTA 2L3JA 4YY3I 1UILA 3VYXA 2EZ6A 1WUUA 4PRXA 3OTOI 1DI2A 1ZXNA 3QT5A 4JI4E 1N0UA 2A2DA 2DEJA 1HNXI 4YY3E 4X8WA 1N33I 2X36A 2HKEA 2BM0A 2UU9E 4LFAE 1K47A 4HYMA 1UHZA 4DR6E 3PYFA 1U2RA 4DV3E 4LFBE 2HKJA 1DARA 4EMDA 1IBLI 2L2NA 4B3TI 4K0KE 1S16A 1X49A 4JI1E 2VQFE 1X47A 4GKJE 4DPTA 2HHHI 5IWAI 2UXDI 2F4VE 2LTSA 3LTOA 1HNZE 2E5LE 4LFAI 4JI1I 2HK3A 4DPUA 4M1KA 3QT7A 3T1YE 1XNRE 2LTRA 5FLXQ 3HTXA 1EA6A 4LFCE 1Z0CA 2HHHE 4JI2I 2ZM6E 4WUCA 4Z7YA 4LF4I 1KTVA 4NXME 4JI3I 1MU5A 4DV1I 1X48A 5IT9C 4DV5E 3ZZTA 4DR6I 2HFSA 2V34A 3HULA 5LMUE 2VF3A 4OX9I 4JV5I 3GONA 1N32E 4DR5I 4LF5E 1XNQE 4YHHI 3ADIA 2UUCE 1YYOA 4OX9E 4YHHE 2B7VA 1N36E 3T1HE 4ZVIA 2LBSB 4LF7E 3B82A 4GKKI 4JYAE 1ZM2A 1KKHA 3B78A 1H72C 5A2QC 4DV2I 4B3RE 1Z0WA 1T4NA 4KHPI 2ZITA 3C4TA 4DUYI 2LJHA 4JI5I 4B3RI 1B63A 3J80Q 1XMQI 4M2ZA 2VQEI 4X62E 3CWVA 4DR2I 1H7SA 4B3TE 2BM1A 2B7TA 1ELOA 4JI8E 4DR4I 1IBKI 4WFTA 4DV1E 1HNWI 3V5RA 1FWLA 2V2VA 3VYYA 3PYEA 4X62I 4XTJA 3D4JA 2V2ZA 3Q1QA 4JYAI 4JI4I 2GS8A 1WHNA 1RQ0A 4JI8I 1UEKA 2DB2A 3JAMQ 3LLHA 3ZZUA 2L2MA 4DR1I 1H7UA 1Z0GA 4DPXA 3T1HI 2JY9A 1PIEA 4DPYA 1EKZA 2RS7A 4DXLA 1IBMI 2Q2EB 3J81Q 3J7AG 4HACB 4X64I 1N33E 2JVAA 4UTGA 1N32I 4JI6I 1HR0E 4KQVA 4DV4E 4DPWA 1Z0BA 5LMUI 4B3SE 3J81C 2LRSA 2XEXA 2RS6A 4JI0E 4LF9E 2LUQA 3WU3A 3LNUA 4X64E 5GMEA 5CFFE 4P7AA 2WW4A 5IWAE 2UXDE 3P1XA 2UXCE 4NXMI 3PYGA 1KVKA 3ZKDA 3J7Yp 4M30A 3H4LA 4OOGC 3JAMC 4P52A 5LMNI 4B3SI 2E1RA 2ZBKB 4NXNI 3OTOE 4LF8E 2EFGA 3J7AM 5FLXC 1FWKA 2ZM6I 4ED4A 1OJ4A 4USKA 1J5EE 4JI7I 1ZM9A 1N34I 2UUAI 4X65I 3C4BA 1ZM3A 1T4LB 2NA2A 1YYWA 1NHJA 3J80C 4WUBA 2UUBE 2X7IA 2L2KB 2HK2A 4JI7E 2CZ9A 4HY1A 4DV2E 1HNXE 4AQYI 3WU6A 1FJGE 3QT8A 2UUAE
chains in the Genus database with same CATH superfamily
4DUZE 2HC5A 4DR3E 4JI5E 2EOQA 2UUCI 3T1YI 4HXZA 2BA0D 4LF6I 4IZJD 2YTIA 3K17A 4RH8A 2C37B 4R1FA 1YPNA 1XMQE 4FW9A 4RPFA 4TUGA 4DR7E 2CVEA 4WUDA 5GMDA 3C6MA 4BCAA 2CGEA 4IS9A 4I8OA 1ZXMA 1RREA 5DNXA 3DF6A 4KZSA 2JEBA 1ZU1A 3ECRA 2Z5CA 2GPIA 4NHRA 1NZ0A 3WU4A 1X5WA 1X6HA 2JR1A 4F9BB 4RHBB 1MEYC 1IMUA 1FNMA 5DRPA 4WSGA 5BR8I 1ZM4A 1XMOE 1VISA 2FTXB 2LV2A 1Z0TA 2YRKA 3ZM7A 3HXLA 2EP3A 1J5EI 4LF7I 4P78A 2RQLA 4USMA 4DV6I 5KL4A 2L33A 2LUPB 3QT6A 4UT4A 1Z0EA 4R2PA 1Z59A 3U1KA 1QZRA 2EN8A 2JEAA 4DR7I 1FKAE 2WZOA 2M7QA 4N3OA 4LPFA 4LCHA 3BF2A 1Z0VA 2IOPA 3Q6MA 1YYKA 4MQYA 5A2QQ 1VI7A 4IFDE 1USVA 3ZZ0A 4DR5E 3CDIA 1STUA 2MDGA 1MX0A 2EMBA 1RC7A 2YRMA 1Z1BA 1E3PA 4BC9A 1GQEA 2EM3A 2EPMX 1UBDC 1OYRA 3P76A 5KL2A 1H74A 2YTPA 1Z5CA 2EOOA 2YTOA 4NXNE 4FWGA 5L3JA 2O3ZA 1Z5AA 1RR9A 4JI6E 3ADJA 1IBMI 1PVGA 2CT1A 2V8PA 1FJGI 1A1KA 4DU7A 1J26A 1IQSA 2NUFA 4DV7E 3HPZA 1EI1A 1S4EA 2JT2A 3L7ZA 1UDNA 5IT9Q 1B69A 1H73A 1QNTA 3F0NA 4K0KI 3F6HA 5KL5A 3QG5C 2Z5EA 1IBKE 4DR1E 4LF6E 4OKGA 1XHKA 3LPSA 4DV5I 1YSAC 2VQFI 3M6AA 4GKJI 2DMYA 2G7HA 4F54A 4I3HA 5EKWA 2MKDA 3PYDA 2UXBI 4PRVA 4DV7I 1I94I 4B3ME 2NN6D 3MHSC 2VE7C 2PNLA 3EPLA 2R3VA 2V8QB 2N3GA 3WU5A 5LL6R 4JV5E 2I13A 1D6TA 1HNWE 2LMZA 2EMKA 4O43A 5ADZA 1KIJA 4KHPE 2V88A 3M85D 1T38A 1ZBTA 4FW4A 4AIMA 2UU9I 1XNRI 4M9VC 2NN6F 1A6FA 2K4VA 1MG7A 5JEAF 2RTXA 2YTJA 2GLIA 4R2DA 4JI2E 1UDQA 2YPNA 2EPCA 2YTDA 2EMCA 2NUGA 4AQYE 2V2QA 4DU8A 4LFCI 4HACA 2UXBE 4X66I 2F4VI 2YTQA 4FK5C 4WX9A 2NN6C 2YSPA 2LJPA 2AJ4A 2L6MA 2VQEE 3ADGA 2PNZB 2JWOA 4FWHA 2ENAA 2EQ1A 2VRDA 4JI3E 4FN5A 5T6JA 1FI4A 2KHXA 4DR2E 2EOSA 2EPPA 4X65E 2CPNA 2NUEA 2I9IA 2RPCA 1Y4UA 1AH5A 2EMIA 4Q28A 1JK2A 1HNZI 2E5LI 2OI2A 2R1FA 2EMZA 2FV4B 3P06A 4URLA 2M1SA 2EOMA 3IWDA 2YU5A 4X66E 2EQ0A 2RSMA 4ZYHA 2NN6A 4R2RA 3THNA 1WXRA 3L00A 2GO4A 5A6BD 2EM8A 1F2IG 1IBLE 4DV3I 4LFBI 1HR0I 2EL6A 1WHQA 2EPKX 1IBME 3DD6A 4LF8I 4TUIA 2ODRD 4DUYE 4OZEA 2WCC3 5A6KA 5A6JA 1R6LA 2UUBI 2Z5BA 2EN7A 2EPZA 2O1TA 3EPHA 2NPFA 4PU9A 4NBQA 4JI0I 4LF9I 4DKKA 1N36I 4FWDA 2EM9A 2YTNA 2DEIA 5JEAA 3V2UC 1SR9A 2L8TA 4HTGA 4P7DA 4DR4E 3AUZA 4F6MA 2EJ4A 1YFHA 4BHCA 2N3HA 2L3CA 1BKNA 2F8BA 1XNQI 2EPRA 4ZYDA 1YZ9A 3BBGA 1YH8A 2HFUA 3ADLA 2V86A 2R42A 3K1JA 3P3GA 5DRQA 2UXCI 4MYUA 1O0WA 2EMHA 2LVHA 4HEIA 4R2EA 5DNYA 2A2CA 1N0VC 4AIDA 1QU6A 2EOIA 4FW3A 2YT4A 4Z7CA 4LF5I 1A1IA 4DUZI 4DR3I 4IZKB 3HQ1A 4LF4E 4BC7A 3IWCA 4R2AA 5LMNE 1I94E 1B62A 5C0XC 1TF6A 2C37A 4DV0I 4ZYGA 4OO1D 1PKPA 1WJPA 2EN2A 1NHHA 4DV4I 2B3TB 4JG4A 2DMIA 2DIXA 4WYQB 3B8HA 2PO0B 1BB8A 3KZZA 5F3WA 1PDAA 3KRNA 1A1GA 1Z5BA 3L7ZB 4BS9A 2C38A 4LOMA 2DGCA 3UHMA 2J7KA 2BB8A 2VF1A 4GKKE 5BR8E 3K85A 2YSOA 3THOB 2V85A 1N34E 1T4OA 2JXPA 3EPJA 1XMOI 4F6NA 4KWYA 2IHR1 2BV3A 3ZKBA 4DV0E 4DV6E 3BGHA 1MGTA 1NHIA 2MDRA 2C38B 4MYTA 4QNJA 2L3JA 2WBSA 4YY3I 4LCFA 1UILA 2NN6E 3VYXA 2EZ6A 1WUUA 4PRXA 2BA1D 3MHHC 2EQ3A 3M7ND 4LU9A 3OTOI 2V89A 2M9AA 1DI2A 1UDOA 1ZXNA 3QT5A 4JI4E 1L4SA 1N0UA 5ELWA 3VK6A 5K36F 2A2DA 2DEJA 1HNXI 1PJQA 4YY3E 4X8WA 4BA2B 1N33I 2X36A 2HKEA 2BM0A 1EH7A 2UU9E 4LFAE 1K47A 5DNLA 4HYMA 1UHZA 2EN1A 5C0XE 4DR6E 2CSHA 2EN6A 3PYFA 1U2RA 4DV3E 4LFBE 2HKJA 1DARA 1ZR9A 4EMDA 1BBGA 1IBLI 2L2NA 2IERA 4F2JC 5JEAB 4K0KE 4B3TI 1S16A 4FW7A 4AM3A 3DJWA 2F1DA 1X49A 1YUJA 4JI1E 2VQFE 1X47A 2EL5A 4GKJE 2ODRC 3BIDA 4DPTA 2EMFA 2K7IA 4J8ZA 4GEQB 2HHHI 5IWAI 2UXDI 3TQMA 2F4VE 2LTSA 3LTOA 5JEAC 1HNZE 2E5LE 3PS1A 4WXCA 4J3DA 4LFAI 4BA1B 4MLQA 4FW6A 4JI1I 3KWRA 3EQ1A 2HK3A 4DPUA 5A69A 3JU0A 4M1KA 2LJUA 2A25A 4MU4A 3MSWA 2E1MA 5IV8B 2R76A 3QT7A 3T1YE 1RMDA 1XNRE 2LTRA 5IXMB 5FLXQ 4O5GA 3HTXA 1X6FA 1EA6A 4LFCE 1Z0CA 2HHHE 3HJCA 2J65A 4JI2I 2ZM6E 4WUCA 4Z7YA 4LF4I 4LCGA 1KTVA 2EPXA 2BA1G 3M7NG 2D9HA 3PS2A 4F9AB 4NXME 2EOXA 3PS3A 4JI3I 3F6GA 2EOYA 2LO3A 1MU5A 4DV1I 1X48A 2EMAA 5IT9C 2EPUA 4DV5E 2PO2A 4IFDC 2ENHA 4WXDA 1UDSA 3CDJA 3ZZTA 4IJDA 4OO1B 4DR6I 2LE2A 4MU3A 2HFSA 2O1VA 5AE3A 3U1YA 3UK3C 5K36B 4BA2A 2V34A 2C39B 5FWKA 2NABA 3HULA 1A1JA 5LMUE 2VF3A 1A1HA 4IZJA 5DRRA 4OX9I 2WBTA 2PO1A 2EMXA 4JV5I 1GZ6A 3GONA 1N32E 4DR5I 1A1LA 4LF5E 1XNQE 4YHHI 2VESA 2EORA 5A6AA 3NZKA 3ADIA 2PO2B 4GQUA 4MU1A 2UUCE 1USUA 3FIGA 1YYOA 2EM7A 1YHCA 2EN4A 4OX9E 1PJTA 4YHHE 2EOEA 1G2DC 3K6QA 2B7VA 4O24A 3ZOQB 3T1HE 1N36E 2JE6B 3HKMA 4ZVIA 2LBSB 2EE8A 4LF7E 2KOUA 3P3CA 2YTGA 5K36C 2EWLA 2EOZA 3B82A 4R8OA 4GKKI 4JYAE 1ZM2A 4N4RB 1KKHA 1P47A 4X9JA 3B78A 1H72C 4L8NA 5A2QC 4DV2I 3KZYA 4B3RE 2PRTA 1Z0WA 4IFDF 1T4NA 2PNMA 2HGHA 2JOBA 2GQ0A 4IZJB 4KHPI 2ZITA 3C4TA 4NZVA 4BHBA 4DUYI 2LJHA 2Z5CB 1IQOA 3M99B 1OYSA 4JI5I 1TN9A 5DROA 4B3RI 1B63A 2V83A 5KL7A 1EH6A 3J80Q 1XMQI 2JYAA 5TSEA 4BMJA 1LLMC 1EH8A 4FW5A 5KL6A 3C6KA 2YTFA 4M2ZA 4WSPA 2VQEI 2EPNA 5AC4A 4MU0A 2RSIA 2EPAA 5C0XF 5AC5A 2EMWA 4X62E 3CWVA 3LMLA 2EMGA 4DR2I 1HK7A 2JE6A 4B3TE 1H7SA 5EL9A 2BM1A 2B7TA 1ELOA 4JI8E 4DR4I 1IBKI 4WFTA 3RMPA 1Y60A 4DV1E 2BBGA 1RHYA 4ZYEA 2Q8UA 1HNWI 3V5RA 3EPKA 1FWLA 1DQ3A 3HPSA 4M0VA 2JP9A 1A1FA 2V2VA 1Y5YA 2CG9A 3VYYA 2M4IA 1UN6B 2B9DA 2MC6A 3PYEA 4X62I 4XTJA 2V2ZA 3D4JA 1ZBQA 3Q1QA 4JYAI 1AAYA 4OO1C 4JI4I 1PJSA 2L92A 5AE2A 2GS8A 4GZNC 1WHNA 2J7JA 2IESA 1RQ0A 2WP8A 4OO1F 4JI8I 1GTKA 5K36A 2YRHA 2ELYA 1R6MA 4WPYA 2YWQA 5C0XD 1UEKA 2LT7A 2DB2A 3H09A 2DLQA 3IWBA 2GO3A 2PNZA 3P3EA 3JAMQ 1E3HA 4MDTA 3GLLA 2PO1B 4F9CB 1X3CA 3LLHA 2DLKA 2H36X 3ZZUA 2ADRA 2L2MA 4DR1I 1H7UA 1Z0GA 4DPXA 4U3BA 2AE8A 1YUIA 3B4TA 2IOQA 2MC5A 2JOXA 4IZKA 3T1HI 5K36D 1P42A 2JY9A 1PIEA 2YTEA 4LTYA 4DPYA 1T39A 2V87A 2MKNA 5LLQA 3PRYA 1EKZA 2RS7A 4DXLA 3AV0A 2Q2EB 3J81Q 3J7AG 4BBYA 1KYQA 5AE1A 2EOFA 4HACB 4X64I 4R2QA 1N33E 4L5NC 2JVAA 4UTGA 4IFDA 2O1WA 5K36E 5JEAD 2FGGA 1N32I 4BA1A 4JI6I 4OO1E 1HR0E 2EM4A 4KQVA 4DV4E 4DPWA 2N8XA 2HJJA 1Z0BA 2EM6A 5LMUI 1WRJA 2EPLX 2ENCA 3J81C 4B3SE 3M85G 1ZAAC 2GHFA 2EPOA 2LRSA 5AASA 4IFDB 2XEXA 2RS6A 4MLVA 4JI0E 4LF9E 1XXEA 2EMYA 2LUQA 2EM5A 4R2CA 4R03A 3LNUA 1X6EA 2WP8B 4X64E 5GMEA 3WU3A 4B3MI 2E72A 2WNRB 5CFFE 4P7AA 2PO0A 4IS1C 2WW4A 2YZTA 2YU8A 5IWAE 2UXDE 2DRPA 3P1XA 1N3GA 1NEIA 4DMIA 4Q35B 2UXCE 3PYGA 4NXMI 1KVKA 3ZKDA 3J7Yp 4M30A 3JAMC 4OOGC 3H4LA 3H1CA 2BR2A 4P52A 1Y4SA 5LMNI 4B3SI 3VHTB 2E1RA 3JTZA 2ZBKB 4NXNI 3GMEA 3OMLA 3OTOE 3GCMA 2EM2A 3Q6NA 4LF8E 2EFGA 2CTDA 1DGCA 3J7AM 5FLXC 4R2SA 2C39A 1FWKA 2JEBB 1Y6ZA 2BA0G 2ZM6I 1G2FC 4ED4A 1JK1A 5KL3A 1OJ4A 4USKA 1J5EE 5A6BA 4JI7I 4ISAA 2ELZA 1TF3A 2EMLA 2EOHA 1ZM9A 5JEAE 2EL4A 1N34I 2UUAI 4X65I 2JEAB 2BR2B 4IFDD 2EN3A 3C4BA 4U3DA 1ZM3A 4OO1A 5C0XB 1T4LB 1BBOA 2NA2A 1KJKA 1YYWA 2Z5BB 2EM0A 1NHJA 1OYPA 3J80C 4WUBA 1SFEA 2UUBE 2X7IA 2LCEA 2L2KB 2EOJA 2DSYA 2WNRA 2O1UA 4O4KA 1NCSA 2JPAA 4JI7E 2HK2A 2CZ9A 4HY1A 5C0XA 4DV2E 2KONA 1HNXE 2NN6B 4AQYI 2WBUA 3WU6A 1FJGE 3QT8A 2UUAE 4QNKA
chains in the Genus database with same CATH topology
4DUZE 4DR3E 4JI5E 2UUCI 3T1YI 4HXZA 4LF6I 4IZJD 3K17A 4R1FA 1XMQE 4FW9A 4RPFA 4TUGA 4DR7E 4WUDA 5GMDA 4BCAA 2CGEA 4I8OA 1ZXMA 1RREA 3DF6A 4KZSA 2Z5CA 1NZ0A 3WU4A 5A2QQ 2JR1A 4F9BB 1FNMA 5BR8I 1ZM4A 1XMOE 1VISA 2FTXB 1Z0TA 3ZM7A 3HXLA 1J5EI 4LF7I 4P78A 4USMA 4DV6I 4UT4A 2L33A 2LUPB 3QT6A 1Z0EA 1Z59A 1QZRA 4DR7I 1FKAE 2WZOA 2M7QA 4N3OA 1Z0VA 2IOPA 3Q6MA 1YYKA 1USVA 3ZZ0A 4DR5E 1STUA 1MX0A 1RC7A 4BC9A 1GQEA 1H74A 1Z5CA 4FWGA 4NXNE 5L3JA 1Z5AA 1RR9A 4JI6E 3ADJA 1PVGA 2V8PA 1FJGI 4DU7A 1J26A 2NUFA 1S4EA 4DV7E 3HPZA 1EI1A 5IT9Q 1H73A 3F0NA 4K0KI 3F6HA 2Z5EA 1IBKE 4DR1E 4LF6E 4DV5I 1XHKA 3LPSA 2VQFI 3M6AA 4GKJI 2DMYA 2G7HA 4F54A 4I3HA 2UXBI 3PYDA 4PRVA 4DV7I 1I94I 4B3ME 2PNLA 2R3VA 2VE7C 3WU5A 2V8QB 2N3GA 5LL6R 4JV5E 1D6TA 1HNWE 2LMZA 5ADZA 1KIJA 4KHPE 2V88A 1XNRI 1ZBTA 2UU9I 1A6FA 2K4VA 1MG7A 2RTXA 4JI2E 2V2QA 4DU8A 4B3MI 2NUGA 4AQYE 4LFCI 4HACA 2UXBE 4X66I 2F4VI 2LJPA 2AJ4A 2L6MA 2VQEE 3ADGA 2JWOA 4FWHA 4FN5A 4JI3E 5T6JA 1FI4A 2KHXA 4DR2E 4X65E 2CPNA 2NUEA 1Y4UA 4Q28A 1HNZI 2E5LI 2OI2A 2FV4B 3P06A 4URLA 2M1SA 3IWDA 4X66E 2RSMA 1WXRA 1IBLE 4DV3I 4LFBI 1HR0I 1WHQA 1IBME 4LF8I 4TUIA 2ODRD 4DUYE 2UUBI 2Z5BA 2O1TA 2NPFA 4PU9A 4JI0I 4LF9I 4DKKA 1N36I 4FWDA 2DEIA 3V2UC 1SR9A 2L8TA 4P7DA 4DR4E 3AUZA 2N3HA 2L3CA 1BKNA 2F8BA 1XNQI 1YZ9A 2HFUA 3ADLA 2V86A 2R42A 3K1JA 2UXCI 4MYUA 1O0WA 5DNYA 2A2CA 1N0VC 1QU6A 2YT4A 4Z7CA 4LF5I 4DUZI 4DR3I 4IZKB 3HQ1A 4LF4E 4BC7A 3IWCA 5LMNE 1I94E 1B62A 4DV0I 1PKPA 1NHHA 4DV4I 2B3TB 4JG4A 2DIXA 4WYQB 3B8HA 5F3WA 1Z5BA 4BS9A 2J7KA 4GKKE 2VF1A 3K85A 5BR8E 2V85A 1N34E 1T4OA 1XMOI 2IHR1 2BV3A 3ZKBA 4DV0E 4DV6E 1NHIA 2MDRA 4MYTA 2L3JA 4YY3I 1UILA 3VYXA 2EZ6A 1WUUA 4PRXA 4LU9A 3OTOI 2V89A 1DI2A 1ZXNA 3QT5A 4JI4E 1N0UA 3VK6A 2A2DA 2DEJA 1HNXI 4YY3E 4X8WA 1N33I 2X36A 2HKEA 2BM0A 2UU9E 4LFAE 1K47A 4HYMA 1UHZA 4DR6E 3PYFA 1U2RA 4DV3E 4LFBE 2HKJA 1DARA 4EMDA 1IBLI 2L2NA 4B3TI 4K0KE 1S16A 3DJWA 1X49A 4JI1E 2VQFE 1X47A 4GKJE 2ODRC 4DPTA 4J8ZA 4GEQB 2HHHI 5IWAI 2UXDI 2F4VE 2LTSA 3LTOA 1HNZE 2E5LE 4LFAI 4JI1I 3KWRA 2HK3A 4DPUA 3JU0A 4M1KA 3MSWA 2E1MA 3QT7A 3T1YE 1XNRE 2LTRA 5FLXQ 3HTXA 1EA6A 4LFCE 1Z0CA 2HHHE 3HJCA 4JI2I 2ZM6E 4WUCA 4Z7YA 4LF4I 1KTVA 4F9AB 4NXME 4JI3I 3F6GA 1MU5A 4DV1I 1X48A 5IT9C 4DV5E 3ZZTA 4DR6I 2LE2A 2HFSA 2O1VA 5AE3A 2V34A 5FWKA 3HULA 5LMUE 2VF3A 4IZJA 4OX9I 4JV5I 1GZ6A 3GONA 1N32E 4DR5I 4LF5E 1XNQE 4YHHI 3ADIA 2UUCE 1USUA 3FIGA 1YYOA 4OX9E 4YHHE 3K6QA 2B7VA 1N36E 3ZOQB 3T1HE 4ZVIA 2LBSB 4LF7E 2KOUA 2EWLA 3B82A 4R8OA 4GKKI 4JYAE 1ZM2A 1KKHA 3B78A 1H72C 4L8NA 5A2QC 4DV2I 4B3RE 1Z0WA 1T4NA 2PNMA 2JOBA 2GQ0A 4IZJB 4KHPI 2ZITA 3C4TA 4DUYI 2LJHA 2Z5CB 4JI5I 4B3RI 1B63A 2V83A 3J80Q 1XMQI 4BMJA 4M2ZA 4WSPA 2VQEI 4X62E 3CWVA 3LMLA 4DR2I 1HK7A 1H7SA 4B3TE 2BM1A 2B7TA 1ELOA 4JI8E 4DR4I 1IBKI 4WFTA 3RMPA 4DV1E 1HNWI 3V5RA 1FWLA 1DQ3A 3HPSA 4M0VA 2V2VA 2CG9A 3VYYA 2M4IA 3PYEA 2B9DA 2MC6A 4X62I 4XTJA 2V2ZA 3D4JA 1ZBQA 3Q1QA 4JYAI 4JI4I 2L92A 5AE2A 2GS8A 1WHNA 1RQ0A 4JI8I 4WPYA 1UEKA 2DB2A 3H09A 3IWBA 3JAMQ 4F9CB 3LLHA 2H36X 3ZZUA 2L2MA 4DR1I 1H7UA 1Z0GA 4DPXA 2IOQA 2MC5A 2JOXA 4IZKA 3T1HI 2JY9A 1PIEA 4LTYA 4DPYA 2V87A 3PRYA 1EKZA 2RS7A 4DXLA 3AV0A 2Q2EB 3J81Q 3J7AG 4BBYA 5AE1A 4HACB 4X64I 1IBMI 1N33E 4L5NC 2JVAA 4UTGA 2O1WA 2FGGA 1N32I 4JI6I 1HR0E 4KQVA 4DV4E 4DPWA 1Z0BA 5LMUI 4B3SE 3J81C 2LRSA 5AASA 2XEXA 2RS6A 4JI0E 4LF9E 2LUQA 4R03A 3LNUA 3WU3A 4X64E 5GMEA 5CFFE 4P7AA 2WW4A 2YZTA 2UXDE 5IWAE 3P1XA 4DMIA 2UXCE 4NXMI 3PYGA 1KVKA 3ZKDA 3J7Yp 4M30A 3JAMC 4OOGC 3H4LA 4P52A 1Y4SA 5LMNI 4B3SI 2E1RA 3JTZA 2ZBKB 4NXNI 3OMLA 3OTOE 3Q6NA 4LF8E 2EFGA 3J7AM 5FLXC 1FWKA 1Y6ZA 2ZM6I 4ED4A 1OJ4A 4USKA 1J5EE 4JI7I 1ZM9A 1N34I 2UUAI 4X65I 3C4BA 1ZM3A 1T4LB 2NA2A 1YYWA 2Z5BB 1NHJA 3J80C 4WUBA 2UUBE 2X7IA 2L2KB 2DSYA 2O1UA 2HK2A 4JI7E 2CZ9A 4HY1A 4DV2E 2KONA 1HNXE 4AQYI 3WU6A 1FJGE 3QT8A 2UUAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ E;  4DR3 E;  4JI5 E;  2UUC I;  3T1Y I;  4HXZ A;  4LF6 I;  3K17 A;  4R1F A;  1XMQ E;  4FW9 A;  4RPF A;  4DR7 E;  4WUD A;  5GMD A;  1ZXM A;  1RRE A;  1NZ0 A;  3WU4 A;  5A2Q Q;  1FNM A;  5BR8 I;  1ZM4 A;  1XMO E;  1VIS A;  1Z0T A;  3ZM7 A;  1J5E I;  4LF7 I;  4DV6 I;  4USM A;  4UT4 A;  2L33 A;  2LUP B;  3QT6 A;  1Z0E A;  1Z59 A;  1QZR A;  4DR7 I;  1FKA E;  1Z0V A;  1YYK A;  3ZZ0 A;  4DR5 E;  1STU A;  1MX0 A;  1RC7 A;  1GQE A;  1H74 A;  1Z5C A;  4FWG A;  4NXN E;  5L3J A;  1Z5A A;  1RR9 A;  4JI6 E;  3ADJ A;  1PVG A;  2V8P A;  1FJG I;  4DU7 A;  1J26 A;  2NUF A;  1EI1 A;  4DV7 E;  1S4E A;  5IT9 Q;  1H73 A;  3F0N A;  4K0K I;  1IBK E;  4DR1 E;  4LF6 E;  4DV5 I;  1XHK A;  3LPS A;  2VQF I;  3M6A A;  4GKJ I;  2DMY A;  2UXB I;  4I3H A;  3PYD A;  4PRV A;  4DV7 I;  1I94 I;  4B3M E;  2R3V A;  3WU5 A;  2N3G A;  5LL6 R;  4JV5 E;  1D6T A;  1HNW E;  1KIJ A;  4KHP E;  1XNR I;  1ZBT A;  2UU9 I;  1A6F A;  1MG7 A;  2RTX A;  4JI2 E;  2V2Q A;  4DU8 A;  4B3M I;  2NUG A;  4AQY E;  4LFC I;  4HAC A;  2UXB E;  4X66 I;  2F4V I;  2LJP A;  2AJ4 A;  2VQE E;  3ADG A;  4FWH A;  4FN5 A;  4JI3 E;  1FI4 A;  2KHX A;  4DR2 E;  4X65 E;  2CPN A;  2NUE A;  1HNZ I;  2E5L I;  2OI2 A;  4URL A;  4X66 E;  2RSM A;  1IBL E;  4DV3 I;  4LFB I;  1HR0 I;  1WHQ A;  1IBM E;  4LF8 I;  4DUY E;  2UUB I;  2NPF A;  4PU9 A;  4JI0 I;  4LF9 I;  4DKK A;  1N36 I;  4FWD A;  2DEI A;  3V2U C;  4DR4 E;  2N3H A;  2L3C A;  1BKN A;  1XNQ I;  1YZ9 A;  2HFU A;  3ADL A;  2R42 A;  3K1J A;  2UXC I;  4MYU A;  1O0W A;  2A2C A;  1N0V C;  1QU6 A;  2YT4 A;  4Z7C A;  4LF5 I;  4DUZ I;  4DR3 I;  4LF4 E;  5LMN E;  1I94 E;  1B62 A;  4DV0 I;  1PKP A;  1NHH A;  4DV4 I;  2B3T B;  4JG4 A;  2DIX A;  4WYQ B;  3B8H A;  1Z5B A;  2J7K A;  4GKK E;  5BR8 E;  1N34 E;  1T4O A;  1XMO I;  2IHR 1;  2BV3 A;  3ZKB A;  4DV0 E;  4DV6 E;  1NHI A;  2MDR A;  4MYT A;  2L3J A;  4YY3 I;  1UIL A;  3VYX A;  2EZ6 A;  1WUU A;  4PRX A;  3OTO I;  1DI2 A;  1ZXN A;  3QT5 A;  4JI4 E;  1N0U A;  2A2D A;  2DEJ A;  1HNX I;  4YY3 E;  4X8W A;  1N33 I;  2X36 A;  2HKE A;  2BM0 A;  2UU9 E;  4LFA E;  1K47 A;  4HYM A;  1UHZ A;  4DR6 E;  3PYF A;  1U2R A;  4DV3 E;  4LFB E;  2HKJ A;  1DAR A;  4EMD A;  1IBL I;  2L2N A;  4B3T I;  4K0K E;  1S16 A;  1X49 A;  4JI1 E;  2VQF E;  1X47 A;  4GKJ E;  4DPT A;  2HHH I;  5IWA I;  2UXD I;  2F4V E;  2LTS A;  3LTO A;  1HNZ E;  2E5L E;  4LFA I;  4JI1 I;  2HK3 A;  4DPU A;  4M1K A;  3QT7 A;  3T1Y E;  1XNR E;  2LTR A;  5FLX Q;  3HTX A;  1EA6 A;  4LFC E;  1Z0C A;  2HHH E;  4JI2 I;  2ZM6 E;  4WUC A;  4Z7Y A;  4LF4 I;  1KTV A;  4NXM E;  4JI3 I;  1MU5 A;  4DV1 I;  1X48 A;  5IT9 C;  4DV5 E;  3ZZT A;  4DR6 I;  2HFS A;  2V34 A;  3HUL A;  5LMU E;  2VF3 A;  4OX9 I;  4JV5 I;  3GON A;  1N32 E;  4DR5 I;  4LF5 E;  1XNQ E;  4YHH I;  3ADI A;  2UUC E;  1YYO A;  4OX9 E;  4YHH E;  2B7V A;  1N36 E;  3T1H E;  4ZVI A;  2LBS B;  4LF7 E;  3B82 A;  4GKK I;  4JYA E;  1ZM2 A;  1KKH A;  3B78 A;  1H72 C;  5A2Q C;  4DV2 I;  4B3R E;  1Z0W A;  1T4N A;  4KHP I;  2ZIT A;  3C4T A;  4DUY I;  2LJH A;  4JI5 I;  4B3R I;  1B63 A;  3J80 Q;  1XMQ I;  4M2Z A;  2VQE I;  4X62 E;  3CWV A;  4DR2 I;  1H7S A;  4B3T E;  2BM1 A;  2B7T A;  1ELO A;  4JI8 E;  4DR4 I;  1IBK I;  4WFT A;  4DV1 E;  1HNW I;  3V5R A;  1FWL A;  2V2V A;  3VYY A;  3PYE A;  4X62 I;  4XTJ A;  3D4J A;  2V2Z A;  3Q1Q A;  4JYA I;  4JI4 I;  2GS8 A;  1WHN A;  1RQ0 A;  4JI8 I;  1UEK A;  2DB2 A;  3JAM Q;  3LLH A;  3ZZU A;  2L2M A;  4DR1 I;  1H7U A;  1Z0G A;  4DPX A;  3T1H I;  2JY9 A;  1PIE A;  4DPY A;  1EKZ A;  2RS7 A;  4DXL A;  1IBM I;  2Q2E B;  3J81 Q;  3J7A G;  4HAC B;  4X64 I;  1N33 E;  2JVA A;  4UTG A;  1N32 I;  4JI6 I;  1HR0 E;  4KQV A;  4DV4 E;  4DPW A;  1Z0B A;  5LMU I;  4B3S E;  3J81 C;  2LRS A;  2XEX A;  2RS6 A;  4JI0 E;  4LF9 E;  2LUQ A;  3WU3 A;  3LNU A;  4X64 E;  5GME A;  5CFF E;  4P7A A;  2WW4 A;  5IWA E;  2UXD E;  3P1X A;  2UXC E;  4NXM I;  3PYG A;  1KVK A;  3ZKD A;  3J7Y p;  4M30 A;  3H4L A;  4OOG C;  3JAM C;  4P52 A;  5LMN I;  4B3S I;  2E1R A;  2ZBK B;  4NXN I;  3OTO E;  4LF8 E;  2EFG A;  3J7A M;  5FLX C;  1FWK A;  2ZM6 I;  4ED4 A;  1OJ4 A;  4USK A;  1J5E E;  4JI7 I;  1ZM9 A;  1N34 I;  2UUA I;  4X65 I;  3C4B A;  1ZM3 A;  1T4L B;  2NA2 A;  1YYW A;  1NHJ A;  3J80 C;  4WUB A;  2UUB E;  2X7I A;  2L2K B;  2HK2 A;  4JI7 E;  2CZ9 A;  4HY1 A;  4DV2 E;  1HNX E;  4AQY I;  3WU6 A;  1FJG E;  3QT8 A;  2UUA E; 
#chains in the Genus database with same CATH topology
 4DUZ E;  2HC5 A;  4DR3 E;  4JI5 E;  2EOQ A;  2UUC I;  3T1Y I;  4HXZ A;  2BA0 D;  4LF6 I;  4IZJ D;  2YTI A;  3K17 A;  4RH8 A;  2C37 B;  4R1F A;  1YPN A;  1XMQ E;  4FW9 A;  4RPF A;  4TUG A;  4DR7 E;  2CVE A;  4WUD A;  5GMD A;  3C6M A;  4BCA A;  2CGE A;  4IS9 A;  4I8O A;  1ZXM A;  1RRE A;  5DNX A;  3DF6 A;  4KZS A;  2JEB A;  1ZU1 A;  3ECR A;  2Z5C A;  2GPI A;  4NHR A;  1NZ0 A;  3WU4 A;  1X5W A;  1X6H A;  2JR1 A;  4F9B B;  4RHB B;  1MEY C;  1IMU A;  1FNM A;  5DRP A;  4WSG A;  5BR8 I;  1ZM4 A;  1XMO E;  1VIS A;  2FTX B;  2LV2 A;  1Z0T A;  2YRK A;  3ZM7 A;  3HXL A;  2EP3 A;  1J5E I;  4LF7 I;  4P78 A;  2RQL A;  4USM A;  4DV6 I;  5KL4 A;  2L33 A;  2LUP B;  3QT6 A;  4UT4 A;  1Z0E A;  4R2P A;  1Z59 A;  3U1K A;  1QZR A;  2EN8 A;  2JEA A;  4DR7 I;  1FKA E;  2WZO A;  2M7Q A;  4N3O A;  4LPF A;  4LCH A;  3BF2 A;  1Z0V A;  2IOP A;  3Q6M A;  1YYK A;  4MQY A;  5A2Q Q;  1VI7 A;  4IFD E;  1USV A;  3ZZ0 A;  4DR5 E;  3CDI A;  1STU A;  2MDG A;  1MX0 A;  2EMB A;  1RC7 A;  2YRM A;  1Z1B A;  1E3P A;  4BC9 A;  1GQE A;  2EM3 A;  2EPM X;  1UBD C;  1OYR A;  3P76 A;  5KL2 A;  1H74 A;  2YTP A;  1Z5C A;  2EOO A;  2YTO A;  4NXN E;  4FWG A;  5L3J A;  2O3Z A;  1Z5A A;  1RR9 A;  4JI6 E;  3ADJ A;  1IBM I;  1PVG A;  2CT1 A;  2V8P A;  1FJG I;  1A1K A;  4DU7 A;  1J26 A;  1IQS A;  2NUF A;  4DV7 E;  3HPZ A;  1EI1 A;  1S4E A;  2JT2 A;  3L7Z A;  1UDN A;  5IT9 Q;  1B69 A;  1H73 A;  1QNT A;  3F0N A;  4K0K I;  3F6H A;  5KL5 A;  3QG5 C;  2Z5E A;  1IBK E;  4DR1 E;  4LF6 E;  4OKG A;  1XHK A;  3LPS A;  4DV5 I;  1YSA C;  2VQF I;  3M6A A;  4GKJ I;  2DMY A;  2G7H A;  4F54 A;  4I3H A;  5EKW A;  2MKD A;  3PYD A;  2UXB I;  4PRV A;  4DV7 I;  1I94 I;  4B3M E;  2NN6 D;  3MHS C;  2VE7 C;  2PNL A;  3EPL A;  2R3V A;  2V8Q B;  2N3G A;  3WU5 A;  5LL6 R;  4JV5 E;  2I13 A;  1D6T A;  1HNW E;  2LMZ A;  2EMK A;  4O43 A;  5ADZ A;  1KIJ A;  4KHP E;  2V88 A;  3M85 D;  1T38 A;  1ZBT A;  4FW4 A;  4AIM A;  2UU9 I;  1XNR I;  4M9V C;  2NN6 F;  1A6F A;  2K4V A;  1MG7 A;  5JEA F;  2RTX A;  2YTJ A;  2GLI A;  4R2D A;  4JI2 E;  1UDQ A;  2YPN A;  2EPC A;  2YTD A;  2EMC A;  2NUG A;  4AQY E;  2V2Q A;  4DU8 A;  4LFC I;  4HAC A;  2UXB E;  4X66 I;  2F4V I;  2YTQ A;  4FK5 C;  4WX9 A;  2NN6 C;  2YSP A;  2LJP A;  2AJ4 A;  2L6M A;  2VQE E;  3ADG A;  2PNZ B;  2JWO A;  4FWH A;  2ENA A;  2EQ1 A;  2VRD A;  4JI3 E;  4FN5 A;  5T6J A;  1FI4 A;  2KHX A;  4DR2 E;  2EOS A;  2EPP A;  4X65 E;  2CPN A;  2NUE A;  2I9I A;  2RPC A;  1Y4U A;  1AH5 A;  2EMI A;  4Q28 A;  1JK2 A;  1HNZ I;  2E5L I;  2OI2 A;  2R1F A;  2EMZ A;  2FV4 B;  3P06 A;  4URL A;  2M1S A;  2EOM A;  3IWD A;  2YU5 A;  4X66 E;  2EQ0 A;  2RSM A;  4ZYH A;  2NN6 A;  4R2R A;  3THN A;  1WXR A;  3L00 A;  2GO4 A;  5A6B D;  2EM8 A;  1F2I G;  1IBL E;  4DV3 I;  4LFB I;  1HR0 I;  2EL6 A;  1WHQ A;  2EPK X;  1IBM E;  3DD6 A;  4LF8 I;  4TUI A;  2ODR D;  4DUY E;  4OZE A;  2WCC 3;  5A6K A;  5A6J A;  1R6L A;  2UUB I;  2Z5B A;  2EN7 A;  2EPZ A;  2O1T A;  3EPH A;  2NPF A;  4PU9 A;  4NBQ A;  4JI0 I;  4LF9 I;  4DKK A;  1N36 I;  4FWD A;  2EM9 A;  2YTN A;  2DEI A;  5JEA A;  3V2U C;  1SR9 A;  2L8T A;  4HTG A;  4P7D A;  4DR4 E;  3AUZ A;  4F6M A;  2EJ4 A;  1YFH A;  4BHC A;  2N3H A;  2L3C A;  1BKN A;  2F8B A;  1XNQ I;  2EPR A;  4ZYD A;  1YZ9 A;  3BBG A;  1YH8 A;  2HFU A;  3ADL A;  2V86 A;  2R42 A;  3K1J A;  3P3G A;  5DRQ A;  2UXC I;  4MYU A;  1O0W A;  2EMH A;  2LVH A;  4HEI A;  4R2E A;  5DNY A;  2A2C A;  1N0V C;  4AID A;  1QU6 A;  2EOI A;  4FW3 A;  2YT4 A;  4Z7C A;  4LF5 I;  1A1I A;  4DUZ I;  4DR3 I;  4IZK B;  3HQ1 A;  4LF4 E;  4BC7 A;  3IWC A;  4R2A A;  5LMN E;  1I94 E;  1B62 A;  5C0X C;  1TF6 A;  2C37 A;  4DV0 I;  4ZYG A;  4OO1 D;  1PKP A;  1WJP A;  2EN2 A;  1NHH A;  4DV4 I;  2B3T B;  4JG4 A;  2DMI A;  2DIX A;  4WYQ B;  3B8H A;  2PO0 B;  1BB8 A;  3KZZ A;  5F3W A;  1PDA A;  3KRN A;  1A1G A;  1Z5B A;  3L7Z B;  4BS9 A;  2C38 A;  4LOM A;  2DGC A;  3UHM A;  2J7K A;  2BB8 A;  2VF1 A;  4GKK E;  5BR8 E;  3K85 A;  2YSO A;  3THO B;  2V85 A;  1N34 E;  1T4O A;  2JXP A;  3EPJ A;  1XMO I;  4F6N A;  4KWY A;  2IHR 1;  2BV3 A;  3ZKB A;  4DV0 E;  4DV6 E;  3BGH A;  1MGT A;  1NHI A;  2MDR A;  2C38 B;  4MYT A;  4QNJ A;  2L3J A;  2WBS A;  4YY3 I;  4LCF A;  1UIL A;  2NN6 E;  3VYX A;  2EZ6 A;  1WUU A;  4PRX A;  2BA1 D;  3MHH C;  2EQ3 A;  3M7N D;  4LU9 A;  3OTO I;  2V89 A;  2M9A A;  1DI2 A;  1UDO A;  1ZXN A;  3QT5 A;  4JI4 E;  1L4S A;  1N0U A;  5ELW A;  3VK6 A;  5K36 F;  2A2D A;  2DEJ A;  1HNX I;  1PJQ A;  4YY3 E;  4X8W A;  4BA2 B;  1N33 I;  2X36 A;  2HKE A;  2BM0 A;  1EH7 A;  2UU9 E;  4LFA E;  1K47 A;  5DNL A;  4HYM A;  1UHZ A;  2EN1 A;  5C0X E;  4DR6 E;  2CSH A;  2EN6 A;  3PYF A;  1U2R A;  4DV3 E;  4LFB E;  2HKJ A;  1DAR A;  1ZR9 A;  4EMD A;  1BBG A;  1IBL I;  2L2N A;  2IER A;  4F2J C;  5JEA B;  4K0K E;  4B3T I;  1S16 A;  4FW7 A;  4AM3 A;  3DJW A;  2F1D A;  1X49 A;  1YUJ A;  4JI1 E;  2VQF E;  1X47 A;  2EL5 A;  4GKJ E;  2ODR C;  3BID A;  4DPT A;  2EMF A;  2K7I A;  4J8Z A;  4GEQ B;  2HHH I;  5IWA I;  2UXD I;  3TQM A;  2F4V E;  2LTS A;  3LTO A;  5JEA C;  1HNZ E;  2E5L E;  3PS1 A;  4WXC A;  4J3D A;  4LFA I;  4BA1 B;  4MLQ A;  4FW6 A;  4JI1 I;  3KWR A;  3EQ1 A;  2HK3 A;  4DPU A;  5A69 A;  3JU0 A;  4M1K A;  2LJU A;  2A25 A;  4MU4 A;  3MSW A;  2E1M A;  5IV8 B;  2R76 A;  3QT7 A;  3T1Y E;  1RMD A;  1XNR E;  2LTR A;  5IXM B;  5FLX Q;  4O5G A;  3HTX A;  1X6F A;  1EA6 A;  4LFC E;  1Z0C A;  2HHH E;  3HJC A;  2J65 A;  4JI2 I;  2ZM6 E;  4WUC A;  4Z7Y A;  4LF4 I;  4LCG A;  1KTV A;  2EPX A;  2BA1 G;  3M7N G;  2D9H A;  3PS2 A;  4F9A B;  4NXM E;  2EOX A;  3PS3 A;  4JI3 I;  3F6G A;  2EOY A;  2LO3 A;  1MU5 A;  4DV1 I;  1X48 A;  2EMA A;  5IT9 C;  2EPU A;  4DV5 E;  2PO2 A;  4IFD C;  2ENH A;  4WXD A;  1UDS A;  3CDJ A;  3ZZT A;  4IJD A;  4OO1 B;  4DR6 I;  2LE2 A;  4MU3 A;  2HFS A;  2O1V A;  5AE3 A;  3U1Y A;  3UK3 C;  5K36 B;  4BA2 A;  2V34 A;  2C39 B;  5FWK A;  2NAB A;  3HUL A;  1A1J A;  5LMU E;  2VF3 A;  1A1H A;  4IZJ A;  5DRR A;  4OX9 I;  2WBT A;  2PO1 A;  2EMX A;  4JV5 I;  1GZ6 A;  3GON A;  1N32 E;  4DR5 I;  1A1L A;  4LF5 E;  1XNQ E;  4YHH I;  2VES A;  2EOR A;  5A6A A;  3NZK A;  3ADI A;  2PO2 B;  4GQU A;  4MU1 A;  2UUC E;  1USU A;  3FIG A;  1YYO A;  2EM7 A;  1YHC A;  2EN4 A;  4OX9 E;  1PJT A;  4YHH E;  2EOE A;  1G2D C;  3K6Q A;  2B7V A;  4O24 A;  3ZOQ B;  3T1H E;  1N36 E;  2JE6 B;  3HKM A;  4ZVI A;  2LBS B;  2EE8 A;  4LF7 E;  2KOU A;  3P3C A;  2YTG A;  5K36 C;  2EWL A;  2EOZ A;  3B82 A;  4R8O A;  4GKK I;  4JYA E;  1ZM2 A;  4N4R B;  1KKH A;  1P47 A;  4X9J A;  3B78 A;  1H72 C;  4L8N A;  5A2Q C;  4DV2 I;  3KZY A;  4B3R E;  2PRT A;  1Z0W A;  4IFD F;  1T4N A;  2PNM A;  2HGH A;  2JOB A;  2GQ0 A;  4IZJ B;  4KHP I;  2ZIT A;  3C4T A;  4NZV A;  4BHB A;  4DUY I;  2LJH A;  2Z5C B;  1IQO A;  3M99 B;  1OYS A;  4JI5 I;  1TN9 A;  5DRO A;  4B3R I;  1B63 A;  2V83 A;  5KL7 A;  1EH6 A;  3J80 Q;  1XMQ I;  2JYA A;  5TSE A;  4BMJ A;  1LLM C;  1EH8 A;  4FW5 A;  5KL6 A;  3C6K A;  2YTF A;  4M2Z A;  4WSP A;  2VQE I;  2EPN A;  5AC4 A;  4MU0 A;  2RSI A;  2EPA A;  5C0X F;  5AC5 A;  2EMW A;  4X62 E;  3CWV A;  3LML A;  2EMG A;  4DR2 I;  1HK7 A;  2JE6 A;  4B3T E;  1H7S A;  5EL9 A;  2BM1 A;  2B7T A;  1ELO A;  4JI8 E;  4DR4 I;  1IBK I;  4WFT A;  3RMP A;  1Y60 A;  4DV1 E;  2BBG A;  1RHY A;  4ZYE A;  2Q8U A;  1HNW I;  3V5R A;  3EPK A;  1FWL A;  1DQ3 A;  3HPS A;  4M0V A;  2JP9 A;  1A1F A;  2V2V A;  1Y5Y A;  2CG9 A;  3VYY A;  2M4I A;  1UN6 B;  2B9D A;  2MC6 A;  3PYE A;  4X62 I;  4XTJ A;  2V2Z A;  3D4J A;  1ZBQ A;  3Q1Q A;  4JYA I;  1AAY A;  4OO1 C;  4JI4 I;  1PJS A;  2L92 A;  5AE2 A;  2GS8 A;  4GZN C;  1WHN A;  2J7J A;  2IES A;  1RQ0 A;  2WP8 A;  4OO1 F;  4JI8 I;  1GTK A;  5K36 A;  2YRH A;  2ELY A;  1R6M A;  4WPY A;  2YWQ A;  5C0X D;  1UEK A;  2LT7 A;  2DB2 A;  3H09 A;  2DLQ A;  3IWB A;  2GO3 A;  2PNZ A;  3P3E A;  3JAM Q;  1E3H A;  4MDT A;  3GLL A;  2PO1 B;  4F9C B;  1X3C A;  3LLH A;  2DLK A;  2H36 X;  3ZZU A;  2ADR A;  2L2M A;  4DR1 I;  1H7U A;  1Z0G A;  4DPX A;  4U3B A;  2AE8 A;  1YUI A;  3B4T A;  2IOQ A;  2MC5 A;  2JOX A;  4IZK A;  3T1H I;  5K36 D;  1P42 A;  2JY9 A;  1PIE A;  2YTE A;  4LTY A;  4DPY A;  1T39 A;  2V87 A;  2MKN A;  5LLQ A;  3PRY A;  1EKZ A;  2RS7 A;  4DXL A;  3AV0 A;  2Q2E B;  3J81 Q;  3J7A G;  4BBY A;  1KYQ A;  5AE1 A;  2EOF A;  4HAC B;  4X64 I;  4R2Q A;  1N33 E;  4L5N C;  2JVA A;  4UTG A;  4IFD A;  2O1W A;  5K36 E;  5JEA D;  2FGG A;  1N32 I;  4BA1 A;  4JI6 I;  4OO1 E;  1HR0 E;  2EM4 A;  4KQV A;  4DV4 E;  4DPW A;  2N8X A;  2HJJ A;  1Z0B A;  2EM6 A;  5LMU I;  1WRJ A;  2EPL X;  2ENC A;  3J81 C;  4B3S E;  3M85 G;  1ZAA C;  2GHF A;  2EPO A;  2LRS A;  5AAS A;  4IFD B;  2XEX A;  2RS6 A;  4MLV A;  4JI0 E;  4LF9 E;  1XXE A;  2EMY A;  2LUQ A;  2EM5 A;  4R2C A;  4R03 A;  3LNU A;  1X6E A;  2WP8 B;  4X64 E;  5GME A;  3WU3 A;  4B3M I;  2E72 A;  2WNR B;  5CFF E;  4P7A A;  2PO0 A;  4IS1 C;  2WW4 A;  2YZT A;  2YU8 A;  5IWA E;  2UXD E;  2DRP A;  3P1X A;  1N3G A;  1NEI A;  4DMI A;  4Q35 B;  2UXC E;  3PYG A;  4NXM I;  1KVK A;  3ZKD A;  3J7Y p;  4M30 A;  3JAM C;  4OOG C;  3H4L A;  3H1C A;  2BR2 A;  4P52 A;  1Y4S A;  5LMN I;  4B3S I;  3VHT B;  2E1R A;  3JTZ A;  2ZBK B;  4NXN I;  3GME A;  3OML A;  3OTO E;  3GCM A;  2EM2 A;  3Q6N A;  4LF8 E;  2EFG A;  2CTD A;  1DGC A;  3J7A M;  5FLX C;  4R2S A;  2C39 A;  1FWK A;  2JEB B;  1Y6Z A;  2BA0 G;  2ZM6 I;  1G2F C;  4ED4 A;  1JK1 A;  5KL3 A;  1OJ4 A;  4USK A;  1J5E E;  5A6B A;  4JI7 I;  4ISA A;  2ELZ A;  1TF3 A;  2EML A;  2EOH A;  1ZM9 A;  5JEA E;  2EL4 A;  1N34 I;  2UUA I;  4X65 I;  2JEA B;  2BR2 B;  4IFD D;  2EN3 A;  3C4B A;  4U3D A;  1ZM3 A;  4OO1 A;  5C0X B;  1T4L B;  1BBO A;  2NA2 A;  1KJK A;  1YYW A;  2Z5B B;  2EM0 A;  1NHJ A;  1OYP A;  3J80 C;  4WUB A;  1SFE A;  2UUB E;  2X7I A;  2LCE A;  2L2K B;  2EOJ A;  2DSY A;  2WNR A;  2O1U A;  4O4K A;  1NCS A;  2JPA A;  4JI7 E;  2HK2 A;  2CZ9 A;  4HY1 A;  5C0X A;  4DV2 E;  2KON A;  1HNX E;  2NN6 B;  4AQY I;  2WBU A;  3WU6 A;  1FJG E;  3QT8 A;  2UUA E;  4QNK A; 
#chains in the Genus database with same CATH homology
 4DUZ E;  4DR3 E;  4JI5 E;  2UUC I;  3T1Y I;  4HXZ A;  4LF6 I;  4IZJ D;  3K17 A;  4R1F A;  1XMQ E;  4FW9 A;  4RPF A;  4TUG A;  4DR7 E;  4WUD A;  5GMD A;  4BCA A;  2CGE A;  4I8O A;  1ZXM A;  1RRE A;  3DF6 A;  4KZS A;  2Z5C A;  1NZ0 A;  3WU4 A;  5A2Q Q;  2JR1 A;  4F9B B;  1FNM A;  5BR8 I;  1ZM4 A;  1XMO E;  1VIS A;  2FTX B;  1Z0T A;  3ZM7 A;  3HXL A;  1J5E I;  4LF7 I;  4P78 A;  4USM A;  4DV6 I;  4UT4 A;  2L33 A;  2LUP B;  3QT6 A;  1Z0E A;  1Z59 A;  1QZR A;  4DR7 I;  1FKA E;  2WZO A;  2M7Q A;  4N3O A;  1Z0V A;  2IOP A;  3Q6M A;  1YYK A;  1USV A;  3ZZ0 A;  4DR5 E;  1STU A;  1MX0 A;  1RC7 A;  4BC9 A;  1GQE A;  1H74 A;  1Z5C A;  4FWG A;  4NXN E;  5L3J A;  1Z5A A;  1RR9 A;  4JI6 E;  3ADJ A;  1PVG A;  2V8P A;  1FJG I;  4DU7 A;  1J26 A;  2NUF A;  1S4E A;  4DV7 E;  3HPZ A;  1EI1 A;  5IT9 Q;  1H73 A;  3F0N A;  4K0K I;  3F6H A;  2Z5E A;  1IBK E;  4DR1 E;  4LF6 E;  4DV5 I;  1XHK A;  3LPS A;  2VQF I;  3M6A A;  4GKJ I;  2DMY A;  2G7H A;  4F54 A;  4I3H A;  2UXB I;  3PYD A;  4PRV A;  4DV7 I;  1I94 I;  4B3M E;  2PNL A;  2R3V A;  2VE7 C;  3WU5 A;  2V8Q B;  2N3G A;  5LL6 R;  4JV5 E;  1D6T A;  1HNW E;  2LMZ A;  5ADZ A;  1KIJ A;  4KHP E;  2V88 A;  1XNR I;  1ZBT A;  2UU9 I;  1A6F A;  2K4V A;  1MG7 A;  2RTX A;  4JI2 E;  2V2Q A;  4DU8 A;  4B3M I;  2NUG A;  4AQY E;  4LFC I;  4HAC A;  2UXB E;  4X66 I;  2F4V I;  2LJP A;  2AJ4 A;  2L6M A;  2VQE E;  3ADG A;  2JWO A;  4FWH A;  4FN5 A;  4JI3 E;  5T6J A;  1FI4 A;  2KHX A;  4DR2 E;  4X65 E;  2CPN A;  2NUE A;  1Y4U A;  4Q28 A;  1HNZ I;  2E5L I;  2OI2 A;  2FV4 B;  3P06 A;  4URL A;  2M1S A;  3IWD A;  4X66 E;  2RSM A;  1WXR A;  1IBL E;  4DV3 I;  4LFB I;  1HR0 I;  1WHQ A;  1IBM E;  4LF8 I;  4TUI A;  2ODR D;  4DUY E;  2UUB I;  2Z5B A;  2O1T A;  2NPF A;  4PU9 A;  4JI0 I;  4LF9 I;  4DKK A;  1N36 I;  4FWD A;  2DEI A;  3V2U C;  1SR9 A;  2L8T A;  4P7D A;  4DR4 E;  3AUZ A;  2N3H A;  2L3C A;  1BKN A;  2F8B A;  1XNQ I;  1YZ9 A;  2HFU A;  3ADL A;  2V86 A;  2R42 A;  3K1J A;  2UXC I;  4MYU A;  1O0W A;  5DNY A;  2A2C A;  1N0V C;  1QU6 A;  2YT4 A;  4Z7C A;  4LF5 I;  4DUZ I;  4DR3 I;  4IZK B;  3HQ1 A;  4LF4 E;  4BC7 A;  3IWC A;  5LMN E;  1I94 E;  1B62 A;  4DV0 I;  1PKP A;  1NHH A;  4DV4 I;  2B3T B;  4JG4 A;  2DIX A;  4WYQ B;  3B8H A;  5F3W A;  1Z5B A;  4BS9 A;  2J7K A;  4GKK E;  2VF1 A;  3K85 A;  5BR8 E;  2V85 A;  1N34 E;  1T4O A;  1XMO I;  2IHR 1;  2BV3 A;  3ZKB A;  4DV0 E;  4DV6 E;  1NHI A;  2MDR A;  4MYT A;  2L3J A;  4YY3 I;  1UIL A;  3VYX A;  2EZ6 A;  1WUU A;  4PRX A;  4LU9 A;  3OTO I;  2V89 A;  1DI2 A;  1ZXN A;  3QT5 A;  4JI4 E;  1N0U A;  3VK6 A;  2A2D A;  2DEJ A;  1HNX I;  4YY3 E;  4X8W A;  1N33 I;  2X36 A;  2HKE A;  2BM0 A;  2UU9 E;  4LFA E;  1K47 A;  4HYM A;  1UHZ A;  4DR6 E;  3PYF A;  1U2R A;  4DV3 E;  4LFB E;  2HKJ A;  1DAR A;  4EMD A;  1IBL I;  2L2N A;  4B3T I;  4K0K E;  1S16 A;  3DJW A;  1X49 A;  4JI1 E;  2VQF E;  1X47 A;  4GKJ E;  2ODR C;  4DPT A;  4J8Z A;  4GEQ B;  2HHH I;  5IWA I;  2UXD I;  2F4V E;  2LTS A;  3LTO A;  1HNZ E;  2E5L E;  4LFA I;  4JI1 I;  3KWR A;  2HK3 A;  4DPU A;  3JU0 A;  4M1K A;  3MSW A;  2E1M A;  3QT7 A;  3T1Y E;  1XNR E;  2LTR A;  5FLX Q;  3HTX A;  1EA6 A;  4LFC E;  1Z0C A;  2HHH E;  3HJC A;  4JI2 I;  2ZM6 E;  4WUC A;  4Z7Y A;  4LF4 I;  1KTV A;  4F9A B;  4NXM E;  4JI3 I;  3F6G A;  1MU5 A;  4DV1 I;  1X48 A;  5IT9 C;  4DV5 E;  3ZZT A;  4DR6 I;  2LE2 A;  2HFS A;  2O1V A;  5AE3 A;  2V34 A;  5FWK A;  3HUL A;  5LMU E;  2VF3 A;  4IZJ A;  4OX9 I;  4JV5 I;  1GZ6 A;  3GON A;  1N32 E;  4DR5 I;  4LF5 E;  1XNQ E;  4YHH I;  3ADI A;  2UUC E;  1USU A;  3FIG A;  1YYO A;  4OX9 E;  4YHH E;  3K6Q A;  2B7V A;  1N36 E;  3ZOQ B;  3T1H E;  4ZVI A;  2LBS B;  4LF7 E;  2KOU A;  2EWL A;  3B82 A;  4R8O A;  4GKK I;  4JYA E;  1ZM2 A;  1KKH A;  3B78 A;  1H72 C;  4L8N A;  5A2Q C;  4DV2 I;  4B3R E;  1Z0W A;  1T4N A;  2PNM A;  2JOB A;  2GQ0 A;  4IZJ B;  4KHP I;  2ZIT A;  3C4T A;  4DUY I;  2LJH A;  2Z5C B;  4JI5 I;  4B3R I;  1B63 A;  2V83 A;  3J80 Q;  1XMQ I;  4BMJ A;  4M2Z A;  4WSP A;  2VQE I;  4X62 E;  3CWV A;  3LML A;  4DR2 I;  1HK7 A;  1H7S A;  4B3T E;  2BM1 A;  2B7T A;  1ELO A;  4JI8 E;  4DR4 I;  1IBK I;  4WFT A;  3RMP A;  4DV1 E;  1HNW I;  3V5R A;  1FWL A;  1DQ3 A;  3HPS A;  4M0V A;  2V2V A;  2CG9 A;  3VYY A;  2M4I A;  3PYE A;  2B9D A;  2MC6 A;  4X62 I;  4XTJ A;  2V2Z A;  3D4J A;  1ZBQ A;  3Q1Q A;  4JYA I;  4JI4 I;  2L92 A;  5AE2 A;  2GS8 A;  1WHN A;  1RQ0 A;  4JI8 I;  4WPY A;  1UEK A;  2DB2 A;  3H09 A;  3IWB A;  3JAM Q;  4F9C B;  3LLH A;  2H36 X;  3ZZU A;  2L2M A;  4DR1 I;  1H7U A;  1Z0G A;  4DPX A;  2IOQ A;  2MC5 A;  2JOX A;  4IZK A;  3T1H I;  2JY9 A;  1PIE A;  4LTY A;  4DPY A;  2V87 A;  3PRY A;  1EKZ A;  2RS7 A;  4DXL A;  3AV0 A;  2Q2E B;  3J81 Q;  3J7A G;  4BBY A;  5AE1 A;  4HAC B;  4X64 I;  1IBM I;  1N33 E;  4L5N C;  2JVA A;  4UTG A;  2O1W A;  2FGG A;  1N32 I;  4JI6 I;  1HR0 E;  4KQV A;  4DV4 E;  4DPW A;  1Z0B A;  5LMU I;  4B3S E;  3J81 C;  2LRS A;  5AAS A;  2XEX A;  2RS6 A;  4JI0 E;  4LF9 E;  2LUQ A;  4R03 A;  3LNU A;  3WU3 A;  4X64 E;  5GME A;  5CFF E;  4P7A A;  2WW4 A;  2YZT A;  2UXD E;  5IWA E;  3P1X A;  4DMI A;  2UXC E;  4NXM I;  3PYG A;  1KVK A;  3ZKD A;  3J7Y p;  4M30 A;  3JAM C;  4OOG C;  3H4L A;  4P52 A;  1Y4S A;  5LMN I;  4B3S I;  2E1R A;  3JTZ A;  2ZBK B;  4NXN I;  3OML A;  3OTO E;  3Q6N A;  4LF8 E;  2EFG A;  3J7A M;  5FLX C;  1FWK A;  1Y6Z A;  2ZM6 I;  4ED4 A;  1OJ4 A;  4USK A;  1J5E E;  4JI7 I;  1ZM9 A;  1N34 I;  2UUA I;  4X65 I;  3C4B A;  1ZM3 A;  1T4L B;  2NA2 A;  1YYW A;  2Z5B B;  1NHJ A;  3J80 C;  4WUB A;  2UUB E;  2X7I A;  2L2K B;  2DSY A;  2O1U A;  2HK2 A;  4JI7 E;  2CZ9 A;  4HY1 A;  4DV2 E;  2KON A;  1HNX E;  4AQY I;  3WU6 A;  1FJG E;  3QT8 A;  2UUA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...