3Q1QA

Structure of a bacterial ribonuclease p holoenzyme in complex with trna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
112
structure length
112
Chain Sequence
TRRERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGLDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Bacterial Ribonuclease P Holoenzyme in Complex with tRNA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/rna
molecule keywords RNase P RNA
total genus 32
structure length 112
sequence length 112
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3q1qA00
1IBKI 4DUYE 4DR1I 3T1HE 4LFAE 2UUCI 1HNXI 5IT9C 1IBKE 4DR4I 3K17A 5LMUI 3H4LA 4P52A 1A6FA 3QT8A 1EI1A 4UT4A 3J7AM 2R42A 3WU3A 1ZM2A 4JYAI 2BM1A 3PYDA 3ZZUA 1FWKA 1HNWE 4JV5I 1XMOI 3OTOE 2VF3A 2NPFA 1FJGE 2E5LI 4DPYA 1Z0EA 1H73A 4DV4E 1H72C 4DPUA 1N33I 3LNUA 4JI5I 4UTGA 4JI7E 5IWAI 3V5RA 4HXZA 3B8HA 4P7AA 4JI0E 4DV1I 3V2UC 4X66E 4GKJI 1Z0CA 1K47A 2E5LE 3Q1QA 4LFAI 4DR7E 3M6AA 4GKJE 2OI2A 3ZZTA 4DR5E 2UUBE 4FWDA 4LF9E 4AQYI 1XNRI 4YHHE 1N36I 4K0KI 2EFGA 4LF8I 1U2RA 3JAMQ 3ZZ0A 1J5EE 4LF5I 4Z7YA 3GONA 4GKKE 1IBLI 1FJGI 1PVGA 4WUBA 4LF4E 4DV2I 4FWGA 1HNZI 2BM0A 2X36A 2V8PA 2UXDI 1MG7A 4ED4A 2HK3A 1IBME 2BV3A 1XMOE 4I3HA 4LF8E 4B3MI 2V34A 4DR5I 2UUCE 4B3TE 1Z59A 2HK2A 1HR0E 1N34E 5LMNE 4JI6E 1Z5CA 1Z0VA 4B3SE 2E1RA 4DR2E 1D6TA 3WU6A 4JI3E 5IT9Q 2AJ4A 4X66I 1MX0A 4DXLA 4B3RE 4KHPI 4YY3E 4DR6E 1N34I 4B3TI 1FNMA 4DPXA 3LPSA 1S4EA 4DV3E 3QT6A 3B78A 4DR3I 3T1YI 1Z5BA 4DPTA 4DR3E 3T1YE 4DV1E 1N0VC 1XHKA 4LFBI 5LL6R 4LF4I 3LTOA 4RPFA 1B63A 3D4JA 2ZBKB 4JI8I 1H7SA 4DV7I 3J81Q 4PU9A 1ZM3A 2HHHE 4FW9A 4DV3I 2X7IA 4X65E 4K0KE 2HKJA 4X62I 4HACB 4JI4I 4HYMA 4EMDA 2UU9E 1N32I 5LMUE 4JI1E 2UXCE 1N0UA 2GS8A 4FWHA 4PRVA 4OX9E 1RR9A 4USMA 3CWVA 4DUZI 4JI7I 1XNQI 1H74A 4NXNI 4DUYI 4DU7A 1BKNA 3ZKBA 4JYAE 4DV4I 4NXNE 1UEKA 3WU5A 1XMQE 4LF6I 2A2CA 2ZM6E 4OX9I 4B3ME 3J81C 1HNXE 4GKKI 1PKPA 2VQEE 2ZITA 4PRXA 1EA6A 4DV5I 2VQFE 1IBLE 1XMQI 1Z0TA 2A2DA 4DUZE 3J80Q 4LFCE 1N33E 4JI2I 5L3JA 1WUUA 1FWLA 5A2QC 4LF6E 1NZ0A 3J80C 1HNWI 1KTVA 1HNZE 1DARA 5FLXC 2HHHI 2Q2EB 4DV6I 4MYUA 2ZM6I 1XNQE 3QT7A 3WU4A 4JI5E 4X62E 1PIEA 1ELOA 2V2VA 2J7KA 1Z0WA 2UU9I 1N32E 4LF7E 2CZ9A 4WUDA 4DV0I 5A2QQ 4DV6E 2VQFI 4URLA 1NHJA 4NXME 1Z0GA 2UXDE 1KIJA 3OTOI 4KHPE 2HKEA 4R1FA 3T1HI 3ZKDA 3B82A 4LF7I 2V2ZA 3JAMC 1IBMI 1KVKA 4X64E 2DEJA 4LF5E 4LF9I 2UXCI 4Z7CA 2HFUA 4X65I 2UUAI 5LMNI 4LFCI 4JI6I 1FI4A 2UXBE 2XEXA 3HULA 2DEIA 4USKA 1NHIA 4DR6I 4JI8E 1Z0BA 2VQEI 4DR4E 5GMDA 4JI3I 4YHHI 5IWAE 4DR7I 4DV0E 1ZXMA 3F0NA 1QZRA 3J7AG 1KKHA 2UUAE 1S16A 1RREA 3K1JA 1I94E 4YY3I 1Z5AA 4JI2E 1FKAE 4ZVIA 1NHHA 5FLXQ 4MYTA 1VISA 4AQYE 1XNRE 1N36E 4X64I 4DR2I 4DV5E 2LJPA 4XTJA 4JG4A 4LFBE 5GMEA 4KQVA 2F4VI 4JI0I 2UUBI 4DU8A 1ZM4A 3PYEA 4WUCA 3ZM7A 1OJ4A 3QT5A 2R3VA 5BR8E 1ZM9A 4DV7E 3PYFA 2WW4A 2HFSA 4JV5E 3PYGA 1I94I 4B3RI 4DPWA 4HACA 4NXMI 4DV2E 2UXBI 2V2QA 4DR1E 4JI1I 4M1KA 4B3SI 2F4VE 4JI4E 4HY1A 5BR8I 4FN5A 1H7UA 1HR0I 1B62A 1MU5A 1J5EI 1ZXNA
chains in the Genus database with same CATH superfamily
1IBKI 4DUYE 4DR1I 3T1HE 2JEAB 4LFAE 2UUCI 1HNXI 5IT9C 1IBKE 4BA1A 5JEAB 4DR4I 2JT2A 2AE8A 3K17A 5LMUI 3H4LA 4P52A 2PNZA 2GO3A 1A6FA 3QT8A 1EI1A 1Y60A 3Q6MA 4UT4A 1OYRA 3J7AM 1E3HA 5DNLA 2R42A 3WU3A 1ZM2A 4JYAI 2BM1A 3PYDA 3ZZUA 5K36C 1FWKA 5JEAC 1HNWE 2NN6D 3HJCA 4JV5I 1XMOI 3OTOE 2VF3A 5K36A 4MU0A 5C0XC 2NPFA 5JEAA 2E5LI 1FJGE 2CG9A 4DPYA 1Z0EA 1H73A 2PO2A 4DV4E 1H72C 2Z5CA 4DPUA 4LPFA 1N33I 3LNUA 1YHCA 4JI5I 4UTGA 4JI7E 5IWAI 3V5RA 4HXZA 3B8HA 4P7AA 4JI0E 1R6MA 3P06A 4DV1I 3V2UC 5DRPA 4X66E 4GKJI 5K36E 2IOQA 1Z0CA 2CGEA 2PO2B 2Z5BB 1K47A 2E5LE 2C37B 3Q1QA 4LFAI 3UHMA 4DR7E 3M6AA 4GKJE 2OI2A 3ZZTA 4DR5E 2UUBE 5C0XF 4FWDA 4LF9E 4AQYI 1XNRI 1R6LA 4YHHE 2NN6C 1N36I 2O3ZA 4K0KI 2EFGA 3M85G 2C37A 4LF8I 1U2RA 3B4TA 3JAMQ 3ZZ0A 2Z5CB 1J5EE 4LF5I 4Z7YA 3GONA 3PRYA 1IBLI 4GKKE 1FJGI 1PVGA 4WUBA 4DV2I 4LF4E 4FWGA 4NBQA 1HNZI 1HK7A 2BM0A 4OO1B 4FW7A 2X36A 2V8PA 2UXDI 1MG7A 4ED4A 2HK3A 1UDQA 3GMEA 1IBME 2JEBA 2BV3A 2BA0G 4I3HA 1XMOE 4B3MI 4LF8E 2BA1D 2V34A 4DR5I 2CVEA 4MDTA 2UUCE 4B3TE 1Z59A 2HK2A 2NN6F 1HR0E 1N34E 5LMNE 4JI6E 1Z5CA 2VESA 1UDNA 5K36B 3P3CA 1OYPA 1Z0VA 3H1CA 4B3SE 2E1RA 3CDIA 1P42A 4DR2E 1D6TA 3WU6A 4JI3E 5IT9Q 2AJ4A 4X66I 4IZKB 1MX0A 4DXLA 5JEAF 4B3RE 5K36F 4KHPI 4YY3E 4IFDC 3P3GA 4DR6E 1N34I 5K36D 4B3TI 4IFDA 4IZJB 1FNMA 3U1KA 2BA1G 4DPXA 4OO1E 3LPSA 1S4EA 3NZKA 4DV3E 3QT6A 2JEBB 3B78A 4DR3I 3T1YI 1Z5BA 4DPTA 4DR3E 3T1YE 4DV1E 1N0VC 4MU4A 1XHKA 4LFBI 5LL6R 1UDSA 4LF4I 3LTOA 2PO0A 4RPFA 1B63A 1Y4UA 3D4JA 2Z5BA 2ZBKB 4JI8I 1H7SA 4BA2A 3U1YA 4DV7I 3J81Q 4IZKA 4PU9A 1ZM3A 5DRQA 2HHHE 4FW9A 4LCGA 4J3DA 4DV3I 2X7IA 4X65E 4K0KE 2HKJA 4X62I 3K85A 5C0XB 4HACB 4IZJA 4LCFA 4JI4I 4HYMA 4EMDA 2UU9E 1N32I 5LMUE 3CDJA 4QNKA 1OYSA 4JI1E 2UXCE 5DRRA 5JEAD 4U3DA 1N0UA 2C38B 4LCHA 4OO1A 2PO1B 2GS8A 4FWHA 2C39A 4PRVA 4OX9E 1RR9A 4USMA 3CWVA 4DUZI 4IZJD 4JI7I 1XNQI 3PS2A 1H74A 4NXNI 4DUYI 4DU7A 1BKNA 4IS9A 3ZKBA 4JYAE 4DV4I 4NXNE 1UEKA 2C39B 1XXEA 3PS3A 3WU5A 1XMQE 4LF6I 2A2CA 3KRNA 2WNRB 2O1WA 4AM3A 4MU3A 2ZM6E 2Z5EA 4OX9I 4B3ME 4AIDA 3J81C 1HNXE 4GKKI 4IFDD 1PKPA 2BR2B 4FW5A 2PNLA 2VQEE 2ZITA 3HKMA 2JE6B 2C38A 4PRXA 1EA6A 4DV5I 2PO1A 2VQFE 2A2DA 1Y5YA 1YH8A 1Z0TA 4DUZE 1XMQI 1IBLE 3J80Q 4LFCE 2BA0D 5EL9A 1VI7A 1N33E 4JI2I 5L3JA 4OO1F 1UDOA 1WUUA 4QNJA 2BR2A 1USUA 4FW6A 1FWLA 5A2QC 5DROA 4LF6E 1NZ0A 4OKGA 2WP8A 3J80C 4OO1D 4IFDE 5C0XD 2F1DA 5ELWA 1HNWI 1KTVA 1HNZE 2NN6A 1DARA 5FLXC 2HHHI 2Q2EB 4DV6I 3M7ND 2PNZB 2O1TA 4BA2B 4MYUA 2ZM6I 4AIMA 1XNQE 3QT7A 3WU4A 4JI5E 4X62E 1PIEA 1ELOA 2V2VA 4OZEA 5C0XA 2J7KA 5DNXA 1Z0WA 2UU9I 1N32E 4LF7E 3M85D 2CZ9A 4MU1A 4WUDA 2J65A 4DV0I 5A2QQ 4DV6E 2WNRA 2GO4A 1NHJA 4URLA 2VQFI 4NXME 4N3OA 1Z0GA 2UXDE 1KIJA 3OTOI 4BA1B 4KHPE 2WP8B 3DD6A 3PS1A 4IFDB 2O1VA 3M7NG 1E3PA 2HKEA 4R1FA 3T1HI 3ZKDA 3B82A 4LF7I 1Y6ZA 2V2ZA 3JAMC 1IBMI 1KVKA 4IFDF 4X64E 2DEJA 4LF5E 4LF9I 2UXCI 4Z7CA 4LOMA 2HFUA 4X65I 3Q6NA 2UUAI 2PO0B 5LMNI 4LFCI 4JI6I 1FI4A 2UXBE 2XEXA 3HULA 2DEIA 4USKA 1NHIA 4DR6I 3GLLA 4JI8E 1Z0BA 2VQEI 4DR4E 5GMDA 4JI3I 4YHHI 3P3EA 4OO1C 5IWAE 4DR7I 1RHYA 4FW3A 2NN6B 4MQYA 4DV0E 1ZXMA 2IOPA 1QZRA 3F0NA 3J7AG 1KKHA 3L7ZA 2UUAE 1S16A 1RREA 4GQUA 3K1JA 1I94E 4YY3I 1Z5AA 4JI2E 4U3BA 1FKAE 4ZVIA 1NHHA 5FLXQ 4MYTA 1VISA 4AQYE 1XNRE 1N36E 4X64I 5C0XE 4DR2I 4DV5E 2LJPA 4XTJA 4JG4A 4LFBE 2IESA 5GMEA 4KQVA 5JEAE 2F4VI 4JI0I 2UUBI 4DU8A 1ZM4A 3PYEA 2IERA 5FWKA 4WUCA 3ZM7A 1OJ4A 3QT5A 2R3VA 5BR8E 2JE6A 1Y4SA 1ZM9A 4DV7E 3PYFA 2WW4A 1USVA 2HFSA 4FW4A 4JV5E 3PYGA 1I94I 4B3RI 2NN6E 5EKWA 4DPWA 4HACA 4NXMI 4DV2E 2UXBI 2V2QA 4DR1E 4JI1I 2JEAA 4M1KA 4ISAA 4B3SI 2GQ0A 3L7ZB 2F4VE 3P76A 4JI4E 4HY1A 5BR8I 4FN5A 1H7UA 1HR0I 1B62A 2O1UA 3GCMA 2PNMA 1MU5A 1J5EI 1ZXNA
chains in the Genus database with same CATH topology
1IBKI 4DUYE 4DR1I 3T1HE 4LFAE 2UUCI 1HNXI 5IT9C 1IBKE 4DR4I 3K17A 5LMUI 3H4LA 4P52A 1A6FA 3QT8A 1EI1A 3Q6MA 4UT4A 3J7AM 2R42A 3WU3A 1ZM2A 4JYAI 2BM1A 3PYDA 3ZZUA 1FWKA 1HNWE 3HJCA 4JV5I 1XMOI 3OTOE 2VF3A 2NPFA 1FJGE 2E5LI 2CG9A 4DPYA 1Z0EA 1H73A 4DV4E 1H72C 2Z5CA 4DPUA 1N33I 3LNUA 4JI5I 4UTGA 4JI7E 5IWAI 3V5RA 4HXZA 3B8HA 4P7AA 4JI0E 3P06A 4DV1I 3V2UC 4X66E 4GKJI 2IOQA 1Z0CA 2CGEA 2Z5BB 1K47A 2E5LE 3Q1QA 4LFAI 4DR7E 3M6AA 4GKJE 2OI2A 3ZZTA 4DR5E 2UUBE 4FWDA 4LF9E 4AQYI 1XNRI 4YHHE 1N36I 4K0KI 2EFGA 4LF8I 1U2RA 3JAMQ 3ZZ0A 2Z5CB 1J5EE 4LF5I 4Z7YA 3GONA 3PRYA 1IBLI 4GKKE 1FJGI 1PVGA 4WUBA 4DV2I 4LF4E 4FWGA 1HNZI 1HK7A 2BM0A 2X36A 2V8PA 2UXDI 1MG7A 4ED4A 2HK3A 1IBME 2BV3A 1XMOE 4I3HA 4LF8E 4B3MI 2V34A 4DR5I 2UUCE 4B3TE 1Z59A 2HK2A 1HR0E 1N34E 5LMNE 4JI6E 1Z5CA 1Z0VA 4B3SE 2E1RA 4DR2E 1D6TA 3WU6A 4JI3E 5IT9Q 2AJ4A 4X66I 4IZKB 1MX0A 4DXLA 4B3RE 4KHPI 4YY3E 4DR6E 1N34I 4B3TI 4IZJB 1FNMA 4DPXA 3LPSA 1S4EA 4DV3E 3QT6A 3B78A 4DR3I 3T1YI 1Z5BA 4DPTA 4DR3E 3T1YE 4DV1E 1N0VC 1XHKA 4LFBI 5LL6R 4LF4I 3LTOA 4RPFA 1B63A 1Y4UA 3D4JA 2Z5BA 2ZBKB 4JI8I 1H7SA 4DV7I 3J81Q 4IZKA 4PU9A 1ZM3A 2HHHE 4FW9A 4DV3I 2X7IA 4X65E 4K0KE 2HKJA 4X62I 3K85A 4HACB 4IZJA 4JI4I 4HYMA 4EMDA 2UU9E 1N32I 5LMUE 4JI1E 2UXCE 1N0UA 2GS8A 4FWHA 4PRVA 4OX9E 1RR9A 4USMA 3CWVA 4DUZI 4IZJD 4JI7I 1XNQI 1H74A 4NXNI 4DUYI 4DU7A 1BKNA 3ZKBA 4JYAE 4DV4I 4NXNE 1UEKA 3WU5A 1XMQE 4LF6I 2A2CA 2O1WA 2ZM6E 2Z5EA 4OX9I 4B3ME 3J81C 1HNXE 4GKKI 1PKPA 2PNLA 2VQEE 2ZITA 4PRXA 1EA6A 4DV5I 2VQFE 1IBLE 1Z0TA 2A2DA 4DUZE 1XMQI 3J80Q 4LFCE 1N33E 4JI2I 5L3JA 1WUUA 1USUA 1FWLA 5A2QC 4LF6E 1NZ0A 3J80C 1HNWI 1KTVA 1HNZE 1DARA 5FLXC 2HHHI 2Q2EB 4DV6I 2O1TA 4MYUA 2ZM6I 1XNQE 3QT7A 3WU4A 4JI5E 4X62E 1PIEA 1ELOA 2V2VA 2J7KA 1Z0WA 2UU9I 1N32E 4LF7E 2CZ9A 4WUDA 4DV0I 5A2QQ 4DV6E 2VQFI 4URLA 1NHJA 4NXME 4N3OA 1Z0GA 2UXDE 1KIJA 3OTOI 4KHPE 2O1VA 2HKEA 4R1FA 3T1HI 3ZKDA 3B82A 4LF7I 1Y6ZA 2V2ZA 3JAMC 1IBMI 1KVKA 4X64E 2DEJA 4LF5E 4LF9I 2UXCI 4Z7CA 2HFUA 4X65I 3Q6NA 2UUAI 5LMNI 4LFCI 4JI6I 1FI4A 2UXBE 2XEXA 3HULA 2DEIA 4USKA 1NHIA 4DR6I 4JI8E 1Z0BA 2VQEI 4DR4E 5GMDA 4JI3I 4YHHI 5IWAE 4DR7I 4DV0E 1ZXMA 2IOPA 1QZRA 3F0NA 3J7AG 1KKHA 2UUAE 1S16A 1RREA 3K1JA 1I94E 4YY3I 1Z5AA 4JI2E 1FKAE 4ZVIA 1NHHA 5FLXQ 4MYTA 1VISA 4AQYE 1XNRE 1N36E 4X64I 4DR2I 4DV5E 2LJPA 4XTJA 4JG4A 4LFBE 5GMEA 4KQVA 2F4VI 4JI0I 2UUBI 4DU8A 1ZM4A 3PYEA 5FWKA 4WUCA 3ZM7A 1OJ4A 3QT5A 2R3VA 5BR8E 1ZM9A 1Y4SA 4DV7E 3PYFA 2WW4A 1USVA 2HFSA 4JV5E 3PYGA 1I94I 4B3RI 4DPWA 4HACA 4NXMI 4DV2E 2UXBI 2V2QA 4DR1E 4JI1I 4M1KA 4B3SI 2GQ0A 2F4VE 4JI4E 4HY1A 5BR8I 4FN5A 1H7UA 1HR0I 1B62A 2O1UA 2PNMA 1MU5A 1J5EI 1ZXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK I;  4DUY E;  4DR1 I;  3T1H E;  4LFA E;  2UUC I;  1HNX I;  5IT9 C;  1IBK E;  4DR4 I;  3K17 A;  5LMU I;  3H4L A;  4P52 A;  1A6F A;  3QT8 A;  1EI1 A;  4UT4 A;  3J7A M;  2R42 A;  3WU3 A;  1ZM2 A;  4JYA I;  2BM1 A;  3PYD A;  3ZZU A;  1FWK A;  1HNW E;  4JV5 I;  1XMO I;  3OTO E;  2VF3 A;  2NPF A;  1FJG E;  2E5L I;  4DPY A;  1Z0E A;  1H73 A;  4DV4 E;  1H72 C;  4DPU A;  1N33 I;  3LNU A;  4JI5 I;  4UTG A;  4JI7 E;  5IWA I;  3V5R A;  4HXZ A;  3B8H A;  4P7A A;  4JI0 E;  4DV1 I;  3V2U C;  4X66 E;  4GKJ I;  1Z0C A;  1K47 A;  2E5L E;  3Q1Q A;  4LFA I;  4DR7 E;  3M6A A;  4GKJ E;  2OI2 A;  3ZZT A;  4DR5 E;  2UUB E;  4FWD A;  4LF9 E;  4AQY I;  1XNR I;  4YHH E;  1N36 I;  4K0K I;  2EFG A;  4LF8 I;  1U2R A;  3JAM Q;  3ZZ0 A;  1J5E E;  4LF5 I;  4Z7Y A;  3GON A;  4GKK E;  1IBL I;  1FJG I;  1PVG A;  4WUB A;  4LF4 E;  4DV2 I;  4FWG A;  1HNZ I;  2BM0 A;  2X36 A;  2V8P A;  2UXD I;  1MG7 A;  4ED4 A;  2HK3 A;  1IBM E;  2BV3 A;  1XMO E;  4I3H A;  4LF8 E;  4B3M I;  2V34 A;  4DR5 I;  2UUC E;  4B3T E;  1Z59 A;  2HK2 A;  1HR0 E;  1N34 E;  5LMN E;  4JI6 E;  1Z5C A;  1Z0V A;  4B3S E;  2E1R A;  4DR2 E;  1D6T A;  3WU6 A;  4JI3 E;  5IT9 Q;  2AJ4 A;  4X66 I;  1MX0 A;  4DXL A;  4B3R E;  4KHP I;  4YY3 E;  4DR6 E;  1N34 I;  4B3T I;  1FNM A;  4DPX A;  3LPS A;  1S4E A;  4DV3 E;  3QT6 A;  3B78 A;  4DR3 I;  3T1Y I;  1Z5B A;  4DPT A;  4DR3 E;  3T1Y E;  4DV1 E;  1N0V C;  1XHK A;  4LFB I;  5LL6 R;  4LF4 I;  3LTO A;  4RPF A;  1B63 A;  3D4J A;  2ZBK B;  4JI8 I;  1H7S A;  4DV7 I;  3J81 Q;  4PU9 A;  1ZM3 A;  2HHH E;  4FW9 A;  4DV3 I;  2X7I A;  4X65 E;  4K0K E;  2HKJ A;  4X62 I;  4HAC B;  4JI4 I;  4HYM A;  4EMD A;  2UU9 E;  1N32 I;  5LMU E;  4JI1 E;  2UXC E;  1N0U A;  2GS8 A;  4FWH A;  4PRV A;  4OX9 E;  1RR9 A;  4USM A;  3CWV A;  4DUZ I;  4JI7 I;  1XNQ I;  1H74 A;  4NXN I;  4DUY I;  4DU7 A;  1BKN A;  3ZKB A;  4JYA E;  4DV4 I;  4NXN E;  1UEK A;  3WU5 A;  1XMQ E;  4LF6 I;  2A2C A;  2ZM6 E;  4OX9 I;  4B3M E;  3J81 C;  1HNX E;  4GKK I;  1PKP A;  2VQE E;  2ZIT A;  4PRX A;  1EA6 A;  4DV5 I;  2VQF E;  1IBL E;  1XMQ I;  1Z0T A;  2A2D A;  4DUZ E;  3J80 Q;  4LFC E;  1N33 E;  4JI2 I;  5L3J A;  1WUU A;  1FWL A;  5A2Q C;  4LF6 E;  1NZ0 A;  3J80 C;  1HNW I;  1KTV A;  1HNZ E;  1DAR A;  5FLX C;  2HHH I;  2Q2E B;  4DV6 I;  4MYU A;  2ZM6 I;  1XNQ E;  3QT7 A;  3WU4 A;  4JI5 E;  4X62 E;  1PIE A;  1ELO A;  2V2V A;  2J7K A;  1Z0W A;  2UU9 I;  1N32 E;  4LF7 E;  2CZ9 A;  4WUD A;  4DV0 I;  5A2Q Q;  4DV6 E;  2VQF I;  4URL A;  1NHJ A;  4NXM E;  1Z0G A;  2UXD E;  1KIJ A;  3OTO I;  4KHP E;  2HKE A;  4R1F A;  3T1H I;  3ZKD A;  3B82 A;  4LF7 I;  2V2Z A;  3JAM C;  1IBM I;  1KVK A;  4X64 E;  2DEJ A;  4LF5 E;  4LF9 I;  2UXC I;  4Z7C A;  2HFU A;  4X65 I;  2UUA I;  5LMN I;  4LFC I;  4JI6 I;  1FI4 A;  2UXB E;  2XEX A;  3HUL A;  2DEI A;  4USK A;  1NHI A;  4DR6 I;  4JI8 E;  1Z0B A;  2VQE I;  4DR4 E;  5GMD A;  4JI3 I;  4YHH I;  5IWA E;  4DR7 I;  4DV0 E;  1ZXM A;  3F0N A;  1QZR A;  3J7A G;  1KKH A;  2UUA E;  1S16 A;  1RRE A;  3K1J A;  1I94 E;  4YY3 I;  1Z5A A;  4JI2 E;  1FKA E;  4ZVI A;  1NHH A;  5FLX Q;  4MYT A;  1VIS A;  4AQY E;  1XNR E;  1N36 E;  4X64 I;  4DR2 I;  4DV5 E;  2LJP A;  4XTJ A;  4JG4 A;  4LFB E;  5GME A;  4KQV A;  2F4V I;  4JI0 I;  2UUB I;  4DU8 A;  1ZM4 A;  3PYE A;  4WUC A;  3ZM7 A;  1OJ4 A;  3QT5 A;  2R3V A;  5BR8 E;  1ZM9 A;  4DV7 E;  3PYF A;  2WW4 A;  2HFS A;  4JV5 E;  3PYG A;  1I94 I;  4B3R I;  4DPW A;  4HAC A;  4NXM I;  4DV2 E;  2UXB I;  2V2Q A;  4DR1 E;  4JI1 I;  4M1K A;  4B3S I;  2F4V E;  4JI4 E;  4HY1 A;  5BR8 I;  4FN5 A;  1H7U A;  1HR0 I;  1B62 A;  1MU5 A;  1J5E I;  1ZXN A; 
#chains in the Genus database with same CATH topology
 1IBK I;  4DUY E;  4DR1 I;  3T1H E;  2JEA B;  4LFA E;  2UUC I;  1HNX I;  5IT9 C;  1IBK E;  4BA1 A;  5JEA B;  4DR4 I;  2JT2 A;  2AE8 A;  3K17 A;  5LMU I;  3H4L A;  4P52 A;  2PNZ A;  2GO3 A;  1A6F A;  3QT8 A;  1EI1 A;  1Y60 A;  3Q6M A;  4UT4 A;  1OYR A;  3J7A M;  1E3H A;  5DNL A;  2R42 A;  3WU3 A;  1ZM2 A;  4JYA I;  2BM1 A;  3PYD A;  3ZZU A;  5K36 C;  1FWK A;  5JEA C;  1HNW E;  2NN6 D;  3HJC A;  4JV5 I;  1XMO I;  3OTO E;  2VF3 A;  5K36 A;  4MU0 A;  5C0X C;  2NPF A;  5JEA A;  2E5L I;  1FJG E;  2CG9 A;  4DPY A;  1Z0E A;  1H73 A;  2PO2 A;  4DV4 E;  1H72 C;  2Z5C A;  4DPU A;  4LPF A;  1N33 I;  3LNU A;  1YHC A;  4JI5 I;  4UTG A;  4JI7 E;  5IWA I;  3V5R A;  4HXZ A;  3B8H A;  4P7A A;  4JI0 E;  1R6M A;  3P06 A;  4DV1 I;  3V2U C;  5DRP A;  4X66 E;  4GKJ I;  5K36 E;  2IOQ A;  1Z0C A;  2CGE A;  2PO2 B;  2Z5B B;  1K47 A;  2E5L E;  2C37 B;  3Q1Q A;  4LFA I;  3UHM A;  4DR7 E;  3M6A A;  4GKJ E;  2OI2 A;  3ZZT A;  4DR5 E;  2UUB E;  5C0X F;  4FWD A;  4LF9 E;  4AQY I;  1XNR I;  1R6L A;  4YHH E;  2NN6 C;  1N36 I;  2O3Z A;  4K0K I;  2EFG A;  3M85 G;  2C37 A;  4LF8 I;  1U2R A;  3B4T A;  3JAM Q;  3ZZ0 A;  2Z5C B;  1J5E E;  4LF5 I;  4Z7Y A;  3GON A;  3PRY A;  1IBL I;  4GKK E;  1FJG I;  1PVG A;  4WUB A;  4DV2 I;  4LF4 E;  4FWG A;  4NBQ A;  1HNZ I;  1HK7 A;  2BM0 A;  4OO1 B;  4FW7 A;  2X36 A;  2V8P A;  2UXD I;  1MG7 A;  4ED4 A;  2HK3 A;  1UDQ A;  3GME A;  1IBM E;  2JEB A;  2BV3 A;  2BA0 G;  4I3H A;  1XMO E;  4B3M I;  4LF8 E;  2BA1 D;  2V34 A;  4DR5 I;  2CVE A;  4MDT A;  2UUC E;  4B3T E;  1Z59 A;  2HK2 A;  2NN6 F;  1HR0 E;  1N34 E;  5LMN E;  4JI6 E;  1Z5C A;  2VES A;  1UDN A;  5K36 B;  3P3C A;  1OYP A;  1Z0V A;  3H1C A;  4B3S E;  2E1R A;  3CDI A;  1P42 A;  4DR2 E;  1D6T A;  3WU6 A;  4JI3 E;  5IT9 Q;  2AJ4 A;  4X66 I;  4IZK B;  1MX0 A;  4DXL A;  5JEA F;  4B3R E;  5K36 F;  4KHP I;  4YY3 E;  4IFD C;  3P3G A;  4DR6 E;  1N34 I;  5K36 D;  4B3T I;  4IFD A;  4IZJ B;  1FNM A;  3U1K A;  2BA1 G;  4DPX A;  4OO1 E;  3LPS A;  1S4E A;  3NZK A;  4DV3 E;  3QT6 A;  2JEB B;  3B78 A;  4DR3 I;  3T1Y I;  1Z5B A;  4DPT A;  4DR3 E;  3T1Y E;  4DV1 E;  1N0V C;  4MU4 A;  1XHK A;  4LFB I;  5LL6 R;  1UDS A;  4LF4 I;  3LTO A;  2PO0 A;  4RPF A;  1B63 A;  1Y4U A;  3D4J A;  2Z5B A;  2ZBK B;  4JI8 I;  1H7S A;  4BA2 A;  3U1Y A;  4DV7 I;  3J81 Q;  4IZK A;  4PU9 A;  1ZM3 A;  5DRQ A;  2HHH E;  4FW9 A;  4LCG A;  4J3D A;  4DV3 I;  2X7I A;  4X65 E;  4K0K E;  2HKJ A;  4X62 I;  3K85 A;  5C0X B;  4HAC B;  4IZJ A;  4LCF A;  4JI4 I;  4HYM A;  4EMD A;  2UU9 E;  1N32 I;  5LMU E;  3CDJ A;  4QNK A;  1OYS A;  4JI1 E;  2UXC E;  5DRR A;  5JEA D;  4U3D A;  1N0U A;  2C38 B;  4LCH A;  4OO1 A;  2PO1 B;  2GS8 A;  4FWH A;  2C39 A;  4PRV A;  4OX9 E;  1RR9 A;  4USM A;  3CWV A;  4DUZ I;  4IZJ D;  4JI7 I;  1XNQ I;  3PS2 A;  1H74 A;  4NXN I;  4DUY I;  4DU7 A;  1BKN A;  4IS9 A;  3ZKB A;  4JYA E;  4DV4 I;  4NXN E;  1UEK A;  2C39 B;  1XXE A;  3PS3 A;  3WU5 A;  1XMQ E;  4LF6 I;  2A2C A;  3KRN A;  2WNR B;  2O1W A;  4AM3 A;  4MU3 A;  2ZM6 E;  2Z5E A;  4OX9 I;  4B3M E;  4AID A;  3J81 C;  1HNX E;  4GKK I;  4IFD D;  1PKP A;  2BR2 B;  4FW5 A;  2PNL A;  2VQE E;  2ZIT A;  3HKM A;  2JE6 B;  2C38 A;  4PRX A;  1EA6 A;  4DV5 I;  2PO1 A;  2VQF E;  2A2D A;  1Y5Y A;  1YH8 A;  1Z0T A;  4DUZ E;  1XMQ I;  1IBL E;  3J80 Q;  4LFC E;  2BA0 D;  5EL9 A;  1VI7 A;  1N33 E;  4JI2 I;  5L3J A;  4OO1 F;  1UDO A;  1WUU A;  4QNJ A;  2BR2 A;  1USU A;  4FW6 A;  1FWL A;  5A2Q C;  5DRO A;  4LF6 E;  1NZ0 A;  4OKG A;  2WP8 A;  3J80 C;  4OO1 D;  4IFD E;  5C0X D;  2F1D A;  5ELW A;  1HNW I;  1KTV A;  1HNZ E;  2NN6 A;  1DAR A;  5FLX C;  2HHH I;  2Q2E B;  4DV6 I;  3M7N D;  2PNZ B;  2O1T A;  4BA2 B;  4MYU A;  2ZM6 I;  4AIM A;  1XNQ E;  3QT7 A;  3WU4 A;  4JI5 E;  4X62 E;  1PIE A;  1ELO A;  2V2V A;  4OZE A;  5C0X A;  2J7K A;  5DNX A;  1Z0W A;  2UU9 I;  1N32 E;  4LF7 E;  3M85 D;  2CZ9 A;  4MU1 A;  4WUD A;  2J65 A;  4DV0 I;  5A2Q Q;  4DV6 E;  2WNR A;  2GO4 A;  1NHJ A;  4URL A;  2VQF I;  4NXM E;  4N3O A;  1Z0G A;  2UXD E;  1KIJ A;  3OTO I;  4BA1 B;  4KHP E;  2WP8 B;  3DD6 A;  3PS1 A;  4IFD B;  2O1V A;  3M7N G;  1E3P A;  2HKE A;  4R1F A;  3T1H I;  3ZKD A;  3B82 A;  4LF7 I;  1Y6Z A;  2V2Z A;  3JAM C;  1IBM I;  1KVK A;  4IFD F;  4X64 E;  2DEJ A;  4LF5 E;  4LF9 I;  2UXC I;  4Z7C A;  4LOM A;  2HFU A;  4X65 I;  3Q6N A;  2UUA I;  2PO0 B;  5LMN I;  4LFC I;  4JI6 I;  1FI4 A;  2UXB E;  2XEX A;  3HUL A;  2DEI A;  4USK A;  1NHI A;  4DR6 I;  3GLL A;  4JI8 E;  1Z0B A;  2VQE I;  4DR4 E;  5GMD A;  4JI3 I;  4YHH I;  3P3E A;  4OO1 C;  5IWA E;  4DR7 I;  1RHY A;  4FW3 A;  2NN6 B;  4MQY A;  4DV0 E;  1ZXM A;  2IOP A;  1QZR A;  3F0N A;  3J7A G;  1KKH A;  3L7Z A;  2UUA E;  1S16 A;  1RRE A;  4GQU A;  3K1J A;  1I94 E;  4YY3 I;  1Z5A A;  4JI2 E;  4U3B A;  1FKA E;  4ZVI A;  1NHH A;  5FLX Q;  4MYT A;  1VIS A;  4AQY E;  1XNR E;  1N36 E;  4X64 I;  5C0X E;  4DR2 I;  4DV5 E;  2LJP A;  4XTJ A;  4JG4 A;  4LFB E;  2IES A;  5GME A;  4KQV A;  5JEA E;  2F4V I;  4JI0 I;  2UUB I;  4DU8 A;  1ZM4 A;  3PYE A;  2IER A;  5FWK A;  4WUC A;  3ZM7 A;  1OJ4 A;  3QT5 A;  2R3V A;  5BR8 E;  2JE6 A;  1Y4S A;  1ZM9 A;  4DV7 E;  3PYF A;  2WW4 A;  1USV A;  2HFS A;  4FW4 A;  4JV5 E;  3PYG A;  1I94 I;  4B3R I;  2NN6 E;  5EKW A;  4DPW A;  4HAC A;  4NXM I;  4DV2 E;  2UXB I;  2V2Q A;  4DR1 E;  4JI1 I;  2JEA A;  4M1K A;  4ISA A;  4B3S I;  2GQ0 A;  3L7Z B;  2F4V E;  3P76 A;  4JI4 E;  4HY1 A;  5BR8 I;  4FN5 A;  1H7U A;  1HR0 I;  1B62 A;  2O1U A;  3GCM A;  2PNM A;  1MU5 A;  1J5E I;  1ZXN A; 
#chains in the Genus database with same CATH homology
 1IBK I;  4DUY E;  4DR1 I;  3T1H E;  4LFA E;  2UUC I;  1HNX I;  5IT9 C;  1IBK E;  4DR4 I;  3K17 A;  5LMU I;  3H4L A;  4P52 A;  1A6F A;  3QT8 A;  1EI1 A;  3Q6M A;  4UT4 A;  3J7A M;  2R42 A;  3WU3 A;  1ZM2 A;  4JYA I;  2BM1 A;  3PYD A;  3ZZU A;  1FWK A;  1HNW E;  3HJC A;  4JV5 I;  1XMO I;  3OTO E;  2VF3 A;  2NPF A;  1FJG E;  2E5L I;  2CG9 A;  4DPY A;  1Z0E A;  1H73 A;  4DV4 E;  1H72 C;  2Z5C A;  4DPU A;  1N33 I;  3LNU A;  4JI5 I;  4UTG A;  4JI7 E;  5IWA I;  3V5R A;  4HXZ A;  3B8H A;  4P7A A;  4JI0 E;  3P06 A;  4DV1 I;  3V2U C;  4X66 E;  4GKJ I;  2IOQ A;  1Z0C A;  2CGE A;  2Z5B B;  1K47 A;  2E5L E;  3Q1Q A;  4LFA I;  4DR7 E;  3M6A A;  4GKJ E;  2OI2 A;  3ZZT A;  4DR5 E;  2UUB E;  4FWD A;  4LF9 E;  4AQY I;  1XNR I;  4YHH E;  1N36 I;  4K0K I;  2EFG A;  4LF8 I;  1U2R A;  3JAM Q;  3ZZ0 A;  2Z5C B;  1J5E E;  4LF5 I;  4Z7Y A;  3GON A;  3PRY A;  1IBL I;  4GKK E;  1FJG I;  1PVG A;  4WUB A;  4DV2 I;  4LF4 E;  4FWG A;  1HNZ I;  1HK7 A;  2BM0 A;  2X36 A;  2V8P A;  2UXD I;  1MG7 A;  4ED4 A;  2HK3 A;  1IBM E;  2BV3 A;  1XMO E;  4I3H A;  4LF8 E;  4B3M I;  2V34 A;  4DR5 I;  2UUC E;  4B3T E;  1Z59 A;  2HK2 A;  1HR0 E;  1N34 E;  5LMN E;  4JI6 E;  1Z5C A;  1Z0V A;  4B3S E;  2E1R A;  4DR2 E;  1D6T A;  3WU6 A;  4JI3 E;  5IT9 Q;  2AJ4 A;  4X66 I;  4IZK B;  1MX0 A;  4DXL A;  4B3R E;  4KHP I;  4YY3 E;  4DR6 E;  1N34 I;  4B3T I;  4IZJ B;  1FNM A;  4DPX A;  3LPS A;  1S4E A;  4DV3 E;  3QT6 A;  3B78 A;  4DR3 I;  3T1Y I;  1Z5B A;  4DPT A;  4DR3 E;  3T1Y E;  4DV1 E;  1N0V C;  1XHK A;  4LFB I;  5LL6 R;  4LF4 I;  3LTO A;  4RPF A;  1B63 A;  1Y4U A;  3D4J A;  2Z5B A;  2ZBK B;  4JI8 I;  1H7S A;  4DV7 I;  3J81 Q;  4IZK A;  4PU9 A;  1ZM3 A;  2HHH E;  4FW9 A;  4DV3 I;  2X7I A;  4X65 E;  4K0K E;  2HKJ A;  4X62 I;  3K85 A;  4HAC B;  4IZJ A;  4JI4 I;  4HYM A;  4EMD A;  2UU9 E;  1N32 I;  5LMU E;  4JI1 E;  2UXC E;  1N0U A;  2GS8 A;  4FWH A;  4PRV A;  4OX9 E;  1RR9 A;  4USM A;  3CWV A;  4DUZ I;  4IZJ D;  4JI7 I;  1XNQ I;  1H74 A;  4NXN I;  4DUY I;  4DU7 A;  1BKN A;  3ZKB A;  4JYA E;  4DV4 I;  4NXN E;  1UEK A;  3WU5 A;  1XMQ E;  4LF6 I;  2A2C A;  2O1W A;  2ZM6 E;  2Z5E A;  4OX9 I;  4B3M E;  3J81 C;  1HNX E;  4GKK I;  1PKP A;  2PNL A;  2VQE E;  2ZIT A;  4PRX A;  1EA6 A;  4DV5 I;  2VQF E;  1IBL E;  1Z0T A;  2A2D A;  4DUZ E;  1XMQ I;  3J80 Q;  4LFC E;  1N33 E;  4JI2 I;  5L3J A;  1WUU A;  1USU A;  1FWL A;  5A2Q C;  4LF6 E;  1NZ0 A;  3J80 C;  1HNW I;  1KTV A;  1HNZ E;  1DAR A;  5FLX C;  2HHH I;  2Q2E B;  4DV6 I;  2O1T A;  4MYU A;  2ZM6 I;  1XNQ E;  3QT7 A;  3WU4 A;  4JI5 E;  4X62 E;  1PIE A;  1ELO A;  2V2V A;  2J7K A;  1Z0W A;  2UU9 I;  1N32 E;  4LF7 E;  2CZ9 A;  4WUD A;  4DV0 I;  5A2Q Q;  4DV6 E;  2VQF I;  4URL A;  1NHJ A;  4NXM E;  4N3O A;  1Z0G A;  2UXD E;  1KIJ A;  3OTO I;  4KHP E;  2O1V A;  2HKE A;  4R1F A;  3T1H I;  3ZKD A;  3B82 A;  4LF7 I;  1Y6Z A;  2V2Z A;  3JAM C;  1IBM I;  1KVK A;  4X64 E;  2DEJ A;  4LF5 E;  4LF9 I;  2UXC I;  4Z7C A;  2HFU A;  4X65 I;  3Q6N A;  2UUA I;  5LMN I;  4LFC I;  4JI6 I;  1FI4 A;  2UXB E;  2XEX A;  3HUL A;  2DEI A;  4USK A;  1NHI A;  4DR6 I;  4JI8 E;  1Z0B A;  2VQE I;  4DR4 E;  5GMD A;  4JI3 I;  4YHH I;  5IWA E;  4DR7 I;  4DV0 E;  1ZXM A;  2IOP A;  1QZR A;  3F0N A;  3J7A G;  1KKH A;  2UUA E;  1S16 A;  1RRE A;  3K1J A;  1I94 E;  4YY3 I;  1Z5A A;  4JI2 E;  1FKA E;  4ZVI A;  1NHH A;  5FLX Q;  4MYT A;  1VIS A;  4AQY E;  1XNR E;  1N36 E;  4X64 I;  4DR2 I;  4DV5 E;  2LJP A;  4XTJ A;  4JG4 A;  4LFB E;  5GME A;  4KQV A;  2F4V I;  4JI0 I;  2UUB I;  4DU8 A;  1ZM4 A;  3PYE A;  5FWK A;  4WUC A;  3ZM7 A;  1OJ4 A;  3QT5 A;  2R3V A;  5BR8 E;  1ZM9 A;  1Y4S A;  4DV7 E;  3PYF A;  2WW4 A;  1USV A;  2HFS A;  4JV5 E;  3PYG A;  1I94 I;  4B3R I;  4DPW A;  4HAC A;  4NXM I;  4DV2 E;  2UXB I;  2V2Q A;  4DR1 E;  4JI1 I;  4M1K A;  4B3S I;  2GQ0 A;  2F4V E;  4JI4 E;  4HY1 A;  5BR8 I;  4FN5 A;  1H7U A;  1HR0 I;  1B62 A;  2O1U A;  2PNM A;  1MU5 A;  1J5E I;  1ZXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...