3Q1QA

Structure of a bacterial ribonuclease p holoenzyme in complex with trna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
112
structure length
112
Chain Sequence
TRRERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGLDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNase P RNA
publication title Structure of a Bacterial Ribonuclease P Holoenzyme in Complex with tRNA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/rna
total genus 32
structure length 112
sequence length 112
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3q1qA00
4LF7I 1N32I 2V2QA 1NHIA 4DUZI 4DUYE 1HNXE 2DEIA 1ZM9A 4DV0I 4DV1I 3PYEA 1MU5A 1NHHA 4X65I 4PU9A 4JI8I 3ZZ0A 2BM1A 1N34I 2VF3A 4LF7E 3Q1QA 4LF9E 1UEKA 1N32E 4B3SI 1N36I 5BR8I 4JI4I 4DUZE 4R1FA 1N33I 4KHPE 3J7AG 4DV0E 4DV1E 4ED4A 4JI8E 2E5LI 1H72C 4JI7I 4B3SE 5BR8E 2UUAI 4JI4E 3J80C 1PVGA 3WU3A 1FWLA 1D6TA 1OJ4A 1WUUA 4HYMA 2F4VI 4JI2I 2CZ9A 4DPTA 4PRVA 4JI7E 1H7SA 4LFCE 4DPWA 2UUAE 4P7AA 4USKA 4X66I 1FNMA 1HNZI 1ZM4A 4WUBA 3ZKDA 2F4VE 4JI2E 4DV2I 1EA6A 1HR0E 1XMOI 4LF4I 4YHHI 3ZM7A 4JYAI 2NPFA 5L3JA 4X66E 4JI0I 4JI5I 2WW4A 1HNZE 4FWGA 4DU8A 4DR4I 5GMEA 2UUBI 4DV2E 4K0KI 4LF4E 5FLXQ 4YHHE 1IBLI 1I94I 4FWHA 4JYAE 4JV5I 2VQEI 4JI5E 1QZRA 1FJGI 1K47A 4DR4E 4XTJA 3QT8A 2DEJA 4MYUA 5IWAE 4X62E 2UUBE 4DPUA 2AJ4A 4B3MI 4YY3I 1Z5CA 4LFAI 1I94E 2X36A 4JV5E 1A6FA 2VQEE 2ZM6I 1FJGE 1Z0BA 4OX9I 1PKPA 1XMQE 3V5RA 4NXMI 3B78A 4B3ME 1KIJA 1B62A 4MYTA 2BM0A 4HXZA 4AQYI 1Z0TA 4JI3I 4UT4A 3CWVA 1HNWI 2ZM6E 1RR9A 2VQFI 1Z5AA 1S4EA 2UU9I 3J7AM 4DV7I 4NXME 1ZXMA 3J81Q 1PIEA 1Z0CA 1ZXNA 5GMDA 4AQYE 1XHKA 2UUCI 5A2QQ 1HNWE 2HFSA 1ZM2A 2V34A 3PYGA 4X65E 4DV7E 4HY1A 3JAMQ 1DARA 1N34E 1J5EI 4NXNI 1EI1A 1N36E 4WUDA 3ZKBA 4DV4I 2UUCE 4RPFA 1N33E 3HULA 1FWKA 1H73A 3ZZUA 2E5LE 1Z0VA 3D4JA 4NXNE 1Z0WA 5FLXC 2R3VA 3F0NA 2A2DA 3B8HA 4FWDA 5IT9Q 5LL6R 3WU5A 1XNQI 4DR6I 1H74A 4B3RI 1KKHA 2HHHI 4P52A 2HK3A 4PRXA 3LPSA 2V2ZA 1RREA 3V2UC 3QT5A 1BKNA 3PYDA 4EMDA 2OI2A 3PYFA 1XNQE 4DR6E 4B3RE 1MG7A 4GKKI 5LMUI 3T1HI 1MX0A 1XMOE 4DR5I 3QT7A 4JI0E 4JI1I 1ELOA 1S16A 2E1RA 3LNUA 4GKKE 2ZITA 4K0KE 3J81C 4ZVIA 2ZBKB 4DV5I 4JG4A 4DR5E 1IBLE 4DPYA 3WU4A 5A2QC 2UXBI 4DR1I 4FW9A 1Z0EA 2BV3A 4B3TI 4HACB 3JAMC 3B82A 4YY3E 3LTOA 4LF6I 4LFAE 4LF5I 4LFBI 4OX9E 1B63A 1NHJA 4DUYI 4DR7I 4B3TE 1KVKA 4LF6E 2R42A 4JI3E 2HFUA 4LF9I 4DR2I 4LF5E 2VQFE 1FKAE 3OTOI 2X7IA 4LFBE 5IT9C 1KTVA 1IBKI 4DR7E 2UU9E 4KHPI 4Z7CA 4DV6I 1VISA 4WUCA 4DR2E 2Q2EB 3OTOE 1N0UA 3T1YI 2XEXA 1IBKE 4USMA 4DPXA 4DV6E 1J5EE 2J7KA 1U2RA 4HACA 4DV4E 4GKJI 4LFCI 3T1YE 4URLA 1Z5BA 3H4LA 1FI4A 2LJPA 3K17A 2HKJA 4LF8I 1N0VC 1IBMI 4GKJE 1HR0I 4I3HA 4M1KA 1XNRI 2EFGA 2HK2A 2HHHE 4LF8E 1IBME 3GONA 4Z7YA 3ZZTA 3J80Q 1XNRE 3M6AA 2UXDI 1NZ0A 2A2CA 5LMUE 4X64I 5IWAI 1ZM3A 2V2VA 3T1HE 4X62I 4DU7A 4DV3I 4DXLA 2UXCI 4JI1E 3WU6A 5LMNI 4DR3I 2UXDE 4JI6I 3K1JA 1XMQI 4FN5A 1Z0GA 4X64E 4DV5E 2V8PA 4DV3E 1H7UA 2UXBE 4DR1E 2UXCE 2HKEA 4UTGA 5LMNE 1HNXI 4DR3E 4JI6E 4KQVA 3QT6A 2GS8A 1Z59A
chains in the Genus database with same CATH superfamily
5JEAF 5EKWA 4LF7I 3H1CA 1N32I 2V2QA 4MU0A 1NHIA 4DUZI 4DUYE 1HNXE 4BA2A 2DEIA 1ZM9A 4DV0I 4DV1I 4OO1D 3PYEA 1MU5A 1NHHA 4OO1F 1UDQA 4X65I 4PU9A 4JI8I 5K36A 5EL9A 3ZZ0A 2BM1A 1N34I 2VF3A 4LF7E 3Q1QA 2PNZB 4LF9E 4IFDA 1UEKA 1N32E 4LCFA 5DNXA 4B3SI 1N36I 5BR8I 5K36E 5ELWA 4JI4I 4DUZE 4R1FA 2NN6D 4NBQA 1N33I 4KHPE 2C39A 3J7AG 4DV0E 1OYPA 4DV1E 2CVEA 4IFDE 4ED4A 4JI8E 2E5LI 1H72C 2C38A 2IOPA 4U3BA 4JI7I 4B3SE 5BR8E 2UUAI 4JI4E 2PO2A 2J65A 3J80C 1P42A 1PVGA 3GMEA 3WU3A 1FWLA 1D6TA 1OJ4A 1WUUA 2JEBA 4HYMA 2F4VI 4JI2I 2PO0B 2O1WA 2CZ9A 4DPTA 1YH8A 4J3DA 4PRVA 4JI7E 1H7SA 4LFCE 4DPWA 2UUAE 2AE8A 4P7AA 1USVA 4USKA 2CG9A 2C37B 4X66I 1FNMA 1HNZI 1ZM4A 4WUBA 3K85A 3ZKDA 2F4VE 4JI2E 4DV2I 2JE6B 1EA6A 4AM3A 1HR0E 1XMOI 4BA1B 4LF4I 4YHHI 3ZM7A 4JYAI 2NPFA 2O1UA 2PNZA 5L3JA 4X66E 4JI0I 4JI5I 2WW4A 1HNZE 4QNJA 4FWGA 4DU8A 4DR4I 5GMEA 2UUBI 4DV2E 3HJCA 4K0KI 4U3DA 4LF4E 2GO3A 5FLXQ 4YHHE 1IBLI 1I94I 5K36C 4FWHA 4JYAE 4JV5I 2PNMA 4MU1A 2VQEI 4LCGA 5FWKA 4JI5E 4IFDC 1QZRA 1FJGI 3Q6MA 1K47A 4DR4E 4XTJA 3QT8A 2DEJA 2BA0G 4MYUA 5IWAE 4X62E 2UUBE 4DPUA 2AJ4A 4B3MI 4YY3I 1Z5CA 4LFAI 1I94E 2PO0A 2X36A 4JV5E 1A6FA 2VQEE 1YHCA 4IZJB 4FW5A 2VESA 2ZM6I 1FJGE 1Z0BA 4OX9I 1PKPA 2O1TA 3V5RA 1XMQE 4IZKB 4NXMI 3B78A 4B3ME 1KIJA 1B62A 4AIMA 2BA0D 4MYTA 2BM0A 4HXZA 1OYSA 3UHMA 4AQYI 1Z0TA 2BR2B 4JI3I 2JE6A 1RHYA 4UT4A 3PRYA 3CWVA 2Z5BB 5DNLA 2ZM6E 1HNWI 4BA1A 1RR9A 2VQFI 1Z5AA 1S4EA 2Z5EA 2UU9I 3J7AM 3CDJA 4DV7I 4NXME 1ZXMA 3J81Q 4FW4A 1PIEA 1Z0CA 1ZXNA 5GMDA 4AQYE 4FW7A 1XHKA 2UUCI 5A2QQ 1HNWE 2HFSA 1ZM2A 2V34A 5K36D 3PYGA 5K36F 4X65E 4DV7E 4HY1A 4IFDD 3JAMQ 1R6MA 1DARA 1N34E 1J5EI 4IFDF 4NXNI 3CDIA 1EI1A 2BA1G 1N36E 4WUDA 3ZKBA 4DV4I 4MQYA 4RPFA 2UUCE 1N33E 2JEAB 1XXEA 3HULA 1FWKA 4ISAA 1H73A 3ZZUA 2E5LE 4IZJA 1Z0VA 3D4JA 5DRRA 4NXNE 1Z0WA 5FLXC 2R3VA 3F0NA 2A2DA 2BR2A 1OYRA 3B8HA 4FWDA 5IT9Q 1Y4UA 2IOQA 3P3EA 1UDNA 5LL6R 2Z5BA 3WU5A 1XNQI 4GQUA 4DR6I 1H74A 4B3RI 1KKHA 5C0XB 2HHHI 5JEAB 2F1DA 4P52A 2HK3A 5DROA 4PRXA 3LPSA 2V2ZA 1RREA 3HKMA 3V2UC 3QT5A 1BKNA 4IS9A 3PYDA 4EMDA 2OI2A 3PYFA 5C0XC 1XNQE 4OO1B 4DR6E 4B3RE 1MG7A 2PO1B 4GKKI 1Y6ZA 5LMUI 3T1HI 4AIDA 1MX0A 1XMOE 4DR5I 3QT7A 5DRPA 4JI0E 2NN6B 2WP8B 3P76A 4JI1I 1ELOA 1S16A 2E1RA 1HK7A 3LNUA 2JEAA 4GKKE 2ZITA 4K0KE 3J81C 4QNKA 4ZVIA 2IESA 2ZBKB 4DV5I 3Q6NA 4JG4A 4DR5E 1IBLE 4DPYA 1Y60A 2NN6C 3WU4A 5A2QC 2UXBI 4DR1I 4FW9A 3U1YA 2CGEA 1Z0EA 2BV3A 2C37A 4B3TI 4FW3A 4HACB 3JAMC 3B82A 4YY3E 3LTOA 4LF6I 4LFAE 2PNLA 2PO2B 4LPFA 5C0XA 5JEAA 3M85G 3U1KA 3P06A 4LF5I 4MU3A 4LFBI 4OX9E 1B63A 1NHJA 1E3PA 2JEBB 4DUYI 3PS2A 4DR7I 4B3TE 5C0XE 5JEAE 1KVKA 3DD6A 1R6LA 4OO1A 4LF6E 2GQ0A 5C0XF 2PO1A 2R42A 4JI3E 3P3GA 1USUA 2HFUA 4LF9I 2WNRB 4DR2I 4LF5E 2VQFE 3OTOI 1FKAE 2X7IA 4LFBE 3PS1A 4OO1E 2Z5CB 5IT9C 3M85D 1KTVA 1IBKI 4DR7E 2UU9E 4KHPI 4Z7CA 2NN6A 4DV6I 2WP8A 1VISA 2O1VA 3P3CA 1UDOA 5DRQA 4WUCA 4DR2E 2NN6E 2Q2EB 3OTOE 1N0UA 3T1YI 2XEXA 1IBKE 3L7ZB 3GLLA 4USMA 4DPXA 2NN6F 4N3OA 4DV6E 1J5EE 2J7KA 4IZKA 1U2RA 4MU4A 4HACA 4DV4E 4GKJI 3M7NG 2BA1D 4LFCI 3T1YE 4URLA 4IZJD 1Z5BA 3H4LA 1FI4A 3GCMA 2LJPA 1VI7A 3K17A 2HKJA 4LF8I 1N0VC 1IBMI 4GKJE 1HR0I 4I3HA 4M1KA 3NZKA 3B4TA 3M7ND 1XNRI 2EFGA 4OKGA 2WNRA 5JEAC 2HK2A 2Z5CA 4LCHA 2HHHE 4LF8E 1Y5YA 1IBME 3GONA 4Z7YA 3ZZTA 4BA2B 4OO1C 3J80Q 4OZEA 4LOMA 1XNRE 1E3HA 3M6AA 5K36B 3KRNA 2UXDI 1NZ0A 2A2CA 5LMUE 3L7ZA 4X64I 5IWAI 1ZM3A 2V2VA 3T1HE 4X62I 4IFDB 4DU7A 4DV3I 2C39B 4DXLA 2GO4A 2UXCI 2JT2A 4JI1E 3WU6A 5LMNI 2C38B 4DR3I 2UXDE 4JI6I 3K1JA 1XMQI 4FN5A 1Z0GA 4X64E 2O3ZA 4DV5E 2V8PA 3PS3A 4DV3E 1H7UA 4MDTA 2UXBE 4FW6A 4DR1E 2UXCE 2HKEA 2IERA 4UTGA 1Y4SA 5LMNE 1HNXI 4DR3E 4JI6E 4KQVA 1UDSA 3QT6A 5C0XD 5JEAD 2GS8A 1Z59A
chains in the Genus database with same CATH topology
4LF7I 1N32I 2V2QA 1NHIA 4DUZI 4DUYE 1HNXE 2DEIA 1ZM9A 4DV0I 4DV1I 3PYEA 1MU5A 1NHHA 4X65I 4PU9A 4JI8I 3ZZ0A 2BM1A 1N34I 2VF3A 4LF7E 3Q1QA 4LF9E 1UEKA 1N32E 4B3SI 1N36I 5BR8I 4JI4I 4DUZE 4R1FA 1N33I 4KHPE 3J7AG 4DV0E 4DV1E 4ED4A 4JI8E 2E5LI 1H72C 2IOPA 4JI7I 4B3SE 5BR8E 2UUAI 4JI4E 3J80C 1PVGA 3WU3A 1FWLA 1D6TA 1OJ4A 1WUUA 4HYMA 2F4VI 4JI2I 2O1WA 2CZ9A 4DPTA 4PRVA 4JI7E 1H7SA 4LFCE 4DPWA 2UUAE 4P7AA 1USVA 4USKA 2CG9A 4X66I 1FNMA 1HNZI 1ZM4A 4WUBA 3K85A 3ZKDA 2F4VE 4JI2E 4DV2I 1EA6A 1HR0E 1XMOI 4LF4I 4YHHI 3ZM7A 4JYAI 2NPFA 2O1UA 5L3JA 4X66E 4JI0I 4JI5I 2WW4A 1HNZE 4FWGA 4DU8A 4DR4I 5GMEA 2UUBI 4DV2E 3HJCA 4K0KI 4LF4E 5FLXQ 4YHHE 1IBLI 1I94I 4FWHA 4JYAE 4JV5I 2PNMA 2VQEI 5FWKA 4JI5E 1QZRA 1FJGI 3Q6MA 1K47A 4DR4E 4XTJA 3QT8A 2DEJA 4MYUA 5IWAE 4X62E 2UUBE 4DPUA 2AJ4A 4B3MI 4YY3I 1Z5CA 4LFAI 1I94E 2X36A 4JV5E 1A6FA 2VQEE 4IZJB 2ZM6I 1FJGE 1Z0BA 4OX9I 1PKPA 2O1TA 3V5RA 1XMQE 4IZKB 4NXMI 3B78A 4B3ME 1KIJA 1B62A 4MYTA 2BM0A 4HXZA 4AQYI 1Z0TA 4JI3I 4UT4A 3PRYA 3CWVA 2Z5BB 1HNWI 2ZM6E 1RR9A 2VQFI 1Z5AA 1S4EA 2Z5EA 2UU9I 3J7AM 4DV7I 4NXME 1ZXMA 3J81Q 1PIEA 1Z0CA 1ZXNA 5GMDA 4AQYE 1XHKA 2UUCI 5A2QQ 1HNWE 2HFSA 1ZM2A 2V34A 3PYGA 4X65E 4DV7E 4HY1A 3JAMQ 1DARA 1N34E 1J5EI 4NXNI 1EI1A 1N36E 4WUDA 3ZKBA 4DV4I 2UUCE 4RPFA 1N33E 3HULA 1FWKA 1H73A 3ZZUA 2E5LE 4IZJA 1Z0VA 3D4JA 4NXNE 1Z0WA 5FLXC 2R3VA 3F0NA 2A2DA 3B8HA 4FWDA 5IT9Q 1Y4UA 2IOQA 5LL6R 2Z5BA 3WU5A 1XNQI 4DR6I 1H74A 4B3RI 1KKHA 2HHHI 4P52A 2HK3A 4PRXA 3LPSA 2V2ZA 1RREA 3V2UC 3QT5A 1BKNA 3PYDA 4EMDA 2OI2A 3PYFA 1XNQE 4DR6E 4B3RE 1MG7A 4GKKI 1Y6ZA 5LMUI 3T1HI 1MX0A 1XMOE 4DR5I 3QT7A 4JI0E 4JI1I 1ELOA 1S16A 2E1RA 1HK7A 3LNUA 4GKKE 2ZITA 4K0KE 3J81C 4ZVIA 2ZBKB 4DV5I 3Q6NA 4JG4A 4DR5E 1IBLE 4DPYA 3WU4A 5A2QC 2UXBI 4DR1I 4FW9A 2CGEA 1Z0EA 2BV3A 4B3TI 4HACB 3JAMC 3B82A 4YY3E 3LTOA 4LF6I 4LFAE 2PNLA 3P06A 4LF5I 4LFBI 4OX9E 1B63A 1NHJA 4DUYI 4DR7I 4B3TE 1KVKA 4LF6E 2GQ0A 2R42A 4JI3E 1USUA 2HFUA 4LF9I 4DR2I 4LF5E 2VQFE 3OTOI 1FKAE 2X7IA 4LFBE 2Z5CB 5IT9C 1KTVA 1IBKI 4DR7E 2UU9E 4KHPI 4Z7CA 4DV6I 1VISA 2O1VA 4WUCA 4DR2E 2Q2EB 3OTOE 1N0UA 3T1YI 2XEXA 1IBKE 4USMA 4DPXA 4N3OA 4DV6E 1J5EE 2J7KA 4IZKA 1U2RA 4HACA 4DV4E 4GKJI 4LFCI 3T1YE 4URLA 4IZJD 1Z5BA 3H4LA 1FI4A 2LJPA 3K17A 2HKJA 4LF8I 1N0VC 1IBMI 4GKJE 1HR0I 4I3HA 4M1KA 1XNRI 2EFGA 2HK2A 2Z5CA 2HHHE 4LF8E 1IBME 3GONA 4Z7YA 3ZZTA 3J80Q 1XNRE 3M6AA 2UXDI 1NZ0A 2A2CA 5LMUE 4X64I 5IWAI 1ZM3A 2V2VA 3T1HE 4X62I 4DU7A 4DV3I 4DXLA 2UXCI 4JI1E 3WU6A 5LMNI 4DR3I 2UXDE 4JI6I 3K1JA 1XMQI 4FN5A 1Z0GA 4X64E 4DV5E 2V8PA 4DV3E 1H7UA 2UXBE 4DR1E 2UXCE 2HKEA 4UTGA 1Y4SA 5LMNE 1HNXI 4DR3E 4JI6E 4KQVA 3QT6A 2GS8A 1Z59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 I;  1N32 I;  2V2Q A;  1NHI A;  4DUZ I;  4DUY E;  1HNX E;  2DEI A;  1ZM9 A;  4DV0 I;  4DV1 I;  3PYE A;  1MU5 A;  1NHH A;  4X65 I;  4PU9 A;  4JI8 I;  3ZZ0 A;  2BM1 A;  1N34 I;  2VF3 A;  4LF7 E;  3Q1Q A;  4LF9 E;  1UEK A;  1N32 E;  4B3S I;  1N36 I;  5BR8 I;  4JI4 I;  4DUZ E;  4R1F A;  1N33 I;  4KHP E;  3J7A G;  4DV0 E;  4DV1 E;  4ED4 A;  4JI8 E;  2E5L I;  1H72 C;  4JI7 I;  4B3S E;  5BR8 E;  2UUA I;  4JI4 E;  3J80 C;  1PVG A;  3WU3 A;  1FWL A;  1D6T A;  1OJ4 A;  1WUU A;  4HYM A;  2F4V I;  4JI2 I;  2CZ9 A;  4DPT A;  4PRV A;  4JI7 E;  1H7S A;  4LFC E;  4DPW A;  2UUA E;  4P7A A;  4USK A;  4X66 I;  1FNM A;  1HNZ I;  1ZM4 A;  4WUB A;  3ZKD A;  2F4V E;  4JI2 E;  4DV2 I;  1EA6 A;  1HR0 E;  1XMO I;  4LF4 I;  4YHH I;  3ZM7 A;  4JYA I;  2NPF A;  5L3J A;  4X66 E;  4JI0 I;  4JI5 I;  2WW4 A;  1HNZ E;  4FWG A;  4DU8 A;  4DR4 I;  5GME A;  2UUB I;  4DV2 E;  4K0K I;  4LF4 E;  5FLX Q;  4YHH E;  1IBL I;  1I94 I;  4FWH A;  4JYA E;  4JV5 I;  2VQE I;  4JI5 E;  1QZR A;  1FJG I;  1K47 A;  4DR4 E;  4XTJ A;  3QT8 A;  2DEJ A;  4MYU A;  5IWA E;  4X62 E;  2UUB E;  4DPU A;  2AJ4 A;  4B3M I;  4YY3 I;  1Z5C A;  4LFA I;  1I94 E;  2X36 A;  4JV5 E;  1A6F A;  2VQE E;  2ZM6 I;  1FJG E;  1Z0B A;  4OX9 I;  1PKP A;  1XMQ E;  3V5R A;  4NXM I;  3B78 A;  4B3M E;  1KIJ A;  1B62 A;  4MYT A;  2BM0 A;  4HXZ A;  4AQY I;  1Z0T A;  4JI3 I;  4UT4 A;  3CWV A;  1HNW I;  2ZM6 E;  1RR9 A;  2VQF I;  1Z5A A;  1S4E A;  2UU9 I;  3J7A M;  4DV7 I;  4NXM E;  1ZXM A;  3J81 Q;  1PIE A;  1Z0C A;  1ZXN A;  5GMD A;  4AQY E;  1XHK A;  2UUC I;  5A2Q Q;  1HNW E;  2HFS A;  1ZM2 A;  2V34 A;  3PYG A;  4X65 E;  4DV7 E;  4HY1 A;  3JAM Q;  1DAR A;  1N34 E;  1J5E I;  4NXN I;  1EI1 A;  1N36 E;  4WUD A;  3ZKB A;  4DV4 I;  2UUC E;  4RPF A;  1N33 E;  3HUL A;  1FWK A;  1H73 A;  3ZZU A;  2E5L E;  1Z0V A;  3D4J A;  4NXN E;  1Z0W A;  5FLX C;  2R3V A;  3F0N A;  2A2D A;  3B8H A;  4FWD A;  5IT9 Q;  5LL6 R;  3WU5 A;  1XNQ I;  4DR6 I;  1H74 A;  4B3R I;  1KKH A;  2HHH I;  4P52 A;  2HK3 A;  4PRX A;  3LPS A;  2V2Z A;  1RRE A;  3V2U C;  3QT5 A;  1BKN A;  3PYD A;  4EMD A;  2OI2 A;  3PYF A;  1XNQ E;  4DR6 E;  4B3R E;  1MG7 A;  4GKK I;  5LMU I;  3T1H I;  1MX0 A;  1XMO E;  4DR5 I;  3QT7 A;  4JI0 E;  4JI1 I;  1ELO A;  1S16 A;  2E1R A;  3LNU A;  4GKK E;  2ZIT A;  4K0K E;  3J81 C;  4ZVI A;  2ZBK B;  4DV5 I;  4JG4 A;  4DR5 E;  1IBL E;  4DPY A;  3WU4 A;  5A2Q C;  2UXB I;  4DR1 I;  4FW9 A;  1Z0E A;  2BV3 A;  4B3T I;  4HAC B;  3JAM C;  3B82 A;  4YY3 E;  3LTO A;  4LF6 I;  4LFA E;  4LF5 I;  4LFB I;  4OX9 E;  1B63 A;  1NHJ A;  4DUY I;  4DR7 I;  4B3T E;  1KVK A;  4LF6 E;  2R42 A;  4JI3 E;  2HFU A;  4LF9 I;  4DR2 I;  4LF5 E;  2VQF E;  1FKA E;  3OTO I;  2X7I A;  4LFB E;  5IT9 C;  1KTV A;  1IBK I;  4DR7 E;  2UU9 E;  4KHP I;  4Z7C A;  4DV6 I;  1VIS A;  4WUC A;  4DR2 E;  2Q2E B;  3OTO E;  1N0U A;  3T1Y I;  2XEX A;  1IBK E;  4USM A;  4DPX A;  4DV6 E;  1J5E E;  2J7K A;  1U2R A;  4HAC A;  4DV4 E;  4GKJ I;  4LFC I;  3T1Y E;  4URL A;  1Z5B A;  3H4L A;  1FI4 A;  2LJP A;  3K17 A;  2HKJ A;  4LF8 I;  1N0V C;  1IBM I;  4GKJ E;  1HR0 I;  4I3H A;  4M1K A;  1XNR I;  2EFG A;  2HK2 A;  2HHH E;  4LF8 E;  1IBM E;  3GON A;  4Z7Y A;  3ZZT A;  3J80 Q;  1XNR E;  3M6A A;  2UXD I;  1NZ0 A;  2A2C A;  5LMU E;  4X64 I;  5IWA I;  1ZM3 A;  2V2V A;  3T1H E;  4X62 I;  4DU7 A;  4DV3 I;  4DXL A;  2UXC I;  4JI1 E;  3WU6 A;  5LMN I;  4DR3 I;  2UXD E;  4JI6 I;  3K1J A;  1XMQ I;  4FN5 A;  1Z0G A;  4X64 E;  4DV5 E;  2V8P A;  4DV3 E;  1H7U A;  2UXB E;  4DR1 E;  2UXC E;  2HKE A;  4UTG A;  5LMN E;  1HNX I;  4DR3 E;  4JI6 E;  4KQV A;  3QT6 A;  2GS8 A;  1Z59 A; 
#chains in the Genus database with same CATH topology
 5JEA F;  5EKW A;  4LF7 I;  3H1C A;  1N32 I;  2V2Q A;  4MU0 A;  1NHI A;  4DUZ I;  4DUY E;  1HNX E;  4BA2 A;  2DEI A;  1ZM9 A;  4DV0 I;  4DV1 I;  4OO1 D;  3PYE A;  1MU5 A;  1NHH A;  4OO1 F;  1UDQ A;  4X65 I;  4PU9 A;  4JI8 I;  5K36 A;  5EL9 A;  3ZZ0 A;  2BM1 A;  1N34 I;  2VF3 A;  4LF7 E;  3Q1Q A;  2PNZ B;  4LF9 E;  4IFD A;  1UEK A;  1N32 E;  4LCF A;  5DNX A;  4B3S I;  1N36 I;  5BR8 I;  5K36 E;  5ELW A;  4JI4 I;  4DUZ E;  4R1F A;  2NN6 D;  4NBQ A;  1N33 I;  4KHP E;  2C39 A;  3J7A G;  4DV0 E;  1OYP A;  4DV1 E;  2CVE A;  4IFD E;  4ED4 A;  4JI8 E;  2E5L I;  1H72 C;  2C38 A;  2IOP A;  4U3B A;  4JI7 I;  4B3S E;  5BR8 E;  2UUA I;  4JI4 E;  2PO2 A;  2J65 A;  3J80 C;  1P42 A;  1PVG A;  3GME A;  3WU3 A;  1FWL A;  1D6T A;  1OJ4 A;  1WUU A;  2JEB A;  4HYM A;  2F4V I;  4JI2 I;  2PO0 B;  2O1W A;  2CZ9 A;  4DPT A;  1YH8 A;  4J3D A;  4PRV A;  4JI7 E;  1H7S A;  4LFC E;  4DPW A;  2UUA E;  2AE8 A;  4P7A A;  1USV A;  4USK A;  2CG9 A;  2C37 B;  4X66 I;  1FNM A;  1HNZ I;  1ZM4 A;  4WUB A;  3K85 A;  3ZKD A;  2F4V E;  4JI2 E;  4DV2 I;  2JE6 B;  1EA6 A;  4AM3 A;  1HR0 E;  1XMO I;  4BA1 B;  4LF4 I;  4YHH I;  3ZM7 A;  4JYA I;  2NPF A;  2O1U A;  2PNZ A;  5L3J A;  4X66 E;  4JI0 I;  4JI5 I;  2WW4 A;  1HNZ E;  4QNJ A;  4FWG A;  4DU8 A;  4DR4 I;  5GME A;  2UUB I;  4DV2 E;  3HJC A;  4K0K I;  4U3D A;  4LF4 E;  2GO3 A;  5FLX Q;  4YHH E;  1IBL I;  1I94 I;  5K36 C;  4FWH A;  4JYA E;  4JV5 I;  2PNM A;  4MU1 A;  2VQE I;  4LCG A;  5FWK A;  4JI5 E;  4IFD C;  1QZR A;  1FJG I;  3Q6M A;  1K47 A;  4DR4 E;  4XTJ A;  3QT8 A;  2DEJ A;  2BA0 G;  4MYU A;  5IWA E;  4X62 E;  2UUB E;  4DPU A;  2AJ4 A;  4B3M I;  4YY3 I;  1Z5C A;  4LFA I;  1I94 E;  2PO0 A;  2X36 A;  4JV5 E;  1A6F A;  2VQE E;  1YHC A;  4IZJ B;  4FW5 A;  2VES A;  2ZM6 I;  1FJG E;  1Z0B A;  4OX9 I;  1PKP A;  2O1T A;  3V5R A;  1XMQ E;  4IZK B;  4NXM I;  3B78 A;  4B3M E;  1KIJ A;  1B62 A;  4AIM A;  2BA0 D;  4MYT A;  2BM0 A;  4HXZ A;  1OYS A;  3UHM A;  4AQY I;  1Z0T A;  2BR2 B;  4JI3 I;  2JE6 A;  1RHY A;  4UT4 A;  3PRY A;  3CWV A;  2Z5B B;  5DNL A;  2ZM6 E;  1HNW I;  4BA1 A;  1RR9 A;  2VQF I;  1Z5A A;  1S4E A;  2Z5E A;  2UU9 I;  3J7A M;  3CDJ A;  4DV7 I;  4NXM E;  1ZXM A;  3J81 Q;  4FW4 A;  1PIE A;  1Z0C A;  1ZXN A;  5GMD A;  4AQY E;  4FW7 A;  1XHK A;  2UUC I;  5A2Q Q;  1HNW E;  2HFS A;  1ZM2 A;  2V34 A;  5K36 D;  3PYG A;  5K36 F;  4X65 E;  4DV7 E;  4HY1 A;  4IFD D;  3JAM Q;  1R6M A;  1DAR A;  1N34 E;  1J5E I;  4IFD F;  4NXN I;  3CDI A;  1EI1 A;  2BA1 G;  1N36 E;  4WUD A;  3ZKB A;  4DV4 I;  4MQY A;  4RPF A;  2UUC E;  1N33 E;  2JEA B;  1XXE A;  3HUL A;  1FWK A;  4ISA A;  1H73 A;  3ZZU A;  2E5L E;  4IZJ A;  1Z0V A;  3D4J A;  5DRR A;  4NXN E;  1Z0W A;  5FLX C;  2R3V A;  3F0N A;  2A2D A;  2BR2 A;  1OYR A;  3B8H A;  4FWD A;  5IT9 Q;  1Y4U A;  2IOQ A;  3P3E A;  1UDN A;  5LL6 R;  2Z5B A;  3WU5 A;  1XNQ I;  4GQU A;  4DR6 I;  1H74 A;  4B3R I;  1KKH A;  5C0X B;  2HHH I;  5JEA B;  2F1D A;  4P52 A;  2HK3 A;  5DRO A;  4PRX A;  3LPS A;  2V2Z A;  1RRE A;  3HKM A;  3V2U C;  3QT5 A;  1BKN A;  4IS9 A;  3PYD A;  4EMD A;  2OI2 A;  3PYF A;  5C0X C;  1XNQ E;  4OO1 B;  4DR6 E;  4B3R E;  1MG7 A;  2PO1 B;  4GKK I;  1Y6Z A;  5LMU I;  3T1H I;  4AID A;  1MX0 A;  1XMO E;  4DR5 I;  3QT7 A;  5DRP A;  4JI0 E;  2NN6 B;  2WP8 B;  3P76 A;  4JI1 I;  1ELO A;  1S16 A;  2E1R A;  1HK7 A;  3LNU A;  2JEA A;  4GKK E;  2ZIT A;  4K0K E;  3J81 C;  4QNK A;  4ZVI A;  2IES A;  2ZBK B;  4DV5 I;  3Q6N A;  4JG4 A;  4DR5 E;  1IBL E;  4DPY A;  1Y60 A;  2NN6 C;  3WU4 A;  5A2Q C;  2UXB I;  4DR1 I;  4FW9 A;  3U1Y A;  2CGE A;  1Z0E A;  2BV3 A;  2C37 A;  4B3T I;  4FW3 A;  4HAC B;  3JAM C;  3B82 A;  4YY3 E;  3LTO A;  4LF6 I;  4LFA E;  2PNL A;  2PO2 B;  4LPF A;  5C0X A;  5JEA A;  3M85 G;  3U1K A;  3P06 A;  4LF5 I;  4MU3 A;  4LFB I;  4OX9 E;  1B63 A;  1NHJ A;  1E3P A;  2JEB B;  4DUY I;  3PS2 A;  4DR7 I;  4B3T E;  5C0X E;  5JEA E;  1KVK A;  3DD6 A;  1R6L A;  4OO1 A;  4LF6 E;  2GQ0 A;  5C0X F;  2PO1 A;  2R42 A;  4JI3 E;  3P3G A;  1USU A;  2HFU A;  4LF9 I;  2WNR B;  4DR2 I;  4LF5 E;  2VQF E;  3OTO I;  1FKA E;  2X7I A;  4LFB E;  3PS1 A;  4OO1 E;  2Z5C B;  5IT9 C;  3M85 D;  1KTV A;  1IBK I;  4DR7 E;  2UU9 E;  4KHP I;  4Z7C A;  2NN6 A;  4DV6 I;  2WP8 A;  1VIS A;  2O1V A;  3P3C A;  1UDO A;  5DRQ A;  4WUC A;  4DR2 E;  2NN6 E;  2Q2E B;  3OTO E;  1N0U A;  3T1Y I;  2XEX A;  1IBK E;  3L7Z B;  3GLL A;  4USM A;  4DPX A;  2NN6 F;  4N3O A;  4DV6 E;  1J5E E;  2J7K A;  4IZK A;  1U2R A;  4MU4 A;  4HAC A;  4DV4 E;  4GKJ I;  3M7N G;  2BA1 D;  4LFC I;  3T1Y E;  4URL A;  4IZJ D;  1Z5B A;  3H4L A;  1FI4 A;  3GCM A;  2LJP A;  1VI7 A;  3K17 A;  2HKJ A;  4LF8 I;  1N0V C;  1IBM I;  4GKJ E;  1HR0 I;  4I3H A;  4M1K A;  3NZK A;  3B4T A;  3M7N D;  1XNR I;  2EFG A;  4OKG A;  2WNR A;  5JEA C;  2HK2 A;  2Z5C A;  4LCH A;  2HHH E;  4LF8 E;  1Y5Y A;  1IBM E;  3GON A;  4Z7Y A;  3ZZT A;  4BA2 B;  4OO1 C;  3J80 Q;  4OZE A;  4LOM A;  1XNR E;  1E3H A;  3M6A A;  5K36 B;  3KRN A;  2UXD I;  1NZ0 A;  2A2C A;  5LMU E;  3L7Z A;  4X64 I;  5IWA I;  1ZM3 A;  2V2V A;  3T1H E;  4X62 I;  4IFD B;  4DU7 A;  4DV3 I;  2C39 B;  4DXL A;  2GO4 A;  2UXC I;  2JT2 A;  4JI1 E;  3WU6 A;  5LMN I;  2C38 B;  4DR3 I;  2UXD E;  4JI6 I;  3K1J A;  1XMQ I;  4FN5 A;  1Z0G A;  4X64 E;  2O3Z A;  4DV5 E;  2V8P A;  3PS3 A;  4DV3 E;  1H7U A;  4MDT A;  2UXB E;  4FW6 A;  4DR1 E;  2UXC E;  2HKE A;  2IER A;  4UTG A;  1Y4S A;  5LMN E;  1HNX I;  4DR3 E;  4JI6 E;  4KQV A;  1UDS A;  3QT6 A;  5C0X D;  5JEA D;  2GS8 A;  1Z59 A; 
#chains in the Genus database with same CATH homology
 4LF7 I;  1N32 I;  2V2Q A;  1NHI A;  4DUZ I;  4DUY E;  1HNX E;  2DEI A;  1ZM9 A;  4DV0 I;  4DV1 I;  3PYE A;  1MU5 A;  1NHH A;  4X65 I;  4PU9 A;  4JI8 I;  3ZZ0 A;  2BM1 A;  1N34 I;  2VF3 A;  4LF7 E;  3Q1Q A;  4LF9 E;  1UEK A;  1N32 E;  4B3S I;  1N36 I;  5BR8 I;  4JI4 I;  4DUZ E;  4R1F A;  1N33 I;  4KHP E;  3J7A G;  4DV0 E;  4DV1 E;  4ED4 A;  4JI8 E;  2E5L I;  1H72 C;  2IOP A;  4JI7 I;  4B3S E;  5BR8 E;  2UUA I;  4JI4 E;  3J80 C;  1PVG A;  3WU3 A;  1FWL A;  1D6T A;  1OJ4 A;  1WUU A;  4HYM A;  2F4V I;  4JI2 I;  2O1W A;  2CZ9 A;  4DPT A;  4PRV A;  4JI7 E;  1H7S A;  4LFC E;  4DPW A;  2UUA E;  4P7A A;  1USV A;  4USK A;  2CG9 A;  4X66 I;  1FNM A;  1HNZ I;  1ZM4 A;  4WUB A;  3K85 A;  3ZKD A;  2F4V E;  4JI2 E;  4DV2 I;  1EA6 A;  1HR0 E;  1XMO I;  4LF4 I;  4YHH I;  3ZM7 A;  4JYA I;  2NPF A;  2O1U A;  5L3J A;  4X66 E;  4JI0 I;  4JI5 I;  2WW4 A;  1HNZ E;  4FWG A;  4DU8 A;  4DR4 I;  5GME A;  2UUB I;  4DV2 E;  3HJC A;  4K0K I;  4LF4 E;  5FLX Q;  4YHH E;  1IBL I;  1I94 I;  4FWH A;  4JYA E;  4JV5 I;  2PNM A;  2VQE I;  5FWK A;  4JI5 E;  1QZR A;  1FJG I;  3Q6M A;  1K47 A;  4DR4 E;  4XTJ A;  3QT8 A;  2DEJ A;  4MYU A;  5IWA E;  4X62 E;  2UUB E;  4DPU A;  2AJ4 A;  4B3M I;  4YY3 I;  1Z5C A;  4LFA I;  1I94 E;  2X36 A;  4JV5 E;  1A6F A;  2VQE E;  4IZJ B;  2ZM6 I;  1FJG E;  1Z0B A;  4OX9 I;  1PKP A;  2O1T A;  3V5R A;  1XMQ E;  4IZK B;  4NXM I;  3B78 A;  4B3M E;  1KIJ A;  1B62 A;  4MYT A;  2BM0 A;  4HXZ A;  4AQY I;  1Z0T A;  4JI3 I;  4UT4 A;  3PRY A;  3CWV A;  2Z5B B;  1HNW I;  2ZM6 E;  1RR9 A;  2VQF I;  1Z5A A;  1S4E A;  2Z5E A;  2UU9 I;  3J7A M;  4DV7 I;  4NXM E;  1ZXM A;  3J81 Q;  1PIE A;  1Z0C A;  1ZXN A;  5GMD A;  4AQY E;  1XHK A;  2UUC I;  5A2Q Q;  1HNW E;  2HFS A;  1ZM2 A;  2V34 A;  3PYG A;  4X65 E;  4DV7 E;  4HY1 A;  3JAM Q;  1DAR A;  1N34 E;  1J5E I;  4NXN I;  1EI1 A;  1N36 E;  4WUD A;  3ZKB A;  4DV4 I;  2UUC E;  4RPF A;  1N33 E;  3HUL A;  1FWK A;  1H73 A;  3ZZU A;  2E5L E;  4IZJ A;  1Z0V A;  3D4J A;  4NXN E;  1Z0W A;  5FLX C;  2R3V A;  3F0N A;  2A2D A;  3B8H A;  4FWD A;  5IT9 Q;  1Y4U A;  2IOQ A;  5LL6 R;  2Z5B A;  3WU5 A;  1XNQ I;  4DR6 I;  1H74 A;  4B3R I;  1KKH A;  2HHH I;  4P52 A;  2HK3 A;  4PRX A;  3LPS A;  2V2Z A;  1RRE A;  3V2U C;  3QT5 A;  1BKN A;  3PYD A;  4EMD A;  2OI2 A;  3PYF A;  1XNQ E;  4DR6 E;  4B3R E;  1MG7 A;  4GKK I;  1Y6Z A;  5LMU I;  3T1H I;  1MX0 A;  1XMO E;  4DR5 I;  3QT7 A;  4JI0 E;  4JI1 I;  1ELO A;  1S16 A;  2E1R A;  1HK7 A;  3LNU A;  4GKK E;  2ZIT A;  4K0K E;  3J81 C;  4ZVI A;  2ZBK B;  4DV5 I;  3Q6N A;  4JG4 A;  4DR5 E;  1IBL E;  4DPY A;  3WU4 A;  5A2Q C;  2UXB I;  4DR1 I;  4FW9 A;  2CGE A;  1Z0E A;  2BV3 A;  4B3T I;  4HAC B;  3JAM C;  3B82 A;  4YY3 E;  3LTO A;  4LF6 I;  4LFA E;  2PNL A;  3P06 A;  4LF5 I;  4LFB I;  4OX9 E;  1B63 A;  1NHJ A;  4DUY I;  4DR7 I;  4B3T E;  1KVK A;  4LF6 E;  2GQ0 A;  2R42 A;  4JI3 E;  1USU A;  2HFU A;  4LF9 I;  4DR2 I;  4LF5 E;  2VQF E;  3OTO I;  1FKA E;  2X7I A;  4LFB E;  2Z5C B;  5IT9 C;  1KTV A;  1IBK I;  4DR7 E;  2UU9 E;  4KHP I;  4Z7C A;  4DV6 I;  1VIS A;  2O1V A;  4WUC A;  4DR2 E;  2Q2E B;  3OTO E;  1N0U A;  3T1Y I;  2XEX A;  1IBK E;  4USM A;  4DPX A;  4N3O A;  4DV6 E;  1J5E E;  2J7K A;  4IZK A;  1U2R A;  4HAC A;  4DV4 E;  4GKJ I;  4LFC I;  3T1Y E;  4URL A;  4IZJ D;  1Z5B A;  3H4L A;  1FI4 A;  2LJP A;  3K17 A;  2HKJ A;  4LF8 I;  1N0V C;  1IBM I;  4GKJ E;  1HR0 I;  4I3H A;  4M1K A;  1XNR I;  2EFG A;  2HK2 A;  2Z5C A;  2HHH E;  4LF8 E;  1IBM E;  3GON A;  4Z7Y A;  3ZZT A;  3J80 Q;  1XNR E;  3M6A A;  2UXD I;  1NZ0 A;  2A2C A;  5LMU E;  4X64 I;  5IWA I;  1ZM3 A;  2V2V A;  3T1H E;  4X62 I;  4DU7 A;  4DV3 I;  4DXL A;  2UXC I;  4JI1 E;  3WU6 A;  5LMN I;  4DR3 I;  2UXD E;  4JI6 I;  3K1J A;  1XMQ I;  4FN5 A;  1Z0G A;  4X64 E;  4DV5 E;  2V8P A;  4DV3 E;  1H7U A;  2UXB E;  4DR1 E;  2UXC E;  2HKE A;  4UTG A;  1Y4S A;  5LMN E;  1HNX I;  4DR3 E;  4JI6 E;  4KQV A;  3QT6 A;  2GS8 A;  1Z59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...