3Q1QA

Structure of a bacterial ribonuclease p holoenzyme in complex with trna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
112
structure length
112
Chain Sequence
b'TRRERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGLDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNase P RNA
publication title Structure of a Bacterial Ribonuclease P Holoenzyme in Complex with tRNA.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/rna
total genus 32
structure length 112
sequence length 112
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3q1qA00
4YY3E 3B82A 4OX9I 4JI5I 1ZM3A 4JI6I 1XMQI 3JAMQ 1NHJA 2ZITA 2HFUA 2UXBE 4YHHI 4DR5I 1N36I 3ZKDA 2BM1A 4LF9I 2UXCI 4AQYE 2NPFA 1Z5AA 4LF4I 3OTOI 4HACA 2R3VA 5L3JA 3QT5A 4JI3E 4JI8E 4DR2I 1ZM9A 2DEJA 4ZVIA 4USMA 2WW4A 1FI4A 4M1KA 1VISA 4JI2I 3HULA 2E5LI 4DPWA 4DV1I 2Q2EB 3V5RA 1XMOI 4EMDA 2V8PA 2UUBI 5LMNI 1HNWI 4B3TE 1PIEA 3D4JA 1Z5CA 4FWDA 4LFBE 3B8HA 2UXDE 2A2DA 4LF5I 4LF8E 5BR8E 3T1HI 3ZKBA 3B78A 4MYTA 1MU5A 2LJPA 2HKJA 2V2QA 4I3HA 3F0NA 3CWVA 4GKJI 3ZZUA 4B3RI 2OI2A 4NXNE 4PRVA 2UUCE 1MG7A 1J5EE 4DV5E 1Z0GA 4LF8I 1HNXI 1IBKE 4HACB 2HK3A 4OX9E 4JI5E 4KHPI 2VQEE 1N32I 4JI6E 1XMQE 4X66E 3K1JA 1Z5BA 1Z0WA 4Z7CA 4YHHE 4DR5E 1N36E 5LMUI 4LF9E 3ZZ0A 2UXCE 2V2ZA 1D6TA 4LF4E 3OTOE 3PYGA 1J5EI 1IBKI 5GMEA 4DR2E 2VQEI 3M6AA 4DV2I 1FKAE 4WUCA 3LNUA 4X66I 4DU7A 5A2QQ 1Z0EA 4DR6I 4DR1I 4LF7I 2E1RA 2V34A 4X65I 4JI2E 2E5LE 4DV1E 4URLA 3QT8A 1FWLA 1XMOE 1NZ0A 2VQFI 2HK2A 1H7UA 2UUBE 5LMNE 1XNQE 1WUUA 1HR0I 1HNWE 3QT7A 1B63A 4P7AA 3LTOA 3QT6A 4DV0I 4LF5E 1PVGA 1PKPA 4UTGA 4B3SE 1KTVA 3T1HE 1HNZE 2HFSA 3H4LA 1N33I 4NXMI 3WU3A 4LFCI 4K0KI 1XNQI 4X64I 5FLXC 1XHKA 4DPTA 4GKJE 4B3RE 3ZM7A 1FNMA 4DR7I 1HNXE 4B3SI 4KHPE 5IT9C 2ZM6I 1N34E 1HNZI 1RR9A 1N32E 4FWHA 2J7KA 4DR4I 4PU9A 2BV3A 3PYEA 4DR3I 1H74A 4DPXA 5LMUE 4RPFA 1MX0A 3K17A 1FJGI 4LFAI 1IBMI 3J81C 4HXZA 1UEKA 4JI1I 4JI7I 3GONA 2AJ4A 1N34I 4DV2E 4DV3I 4JG4A 4R1FA 1IBLI 3PYFA 2R42A 4ED4A 4DUZI 5IWAI 4DV7I 2HHHI 4DR6E 4DR1E 4LF7E 4FN5A 4X65E 4PRXA 1DARA 4P52A 4JI4I 1ZXMA 4WUDA 1B62A 2VQFE 1H7SA 4USKA 1ZM2A 1NHIA 1Z0BA 5LL6R 1N0UA 2UU9I 2A2CA 2X7IA 5FLXQ 1HR0E 3T1YE 4B3MI 4JI0I 4FW9A 4DV0E 1OJ4A 1I94I 3WU6A 4JYAI 4DUYI 4WUBA 3ZZTA 1U2RA 1EI1A 1N33E 4DPUA 2F4VE 2CZ9A 4NXME 2ZBKB 2X36A 4LFCE 4K0KE 3WU5A 1Z0CA 4X64E 4JV5I 4LF6I 3T1YI 2GS8A 2BM0A 1Z0VA 4DU8A 3J80C 4DV6I 2UUAI 4GKKI 1XNRI 4HY1A 1NHHA 3J81Q 4DV4I 4DR7E 2XEXA 2ZM6E 1QZRA 4X62I 3WU4A 4YY3I 4UT4A 2F4VI 4DXLA 4DR4E 4DR3E 1ZXNA 1EA6A 2UXBI 1FJGE 1ZM4A 4LFAE 1IBME 2EFGA 1S4EA 4AQYI 1KIJA 4JI1E 4JI7E 1ELOA 4DV3E 4JI3I 4JI8I 1K47A 1IBLE 4DUZE 5IWAE 4DV7E 2HHHE 5A2QC 3JAMC 2HKEA 1BKNA 4JI4E 3J7AM 3Q1QA 1Z59A 1N0VC 1FWKA 3J7AG 1S16A 4KQVA 2VF3A 2UU9E 4MYUA 1KKHA 3V2UC 3J80Q 4FWGA 4B3ME 4JI0E 4B3TI 1I94E 4LFBI 3LPSA 2UXDI 4JYAE 4DUYE 5BR8I 1H73A 2DEIA 4XTJA 1RREA 4JV5E 4LF6E 4HYMA 5GMDA 1H72C 4DV6E 2UUAE 4GKKE 1XNRE 1KVKA 1Z0TA 4NXNI 4DV4E 2UUCI 3PYDA 4Z7YA 4DPYA 4DV5I 5IT9Q 4X62E 1A6FA 2V2VA
chains in the Genus database with same CATH superfamily
4U3DA 3B82A 4YY3E 4OX9I 1RHYA 4JI5I 1ZM3A 2C39B 4IFDE 4JI6I 2CGEA 5JEAD 1XMQI 3PRYA 4BA1B 3JAMQ 1NHJA 2ZITA 2HFUA 4AIDA 2UXBE 4YHHI 4QNKA 4DR5I 2PO1A 1N36I 4IFDA 3ZKDA 4AM3A 2BM1A 4FW5A 2PNZA 2JE6A 4LF9I 2UXCI 4AQYE 2NPFA 1Z5AA 2NN6E 4LF4I 3OTOI 4HACA 2R3VA 5L3JA 3K85A 3QT5A 4JI3E 4JI8E 4DR2I 3NZKA 1ZM9A 3L7ZA 3M85G 2DEJA 4ZVIA 4USMA 2WW4A 1FI4A 4M1KA 2NN6F 1VISA 4JI2I 3HULA 2E5LI 4DPWA 2JEBA 4DV1I 2O3ZA 2Q2EB 2IESA 5C0XE 3V5RA 3GMEA 1XMOI 2PO2B 4EMDA 5FWKA 2V8PA 1YHCA 4IFDD 4MQYA 2UUBI 5LMNI 3GCMA 2CVEA 5C0XA 1R6LA 1HNWI 4B3TE 4N3OA 5C0XF 1PIEA 3D4JA 1Z5CA 4FWDA 2O1WA 4LFBE 1E3PA 3B8HA 2UXDE 2A2DA 4LF5I 4LF8E 5BR8E 3M85D 2WNRB 3T1HI 4OZEA 2BR2A 3ZKBA 3B78A 4MYTA 1MU5A 2LJPA 2HKJA 2V2QA 5JEAE 5DRPA 4I3HA 4ISAA 3F0NA 5DROA 3CWVA 3M7NG 4GKJI 2IOQA 2PO1B 3ZZUA 4IFDB 4B3RI 2OI2A 4NXNE 4PRVA 4FW6A 2PNZB 2JE6B 2UUCE 5JEAA 1MG7A 1J5EE 1Y60A 4DV5E 1Z0GA 1OYPA 4LF8I 5JEAF 4OO1C 4HACB 2HK3A 1IBKE 1HNXI 4OX9E 4JI5E 4KHPI 4LPFA 2VQEE 1N32I 4JI6E 1XMQE 4X66E 3K1JA 3L7ZB 5DNLA 1Z5BA 1Z0WA 4Z7CA 4YHHE 4DR5E 1N36E 5LMUI 2Z5EA 2O1UA 2O1TA 4LF9E 3ZZ0A 2UXCE 2JEBB 2V2ZA 1D6TA 4LF4E 3OTOE 3PYGA 1J5EI 4MU4A 1IBKI 5GMEA 4DR2E 2VQEI 3KRNA 3M6AA 4DV2I 1FKAE 4WUCA 3LNUA 4X66I 5C0XB 4DU7A 5A2QQ 1Z0EA 1P42A 4DR6I 4DR1I 4LF7I 2E1RA 2V34A 4X65I 4JI2E 2E5LE 4DV1E 2GO4A 4URLA 3QT8A 1Y4UA 4FW4A 4IFDF 2NN6C 1FWLA 3GLLA 1XMOE 1NZ0A 3Q6MA 2BR2B 2VQFI 2HK2A 1H7UA 3PS3A 2UUBE 5LMNE 1XNQE 1WUUA 1A6FA 3UHMA 1E3HA 1HR0I 1HNWE 2AE8A 3QT7A 1B63A 5DRRA 4P7AA 3LTOA 4IZKA 1UDNA 3QT6A 4DV0I 5JEAB 1PVGA 4LF5E 5C0XC 1PKPA 5K36D 3P06A 4UTGA 4B3SE 2PO0A 1KTVA 3T1HE 1VI7A 1HNZE 2HFSA 3H4LA 1N33I 4J3DA 3DD6A 4NXMI 3WU3A 4LFCI 4K0KI 4MDTA 1XNQI 4X64I 4GQUA 4MU3A 3U1KA 5FLXC 1XHKA 4DPTA 4GKJE 4B3RE 3ZM7A 4FW7A 1FNMA 3PS2A 5DNXA 4NBQA 4DR7I 1HNXE 1Y5YA 4B3SI 4KHPE 5IT9C 2ZM6I 1N34E 1HNZI 1RR9A 1N32E 5ELWA 4FWHA 5JEAC 2J7KA 2BA1G 4DR4I 4PU9A 2Z5BA 2BV3A 3PYEA 4DR3I 4QNJA 1H74A 4DPXA 5LMUE 4RPFA 1MX0A 3K17A 1FJGI 4LFAI 4OKGA 1UDOA 1IBMI 3PS1A 3J81C 4HXZA 1USUA 4LCFA 1UEKA 4JI1I 4JI7I 3GONA 2IOPA 2AJ4A 3CDJA 1N34I 4DV2E 4DV3I 4JG4A 4R1FA 1IBLI 3PYFA 2R42A 4ED4A 2Z5CA 4DUZI 5IWAI 4DV7I 2C37A 2HHHI 4DR1E 4DR6E 4LF7E 4FN5A 4X65E 2GQ0A 4IZKB 2GO3A 1DARA 4PRXA 4P52A 4JI4I 1ZXMA 4WUDA 4LCGA 5K36E 2PO0B 1B62A 1R6MA 2VQFE 1Y6ZA 1H7SA 4MU0A 4USKA 1ZM2A 4IFDC 1NHIA 1Z0BA 5LL6R 1N0UA 2UU9I 3M7ND 3Q6NA 2A2CA 2X7IA 5FLXQ 1HR0E 3T1YE 4IS9A 3P3EA 2F1DA 5K36A 4B3MI 4OO1A 4JI0I 5K36F 4FW9A 4DV0E 1OJ4A 1I94I 3WU6A 4BA2A 3H1CA 4JYAI 4DUYI 4WUBA 3ZZTA 1U2RA 1EI1A 3P3GA 1N33E 4DPUA 2F4VE 2CZ9A 4NXME 2CG9A 2ZBKB 2X36A 4LFCE 4K0KE 3WU5A 1Z0CA 4X64E 2Z5BB 4JV5I 4LF6I 3T1YI 2GS8A 2BM0A 1Z0VA 4DU8A 3J80C 4DV6I 2UUAI 4GKKI 1XNRI 4HY1A 1NHHA 3J81Q 2WP8A 3HJCA 4DV4I 4DR7E 2XEXA 1QZRA 2ZM6E 4X62I 4OO1D 3WU4A 4YY3I 4LCHA 4UT4A 2F4VI 4DXLA 3P3CA 4DR4E 1OYSA 2PNLA 2C38A 2BA0G 2Z5CB 2NN6A 4DR3E 1OYRA 2C37B 1ZXNA 1EA6A 2UXBI 5EKWA 1FJGE 2JEAA 1ZM4A 4LFAE 4IZJA 1IBME 2EFGA 1S4EA 4AQYI 1KIJA 4JI1E 4JI7E 3HKMA 2J65A 3U1YA 1ELOA 2C39A 4DV3E 4JI3I 4JI8I 1K47A 1IBLE 5EL9A 1UDQA 4LOMA 5K36B 4BA1A 4DUZE 5IWAE 4DV7E 2HHHE 4OO1B 1HK7A 5A2QC 3JAMC 2HKEA 1BKNA 4JI4E 3J7AM 4BA2B 3Q1QA 3B4TA 1Z59A 1Y4SA 2NN6D 4MU1A 1N0VC 1FWKA 3J7AG 2BA0D 1S16A 4KQVA 2VF3A 2UU9E 5DRQA 4MYUA 4IZJD 1KKHA 3V2UC 3J80Q 4FWGA 2JT2A 4B3ME 4JI0E 3P76A 4AIMA 2IERA 4B3TI 2PNMA 1I94E 2WP8B 3CDIA 4LFBI 3LPSA 2UXDI 5K36C 4JYAE 4DUYE 5C0XD 5BR8I 2BA1D 1H73A 4OO1E 2PO2A 1USVA 1YH8A 2DEIA 4XTJA 1RREA 2C38B 4JV5E 2VESA 2NN6B 4LF6E 4HYMA 5GMDA 1H72C 4U3BA 4DV6E 4FW3A 2O1VA 2UUAE 4GKKE 1XNRE 1XXEA 1KVKA 2JEAB 1Z0TA 4OO1F 4NXNI 4DV4E 4IZJB 1UDSA 2UUCI 3PYDA 4Z7YA 4DPYA 4DV5I 5IT9Q 4X62E 2WNRA 2V2VA
chains in the Genus database with same CATH topology
4YY3E 3B82A 4OX9I 4JI5I 1ZM3A 4JI6I 2CGEA 1XMQI 3PRYA 3JAMQ 1NHJA 2ZITA 2HFUA 2UXBE 4YHHI 4DR5I 1N36I 3ZKDA 2BM1A 4LF9I 2UXCI 4AQYE 2NPFA 1Z5AA 4LF4I 3OTOI 4HACA 2R3VA 5L3JA 3K85A 3QT5A 4JI3E 4JI8E 4DR2I 1ZM9A 2DEJA 4ZVIA 4USMA 2WW4A 1FI4A 4M1KA 1VISA 4JI2I 3HULA 2E5LI 4DPWA 4DV1I 2Q2EB 3V5RA 1XMOI 4EMDA 5FWKA 2V8PA 2UUBI 5LMNI 1HNWI 4B3TE 4N3OA 1PIEA 3D4JA 1Z5CA 4FWDA 2O1WA 4LFBE 3B8HA 2UXDE 2A2DA 4LF5I 4LF8E 5BR8E 3T1HI 3ZKBA 3B78A 4MYTA 1MU5A 2LJPA 2HKJA 2V2QA 4I3HA 3F0NA 3CWVA 4GKJI 2IOQA 3ZZUA 4B3RI 2OI2A 4NXNE 4PRVA 2UUCE 1MG7A 1J5EE 4DV5E 1Z0GA 4LF8I 4HACB 2HK3A 1IBKE 1HNXI 4OX9E 4JI5E 4KHPI 2VQEE 1N32I 4JI6E 1XMQE 4X66E 3K1JA 1Z5BA 1Z0WA 4Z7CA 4YHHE 4DR5E 1N36E 5LMUI 2Z5EA 2O1UA 2O1TA 4LF9E 3ZZ0A 2UXCE 2V2ZA 1D6TA 4LF4E 3OTOE 3PYGA 1J5EI 1IBKI 5GMEA 4DR2E 2VQEI 3M6AA 4DV2I 1FKAE 4WUCA 3LNUA 4X66I 4DU7A 5A2QQ 1Z0EA 4DR6I 4DR1I 4LF7I 2E1RA 2V34A 4X65I 4JI2E 2E5LE 4DV1E 4URLA 3QT8A 1Y4UA 1FWLA 1XMOE 1NZ0A 3Q6MA 2VQFI 2HK2A 1H7UA 2UUBE 5LMNE 1XNQE 1WUUA 1HR0I 1HNWE 3QT7A 1B63A 4P7AA 3LTOA 4IZKA 3QT6A 4DV0I 4LF5E 1PVGA 1PKPA 3P06A 4UTGA 4B3SE 1KTVA 3T1HE 1HNZE 2HFSA 3H4LA 1N33I 4NXMI 3WU3A 4LFCI 4K0KI 1XNQI 4X64I 5FLXC 1XHKA 4DPTA 4GKJE 4B3RE 3ZM7A 1FNMA 4DR7I 1HNXE 4B3SI 4KHPE 5IT9C 2ZM6I 1N34E 1HNZI 1RR9A 1N32E 4FWHA 2J7KA 4DR4I 4PU9A 2Z5BA 2BV3A 3PYEA 4DR3I 1H74A 4DPXA 5LMUE 4RPFA 1MX0A 3K17A 1FJGI 4LFAI 1IBMI 3J81C 4HXZA 1USUA 1UEKA 4JI1I 4JI7I 3GONA 2IOPA 2AJ4A 1N34I 4DV2E 4DV3I 4JG4A 4R1FA 1IBLI 3PYFA 2R42A 4ED4A 2Z5CA 4DUZI 5IWAI 4DV7I 2HHHI 4DR6E 4DR1E 4LF7E 4FN5A 4X65E 2GQ0A 4IZKB 4PRXA 1DARA 4P52A 4JI4I 1ZXMA 4WUDA 1B62A 2VQFE 1Y6ZA 1H7SA 4USKA 1ZM2A 1NHIA 1Z0BA 5LL6R 1N0UA 2UU9I 3Q6NA 2A2CA 2X7IA 5FLXQ 1HR0E 3T1YE 4B3MI 4JI0I 4FW9A 4DV0E 1OJ4A 1I94I 3WU6A 4JYAI 4DUYI 4WUBA 3ZZTA 1U2RA 1EI1A 1N33E 4DPUA 2F4VE 2CZ9A 4NXME 2CG9A 2ZBKB 2X36A 4LFCE 4K0KE 3WU5A 1Z0CA 4X64E 2Z5BB 4JV5I 4LF6I 3T1YI 2GS8A 2BM0A 1Z0VA 4DU8A 3J80C 4DV6I 2UUAI 4GKKI 1XNRI 4HY1A 1NHHA 3J81Q 3HJCA 4DV4I 4DR7E 2XEXA 2ZM6E 1QZRA 4X62I 3WU4A 4YY3I 4UT4A 2F4VI 4DXLA 4DR4E 2PNLA 2Z5CB 4DR3E 1ZXNA 1EA6A 2UXBI 1FJGE 1ZM4A 4LFAE 4IZJA 1IBME 2EFGA 1S4EA 4AQYI 1KIJA 4JI1E 4JI7E 1ELOA 4DV3E 4JI3I 4JI8I 1K47A 1IBLE 4DUZE 5IWAE 4DV7E 2HHHE 1HK7A 5A2QC 3JAMC 2HKEA 1BKNA 4JI4E 3J7AM 3Q1QA 1Z59A 1Y4SA 1N0VC 1FWKA 3J7AG 1S16A 4KQVA 2VF3A 2UU9E 4MYUA 4IZJD 1KKHA 3V2UC 3J80Q 4FWGA 4B3ME 4JI0E 4B3TI 2PNMA 1I94E 4LFBI 3LPSA 2UXDI 4JYAE 4DUYE 5BR8I 1H73A 1USVA 2DEIA 4XTJA 1RREA 4JV5E 4LF6E 4HYMA 5GMDA 1H72C 4DV6E 2O1VA 2UUAE 4GKKE 1XNRE 1KVKA 1Z0TA 4NXNI 4DV4E 4IZJB 2UUCI 3PYDA 4Z7YA 4DPYA 4DV5I 5IT9Q 4X62E 1A6FA 2V2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 E;  3B82 A;  4OX9 I;  4JI5 I;  1ZM3 A;  4JI6 I;  1XMQ I;  3JAM Q;  1NHJ A;  2ZIT A;  2HFU A;  2UXB E;  4YHH I;  4DR5 I;  1N36 I;  3ZKD A;  2BM1 A;  4LF9 I;  2UXC I;  4AQY E;  2NPF A;  1Z5A A;  4LF4 I;  3OTO I;  4HAC A;  2R3V A;  5L3J A;  3QT5 A;  4JI3 E;  4JI8 E;  4DR2 I;  1ZM9 A;  2DEJ A;  4ZVI A;  4USM A;  2WW4 A;  1FI4 A;  4M1K A;  1VIS A;  4JI2 I;  3HUL A;  2E5L I;  4DPW A;  4DV1 I;  2Q2E B;  3V5R A;  1XMO I;  4EMD A;  2V8P A;  2UUB I;  5LMN I;  1HNW I;  4B3T E;  1PIE A;  3D4J A;  1Z5C A;  4FWD A;  4LFB E;  3B8H A;  2UXD E;  2A2D A;  4LF5 I;  4LF8 E;  5BR8 E;  3T1H I;  3ZKB A;  3B78 A;  4MYT A;  1MU5 A;  2LJP A;  2HKJ A;  2V2Q A;  4I3H A;  3F0N A;  3CWV A;  4GKJ I;  3ZZU A;  4B3R I;  2OI2 A;  4NXN E;  4PRV A;  2UUC E;  1MG7 A;  1J5E E;  4DV5 E;  1Z0G A;  4LF8 I;  1HNX I;  1IBK E;  4HAC B;  2HK3 A;  4OX9 E;  4JI5 E;  4KHP I;  2VQE E;  1N32 I;  4JI6 E;  1XMQ E;  4X66 E;  3K1J A;  1Z5B A;  1Z0W A;  4Z7C A;  4YHH E;  4DR5 E;  1N36 E;  5LMU I;  4LF9 E;  3ZZ0 A;  2UXC E;  2V2Z A;  1D6T A;  4LF4 E;  3OTO E;  3PYG A;  1J5E I;  1IBK I;  5GME A;  4DR2 E;  2VQE I;  3M6A A;  4DV2 I;  1FKA E;  4WUC A;  3LNU A;  4X66 I;  4DU7 A;  5A2Q Q;  1Z0E A;  4DR6 I;  4DR1 I;  4LF7 I;  2E1R A;  2V34 A;  4X65 I;  4JI2 E;  2E5L E;  4DV1 E;  4URL A;  3QT8 A;  1FWL A;  1XMO E;  1NZ0 A;  2VQF I;  2HK2 A;  1H7U A;  2UUB E;  5LMN E;  1XNQ E;  1WUU A;  1HR0 I;  1HNW E;  3QT7 A;  1B63 A;  4P7A A;  3LTO A;  3QT6 A;  4DV0 I;  4LF5 E;  1PVG A;  1PKP A;  4UTG A;  4B3S E;  1KTV A;  3T1H E;  1HNZ E;  2HFS A;  3H4L A;  1N33 I;  4NXM I;  3WU3 A;  4LFC I;  4K0K I;  1XNQ I;  4X64 I;  5FLX C;  1XHK A;  4DPT A;  4GKJ E;  4B3R E;  3ZM7 A;  1FNM A;  4DR7 I;  1HNX E;  4B3S I;  4KHP E;  5IT9 C;  2ZM6 I;  1N34 E;  1HNZ I;  1RR9 A;  1N32 E;  4FWH A;  2J7K A;  4DR4 I;  4PU9 A;  2BV3 A;  3PYE A;  4DR3 I;  1H74 A;  4DPX A;  5LMU E;  4RPF A;  1MX0 A;  3K17 A;  1FJG I;  4LFA I;  1IBM I;  3J81 C;  4HXZ A;  1UEK A;  4JI1 I;  4JI7 I;  3GON A;  2AJ4 A;  1N34 I;  4DV2 E;  4DV3 I;  4JG4 A;  4R1F A;  1IBL I;  3PYF A;  2R42 A;  4ED4 A;  4DUZ I;  5IWA I;  4DV7 I;  2HHH I;  4DR6 E;  4DR1 E;  4LF7 E;  4FN5 A;  4X65 E;  4PRX A;  1DAR A;  4P52 A;  4JI4 I;  1ZXM A;  4WUD A;  1B62 A;  2VQF E;  1H7S A;  4USK A;  1ZM2 A;  1NHI A;  1Z0B A;  5LL6 R;  1N0U A;  2UU9 I;  2A2C A;  2X7I A;  5FLX Q;  1HR0 E;  3T1Y E;  4B3M I;  4JI0 I;  4FW9 A;  4DV0 E;  1OJ4 A;  1I94 I;  3WU6 A;  4JYA I;  4DUY I;  4WUB A;  3ZZT A;  1U2R A;  1EI1 A;  1N33 E;  4DPU A;  2F4V E;  2CZ9 A;  4NXM E;  2ZBK B;  2X36 A;  4LFC E;  4K0K E;  3WU5 A;  1Z0C A;  4X64 E;  4JV5 I;  4LF6 I;  3T1Y I;  2GS8 A;  2BM0 A;  1Z0V A;  4DU8 A;  3J80 C;  4DV6 I;  2UUA I;  4GKK I;  1XNR I;  4HY1 A;  1NHH A;  3J81 Q;  4DV4 I;  4DR7 E;  2XEX A;  2ZM6 E;  1QZR A;  4X62 I;  3WU4 A;  4YY3 I;  4UT4 A;  2F4V I;  4DXL A;  4DR4 E;  4DR3 E;  1ZXN A;  1EA6 A;  2UXB I;  1FJG E;  1ZM4 A;  4LFA E;  1IBM E;  2EFG A;  1S4E A;  4AQY I;  1KIJ A;  4JI1 E;  4JI7 E;  1ELO A;  4DV3 E;  4JI3 I;  4JI8 I;  1K47 A;  1IBL E;  4DUZ E;  5IWA E;  4DV7 E;  2HHH E;  5A2Q C;  3JAM C;  2HKE A;  1BKN A;  4JI4 E;  3J7A M;  3Q1Q A;  1Z59 A;  1N0V C;  1FWK A;  3J7A G;  1S16 A;  4KQV A;  2VF3 A;  2UU9 E;  4MYU A;  1KKH A;  3V2U C;  3J80 Q;  4FWG A;  4B3M E;  4JI0 E;  4B3T I;  1I94 E;  4LFB I;  3LPS A;  2UXD I;  4JYA E;  4DUY E;  5BR8 I;  1H73 A;  2DEI A;  4XTJ A;  1RRE A;  4JV5 E;  4LF6 E;  4HYM A;  5GMD A;  1H72 C;  4DV6 E;  2UUA E;  4GKK E;  1XNR E;  1KVK A;  1Z0T A;  4NXN I;  4DV4 E;  2UUC I;  3PYD A;  4Z7Y A;  4DPY A;  4DV5 I;  5IT9 Q;  4X62 E;  1A6F A;  2V2V A; 
#chains in the Genus database with same CATH topology
 4U3D A;  3B82 A;  4YY3 E;  4OX9 I;  1RHY A;  4JI5 I;  1ZM3 A;  2C39 B;  4IFD E;  4JI6 I;  2CGE A;  5JEA D;  1XMQ I;  3PRY A;  4BA1 B;  3JAM Q;  1NHJ A;  2ZIT A;  2HFU A;  4AID A;  2UXB E;  4YHH I;  4QNK A;  4DR5 I;  2PO1 A;  1N36 I;  4IFD A;  3ZKD A;  4AM3 A;  2BM1 A;  4FW5 A;  2PNZ A;  2JE6 A;  4LF9 I;  2UXC I;  4AQY E;  2NPF A;  1Z5A A;  2NN6 E;  4LF4 I;  3OTO I;  4HAC A;  2R3V A;  5L3J A;  3K85 A;  3QT5 A;  4JI3 E;  4JI8 E;  4DR2 I;  3NZK A;  1ZM9 A;  3L7Z A;  3M85 G;  2DEJ A;  4ZVI A;  4USM A;  2WW4 A;  1FI4 A;  4M1K A;  2NN6 F;  1VIS A;  4JI2 I;  3HUL A;  2E5L I;  4DPW A;  2JEB A;  4DV1 I;  2O3Z A;  2Q2E B;  2IES A;  5C0X E;  3V5R A;  3GME A;  1XMO I;  2PO2 B;  4EMD A;  5FWK A;  2V8P A;  1YHC A;  4IFD D;  4MQY A;  2UUB I;  5LMN I;  3GCM A;  2CVE A;  5C0X A;  1R6L A;  1HNW I;  4B3T E;  4N3O A;  5C0X F;  1PIE A;  3D4J A;  1Z5C A;  4FWD A;  2O1W A;  4LFB E;  1E3P A;  3B8H A;  2UXD E;  2A2D A;  4LF5 I;  4LF8 E;  5BR8 E;  3M85 D;  2WNR B;  3T1H I;  4OZE A;  2BR2 A;  3ZKB A;  3B78 A;  4MYT A;  1MU5 A;  2LJP A;  2HKJ A;  2V2Q A;  5JEA E;  5DRP A;  4I3H A;  4ISA A;  3F0N A;  5DRO A;  3CWV A;  3M7N G;  4GKJ I;  2IOQ A;  2PO1 B;  3ZZU A;  4IFD B;  4B3R I;  2OI2 A;  4NXN E;  4PRV A;  4FW6 A;  2PNZ B;  2JE6 B;  2UUC E;  5JEA A;  1MG7 A;  1J5E E;  1Y60 A;  4DV5 E;  1Z0G A;  1OYP A;  4LF8 I;  5JEA F;  4OO1 C;  4HAC B;  2HK3 A;  1IBK E;  1HNX I;  4OX9 E;  4JI5 E;  4KHP I;  4LPF A;  2VQE E;  1N32 I;  4JI6 E;  1XMQ E;  4X66 E;  3K1J A;  3L7Z B;  5DNL A;  1Z5B A;  1Z0W A;  4Z7C A;  4YHH E;  4DR5 E;  1N36 E;  5LMU I;  2Z5E A;  2O1U A;  2O1T A;  4LF9 E;  3ZZ0 A;  2UXC E;  2JEB B;  2V2Z A;  1D6T A;  4LF4 E;  3OTO E;  3PYG A;  1J5E I;  4MU4 A;  1IBK I;  5GME A;  4DR2 E;  2VQE I;  3KRN A;  3M6A A;  4DV2 I;  1FKA E;  4WUC A;  3LNU A;  4X66 I;  5C0X B;  4DU7 A;  5A2Q Q;  1Z0E A;  1P42 A;  4DR6 I;  4DR1 I;  4LF7 I;  2E1R A;  2V34 A;  4X65 I;  4JI2 E;  2E5L E;  4DV1 E;  2GO4 A;  4URL A;  3QT8 A;  1Y4U A;  4FW4 A;  4IFD F;  2NN6 C;  1FWL A;  3GLL A;  1XMO E;  1NZ0 A;  3Q6M A;  2BR2 B;  2VQF I;  2HK2 A;  1H7U A;  3PS3 A;  2UUB E;  5LMN E;  1XNQ E;  1WUU A;  1A6F A;  3UHM A;  1E3H A;  1HR0 I;  1HNW E;  2AE8 A;  3QT7 A;  1B63 A;  5DRR A;  4P7A A;  3LTO A;  4IZK A;  1UDN A;  3QT6 A;  4DV0 I;  5JEA B;  1PVG A;  4LF5 E;  5C0X C;  1PKP A;  5K36 D;  3P06 A;  4UTG A;  4B3S E;  2PO0 A;  1KTV A;  3T1H E;  1VI7 A;  1HNZ E;  2HFS A;  3H4L A;  1N33 I;  4J3D A;  3DD6 A;  4NXM I;  3WU3 A;  4LFC I;  4K0K I;  4MDT A;  1XNQ I;  4X64 I;  4GQU A;  4MU3 A;  3U1K A;  5FLX C;  1XHK A;  4DPT A;  4GKJ E;  4B3R E;  3ZM7 A;  4FW7 A;  1FNM A;  3PS2 A;  5DNX A;  4NBQ A;  4DR7 I;  1HNX E;  1Y5Y A;  4B3S I;  4KHP E;  5IT9 C;  2ZM6 I;  1N34 E;  1HNZ I;  1RR9 A;  1N32 E;  5ELW A;  4FWH A;  5JEA C;  2J7K A;  2BA1 G;  4DR4 I;  4PU9 A;  2Z5B A;  2BV3 A;  3PYE A;  4DR3 I;  4QNJ A;  1H74 A;  4DPX A;  5LMU E;  4RPF A;  1MX0 A;  3K17 A;  1FJG I;  4LFA I;  4OKG A;  1UDO A;  1IBM I;  3PS1 A;  3J81 C;  4HXZ A;  1USU A;  4LCF A;  1UEK A;  4JI1 I;  4JI7 I;  3GON A;  2IOP A;  2AJ4 A;  3CDJ A;  1N34 I;  4DV2 E;  4DV3 I;  4JG4 A;  4R1F A;  1IBL I;  3PYF A;  2R42 A;  4ED4 A;  2Z5C A;  4DUZ I;  5IWA I;  4DV7 I;  2C37 A;  2HHH I;  4DR1 E;  4DR6 E;  4LF7 E;  4FN5 A;  4X65 E;  2GQ0 A;  4IZK B;  2GO3 A;  1DAR A;  4PRX A;  4P52 A;  4JI4 I;  1ZXM A;  4WUD A;  4LCG A;  5K36 E;  2PO0 B;  1B62 A;  1R6M A;  2VQF E;  1Y6Z A;  1H7S A;  4MU0 A;  4USK A;  1ZM2 A;  4IFD C;  1NHI A;  1Z0B A;  5LL6 R;  1N0U A;  2UU9 I;  3M7N D;  3Q6N A;  2A2C A;  2X7I A;  5FLX Q;  1HR0 E;  3T1Y E;  4IS9 A;  3P3E A;  2F1D A;  5K36 A;  4B3M I;  4OO1 A;  4JI0 I;  5K36 F;  4FW9 A;  4DV0 E;  1OJ4 A;  1I94 I;  3WU6 A;  4BA2 A;  3H1C A;  4JYA I;  4DUY I;  4WUB A;  3ZZT A;  1U2R A;  1EI1 A;  3P3G A;  1N33 E;  4DPU A;  2F4V E;  2CZ9 A;  4NXM E;  2CG9 A;  2ZBK B;  2X36 A;  4LFC E;  4K0K E;  3WU5 A;  1Z0C A;  4X64 E;  2Z5B B;  4JV5 I;  4LF6 I;  3T1Y I;  2GS8 A;  2BM0 A;  1Z0V A;  4DU8 A;  3J80 C;  4DV6 I;  2UUA I;  4GKK I;  1XNR I;  4HY1 A;  1NHH A;  3J81 Q;  2WP8 A;  3HJC A;  4DV4 I;  4DR7 E;  2XEX A;  1QZR A;  2ZM6 E;  4X62 I;  4OO1 D;  3WU4 A;  4YY3 I;  4LCH A;  4UT4 A;  2F4V I;  4DXL A;  3P3C A;  4DR4 E;  1OYS A;  2PNL A;  2C38 A;  2BA0 G;  2Z5C B;  2NN6 A;  4DR3 E;  1OYR A;  2C37 B;  1ZXN A;  1EA6 A;  2UXB I;  5EKW A;  1FJG E;  2JEA A;  1ZM4 A;  4LFA E;  4IZJ A;  1IBM E;  2EFG A;  1S4E A;  4AQY I;  1KIJ A;  4JI1 E;  4JI7 E;  3HKM A;  2J65 A;  3U1Y A;  1ELO A;  2C39 A;  4DV3 E;  4JI3 I;  4JI8 I;  1K47 A;  1IBL E;  5EL9 A;  1UDQ A;  4LOM A;  5K36 B;  4BA1 A;  4DUZ E;  5IWA E;  4DV7 E;  2HHH E;  4OO1 B;  1HK7 A;  5A2Q C;  3JAM C;  2HKE A;  1BKN A;  4JI4 E;  3J7A M;  4BA2 B;  3Q1Q A;  3B4T A;  1Z59 A;  1Y4S A;  2NN6 D;  4MU1 A;  1N0V C;  1FWK A;  3J7A G;  2BA0 D;  1S16 A;  4KQV A;  2VF3 A;  2UU9 E;  5DRQ A;  4MYU A;  4IZJ D;  1KKH A;  3V2U C;  3J80 Q;  4FWG A;  2JT2 A;  4B3M E;  4JI0 E;  3P76 A;  4AIM A;  2IER A;  4B3T I;  2PNM A;  1I94 E;  2WP8 B;  3CDI A;  4LFB I;  3LPS A;  2UXD I;  5K36 C;  4JYA E;  4DUY E;  5C0X D;  5BR8 I;  2BA1 D;  1H73 A;  4OO1 E;  2PO2 A;  1USV A;  1YH8 A;  2DEI A;  4XTJ A;  1RRE A;  2C38 B;  4JV5 E;  2VES A;  2NN6 B;  4LF6 E;  4HYM A;  5GMD A;  1H72 C;  4U3B A;  4DV6 E;  4FW3 A;  2O1V A;  2UUA E;  4GKK E;  1XNR E;  1XXE A;  1KVK A;  2JEA B;  1Z0T A;  4OO1 F;  4NXN I;  4DV4 E;  4IZJ B;  1UDS A;  2UUC I;  3PYD A;  4Z7Y A;  4DPY A;  4DV5 I;  5IT9 Q;  4X62 E;  2WNR A;  2V2V A; 
#chains in the Genus database with same CATH homology
 4YY3 E;  3B82 A;  4OX9 I;  4JI5 I;  1ZM3 A;  4JI6 I;  2CGE A;  1XMQ I;  3PRY A;  3JAM Q;  1NHJ A;  2ZIT A;  2HFU A;  2UXB E;  4YHH I;  4DR5 I;  1N36 I;  3ZKD A;  2BM1 A;  4LF9 I;  2UXC I;  4AQY E;  2NPF A;  1Z5A A;  4LF4 I;  3OTO I;  4HAC A;  2R3V A;  5L3J A;  3K85 A;  3QT5 A;  4JI3 E;  4JI8 E;  4DR2 I;  1ZM9 A;  2DEJ A;  4ZVI A;  4USM A;  2WW4 A;  1FI4 A;  4M1K A;  1VIS A;  4JI2 I;  3HUL A;  2E5L I;  4DPW A;  4DV1 I;  2Q2E B;  3V5R A;  1XMO I;  4EMD A;  5FWK A;  2V8P A;  2UUB I;  5LMN I;  1HNW I;  4B3T E;  4N3O A;  1PIE A;  3D4J A;  1Z5C A;  4FWD A;  2O1W A;  4LFB E;  3B8H A;  2UXD E;  2A2D A;  4LF5 I;  4LF8 E;  5BR8 E;  3T1H I;  3ZKB A;  3B78 A;  4MYT A;  1MU5 A;  2LJP A;  2HKJ A;  2V2Q A;  4I3H A;  3F0N A;  3CWV A;  4GKJ I;  2IOQ A;  3ZZU A;  4B3R I;  2OI2 A;  4NXN E;  4PRV A;  2UUC E;  1MG7 A;  1J5E E;  4DV5 E;  1Z0G A;  4LF8 I;  4HAC B;  2HK3 A;  1IBK E;  1HNX I;  4OX9 E;  4JI5 E;  4KHP I;  2VQE E;  1N32 I;  4JI6 E;  1XMQ E;  4X66 E;  3K1J A;  1Z5B A;  1Z0W A;  4Z7C A;  4YHH E;  4DR5 E;  1N36 E;  5LMU I;  2Z5E A;  2O1U A;  2O1T A;  4LF9 E;  3ZZ0 A;  2UXC E;  2V2Z A;  1D6T A;  4LF4 E;  3OTO E;  3PYG A;  1J5E I;  1IBK I;  5GME A;  4DR2 E;  2VQE I;  3M6A A;  4DV2 I;  1FKA E;  4WUC A;  3LNU A;  4X66 I;  4DU7 A;  5A2Q Q;  1Z0E A;  4DR6 I;  4DR1 I;  4LF7 I;  2E1R A;  2V34 A;  4X65 I;  4JI2 E;  2E5L E;  4DV1 E;  4URL A;  3QT8 A;  1Y4U A;  1FWL A;  1XMO E;  1NZ0 A;  3Q6M A;  2VQF I;  2HK2 A;  1H7U A;  2UUB E;  5LMN E;  1XNQ E;  1WUU A;  1HR0 I;  1HNW E;  3QT7 A;  1B63 A;  4P7A A;  3LTO A;  4IZK A;  3QT6 A;  4DV0 I;  4LF5 E;  1PVG A;  1PKP A;  3P06 A;  4UTG A;  4B3S E;  1KTV A;  3T1H E;  1HNZ E;  2HFS A;  3H4L A;  1N33 I;  4NXM I;  3WU3 A;  4LFC I;  4K0K I;  1XNQ I;  4X64 I;  5FLX C;  1XHK A;  4DPT A;  4GKJ E;  4B3R E;  3ZM7 A;  1FNM A;  4DR7 I;  1HNX E;  4B3S I;  4KHP E;  5IT9 C;  2ZM6 I;  1N34 E;  1HNZ I;  1RR9 A;  1N32 E;  4FWH A;  2J7K A;  4DR4 I;  4PU9 A;  2Z5B A;  2BV3 A;  3PYE A;  4DR3 I;  1H74 A;  4DPX A;  5LMU E;  4RPF A;  1MX0 A;  3K17 A;  1FJG I;  4LFA I;  1IBM I;  3J81 C;  4HXZ A;  1USU A;  1UEK A;  4JI1 I;  4JI7 I;  3GON A;  2IOP A;  2AJ4 A;  1N34 I;  4DV2 E;  4DV3 I;  4JG4 A;  4R1F A;  1IBL I;  3PYF A;  2R42 A;  4ED4 A;  2Z5C A;  4DUZ I;  5IWA I;  4DV7 I;  2HHH I;  4DR6 E;  4DR1 E;  4LF7 E;  4FN5 A;  4X65 E;  2GQ0 A;  4IZK B;  4PRX A;  1DAR A;  4P52 A;  4JI4 I;  1ZXM A;  4WUD A;  1B62 A;  2VQF E;  1Y6Z A;  1H7S A;  4USK A;  1ZM2 A;  1NHI A;  1Z0B A;  5LL6 R;  1N0U A;  2UU9 I;  3Q6N A;  2A2C A;  2X7I A;  5FLX Q;  1HR0 E;  3T1Y E;  4B3M I;  4JI0 I;  4FW9 A;  4DV0 E;  1OJ4 A;  1I94 I;  3WU6 A;  4JYA I;  4DUY I;  4WUB A;  3ZZT A;  1U2R A;  1EI1 A;  1N33 E;  4DPU A;  2F4V E;  2CZ9 A;  4NXM E;  2CG9 A;  2ZBK B;  2X36 A;  4LFC E;  4K0K E;  3WU5 A;  1Z0C A;  4X64 E;  2Z5B B;  4JV5 I;  4LF6 I;  3T1Y I;  2GS8 A;  2BM0 A;  1Z0V A;  4DU8 A;  3J80 C;  4DV6 I;  2UUA I;  4GKK I;  1XNR I;  4HY1 A;  1NHH A;  3J81 Q;  3HJC A;  4DV4 I;  4DR7 E;  2XEX A;  2ZM6 E;  1QZR A;  4X62 I;  3WU4 A;  4YY3 I;  4UT4 A;  2F4V I;  4DXL A;  4DR4 E;  2PNL A;  2Z5C B;  4DR3 E;  1ZXN A;  1EA6 A;  2UXB I;  1FJG E;  1ZM4 A;  4LFA E;  4IZJ A;  1IBM E;  2EFG A;  1S4E A;  4AQY I;  1KIJ A;  4JI1 E;  4JI7 E;  1ELO A;  4DV3 E;  4JI3 I;  4JI8 I;  1K47 A;  1IBL E;  4DUZ E;  5IWA E;  4DV7 E;  2HHH E;  1HK7 A;  5A2Q C;  3JAM C;  2HKE A;  1BKN A;  4JI4 E;  3J7A M;  3Q1Q A;  1Z59 A;  1Y4S A;  1N0V C;  1FWK A;  3J7A G;  1S16 A;  4KQV A;  2VF3 A;  2UU9 E;  4MYU A;  4IZJ D;  1KKH A;  3V2U C;  3J80 Q;  4FWG A;  4B3M E;  4JI0 E;  4B3T I;  2PNM A;  1I94 E;  4LFB I;  3LPS A;  2UXD I;  4JYA E;  4DUY E;  5BR8 I;  1H73 A;  1USV A;  2DEI A;  4XTJ A;  1RRE A;  4JV5 E;  4LF6 E;  4HYM A;  5GMD A;  1H72 C;  4DV6 E;  2O1V A;  2UUA E;  4GKK E;  1XNR E;  1KVK A;  1Z0T A;  4NXN I;  4DV4 E;  4IZJ B;  2UUC I;  3PYD A;  4Z7Y A;  4DPY A;  4DV5 I;  5IT9 Q;  4X62 E;  1A6F A;  2V2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...