3PYGA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
GSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 83
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pygA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pygA01
4YHHE 3J81C 2E1RA 1RR9A 4M1KA 3ZM7A 4B3RE 3WU3A 4DPXA 2UUBI 3B78A 1NHIA 4B3MI 4FWGA 4WUCA 2UUBE 1NHHA 4B3ME 3PYEA 4DPUA 2ZITA 2DEIA 1EA6A 3B8HA 2X7IA 4P7AA 4JI8I 4JG4A 1IBMI 4GKKI 2J7KA 3ZZTA 3HULA 4LF5I 4X66I 4JI8E 2HFSA 1IBME 4FN5A 4LF8I 4LFAI 4DR5I 1PKPA 2ZBKB 1N0VC 1N34I 4LF5E 4MYUA 4X66E 1N32I 4LF8E 4LFAE 4DR5E 4DV4I 3ZKBA 1S16A 1N34E 1H72C 2UXDI 4DV4E 1I94I 1K47A 4RPFA 3K17A 2BM0A 5FLXQ 1HNXI 1MU5A 4DV0I 1ZM2A 3ZZUA 1FJGI 2F4VI 1I94E 1FI4A 1HNXE 4JI4I 4LFBE 4DV0E 2V2QA 1KTVA 5L3JA 3JAMQ 1FJGE 3J7AM 2F4VE 1NZ0A 4JI4E 1Z5AA 4ED4A 4PRVA 4JI0I 1FNMA 4HY1A 1ELOA 4X65I 4JI0E 4DPWA 4DR4I 1OJ4A 1B63A 4ZVIA 4LF9E 4NXMI 1FWLA 4DR2I 2A2DA 4X65E 4DR4E 2HKJA 5IWAI 4NXME 2GS8A 3J80Q 4DR2E 1MG7A 2V34A 1H7UA 5IT9Q 4K0KI 1N36I 4USMA 1ZM4A 3OTOI 5LL6R 4LF4I 1XMQI 1DARA 1D6TA 4K0KE 1N36E 3OTOE 3ZKDA 2UUCI 1XMQE 4DR3I 2UUCE 1EI1A 2AJ4A 4LFCI 5A2QC 1HR0I 2HHHI 4DR3E 2UXCI 4URLA 3LNUA 4LFCE 4XTJA 4JV5I 1HR0E 2HHHE 4X64I 4DV3I 2A2CA 4YY3I 2UXCE 4JV5E 4HXZA 3QT6A 4KQVA 3WU4A 4JYAI 4X64E 4Z7YA 4DV3E 3PYDA 4DV6I 3QT8A 4YY3E 4UT4A 1Z0TA 4LF7I 4JYAE 4DV6E 1VISA 1PVGA 3PYFA 4LF7E 3V2UC 2HFUA 1KKHA 4PRXA 4JI5I 2V2ZA 1ZXNA 4JI5E 3K1JA 1RREA 1Z0VA 2LJPA 1PIEA 4LF6I 4LFBI 1XNRI 3ZZ0A 1Z0WA 4LF6E 1KVKA 4B3SI 4P52A 5FLXC 1XNRE 1Z0BA 4WUBA 3T1YI 3LPSA 4B3SE 2CZ9A 5LMNI 4JI2E 3JAMC 1IBKI 3T1YE 1XNQI 4FW9A 4JI7I 1XMOE 5LMNE 4LF9I 4AQYI 1IBKE 1XNQE 2VQFI 4JI7E 2HK2A 3V5RA 2VF3A 4AQYE 2R42A 2EFGA 2VQFE 4DUZE 1H73A 1MX0A 4GKJI 4WUDA 4B3TI 1ZXMA 1BKNA 4USKA 4GKJE 1J5EI 1Z5BA 1N33I 1FKAE 4B3TE 1Z0EA 1J5EE 4DV1I 4HYMA 1N33E 3B82A 2HK3A 1WUUA 1Z59A 4DV5I 4DV1E 4OX9I 4DR6I 1Z5CA 1HNWI 4DV5E 4OX9E 5GMEA 4JI6E 5GMDA 3GONA 2X36A 4JI1I 4DR6E 2UXBI 4FWHA 3J81Q 1HNWE 4HACB 5BR8I 4JI1E 4Z7CA 4R1FA 3WU5A 4DR1I 1FWKA 2UXBE 1B62A 3T1HI 2WW4A 5BR8E 1Z0GA 4DR1E 2VQEI 4FWDA 3T1HE 1N0UA 2VQEE 1A6FA 4UTGA 2OI2A 2UUAI 2V2VA 3LTOA 4EMDA 2BV3A 2UUAE 3PYGA 4GKKE 3Q1QA 2NPFA 5LMUI 4DXLA 1S4EA 4DUYI 4JI2I 5LMUE 1N32E 3M6AA 1U2RA 1XMOI 4DUYE 3QT7A 3H4LA 3F0NA 3CWVA 2UXDE 4DPYA 1ZM9A 1HNZI 4DU7A 1UEKA 4JI3I 2R3VA 4DR7I 4I3HA 4DUZI 1HNZE 1NHJA 2Q2EB 4KHPI 4JI3E 4DR7E 1IBLI 3J7AG 3WU6A 1ZM3A 4KHPE 1IBLE 1QZRA 4PU9A 3J80C 2DEJA 1H7SA 3D4JA 5IT9C 2ZM6I 4NXNI 2UU9I 1KIJA 4DV7I 2XEXA 4DPTA 2V8PA 4X62I 2ZM6E 4NXNE 2UU9E 2HKEA 2BM1A 4DV7E 3QT5A 4HACA 5IWAE 2E5LI 4JI6I 1H74A 4X62E 4DU8A 4DV2I 2E5LE 4MYTA 4LF4E 1Z0CA 4YHHI 5A2QQ 4DV2E 1XHKA 4B3RI
chains in the Genus database with same CATH superfamily
1HW8A 4QWAA 2CJXB 2VJVA 2ZH8A 4X65J 3D9BA 2D9OA 2AJFE 3MR5A 3GFXA 2RQCA 3OQ2A 4QR2A 1SBRA 4AL6A 4M5HA 5IXUA 2DEIA 1V5VA 5I3UB 3CPWR 1WG1A 4QU6A 3PFOA 4OI1A 3VQSA 4IFDE 3ZZZA 1PKPA 3HF5A 1X5PA 3N0VA 2UUCJ 3EDRB 1VQMS 1UMJA 2GIRA 5HQ8A 2CUYA 5J2MB 1YX2A 1Y10A 3IAM9 1MU5A 2XQCA 4CLTA 2OPRA 1RTIA 3QRPA 4LFBE 3MUMP 1SKRA 2F4VE 2UXCF 4NRUA 2BW7A 4OX7A 2HZAA 1TK5A 4HY1A 4L73A 4ZLNA 4YR3A 4IG3B 4LF9E 4JI5J 4YB6A 1K1SA 1RAGB 2GS8A 2CXEA 1HW9A 2YNGB 4IZJB 1VRTA 3TJ8A 2HHPA 1R0BG 1ZM4A 3GFHA 2QX0A 3QWPA 2CG8A 2XS7A 1RT6B 4C0OC 3LWLA 4LF6F 1N36E 2XMVA 2OLWA 4H4MB 4KRWA 2C2MB 3CO0P 2F3JA 2R8IA 2DITA 6FD1A 3Q6NA 3TAMA 4OO1B 4LFCI 3HSDA 1HR0I 1S6UA 2JE6A 2JRSA 1D9FA 3FC9A 3CJ5A 2ACYA 1AZSB 4JI3J 3FDSA 2FQQB 2J6TA 2AKWB 4Z7YA 3PYDA 1QLNA 1Y4ZB 3DRXA 2E1AA 1XC9A 3ENVA 3C6TB 4CO0A 2LA4A 1N33J 2CQHA 3OTEA 2KJWA 4OJ3A 3SI8A 1ZZNA 1MW7A 3KHHA 5C2CA 2M8HA 3MM5B 1FA0A 3GWCA 2E5LJ 2VPZB 3G9CA 3ZZ0A 4LVNP 1JJ2R 4QIFA 7AT1B 4K59A 3HHNB 1P42A 2GC8A 1SVDA 3CSKA 3GG1A 3KLHB 1GEHA 3KUHA 2VQEJ 2J6SA 1H7WA 3J7AN 4LQ9A 2WNRB 1XNQE 1HKAA 4J9PA 4C11B 1BQNA 1YTYA 4CO5A 2R42A 2F40A 1P6TA 2ZJQQ 2NUUG 4A8MP 4LT6A 4WE1B 4LFAF 1G3OA 3V4IB 3CJSA 2Q43A 2QN6B 4O4RA 4O3NA 2P9GA 1TK0A 1NB2A 3MHYA 1BHNA 3R8YA 1TAQA 1OSCA 5THWA 2PFDA 2VG5B 4Q43A 3CCZA 2HRUA 1ZTWA 4N47A 4R1FA 4NZ7A 4FNHA 2MKCA 3MAAB 3FEYB 4NX9A 2AGQA 2ZUGA 2XMTA 4I7FB 1RACB 4KV8B 2BQUA 2DK2A 3FFIA 3K7RA 3IC1A 2QFJA 1NKCA 4MKYA 3TA1A 2HWHA 4C0BA 3G8TA 2MHEA 4UOCA 2ZOFA 2Q6BA 4OHXA 2YY3A 4FF2A 5HMYA 4GKKE 2YX7A 2NCKL 1YIJS 1T8EA 5JEAA 1X5OA 3M1VA 3MR2A 1Y5IB 4ZVTB 4WPAA 3QGGA 1PJ6A 5HI7A 5KFSA 3MTKA 3H2VE 1UFWA 2LXFA 4Q8FA 1YJWS 3H2LA 2R3VA 3IBFB 2O01C 1HNZE 3D0IE 3J7AG 2L3MA 1PSDA 1Z4UA 1RA6A 5F8NA 1QAIA 4CM2A 1IVZA 2V69A 4OYXA 1L3SA 3JSMB 1U1QA 1IR1A 2YNFA 3S1TA 4FYVB 4LF8F 4CZCA 3IGVA 3HHLA 3LH2S 4R0EA 3TZYA 2BM1A 2H4WB 3KXDA 3EZ5A 2EWHA 3PKMA 4MIBA 1RCOB 3G86A 3CD6S 5GAHI 4RNNA 3QYYA 4Q7AA 3SBMA 1EETB 3WHIA 2LMIA 4LF4E 4I1TA 3MMBB 4YHHI 3PW2A 2HSEB 1TUGB 4B3SF 1T03B 3A8KA 3I96A 4YDXA 4W4MA 3T1YF 1AW0A 2V67A 2OMLA 1YRXA 2HBYB 4JP8A 4F0HA 3THPA 1X4FA 2DNKA 1QM9A 3LP2A 4F0MA 2ZVSA 4P7AA 1FT8A 3H1CA 4F36A 1SJRA 3GPAA 4LFAI 4U8VA 5F8IA 1XMQJ 1WOPA 4ZCLA 3G87A 5JXSA 1EQ0A 2UP1A 4M5MA 3LA0A 1I94I 1W26A 1YJUA 2DNHA 2FZKB 4R0JA 1IKVA 3IRXB 4LCHA 4EO6A 5KG4A 4K4VA 1LWCB 1REGX 2V2QA 2HAIA 1FJGE 2IMOA 2PC6A 3IR7B 4DZ6A 1FXDA 2IVMA 4TQRA 5JEAE 4PRVA 4O3SA 4QZVB 1MU2B 2LQ5A 1S0NA 1JWWA 1EZZB 4PUOA 2KO1A 4F04B 4PYAA 4LRAA 1M5PC 1AA1B 2EFNA 2IYGA 3BKTA 1S49A 9RUBA 1YI2S 2ZDOA 1IKYB 1VJQA 3G4SS 2FJWA 3A1YG 4NLQA 1UA1A 5EX3A 1LWXA 1R6VA 3OD2A 4R8UA 3UI3A 2M70A 5K8OA 2RRBA 1DTQA 3TR5A 1RWPB 4RJVA 3KUEA 1CEZA 4F67A 4NLWA 4JI2J 4K5RA 1TKXB 3BSCA 1XMOJ 1HQEA 1LWEB 1TVRA 3GE9A 2ZD1B 1RISA 5CYJA 3KMSA 4CO2A 1OIAA 2CNNB 2GJFA 4DQRA 5KOWA 3KJQB 4ANEA 3DM2B 2IVFB 3ZTRA 1BQXA 1BE4A 4NLUA 4H54A 3MI7X 2V9WA 2W9CB 3GJTB 3ET6B 1TK8A 4GKJJ 1NK0A 2XWXA 1PVGA 1CJUA 1SUQA 2BJ3A 3V6DA 1RT2A 2ZDPA 3HHDA 1FKAF 4NWBA 3DLGA 4UUXA 1IM6A 1SI9A 1TU0B 2HFZA 4C98A 2BJ8A 1GX6A 3EX7B 4DV5J 4ZHRB 4LBHA 4JUZA 4NCBA 1U8WA 4BS2A 1EX8A 3PY8A 4ERDA 4IOAQ 4OJ1A 2KXHA 4B3SI 1TP7A 2UXBJ 1UW9A 1RAEB 5DGBA 3T1YI 5J1EA 1OWXA 4NCAA 3IS9A 1OPIA 1IBKI 2J8SA 5DDRC 3MMAB 2IBKA 1UVMA 3VF0B 1CS4A 2WZ1A 1MWYA 2WONA 1NBEB 2VDIA 2K06A 2GAHC 3VGVA 2W2NP 2RDIA 3MM8A 4MH8A 4IZKA 2QA2A 2YKNA 4CWBA 1U26A 3W2WB 1NM2A 3IA0A 4JV1A 3W65A 1X4EA 4OI0A 1L3KA 1UPPA 2OD6A 1NSQA 1C1BB 5IM0A 1HIYA 1YBAA 4B3TE 4I0WA 2N4CA 1RTHB 1SQGA 1JLEA 3MCSA 2AGPA 1L3UA 1WUUA 3C2PA 4UY85 5CD4A 4LUBA 1CC7A 4WFXA 2ALZA 1P8GA 2LECA 3BR8A 4MDTA 3ENAA 3EZOA 2QLFB 1FWKA 2BE9B 3NNHA 2RMLA 1TELA 4M5DB 1LWFA 2HPUA 1KVIA 3J80Y 3D6MB 4WFBQ 2YWKA 3HD2A 2OPQA 3QQCD 2HGMA 2PMWA 3BGRB 2FVPA 3ETMA 2BV3A 4RW4B 4EBEA 1Q5YA 1CJTA 3RR7A 2UU9F 1RB0A 2EK1A 3T19A 4OZ5A 2Z30B 3PM9A 4DS5A 1HNIA 1Q86T 2JFDA 2POKA 4EUVA 4QWBA 1OS5A 1S1TA 3QIPA 4DCPB 4KTQA 5JUMA 2CQDA 1JKHA 4DUYI 1N5TA 4PR6A 3GIMA 2F9DA 3W9JA 4KPCA 2JEAA 2M0GB 4NEZA 1REVA 1U2RA 1C0UA 2C3YA 4HL9A 3H4LA 3DOMA 4LFCJ 3D6HB 1HR0J 3UVJB 4KPYA 3DLEB 3AY0A 1CPZA 1KQGB 2P6TA 1Q95G 2XZTB 2HMIB 3DYAA 2YWFA 4TY9A 2BKNA 3FRYA 2CQCA 3C14B 3N01A 3AHPA 8AT1B 1RHKB 3KLIB 1H7SA 3MEKA 3FEXB 4KKOB 1RHYA 1NZ8A 5HK4A 1KIJA 3HD1A 3N6LA 1UVIA 4B3OB 1WKJA 2BJDA 4GQUA 4B08A 2HIYA 3H8YA 5CH7B 2XS2A 4EI2A 4NLDA 2ZH9A 2W4CA 2UV8A 1Q5VA 4NASA 4ZCIA 1VRQC 2VG6A 1WI8A 3WU3A 4DFJA 2CIMA 2PO2B 2JEBB 3PXGa 2WP8A 2RILA 4QPTA 1VC5A 2XZWA 3DU6A 1GTHA 3R1HA 2DNZA 4JI8E 2HFSA 3NLCA 4CLKA 3P06A 1FEHA 3KK3A 2CPJA 3Q23A 1N6QA 2LQ9A 4X66E 3BDPA 5M2UA 2VKRA 1RHJB 4WP3A 2C2ZB 1IBCB 2H48B 4DV1F 2VJUA 1YJRA 1EAYC 3K17A 3NEKA 2F7VA 3FEZA 2IIHA 4DR3F 2HHWA 3PX0A 1URNA 1KHWA 3S8SA 2UXCJ 1LNQA 1FI4A 8RUCA 2HHHF 3DGPB 2C37A 2CFXA 1JB0C 1SPBP 3FKBA 2EI5A 4R5PA 4YY3F 2ZZNA 3I0SA 3PR4A 3CC7S 5GADI 5A2QU 3M85G 3NKYA 5C24A 4KHMA 4XDDA 1SIWB 2J8AA 5CZXA 1RDRA 4OYIA 4B9UA 3MEGB 1RP5A 4DFMA 4LF6J 3SQGB 1S59A 4RW9A 3EVMA 4OYBA 5D3GA 4Q0BB 4M94A 1NH7A 2J0XA 2XSJB 1SH2A 3L9ZA 1Q16B 3BS9A 3B6BA 3US5A 5IZHA 2IM1A 4O3PA 4JB8B 1OPZA 4YQWA 2HIQA 1JLFA 4Q45A 4AQYF 4ZN3A 4JYAI 1LW2A 4QIVA 4X64E 1IKXA 2PGCA 1YKWA 5E7OB 4XPCA 1RYSA 3TRGA 3P3GA 2CJKA 2H5JB 2JX2A 1VQYA 2ILYA 2Z2YB 1CJVA 4P7VA 3SDEB 2DT9A 2MKKA 4IO9Q 4I2PB 1HNVB 2Y8WA 2NSCA 3IWLA 2Z0GA 2KXNB 2MLYA 3PRYA 1XNRI 4NI2B 5KFJA 2BJ1A 4JI1F 2KFNA 5LMNI 4IH6A 4PQUB 2GW8A 5LJ3Y 1R0AA 3BSOA 2FPHX 4JI7I 2SXLA 4BCAA 5A0YB 4JBCA 3T1HF 3A8JA 1S77D 3P49B 4O0NA 3V5RA 4F26A 3SV4A 1YZ7A 5IQ6A 3QO9A 3AXMA 3T6BA 2FHOB 4F02A 4DMZA 3U1NA 2BDPA 3J7YU 1X60A 3NNCA 2QYGA 5FWKA 4LFAJ 2HS3A 2Y9HA 3I32A 1RAAB 1Z0EA 2BRKA 2D3OR 3ZNUA 2R7QA 4DV1I 2K7JA 4J9LA 3G6YA 1RLCL 2WW8A 5EWFA 2RF2A 5KFXA 2CG4A 3R9LA 5GMEA 2HAFA 2VBXA 3AFGA 2DHHA 2ZBCA 2DGUA 2PIIA 1RQ0A 1HNWE 2DCUB 4RW8A 5HJXA 4CLFA 3M32A 2RHQB 2YKPA 5H1SV 1Z2ZA 4M63A 2EG1A 3TVYA 1UDSA 3RYLA 3CJ0A 2VOOA 2LP4A 3LTOA 3SQOP 3W8GA 2CPIA 4UOGA 3DNCA 2ZM6F 3UPFA 3MTJA 4UOHA 2KI2A 2VESA 3JSBA 4OYZA 2P6SA 5LMUE 4DL6A 5B09A 3E01B 3PV8A 5H9FJ 1KDNA 2NSBA 5BYSA 2J5AA 5KFCA 2XMKA 1FDBA 1YJ9S 1D9DA 3CGIA 1X31C 2MGZA 2D41A 4B3MF 4PRFA 1XR6A 5L38A 1NEEA 1ZM3A 5HROA 2V4JA 1VQ9S 2EKNA 2J0SD 3CULA 4LF8J 3J81U 3VQTA 1U09A 4PPDA 2YQ1A 1B7FA 3BBBA 3NS5A 4OMFG 1RWXB 2NN6A 2V8PA 4DV7E 5AXLA 5IWAE 1Y60A 3DI6A 5H9FK 4LPFA 2G2YA 1XEZA 1HBUB 1R0CB 4DV2I 4NLOA 1OY9A 4Y00A 2O1UA 3VHQA 1C0TB 3V81B 4F4KA 3ENWA 4DPOA 2ASYA 3T1YJ 4TLRA 1ZA2B 4MMOA 1WHWA 3DOKB 3R7BB 1S0VA 1T9XA 1IR0A 2Z57B 3MMCA 3EJMA 4ED2A 3MCMA 3MPWA 2GIQA 3VVTA 4E98A 3E8OA 5F8LA 3B8HA 5ETOA 4WKRA 2XY6A 3EZUA 3P5BP 1UWBB 4H4OB 3CJ8A 1B99A 3RBEA 4LF5I 3RR8A 5E5NA 2XHCA 1VIXA 2RJZA 4DR5E 2D1CA 4ZVEA 2PNMA 2GQ2A 5KFEA 1KQSR 5HO4A 4DV0E 2CPYA 5L3JA 3N9UC 2R7WA 3CDAA 3FSXA 1BMQB 4PABA 1CQNA 1HFEL 4O44A 2N3OA 5LSOA 1FNMA 2ZHOA 2DIVA 4DV6F 4ELUA 1NDCA 1PYTA 3MEDB 2QZ8A 1Q0NA 2A2DA 2ATCB 1R8AA 1Q82T 4DR2E 3CEDA 3FK4A 1Q1KA 5IT9Q 3T9ZA 1SV5B 1I1GA 3LO3A 1DARA 3SMZA 1VQSA 3UN5A 2ZFHA 1FNOA 2E5JA 5KG0A 4EWTA 1H3DA 4GVBA 2K3IA 4K4UA 4A8YA 5A6WA 1WDTA 4OX8A 4FF1A 4ECVA 1JJCB 3Q8UA 1Q8IA 3W62A 2DRAA 1WHVA 1O0PA 2NN6E 1X9SA 2LEAA 1HBMB 4UF4A 1FNXH 2IJNA 3QT6A 4MIWA 5DDOC 3CW2C 3K5MA 4IFDB 4Q5VA 4HDGA 2WBMA 2GO3A 1OQ3A 2PO1A 2ZHBA 3GIRA 1S76D 2QRRA 3PACA 1CJKA 3MD3A 2NZ4A 1ZXNA 2G9OA 3CWJA 2UVUA 2FY1A 2VA3A 2NXEA 4O3QA 4CLLA 4E0DA 5KFBA 1PYOB 1RWVB 3ULHA 2J76E 4KBIA 3H98A 1TL1B 1HQUA 3ZNJ1 5DO2A 2WOMA 1ZTTA 4IDKB 3MOZA 2RKIB 3IFEA 1SXLA 4KT0C 2P2CB 2B4PA 4ED6A 1M90T 1K1QA 5A8RA 2HK2A 4CYUB 2FB0A 3UR0A 4DUZE 3EPIA 3C16B 4ELVA 2VKZG 4H4KA 1PILA 5LSRA 1QDUB 5AXKA 1IBMF 2DGOA 3KLFA 1FHTA 5CAAA 4TYBA 2E29A 3G6XA 3JQKA 2HWIA 1PC5A 1TUWA 2LDYA 4OX9I 3U02A 3WDOA 2HQDA 4DR6I 1S57A 1FFWB 4JI6E 1CSJA 3EPGA 5F8HA 5EUHA 2OPSA 4RU2A 4NLYA 1K0TA 4YMEA 2Z56B 1NPRA 2MZ1A 4OYOA 2DR7A 2GGPA 1OSDA 1S6OA 4ANDA 1EP4A 1PJ7A 4C6AA 4JI0F 3ISZA 3I55S 3CD0A 4WP8A 1R6MA 2UU9J 3BEGB 2JSXA 1U1OA 4DR4F 2EK6A 2KM8C 1CC8A 1LOUA 2CNKB 1QSLA 3M6UA 3NGKA 1VFJA 5C0XB 4FBTA 2W8KA 1BY9A 1TFYA 1R8CA 4R25A 4P72A 2YBVA 5KFLA 2W7OA 2OKQA 4JV0A 3AAWB 1JLQB 3HMJG 2FHJD 4LR7A 4NE9C 5AE2A 1L3VA 3TUJC 5K8MA 3I5AA 5A76A 2DPJA 4JI3E 1S6QA 2ZEJA 3D1HA 1RTIB 2W9AA 2V9KA 1HHQA 1XQIA 4KHPE 2L08A 4Y0FA 4FW6A 2V2KA 2WVFA 4RNFA 3MD1A 4IFDF 2J0QD 1LEOA 1UDOA 2ZC4A 4K4YA 2LU1A 3MCNA 3P96A 3EGZA 2IMWP 1FKOA 2HKEA 4LF2A 3NRBA 3MWBA 2XULA 2GJ2A 2E5LE 4MKBA 4ZN1A 4ID8A 4LFBF 2CKWA 3RUBL 4YDDB 2MDAA 2F4VF 3EE3A 4D3HA 2DHXA 2I5JB 4AYBD 3K57A 3NS7B 3M6VA 4NYZA 2UUBI 4F25A 3B78A 4L76A 2OJ3A 1VC0A 2OTJS 4KYZA 5L9XA 2RAQA 1S6PA 4LF9F 3GLLA 3CMQA 3PYEA 3TAMB 2JE6B 3GMEA 3EICA 1GH8A 1IBMI 2KXFA 2WB1D 2FC8A 1LFPA 3MR3A 3ZTSA 2O3ZA 4A8KA 4TU8A 2YPZA 2DYAA 4MYUA 1FK9A 4PQAA 2GO9A 4UW2A 1NJZA 1UJ5A 3Q8VA 2XI2A 2I1RA 1VBZA 1JXEA 3VAKA 5A2QY 5HAOA 3HP6A 2QL7B 4DR3J 2QIFA 4ID5A 3MM9B 2HHHJ 2W7PA 4PG6A 3PVXA 4N77A 1ZOTA 2JL9A 5GMKa 2VA2A 1U0HA 2HVHA 2K3KA 4YY3J 8ATCB 3OUYA 4FPIA 1IQTA 4JI0I 4DR1F 5E3QA 1H0HB 1FRXA 4WKYA 1ELOA 1U47A 1EKRA 1SJFA 4DR4I 4KQZA 1TQLA 1N5YB 3DOLA 5MLCV 3LWMA 2ABYA 2H1YA 4NXME 2O1PA 3P6YC 2KL8A 4XDCA 4ZVFA 1G7CB 3O3LA 5F8JA 4J9NA 1RWOB 1EARA 1BQNB 1X9MA 1NJXA 5C0XF 2QE5A 2IOPA 5EL9A 4ILRA 3JAMY 3N5FA 3GMGA 3RB6A 3D3CJ 1N8RT 3IBWA 1S7IA 4HH0A 1VBYA 1SIZA 4AQYJ 3ILJA 1XNQF 2MJNA 1NB7A 1B0TA 3DGVA 1DZ5A 3M8ZA 2GO8A 2EPIA 2ZKUA 4RWWA 2HFOA 4DV3E 2EFOA 1F3VA 4CH1A 2XC9A 5LXRA 2FGOA 1JNRB 2JVRA 2ASJA 1S9EA 3M8QB 1V3RA 2ZKTA 1SC4B 2JNJA 4M5KA 3V2UC 4IZJD 1E6YB 4UY8T 4J7CA 3MM7A 2MQPA 1N48A 3NCPA 1S72S 2X1FA 4FNIA 4LFBI 2AQ4A 3OR2A 5KG2A 3GB0A 2W2MP 1A6LA 2DNNA 4JI1J 1D09B 1Z0BA 5DZ6A 1FXRA 5KFPA 3LPSA 4BA2A 2WRMA 5JEAB 2MQ8A 3T1HJ 3UR3C 3M1VB 4YP3A 4LF9I 1ITPA 2BA9A 2B9YA 1SL1A 1DLOA 4X4VA 3JS9A 1WC6A 1W2BR 4HHHA 4MKVA 1N52B 2I6WA 4J9SA 4FXDA 4B9TA 3M8WA 1M5OC 5K8PA 2ZE2B 5EGYA 3S6EA 1S1WA 4GKKF 3CNQP 1J5EI 3HFZB 1NJWA 3O8WA 2CVEA 4IG0A 1T9YA 2BXJA 3W64A 2RRNA 1GQEA 2DBBA 1RWNB 1S9GA 2ZWPA 2COLA 2PD1A 4DL2A 3Q22A 2ZBQA 3HHLB 4U8YA 2X36A 1IUJA 4ZCMA 4J9KA 4ATNA 1HNZF 1RADB 4DR1I 1B62A 4KE5A 2XCAA 4CRJA 2CQ4A 5DNLA 2BA1G 4KGKA 3HVRA 3BZQA 1WG4A 2ZM6J 4FBUA 3FSIA 2F5GA 1RT4A 4FYDA 5KFTA 1QE1B 4IOBA 3SYZA 2NR0A 3KHLA 1E6VB 2FJDB 4B9MA 1UJ6A 3DRPA 3LPYA 4K4WA 3LP2B 5HN0A 3OPKA 3QPIA 4RW7B 4LF4F 5G4DA 2PEHA 2PDAA 1MN7A 3J81Y 3QT7A 4PKDB 2ZUAA 3PO5A 2PMZD 2F8EX 4KGZB 1MMDA 2QMXA 2UXDE 4B3MJ 3W9HA 2BR2A 1HLWA 3O5TB 1FESA 4DS4A 1Y5YA 4DFKA 1FX2A 1IKVB 3WU6A 4ED5A 1CVJA 3A3NB 4B9LA 1RTZA 1F9FA 1TV6A 3D4JA 4NYOA 2MLXA 4FS2A 4CI0B 3CJQA 4WP9A 3GJRB 4DPTA 2BOPA 1RJJA 1WG5A 4HTJA 3PHEA 1B7YB 4OHWA 4X62E 1F1BB 4HDHA 5L8RC 5IV4A 1JLAB 1FJGF 2AEJA 5JEAF 2W01A 5KOXA 4I2QB 4QJVA 5AJ3F 4ZS6A 3HJCA 1VS3A 2BQ3A 3TZXA 1TFWA 1HQEB 1PBUA 4GKKI 1BGXT 1NPPA 4GO5X 2HYIB 4FPRA 3ZZTA 1B64A 3DMJA 5KFVA 3HT3A 2ASDA 4J9QA 1APSA 4BC7A 4JV2A 4A4JA 1AXQA 4D3GA 3LP1B 4LR9A 2B7BB 1FWPA 2AYMA 1H72C 3TQEA 1SUQB 2IESA 2BANB 3GLJA 4F4XA 1TL4A 3DLGB 3ZZUA 2AV5A 2VPYB 3M05A 4QYZK 3EDQB 1UDQA 2H9ZA 2MB0B 3RRKA 3J7AM 3H5UA 4HYKA 4J9VA 2BABA 2R9LA 1LW0B 4DV6J 4OLPA 2GVZA 2C42A 2OSQA 4RW6A 4X65I 3M2RA 2GHPA 5J1EB 2WSEC 4OZLA 1FWLA 4PXCA 3IS9B 4OI3A 4DSEA 4MAKA 4NZ0A 2QSFA 1ROFA 2UUAF 1CS4B 1H7UA 2AJ2A 2YKMA 4DJBA 4CNYA 4USMA 4J91A 3D66A 4LF4I 1FFGB 2FHJA 4ECZA 4CNZA 3VVUA 1QUPA 1TL5A 5CA5A 2UUCI 2BE7D 2GAGC 1WOSA 1KQKA 3TYTA 1VQOS 1SKSA 3TUIC 2NPIA 3MECA 1HI1A 5DG7A 3DDNA 2A3JA 2ALYB 5M2PA 2VIHA 2EXUA 3I9ZA 1JLEB 4N56A 2CNOB 1T9UA 3LNUA 4LFCE 1HR0E 4ZIVA 5U47A 3QJPA 5KFNA 4ER8A 3Q8PB 3GJSB 5LL6d 2EVZA 1Z0TA 2QLJB 2EW9A 4U95A 5AT1B 4EFAC 4B3TF 4JI5I 1SCJB 1VR6A 5DRKA 3TP2A 1VQNS 1LWFB 3GCXP 2CQ2A 2OPQB 4P75A 2Z2MA 5KTQA 1TKDA 4EU0A 4NL5A 2C2DA 2MZTA 2KRBA 2MSTA 4DX5A 3R5GA 2BKPA 1T05B 3DD6A 1NK6A 1CJTB 4W90B 1IJFB 2C39A 1FDNA 2EBEA 3OT9A 4WUBA 2AE8A 1NJIT 2ROPA 4DSKA 2OEMA 4EYHB 1U1PA 4PCQA 4B3RF 1RA7A 1JKHB 2GVDA 2YX1A 2Y0SD 5DETA 3HHEA 1RKIA 4C8KA 2W9BA 1XERA 4G1QB 1N56A 5KFYA 1REVB 1VQ6S 4PG7A 3LUYA 5H9EJ 1NKEA 5M2RA 1IBMJ 5KT7A 4MU4A 2XHWA 4Y2AA 2MQMA 1N33I 3DYAB 3GFZA 5J2NB 2PNZB 4HT7A 2V68A 3VWSA 1BUXA 2MY7A 2J7WA 2HNYB 2DO0A 4AUKA 4XK8C 2DCLA 5B7WA 3HFKA 1HPZA 2NUHA 2KZZA 3AQPA 1PGZA 3Q83A 4CH0S 1WHXA 5H9EK 5AXNA 2HVDA 3R27A 4JI0J 3AJ1A 2VQEI 2JHEA 2KB2A 3CDEA 2OPPB 1FCAA 4DR4J 4W92B 2UUAI 1HQ2A 3AJ2A 4PXDA 4OX6A 2MLZA 1IN0A 5A8KA 1T94A 1Y11A 2ZC3A 3T41A 3DDIA 1QUVA 3FQKA 4IRCA 3ETOA 3P3DA 1WD6A 2IC3B 4Y2CA 3IM9A 4YR0A 1QTMA 5KFMA 1WDDA 4IG3A 2MPUA 3KK3B 3DXSX 1HWJA 1UFKA 4CLSA 3F0NA 1N6QB 5C25A 1B0PA 3UDLA 4MU3A 4ZP8A 4LRCA 2YNGA 1UEKA 4IZJA 2CZ4A 1DQAA 5K5MA 1F6TA 2ADBA 2Q2EB 3EWGA 2DHGA 1RT6A 1WF0A 2HNDB 1XXEA 1DRZA 3P76A 4H4MA 1KHVA 2C37B 1GAOA 1ZH5A 3J80C 3CJTA 4LF7F 4OO1A 2XEXA 3FUYA 1RT3B 5G0RA 1AZSA 2A0FB 1SQFA 2P9EA 4HACA 5KFAA 2HEKA 1X4HA 2BX6A 3PKYA 4WXWA 5HMWA 3OJSA 5C24B 4LFBJ 1VBKA 3K0JA 1P1TA 4WZMA 2QL5B 2F4VJ 4C8ZA 5I3PA 1T3NA 3KNAA 5A2QQ 2UVRA 2JVOA 2AIRB 4B3RI 3BBFA 4RW9B 4YHHE 4U7CA 3CE8A 5D3GB 1TL3B 3HCXA 1KP6A 2IPOB 3HFVA 4LF9J 3MM5A 5GAHU 2LLZA 2VFVA 5KT6A 3W1YC 3FVYA 2DO4A 3IN5A 1UL3A 3CCTA 2J7KA 1P9QC 1NU4A 3V6KA 2J9CA 5SZTA 4GKJF 1LW2B 2NYHA 2I9SA 4FZVA 4WFNQ 2ZH7A 4LFAE 3GV5B 2B5JB 2WNRA 4C11A 4DQQA 4J9OA 3VTIA 3IG1B 1NCLA 4DV5F 1VQPS 2BOAA 1I94E 4B9VA 2L48A 3EVOA 3GIIA 1Y9OA 1U6ZA 1FXLA 3JAMQ 4XO0A 4WE1A 3CTRA 3Q2SC 4DR1J 3HKWA 3HVWA 2DXEA 3KLEB 3TAPA 1WC5A 4C8OA 1NHUA 5GAEU 3RW6A 1T0TV 1R0AB 2C2NA 2VG5A 3QSYB 4OHYA 1MN9A 3VGSA 2C38A 3AOBA 2R2SA 1XMQI 4IS9A 3TI0A 2Y1IA 3H0PA 2OIHA 1OYRA 3RBZA 1HI8A 1NJYA 3ITHB 1JXVA 1M5SA 2IDLA 4OO1E 2VC0A 1XNQJ 1FRHA 2B8PA 3DRRB 4QWDA 3FCHA 4OI4A 3GSDA 2A2CA 2IM0A 2ZHAA 2RF2B 4HXZA 1WKLA 3WU4A 3Q6MA 2VL1A 2WSFC 2W4PA 3CDUA 4LF7I 3MM6A 2O1WA 2UUTA 3C46A 1H98A 3KJNB 2QL9B 4OI2A 4ES3A 3CCES 3QLHA 4CO3A 1OQ6A 2GX8A 4NXNF 5HJYA 3MEEB 5D0GA 1PIEA 2GQQA 4ITSA 2GCFA 2W7AA 3I6PA 1BWEA 3GV8B 4MK9A 1VIOA 2AW0A 5DGAA 1KVKA 2HVEA 5KFFA 1U24A 3J80U 3L09A 4B3SE 3JSMA 2GFFA 1W25A 3T1YE 2E5GA 4OV6A 2FJEB 4TQSA 4WBFA 1IBKE 2RUSA 4OYMA 2W25A 3G82A 2H4YB 2CPEA 1U2CA 1FERA 3MURP 3T9NA 1F9HA 1EETA 1S1XB 4GKKJ 4GKJI 1X4GA 4WUDA 3P8BB 2C3OA 5L1IA 1T03A 3D1QA 1U1LA 4RBVA 3BQ0A 4M95A 2OP5A 3LGMA 2J65A 5ETLA 3I87A 5HROB 4ZIWA 5LMUF 3BGUA 2D7SA 2KG1A 4DV5I 1Z59A 1RHQB 4DV4F 4OZJA 5K36A 1Z5CA 1WWHA 2CRLA 2NN6B 1HNZJ 1A0OB 2UXBI 2F4FA 4IRKA 3J81Q 4J9UE 4Z7CA 3HO1A 3WU5A 4KGXB 5IS2A 4RNMA 4HEA9 2JEJA 1FE4A 1M5VC 2VDHA 1F5BA 4FWDA 1HL6A 3KG4A 4C8LA 4W98A 4CDIA 2JT2A 3Q0AA 1A6FA 2BQRA 4UTGA 2M7SA 3IRXA 5HQMA 4I6AA 2FVRA 2K7KA 2VODA 1LWCA 5K9FA 4KY3A 4DV7F 3MMCB 2FZGB 2BBEA 5IWAF 4LF4J 1C4CA 1C1CB 1MU2A 2WBRA 3MXHP 1RT5B 1M1HA 2V94A 2VHGA 4DUYE 2XLKA 4M8LA 1IKYA 1YRTA 2XNRA 4N8OA 4U3BA 3DC2A 2FVQA 3OVSA 1CBKA 4LRFA 4ECYA 1NK7A 1P1LA 4X4NA 1FRMA 1IM4A 5T41A 4JV5F 5L1KA 2BZ2A 3T6JA 2R2UA 1TKXA 1UTAA 2E9TA 1DAXA 4NXNI 4NCGA 1LWEA 2N3LA 4DR5F 2K1RB 3A12A 2ZD1A 3FGVA 5HSPA 2F8MA 4P2XA 3THVA 1YITS 2HZCA 4RNHA 1RK8A 4OZ0A 1FJGJ 4EGLA 1SC3B 4ED8A 1WJ9A 2W9CA 4ZLJA 3UD3P 4F3MA 2IHR1 3KHGA 3TO8A 5F0UA 1HWUA 4FP9A 5AJ3J 1FRIA 3EYZA 3PW0A 2WSCC 1G4CA 2VONA 3CJKB 4GVBB 4ZPVR 2B51A 2Y1JA 4ICLB 5HATA 2UV8G 1FF2A 5B0EA 2B6AB 4ZHRA 4IO1A 4KJIA 4NRTA 5K36E 4J37A 3A8EA 2CWKA 4DR2F 1GMWD 2GA7A 4MK8A 2VBZA 3MMAA 5B08A 4DV4I 4FS1A 2HRTA 3B4MA 2WB4A 4P2FA 1RLDA 3BH7B 3NGRA 1CULB 3ZZYA 2W2QP 4DSIA 2CWXA 1ICEB 2NN6F 3W2WA 1R6LA 2LA6A 3FMBA 1HMVB 2E1CA 1GMUA 2CA9A 3CJRA 1NZ0A 1C1BA 2NREA 1YG0A 2KVIA 2HHVA 3N6MA 3LANA 1RTHA 1USUA 5RUBA 3LAMA 2DGWA 2KDOA 3MGJA 2C22A 2UUAJ 2E7VA 3GR0A 4HHJA 5IWAI 3ICLA 4O0IA 4DHVA 2B4UA 2G4BA 3M30B 1HBOB 2V6AA 4RNOA 3NGSA 1ZAWA 5LL6R 3BPDA 1RTJA 3I9V9 2X3GA 1YGYA 3ZO7A 2XNQA 5GADU 4U6PA 4YB1P 1U48A 3KLVA 3T5LA 4L3KA 5FIIA 2YKQA 1HK7A 3BGRA 2JEIA 3PFEA 2DNOA 3NAIA 4RW4A 4WXOA 2YWHA 1MLAA 2D3ZA 1OYSA 3O44A 2UXCI 4JV5I 1JLGA 3UN2A 1Q53A 3VAFA 1KN6A 3DU5A 3MPVA 4DUZF 3NOGA 2HBRB 3N5BA 4JYAE 3D1OA 4HTIA 3X1LB 4B3TJ 1XIQA 3KDNA 3RZAA 3RB0A 2HG4A 3UVJA 4USHA 3AT1B 1T95A 4K50A 2IAJB 5HVHA 3DLEA 3HLUA 3G96A 3O6QA 4LF6I 2PA3A 4JI6F 2X1BA 1YHQS 4YR2A 3RJMB 1QVFR 3W60A 2ZJPQ 1XNRE 5BJRA 3K85A 2BYCA 1B4SA 4OJHA 4HI1A 3C14A 5ETRA 4OZ3A 2CZ9A 2NLWA 4UQTA 6FDRA 4B3RJ 4KKOA 1UA0A 5D8HB 4FW9A 2Y3YA 5D0HA 5LMNE 4WFZA 3I31A 2XGPA 1IR2A 4JI7E 4IFDD 2BA1D 2EFGA 3BBCA 4B3OA 3OW2R 3C3LA 4OI6A 3BGLA 1FDDA 2VC1A 1RT1B 1U1NA 4IUFA 2ZNZA 4HHUA 3BO2A 2PO2A 2JEBA 1YWXA 2QMUB 3W7BA 1OY6A 5F9LA 2C3MA 4DV1E 4N41A 3NMRA 5C42A 3PEJA 3PCOB 5EKWA 3PEHA 3EXCX 4XTTA 3GONA 4CLZA 1HNXF 1HBNB 3VAHA 2D69A 3VALA 3I82A 2MYFA 4JI4F 3MPDA 2WW4A 4ILMA 4M5GA 4AT1B 4MU1A 5CYQB 4U7UD 4KHPF 5DQHA 5D4PA 4LCFA 2I0XA 2FLPA 1EKSA 1N0UA 2GO4A 4YS2A 1NK4A 2Z8QA 2OI2A 1PG5B 3ELHA 3SIPB 3K58A 2CZVC 2HRYA 2MTLA 3DGPA 4Q8EA 1S6PB 3PYGA 3GCWP 2GMHA 3NCRA 3QRQA 5A8WA 3SCLE 4J9MA 3U1YA 2BUNA 2C2RA 1V3SA 1S12A 2V8HA 5EX0A 2YNIB 3OTOF 2O1TA 1S4EA 4RUBA 1AUSL 2QA1A 3AD9C 1N32E 2NXNA 3SCKE 3L7OA 1P27B 2ADCA 4WZQA 2XMAA 2V8VA 5GAEI 3SZ2A 1SB6A 4DUZI 1FVQA 3MEGA 3G6VA 2JC0A 2Z58B 7FD1A 4Q0BA 3UDVA 1RBOB 4BC9A 5DG9A 4KH0B 2FZCB 4LF7J 2GIFA 3NY0A 2XSJA 2MXYA 1U0HB 1KLMA 1Y6ZA 3JXOA 2NS1B 1F5CA 1NXIA 5C0XD 2B56A 4TXSA 1X5SA 1XMBA 4N8NA 2F1DA 3M9NB 2VBWA 4M5JA 3M2UB 2KZMA 4DI6A 4JI6I 1T11A 1P9YA 5CD4H 2YH0A 3AODA 3DOLB 1SJ4P 4O4GA 4AE5A 3HVTA 1VQ4S 4DX8H 4DV2E 4O3RA 3JSYA 4USTA 4MQYA 3WX8A 2XGQA 3OR1B 1UVNA 3HKZD 3UNYA 2B43A 4I2PA 3QGHA 4ZVHA 4USJC 4TKTA 3OL6A 2HHUA 4BA1B 3KK1B 2XCPA 3D6FB 5ETKA 4NI2A 4NXMF 5HL7Q 2HS0A 5DDQC 4FYXB 3HX9A 2VICA 3HULA 3OFEA 5B0AA 3DLKB 2GQ0A 4NLGA 4LF8I 3KK2B 4PQUA 4N3OA 1CQMA 2ZBKB 4LF5E 2IJRA 4DF4A 1DQ8A 1S9EB 2QA4S 3BH6B 4F4AA 4Y3CA 2AYGA 1HNXI 4A8QA 4QQBA 4HH1A 1ZAXA 2L41A 3GR1A 1F5AA 3MM7B 4JI4I 2V4RA 2X51A 2MZJA 1WNEA 1KWMA 1BD6A 3OR2B 1Z5AA 4Y2KA 3P3CA 3V4MA 1J5OA 2MJUA 5BR8F 3U1MA 2Z5CB 1L5UA 4TVAB 1E3PA 1FRJA 4K2JA 3W2VB 1OJ4A 4DQIA 5F3ZA 1UWAA 4YFUA 1HD1A 4AM3A 1FVSA 1KSPA 3D67A 4KO0B 1M5KC 2XLJA 4QIGA 3OTOI 3T3FA 2JLFA 2EFPA 1JNZB 3QGPA 4QBUA 2RS2A 5FJ4A 4XPEA 1Z2LA 3BGOP 4O23A 3NOCA 3VAGA 4PWWA 1EI1A 5A2QC 4MU0A 3CCUS 2DY9A 1YJNS 2HHQA 3GSIA 4QWEA 4AL5A 3IWNC 2N7CA 1SH3A 3VZHA 2ATLA 4L74A 3PG9A 1IBLF 1X5TA 1KONA 2QSWA 3E01A 1VISA 3JB9k 5CHCB 2R7XA 3PYFA 3FBCA 5IT0A 3L7UA 4NXNJ 4A8OA 5L39A 3BDEA 3RBXA 4U96A 2W2OP 4TY8B 3K1JA 1T3OA 2HURA 4NOHA 5HANA 5AE1A 4LQ3A 4C4WA 3OVAA 4RR5A 1KD1T 3N28A 3P3EA 3PZPA 4CTAB 5B0FA 4P52A 4PEOA 2NZCA 2ZOGA 1FX4A 2AX1A 3JAMC 1I51B 3LAKA 3CC4S 1GMWA 5JVHQ 3R1LA 1GMVA 5K14A 5CCMA 4ZPDA 2MKSA 1RYRA 4WCEQ 4Y34A 3KKFA 4FKYA 4KAIA 1C0TA 1F2GA 2DGSA 2BR2B 1U1RA 2LFVA 1M0SA 3KJVA 4CO1A 2DJWA 5LMUJ 2V0NA 3DOKA 3C15B 3NNAA 4DV4J 3CDIA 4NMXA 1TV6B 2HS4A 4LRBA 1U02A 1UVJA 3VCDA 2Y0BB 4ZPTR 4X2BA 2UXDF 1K8AT 5JEAD 4OX9E 3OXGA 3TUPA 4DR6E 1UWBA 5L1LA 3T5JA 2B8QA 4K8RA 5BR8I 4XIUA 3GCMA 4WFAQ 2V8GA 3HT0A 4DN9A 4DOZA 1UETA 2Z2ZA 2XM3A 2RH3A 3PJWA 3K89A 3OLAA 2DNRA 3R5DA 4DV7J 2V2VA 3CCWA 3B4TA 3EVWA 2WCXA 3JTPA 1Q8BA 3ZC4A 5IWAJ 1NZAA 1FKPA 3AA8A 2HLUA 1QSYA 4X62F 3DFEA 2DNPA 3J7Z5 2DGXA 3BYRA 4MKAA 4WWSA 2CPDA 4K0KF 3CC2S 1S1VA 3HHLD 4F4YA 2CPFA 2YKOA 3MEDA 2B9EA 4LBPA 3WIUA 3QJJA 3FCVA 1VMBA 4AIMA 3POTB 4K4XA 5K8NA 4JV5J 1SV5A 2EFVA 5KG1A 2XO6A 3UWTA 3H90A 4WU3A 4GRSA 1HYSB 3UHMA 2XMMA 1IBLI 4IFDC 2WAQD 4B9SA 2LU2A 1U49A 1VRUA 3UCZP 1QZRA 3CXCR 3K5NA 3OTDA 2GNKA 3KYLA 4DR5J 1O5JA 2E9RX 2DXFA 2UU9I 3CMES 4NA1A 3V6JA 2GVZB 1RWMB 3KG1A 4LSLA 1VI7A 3Q86A 3DRYA 4BDPA 4RW6B 3NCQA 1WTBA 1HBMA 4LRDA 1H74A 2DHAA 4DU8A 3TAQA 3BF4A 2EBGA 4MYTA 5F8GA 1YQHA 3BSNA 2CPZA 5IC4B 1RU1A 4ED3A 4LMZA 2XSFA 3J81C 1UKUA 1OY8A 2E1RA 4USUA 4P2SA 2CQPA 3RW7A 2JC1A 2HVIA 2UUBE 2G0CA 3MECB 4DR2J 3NXZA 1O51A 3GV7B 2MSSA 4ZLLA 2V4QA 1B0VA 1IBME 2AHOB 2D3O1 3MFIA 3JAMU 5D77A 4IDKA 1TAUA 1KOHA 2RKIA 3W5ZA 1TL7B 2R7OA 1BXNA 2MQLA 1S1UA 2UXDI 4C7QA 2PO0A 2HBQB 4X4QA 2BM0A 2GMLA 3PW4A 1ZM2A 1Q79A 5J2PB 1NK5A 5CCLA 4NYPA 5IV3A 5D4LA 1DURA 1QTNB 1EJ7L 2W4DA 1WF2A 4B17A 3O1LA 1WKKA 4CCHA 2OEJA 4Q2MA 4K4SA 2FLOA 4P7TA 3R2CJ 2BA0D 2MZSA 4ECTA 3U1LA 1YDLA 2C39B 1LK7A 1GXTA 3W3SA 4JI0E 1PC4A 1S7HA 4URSA 3JYTA 1WOOA 2HHTA 4YEAA 4Y28C 4DR4E 2HKJA 3R5JB 4BWJA 5C0XC 2QTWA 4WF9Q 4P6QA 2W9BB 4K0KI 4C3KA 3HSZA 1U1KA 5FLXY 1AFIA 1D6TA 2Z4PA 4PWDB 3M8PB 4RKUC 4RUCA 2XBPA 2XY5A 3MR6A 4LOMA 2AZ3A 3NGDA 4DR3I 3NBPA 1F3FA 2HHHI 5D15A 1NMEB 2AT1B 1GT8A 1Y00A 1Y4SA 5ETVA 2HNZA 4DUZJ 4YY3I 5C0XA 4KQVA 2C2OB 2CDRB 4DR7F 5J1PA 3PS2A 3LP0B 2DGQA 4WTYA 1HPZB 1KBRA 4ZOSA 5EDWA 2XY7A 3A4TA 2CQIA 1JLQA 3WBZA 3G71S 3Q2TC 3VAJA 4ENOA 4OYAA 2U1AA 2HBZB 3RAXA 2ZH2A 3PS1A 1S99A 1AFJA 1M1GA 4JI6J 4V19X 4U3DA 1RAIB 5ETQA 3H5YA 5D78A 4IRDA 3F56A 5E3RA 2ZH3A 1MWZA 2AJQA 5A8KB 3D5MA 2L9WA 1V6HA 2RD5C 1RTDA 1TMMA 3N4WA 4AQYI 5KFQA 4Y2IA 1FD8A 1VHFA 3Q8QB 4IFYA 5ETTA 1MROA 2VF3A 2YQ3A 1FTCA 2KG0A 5C25B 1EB0A 2CDQA 3SSSA 4IFVA 1ZXMA 2I5JA 4HT5A 5HVGA 3W61A 3QZ8A 1IWGA 1J5EE 2DKOB 2KT3A 3HSJA 5FDLB 2HHXA 5T7LB 1RWKB 1N34F 4N5SA 2HK3A 1H7XA 1YK9A 2PE8A 3M7VA 1HNXJ 3OHAA 3NMAA 2IRYA 1WEXA 4JI1I 1JLCB 5G0RB 4JI4J 1YJ7A 4P71A 1ZA1B 4HACB 3K8VA 1RCXB 3QFWA 1Y3JA 2CG9A 4KHPJ 1Q8KA 1T9WA 3T1HI 4ZP6A 4DR1E 2YXLA 1W2IA 1YHCA 2KHDA 3WC2A 3PRBA 1WEZA 2OUGA 3MM9A 3TNVA 2DB1A 3SSRA 2IRUA 4U67Q 4UZBA 1TUVA 3IBCB 4F50A 3KOAA 3WIVA 5HP1A 3OTOJ 5C0XE 1ACMB 1DQ9A 4OHZA 1K9MT 4USIA 3LALA 3M6AA 4EEYA 4IH5A 3P4UB 3ILOA 2M4MA 2FJBB 4X4TA 4YHHF 3OL8A 1N5YA 2HQGA 3K5PA 2G1HA 4QOTA 1ZM9A 4DZDA 4DR7I 4QIEA 5KG6A 2OHDA 3CCJS 3FBFA 1VLYA 5DM6Q 1YSJA 3DRSB 5KFIA 5JJBA 4NMLA 1FJEB 3DLHA 2ZM6I 5I42B 1FEEA 3M2VA 1GTEA 3GU0A 3MR7A 1K73T 1I5OB 1I94F 3I56S 5JEAC 4V19J 1Y4UA 3M8QA 3G6ES 3R7SB 2C38B 1E6YA 1O8BA 1NDKA 4QW8A 3I0RB 3NGUA 2M3DA 4ZVSB 1WC0A 3AQOA 2ZNYA 4B3MI 2FJVA 4FWGA 5CZVA 4RBTA 2WVBA 4WUCA 2ZH4A 2IVYA 2Z5EA 2M8DB 1VCTA 4NXMJ 2HFNA 4DPUA 2ZITA 4IQXA 2VQFF 2E44A 3AB4B 5KAKA 3C6UB 1EA6A 2X7IA 3CCVS 4P10A 5ITHA 2F65A 1I6JA 5HMXA 4QW9A 2XMJA 5EWEA 1N34I 1ZYQA 3KTQA 1UVLA 3MM6B 4KHRA 1WSRA 3HHLC 2LDIA 1K47A 4RPFA 2QYCA 4OO1F 5KFOA 5D0EA 4MT1A 3QLHB 4S0MA 5CYMB 3GIJA 3ZXWA 1NH8A 3GJQB 2HW3A 2ZE2A 3LGNA 3L7ZA 4DV3J 4DL0C 1TKTB 5BR8J 4LCGA 4ZP9A 3GTYX 2CNLB 4OL8A 1YRUA 3ZZOA 3OBIA 4NLTA 4OV1A 5IC6B 2OH2A 1DTTA 2PI5A 4X65E 1R3NA 4OZ1A 1VHIA 3J80Q 1F60B 3TOQA 2DR5A 1XJWB 3G82B 3GZ7A 3KRNA 1FO1A 4L3NA 3I4HX 3O2IA 4I56A 1SJ3P 3L95X 2Z5BA 1NDLA 1Q7LB 1F0XA 4PZVA 4ZA1A 2L9DA 1QSSA 2UUCE 2VFUA 2YNHB 2J9DA 3IGNA 1QE1A 3H4DA 1E6VA 4QPXA 2C28A 1IBKF 2M2BA 1VGYA 1BQMA 5K36B 2F63A 1IBLJ 4DV6I 3QFHA 4OHVA 4EBDA 2FHMA 4UT4A 4RW7A 4DG1A 4C8NA 4KR0B 1WSVA 2LKZA 3ONQA 1VQ5S 3EGWB 4G1IA 1S9FA 4P74A 4PRXA 2V2ZA 3CCRS 1VOMA 2LXIA 4ZMMA 4ES1A 1C4AA 4JI5E 5K20B 1H2VZ 4E2FB 2YVSA 4ZLPA 1R8BA 3A8IA 4WK1A 2E1PA 4DQSA 1Z0WA 4V1Ak 3LW5C 4LSZB 3MAQA 3MCOA 1N5VA 4J3DA 2D3UA 3K5LA 5DNXA 3ZTQA 3A3OB 4DCJB 4HR2A 2AJ0A 2OEKA 2O3DA 2HLTA 4HVZA 2XMWA 1CLFA 3KDOA 3CF5Q 3UCUP 2VQFI 2PMHA 3D2WA 4ILLA 3FSYA 2OSRA 4OYPA 1H73A 4URGA 2OPRB 2YQ0A 1MX0A 4ZVQB 4ZPBA 1JLAA 3ZTOA 3UD4P 2PSZA 2YWWA 5LXYA 5DLFA 4F3QA 3RAQA 1QAJA 4I2QA 1JLBA 5T14A 3TQ1A 1N33E 3EUNA 2UXDJ 4DUYF 2V50A 4NCGB 2ZBPA 2Q6CA 1KFSA 2YPYA 4ZVOB 3SFUA 5KT5A 4GVLA 2H65B 1VRTB 3TX8A 1D1UA 1VK3A 2ROEA 3HHKA 2XYGB 3GIKA 1Z0GA 3LP1A 3H5SA 4G3IA 4LSNA 2RDJA 5IT9Y 4BLGA 5CABA 1HA1A 1SL2A 2VQEE 1WACA 2BANA 2ZH6A 2KH9A 2J9DE 2VH7A 4NLXA 1R8HA 4X62J 3OTBA 2UUAE 5DS7A 2P9CA 2BRLA 3RB4A 5C5JA 4K0KJ 4P2MA 4LJMA 4DDFA 1GFWB 5L1JA 1LW0A 1N36F 4MFBA 1UFLA 2R4FA 3GYGA 1IQZA 2NN6D 5J1NA 1AROP 4AXJA 2R8JA 2AGOA 3Q89A 1RKJA 1FFSB 1Q4RA 4X84A 4QCLA 1S10A 3J7A1 2HWTA 4WTOB 4U9RA 1OO0B 4C3MA 2W8LA 3VZIA 2B7CB 5K36F 2OFGX 2XI3A 4RX6A 3OFGA 3GYXB 4AXIA 1URRA 3GILA 4YUDA 1U6FA 3AD8C 2HFVA 2RUGA 3HKMA 2X1AA 2F8HA 9ATCB 1KLNA 3SEOA 1XR7A 3AOAA 2YTCA 1YVFA 2CQGA 1NUEA 2GJIA 5B0GA 3RRGA 4YB5A 3DLBA 4ETXA 1XHKA 3QRRA 5HBMA 1RTJB 2VG7A 4B3RE 1X4CA 1DJ0A 1Q78A 2AJ1A 2P8IA 1S4FA 3CUNA 2DNGA 1H6KX 3TZWA 4PG4A 1Y7PA 1DY3A 2G13A 4L6V3 1T05A 4I4BA 1JLGB 4ECSA 2FDNA 3QJLA 5KG3A 2ROGA 4CQ1A 1Q8LA 5HVFA 1KOOA 3PJ9A 4Z2XA 2DPIA 3BQ2A 3JSRA 4G1QA 4DX6A 3KG0A 3FFIB 4K7QA 2DGVA 4G1PA 5FLXQ 2JZ5A 2F4VI 2DR6A 4ZPAA 3R7NB 1IJEB 1XTZA 2YKAA 4JOUA 2B3TB 2IFXA 3F41A 3QAEA 4G65A 2Y1LB 5J2NA 2FVSA 2PNZA 1RHRB 4JYAF 1SL0A 3K59A 5D0RA 2M52A 5GVQA 5ADZA 2FJAB 2XTJP 2HNYA 1VC6A 3OTCA 1JK9B 1DFDA 4J9RA 2O67A 3CIZA 2CVIA 3VR1A 2E5IA 1N36I 1Q81T 5KG7A 1FJCA 3PX6A 2EC0A 4IYQA 2R7VA 1XMQE 4OFZA 2JLGA 4KGMA 4ED1A 1XNRF 1NHKL 3G2XA 2OPPA 4K5SA 4ETZA 2AP6A 3BJYA 2YNFB 1Z1ZA 3D0HE 4FF4A 3D54A 2YX4A 1TR0A 5LMNF 4JI7F 4DR7J 3K8WA 2IC3A 3T5HA 2IBOA 2YWEA 5C42B 3WQPA 3R5CA 1NAQA 3N6NA 3H2UB 3PW7A 3KJFB 4LF7E 4QWCA 2BMBA 5CQGA 1LK5A 4G6VB 3E3XA 2C3PA 2HFUA 2DRDA 2JEFA 1PJ5A 2DXDA 1IKWA 4LIWA 3MPUB 3UNGC 4WIQA 3TANA 5D4OA 1S0MA 3I5CA 3U27A 2HNDA 4X4RA 5HLFA 1O6XA 2DISA 4PWUA 2H5EA 2R8HA 2KFZA 1RAJA 1VYAA 3UCGA 2DH8A 2H51B 4I64A 2G0IA 5KFRA 5A8WB 3SCIE 4JI2E 4N7TA 1XNQI 2LEPA 3V6HA 4FVMA 2VFTA 1KEKA 1XMOE 2PN6A 3DLJA 2MHNA 1RT3A 1UZHA 2Q79A 1U45A 4MTPA 3BSAA 1D8YA 3J7ZT 4IR1A 3CCMS 2PNLA 1M1KT 4I67A 1LXNA 3GP9A 4PG8A 2CADA 4BBYA 1FRLA 2RU9A 4I68A 2HQCA 4USKA 1HHTP 4GKJE 2AU0A 3MF5A 1N34J 1TL3A 4TYAA 1F2HA 4NEYA 4DL7A 3B82A 4PUOB 1V3ZA 1N32F 1KLMB 3BR9A 3JTNA 2VD3A 1FE0A 3M8YA 3W63A 2NXCA 4DV5E 3CD5A 4FXWA 5GMDA 2FD2A 2CQ0A 2RE1A 2Y1RI 2B4OA 4M5IA 3OL7A 2UXBE 1KR4A 4R8UB 4MIAA 3RU0A 1QVGR 1DTQB 1D8ZA 4O4GB 3HVTB 1UPMB 2B5JA 4QYZJ 2GZOA 4PAAA 3D0GE 5F41A 1K0VA 5ETSA 4FW4A 3EMTA 1NNDA 3IG1A 1NDPA 3IMQJ 4FKXA 1VLOA 1TVRB 3M85D 3J81j 5BXIA 2MKIA 3WC0A 3TARA 2UVVA 4KFBA 3TWZA 2XYHB 4PYDA 1U8SA 1SJQA 3M8RA 4DWIA 4ZJLA 3IR6B 4ZK7M 2VBYA 5DROA 5LT5A 2F9JA 3KLEA 4YHHJ 4DV2F 3CCLS 2IDEA 1ZETA 2W2PP 1CJUB 3V6DB 1RT2B 4OYWA 4Z37A 3PHTA 4C3LA 2R2RA 4KB7A 1HNZI 3M9MB 3PRVA 3K2YA 3LF0A 3QAUA 4Y2MA 2JOQA 1U6BA 3G8SA 3CDJA 1Y0HA 5KFWA 1RT7A 2J7UA 3NAHA 3ITHA 3D7SB 4LF5F 4PXBA 5KFUA 1J5OB 2DNYA 3DRRA 3KLGA 1C2PA 1BWVA 1S48A 3CJ3A 4ZPCA 4NXNE 3UD5A 3CCQS 2W24A 2WONB 2ASLA 3QT5A 1I94J 2XS5A 3MM8B 4L72B 3OXLA 4IZKB 2YKNB 1R43A 4C48A 1Z0CA 5DRQA 3FQLA 4NLVA 1WF1A 1LV5A 3RAMA 5IM0B 2BE2A 1YBUA 1TKZA 4EO8A 1RR9A 5C7PA 5J2QA 2FHKA 2MZQA 2QLBB 3I4PA 3MEEA 2VQFJ 2PT0A 1NHHA 1SJ1A 2KVQE 4ED7A 2BW2A 5DJBA 1D3WA 3GYNA 3FMWA 4Y65A 2RT3A 4AIDA 4FN5A 1X4BA 2A6MA 4DBQA 1G6BA 2XG8A 4ZVPB 3AA9A 1N32I 3KFWX 2XYPB 1RE1B 3SCJE 1Q7YT 1RAHB 4ZVGA 2NN6C 1JMTA 2QLWA 4DV4E 3NGTA 5F8MA 1RAFB 1FJGI 1S1XA 5IOLA 2A18A 1KTVA 2XWYA 1HNIB 3Q8RB 4WYWA 2AYBA 1S1TB 3QIPB 1SKWA 3EGVA 2JEAB 1C0UB 4ZVIA 1B70B 1Y5LB 3DOMB 2GV1A 1NKBA 1OYEA 5EHHA 4Q2LA 2KT2A 5K14B 3S01A 2MEWA 1S0OA 4DCOB 4X4PA 1WC1A 4B3SJ 3N79A 2A1BA 3KJVB 4BHQA 2KYZA 2XO7A 1IBKJ 5I3UA 2KFYA 2XB2D 5F9NA 1NHVA 1TMJA 3HJFA 2UXCE 4JV5E 1HWLA 4CM0A 1C1CA 1LFWA 1VQ7S 1RT5A 3BB5A 3AXKA 2JDJA 2CJYB 3CD7A 3H42A 1WC4A 2K2PA 5KG5A 1WORA 5J2MA 1PO6A 1T9TA 2VG6B 2RIJA 3BO3A 2RQMA 3M7NG 1VK8A 1QAXA 3K5OA 1LXJA 2WP8B 4DLEA 2VZ9A 4P9SA 3SXLA 3BQ1A 4OX9F 4LF6E 4DR6F 1PYSB 4F8RA 1FKPB 4FVCA 2BEFA 4ES2A 1BLUA 4DN0A 3T1AA 2K1RA 2RSQA 1S1VB 3ENQA 2UVWA 3FBBA 1GXLA 2FVCA 2O66A 4EBCA 5KFDA 4TU9A 2E7WA 4NA3A 1SQEA 2MMYA 2BACA 1XBWA 2QEXS 1WHYA 3DN9A 1NPKA 1R31A 1LQ9A 2RS8A 2L9NA 2FJXA 4B3TI 2HVZA 4JI8F 1HI0P 2GQCA 4DL3A 2W1BA 2G1DA 3H40A 4R5PB 4X66F 2FTRA 1N4LA 1RAOA 2CJAA 3I0SB 3CO9A 1VRUB 3CJKA 4DUYJ 1YZ6A 2JWNA 5KFGA 1G2EA 6AT1B 4ICLA 2B6AA 1D0EA 5SUHA 3PNIA 2DH7A 3F73A 4LSLB 4CLWA 3M4XA 2AD9A 2QMWA 1R27B 4RZRA 2HQIA 4QU7A 3C6TA 4NLRA 2X3DA 1X7VA 3R5BA 2VV5A 2E7XA 4LR8A 3AB2B 3E51A 2OD4A 1YH8A 4K4ZA 5FD1A 5IQQA 1CULA 4A48A 2DNMA 3DKDA 4ZVUB 4WIIA 3HM9A 2ZBRA 1JLFB 1HMVA 2AF6A 2CJQA 4FW5A 4FYWB 1N36J 2PA8D 3H4BA 1UEUA 4H4KC 3M8SA 3Q1QA 1QAYA 2BR0A 3KLHA 3JQMA 1IKXB 1DBDA 4DXLA 1S79A 1SC1B 3B4DA 1UZDA 4ZVRB 2R7RA 5DQIA 5I3QA 1MMLA 1KTQA 4ZPWR 4B9NA 4I69A 1CJVB 3B54A 3QMQA 3NWGA 3IM8A 4DU7A 3X3UA 2CAJA 3M30A 1S1UB 1HBOA 2UUBF 3F44A 2PO0B 2FIUA 3EGNA 3G8QA 1NHJA 1YJVA 3BGFA 4X64F 4J90A 3V4IA 1MNEA 4A8XA 1MMNA 5D6GA 2Q66A 4FF3A 4C8YA 3VGUA 2MKJA 3PRDA 3HZEA 3NP5A 2IRXA 2LQJA 1X4DA 4EZ6A 3NS6A 2OAUA 2FY8A 2FC9A 5EWGA 2OO4A 2IOQA 1V5IB 1SH0A 3JYTB 3A13A 2EG2A 3L3CA 3QO9B 3MAAA 4B02A 2V5HG 3KUGA 4F4ZA 4KV8A 4I7FA 1ZPWX 3SV3A 4ECRA 2WK4A 2EFQA 3PR5B 1ZZFA 4Q44A 2NQPA 2U2FA 1F9EB 2C3UA 4NZ6A 1NHIA 2LCWA 4F4WA 5E33A 5E3PA 2IAJA 4I6YA 2GMJA 1X8DA 3NBPB 1ZAVA 3QSIA 2FGCA 3OSNA 4M5NA 4HKQA 4QNKA 4JI8I 4JG4A 2ERRA 3MUVP 1HHSA 1OYDA 4C8MA 2HNZB 4X66I 4ISAA 2M5YA 4RW8B 3M32B 5AXMA 2AEMA 4LF8E 2JH3A 1J2VA 3ZKBA 3AOCA 1ULRA 1RU2A 4QR0A 2V8DA 1Y3KA 2N4DA 3FJ2A 2K8GA 3TVZA 1HNXE 4DL4A 1HNWF 4JI4E 5ETNA 4JYAJ 1RT1A 1TZ0A 4DFPA 4ED4A 3IR5B 3OVBA 4DSLA 2NXJA 1GK8A 5B0BA 2C1EB 2KT5A 3NL0A 1RTDB 3R3TA 2VFSA 4OKGA 2IJFA 1HD0A 1MG7A 1RI7A 1HBNA 3MMBA 2H3EB 2ZH1A 3OLBA 4IFYB 1MROB 2MGZB 2AYEA 1XNRJ 1R89A 5MAOA 3D3BJ 1T9VA 5CYQA 3ZKDA 3OTOE 2GHWA 4UQGA 2ACMA 4IFVB 2V4JB 3CMAS 2QGFB 1IWAA 1RWUA 1QD1A 2VB6A 1SKUB 1WI6A 5LMNJ 1RHUB 2KKHA 3RGIA 4JI7J 2DHSA 4URLA 2DRBA 4X64I 3THTA 3DI6B 2CQ3A 2E66A 2E9ZA 5E3AA 2YNIA 3H5XA 1VJWA 2F1FA 4IOCQ 2MZRA 2LQ8A 3Q24A 1SC6A 3TA2A 4F3OA 2B9XA 1XWLA 2JFKA 1J5EF 4MJKA 4DV1J 4O3OA 3UFCX 4A8FA 4E8UA 3IAS9 2BKOA 5DZ7A 5JVGQ 4KH1B 3KNGA 4TU7A 3RG6A 3C8YA 4FDFA 2HHSA 4WYLA 5DRRA 5FLXC 5F3TA 3J7YI 1ZBTA 5L9NA 1EQMA 5HP1B 2DY1A 2ZJRQ 3T5KA 3CCSS 5DG8A 2RQKA 1RABB 3D6TB 1HWIA 1AB8A 1E3HA 3M2UA 5DLGA 4P73A 2Q3PA 1YJTA 4EZ9A 3PS3A 2H5IB 1BKNA 3QZ7A 4PG5A 1Z5BA 1FKAE 1JJHA 1N32J 4O44B 3OR1A 3UN3A 4HYMA 3IO1A 4TNOA 2Z2LA 2EEYA 4BA1A 2A6OA 4EK2A 3KK1A 3W9IA 1IXKA 3DM2A 1HNWI 3OFFA 4RWXA 3LOUA 3M2VB 3ET6A 3HSGA 4DV0F 3DLKA 3KK2A 1D9AA 2BJ7A 3P45B 5BR8E 2CGEA 4YN3B 4WFYA 4RUHA 2J6UA 1PBAA 3VV2B 3PX4A 4X4UA 4IH7A 2KN4A 4DUTA 2IA0A 4PPZA 2UZAA 2PI4A 2R7TA 4ECUA 5LMUI 4OO1D 2MQNA 4DV2J 3AH6A 2Z5CA 2ZH5A 1I3OB 1VDHA 1TTHB 3W2VA 3DXBA 2VPWB 2PO1B 1CG2A 1JX4A 1MSWD 3FCWA 3RTVA 5D4NA 1JXLA 1CJKB 4ANCA 4OLOA 3DHXA 1WTFA 4USWA 4KO0A 1N5SA 3H25A 5BYQA 4RU9A 5DM7Q 4DSFA 4Y6IA 1LKZA 2HGNA 4QIWD 1IBLE 2X1GA 1M5HA 3JQJA 3L7ZB 3CVKA 1NSKL 4LF5J 2KHCA 2QV6A 1HQUB 4ZJQA 2GHVC 2WOMB 3OL9A 4F2SA 3PIOQ 2M88A 4DV7I 4OJGA 3S7RA 2HGLA 2UU9E 2DTJA 4KC5A 5DQGA 5A8RB 1DTTB 4FXVA 1W7WA 4X4SA 4M5DA 1MWQA 2HQFA 2AWZA 2KJVA 4ECQA 2VASA 3M9OB 5GAGU 4A47A 2R8GA 3UQSA 3KLFB 2WVEA 4LREA 2Z5BB 3FRZA 3ZM7A 1QY7A 2IYIA 4TY8A 3E2EA 3HJVA 2BVZA 3KMQA 2R7SA 2QO3A 3R6LB 4KSEB 4OZEA 1NSPA 4X65F 3GQCA 2KRRA 1HARA 4TLQA 1KC8T 1AYEA 4CTAA 5FLXU 5LJ5Y 2MKHA 4OZNA 2ZZMA 3TA0A 3NG8A 3L4BC 2B0GA 2I8EA 2OPSB 1FRKA 1BQMB 4DR5I 4KIAA 1NO8A 1N0VC 2PFFB 2GGPB 4PXEA 2ZVIA 4DG1B 1EP4B 4DSJA 3ILIA 2UUCF 4C97A 5LOQA 2OMOA 3C19A 2MQQA 4C0HA 3OHBA 2FYXA 4DV0I 2HMIA 5EN1A 5B0DA 3PW5A 3CDBA 3MZIA 4LBIA 1XK8A 4URQU 5KT2A 4BWMA 1T7PA 4WJBA 3KLIA 4RL1A 1NK8A 2XMUA 3LGHA 4RO0A 4HI2A 1GNKA 1WC3A 1PAUB 3C15A 2O5DA 2N7YA 2DVIA 4DPWA 2IM3A 1B63A 1ZS6A 3BKFA 3UDCA 1X4AA 4DR2I 5I4MA 1JIHA 1H2UX 2NYIA 5CXTA 4JI5F 1OYPA 4F2RA 4YB7A 2RU3A 3TEGA 1N88A 3BYPA 2UUWA 2KM8B 3HXMA 1S6QB 1UP1A 4K0KE 4ELTA 2OTLS 2G2ZA 3RB3A 1RBAA 2EKYA 2BJ9A 5DRPA 2IA6A 2AJ4A 4RLEA 3Q8SB 4QYRA 2ILZA 4NLPA 4DR3E 1JLBB 2YH1A 4ZKAA 1FKOB 4XTJA 3ZTPA 2HHHE 1VBXA 2WVDA 1FD2A 4AD6A 1N54B 1RXOB 3HVAA 3OXFA 4ZDNA 4JI3F 1U2FA 3QT8A 4YY3E 2LQBA 3VGTA 4ECXA 1AUDA 3I5BA 2AX0A 2DR8A 3ISND 1RWWB 2V63A 3BN7A 4CH7A 2R7UA 1U4BA 3POTA 1N33F 3H7HB 4LSNB 1RREA 1Z0VA 2LJPA 1UAWA 3R2DJ 4OX9J 5A6PA 4ZCKA 2ZZTA 1HYSA 4DR6J 1EHWA 3P5TL 3HK2A 4M5LA 2E5LF 1UJ4A 1U25A 4ALZA 4RUAA 4YOEA 3OV7A 1R7IA 1FK9B 5K36D 4MFBB 4TN2A 2YWGA 1USVA 4IR9A 2QT7A 1U7LA 2QJ3A 2VQEF 4AQYE 3SQGA 4EYIB 4ID5B 2PO4A 4JI8J 4X4OA 5LM7E 3TVKA 3U1KA 3OSPA 1RGVA 4X66J 1Y5NB 4UOFA 2ZOMA 3BO4A 3OUYB 2H54B 3TUZC 1GXUA 4LVOP 3MAHA 3TX0A 1N5QA 2IERA 2OGUA 1V9OA 4ED0A 4FWHA 2IY5B 3FZBA 4JI1E 3PJXA 5AE3A 5C2GA 3QNWB 4USVA 1TL7A 4F0KA 3SDEA 7FDRA 1JJ4A 5ETMA 3T1HE 1HNVA 3IRWP 2AZ1A 5HBMB 2VG7B 4EMDA 5J2PA 1S97A 1PCAA 4CP5A 2EC2A 2LYVA 1U0SA 3CJ4A 3QGIA 4UUWA 2ZBIA 1T02A 3IWXA 5A0YA 1KVJA 1K44A 2OELA 3ZFVA 3W8PA 3CWVA 4IQMA 1DHMA 4RBUA 2UUBJ 4JI3I 4X64J 1NRKA 1X0FA 1GX5A 4KHPI 2MKYA 4DEZA 4DF8A 4DR7E 4DV3F 3TW0A 4A8SA 2LEBA 1VQ8S 4NBQA 5E3CA 5ETPA 4PWDA 3M8PA 2R8KA 1X9WA 4BA2B 2J9EA 2DEJA 5IT9C 1X0PA 2CJ9A 2OFHX 2ZM6E 1YBTA 2VFRA 1WEYA 1DLOB 2E5LI 3QWUA 2QLXA 1RBLA 4GMKA 4L75A 3LP0A 3RRHA 2FLNA 2DD8S 5IT4A 4GC6A 3DDKA 3ADAC 5E41A 4WU2A 1S1WB 4A8WA 5HMZA 1KS2A 1L3TA 4IG0B 4M1KA 2Y8YA 4DPXA 2E1MC 3Q8YA 3SSQA 4ECWA 1UDNA 4CT8A 3BV8A 3QIDA 1NK9A 4B3ME 2KTQA 1S9GB 3UO0A 2WTFA 3BPSP 4DQPA 2R2TA 1UCNA 1OMSA 2VOPA 3TJAA 4UZCA 4NPOA 2QG9B 2CYYA 4GO7X 3DLLQ 4OO1C 1XMQF 4KGVB 1S16A 1N34E 3UE2A 1G1XA 3TJ9A 3R97A 2J0WA 1AT1B 1KFDA 1RT4B 4QNJA 1HNWJ 2RQ4A 4K4TA 3HZGA 1IKWB 2AEFA 3U7JA 5HQLA 1H2TZ 2G2OA 3M6WA 1ZPVA 3DRPB 4FW7A 5B0CA 5HLFB 4CO4A 1UEVA 1JQGA 1PAEX 5FDLA 3KWMA 5T7LA 3BN4A 2XLIA 3CIMA 3R5AA 3BREA 3HI9A 5E2QA 4NXMI 3FNNA 2APOA 2XZDB 3ZZRA 1HBUA 4WK3A 3NZKA 1A7GE 1JLCA 2V34A 3SFGA 3V81A 3MPYA 3PIPQ 1RSCA 4LF1A 3M7ND 3VAMA 1H38A 5LSLA 2B9WA 3CB4A 3LQVA 2D74B 2JEGA 3PTWA 3HPOA 3BM7A 3WZ0A 4JI2F 2DR9A 2VPXB 4AL7A 3AD7C 2RNEA 3PO4A 2E5HA 2WVCA 2MY8A 1XMOF 2D9PA 1UW4A 2I2YA 4H4OA 3GFYA 3OJUA 2LVWA 2DH9A 4DV3I 5E0OA 2ZWOA 4QR1A 4NLSA 5KFHA 5JMNA 4DLGA 5IFMA 4DV6E 2RDDA 4F7VA 1J5EJ 2CPXA 2M9KA 2P5VA 1KKHA 3JTOA 4ZJOA 1RZMA 2RRAA 4FYYB 2PEBA 1KNZA 3IP0A 2RVJA 3DHWC 2FLLA 3DCAA 2Q1LA 3DRSA 1KRPA 3H20A 2CQBA 3OFHA 1VQLS 1FJ7A 4CLUA 2DGTA 5ELWA 3DMJB 4KFBB 3UDEA 4C9DA 3MUTP 3CJ2A 4U7UK 5IT9U 1BC6A 3MDFA 2UXBF 1KQFB 2KU7A 5I42A 1XN9A 2JLEA 3EXYA 3MMJA 5DDPC 3M6XA 4FW3A 2JJ4D 1QJHA 4DL5A 2QFIA 3L7PA 1FDAA 2VQFE 2DIUA 2FUG9 2I38A 2WHOA 3D28A 2NXUA 3ILLA 1S5ZA 2BJEA 2CQ1A 2QA4G 5GAGI 2B4VA 2DNLA 1NLKL 3I0RA 4NA2A 5KFZA 3PDNA 2LXUA 3MOJB 1RHMB 3W5YA 3ZZPA 3W5XA 1RT7B 2G0JA 3M2RB 4K2XA 5KT3A 1YLXA 2RB7A 2MQOA 3C6UA 4DV0J 3KLGB 3AJDA 3QATA 4CT9A 2YKMB 4AFFA 4IFDA 4I6WA 2BA0G 4J5OA 2C2KB 1J27A 5L46A 1UVKA 1A9NB 3QBCA 4LIRA 3MFHA 4HLBA 3NWRA 4CIOA 4OQJA 1R8PA 2BE2B 3A3PB 4MK7A 1TKZB 3W66A 1B3TA 3ISNC 5J2QB 3EM1A 5CYMA 2A10A 3FBEA 1WELA 4CLPA 1TL1A 1TKTA 2DNQA 2NPFA 2HQ3A 5KFKA 4XAKA 3CDWA 3BKUA 3WX4A 2N82B 3TZZA 2KYXA 4JI2I 1PKUA 3RBDA 3UW1A 1XMOI 4CYUA 1RUSA 4DPYA 1VQKS 5K36C 2IM2A 4LFCF 3C16A 1HR0F 5KT4A 2HZVA 2CPHA 4I3HA 1R6YA 4GC7A 3LPEA 3IXQA 1HWKA 3CT9A 1FTRA 4ZP7A 2O1VA 3VAIA 5BYRA 3GG0A 2VU5A 3R6GB 2VUGA 4N76A 4PU9A 4A46A 2YNHA 1XR5A 4CLYA 4IKAA 1NSAA 4X62I 2GVDB 2CJBA 4DX7A 3TEHB 4ZITA 3C66A 3D68A 4OIXA 1EIYB 2QC3A 4OZ2A 3FZ2A 3KHRA 3HDSA 1U1MA 2RHSB 2AMCB 2C2EA 4C2MA 5F0WA 3H59A
chains in the Genus database with same CATH topology
4YHHE 3J81C 2E1RA 1RR9A 2Z5BB 4M1KA 3ZM7A 4B3RE 3WU3A 4DPXA 2UUBI 3B78A 1NHIA 4B3MI 4FWGA 3HJCA 4WUCA 2UUBE 2Z5EA 1NHHA 4B3ME 3PYEA 4DPUA 2ZITA 2DEIA 1EA6A 3B8HA 2X7IA 4P7AA 4JI8I 4JG4A 1IBMI 4GKKI 2J7KA 3ZZTA 3HULA 4LF5I 4X66I 4JI8E 2GQ0A 2HFSA 1IBME 4FN5A 4LF8I 4LFAI 3P06A 4DR5I 1PKPA 4N3OA 2ZBKB 1N0VC 1N34I 4LF5E 4MYUA 4X66E 1N32I 4LF8E 4LFAE 4DR5E 4DV4I 3ZKBA 1S16A 1N34E 2PNMA 1H72C 2UXDI 4DV4E 1I94I 1K47A 4RPFA 3K17A 2BM0A 5FLXQ 1HNXI 1MU5A 4DV0I 1ZM2A 3ZZUA 1FJGI 2F4VI 1I94E 1FI4A 1HNXE 4JI4I 4LFBE 4DV0E 2V2QA 1KTVA 5L3JA 3JAMQ 1FJGE 3J7AM 2F4VE 1NZ0A 4JI4E 1Z5AA 4ED4A 4PRVA 4JI0I 1USUA 2Z5CB 1FNMA 4HY1A 1ELOA 4X65I 4JI0E 4DPWA 4DR4I 1OJ4A 1B63A 4ZVIA 4LF9E 4NXMI 1FWLA 4DR2I 2A2DA 4X65E 4DR4E 2HKJA 5IWAI 4NXME 2GS8A 3J80Q 4DR2E 1MG7A 2V34A 1H7UA 5IT9Q 4IZJB 4K0KI 1N36I 4USMA 1ZM4A 3OTOI 5LL6R 4LF4I 1XMQI 1DARA 2Z5BA 1D6TA 4K0KE 1N36E 3OTOE 3ZKDA 2IOPA 2UUCI 1XMQE 4DR3I 2UUCE 1EI1A 1HK7A 2AJ4A 3Q6NA 4LFCI 5A2QC 1HR0I 2HHHI 4DR3E 2UXCI 4URLA 3LNUA 4LFCE 4XTJA 4JV5I 1HR0E 2HHHE 1Y4SA 4X64I 4DV3I 2A2CA 4YY3I 2UXCE 4JV5E 4HXZA 3QT6A 4KQVA 3Q6MA 3WU4A 4JYAI 4X64E 4Z7YA 4DV3E 3PYDA 4DV6I 3QT8A 4YY3E 4UT4A 1Z0TA 4LF7I 4JYAE 2O1WA 4DV6E 1VISA 1PVGA 3PYFA 4LF7E 3V2UC 4IZJD 2HFUA 1KKHA 4PRXA 4JI5I 2V2ZA 1ZXNA 4JI5E 3K1JA 1RREA 1Z0VA 2LJPA 1PIEA 4LF6I 3PRYA 4LFBI 1XNRI 3ZZ0A 1Z0WA 4LF6E 1KVKA 4B3SI 4P52A 5FLXC 1XNRE 3K85A 1Z0BA 4WUBA 3T1YI 3LPSA 4B3SE 2CZ9A 5LMNI 4JI2E 3JAMC 1IBKI 3T1YE 1XNQI 4FW9A 4JI7I 1XMOE 5LMNE 4LF9I 1USVA 4AQYI 1IBKE 1XNQE 2VQFI 4JI7E 2HK2A 3V5RA 2VF3A 4AQYE 2R42A 2EFGA 2VQFE 2PNLA 4IZKA 4DUZE 1H73A 1MX0A 4GKJI 4WUDA 4B3TI 5FWKA 1ZXMA 1BKNA 4USKA 4GKJE 1J5EI 1Z5BA 1N33I 1FKAE 4B3TE 1Z0EA 1J5EE 4DV1I 4HYMA 1N33E 3B82A 2HK3A 1WUUA 1Z59A 4DV5I 4DV1E 4OX9I 4DR6I 1Z5CA 1HNWI 4DV5E 4OX9E 5GMEA 4JI6E 5GMDA 3GONA 2X36A 4JI1I 4DR6E 2UXBI 4FWHA 3J81Q 1HNWE 4HACB 5BR8I 4Z7CA 4R1FA 4JI1E 3WU5A 4DR1I 1FWKA 2UXBE 2CG9A 1B62A 3T1HI 2WW4A 5BR8E 1Z0GA 2CGEA 4DR1E 2VQEI 4FWDA 3T1HE 1N0UA 2VQEE 1A6FA 4UTGA 2OI2A 2UUAI 2V2VA 3LTOA 4EMDA 2BV3A 2UUAE 3PYGA 4GKKE 3Q1QA 2NPFA 5LMUI 4DXLA 2Z5CA 2O1TA 1S4EA 4DUYI 4JI2I 5LMUE 1N32E 3M6AA 1U2RA 1XMOI 4DUYE 3QT7A 3H4LA 3F0NA 3CWVA 2UXDE 4DPYA 1ZM9A 1HNZI 4DU7A 1UEKA 4JI3I 2R3VA 4DR7I 4IZJA 4I3HA 4DUZI 1HNZE 1NHJA 2Q2EB 4KHPI 4JI3E 2O1VA 4DR7E 1IBLI 3J7AG 3WU6A 1ZM3A 4KHPE 1IBLE 1QZRA 4PU9A 3J80C 1Y6ZA 2DEJA 1H7SA 3D4JA 5IT9C 2ZM6I 4NXNI 2UU9I 1KIJA 4DV7I 2XEXA 4DPTA 2V8PA 4X62I 2ZM6E 4NXNE 2UU9E 2HKEA 2BM1A 4DV7E 2IOQA 3QT5A 4HACA 5IWAE 2E5LI 4JI6I 1H74A 4X62E 4DU8A 4IZKB 4DV2I 2E5LE 2O1UA 4MYTA 4LF4E 1Z0CA 4YHHI 5A2QQ 4DV2E 1Y4UA 1XHKA 4B3RI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH E;  3J81 C;  2E1R A;  1RR9 A;  4M1K A;  3ZM7 A;  4B3R E;  3WU3 A;  4DPX A;  2UUB I;  3B78 A;  1NHI A;  4B3M I;  4FWG A;  4WUC A;  2UUB E;  1NHH A;  4B3M E;  3PYE A;  4DPU A;  2ZIT A;  2DEI A;  1EA6 A;  3B8H A;  2X7I A;  4P7A A;  4JI8 I;  4JG4 A;  1IBM I;  4GKK I;  2J7K A;  3ZZT A;  3HUL A;  4LF5 I;  4X66 I;  4JI8 E;  2HFS A;  1IBM E;  4FN5 A;  4LF8 I;  4LFA I;  4DR5 I;  1PKP A;  2ZBK B;  1N0V C;  1N34 I;  4LF5 E;  4MYU A;  4X66 E;  1N32 I;  4LF8 E;  4LFA E;  4DR5 E;  4DV4 I;  3ZKB A;  1S16 A;  1N34 E;  1H72 C;  2UXD I;  4DV4 E;  1I94 I;  1K47 A;  4RPF A;  3K17 A;  2BM0 A;  5FLX Q;  1HNX I;  1MU5 A;  4DV0 I;  1ZM2 A;  3ZZU A;  1FJG I;  2F4V I;  1I94 E;  1FI4 A;  1HNX E;  4JI4 I;  4LFB E;  4DV0 E;  2V2Q A;  1KTV A;  5L3J A;  3JAM Q;  1FJG E;  3J7A M;  2F4V E;  1NZ0 A;  4JI4 E;  1Z5A A;  4ED4 A;  4PRV A;  4JI0 I;  1FNM A;  4HY1 A;  1ELO A;  4X65 I;  4JI0 E;  4DPW A;  4DR4 I;  1OJ4 A;  1B63 A;  4ZVI A;  4LF9 E;  4NXM I;  1FWL A;  4DR2 I;  2A2D A;  4X65 E;  4DR4 E;  2HKJ A;  5IWA I;  4NXM E;  2GS8 A;  3J80 Q;  4DR2 E;  1MG7 A;  2V34 A;  1H7U A;  5IT9 Q;  4K0K I;  1N36 I;  4USM A;  1ZM4 A;  3OTO I;  5LL6 R;  4LF4 I;  1XMQ I;  1DAR A;  1D6T A;  4K0K E;  1N36 E;  3OTO E;  3ZKD A;  2UUC I;  1XMQ E;  4DR3 I;  2UUC E;  1EI1 A;  2AJ4 A;  4LFC I;  5A2Q C;  1HR0 I;  2HHH I;  4DR3 E;  2UXC I;  4URL A;  3LNU A;  4LFC E;  4XTJ A;  4JV5 I;  1HR0 E;  2HHH E;  4X64 I;  4DV3 I;  2A2C A;  4YY3 I;  2UXC E;  4JV5 E;  4HXZ A;  3QT6 A;  4KQV A;  3WU4 A;  4JYA I;  4X64 E;  4Z7Y A;  4DV3 E;  3PYD A;  4DV6 I;  3QT8 A;  4YY3 E;  4UT4 A;  1Z0T A;  4LF7 I;  4JYA E;  4DV6 E;  1VIS A;  1PVG A;  3PYF A;  4LF7 E;  3V2U C;  2HFU A;  1KKH A;  4PRX A;  4JI5 I;  2V2Z A;  1ZXN A;  4JI5 E;  3K1J A;  1RRE A;  1Z0V A;  2LJP A;  1PIE A;  4LF6 I;  4LFB I;  1XNR I;  3ZZ0 A;  1Z0W A;  4LF6 E;  1KVK A;  4B3S I;  4P52 A;  5FLX C;  1XNR E;  1Z0B A;  4WUB A;  3T1Y I;  3LPS A;  4B3S E;  2CZ9 A;  5LMN I;  4JI2 E;  3JAM C;  1IBK I;  3T1Y E;  1XNQ I;  4FW9 A;  4JI7 I;  1XMO E;  5LMN E;  4LF9 I;  4AQY I;  1IBK E;  1XNQ E;  2VQF I;  4JI7 E;  2HK2 A;  3V5R A;  2VF3 A;  4AQY E;  2R42 A;  2EFG A;  2VQF E;  4DUZ E;  1H73 A;  1MX0 A;  4GKJ I;  4WUD A;  4B3T I;  1ZXM A;  1BKN A;  4USK A;  4GKJ E;  1J5E I;  1Z5B A;  1N33 I;  1FKA E;  4B3T E;  1Z0E A;  1J5E E;  4DV1 I;  4HYM A;  1N33 E;  3B82 A;  2HK3 A;  1WUU A;  1Z59 A;  4DV5 I;  4DV1 E;  4OX9 I;  4DR6 I;  1Z5C A;  1HNW I;  4DV5 E;  4OX9 E;  5GME A;  4JI6 E;  5GMD A;  3GON A;  2X36 A;  4JI1 I;  4DR6 E;  2UXB I;  4FWH A;  3J81 Q;  1HNW E;  4HAC B;  5BR8 I;  4JI1 E;  4Z7C A;  4R1F A;  3WU5 A;  4DR1 I;  1FWK A;  2UXB E;  1B62 A;  3T1H I;  2WW4 A;  5BR8 E;  1Z0G A;  4DR1 E;  2VQE I;  4FWD A;  3T1H E;  1N0U A;  2VQE E;  1A6F A;  4UTG A;  2OI2 A;  2UUA I;  2V2V A;  3LTO A;  4EMD A;  2BV3 A;  2UUA E;  3PYG A;  4GKK E;  3Q1Q A;  2NPF A;  5LMU I;  4DXL A;  1S4E A;  4DUY I;  4JI2 I;  5LMU E;  1N32 E;  3M6A A;  1U2R A;  1XMO I;  4DUY E;  3QT7 A;  3H4L A;  3F0N A;  3CWV A;  2UXD E;  4DPY A;  1ZM9 A;  1HNZ I;  4DU7 A;  1UEK A;  4JI3 I;  2R3V A;  4DR7 I;  4I3H A;  4DUZ I;  1HNZ E;  1NHJ A;  2Q2E B;  4KHP I;  4JI3 E;  4DR7 E;  1IBL I;  3J7A G;  3WU6 A;  1ZM3 A;  4KHP E;  1IBL E;  1QZR A;  4PU9 A;  3J80 C;  2DEJ A;  1H7S A;  3D4J A;  5IT9 C;  2ZM6 I;  4NXN I;  2UU9 I;  1KIJ A;  4DV7 I;  2XEX A;  4DPT A;  2V8P A;  4X62 I;  2ZM6 E;  4NXN E;  2UU9 E;  2HKE A;  2BM1 A;  4DV7 E;  3QT5 A;  4HAC A;  5IWA E;  2E5L I;  4JI6 I;  1H74 A;  4X62 E;  4DU8 A;  4DV2 I;  2E5L E;  4MYT A;  4LF4 E;  1Z0C A;  4YHH I;  5A2Q Q;  4DV2 E;  1XHK A;  4B3R I; 
#chains in the Genus database with same CATH topology
 1HW8 A;  4QWA A;  2CJX B;  2VJV A;  2ZH8 A;  4X65 J;  3D9B A;  2D9O A;  2AJF E;  3MR5 A;  3GFX A;  2RQC A;  3OQ2 A;  4QR2 A;  1SBR A;  4AL6 A;  4M5H A;  5IXU A;  2DEI A;  1V5V A;  5I3U B;  3CPW R;  1WG1 A;  4QU6 A;  3PFO A;  4OI1 A;  3VQS A;  4IFD E;  3ZZZ A;  1PKP A;  3HF5 A;  1X5P A;  3N0V A;  2UUC J;  3EDR B;  1VQM S;  1UMJ A;  2GIR A;  5HQ8 A;  2CUY A;  5J2M B;  1YX2 A;  1Y10 A;  3IAM 9;  1MU5 A;  2XQC A;  4CLT A;  2OPR A;  1RTI A;  3QRP A;  4LFB E;  3MUM P;  1SKR A;  2F4V E;  2UXC F;  4NRU A;  2BW7 A;  4OX7 A;  2HZA A;  1TK5 A;  4HY1 A;  4L73 A;  4ZLN A;  4YR3 A;  4IG3 B;  4LF9 E;  4JI5 J;  4YB6 A;  1K1S A;  1RAG B;  2GS8 A;  2CXE A;  1HW9 A;  2YNG B;  4IZJ B;  1VRT A;  3TJ8 A;  2HHP A;  1R0B G;  1ZM4 A;  3GFH A;  2QX0 A;  3QWP A;  2CG8 A;  2XS7 A;  1RT6 B;  4C0O C;  3LWL A;  4LF6 F;  1N36 E;  2XMV A;  2OLW A;  4H4M B;  4KRW A;  2C2M B;  3CO0 P;  2F3J A;  2R8I A;  2DIT A;  6FD1 A;  3Q6N A;  3TAM A;  4OO1 B;  4LFC I;  3HSD A;  1HR0 I;  1S6U A;  2JE6 A;  2JRS A;  1D9F A;  3FC9 A;  3CJ5 A;  2ACY A;  1AZS B;  4JI3 J;  3FDS A;  2FQQ B;  2J6T A;  2AKW B;  4Z7Y A;  3PYD A;  1QLN A;  1Y4Z B;  3DRX A;  2E1A A;  1XC9 A;  3ENV A;  3C6T B;  4CO0 A;  2LA4 A;  1N33 J;  2CQH A;  3OTE A;  2KJW A;  4OJ3 A;  3SI8 A;  1ZZN A;  1MW7 A;  3KHH A;  5C2C A;  2M8H A;  3MM5 B;  1FA0 A;  3GWC A;  2E5L J;  2VPZ B;  3G9C A;  3ZZ0 A;  4LVN P;  1JJ2 R;  4QIF A;  7AT1 B;  4K59 A;  3HHN B;  1P42 A;  2GC8 A;  1SVD A;  3CSK A;  3GG1 A;  3KLH B;  1GEH A;  3KUH A;  2VQE J;  2J6S A;  1H7W A;  3J7A N;  4LQ9 A;  2WNR B;  1XNQ E;  1HKA A;  4J9P A;  4C11 B;  1BQN A;  1YTY A;  4CO5 A;  2R42 A;  2F40 A;  1P6T A;  2ZJQ Q;  2NUU G;  4A8M P;  4LT6 A;  4WE1 B;  4LFA F;  1G3O A;  3V4I B;  3CJS A;  2Q43 A;  2QN6 B;  4O4R A;  4O3N A;  2P9G A;  1TK0 A;  1NB2 A;  3MHY A;  1BHN A;  3R8Y A;  1TAQ A;  1OSC A;  5THW A;  2PFD A;  2VG5 B;  4Q43 A;  3CCZ A;  2HRU A;  1ZTW A;  4N47 A;  4R1F A;  4NZ7 A;  4FNH A;  2MKC A;  3MAA B;  3FEY B;  4NX9 A;  2AGQ A;  2ZUG A;  2XMT A;  4I7F B;  1RAC B;  4KV8 B;  2BQU A;  2DK2 A;  3FFI A;  3K7R A;  3IC1 A;  2QFJ A;  1NKC A;  4MKY A;  3TA1 A;  2HWH A;  4C0B A;  3G8T A;  2MHE A;  4UOC A;  2ZOF A;  2Q6B A;  4OHX A;  2YY3 A;  4FF2 A;  5HMY A;  4GKK E;  2YX7 A;  2NCK L;  1YIJ S;  1T8E A;  5JEA A;  1X5O A;  3M1V A;  3MR2 A;  1Y5I B;  4ZVT B;  4WPA A;  3QGG A;  1PJ6 A;  5HI7 A;  5KFS A;  3MTK A;  3H2V E;  1UFW A;  2LXF A;  4Q8F A;  1YJW S;  3H2L A;  2R3V A;  3IBF B;  2O01 C;  1HNZ E;  3D0I E;  3J7A G;  2L3M A;  1PSD A;  1Z4U A;  1RA6 A;  5F8N A;  1QAI A;  4CM2 A;  1IVZ A;  2V69 A;  4OYX A;  1L3S A;  3JSM B;  1U1Q A;  1IR1 A;  2YNF A;  3S1T A;  4FYV B;  4LF8 F;  4CZC A;  3IGV A;  3HHL A;  3LH2 S;  4R0E A;  3TZY A;  2BM1 A;  2H4W B;  3KXD A;  3EZ5 A;  2EWH A;  3PKM A;  4MIB A;  1RCO B;  3G86 A;  3CD6 S;  5GAH I;  4RNN A;  3QYY A;  4Q7A A;  3SBM A;  1EET B;  3WHI A;  2LMI A;  4LF4 E;  4I1T A;  3MMB B;  4YHH I;  3PW2 A;  2HSE B;  1TUG B;  4B3S F;  1T03 B;  3A8K A;  3I96 A;  4YDX A;  4W4M A;  3T1Y F;  1AW0 A;  2V67 A;  2OML A;  1YRX A;  2HBY B;  4JP8 A;  4F0H A;  3THP A;  1X4F A;  2DNK A;  1QM9 A;  3LP2 A;  4F0M A;  2ZVS A;  4P7A A;  1FT8 A;  3H1C A;  4F36 A;  1SJR A;  3GPA A;  4LFA I;  4U8V A;  5F8I A;  1XMQ J;  1WOP A;  4ZCL A;  3G87 A;  5JXS A;  1EQ0 A;  2UP1 A;  4M5M A;  3LA0 A;  1I94 I;  1W26 A;  1YJU A;  2DNH A;  2FZK B;  4R0J A;  1IKV A;  3IRX B;  4LCH A;  4EO6 A;  5KG4 A;  4K4V A;  1LWC B;  1REG X;  2V2Q A;  2HAI A;  1FJG E;  2IMO A;  2PC6 A;  3IR7 B;  4DZ6 A;  1FXD A;  2IVM A;  4TQR A;  5JEA E;  4PRV A;  4O3S A;  4QZV B;  1MU2 B;  2LQ5 A;  1S0N A;  1JWW A;  1EZZ B;  4PUO A;  2KO1 A;  4F04 B;  4PYA A;  4LRA A;  1M5P C;  1AA1 B;  2EFN A;  2IYG A;  3BKT A;  1S49 A;  9RUB A;  1YI2 S;  2ZDO A;  1IKY B;  1VJQ A;  3G4S S;  2FJW A;  3A1Y G;  4NLQ A;  1UA1 A;  5EX3 A;  1LWX A;  1R6V A;  3OD2 A;  4R8U A;  3UI3 A;  2M70 A;  5K8O A;  2RRB A;  1DTQ A;  3TR5 A;  1RWP B;  4RJV A;  3KUE A;  1CEZ A;  4F67 A;  4NLW A;  4JI2 J;  4K5R A;  1TKX B;  3BSC A;  1XMO J;  1HQE A;  1LWE B;  1TVR A;  3GE9 A;  2ZD1 B;  1RIS A;  5CYJ A;  3KMS A;  4CO2 A;  1OIA A;  2CNN B;  2GJF A;  4DQR A;  5KOW A;  3KJQ B;  4ANE A;  3DM2 B;  2IVF B;  3ZTR A;  1BQX A;  1BE4 A;  4NLU A;  4H54 A;  3MI7 X;  2V9W A;  2W9C B;  3GJT B;  3ET6 B;  1TK8 A;  4GKJ J;  1NK0 A;  2XWX A;  1PVG A;  1CJU A;  1SUQ A;  2BJ3 A;  3V6D A;  1RT2 A;  2ZDP A;  3HHD A;  1FKA F;  4NWB A;  3DLG A;  4UUX A;  1IM6 A;  1SI9 A;  1TU0 B;  2HFZ A;  4C98 A;  2BJ8 A;  1GX6 A;  3EX7 B;  4DV5 J;  4ZHR B;  4LBH A;  4JUZ A;  4NCB A;  1U8W A;  4BS2 A;  1EX8 A;  3PY8 A;  4ERD A;  4IOA Q;  4OJ1 A;  2KXH A;  4B3S I;  1TP7 A;  2UXB J;  1UW9 A;  1RAE B;  5DGB A;  3T1Y I;  5J1E A;  1OWX A;  4NCA A;  3IS9 A;  1OPI A;  1IBK I;  2J8S A;  5DDR C;  3MMA B;  2IBK A;  1UVM A;  3VF0 B;  1CS4 A;  2WZ1 A;  1MWY A;  2WON A;  1NBE B;  2VDI A;  2K06 A;  2GAH C;  3VGV A;  2W2N P;  2RDI A;  3MM8 A;  4MH8 A;  4IZK A;  2QA2 A;  2YKN A;  4CWB A;  1U26 A;  3W2W B;  1NM2 A;  3IA0 A;  4JV1 A;  3W65 A;  1X4E A;  4OI0 A;  1L3K A;  1UPP A;  2OD6 A;  1NSQ A;  1C1B B;  5IM0 A;  1HIY A;  1YBA A;  4B3T E;  4I0W A;  2N4C A;  1RTH B;  1SQG A;  1JLE A;  3MCS A;  2AGP A;  1L3U A;  1WUU A;  3C2P A;  4UY8 5;  5CD4 A;  4LUB A;  1CC7 A;  4WFX A;  2ALZ A;  1P8G A;  2LEC A;  3BR8 A;  4MDT A;  3ENA A;  3EZO A;  2QLF B;  1FWK A;  2BE9 B;  3NNH A;  2RML A;  1TEL A;  4M5D B;  1LWF A;  2HPU A;  1KVI A;  3J80 Y;  3D6M B;  4WFB Q;  2YWK A;  3HD2 A;  2OPQ A;  3QQC D;  2HGM A;  2PMW A;  3BGR B;  2FVP A;  3ETM A;  2BV3 A;  4RW4 B;  4EBE A;  1Q5Y A;  1CJT A;  3RR7 A;  2UU9 F;  1RB0 A;  2EK1 A;  3T19 A;  4OZ5 A;  2Z30 B;  3PM9 A;  4DS5 A;  1HNI A;  1Q86 T;  2JFD A;  2POK A;  4EUV A;  4QWB A;  1OS5 A;  1S1T A;  3QIP A;  4DCP B;  4KTQ A;  5JUM A;  2CQD A;  1JKH A;  4DUY I;  1N5T A;  4PR6 A;  3GIM A;  2F9D A;  3W9J A;  4KPC A;  2JEA A;  2M0G B;  4NEZ A;  1REV A;  1U2R A;  1C0U A;  2C3Y A;  4HL9 A;  3H4L A;  3DOM A;  4LFC J;  3D6H B;  1HR0 J;  3UVJ B;  4KPY A;  3DLE B;  3AY0 A;  1CPZ A;  1KQG B;  2P6T A;  1Q95 G;  2XZT B;  2HMI B;  3DYA A;  2YWF A;  4TY9 A;  2BKN A;  3FRY A;  2CQC A;  3C14 B;  3N01 A;  3AHP A;  8AT1 B;  1RHK B;  3KLI B;  1H7S A;  3MEK A;  3FEX B;  4KKO B;  1RHY A;  1NZ8 A;  5HK4 A;  1KIJ A;  3HD1 A;  3N6L A;  1UVI A;  4B3O B;  1WKJ A;  2BJD A;  4GQU A;  4B08 A;  2HIY A;  3H8Y A;  5CH7 B;  2XS2 A;  4EI2 A;  4NLD A;  2ZH9 A;  2W4C A;  2UV8 A;  1Q5V A;  4NAS A;  4ZCI A;  1VRQ C;  2VG6 A;  1WI8 A;  3WU3 A;  4DFJ A;  2CIM A;  2PO2 B;  2JEB B;  3PXG a;  2WP8 A;  2RIL A;  4QPT A;  1VC5 A;  2XZW A;  3DU6 A;  1GTH A;  3R1H A;  2DNZ A;  4JI8 E;  2HFS A;  3NLC A;  4CLK A;  3P06 A;  1FEH A;  3KK3 A;  2CPJ A;  3Q23 A;  1N6Q A;  2LQ9 A;  4X66 E;  3BDP A;  5M2U A;  2VKR A;  1RHJ B;  4WP3 A;  2C2Z B;  1IBC B;  2H48 B;  4DV1 F;  2VJU A;  1YJR A;  1EAY C;  3K17 A;  3NEK A;  2F7V A;  3FEZ A;  2IIH A;  4DR3 F;  2HHW A;  3PX0 A;  1URN A;  1KHW A;  3S8S A;  2UXC J;  1LNQ A;  1FI4 A;  8RUC A;  2HHH F;  3DGP B;  2C37 A;  2CFX A;  1JB0 C;  1SPB P;  3FKB A;  2EI5 A;  4R5P A;  4YY3 F;  2ZZN A;  3I0S A;  3PR4 A;  3CC7 S;  5GAD I;  5A2Q U;  3M85 G;  3NKY A;  5C24 A;  4KHM A;  4XDD A;  1SIW B;  2J8A A;  5CZX A;  1RDR A;  4OYI A;  4B9U A;  3MEG B;  1RP5 A;  4DFM A;  4LF6 J;  3SQG B;  1S59 A;  4RW9 A;  3EVM A;  4OYB A;  5D3G A;  4Q0B B;  4M94 A;  1NH7 A;  2J0X A;  2XSJ B;  1SH2 A;  3L9Z A;  1Q16 B;  3BS9 A;  3B6B A;  3US5 A;  5IZH A;  2IM1 A;  4O3P A;  4JB8 B;  1OPZ A;  4YQW A;  2HIQ A;  1JLF A;  4Q45 A;  4AQY F;  4ZN3 A;  4JYA I;  1LW2 A;  4QIV A;  4X64 E;  1IKX A;  2PGC A;  1YKW A;  5E7O B;  4XPC A;  1RYS A;  3TRG A;  3P3G A;  2CJK A;  2H5J B;  2JX2 A;  1VQY A;  2ILY A;  2Z2Y B;  1CJV A;  4P7V A;  3SDE B;  2DT9 A;  2MKK A;  4IO9 Q;  4I2P B;  1HNV B;  2Y8W A;  2NSC A;  3IWL A;  2Z0G A;  2KXN B;  2MLY A;  3PRY A;  1XNR I;  4NI2 B;  5KFJ A;  2BJ1 A;  4JI1 F;  2KFN A;  5LMN I;  4IH6 A;  4PQU B;  2GW8 A;  5LJ3 Y;  1R0A A;  3BSO A;  2FPH X;  4JI7 I;  2SXL A;  4BCA A;  5A0Y B;  4JBC A;  3T1H F;  3A8J A;  1S77 D;  3P49 B;  4O0N A;  3V5R A;  4F26 A;  3SV4 A;  1YZ7 A;  5IQ6 A;  3QO9 A;  3AXM A;  3T6B A;  2FHO B;  4F02 A;  4DMZ A;  3U1N A;  2BDP A;  3J7Y U;  1X60 A;  3NNC A;  2QYG A;  5FWK A;  4LFA J;  2HS3 A;  2Y9H A;  3I32 A;  1RAA B;  1Z0E A;  2BRK A;  2D3O R;  3ZNU A;  2R7Q A;  4DV1 I;  2K7J A;  4J9L A;  3G6Y A;  1RLC L;  2WW8 A;  5EWF A;  2RF2 A;  5KFX A;  2CG4 A;  3R9L A;  5GME A;  2HAF A;  2VBX A;  3AFG A;  2DHH A;  2ZBC A;  2DGU A;  2PII A;  1RQ0 A;  1HNW E;  2DCU B;  4RW8 A;  5HJX A;  4CLF A;  3M32 A;  2RHQ B;  2YKP A;  5H1S V;  1Z2Z A;  4M63 A;  2EG1 A;  3TVY A;  1UDS A;  3RYL A;  3CJ0 A;  2VOO A;  2LP4 A;  3LTO A;  3SQO P;  3W8G A;  2CPI A;  4UOG A;  3DNC A;  2ZM6 F;  3UPF A;  3MTJ A;  4UOH A;  2KI2 A;  2VES A;  3JSB A;  4OYZ A;  2P6S A;  5LMU E;  4DL6 A;  5B09 A;  3E01 B;  3PV8 A;  5H9F J;  1KDN A;  2NSB A;  5BYS A;  2J5A A;  5KFC A;  2XMK A;  1FDB A;  1YJ9 S;  1D9D A;  3CGI A;  1X31 C;  2MGZ A;  2D41 A;  4B3M F;  4PRF A;  1XR6 A;  5L38 A;  1NEE A;  1ZM3 A;  5HRO A;  2V4J A;  1VQ9 S;  2EKN A;  2J0S D;  3CUL A;  4LF8 J;  3J81 U;  3VQT A;  1U09 A;  4PPD A;  2YQ1 A;  1B7F A;  3BBB A;  3NS5 A;  4OMF G;  1RWX B;  2NN6 A;  2V8P A;  4DV7 E;  5AXL A;  5IWA E;  1Y60 A;  3DI6 A;  5H9F K;  4LPF A;  2G2Y A;  1XEZ A;  1HBU B;  1R0C B;  4DV2 I;  4NLO A;  1OY9 A;  4Y00 A;  2O1U A;  3VHQ A;  1C0T B;  3V81 B;  4F4K A;  3ENW A;  4DPO A;  2ASY A;  3T1Y J;  4TLR A;  1ZA2 B;  4MMO A;  1WHW A;  3DOK B;  3R7B B;  1S0V A;  1T9X A;  1IR0 A;  2Z57 B;  3MMC A;  3EJM A;  4ED2 A;  3MCM A;  3MPW A;  2GIQ A;  3VVT A;  4E98 A;  3E8O A;  5F8L A;  3B8H A;  5ETO A;  4WKR A;  2XY6 A;  3EZU A;  3P5B P;  1UWB B;  4H4O B;  3CJ8 A;  1B99 A;  3RBE A;  4LF5 I;  3RR8 A;  5E5N A;  2XHC A;  1VIX A;  2RJZ A;  4DR5 E;  2D1C A;  4ZVE A;  2PNM A;  2GQ2 A;  5KFE A;  1KQS R;  5HO4 A;  4DV0 E;  2CPY A;  5L3J A;  3N9U C;  2R7W A;  3CDA A;  3FSX