3PYGA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
GSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 83
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pygA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pygA01
4DPXA 2ZBKB 2BM0A 1IBLI 4DV3I 4LFCE 4B3ME 2F4VE 4YY3I 2DEIA 2EFGA 4URLA 4X65E 4DR1I 4LFAI 3JAMC 2UUCI 1H73A 1D6TA 3QT6A 1I94E 1HNXE 1VISA 4HACB 4LF5E 1OJ4A 5A2QQ 3K1JA 4YHHE 3J81C 4OX9I 4JV5I 4X62E 4HACA 4LFBI 1ZM3A 4Z7YA 4JI8I 1HNWE 1ZXNA 4DUYE 2X7IA 1HNWI 1ZM4A 5LMUE 4DV7E 4NXME 4AQYI 1MG7A 4XTJA 2VQFI 1N33E 4P7AA 4JYAE 4MYTA 3B78A 5GMEA 4FWDA 5IWAE 4JYAI 4DU7A 1KIJA 1EA6A 4P52A 1FNMA 4JI4E 2V34A 2Q2EB 3V5RA 1J5EE 4M1KA 1RREA 1ZM9A 3H4LA 2GS8A 3WU5A 1DARA 4DV5E 2J7KA 1N36I 4GKKI 4KQVA 1Z0EA 4I3HA 2ZM6E 1HR0E 3WU6A 4DV4E 3J81Q 2UXBI 4DV6I 4LF6I 1XMOE 2BV3A 1XMOI 5L3JA 2UXCI 2UUAE 4DUZI 1IBKI 4ED4A 3V2UC 1ELOA 3T1YE 2E1RA 3LTOA 3J7AG 4KHPI 5LMNI 4UTGA 4B3TE 2HFUA 2HK3A 3QT8A 4JI5I 1IBLE 3ZZTA 1N34E 4DV3E 2V2QA 2VF3A 1N34I 1XMQI 4YY3E 2A2DA 1N0UA 4DR7I 3OTOI 4DR1E 4LFAE 3PYEA 4DV0I 1BKNA 2UUCE 3QT7A 4LF4I 4JI7I 4EMDA 4JG4A 2VQEI 1Z5BA 1HNZI 4OX9E 3T1HI 2V2VA 4JV5E 4HXZA 2HKEA 1EI1A 1S4EA 3CWVA 4LFBE 4NXNI 4JI8E 3ZKDA 2NPFA 4DU8A 2WW4A 4AQYE 2OI2A 2HHHI 4X66I 2VQFE 3PYGA 1KVKA 1N32I 2UU9I 4PRXA 2ZITA 4DXLA 4DR6E 4K0KI 4Z7CA 4DR6I 3J80C 4HY1A 3ZM7A 4GKJI 4JI0E 3M6AA 4JI2I 4JI0I 4DPUA 4DR3I 1Z0WA 4PU9A 3B82A 1MX0A 2AJ4A 4JI1I 4DR5I 4RPFA 2BM1A 1NHIA 4LF8I 1N36E 4GKKE 4LF9I 5FLXQ 1IBMI 1B62A 4ZVIA 1Z5AA 2A2CA 2UXBE 4FW9A 4DV6E 4LF6E 5BR8I 2UXDI 1NZ0A 1FJGI 2UXCE 1FWKA 4DUZE 1IBKE 4X64I 3K17A 4JI3I 3PYDA 1PKPA 4KHPE 4DV1I 5LMNE 4PRVA 1XNQI 3GONA 3LPSA 3ZZ0A 2HFSA 4JI5E 1FI4A 4WUCA 1NHJA 5LL6R 3J80Q 1XMQE 4DV2I 2V2ZA 5GMDA 3ZKBA 4DR7E 3OTOE 2UUBI 4LF7I 1FWLA 4DV0E 1B63A 1S16A 4UT4A 2XEXA 4B3SE 4JI6I 4LF4E 4JI7E 1ZXMA 4B3SI 4DR2I 2VQEE 4DR4I 1FKAE 4B3RE 3D4JA 1Z59A 4B3RI 4WUDA 3PYFA 1HNZE 1PIEA 1K47A 1N0VC 5FLXC 3T1HE 2HK2A 4LFCI 2R3VA 1Z0GA 4FWGA 4B3MI 4WUBA 2F4VI 4NXNE 4X65I 3QT5A 3HULA 4DPYA 3WU3A 1I94I 4USKA 1HNXI 1H74A 1ZM2A 2HHHE 4X66E 4LF5I 1KTVA 1WUUA 4YHHI 1N32E 1MU5A 2UU9E 1PVGA 3B8HA 4X62I 4K0KE 5IT9C 2X36A 4GKJE 4DUYI 2V8PA 2HKJA 4JI2E 1KKHA 5LMUI 3F0NA 4DR3E 4DV7I 4NXMI 4FWHA 4JI1E 4DR5E 1N33I 4DPTA 4LF8E 1Z0CA 5IWAI 4LF9E 1H7SA 1RR9A 3WU4A 1IBME 2E5LE 1A6FA 4HYMA 2E5LI 1Z0TA 5BR8E 2LJPA 4JI4I 1NHHA 2UXDE 1FJGE 1U2RA 2DEJA 1QZRA 3JAMQ 1J5EI 4X64E 1XNRE 4USMA 4R1FA 4MYUA 1XNRI 4FN5A 4DV5I 4JI3E 4DV1E 5A2QC 1XNQE 2ZM6I 1HR0I 2R42A 4DV4I 1Z0VA 1Z5CA 3Q1QA 1XHKA 5IT9Q 1UEKA 2CZ9A 4DV2E 4DPWA 2UUAI 3LNUA 1H7UA 2UUBE 4LF7E 3T1YI 3ZZUA 4JI6E 1H72C 1Z0BA 4DR2E 4DR4E 4B3TI 3J7AM
chains in the Genus database with same CATH superfamily
1Y4ZB 3W2WB 2UUCJ 1HWIA 3N0VA 3M9MB 4RZRA 4I2PB 3OL9A 2F40A 5F9NA 4C8KA 1GAOA 4YP3A 2AEJA 2JLGA 3QJLA 2UV8G 1H73A 2RS2A 4IS9A 2NZ4A 1SC3B 2AD9A 1BQNA 1SIWB 1OJ4A 3KUEA 3OHBA 3J81C 3UNGC 5J2NB 4HACA 3TVYA 4DR2F 4EU0A 1KQSR 2XSFA 1IUJA 2Z2MA 3HHEA 4QIGA 3TJAA 4IG3A 3U1KA 1HQEB 2Q6CA 4YB7A 1RT5A 4X4RA 1YJ7A 1UAWA 3R8YA 4CLFA 3MMBB 2YX1A 5C25A 3QAUA 3ETMA 4RU2A 2JL9A 2OPSB 3KJVA 1VBYA 2B4PA 2CG9A 2WCXA 1H3DA 3SQGB 1F9EB 1YDLA 2EFOA 2R9LA 2VJUA 3CGIA 4P2MA 1HYSA 2IBKA 1XMOI 4YQWA 3RBDA 2E5GA 5D0EA 3FRZA 1ELOA 3KLVA 3O1LA 2KM8B 1U1PA 1SUQB 1KOOA 4K4VA 4CT9A 1F1BB 3NRBA 3PW4A 4K4WA 2ZH3A 1Q86T 5JEAF 1DFDA 4DR7I 1P1TA 1LWFB 2KYZA 4R5PB 2HFZA 1H2TZ 4X4SA 1B0TA 1KSPA 2FY8A 2X1AA 4ERDA 3CW2C 1IR1A 2V2KA 1LFWA 4KV8B 4TNOA 5HVFA 1EI1A 2D3O1 2IA6A 2G1HA 1AFIA 3H5UA 4M5IA 2I6WA 2C39B 4CDIA 1N32J 2XYPB 2ZE2B 2W7OA 1B0VA 4C9DA 4QYZJ 2QA1A 1T9YA 2QA4G 4N56A 4PRXA 1N33J 3HHKA 3DXSX 3LP1B 4MFBB 4HDGA 3P3DA 4OX9F 3JSMA 3PV8A 5T7LA 4X4VA 2UVWA 1YWXA 4JI4J 1TUGB 1NZ8A 2BR2A 1UPPA 2PDAA 3WX8A 4MIBA 3Q2TC 1J5EJ 4IFDB 2JRSA 3JSYA 4AD6A 2AZ1A 1VC6A 3EVWA 4PAAA 1HPZA 4PXEA 3OTEA 4JYAF 1FJGI 1C0UA 2BJDA 5K14A 3K8WA 1VQ4S 1XMBA 3BQ0A 4DUTA 3H4BA 4PWUA 1SKWA 1RT2B 2FVRA 4KHPE 1S1XA 1RE1B 3BO3A 2I0XA 5J1EB 3KUHA 4AIDA 5E3QA 2AT1B 4C3LA 1R31A 2CPFA 3BSNA 3BDPA 1AB8A 1X4HA 2PO0B 4HKQA 4X65J 2VQEE 2CDQA 4B3RI 1PIEA 2YKMB 2B9WA 1U2CA 1RCOB 4OYOA 3A3PB 1HNVB 1O8BA 4JV5J 4EFAC 2GGPA 4PG5A 1TL3A 1RA6A 1H74A 2H4WB 4IFDE 3D1QA 5CH7B 1UDSA 4KPYA 4YHHI 2GA7A 3HM9A 2H1YA 3OPKA 3P4UB 1RT6B 3M8PB 1SL1A 4RW8A 2XI2A 1YHQS 2VESA 2OIHA 3OVBA 3KG1A 3M8SA 4FKYA 4H4MA 3MCMA 4DX6A 5DLGA 2GIQA 3GV8B 3KLFB 4ZP6A 1ZTWA 1LW0A 1MWYA 4WP8A 2BVZA 2R7TA 3EGVA 3AQPA 3K5OA 2E7XA 4J9OA 2VASA 1C1CB 2MB0B 5JEAD 1GMWA 2BRKA 5K8NA 5F8LA 5ETOA 1IM6A 1VI7A 1FRLA 1VS3A 4DUZJ 5B0CA 4DSKA 1UJ4A 4NZ7A 1V6HA 2RRBA 3HO1A 4OZ2A 4C8MA 1G7CB 2ACMA 2JHEA 3IBWA 1K0VA 2YPYA 1X4GA 3R7SB 1HBNB 3ZZUA 4FXVA 4WP9A 4EYHB 3GLLA 4OZ3A 2RQMA 4PWDA 3PX6A 1YRUA 1UKUA 3NCPA 2BJ1A 2NN6F 5DG8A 3DFEA 3RAXA 1A9NB 4JI7J 4ZVHA 1XC9A 2AQ4A 4LREA 1WD6A 3OD2A 3QYYA 4OZ1A 3M8RA 4O23A 4G65A 1WWHA 4QR2A 3Q6MA 2H4YB 2DRAA 1C1BB 3NMRA 3DRSB 1NPPA 2C3PA 3K7RA 2HHHJ 2YTCA 4NLVA 4FZVA 3HJCA 2HNDA 1YG0A 3FCVA 3D1HA 3E01B 2HHVA 1VQ7S 1QM9A 4ZA1A 4RW7A 5HQ8A 1N33E 2BA1D 3UN3A 4NA2A 4IUFA 5MAOA 2R2RA 4CO5A 1I94F 3SXLA 5GAGI 1X9WA 2LFVA 4JI4E 4L75A 1S1TB 5KFIA 2Y3YA 1J5EE 1S9FA 1EKRA 4NCGB 4FVMA 3L7UA 1S48A 3KLEB 4KQVA 3WU6A 1FXLA 2IPOB 4KT0C 1DTQB 3JQKA 3KLGB 3OFEA 2CUYA 4MKVA 2V50A 4WIQA 3J80U 5HMZA 4OYWA 3M85G 2MQNA 1VOMA 2WOMB 3HT0A 3TZYA 1EIYB 4DFPA 3M2RA 2F5GA 4M5DA 4U67Q 3OTCA 3UDLA 5DS7A 3QT8A 3L4BC 1N34I 2R2TA 4DV4F 2LLZA 1W7WA 3PYEA 4DL6A 5DG9A 1M5HA 3GFYA 4OYPA 4IO9Q 4PWWA 3A8KA 4NXNJ 1UJ6A 3MTJA 2VPZB 3IFEA 1V3ZA 1Y6ZA 1Y3KA 5DDPC 2O67A 5CAAA 4YR2A 4JV5E 3TVKA 2FJVA 1S4EA 1ZBTA 2XZWA 3VQSA 2W2OP 3V81A 1CLFA 4QWEA 3NCRA 4URSA 3MEKA 1RAGB 1NJZA 1O5JA 3NGRA 3RB3A 2R8GA 4KC5A 1U1RA 4DF8A 4JI2J 4NXMJ 1WDTA 2PD1A 3VALA 2F8MA 4N3OA 3X3UA 2K1RA 1XWLA 4NE9C 4LBPA 2C38A 1RKIA 4DR5I 1NHIA 2OKQA 1R6YA 2A18A 2W9CB 2GQCA 3CJRA 1U1LA 1R0CB 2QX0A 4L6V3 2FLOA 2LA6A 3L3CA 4N8OA 2CJQA 2UXCE 4DUZE 4ID5B 2Z5CB 2W4DA 3I55S 1IKWA 3VAKA 2J65A 1XR5A 4OI3A 4AL5A 2LCWA 2UUAJ 3PIOQ 1PKPA 4PRVA 2HWTA 4P2SA 1OQ3A 4OYMA 4YB1P 1RHKB 2JE6B 3R5AA 3I82A 3H98A 2DRDA 3AOCA 4IDKB 3CCLS 3J80Q 1F2HA 4DSIA 1BXNA 1VQKS 4BC7A 2HWIA 1FDDA 3PACA 4L73A 1UWBB 4OIXA 5M2UA 2DO4A 5DQHA 2AGOA 2XEXA 2RDIA 3DDNA 3OFHA 5MLCV 1NB7A 4JI7E 2DXEA 2Y1LB 2E1MC 1RJJA 4KQZA 2NN6A 1EJ7L 1F5CA 3ZZOA 3DLBA 4B3MI 3TEHB 4IR9A 2LXUA 4WP3A 2JFDA 1JXEA 5HMYA 2HHHE 1RT7A 3CD7A 2RMLA 4ZITA 1S49A 4RW4B 4MKAA 5J2MA 4OHXA 2B4UA 4IKAA 2DHGA 4ED3A 1JJ4A 5IT9C 1TV6A 3ZNUA 3LWLA 2BZ2A 2FZKB 2HW3A 2C37B 3RRHA 1LOUA 4TYAA 5B0BA 2E7WA 1FHTA 4FWHA 4ZMMA 3V6DA 2QL7B 1VQ6S 3AJ2A 3PIPQ 4WZQA 3CNQP 1JMTA 3P5TL 3F73A 4E98A 4DQPA 5U47A 4NLTA 1RT1A 5DETA 4FP9A 4OI2A 2EK1A 2YPZA 2UU9F 4BDPA 1YRTA 2XYHB 4USMA 4MT1A 3ISND 3PR5B 1XNRI 1XMOJ 1AZSB 4RLEA 4I7FA 3GFHA 3AQOA 4P2XA 5A2QC 4JI0F 2ZM6I 4F7VA 5ETTA 1UVJA 4JI1F 3GILA 1XHKA 1MW7A 4RL1A 4RX6A 3Q24A 4C8LA 4WE1B 3OW2R 2ZJQQ 1NJYA 3PEJA 4DR7J 2V9WA 3G8QA 1Y00A 2VG5A 1ACMB 4Q8FA 3GCWP 2YKPA 2YWKA 1RHJB 2GVDB 3JSRA 2UUWA 2FY1A 5FDLB 2CQ4A 2BA0D 2M4MA 4OLOA 5BYQA 1R3NA 4YUDA 4ZHRA 2IY5B 4J9LA 1BLUA 1F3VA 4RNFA 3K1JA 4K4ZA 2HBYB 2J6UA 3HHLC 2X1BA 2O1PA 3E51A 4Y6IA 5FWKA 5A8RA 4A8QA 4JI8I 2ZOFA 1HNWI 3LP2B 1R43A 1RWOB 2C2ZB 4DI6A 1T03A 2Z5EA 1ITPA 4NXME 3UQSA 1I5OB 4FWDA 1HNIA 3MEDA 4JV1A 4KHRA 5LJ3Y 2VPYB 4OQJA 5HP1B 3FDSA 1NK6A 9RUBA 1YSJA 4GVBA 2CWXA 2VBWA 5K8MA 3WC2A 3P8BB 1FJGJ 1HHQA 3PRBA 4OI0A 3RW6A 1CQMA 2QMWA 1VLOA 4U7UK 2BJEA 1NZAA 4OHZA 5K36B 4ZJQA 3CCMS 3M05A 1T8EA 1VK3A 2XNRA 5IT9U 1GX5A 2DO0A 3DI6B 2HHTA 2UUAE 1VBXA 1OSDA 2BR0A 1N6QA 1Y11A 4CT8A 3W64A 2HHUA 4JB8B 4ZVPB 2ZH5A 4DQQA 4MIWA 2ZKUA 1U8WA 4ECWA 5CYMA 2AJFE 3DOLA 1T11A 2ADBA 3Q8PB 4B3RJ 1Y5IB 3PHEA 1SB6A 1CQNA 3MUTP 2FIUA 1KWMA 1R6LA 4EMDA 1KHVA 3DOMA 1TK0A 3HPOA 3DD6A 2VA3A 1XERA 2JEIA 1H7WA 1FDBA 2AYEA 2MJUA 2HURA 1EAYC 4X66I 5F8HA 4GKJJ 1KVKA 5E33A 3KJFB 5K36E 3BGRB 5LT5A 2Y1IA 3V4IB 5B0EA 2OD4A 2FLPA 3MM7B 1JLQB 3IGVA 3K2YA 2CADA 4DPUA 2KJWA 1Q8KA 2W2QP 3SCJE 1YLXA 4NI2B 1FJCA 4NLWA 4PU9A 2ZFHA 3TRGA 2NSCA 1QSYA 4FPIA 5AJ3F 2H65B 3H8YA 1YH8A 4ZVIA 2I8EA 1G3OA 3HX9A 2DGQA 5CA5A 3UVJA 1IQZA 2EW9A 2WVFA 2DR9A 4M5LA 1AYEA 3ILJA 5E7OB 3T6JA 4G1PA 3KK1A 4A8FA 1RHRB 2RU3A 3H5SA 1RT3B 2LEAA 2GHPA 2H51B 4FXDA 3VGSA 3EDRB 4KGKA 4O3QA 1QAYA 2CQ3A 2FVSA 3PY8A 1HL6A 2IYGA 4DR7E 3S01A 3GE9A 1R0AA 2AF6A 3BBCA 1FWLA 3N6LA 3FMWA 2O01C 1J5OB 2QEXS 1TVRB 1U1OA 2ASLA 2IM2A 5KFYA 5C24A 2DRBA 5DNXA 1YJ9S 4NCAA 2MQLA 1Z0GA 1VQLS 4KHPF 1RP5A 2DK2A 4KO0B 3QQCD 2B6AB 1XN9A 3AH6A 4NA3A 5KT6A 3NAIA 4AUKA 2CQ1A 2IRYA 1Q81T 3D28A 2B4VA 4QIEA 2YX7A 1KTVA 4CLKA 3MR7A 4B9UA 1B99A 4DV7J 1FVSA 5IM0B 2KZZA 2CJKA 3D0HE 1CSJA 2VQEF 2GO4A 1OPIA 5IWAJ 4DUYI 2KT5A 2IC3B 4UF4A 4U9RA 4DCOB 5EUHA 1CJUB 3C16A 2IESA 2YWEA 5HMXA 2YWHA 3ITHA 1UDQA 1YZ6A 4RNNA 2RHSB 3AT1B 3D0IE 1SKUB 1WDDA 4P75A 2IVYA 3A12A 2E5LI 4IFDF 1JLAB 4PZVA 3MR2A 1FJGE 1KS2A 2XB2D 3FNNA 3KK2A 1SIZA 4KKOA 3TZZA 3PEHA 4NYOA 4FNHA 4R1FA 1YJVA 3LPYA 1Y0HA 4PUOB 2ZWOA 4O3NA 2DNRA 1Y5NB 3CPWR 2XLKA 2VB6A 1HBMA 2PI5A 1O0PA 1WOSA 2EBGA 2CNLB 3KYLA 5IC6B 3QAEA 2HQCA 1UEUA 2DY9A 4KSEB 2VDIA 1DLOB 4IOCQ 4JBCA 1N34J 2V63A 4R8UA 3RBEA 1KR4A 2BX6A 3B54A 4QW9A 3CE8A 4NLSA 2J5AA 4EO6A 1VRTB 4MKBA 1VQPS 2O3ZA 3X1LB 3IG1B 3W2WA 2QMXA 3H20A 3MEEB 1HBUB 1YX2A 4K4SA 2V68A 1Q8LA 2RILA 4OO1E 3L95X 1JXLA 6FDRA 4YHHE 4Q45A 1WACA 1S1VB 4MQYA 1BUXA 2YQ0A 3UDVA 1RU2A 1FKAF 3J81Y 5J2NA 3GMEA 1VC0A 3TYTA 2GNKA 2XLIA 1SL0A 5HROA 2E66A 4TU7A 3HFZB 1RWKB 3GV5B 2ZH4A 4DU7A 5IT4A 4DR5J 5B09A 5J2QB 5D0HA 2JC0A 2AYGA 2C3MA 3CCZA 3THVA 2BANA 1BQXA 2HMIA 1Q78A 4ETXA 3W9JA 3RU0A 1GXLA 4PG8A 2IJNA 4Q0BA 4KH0B 1L3KA 3IWXA 1Z0EA 2OPSA 5CD4A 5KFGA 2J9EA 3QZ7A 1NDCA 4IFVA 1YJRA 1N33F 1RTDA 3WZ0A 3ENAA 4P72A 4J9KA 2AYBA 3RZAA 1VQMS 3MTKA 3SCKE 2AHOB 3R7BB 3H5XA 3EVOA 4NMXA 4F4XA 3A8IA 4ZK7M 1JLCB 4ZIVA 4LBHA 2DJWA 4JI4F 1JLFB 4UUXA 1K1SA 4ZVEA 1J5EF 2KKHA 5D4PA 1DQ9A 2UZAA 2VFUA 3ZZTA 2DCLA 5ETMA 2BE2B 4U3BA 4J3DA 1SUQA 2HS0A 1EZZB 2J0QD 3KMQA 2PNZA 1QJHA 5EX0A 3D6HB 4DV0I 1AW0A 4B3MJ 2EFPA 4ZP7A 1JQGA 3MMCB 4ZN1A 3K85A 4R5PA 5G0RB 3QATA 3A8EA 1YTYA 2W2NP 3VAGA 5HATA 1CULA 1S9GA 3HVWA 2MLZA 2HKEA 4IZKB 4IFDD 3CWVA 3O3LA 4B9VA 3D2WA 1RISA 4ZPWR 4LQ3A 1UVNA 2HNZA 3L7ZB 2VV5A 5RUBA 5C0XA 2MHNA 1VBZA 4HI2A 2APOA 2CPZA 3WBZA 1KLMB 5K5MA 2ZE2A 2N7YA 2O66A 3B4TA 2WRMA 4HY1A 3ZM7A 2PO1B 5B0GA 2J9CA 4LF9J 5AXLA 2RDJA 2MQPA 1IBMJ 4I1TA 4JV5F 5DZ6A 3N79A 1GH8A 2GMJA 3OFGA 4LF8I 3MUVP 1RSCA 2WHOA 2OAUA 3M7ND 1XNRJ 4LBIA 3KJNB 3IBCB 2JNJA 3KLIB 1V5IB 5F8NA 2ZM6J 3GU0A 5IV3A 2B56A 4ZPCA 1IWGA 3DDIA 5DRQA 4LF2A 4RUHA 2DGTA 4WFNQ 1HARA 3CJ5A 4Y34A 3GONA 2BA1G 2HQFA 2BE9B 2BJ7A 2DYAA 3VQTA 3S1TA 1GMUA 4GO5X 1U1MA 1S6QA 1B7YB 4NLYA 3T5JA 1HKAA 1HLWA 4LF7I 3LGNA 3EJMA 2QL9B 3KK3B 3ET6B 4DN0A 1B63A 2EI5A 2R2UA 1ZXMA 2UXCF 3W5ZA 4DUZF 2PO0A 4I64A 1X9SA 1N0VC 5FLXC 1QVGR 1VMBA 4F0MA 2BOAA 4N41A 3QT5A 2YKMA 3DRYA 4AYBD 4NZ0A 3JS9A 4DPYA 3JQMA 1MN9A 2VOOA 4JI8J 1M90T 1HNWJ 3MM6B 4Q7AA 1PVGA 1VR6A 4RJVA 4JI7F 3QJPA 1NDKA 3QRRA 3TP2A 3G4SS 2KI2A 4IG3B 4HHJA 4N7TA 1HWKA 4L3NA 1KKHA 3M8PA 2B8PA 2R7XA 4DR5E 2VA2A 2BW7A 2O1TA 3C8YA 3CO9A 1L5UA 3SFGA 5C25B 1H7SA 2FDNA 1SH0A 2M0GB 2V8VA 1REGX 2BKNA 2ILZA 2HHHF 3VZIA 5HSPA 3KJVB 4KPCA 1LXJA 2FJAB 5KT2A 4ZS6A 3EWGA 1PBAA 1T9TA 3GLJA 5E3AA 4QIWD 1HYSB 4C98A 2QC3A 1X60A 2CPIA 2RB7A 4QWBA 1PJ5A 5KG5A 3G6XA 1JKHA 2CJYB 4Y2AA 3EGWB 2RU9A 3CCJS 2MQQA 2I2YA 4WIIA 2ZBKB 2XZTB 3EM1A 1IBLI 1NLKL 2WVCA 4B3ME 4YY3I 2DEIA 3I0RA 3KG0A 2CXEA 1IKVB 3MUMP 1QY7A 1WC1A 3AJDA 3NWRA 4K5RA 3T1AA 1PAEX 4MU3A 2EFNA 3HT3A 3RYLA 1FE0A 4X66J 2EEYA 5KFVA 2LDYA 2DNPA 4K4YA 3M6WA 4A8MP 2YNHA 1CJVB 1T0TV 1ZM4A 1D9DA 4QR0A 4ECTA 4Y65A 4FNIA 4USTA 4ZVTB 2DITA 1XR6A 1P42A 3JSMB 5FLXU 1S1UA 2PT0A 2BR2B 4OI4A 2B0GA 2POKA 3I96A 1RAIB 3ZXWA 1ZM9A 1LK7A 1P9YA 3GP9A 2XWXA 1HPZB 1D0EA 1S1TA 2J7KA 4H54A 5EGYA 2GJFA 4JI2F 3JYTA 2ZM6E 3ZTQA 3M4XA 4NCGA 4NXMF 4A48A 4DL3A 1AA1B 1ZTTA 1S12A 5BXIA 1X4CA 4LF1A 2G0CA 5BYRA 3LAKA 3BJYA 1DTQA 2IJFA 2XC9A 5L1KA 5IQ6A 3LGHA 2Q3PA 4UOCA 3TUIC 3CT9A 1NRKA 3UE2A 3RAQA 4LRDA 2QT7A 4OL8A 2VF3A 1NK7A 2EFVA 4OHYA 1MMLA 1UJ5A 1C2PA 4F4WA 3O5TB 1UFKA 1IVZA 2B9XA 2HZVA 2B7CB 1NSQA 2JEGA 2CJAA 2UUAF 5HK4A 4QNKA 2GGPB 1T7PA 4H4OA 1BC6A 4DZDA 1TU0B 4JI8E 2MQMA 1QE1A 4CCHA 3DMJB 1X31C 4U6PA 1U09A 1WF0A 4RW8B 4O4GA 5F0UA 4A8YA 4DR6E 4HL9A 4TU8A 3NS5A 1X4DA 2XS7A 1VDHA 1CC7A 4LMZA 3GCMA 2E5LJ 4B9NA 1Z0WA 2F1DA 2BKOA 2BA0G 3MPWA 1U8SA 4CO0A 1WKKA 2PMHA 4JUZA 1MLAA 1WSVA 5FLXQ 3T5KA 4AFFA 3BKTA 1XJWB 1PCAA 1XR7A 4FKXA 4LVNP 3CCRS 4BS2A 5K36F 3D6MB 1FWKA 1FFGB 3TUPA 3UR3C 1D8ZA 4IZJD 3DOKA 3P6YC 1X5TA 4DV2J 2Z5CA 2AP6A 4QJVA 1ZETA 2Z5BB 2Z30B 4QPXA 3PKYA 5GMDA 1KC8T 2CRLA 2DY1A 3ZKBA 2PE8A 2IM1A 4BC9A 4J9PA 3MFHA 4ED7A 3BPDA 4IOAQ 4DQIA 1XMOF 3T41A 1UWBA 3FBBA 1KQKA 2U1AA 2FZCB 3BPSP 2J8SA 4MU0A 1WOOA 2NYHA 4FBTA 2F4VI 1RHQB 3D6FB 4DFMA 4LF5J 3NNHA 7FDRA 5H9EK 4PG4A 3RB4A 4X66E 4ES3A 2CJXB 4DR7F 3QFWA 3QO9A 3D6TB 2RUSA 4I0WA 1U4BA 1KFSA 2V8DA 2JEBB 4X62I 4RW7B 2D3OR 2NXEA 2Z0GA 3LF0A 1EP4A 2IRUA 4QYZK 5KFJA 1RI7A 5IT9Y 1KVJA 2BYCA 4ANEA 2C37A 3JTPA 1REVB 1FKOA 1UWAA 4KYZA 3QRQA 2AJQA 2XMKA 4IG0A 1FK9A 5ETQA 4X2BA 3IC1A 2LQBA 2B9YA 4MYUA 1RCXB 1FX4A 3MCOA 4DV5I 5DQIA 5E3CA 2OD6A 4V1Ak 4ED1A 3I4PA 4QU6A 1Z0VA 2YWGA 1YIJS 1AZSA 1U1QA 4FW6A 3IM8A 3L9ZA 5A2QY 3M2RB 2L9NA 2CZ9A 2VHGA 3ZTRA 4M5DB 1F0XA 1SPBP 3H0PA 4HVZA 2L9DA 4G3IA 2W2MP 1B64A 1FJGF 4B3TI 4DV0J 4FW4A 1YZ7A 4WK3A 3OR1B 2OFHX 3W9HA 3UDEA 5DROA 4J9VA 3DRPA 3J7ZT 2CAJA 4X4UA 3W8PA 2V8GA 2UUCI 4F50A 2CPHA 4BA1B 5K20B 2LU1A 2ZBPA 2R7UA 2KFNA 1AUDA 4C8YA 3V81B 2FC9A 3AJ1A 4NBQA 3R5BA 3G8SA 1QSSA 2AV5A 1Y4SA 2MSTA 4J9UE 2CNNB 1FVQA 5K36D 1RBAA 2GIFA 4DUYE 4B3RF 2SXLA 3UW1A 4A8OA 2C3OA 2J0XA 3M8WA 2LEBA 3QFHA 4AQYI 4I6WA 2V4RA 2MHEA 2GJIA 4JYAE 3B78A 1BQMB 1WHXA 1WEXA 4AXJA 5DLFA 2C38B 3LOUA 5A8KA 1TELA 2MTLA 5ELWA 2IAJB 4OO1F 1N36J 4KTQA 1UDOA 4YHHF 3V5RA 3MPVA 5JJBA 3SCLE 1RREA 2Y1RI 4DOZA 4KY3A 2VUGA 5HP1A 4FW3A 2FC8A 5B0AA 4DZ6A 1RAHB 1KEKA 2IM0A 2BRLA 3JSBA 3R6LB 3DLJA 2DH9A 2E5JA 4OZ5A 2NSBA 3MF5A 4CH7A 1SJ3P 2OMOA 3N6MA 3DI6A 4LF7J 2HQ3A 5L9XA 2EBEA 1Q8BA 4ZJLA 1RTJA 5A0YB 3MECA 5D0GA 2DBBA 4ZPTR 1S57A 2PO2B 3POTA 3OTOI 1S77D 2I5JB 3DM2A 2YBVA 4G6VB 3EXCX 2J6TA 2HIQA 3QWUA 2V9KA 3D54A 3CF5Q 4ZIWA 1LQ9A 3NGTA 5KG3A 1OQ6A 4WF9Q 2RQCA 4C97A 3LWMA 2RRAA 4K5SA 4ZVOB 5ITHA 2HLUA 1RT7B 3W5XA 3C19A 3VV2B 5J2MB 3L09A 2F3JA 1WG5A 1TV6B 3PYGA 1YJTA 1X5PA 1WTBA 4WFZA 4ZLJA 1OY9A 4X84A 1N32I 2EFQA 1EKSA 3D66A 1G2EA 4K0KI 4K7QA 1UFWA 2K8GA 4L72B 1KVIA 1VRQC 1HHTP 3PXGa 2DNHA 3V4IA 2C22A 2AJ4A 2DNMA 3W8GA 3KWMA 2HLTA 4UY8T 1PKUA 2ROGA 3QIPA 4I7FB 2R7RA 2WB1D 3G2XA 2KH9A 5IWAF 3RGIA 4ZLLA 1P9QC 2NN6E 3OLAA 3DLGA 2NREA 5EL9A 2JVRA 3KFWX 4M5MA 1FD2A 1VRUB 4DX5A 1Y5YA 4USJC 3LPSA 4NA1A 5E2QA 1WHVA 3TUJC 2ACYA 3OV7A 2I38A 3A8JA 1TK8A 1YITS 3ZO7A 3FSXA 4PEOA 3CJ4A 1M1KT 4DV0E 2VG5B 4YY3J 4NYPA 1S6OA 1WC5A 3T9ZA 1SBRA 5JEAC 2IDEA 1Z59A 2XWYA 2R8JA 1D09B 2PO4A 1J5OA 5KFMA 4LFCI 4FWGA 5FJ4A 5HL7Q 4IR1A 4RW9A 1RAOA 4X65I 4OO1D 3TAQA 3OT9A 1RWNB 3SSQA 2C42A 2RSQA 3DYAA 5L1LA 4MK9A 3WU3A 2CG8A 1N34F 1H38A 1HNXI 3FRYA 2B6AA 1CJTB 3GJQB 2IDLA 5A8RB 4QYRA 1LW2B 2BJ9A 3R9LA 2PEBA 5AXNA 2ZC4A 3GPAA 5KFHA 2UUTA 7AT1B 2ZH6A 3HVRA 1CJKB 4NCBA 1HNIB 2GCFA 3MEDB 5KFFA 3PS3A 5IM0A 4YEAA 3OSNA 2EVZA 3F0NA 4ISAA 3GCXP 4HR2A 2MZSA 2ZUAA 4LF8E 3MGJA 4A47A 1Z0CA 3G86A 3Q8YA 4GVBB 1JK9B 3SSSA 1X4FA 1IKXA 1K1QA 4OHWA 4G1QA 4F67A 3T5HA 5F8MA 2EK6A 4W4MA 1HR0J 1PYSB 4AM3A 2W24A 1UW4A 4I6YA 1JLAA 5KFWA 5E0OA 2VH7A 3DU5A 4Q5VA 1HWUA 3OJUA 4N47A 4CLLA 2XCPA 1HI8A 4RW6A 2ZDOA 4DR5F 1Y3JA 4PUOA 8RUCA 3D9BA 5HLFA 1RAFB 1QUPA 2CQHA 2Z2ZA 3IS9A 3LNUA 1X9MA 1C0TB 4LF7E 4DL4A 5LXRA 2KTQA 2H3EB 3J7AN 2FVQA 1RZMA 3SYZA 4BCAA 5KAKA 4FS1A 3MPDA 3KTQA 3M7NG 4HI1A 4DCJB 2E44A 3BZQA 3KDOA 2NXUA 4LFAI 2XHCA 3JAMC 3M6UA 1WG1A 1RYRA 3I9V9 2H54B 2IERA 3D3BJ 2EC2A 1IQTA 1GTHA 3I32A 1RTIB 4OYBA 1Q0NA 2J7WA 2K2PA 3CDWA 1VQYA 2QGFB 3TQ1A 2LQ8A 5GAHU 1IKYB 1SQEA 3BO4A 3Q8QB 1NAQA 3OXLA 5A8WA 4B3MF 3L7PA 3E2EA 6FD1A 5KG7A 1FDAA 1MWZA 2O1VA 1SJ1A 3CC7S 3RUBL 1CPZA 3FKBA 2ZHAA 4S0MA 2HQIA 3BYPA 3QGPA 4N8NA 3RR8A 5J2QA 5D4LA 1XK8A 2ZNZA 3MHYA 2HWHA 4NEZA 2U2FA 4NX9A 4ZLNA 2M3DA 3MDFA 4DV6I 1UVIA 4LF6I 1SQFA 2BV3A 4LF9F 3MM5A 4DFKA 2D9PA 3V2UC 3LTOA 2LQJA 1VIOA 1FRXA 2VFTA 4IRKA 3R2DJ 1R0AB 1U6FA 5EKWA 3QRPA 1IBLE 1XNRF 3U27A 2QLFB 4C2MA 4YY3E 4NL5A 1JLGA 2ZM6F 5C24B 1TFWA 2F4VJ 4A8KA 1N5SA 4F3OA 5KFAA 1Z5BA 1PBUA 4KIAA 4ITSA 4ZPVR 3KOAA 2D74B 1SVDA 4NXNI 1S6PA 5G0RA 3ZKDA 5IOLA 4MMOA 4X62J 1S79A 4ID8A 4NLXA 3TAMA 2JH3A 2YKNA 5E3PA 2ZH7A 4EZ6A 4B02A 3WQPA 5KG2A 2EG2A 3LW5C 3CJTA 3CMAS 1WC4A 1QSLA 3ITHB 4IRDA 3MI7X 4JI0E 1KLMA 2HQGA 4JI2I 3H2VE 1G1XA 2YXLA 2XG8A 3JAMU 2ALZA 2J0WA 4RPFA 2FPHX 2HS4A 4JI8F 3Q6NA 1HNWF 1PYOB 3KK2B 2W01A 2A10A 4KKOB 3OL8A 3KHGA 1X5OA 2FJEB 5K8OA 3RTVA 2UVUA 1H98A 2DGOA 6AT1B 1M5PC 2ZZMA 1S76D 1HBMB 2B7BB 4XPEA 3KLIA 3HJVA 2MSSA 2YX4A 3SZ2A 2CA9A 3HDSA 3BH7B 4M8LA 1HHSA 3CMQA 2OPPA 1Q5YA 2CQPA 2HFSA 1DZ5A 4RBUA 2HZCA 2Y8WA 4B3TJ 3D3CJ 1R6MA 4V19X 4DR2J 2UUBI 2WNRA 2XI3A 5DDOC 2P9GA 3H59A 3BF4A 4B3SI 4KRWA 4DG1B 3C3LA 1X0PA 3NBPA 4WUDA 3KK3A 3ET6A 2EPIA 1G4CA 1Z4UA 2P6SA 1FTRA 3ISNC 2A1BA 1ZAXA 2VZ9A 1IBCB 1UVLA 3MM9A 4C11A 5FLXY 3G6YA 4I4BA 3CJ3A 4ED2A 3MD3A 3HHLA 3BREA 3K5LA 2GFFA 2HGLA 5FIIA 4AQYJ 3ZFVA 1XTZA 4OYAA 5HROB 3MM6A 3HZEA 3HHDA 1W2BR 4BLGA 3EGZA 5LMUI 3M30A 4MH8A 2DNOA 5F8JA 3OR2A 1NNDA 4D3HA 2MKYA 2BANB 2HMIB 2YY3A 1LWEA 4LRBA 4X66F 5KFCA 4Q0BB 1OY8A 3T19A 4OZEA 2JEJA 3JAMQ 1WEZA 2X1GA 2Q6BA 4NASA 4IFVB 4BBYA 1OPZA 2CIMA 1IN0A 1RTDB 1U02A 2WVBA 3UCGA 4G1IA 2OHDA 3IRXA 3PJXA 5I42B 1I51B 1PC5A 3SFUA 3P49B 2GQ2A 3GR0A 2HRTA 3T1YI 5E41A 3N4WA 4TYBA 3OTOJ 1GFWB 2OH2A 1D9AA 4HH1A 2PNZB 2VBZA 4ECSA 3QGGA 1NEEA 1BY9A 4FXWA 4M94A 2WP8B 1S1WA 4F04B 1QVFR 2F4VE 2PGCA 3JB9k 2CZ4A 2UV8A 2HHQA 1CULB 1S9GB 4LOMA 3QZ8A 4CH0S 1H2VZ 5H9EJ 1IKVA 2OTJS 3N28A 2HNZB 1QUVA 3SSRA 1PAUB 3IR7B 1V5VA 1FERA 4X62E 5C0XB 4CM2A 2ROPA 1NK8A 3IAS9 2GQ0A 3O44A 2KRRA 2FJXA 1WC6A 4K0KJ 3PR4A 1RWWB 3R1LA 5KG0A 1CJVA 3GYNA 4F2RA 5KFTA 4ZPBA 3THTA 3CO0P 4GQUA 4RNHA 3N5FA 5GADU 2Q1LA 2V34A 2HRYA 3NXZA 3DLHA 2LVWA 1OIAA 4ZVGA 2G4BA 1RAEB 4DV5E 4DUYF 2BEFA 3MR5A 4CQ1A 1D3WA 1GMVA 3R5JB 4OJ3A 2JJ4D 4YMEA 3IWLA 1VJQA 4ECXA 1KP6A 2MKCA 4ZKAA 4ES1A 1IBKI 1IM4A 2E5LF 4CLWA 4ILLA 4N76A 2WSCC 4AL6A 1RBOB 1S6QB 4B3TE 1B3TA 5C0XE 4K2XA 2JT2A 2NXNA 2YH0A 3GIKA 4CLYA 4F4ZA 3CDJA 2NCKL 1T9UA 2LYVA 4LFCJ 3I4HX 2DCUB 4M5HA 2K7KA 2UUCE 4W90B 4ZCIA 1U2FA 1PG5B 4MKYA 1Y60A 1QTNB 4O44A 3MAAB 1FNXH 2XMAA 1KTQA 3T1HI 1HNXJ 1Y10A 2WTFA 1GMWD 5CD4H 1KD1T 2H48B 1B4SA 1NJIT 2AKWB 4C0HA 1WC3A 3CJSA 1K44A 2XZDB 5LSOA 1I1GA 4AQYE 3PM9A 3EPGA 2KVQE 4WXWA 5IT0A 5ETKA 3DMJA 1FT8A 3SV4A 4DXLA 2G2YA 3HXMA 3J80C 2YQ1A 4GKJI 2XBPA 2MY8A 2W2PP 1R89A 4DR3I 4P6QA 2XTJP 3C6UA 1KDNA 4LCGA 5BR8J 3G87A 3MD1A 2R4FA 1ZH5A 4Y00A 1RWXB 4LSNB 4CTAB 4ENOA 4CP5A 2PFDA 2Y0SD 2EWHA 2F65A 4LR9A 1HW8A 2ERRA 2Y9HA 4ZCMA 5KFDA 3ILLA 2VG7B 1X4EA 4PQAA 1VBKA 1P8GA 1KLNA 4JI3I 2C2DA 4HTJA 3VTIA 1JKHB 5F8GA 1XNQI 4BHQA 3ZZ0A 3HKMA 4KGZB 1S99A 1RBLA 4C0OC 4J9QA 2V2ZA 1V9OA 4OLPA 4RUBA 3OTOE 2Z5BA 2V8HA 3CUNA 2KHCA 5B0DA 4PXDA 1UL3A 2V4QA 1F5BA 2C2EA 3I0RB 4LFAJ 1FKAE 4X4TA 2YKOA 5KT5A 1YQHA 1U0HA 4PPDA 1I94J 2DR5A 1XBWA 2ZOGA 2BUNA 3ELHA 1CVJA 3FZ2A 4CH1A 4KGVB 1JWWA 4BA2B 4TKTA 3U1YA 1RXOB 3EZOA 1AFJA 1NSPA 5BJRA 2NYIA 3BSAA 4P2FA 1JLEB 2YNHB 3ENQA 1GX6A 3PX4A 4DV0F 1N32E 1MWQA 4IQMA 2RF2A 4U7CA 3B8HA 4MU1A 4K0KE 2MKSA 3DDKA 1DY3A 2HGNA 2R2SA 1FDNA 2JEBA 4GMKA 4DV7I 1S1UB 1U1KA 2C28A 4F3QA 1JJHA 5IWAI 5D4NA 1RHYA 1X0FA 4PR6A 4Q8EA 1OMSA 1REVA 5ETPA 4U7UD 3IXQA 3H42A 3JYTB 4DV6J 4LF6J 4WKRA 5D4OA 4FN5A 2EXUA 2GQQA 3TA1A 2JSXA 2FHJA 4OZJA 1DRZA 4URGA 3Q1QA 5CYQA 4A8SA 4LF8F 4IH5A 4WU2A 4ANCA 1MU2B 2BABA 3FCHA 2WVDA 2ZBRA 2L9WA 3W3SA 1QTMA 4IH7A 2QO3A 1N5QA 1R8AA 4CO2A 2IHR1 3EGNA 2MGZA 5IZHA 5L1JA 4LFCE 4FYXB 1IJFB 2HVZA 3K8VA 1CBKA 4A46A 4X65E 4ZCKA 3OR1A 1M1HA 4P73A 4LSLA 2UVRA 3MPUB 1HNXE 4H4OB 3FZBA 3W5YA 1QE1B 1WKJA 3AOBA 3DGPB 4LF7F 1RACB 4H4KC 1L3TA 4BA1A 2HFNA 1B70B 3KHRA 2QJ3A 4RNOA 5I3QA 1ZM3A 2M8HA 1GT8A 1F2GA 3M85D 1TKZB 4O4GB 1NJWA 3ZZRA 3NL0A 4F4AA 1I3OB 2Q79A 3DXBA 2LXFA 2RD5C 2X3GA 2AJ1A 3AA9A 2VDHA 3LPEA 2GMLA 2DIVA 5KFUA 3BSOA 2W25A 4P52A 1BQMA 1FNMA 3W9IA 1X4BA 2Y0BB 1HQUA 1X7VA 3M32A 1GK8A 1FXRA 2ZBQA 2QSFA 4M1KA 3HSGA 3NEKA 4OJGA 1V3RA 3BYRA 2IAJA 1NPKA 2HIYA 2V0NA 4IFDC 2VU5A 1RABB 4KHMA 3H4DA 1A0OB 4UOGA 2J9DA 2NN6D 2ZVSA 1U7LA 3K58A 3DOKB 1T05A 2KL8A 4GC6A 2HVDA 2QFJA 1OYPA 3LAMA 4F3MA 3PZPA 1SC1B 4XDCA 2M88A 5LMNI 4F36A 2UUBJ 5IC4B 1GQEA 2JDJA 4UTGA 4P74A 2HFUA 1SI9A 1S59A 4JI5I 3OVAA 2ZH1A 5DDRC 4B3SJ 1OYSA 4LF4J 4B08A 2MLYA 1TUVA 2VKZG 4LFAE 5A0YA 1BKNA 2NS1B 3ULHA 4U8YA 2G1DA 3NKYA 3K0JA 2PO2A 3UN5A 3RRGA 4C8OA 4DPOA 2FUG9 4URQU 2I5JA 2Q66A 3WHIA 1URRA 4L3KA 3LO3A 2HHSA 3QO9B 3C2PA 3CJ2A 1UP1A 3FGVA 1IBLF 2UU9J 1XIQA 1YBUA 4YY3F 2M52A 3HVAA 2IRXA 3PFEA 2M70A 3FQKA 5LMUJ 5L39A 1EP4B 2OPQB 2PC6A 1UVKA 4Z7CA 4JI1J 2C2MB 3F44A 4QR1A 4NMLA 3HVTA 1FKOB 3GJTB 1Q4RA 2QV6A 3K89A 3SMZA 2DGVA 4IG0B 2KT3A 1FK9B 3N6NA 4LF9I 1VQ8S 2MKJA 1UFLA 4P7VA 4Y2CA 1IBMI 4I2QB 1AUSL 4U96A 4DV6E 4LF6E 2AW0A 2QG9B 2OO4A 4WKYA 5JVHQ 2BQ3A 1B7FA 4OYIA 4OX6A 4X64I 1AROP 1XXEA 2GJ2A 2FLNA 1ZOTA 4HTIA 1WEYA 5J1NA 3J7A1 3T1YJ 1RB0A 2PN6A 2GC8A 1NHJA 5LL6R 1VRUA 3G82B 4Y2IA 3Q8UA 2NXCA 2IJRA 4Y0FA 3ZZYA 4XPCA 2OSQA 4UT4A 5ETSA 4LQ9A 4OI6A 3VVTA 4JOUA 4WCEQ 3FCWA 3NLCA 3DRPB 4DR4I 4LT6A 3KHHA 1YBTA 3VWSA 5KFLA 2A6OA 1DQ8A 3R5DA 4WUBA 5KFRA 4NXNE 2M7SA 3TA0A 2XYGB 3EMTA 4RUCA 3R5CA 1LWXA 4J90A 2ZEJA 1UZHA 2AX0A 3LH2S 1WHYA 1TUWA 4RBVA 1CJTA 1LW2A 3MAQA 3HKWA 2FD2A 3NGSA 4JI2E 5A8KB 3A4TA 1T9XA 5DDQC 1VHIA 1CJKA 1VC5A 4AL7A 2JX2A 3NOGA 2CQ2A 1D8YA 1M5SA 5LM7E 1S97A 4F0KA 3TI0A 2WBRA 1ZAWA 1X5SA 3CD5A 3TWZA 3AB4B 2X3DA 1QZRA 2CWKA 2WW8A 4HT7A 3CCQS 3FC9A 1IBKJ 3QLHA 1MSWD 5LOQA 4HYKA 3HP6A 3A13A 1UEKA 1FE4A 4XTTA 1BHNA 2XMMA 4FYWB 1WHWA 1H7UA 2UUBE 3DNCA 3AHPA 1DQAA 1LNQA 1RTJB 1RWMB 3O6QA 3MECB 2IM3A 1VQ9S 1H72C 3M2UA 5CHCB 1VLYA 1A7GE 1C0TA 3POTB 5DJBA 4DL7A 3OL7A 2CQDA 3V4MA 4DL2A 3CTRA 3BQ2A 3PRVA 3DM2B 1RLCL 3CEDA 3BGLA 1YHCA 3PS1A 4DSJA 3M8YA 1EARA 1S9EB 1EB0A 2AYMA 4UQTA 4GRSA 3T1HJ 3W66A 4MDTA 1D6TA 3EUNA 5ETLA 2GO9A 1U0SA 1LK5A 2HG4A 1DAXA 2ZWPA 4WFBQ 4RU9A 5HANA 4PXCA 5ETNA 3QJJA 3QSIA 4ZVUB 3G9CA 3CXCR 1RTIA 4LFBI 2VBXA 3J7YU 2G9OA 1R8BA 2X7IA 3P45B 4WJBA 4GO7X 5LMUE 5J1PA 1SH2A 2F4VF 1IKYA 2DIUA 2VQFI 5K9FA 4ZOSA 1SV5A 1S6UA 5GMEA 4DR3J 2LP4A 1VQSA 3I0SB 3GJSB 4OFZA 4B9SA 2W1BA 8ATCB 1EQ0A 4F2SA 1GEHA 2E5IA 2LXIA 3M8QA 3QIPB 1RTZA 4X62F 4B9LA 1SCJB 3Q23A 4DL0C 5DZ7A 4CO4A 2GS8A 2E1PA 4GKKI 2OP5A 2JFKA 2R8KA 1NHUA 2DHHA 4DHVA 1HA1A 3DLGB 1QAJA 2DISA 4JI3J 2ZUGA 1XMOE 4WTOB 4D3GA 1NDLA 3C14A 1XNQJ 1E6YA 5JUMA 3QGHA 4RBTA 1TR0A 3W62A 3T1YE 3GFXA 2J76E 1PJ7A 4M5JA 3ILOA 3SIPB 4WK1A 3MEGA 5C2GA 2P8IA 1IXKA 3RRKA 4DV5F 3SDEB 1XMQI 2VQEJ 3U7JA 3M9NB 2MZRA 4QIFA 2JOQA 3P3EA 5KFSA 1JJCB 3GJRB 2ATCB 3QT7A 1JNRB 3UWTA 4KAIA 1LWCA 3IA0A 4RW9B 4JG4A 2NZCA 3VAFA 2W7PA 3DYAB 3HLUA 1NKBA 1JB0C 1P6TA 1TMMA 4B3TF 1W25A 4C7QA 2NUUG 5C0XF 2RIJA 3V6JA 3IGNA 2OTLS 4ZDNA 2YWWA 4QBUA 1W2IA 1SKRA 3CJKA 4ZVQB 5D78A 4FS2A 3K5PA 1N5TA 5SZTA 2UUCF 3VHQA 2XMJA 4MAKA 3PDNA 4C4WA 3G8TA 3U1LA 2XHWA 1EQMA 4Q2LA 4ED5A 3OVSA 1IKXB 2BM1A 2RQKA 3OSPA 4G1QB 4DJBA 4OX8A 3TX0A 1O6XA 2E29A 2RUGA 2WSFC 3HFKA 4C8NA 1B62A 4AQYF 4X4PA 1ZZNA 2F63A 2UXDI 1ZA2B 3NCQA 1VYAA 1IBKE 4RW6B 4ZJOA 5KG6A 5HLFB 5L8RC 1ZYQA 2BACA 4DV1I 2XY7A 4WPAA 4GC7A 1U25A 3IS9B 5F3TA 4AT1B 2HFVA 5J2PA 4WUCA 2XULA 3AODA 3NS7B 4DV2I 3ISZA 3AAWB 4EBEA 3PJ9A 2MQ8A 2QLJB 2KYXA 2GHWA 2OPRA 4M5KA 5GMKa 4B3RE 1NHVA 3A3OB 2ZBIA 2CZVC 5AT1B 3T1HE 4YOEA 4DG1A 3DHWC 1RUSA 2DB1A 5EWGA 4Y2KA 2N4DA 2ZH2A 4USKA 1ZM2A 5D77A 1IJEB 4FYVB 4LF5I 1WUUA 3OTOF 5FD1A 4DBQA 3M8ZA 3LQVA 5A8WB 3W7BA 4DS5A 1UETA 4EZ9A 5H9FJ 4GKJE 3LANA 1NK9A 2B8QA 3TJ8A 2KT2A 4DR3E 1VGYA 3S6EA 4TU9A 1Z2ZA 1YJNS 5KT4A 1RU1A 2ZD1B 2MZQA 1WNEA 3CC2S 3NOCA 3HMJG 1NK4A 2RH3A 4E8UA 5AXMA 3J81U 3DRXA 4DEZA 5F9LA 3M9OB 1N32F 5HVGA 1R8PA 2YNFA 1BWVA 4K0KF 2W9BB 3GIIA 2MKKA 2PFFB 2W4CA 2VOPA 4JI3E 3T6BA 5K36C 5C2CA 3MM5B 1XNQE 3MOJB 3QIDA 4LRCA 1DURA 3MZIA 4ALZA 2KJVA 1Q7LB 4NOHA 5LMNJ 3VZHA 4X4OA 4JI5J 4KGXB 5C0XD 5I42A 4ANDA 3Q8SB 3PW5A 3KJQB 4QWDA 1JLGB 4HHUA 1CS4A 4DV3I 3UD5A 1WF1A 2ASDA 4C48A 2R7QA 2VD3A 2WP8A 4XAKA 2OEMA 3CSKA 4CI0B 3S8SA 1S6PB 3QBCA 5AE2A 1T9VA 1X8DA 2D3ZA 3DHXA 1M0SA 3O8WA 3TAMB 2J6SA 3IBFB 2MDAA 2XLJA 2YKNB 1D1UA 3PRDA 3GB0A 4WU3A 5HBMA 1CC8A 1WJ9A 1OS5A 2QYCA 3VCDA 2VIHA 4NYZA 4LFCF 2OUGA 4DV7E 1SQGA 2N82B 4X65F 3RG6A 5IWAE 2HYIB 1FF2A 3EZUA 1B0PA 4UZCA 3MMAA 2A3JA 3UHMA 5CCMA 1EA6A 1PC4A 1KQGB 1HNXF 2VL1A 4ECUA 2BXJA 3KKFA 1GNKA 1RWUA 3IM9A 2FLLA 3H4LA 4I6AA 2FZGB 2CFXA 4UZBA 1N36I 3N9UC 4X64J 2UXCJ 4J91A 1KONA 4I3HA 3P06A 4LJMA 3J81Q 4WXOA 5DGAA 4IFYA 1R6VA 2OPPB 3VAJA 4DWIA 3PFOA 1S4FA 4ELUA 1WOPA 5BR8F 2W7AA 4EO8A 3Q86A 2Z57B 2WNRB 1RKJA 2PI4A 1N34E 2V2QA 3EICA 3DLEB 4DR4J 2ZHBA 1JJ2R 1FRHA 4CNYA 1RHMB 2RAQA 3NBPB 4CIOA 5JEAA 3MPYA 3ILIA 2AZ3A 5D6GA 3ADAC 3IN5A 3MM9B 5HVHA 4C11B 1HNZI 2MLXA 3MFIA 3BB5A 3G6VA 4ER8A 1SJFA 3HHLB 3MAAA 4ICLA 3NAHA 2OMLA 4GVLA 2QZ8A 2NPFA 4PABA 1HMVA 3HD2A 2V4JB 2WW4A 3CJQA 4TQRA 3C46A 2ZBCA 4ILRA 4QWAA 4LFAF 1YJUA 2WK4A 2MJNA 3TUZC 2C1EB 3M30B 3T3FA 3BS9A 3FQLA 5C42A 1PYTA 1FRJA 3OR2B 1PO6A 2HEKA 3BR8A 2QLXA 3J80Y 5JVGQ 1MX0A 1LWEB 4F4KA 4J5OA 4ZPAA 4DSLA 4OO1C 3HZGA 2VFRA 2BDPA 1N5YA 4CLPA 2GX8A 1Z1ZA 4IH6A 4LSNA 4CTAA 2GAHC 2BJ3A 2DGXA 2DPIA 4ES2A 2XS5A 1VHFA 2R7OA 3IRXB 1RGVA 2AGQA 3K17A 1LV5A 2VG7A 1HW9A 2J7UA 2DKOB 5LMNE 3W60A 1U6BA 4XO0A 1T9WA 1A6LA 4JI5E 2FJDB 4HHHA 4TQSA 4LSZB 4DV6F 3PW0A 4LF6F 1S1WB 5HJYA 2M5YA 4JI6I 1NUEA 3UO0A 3UFCX 3D4JA 4B3OA 3OJSA 3GG1A 5M2RA 4LCHA 4R0EA 1H7XA 2LA4A 3CVKA 4LVOP 3MMJA 3FBEA 3C6TB 4RKUC 1Q7YT 3PVXA 2HQDA 4PQUA 1QLNA 1SC4B 4AXIA 4LFBJ 3AXKA 2QTWA 2HVHA 5A6PA 5KTQA 3DLKA 4ZP8A 5EN1A 5LL6d 2CPJA 4CRJA 4MU4A 4BA2A 3BN7A 2VQFJ 1S7HA 2BQRA 1NH7A 1JLEA 4LR7A 2JWNA 4C3MA 4C8ZA 3SI8A 4OMFG 4NXNF 1EETB 2HHWA 2VC1A 4OYXA 1PGZA 4F25A 4LF9E 1NSAA 1U47A 5LSRA 1IBME 1Q16B 4F0HA 1FA0A 1TKTA 4GKKJ 4EBDA 2CNOB 3H1CA 3H7HB 4X64E 1EHWA 2DXFA 2AWZA 1XNRE 1N8RT 3HCXA 5KT3A 1RDRA 5KFXA 1HR0I 2R42A 2D7SA 3BO2A 3JQJA 5D3GA 1NB2A 2EG1A 1VQNS 3CCES 1MROA 4RWXA 2R7WA 1RQ0A 1ICEB 4I56A 1WTFA 1XMQJ 1BGXT 3ZTOA 5GAEI 1U26A 2V6AA 1MU2A 2NPIA 4DR4E 1F9HA 4M5GA 3FFIA 4FBUA 3AD7C 4QIVA 2XGPA 1FFWB 2DHXA 3QMQA 4A8XA 2K7JA 2OLWA 5C5JA 4URLA 1S0NA 4IZJB 4O44B 4DR1I 2DTJA 4DSFA 4CYUA 3BEGB 1OSCA 2UUBF 1HWJA 1U45A 2V5HG 3CCVS 4KFBA 4EK2A 1FNOA 4YB6A 3M2VA 4B3SF 3FEYB 2L08A 2IOPA 4LF4F 2ZC3A 2ZVIA 1FRMA 1T3OA 1SKSA 3DGPA 1HNWE 2IYIA 2V69A 2JEAA 2HBRB 4FW5A 1RWPB 1TKZA 4MYTA 3M1VB 4P9SA 2FVPA 1USVA 3IWNC 2RRNA 2CQCA 3C6UB 3DCAA 4CLTA 1K73T 2CPEA 2RDDA 3BQ1A 2B9EA 1WF2A 2Q2EB 5L46A 3MM8A 3EXYA 2N3OA 3BM7A 3P76A 2UXDJ 4MIAA 3UPFA 1DARA 3VGVA 3AXMA 5D15A 3I5AA 2AJ0A 5LMUF 4FYYB 2MYFA 2Y8YA 4ZCLA 3GYGA 3T9NA 3BKFA 3CCUS 2HNYA 2UXBI 1RTHA 1NK0A 3R27A 4DV1J 4J9MA 2B3TB 1TKXA 2CYYA 2WB4A 4TVAB 2DNQA 2XSJB 3LGMA 2HRUA 4Y28C 2DGSA 4WZMA 2JLEA 3KLHA 2JZ5A 4J9SA 4DQRA 1EX8A 1N54B 3HJFA 2A2DA 4UQGA 1N0UA 4IQXA 5HJXA 5CYJA 1U0HB 5E5NA 1RT4B 2P9EA 4OJ1A 3T1YF 2OJ3A 4HXZA 5KFZA 4LFBE 5GAGU 4DSEA 3NG8A 5CZXA 2C2KB 2RF2B 2QRRA 4YN3B 4WTYA 1U1NA 2VQFE 1XQIA 3PW7A 4UW2A 2E1CA 3EVMA 2HPUA 3BV8A 2P5VA 2KG1A 3AY0A 4DR6I 2LDIA 2OPQA 3NY0A 3KNGA 2MXYA 3M6AA 3DRRA 2ZZNA 3B82A 2MZJA 2P2CB 1S0MA 4J9NA 4A4JA 3I56S 3W61A 2DNZA 2QN6B 4GKKE 4WBFA 3QGIA 3GTYX 1NU4A 2PIIA 4MK7A 2XGQA 4FW9A 3CCSS 1UMJA 1ULRA 3PX0A 4I2QA 5I4MA 5KFKA 1QAXA 5CYQB 3THPA 2LEPA 3BSCA 1NMEB 1USUA 3NZKA 4DLEA 4EBCA 1YJWS 2I1RA 4YDDB 2ASYA 2WAQD 3LP0A 3W2VA 1XMQE 2IVFB 2RT3A 1IR2A 2ZJPQ 4DV3J 4YFUA 2MGZB 2WONA 1S16A 1UVMA 3G82A 2YKQA 3M7VA 2RNEA 2ALYB 4DMZA 2IOQA 4DR2I 3H2LA 1IBKF 2ASJA 2EKYA 3MCNA 5B08A 3PNIA 5A2QU 1PJ6A 1R8CA 4LSLB 5LXYA 4YHHJ 3RBXA 1Q53A 3MR3A 3DKDA 2W8KA 2Z2YB 1KQFB 2DH7A 2X1FA 3TZXA 4B9MA 2KDOA 2XS2A 5DM7Q 3H40A 2YQ3A 2FJWA 4PCQA 4PXBA 1S5ZA 3G71S 2V8PA 3WIVA 1TK5A 3PHTA 3T1HF 3GIJA 1S0VA 4QU7A 3T5LA 3FSYA 3A3NB 3UR0A 1HQUB 3PS2A 3M32B 3FBFA 3W65A 2WSEC 4PPZA 3CIMA 2E5LE 5F8IA 3ZZZA 3HD1A 2D41A 1Z0TA 5GAHI 1TL7B 2X51A 2UXDE 4FF1A 1Q1KA 3HK2A 2GAGC 3B4DA 2XMTA 1BE4A 3C15A 1T05B 2YKAA 4GKJF 1WORA 4NWBA 2AEFA 2LMIA 4DV1E 1J27A 4DR3F 4EEYA 2AE8A 5IT9Q 3D0GE 4DV2E 2VG6B 4O0NA 3D7SB 1TL1A 3Q89A 4HLBA 4E0DA 3CJ0A 3UD4P 2A0FB 4DS4A 3U1NA 5JMNA 2D3UA 1JLBB 2MY7A 5CCLA 3GFZA 4JI3F 1BWEA 2KXNB 1J2VA 1HD1A 3ZZPA 1XNQF 2CNKB 3BGFA 1HNZJ 2PA8D 3GIRA 2DGWA 2WVEA 2YNGA 2XO7A 1S9EA 5I3UA 4LF5E 4RO0A 3MWBA 5A2QQ 1YK9A 2Y1JA 1RADB 5ETRA 4OX9I 1TAQA 3EDQB 4OZNA 2MZ1A 1Q82T 1CG2A 4K4TA 1E3HA 1HBOA 2J9DE 1NM2A 1ZXNA 2WBMA 1VK8A 2C2RA 1AXQA 3Q2SC 3VAHA 2BOPA 2JLFA 2XM3A 1VCTA 4FVCA 5DRKA 2F1FA 1FEHA 1FWPA 1SXLA 3M6XA 4F02A 1W26A 2VONA 3B4MA 4JYAI 3I5BA 3HVTB 1FKPA 2QLWA 4LCFA 5C7PA 4OO1B 4ELVA 2ILYA 2DNKA 4QNJA 4E2FB 4J37A 1H0HB 1Y4UA 3RB6A 4PRFA 5DRRA 1UZDA 3I0SA 1RYSA 2QLBB 1UW9A 3Q8VA 4KBIA 2AGPA 1O51A 3R1HA 1E6VA 4DV7F 4W98A 1K0TA 2FHKA 2KN4A 3BR9A 1BD6A 4YB5A 3V6KA 4ELTA 4JV0A 1HI1A 2VPWB 2R7SA 1HFEL 1N88A 2AIRB 4WFXA 2K3IA 2OSRA 4O0IA 2BE7D 3OUYA 3Q8RB 4FW7A 1QD1A 4JI6J 4DV3E 2FGOA 3ZNJ1 4EYIB 2GO3A 3GZ7A 3SEOA 4EWTA 3PW2A 2BJ8A 1JIHA 2IFXA 3SDEA 3VR1A 1MN7A 4L76A 4ECZA 1RAJA 2E9RX 4I2PA 5DO2A 4ZVFA 5F41A 1FD8A 2BA9A 1G6BA 1TL4A 1BMQB 2I9SA 2QIFA 5CQGA 1U49A 1FO1A 2NLWA 4ECQA 3VAMA 1N48A 1F6TA 1MNEA 1RLDA 4DU8A 3LALA 3FEXB 2MKHA 3NNCA 4USUA 2OI2A 5DRPA 1GTEA 5CABA 3G6ES 1FRIA 3LUYA 1R8HA 2C3UA 2QA2A 2L48A 1WG4A 4R25A 2QSWA 3CMES 1WSRA 4DF4A 3Q22A 1HQEA 1UPMB 3UI3A 4ATNA 4QOTA 2AX1A 3MMBA 5KFPA 3C66A 1N36E 2YNIB 3K5MA 2A2CA 5BR8I 1YGYA 2DHSA 1YVFA 3PJWA 2ZOMA 4PYDA 1NZ0A 1IR0A 3QLHB 3SQGA 1K9MT 5A6WA 2B5JB 2HAFA 2IVMA 5IV4A 1LFPA 2RKIB 4B9TA 2DNGA 2CDRB 1E3PA 3CWJA 1NDPA 1GXUA 1SJRA 3M2UB 3MR6A 1PSDA 4TN2A 2E7VA 4R0JA 1NKEA 3KDNA 3IAM9 2BQUA 4ZPDA 4DR1J 1HI0P 1Q79A 1LWFA 1HNZE 3FJ2A 1K47A 2HK2A 5LMNF 1UA0A 1FEEA 3AOAA 2B51A 2CQGA 4JI5F 5LJ5Y 3U1MA 2O1UA 4OX7A 4KV8A 1I94I 3F56A 1Q95G 4H4KA 3NGUA 2C39A 3DLLQ 4TY8B 1LXNA 2GHVC 1MU5A 5EHHA 1IWAA 4KE5A 1JXVA 2IMOA 4ED6A 3US5A 1SV5B 2ZHOA 3CDBA 2KXFA 2PMZD 3AB2B 1N56A 5EDWA 1FFSB 1FJ7A 3LP1A 4DPTA 1VIXA 4MFBA 2GVZB 1RR9A 2V67A 3M8QB 2H5EA 5GVQA 1ZS6A 3QPIA 2F7VA 1DTTB 2ZD1A 3KNAA 5HI7A 4IFDA 3JTNA 2LECA 3DN9A 2UXBJ 4EI2A 4OV1A 2L41A 1F5AA 2MQOA 2PMWA 3C14B 1FTCA 2MPUA 1E6YB 5T41A 2W9BA 5KFQA 4DV4I 3W63A 1WC0A 1RT2A 5GADI 4K4UA 3E8OA 4DX8H 1IBMF 4M5NA 3MEGB 5J1EA 4NLDA 3NNAA 3TX8A 1FXDA 4RR5A 4F4YA 1F60B 4JI6E 2DPJA 3P96A 3FUYA 3J7AM 3KUGA 4X64F 2BM0A 2CJBA 3EYZA 1LWCB 3PO4A 3VAIA 1BQNB 4TY9A 1KOHA 2NN6C 3N5BA 3QT6A 4FPRA 4HACB 3VGUA 2PNLA 1HNVA 1I6JA 3D67A 3CJKB 4ED8A 4DR4F 2OEJA 3MCSA 1NHKL 2VICA 3UN2A 3W1YC 4N77A 4DR6J 5D8HB 1RT6A 1RT5B 2HSEB 4WYLA 4NRTA 4P7AA 4O4RA 2C3YA 1UCNA 3L7OA 4UOFA 4TLRA 2UP1A 2PNMA 4O3OA 3MXHP 3RW7A 3KLFA 3WIUA 2ZNYA 4I67A 3CD0A 2COLA 2VJVA 2ZDPA 2H9ZA 1C1CA 2K3KA 3SBMA 3TW0A 1HR0E 5HMWA 4K2JA 2E5HA 2FJBB 4MK8A 5KFBA 3R5GA 4ED4A 3EPIA 3RR7A 2NXJA 3HHLD 5J2PB 2E1RA 2RQ4A 3GQCA 2OGUA 1HBNA 2F9DA 2ZJRQ 2IA0A 2OPRB 2CKWA 2DNYA 3WC0A 3Q83A 3HKZD 5KG1A 4PG7A 4DR1E 1LEOA 2KFYA 3DLEA 1KRPA 2A6MA 4LF4I 2Z58B 4NEYA 3TQEA 2KXHA 8AT1B 3FSIA 2V2VA 1C1BA 3DRSA 4HEA9 2NQPA 3CC4S 1WI6A 3ENVA 3KG4A 1PILA 4FYDA 2QL5B 2NUHA 2CG4A 4LIWA 3J81j 4ED0A 3ENWA 3HSZA 4O3PA 2YH1A 3E01A 1VJWA 3CDIA 2V4JA 2DD8S 2UU9I 3R3TA 2B43A 2ZITA 5T7LB 2P6TA 2JVOA 4P10A 2GO8A 4JI0I 1VQOS 4B17A 1UA1A 3PRYA 4JI1I 1Y5LB 4LFBF 2N7CA 4ILMA 3ZC4A 3UCZP 3H25A 1C0UB 1UEVA 2YNFB 3TJ9A 1TFYA 5K14B 4Z2XA 2UXBE 5BYSA 2VQFF 2HBQB 3KLEA 7FD1A 2O5DA 2MEWA 1S1XB 4KGMA 3CIZA 4V19J 3U02A 1TMJA 1U6ZA 3KLGA 1TP7A 4YR3A 3PCOB 2WOMA 3UNYA 1FI4A 4O3RA 4GKKF 2F9JA 1ZPVA 1YI2S 1CS4B 3ZTPA 4CZCA 2VFSA 3BGUA 4OI1A 2KFZA 2KVIA 2HFOA 5EWEA 3CCWA 3FEZA 3IO1A 2F8EX 1YBAA 4DCPB 2R3VA 3TANA 4FF4A 2BKPA 4LRFA 1TL3B 3O2IA 5F0WA 3HULA 1FX2A 4OX9J 1HK7A 1NK5A 1OWXA 5G4DA 1XMQF 5HBMB 3C6TA 4DUYJ 3I6PA 2XY6A 3R7NB 4USWA 3PKMA 4AE5A 3K57A 5IS2A 2FGCA 3LA0A 3CD6S 3E3XA 4H4MB 4J7CA 4JYAJ 4RWWA 3ONQA 3MMAB 1ZA1B 5T14A 1LW0B 5DG7A 2EC0A 4OYZA 1RHUB 5EX3A 3WU4A 2HHXA 4Q44A 1A6FA 1EETA 2F4FA 4HYMA 3A1YG 4WWSA 2LJPA 3RAMA 3IR5B 3CDAA 2Z4PA 2LQ9A 2W9CA 3JXOA 4FF2A 1D9FA 4F8RA 3GSIA 1URNA 5SUHA 2VKRA 2KB2A 4IFYB 4LIRA 3RJMB 4ID5A 1S7IA 1RA7A 4I69A 2VBYA 1KBRA 4IRCA 4OV6A 4P71A 4DPWA 3SCIE 5HAOA 4PWDB 3BN4A 2KHDA 2M9KA 2KZMA 3CJ8A 4DL5A 1LKZA 1R27B 2JE6A 2AEMA 1OYDA 1RWVB 3MURP 3OBIA 5D0RA 4IDKA 2UXDF 4ECRA 1SJQA 2CJ9A 2CPXA 4DR2E 4ZP9A 3G96A 3BKUA 5JEAB 3HF5A 4OZ0A 4DV1F 3I5CA 2EFGA 2N4CA 2M8DB 4EUVA 4A8WA 2GIRA 2DR6A 2DVIA 1HQ2A 5KG4A 4DV2F 4IZJA 1VISA 2CVEA 4ICLB 2HNDB 2H5IB 3TAPA 1HMVB 3UDCA 5AE3A 4QQBA 2DT9A 1OYEA 2PEHA 2P9CA 3ZTSA 4RW4A 2FYXA 3VF0B 4CNZA 2CPDA 4LR8A 1F9FA 3TZWA 4XTJA 5HN0A 5C42B 5E3RA 3HI9A 4CO1A 5H9FK 3AD9C 2EKNA 1Q8IA 1FCAA 2RE1A 2N3LA 3F41A 1NCLA 2LQ5A 4CLUA 1KIJA 4LF5F 3ICLA 2HVIA 3M1VA 1JNZB 1H6KX 1C4CA 3OLBA 1N5YB 2E9TA 3M6VA 3R6GB 2R7VA 1MMNA 3WU5A 2FHOB 4NLGA 1L3UA 5JEAE 2XO6A 4DFJA 3QWPA 1FRKA 5KFOA 2AJ2A 3QNWB 1ZPWX 3OL6A 2D1CA 2XNQA 4KJIA 5L3JA 1M1GA 2HAIA 1C4AA 3OXFA 3J7AG 3FK4A 2XSJA 4KHPI 4CLZA 1FESA 1ZZFA 3Q0AA 4KH1B 4WE1A 2ATLA 4C0BA 4CO3A 3NGKA 3VVUA 1SH3A 4DX7A 3NP5A 3TVZA 4B3OB 2QYGA 1P27B 1JX4A 4TXSA 3CULA 5IQQA 3RBZA 2CQBA 2DXDA 3PG9A 2VQEI 2GVDA 5FDLA 1RT4A 4PQUB 4OX9E 2BBEA 3I9ZA 3DLKB 4WYWA 4DN9A 2KO1A 3QSYB 4C3KA 4I68A 5A76A 3VGTA 4DV3F 4MJKA 5HO4A 2FHJD 3GIMA 2K1RB 5KT7A 2G0JA 1U24A 2HZAA 3BDEA 2HBZB 3LP2A 1ZAVA 2IIHA 2C2OB 2RJZA 3SQOP 4LF8J 4NPOA 4NLRA 3TOQA 5DGBA 4YDXA 4HT5A 2OFGX 1OYRA 4O3SA 1Q5VA 5H1SV 1TKTB 2RHQB 3FVYA 2W9AA 5GAEU 1NH8A 5I3PA 1K8AT 1RAAB 4K4XA 4USIA 4RNMA 1IKWB 2O3DA 2L3MA 1ROFA 2J8AA 4DV4J 3AFGA 1UDNA 3P3GA 5K36A 1UTAA 2VPXB 1OO0B 3K59A 5D3GB 5B0FA 1MROB 3RB0A 2RVJA 4N5SA 2KRBA 3SV3A 5HQMA 4HDHA 1N36F 1N5VA 5KFEA 2HVEA 3FFIB 2KM8C 2JEFA 3H5YA 1L3VA 2NN6B 5DQGA 3WX4A 3PYFA 3P3CA 2HS3A 2XMUA 1S72S 2ADCA 4NZ6A 4NRUA 4CYUB 1KHWA 4NLUA 4C6AA 4KFBB 2KU7A 4U8VA 2F8HA 3FMBA 4F26A 3M2VB 2PSZA 3EX7B 2R8HA 5C0XC 1M5KC 3OFFA 2JEAB 3D1OA 1NXIA 3EZ5A 3V6DB 1SJ4P 2XMVA 1HNZF 2XQCA 5B7WA 3BGRA 2KG0A 1NO8A 4ECYA 5IXUA 5KOXA 1M5OC 1N33I 1RT1B 5JXSA 4PG6A 3MM7A 1JLQA 1YKWA 4ECVA 3MM8B 4TLQA 4NI2A 4NLOA 4Y3CA 1R0BG 2W8LA 5BR8E 1T02A 3TR5A 3J7YI 4JI4I 2G13A 3WDOA 3I87A 1U2RA 2DEJA 3J7Z5 2M2BA 4WFYA 4Y2MA 5K8PA 1J5EI 2HNYB 1RTHB 1TL7A 1TKXB 5CXTA 1YRXA 2O1WA 3AD8C 1QAIA 2LU2A 2AMCB 2E1AA 4WFAQ 2VFVA 1KNZA 4M95A 1Z5CA 1OY6A 4QZVB 3KLHB 2ABYA 2BMBA 3CDEA 2BW2A 1APSA 2FHMA 1VFJA 2W4PA 4K8RA 2Z56B 1IBLJ 5L38A 2CGEA 3JTOA 1RT3A 4U3DA 4U95A 3GMGA 5KOWA 2MMYA 2VG6A 2WZ1A 5L9NA 2IMWP 5DNLA 4DPXA 3TARA 2ROEA 2ZZTA 2UVVA 3KXDA 1TVRA 4ZHRB 5DM6Q 1JLBA 2YWFA 1NSKL 3TEGA 1I94E 4RUAA 3CB4A 3EE3A 4KO0A 2V94A 4USHA 3IR6B 4IYQA 4JV5I 1T03B 4JI6F 2XCAA 2CVIA 1SC6A 4JP8A 4KR0B 1DHMA 4Z7YA 2MKIA 4BWMA 4UOHA 3KHLA 1MG7A 2IBOA 2OEKA 4HH0A 4JI0J 2XY5A 4FDFA 2XMWA 2IC3A 2G0IA 4K59A 3DRRB 2QMUB 1N52B 4ZVRB 1CJUA 5KFNA 1M5VC 5LSLA 4CWBA 1V3SA 3MAHA 4OO1A 2AU0A 2B4OA 1DBDA 4USVA 5AE1A 4EGLA 1MMDA 4DV4E 3DC2A 4OHVA 1NJXA 3IRWP 4QWCA 3GG0A 4XIUA 2R8IA 1NBEB 2DH8A 1N6QB 2J0SD 4OZLA 2UXCI 4DUZI 2NR0A 3NGDA 4K50A 4OJHA 1L3SA 4DLGA 1Y7PA 3KRNA 4CLSA 5CYMB 3DOLB 3LP0B 3W2VB 3DGVA 1DLOA 2HK3A 4QW8A 2WONB 3HSDA 2E9ZA 3NS6A 4CM0A 5HQLA 4Q43A 4PYAA 4P7TA 3KMSA 1HR0F 4NLPA 2K06A 1HWLA 1WELA 3DOMB 4L74A 2HHPA 1P1LA 3OTDA 2QA4S 5AXKA 4ZN3A 4JI7I 1VRTA 4UY85 3IP0A 4MTPA 5F3ZA 4ZVSB 3I31A 3IG1A 3P5BP 2VODA 3MEEA 1HBUA 2DR8A 3GYXB 1KFDA 2H5JB 4XDDA 3GR1A 1U48A 1S1VA 2DNNA 2DHAA 2HHHI 4LRAA 2FTRA 1GXTA 4DR1F 4Z37A 4YR0A 3DU6A 3GSDA 3PTWA 2DNLA 1S0OA 4W92B 4X4QA 2GW8A 4IOBA 3GV7B 1T95A 3HFVA 2ZH9A 2CPYA 4KB7A 1WI8A 3HHNB 4DDFA 1N4LA 2G2OA 4NLQA 3D5MA 2C2NA 3BGOP 3R97A 5ADZA 3UVJB 2D69A 1NKCA 4FF3A 4YS2A 2HGMA 1Z5AA 3PO5A 3C15B 2YNIA 1SL2A 3GWCA 3KK1B 2GV1A 1H2UX 4ZLPA 4X4NA 1QDUB 3TA2A 3B6BA 2GZOA 3NWGA 1TKDA 2CQIA 5L1IA 3FBCA 3PYDA 2B5JA 1TAUA 2Q43A 2RKIA 3BBBA 2RS8A 3TNVA 1JLCA 2OELA 1TL1B 2CQ0A 3OXGA 1JLFA 3OHAA 1T94A 2LKZA 2Z2LA 4LPFA 2FQQB 2FB0A 1FJEB 3OTBA 2UXBF 1HIYA 4B3SE 2BE2A 3BH6B 4LF4E 3D68A 4M63A 2FVCA 2ZKTA 2DR7A 1XEZA 5IFMA 4Q2MA 1TTHB 1DJ0A 2YNGB 3MOZA 1VQ5S 5I3UB 1NPRA 1TQLA 2G2ZA 3HSJA 3MMCA 4IO1A 2GMHA 4OKGA 1WKLA 2PA3A 5ETVA 1R7IA 4IZKA 4ETZA 5AJ3J 3JAMY 1Y9OA 3UD3P 1HBOB 3K5NA 4LUBA 3L7ZA 2Z8QA 3TO8A 2UU9E 2QFIA 1HD0A 3C16B 4TY8A 2X36A 2D9OA 3CCTA 1F3FA 2HKJA 3V6HA 1FKPB 2VC0A 4PKDB 4NXMI 4JI1E 1S10A 2PO1A 4UUWA 3R2CJ 3IMQJ 1CEZA 1X4AA 5EWFA 5M2PA 3ETOA 3N01A 3BBFA 2GVZA 4DV5J 1NHHA 1T3NA 4XK8C 1Z2LA 3CDUA 1E6VB 1TZ0A 2QE5A 1DTTA 4DR6F 1KN6A 2DGUA 3NMAA 4DQSA 2ZH8A 3AA8A 4KHPJ 2JC1A 9ATCB 4R8UB 1AT1B 2UUAI 1TL5A 4QPTA 3OUYB 1RK8A 2YVSA 3H90A 5CZVA 3UCUP 4J9RA 4QCLA 2MZTA 3H2UB 4AIMA 1Z0BA 3S7RA 4JV2A 5THWA 4BWJA 3OQ2A
chains in the Genus database with same CATH topology
4DPXA 2ZBKB 2BM0A 1IBLI 4DV3I 4LFCE 4B3ME 2F4VE 4YY3I 2DEIA 2EFGA 4URLA 4X65E 4IZJB 4DR1I 4LFAI 3JAMC 2UUCI 1H73A 3Q6MA 1D6TA 3QT6A 1I94E 1HNXE 4IZJA 1VISA 4HACB 4LF5E 1OJ4A 2PNLA 5A2QQ 3K1JA 4YHHE 3J81C 4OX9I 4JV5I 4X62E 4HACA 1Y4SA 3HJCA 4LFBI 5FWKA 2IOPA 1ZM3A 4Z7YA 2GQ0A 4JI8I 1HNWE 1ZXNA 4DUYE 2X7IA 1HNWI 1ZM4A 5LMUE 2Z5EA 4DV7E 4NXME 4AQYI 1MG7A 4XTJA 2VQFI 1N33E 4P7AA 4JYAE 4MYTA 3B78A 5GMEA 4FWDA 5IWAE 4JYAI 2O1VA 1USVA 4DU7A 2PNMA 1KIJA 1EA6A 4P52A 1FNMA 1Y4UA 4JI4E 2V34A 2Q2EB 3V5RA 1J5EE 4M1KA 1RREA 1ZM9A 3H4LA 2GS8A 3WU5A 1DARA 4DV5E 2J7KA 2CG9A 1N36I 4GKKI 4KQVA 1Z0EA 4I3HA 2ZM6E 1HR0E 3P06A 3WU6A 4DV4E 3J81Q 2UXBI 4DV6I 4LF6I 1XMOE 2BV3A 1XMOI 5L3JA 2UXCI 2UUAE 4DUZI 1IBKI 4ED4A 3V2UC 1ELOA 3T1YE 2E1RA 3LTOA 3J7AG 4KHPI 5LMNI 4UTGA 4B3TE 2HFUA 2HK3A 3QT8A 4JI5I 1IBLE 3ZZTA 1N34E 4DV3E 2V2QA 2VF3A 1N34I 1XMQI 4YY3E 2A2DA 1N0UA 4DR7I 3OTOI 4DR1E 4LFAE 3PYEA 4DV0I 1BKNA 2UUCE 3QT7A 4LF4I 4JI7I 4EMDA 4JG4A 2VQEI 1Z5BA 3K85A 1Y6ZA 1HNZI 4OX9E 3T1HI 2V2VA 4JV5E 4HXZA 2HKEA 1EI1A 4IZKB 1S4EA 3CWVA 4LFBE 4NXNI 4JI8E 3ZKDA 2NPFA 4DU8A 2WW4A 4AQYE 2OI2A 2HHHI 4X66I 2VQFE 3PYGA 1KVKA 1N32I 2UU9I 4PRXA 2ZITA 4DXLA 4DR6E 4K0KI 4Z7CA 4N3OA 4DR6I 3J80C 4HY1A 3ZM7A 4GKJI 4JI0E 3M6AA 4JI2I 4JI0I 4DPUA 4DR3I 1Z0WA 4PU9A 3B82A 1MX0A 2AJ4A 3PRYA 4JI1I 4DR5I 4RPFA 2BM1A 1NHIA 4LF8I 1N36E 4GKKE 4LF9I 3Q6NA 5FLXQ 1IBMI 1B62A 4ZVIA 1Z5AA 2A2CA 2UXBE 4FW9A 4DV6E 4LF6E 5BR8I 2UXDI 1NZ0A 1FJGI 2UXCE 1FWKA 4DUZE 1IBKE 4X64I 2Z5CB 4IZJD 3K17A 4JI3I 3PYDA 1PKPA 4KHPE 4DV1I 1USUA 5LMNE 4PRVA 2Z5CA 1XNQI 3GONA 3LPSA 3ZZ0A 2HFSA 4JI5E 2Z5BB 1FI4A 4WUCA 1NHJA 5LL6R 3J80Q 1XMQE 4DV2I 2V2ZA 5GMDA 3ZKBA 4DR7E 3OTOE 2UUBI 2Z5BA 4LF7I 1FWLA 4DV0E 1B63A 1S16A 4UT4A 2XEXA 4B3SE 4JI6I 4LF4E 4JI7E 1ZXMA 4B3SI 2IOQA 4DR2I 2VQEE 4DR4I 1FKAE 4B3RE 3D4JA 1Z59A 4B3RI 4WUDA 3PYFA 1HNZE 1PIEA 1K47A 1N0VC 5FLXC 3T1HE 2HK2A 4LFCI 2R3VA 1Z0GA 4FWGA 4B3MI 4WUBA 2F4VI 4NXNE 4X65I 3QT5A 3HULA 1HK7A 2O1UA 4DPYA 3WU3A 1I94I 4IZKA 4USKA 1HNXI 1H74A 1ZM2A 2HHHE 4X66E 4LF5I 1KTVA 1WUUA 4YHHI 1N32E 1MU5A 2UU9E 1PVGA 3B8HA 4X62I 4K0KE 5IT9C 2X36A 4GKJE 4DUYI 2V8PA 2HKJA 4JI2E 1KKHA 5LMUI 3F0NA 4DR3E 4DV7I 4NXMI 4FWHA 4JI1E 4DR5E 2O1TA 1N33I 4DPTA 4LF8E 1Z0CA 5IWAI 4LF9E 1H7SA 1RR9A 3WU4A 1IBME 2E5LE 1A6FA 4HYMA 2E5LI 1Z0TA 5BR8E 2LJPA 4JI4I 1NHHA 2UXDE 1FJGE 1U2RA 2DEJA 1QZRA 3JAMQ 1J5EI 4X64E 1XNRE 4USMA 4R1FA 4MYUA 1XNRI 4FN5A 4DV5I 4JI3E 2O1WA 4DV1E 5A2QC 1XNQE 2ZM6I 1HR0I 2R42A 4DV4I 1Z0VA 1Z5CA 3Q1QA 1XHKA 5IT9Q 1UEKA 2CZ9A 4DV2E 4DPWA 2UUAI 3LNUA 1H7UA 2UUBE 2CGEA 4LF7E 3T1YI 3ZZUA 4JI6E 1H72C 1Z0BA 4DR2E 4DR4E 4B3TI 3J7AM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPX A;  2ZBK B;  2BM0 A;  1IBL I;  4DV3 I;  4LFC E;  4B3M E;  2F4V E;  4YY3 I;  2DEI A;  2EFG A;  4URL A;  4X65 E;  4DR1 I;  4LFA I;  3JAM C;  2UUC I;  1H73 A;  1D6T A;  3QT6 A;  1I94 E;  1HNX E;  1VIS A;  4HAC B;  4LF5 E;  1OJ4 A;  5A2Q Q;  3K1J A;  4YHH E;  3J81 C;  4OX9 I;  4JV5 I;  4X62 E;  4HAC A;  4LFB I;  1ZM3 A;  4Z7Y A;  4JI8 I;  1HNW E;  1ZXN A;  4DUY E;  2X7I A;  1HNW I;  1ZM4 A;  5LMU E;  4DV7 E;  4NXM E;  4AQY I;  1MG7 A;  4XTJ A;  2VQF I;  1N33 E;  4P7A A;  4JYA E;  4MYT A;  3B78 A;  5GME A;  4FWD A;  5IWA E;  4JYA I;  4DU7 A;  1KIJ A;  1EA6 A;  4P52 A;  1FNM A;  4JI4 E;  2V34 A;  2Q2E B;  3V5R A;  1J5E E;  4M1K A;  1RRE A;  1ZM9 A;  3H4L A;  2GS8 A;  3WU5 A;  1DAR A;  4DV5 E;  2J7K A;  1N36 I;  4GKK I;  4KQV A;  1Z0E A;  4I3H A;  2ZM6 E;  1HR0 E;  3WU6 A;  4DV4 E;  3J81 Q;  2UXB I;  4DV6 I;  4LF6 I;  1XMO E;  2BV3 A;  1XMO I;  5L3J A;  2UXC I;  2UUA E;  4DUZ I;  1IBK I;  4ED4 A;  3V2U C;  1ELO A;  3T1Y E;  2E1R A;  3LTO A;  3J7A G;  4KHP I;  5LMN I;  4UTG A;  4B3T E;  2HFU A;  2HK3 A;  3QT8 A;  4JI5 I;  1IBL E;  3ZZT A;  1N34 E;  4DV3 E;  2V2Q A;  2VF3 A;  1N34 I;  1XMQ I;  4YY3 E;  2A2D A;  1N0U A;  4DR7 I;  3OTO I;  4DR1 E;  4LFA E;  3PYE A;  4DV0 I;  1BKN A;  2UUC E;  3QT7 A;  4LF4 I;  4JI7 I;  4EMD A;  4JG4 A;  2VQE I;  1Z5B A;  1HNZ I;  4OX9 E;  3T1H I;  2V2V A;  4JV5 E;  4HXZ A;  2HKE A;  1EI1 A;  1S4E A;  3CWV A;  4LFB E;  4NXN I;  4JI8 E;  3ZKD A;  2NPF A;  4DU8 A;  2WW4 A;  4AQY E;  2OI2 A;  2HHH I;  4X66 I;  2VQF E;  3PYG A;  1KVK A;  1N32 I;  2UU9 I;  4PRX A;  2ZIT A;  4DXL A;  4DR6 E;  4K0K I;  4Z7C A;  4DR6 I;  3J80 C;  4HY1 A;  3ZM7 A;  4GKJ I;  4JI0 E;  3M6A A;  4JI2 I;  4JI0 I;  4DPU A;  4DR3 I;  1Z0W A;  4PU9 A;  3B82 A;  1MX0 A;  2AJ4 A;  4JI1 I;  4DR5 I;  4RPF A;  2BM1 A;  1NHI A;  4LF8 I;  1N36 E;  4GKK E;  4LF9 I;  5FLX Q;  1IBM I;  1B62 A;  4ZVI A;  1Z5A A;  2A2C A;  2UXB E;  4FW9 A;  4DV6 E;  4LF6 E;  5BR8 I;  2UXD I;  1NZ0 A;  1FJG I;  2UXC E;  1FWK A;  4DUZ E;  1IBK E;  4X64 I;  3K17 A;  4JI3 I;  3PYD A;  1PKP A;  4KHP E;  4DV1 I;  5LMN E;  4PRV A;  1XNQ I;  3GON A;  3LPS A;  3ZZ0 A;  2HFS A;  4JI5 E;  1FI4 A;  4WUC A;  1NHJ A;  5LL6 R;  3J80 Q;  1XMQ E;  4DV2 I;  2V2Z A;  5GMD A;  3ZKB A;  4DR7 E;  3OTO E;  2UUB I;  4LF7 I;  1FWL A;  4DV0 E;  1B63 A;  1S16 A;  4UT4 A;  2XEX A;  4B3S E;  4JI6 I;  4LF4 E;  4JI7 E;  1ZXM A;  4B3S I;  4DR2 I;  2VQE E;  4DR4 I;  1FKA E;  4B3R E;  3D4J A;  1Z59 A;  4B3R I;  4WUD A;  3PYF A;  1HNZ E;  1PIE A;  1K47 A;  1N0V C;  5FLX C;  3T1H E;  2HK2 A;  4LFC I;  2R3V A;  1Z0G A;  4FWG A;  4B3M I;  4WUB A;  2F4V I;  4NXN E;  4X65 I;  3QT5 A;  3HUL A;  4DPY A;  3WU3 A;  1I94 I;  4USK A;  1HNX I;  1H74 A;  1ZM2 A;  2HHH E;  4X66 E;  4LF5 I;  1KTV A;  1WUU A;  4YHH I;  1N32 E;  1MU5 A;  2UU9 E;  1PVG A;  3B8H A;  4X62 I;  4K0K E;  5IT9 C;  2X36 A;  4GKJ E;  4DUY I;  2V8P A;  2HKJ A;  4JI2 E;  1KKH A;  5LMU I;  3F0N A;  4DR3 E;  4DV7 I;  4NXM I;  4FWH A;  4JI1 E;  4DR5 E;  1N33 I;  4DPT A;  4LF8 E;  1Z0C A;  5IWA I;  4LF9 E;  1H7S A;  1RR9 A;  3WU4 A;  1IBM E;  2E5L E;  1A6F A;  4HYM A;  2E5L I;  1Z0T A;  5BR8 E;  2LJP A;  4JI4 I;  1NHH A;  2UXD E;  1FJG E;  1U2R A;  2DEJ A;  1QZR A;  3JAM Q;  1J5E I;  4X64 E;  1XNR E;  4USM A;  4R1F A;  4MYU A;  1XNR I;  4FN5 A;  4DV5 I;  4JI3 E;  4DV1 E;  5A2Q C;  1XNQ E;  2ZM6 I;  1HR0 I;  2R42 A;  4DV4 I;  1Z0V A;  1Z5C A;  3Q1Q A;  1XHK A;  5IT9 Q;  1UEK A;  2CZ9 A;  4DV2 E;  4DPW A;  2UUA I;  3LNU A;  1H7U A;  2UUB E;  4LF7 E;  3T1Y I;  3ZZU A;  4JI6 E;  1H72 C;  1Z0B A;  4DR2 E;  4DR4 E;  4B3T I;  3J7A M; 
#chains in the Genus database with same CATH topology
 1Y4Z B;  3W2W B;  2UUC J;  1HWI A;  3N0V A;  3M9M B;  4RZR A;  4I2P B;  3OL9 A;  2F40 A;  5F9N A;  4C8K A;  1GAO A;  4YP3 A;  2AEJ A;  2JLG A;  3QJL A;  2UV8 G;  1H73 A;  2RS2 A;  4IS9 A;  2NZ4 A;  1SC3 B;  2AD9 A;  1BQN A;  1SIW B;  1OJ4 A;  3KUE A;  3OHB A;  3J81 C;  3UNG C;  5J2N B;  4HAC A;  3TVY A;  4DR2 F;  4EU0 A;  1KQS R;  2XSF A;  1IUJ A;  2Z2M A;  3HHE A;  4QIG A;  3TJA A;  4IG3 A;  3U1K A;  1HQE B;  2Q6C A;  4YB7 A;  1RT5 A;  4X4R A;  1YJ7 A;  1UAW A;  3R8Y A;  4CLF A;  3MMB B;  2YX1 A;  5C25 A;  3QAU A;  3ETM A;  4RU2 A;  2JL9 A;  2OPS B;  3KJV A;  1VBY A;  2B4P A;  2CG9 A;  2WCX A;  1H3D A;  3SQG B;  1F9E B;  1YDL A;  2EFO A;  2R9L A;  2VJU A;  3CGI A;  4P2M A;  1HYS A;  2IBK A;  1XMO I;  4YQW A;  3RBD A;  2E5G A;  5D0E A;  3FRZ A;  1ELO A;  3KLV A;  3O1L A;  2KM8 B;  1U1P A;  1SUQ B;  1KOO A;  4K4V A;  4CT9 A;  1F1B B;  3NRB A;  3PW4 A;  4K4W A;  2ZH3 A;  1Q86 T;  5JEA F;  1DFD A;  4DR7 I;  1P1T A;  1LWF B;  2KYZ A;  4R5P B;  2HFZ A;  1H2T Z;  4X4S A;  1B0T A;  1KSP A;  2FY8 A;  2X1A A;  4ERD A;  3CW2 C;  1IR1 A;  2V2K A;  1LFW A;  4KV8 B;  4TNO A;  5HVF A;  1EI1 A;  2D3O 1;  2IA6 A;  2G1H A;  1AFI A;  3H5U A;  4M5I A;  2I6W A;  2C39 B;  4CDI A;  1N32 J;  2XYP B;  2ZE2 B;  2W7O A;  1B0V A;  4C9D A;  4QYZ J;  2QA1 A;  1T9Y A;  2QA4 G;  4N56 A;  4PRX A;  1N33 J;  3HHK A;  3DXS X;  3LP1 B;  4MFB B;  4HDG A;  3P3D A;  4OX9 F;  3JSM A;  3PV8 A;  5T7L A;  4X4V A;  2UVW A;  1YWX A;  4JI4 J;  1TUG B;  1NZ8 A;  2BR2 A;  1UPP A;  2PDA A;  3WX8 A;  4MIB A;  3Q2T C;  1J5E J;  4IFD B;  2JRS A;  3JSY A;  4AD6 A;  2AZ1 A;  1VC6 A;  3EVW A;  4PAA A;  1HPZ A;  4PXE A;  3OTE A;  4JYA F;  1FJG I;  1C0U A;  2BJD A;  5K14 A;  3K8W A;  1VQ4 S;  1XMB A;  3BQ0 A;  4DUT A;  3H4B A;  4PWU A;  1SKW A;  1RT2 B;  2FVR A;  4KHP E;  1S1X A;  1RE1 B;  3BO3 A;  2I0X A;  5J1E B;  3KUH A;  4AID A;  5E3Q A;  2AT1 B;  4C3L A;  1R31 A;  2CPF A;  3BSN A;  3BDP A;  1AB8 A;  1X4H A;  2PO0 B;  4HKQ A;  4X65 J;  2VQE E;  2CDQ A;  4B3R I;  1PIE A;  2YKM B;  2B9W A;  1U2C A;  1RCO B;  4OYO A;  3A3P B;  1HNV B;  1O8B A;  4JV5 J;  4EFA C;  2GGP A;  4PG5 A;  1TL3 A;  1RA6 A;  1H74 A;  2H4W B;  4IFD E;  3D1Q A;  5CH7 B;  1UDS A;  4KPY A;  4YHH I;  2GA7 A;  3HM9 A;  2H1Y A;  3OPK A;  3P4U B;  1RT6 B;  3M8P B;  1SL1 A;  4RW8 A;  2XI2 A;  1YHQ S;  2VES A;  2OIH A;  3OVB A;  3KG1 A;  3M8S A;  4FKY A;  4H4M A;  3MCM A;  4DX6 A;  5DLG A;  2GIQ A;  3GV8 B;  3KLF B;  4ZP6 A;  1ZTW A;  1LW0 A;  1MWY A;  4WP8 A;  2BVZ A;  2R7T A;  3EGV A;  3AQP A;  3K5O A;  2E7X A;  4J9O A;  2VAS A;  1C1C B;  2MB0 B;  5JEA D;  1GMW A;  2BRK A;  5K8N A;  5F8L A;  5ETO A;  1IM6 A;  1VI7 A;  1FRL A;  1VS3 A;  4DUZ J;  5B0C A;  4DSK A;  1UJ4 A;  4NZ7 A;  1V6H A;  2RRB A;  3HO1 A;  4OZ2 A;  4C8M A;  1G7C B;  2ACM A;  2JHE A;  3IBW A;  1K0V A;  2YPY A;  1X4G A;  3R7S B;  1HBN B;  3ZZU A;  4FXV A;  4WP9 A;  4EYH B;  3GLL A;  4OZ3 A;  2RQM A;  4PWD A;  3PX6 A;  1YRU A;  1UKU A;  3NCP A;  2BJ1 A;  2NN6 F;  5DG8 A;  3DFE A;  3RAX A;  1A9N B;  4JI7 J;  4ZVH A;  1XC9 A;  2AQ4 A;  4LRE A;  1WD6 A;  3OD2 A;  3QYY A;  4OZ1 A;  3M8R A;  4O23 A;  4G65 A;  1WWH A;  4QR2 A;  3Q6M A;  2H4Y B;  2DRA A;  1C1B B;  3NMR A;  3DRS B;  1NPP A;  2C3P A;  3K7R A;  2HHH J;  2YTC A;  4NLV A;  4FZV A;  3HJC A;  2HND A;  1YG0 A;  3FCV A;  3D1H A;  3E01 B;  2HHV A;  1VQ7 S;  1QM9 A;  4ZA1 A;  4RW7 A;  5HQ8 A;  1N33 E;  2BA1 D;  3UN3 A;  4NA2 A;  4IUF A;  5MAO A;  2R2R A;  4CO5 A;  1I94 F;  3SXL A;  5GAG I;  1X9W A;  2LFV A;  4JI4 E;  4L75 A;  1S1T B;  5KFI A;  2Y3Y A;  1J5E E;  1S9F A;  1EKR A;  4NCG B;  4FVM A;  3L7U A;  1S48 A;  3KLE B;  4KQV A;  3WU6 A;  1FXL A;  2IPO B;  4KT0 C;  1DTQ B;  3JQK A;  3KLG B;  3OFE A;  2CUY A;  4MKV A;  2V50 A;  4WIQ A;  3J80 U;  5HMZ A;  4OYW A;  3M85 G;  2MQN A;  1VOM A;  2WOM B;  3HT0 A;  3TZY A;  1EIY B;  4DFP A;  3M2R A;  2F5G A;  4M5D A;  4U67 Q;  3OTC A;  3UDL A;  5DS7 A;  3QT8 A;  3L4B C;  1N34 I;  2R2T A;  4DV4 F;  2LLZ A;  1W7W A;  3PYE A;  4DL6 A;  5DG9 A;  1M5H A;  3GFY A;  4OYP A;  4IO9 Q;  4PWW A;  3A8K A;  4NXN J;  1UJ6 A;  3MTJ A;  2VPZ B;  3IFE A;  1V3Z A;  1Y6Z A;  1Y3K A;  5DDP C;  2O67 A;  5CAA A;  4YR2 A;  4JV5 E;  3TVK A;  2FJV A;  1S4E A;  1ZBT A;  2XZW A;  3VQS A;  2W2O P;  3V81 A;  1CLF A;  4QWE A;  3NCR A;  4URS A;  3MEK A;  1RAG B;  1NJZ A;  1O5J A;  3NGR A;  3RB3 A;  2R8G A;  4KC5 A;  1U1R A;  4DF8 A;  4JI2 J;  4NXM J;  1WDT A;  2PD1 A;  3VAL A;  2F8M A;  4N3O A;  3X3U A;  2K1R A;  1XWL A;  4NE9 C;  4LBP A;  2C38 A;  1RKI A;  4DR5 I;  1NHI A;  2OKQ A;  1R6Y A;  2A18 A;  2W9C B;  2GQC A;  3CJR A;  1U1L A;  1R0C B;  2QX0 A;  4L6V 3;  2FLO A;  2LA6 A;  3L3C A;  4N8O A;  2CJQ A;  2UXC E;  4DUZ E;  4ID5 B;  2Z5C B;  2W4D A;  3I55 S;  1IKW A;  3VAK A;  2J65 A;  1XR5 A;  4OI3 A;  4AL5 A;  2LCW A;  2UUA J;  3PIO Q;  1PKP A;  4PRV A;  2HWT A;  4P2S A;  1OQ3 A;  4OYM A;  4YB1 P;  1RHK B;  2JE6 B;  3R5A A;  3I82 A;  3H98 A;  2DRD A;  3AOC A;  4IDK B;  3CCL S;  3J80 Q;  1F2H A;  4DSI A;  1BXN A;  1VQK S;  4BC7 A;  2HWI A;  1FDD A;  3PAC A;  4L73 A;  1UWB B;  4OIX A;  5M2U A;  2DO4 A;  5DQH A;  2AGO A;  2XEX A;  2RDI A;  3DDN A;  3OFH A;  5MLC V;  1NB7 A;  4JI7 E;  2DXE A;  2Y1L B;  2E1M C;  1RJJ A;  4KQZ A;  2NN6 A;  1EJ7 L;  1F5C A;  3ZZO A;  3DLB A;  4B3M I;  3TEH B;  4IR9 A;  2LXU A;  4WP3 A;  2JFD A;  1JXE A;  5HMY A;  2HHH E;  1RT7 A;  3CD7 A;  2RML A;  4ZIT A;  1S49 A;  4RW4 B;  4MKA A;  5J2M A;  4OHX A;  2B4U A;  4IKA A;  2DHG A;  4ED3 A;  1JJ4 A;  5IT9 C;  1TV6 A;  3ZNU A;  3LWL A;  2BZ2 A;  2FZK B;  2HW3 A;  2C37 B;  3RRH A;  1LOU A;  4TYA A;  5B0B A;  2E7W A;  1FHT A;  4FWH A;  4ZMM A;  3V6D A;  2QL7 B;  1VQ6 S;  3AJ2 A;  3PIP Q;  4WZQ A;  3CNQ P;  1JMT A;  3P5T L;  3F73 A;  4E98 A;  4DQP A;  5U47 A;  4NLT A;  1RT1 A;  5DET A;  4FP9 A;  4OI2 A;  2EK1 A;  2YPZ A;  2UU9 F;  4BDP A;  1YRT A;  2XYH B;  4USM A;  4MT1 A;  3ISN D;  3PR5 B;  1XNR I;  1XMO J;  1AZS B;  4RLE A;  4I7F A;  3GFH A;  3AQO A;  4P2X A;  5A2Q C;  4JI0 F;  2ZM6 I;  4F7V A;  5ETT A;  1UVJ A;  4JI1 F;  3GIL A;  1XHK A;  1MW7 A;  4RL1 A;  4RX6 A;  3Q24 A;  4C8L A;  4WE1 B;  3OW2 R;  2ZJQ Q;  1NJY A;  3PEJ A;  4DR7 J;  2V9W A;  3G8Q A;  1Y00 A;  2VG5 A;  1ACM B;  4Q8F A;  3GCW P;  2YKP A;  2YWK A;  1RHJ B;  2GVD B;  3JSR A;  2UUW A;  2FY1 A;  5FDL B;  2CQ4 A;  2BA0 D;  2M4M A;  4OLO A;  5BYQ A;  1R3N A;  4YUD A;  4ZHR A;  2IY5 B;  4J9L A;  1BLU A;  1F3V A;  4RNF A;  3K1J A;  4K4Z A;  2HBY B;  2J6U A;  3HHL C;  2X1B A;  2O1P A;  3E51 A;  4Y6I A;  5FWK A;  5A8R A;  4A8Q A;  4JI8 I;  2ZOF A;  1HNW I;  3LP2 B;  1R43 A;  1RWO B;  2C2Z B;  4DI6 A;  1T03 A;  2Z5E A;  1ITP A;  4NXM E;  3UQS A;  1I5O B;  4FWD A;  1HNI A;  3MED A;  4JV1 A;  4KHR A;  5LJ3 Y;  2VPY B;  4OQJ A;  5HP1 B;  3FDS A;  1NK6 A;  9RUB A;  1YSJ A;  4GVB A;  2CWX A;  2VBW A;  5K8M A;  3WC2 A;  3P8B B;  1FJG J;  1HHQ A;  3PRB A;  4OI0 A;  3RW6 A;  1CQM A;  2QMW A;  1VLO A;  4U7U K;  2BJE A;  1NZA A;  4OHZ A;  5K36 B;  4ZJQ A;  3CCM S;  3M05 A;  1T8E A;  1VK3 A;  2XNR A;  5IT9 U;  1GX5 A;  2DO0 A;  3DI6 B;  2HHT A;  2UUA E;  1VBX A;  1OSD A;  2BR0 A;  1N6Q A;  1Y11 A;  4CT8 A;  3W64 A;  2HHU A;  4JB8 B;  4ZVP B;  2ZH5 A;  4DQQ A;  4MIW A;  2ZKU A;  1U8W A;  4ECW A;  5CYM A;  2AJF E;  3DOL A;  1T11 A;  2ADB A;  3Q8P B;  4B3R J;  1Y5I B;  3PHE A;  1SB6 A;  1CQN A;  3MUT P;  2FIU A;  1KWM A;  1R6L A;  4EMD A;  1KHV A;  3DOM A;  1TK0 A;  3HPO A;  3DD6 A;  2VA3 A;  1XER A;  2JEI A;  1H7W A;  1FDB A;  2AYE A;  2MJU A;  2HUR A;  1EAY C;  4X66 I;  5F8H A;  4GKJ J;  1KVK A;  5E33 A;  3KJF B;  5K36 E;  3BGR B;  5LT5 A;  2Y1I A;  3V4I B;  5B0E A;  2OD4 A;  2FLP A;  3MM7 B;  1JLQ B;  3IGV A;  3K2Y A;  2CAD A;  4DPU A;  2KJW A;  1Q8K A;  2W2Q P;  3SCJ E;  1YLX A;  4NI2 B;  1FJC A;  4NLW A;  4PU9 A;  2ZFH A;  3TRG A;  2NSC A;  1QSY A;  4FPI A;  5AJ3 F;  2H65 B;  3H8Y A;  1YH8 A;  4ZVI A;  2I8E A;  1G3O A;  3HX9 A;  2DGQ A;  5CA5 A;  3UVJ A;  1IQZ A;  2EW9 A;  2WVF A;  2DR9 A;  4M5L A;  1AYE A;  3ILJ A;  5E7O B;  3T6J A;  4G1P A;  3KK1 A;  4A8F A;  1RHR B;  2RU3 A;  3H5S A;  1RT3 B;  2LEA A;  2GHP A;  2H51 B;  4FXD A;  3VGS A;  3EDR B;  4KGK A;  4O3Q A;  1QAY A;  2CQ3 A;  2FVS A;  3PY8 A;  1HL6 A;  2IYG A;  4DR7 E;  3S01 A;  3GE9 A;  1R0A A;  2AF6 A;  3BBC A;  1FWL A;  3N6L A;  3FMW A;  2O01 C;  1J5O B;  2QEX S;  1TVR B;  1U1O A;  2ASL A;  2IM2 A;  5KFY A;  5C24 A;  2DRB A;  5DNX A;  1YJ9 S;  4NCA A;  2MQL A;  1Z0G A;  1VQL S;  4KHP F;  1RP5 A;  2DK2 A;  4KO0 B;  3QQC D;  2B6A B;  1XN9 A;  3AH6 A;  4NA3 A;  5KT6 A;  3NAI A;  4AUK A;  2CQ1 A;  2IRY A;  1Q81 T;  3D28 A;  2B4V A;  4QIE A;  2YX7 A;  1KTV A;  4CLK A;  3MR7 A;  4B9U A;  1B99 A;  4DV7 J;  1FVS A;  5IM0 B;  2KZZ A;  2CJK A;  3D0H E;  1CSJ A;  2VQE F;  2GO4 A;  1OPI A;  5IWA J;  4DUY I;  2KT5 A;  2IC3 B;  4UF4 A;  4U9R A;  4DCO B;  5EUH A;  1CJU B;  3C16 A;  2IES A;  2YWE A;  5HMX A;  2YWH A;  3ITH A;  1UDQ A;  1YZ6 A;  4RNN A;  2RHS B;  3AT1 B;  3D0I E;  1SKU B;  1WDD A;  4P75 A;  2IVY A;  3A12 A;  2E5L I;  4IFD F;  1JLA B;  4PZV A;  3MR2 A;  1FJG E;  1KS2 A;  2XB2 D;  3FNN A;  3KK2 A;  1SIZ A;  4KKO A;  3TZZ A;  3PEH A;  4NYO A;  4FNH A;  4R1F A;  1YJV A;  3LPY A;  1Y0H A;  4PUO B;  2ZWO A;  4O3N A;  2DNR A;  1Y5N B;  3CPW R;  2XLK A;  2VB6 A;  1HBM A;  2PI5 A;  1O0P A;  1WOS A;  2EBG A;  2CNL B;  3KYL A;  5IC6 B;  3QAE A;  2HQC A;  1UEU A;  2DY9 A;  4KSE B;  2VDI A;  1DLO B;  4IOC Q;  4JBC A;  1N34 J;  2V63 A;  4R8U A;  3RBE A;  1KR4 A;  2BX6 A;  3B54 A;  4QW9 A;  3CE8 A;  4NLS A;  2J5A A;  4EO6 A;  1VRT B;  4MKB A;  1VQP S;  2O3Z A;  3X1L B;  3IG1 B;  3W2W A;  2QMX A;  3H20 A;  3MEE B;  1HBU B;  1YX2 A;  4K4S A;  2V68 A;  1Q8L A;  2RIL A;  4OO1 E;  3L95 X;  1JXL A;  6FDR A;  4YHH E;  4Q45 A;  1WAC A;  1S1V B;  4MQY A;  1BUX A;  2YQ0 A;  3UDV A;  1RU2 A;  1FKA F;  3J81 Y;  5J2N A;  3GME A;  1VC0 A;  3TYT A;  2GNK A;  2XLI A;  1SL0 A;  5HRO A;  2E66 A;  4TU7 A;  3HFZ B;  1RWK B;  3GV5