3PYGA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
GSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
total genus 83
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pygA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pygA01
4LFAE 3JAMC 5IT9Q 2UXDE 4DV2I 1H72C 5L3JA 1FKAE 4NXMI 4R1FA 3LTOA 2ZM6E 3F0NA 4X64I 4WUDA 1Z0WA 4K0KI 4B3TI 1NHHA 4DR2I 2HK2A 4DV5E 1VISA 3QT6A 1N0UA 1NZ0A 4DR7I 4DUYE 1IBMI 1N36I 4DR6I 1J5EI 4P7AA 4DV3E 3JAMQ 4PRVA 4JI3I 1A6FA 1NHJA 4I3HA 4LF8I 3OTOE 2V2ZA 1U2RA 2VQFI 2HFSA 4DUZE 4JI6I 2V8PA 4X62E 1Z0EA 4FWDA 1XMOE 2E1RA 4DR5E 1ZM9A 3ZKDA 1ZXMA 1PVGA 1IBKE 1EA6A 3T1HI 3ZKBA 4DV7I 2BM1A 4JG4A 4KHPE 1FNMA 1HR0E 2DEJA 2HKEA 4WUBA 5IWAE 3M6AA 3LPSA 1H7UA 3V5RA 4B3RE 4Z7CA 2F4VI 2X7IA 3ZZUA 2HFUA 4DR1I 3T1YE 4JI8I 1N0VC 3ZZTA 2UUAE 4JI5I 1PIEA 4LFBI 4B3MI 4M1KA 4JI1I 2LJPA 4EMDA 2ZBKB 1FWKA 4DV4I 1Z5AA 2R42A 4X65I 3J7AG 4DV1E 4DV0I 1HNZI 4JI7I 5FLXC 1N34I 4NXME 4AQYI 5GMDA 2WW4A 4LF6I 1OJ4A 4X64E 4JI0I 1B63A 1ZXNA 4FWGA 2NPFA 4HY1A 4GKJI 2VQEI 4B3TE 4HACA 1FJGI 4OX9I 4DR2E 1DARA 2BV3A 2V2QA 4DR7E 1Z0GA 1Z5CA 2A2CA 1H7SA 4JYAI 1IBLE 1I94I 4DR6E 4DR3I 2E5LI 4Z7YA 4FWHA 5A2QC 5LMNI 4JI3E 4DPTA 1XNQI 2HKJA 4B3SI 4ED4A 3PYGA 2DEIA 4LF8E 4PRXA 5FLXQ 2VQFE 1K47A 3K1JA 4DV6I 4JI6E 4URLA 4YY3I 4JI2I 1XHKA 1HNXI 3T1HE 3J81C 4DV7E 4LFAI 1Z5BA 1XNRE 1N33I 3D4JA 2UXDI 2V2VA 3QT5A 4USKA 4GKKI 1RREA 4DU8A 2F4VE 3QT7A 5A2QQ 1FWLA 2UUCI 4DPYA 4DR1E 4MYTA 1WUUA 4DPWA 2UXCI 4JI5E 2UU9I 4LFBE 4B3ME 4JI4I 2OI2A 4JI1E 4LF5I 4LF4I 1XMQI 1D6TA 3B82A 1ELOA 1FI4A 4LF9I 1H73A 4X65E 3HULA 4DV0E 4JI7E 4AQYE 4DU7A 3J81Q 4HXZA 3ZM7A 4LF6E 2HK3A 5GMEA 1N32I 5LMUI 4JI0E 2UUBI 2VF3A 5BR8I 4GKJE 3WU3A 1MG7A 2EFGA 2VQEE 3ZZ0A 4USMA 1FJGE 4OX9E 2CZ9A 4DUZI 4NXNI 3GONA 4HYMA 3V2UC 3Q1QA 4DV2E 1Z0TA 1XMOI 1UEKA 4JYAE 1I94E 1KKHA 2R3VA 1KTVA 4DR3E 2E5LE 4FW9A 5LMNE 1XNQE 1ZM2A 4YHHI 1MU5A 4B3SE 4K0KE 1HNWI 4B3RI 4XTJA 2A2DA 1KVKA 3B78A 4LFCI 1IBME 1N36E 4JV5I 1H74A 4YY3E 1J5EE 2HHHI 4JI2E 1QZRA 4DR4I 1HNXE 4X66I 1S4EA 1N33E 1ZM3A 4DPXA 4LF7I 2UXBI 4P52A 4GKKE 1Z59A 2J7KA 4DV1I 2V34A 1RR9A 1Z0BA 4PU9A 3H4LA 3LNUA 2BM0A 2UUCE 4UTGA 4MYUA 3K17A 2UXCE 2UU9E 1BKNA 4JI4E 4HACB 4FN5A 4LF5E 4LF4E 1XMQE 4UT4A 1IBLI 4LF9E 2XEXA 1NHIA 2Q2EB 2ZM6I 2ZITA 2GS8A 3PYDA 3WU5A 1Z0VA 4JI8E 1N32E 5LMUE 4WUCA 2UUBE 4DV5I 5BR8E 1PKPA 4DUYI 4DV4E 1KIJA 2AJ4A 4NXNE 3J80C 1EI1A 2X36A 3PYFA 3PYEA 4DV3I 1HNZE 1N34E 3WU6A 1MX0A 1XNRI 4DPUA 4YHHE 3OTOI 1HNWE 3QT8A 1B62A 4X62I 3WU4A 5IT9C 5LL6R 4DR5I 4KQVA 4LFCE 1IBKI 1S16A 4JV5E 1Z0CA 2HHHE 4KHPI 4DR4E 1HR0I 4ZVIA 3J7AM 4X66E 5IWAI 3J80Q 3B8HA 4LF7E 1ZM4A 2UXBE 3CWVA 4DV6E 3T1YI 4RPFA 4DXLA 2UUAI
chains in the Genus database with same CATH superfamily
2GJFA 4DSFA 5KFGA 2ZDPA 4LFAE 3BBCA 3MTJA 3DRXA 1WG5A 2J7UA 3A3OB 2PNLA 1E6VB 4DV7J 2D3OR 4MFBA 3NMAA 5L3JA 5F41A 4ZLJA 2W9BB 1R31A 2XZWA 2HQ3A 2HMIB 1O0PA 1X31C 2YKMA 3LTOA 3DMJA 4X64I 4KSEB 1RYRA 4EBDA 3OXGA 3CXCR 4YB1P 2F4VJ 2JVRA 3K5LA 2VG6B 1JLCA 4DR7I 4B9SA 4ECTA 5KG2A 3LGMA 3MURP 5K14A 1LXJA 2ZBRA 1MLAA 2WSFC 3JAMQ 1DQ8A 3ZTOA 1BUXA 2C1EB 3M6XA 1SC4B 2QMUB 2HZAA 4OYIA 3WHIA 4DJBA 1OYEA 3NS5A 4P2SA 2JEFA 3ZKDA 1R43A 2CPIA 2OAUA 3G6XA 4TU7A 4ZITA 2YWHA 1Y3KA 1RWOB 1T03A 2NLWA 3W8PA 2WBMA 2HRUA 4RWXA 4X4TA 2XC9A 3DI6A 2VFVA 4LPFA 3DOLB 4JB8B 5HANA 4Z7CA 3GV8B 2JOQA 5A6WA 3ZZUA 1YJNS 4QIFA 4MQYA 2DTJA 2WZ1A 2WVEA 3ENWA 1KLNA 2VG5B 2BR2B 5IWAF 4KO0A 5I42A 3SZ2A 4O3SA 4B9NA 4U9RA 4DCOB 2APOA 4IZJA 5F9NA 3C3LA 3UR3C 5FLXC 1U6FA 3VQSA 4DZDA 3M1VB 4LF6I 2AE8A 2LECA 1UPMB 2J0SD 1NPKA 2NPFA 4HY1A 4LSLA 2KZMA 2G2OA 2R7TA 1OYDA 3BGRB 2DRAA 1P8GA 3D0HE 2Q3PA 1VLYA 2XY7A 1MN9A 1WJ9A 4LF4J 4DSEA 2HNZA 4JI3E 4DR2F 2HGNA 2FIUA 3BDPA 4B3SI 2ZBQA 1X7VA 5D77A 1NEEA 3EZOA 2IM3A 4EZ9A 5CZXA 1Y6ZA 4RBUA 3JAMU 2KO1A 1IKWA 2FC9A 2DGVA 4F0MA 3BR8A 4ZS6A 1FRXA 2EW9A 3MEDB 1MMLA 4F4AA 1AUDA 1MWQA 4J9RA 2DYAA 2Z0GA 4DMZA 3DOKA 2IRXA 3LO3A 3DRPB 2XLKA 5U47A 4KT0C 4LFBE 1VJQA 1TK5A 2I38A 5F9LA 5KFRA 1LW0B 4P2MA 1FI4A 3GILA 3GYXB 3I56S 4JI8F 3KJVB 1S9GB 2YY3A 3U1YA 4Y2KA 2D74B 4JI0E 1DJ0A 2WTFA 1Y5IB 2DR8A 2GAGC 2PA8D 1F1BB 4CLTA 1NMEB 4IFDB 2KKHA 2CZ9A 4ECQA 4C11A 4AQYF 3FVYA 2H3EB 1G4CA 4RW7A 2OEMA 1FJGF 2L9DA 1JWWA 2GO3A 4PWDB 4NCAA 2CRLA 1SQGA 4YY3E 4HVZA 1TAQA 4JI2E 2LU1A 2KDOA 3AOBA 1S4EA 5K8OA 4HR2A 4A8OA 2J7KA 3L7UA 3IR6B 3MM6A 2KFYA 4OI2A 2G4BA 1D8ZA 2QMXA 2X3GA 3BBFA 4LRFA 2B51A 2BANA 4X62J 4CDIA 3BGFA 2WB4A 4NL5A 4PG8A 4ZVRB 1CS4A 2CG8A 2BE2A 2G1HA 1U0HB 2G0IA 2PMWA 1A7GE 4RL1A 2YQ3A 1BQNA 3PW2A 3T1YJ 3D3BJ 3HHEA 4OX8A 4ZVTB 4NZ0A 1OYSA 3CE8A 2AJ4A 2CQ2A 1EAYC 3PYFA 2MDAA 1OY6A 4Z37A 3U7JA 3R2DJ 3NWRA 1NPRA 3OTOI 1HNWE 3W63A 4J9NA 3L9ZA 4YR3A 3OTEA 4PEOA 5E3RA 3M6VA 2Z30B 2I5JA 3M9MB 4ID5A 1OYPA 4DR4E 2V4QA 1V5VA 1UP1A 3GCWP 3JSRA 3W7BA 4TY9A 3J80Q 3FQLA 3MHYA 4HDGA 4NWBA 3W3SA 1YX2A 1LNQA 2DY9A 2JJ4D 4RUCA 3H20A 4DV6E 3JQMA 4Y0FA 1B70B 2K3IA 3PS2A 2WSEC 3D0IE 4BWJA 4C8ZA 4FF1A 1TELA 2LLZA 2M2BA 4ZPWR 1JNZB 2HQCA 1F9EB 2FY1A 3W64A 1UPPA 2D9OA 4J3DA 2KXHA 4EGLA 1FKAE 2YTCA 1C0UB 3I4PA 2JWNA 2UVVA 4ZP6A 2UXDF 4K0KI 4YEAA 3LA0A 4DV5E 1N0UA 3SMZA 3JSMB 1DTQA 2OPSB 5LJ3Y 5GAHI 1HLWA 5D4NA 2J5AA 2JEIA 2D7SA 4ZVHA 4J9LA 2HG4A 2Z5BB 1Q8LA 1NM2A 4TU8A 3BM7A 3O5TB 5DG8A 1U25A 2CPJA 1X5SA 4IZKB 3F41A 3FFIB 2E1RA 6FDRA 5ITHA 4M5KA 2GIQA 3CJQA 3VAJA 2PI4A 1S12A 2PEHA 4JG4A 1F3VA 4JYAJ 1CEZA 1UDOA 2UVRA 2QSWA 3DRRA 2E1CA 1S9FA 2BYCA 3MI7X 4K0KJ 1P9QC 3J80U 3GFZA 2KJVA 2UUAE 1PIEA 1JLAA 3VGVA 3NAHA 4DL2A 2DNOA 2PT0A 4B3RF 2R42A 4YB6A 4FNIA 3HHKA 1ZA1B 1HNZI 1T9UA 7AT1B 3IO1A 2E7XA 5C5JA 2YKAA 3M2RB 1RHKB 3DKDA 2ZFHA 4L72B 4F26A 2ATLA 3I4HX 4CYUB 4OX9I 3GG0A 4OYOA 2UU9J 2IA6A 3V6KA 2E5LI 3LAMA 3HJCA 5A2QC 1XNQI 3GQCA 2YPZA 4KGKA 4EWTA 2CQGA 1YQHA 1EKRA 1N36F 2IBKA 4DR6F 4ANDA 5DDQC 3O8WA 4OI0A 2CZ4A 2W2OP 3D68A 1ZAXA 4N5SA 2OP5A 2DR7A 3K8VA 2CPHA 4X84A 2CJKA 2FGOA 5GVQA 2AP6A 2I8EA 1HNZJ 2XBPA 4Q45A 2YX7A 2ZHAA 4B3OA 3P96A 2L48A 4HT7A 1I5OB 1MW7A 2MJNA 1L5UA 1SC6A 2C2MB 3QT7A 3OFHA 1RTIA 3KLFA 3TQEA 3TI0A 2N3OA 4JI4I 3JYTB 2BUNA 1HNIB 4C98A 4AM3A 3DLBA 1IQZA 3RBEA 4RWWA 5IZHA 3HULA 4DR1F 4C0OC 2DD8S 2PO2B 4IOAQ 2KXFA 1N32I 3J7A1 1F9FA 4JI1F 5KFDA 2AX0A 1DURA 2J9DE 5LSLA 1SKUB 2VF3A 4J9PA 4GKJE 2RUSA 3WBZA 3A8JA 4X65F 3VZIA 1KONA 3GZ7A 4DV0F 2W9CB 2CADA 4NASA 2PFDA 1VFJA 2XMVA 1X4AA 4OO1E 4C0BA 2Z56B 3HXMA 1Q82T 2DNRA 1SQEA 2VQEF 1RTZA 2X1AA 2BR0A 1ZM2A 4DSJA 4IH7A 3US5A 2DVIA 2CQBA 3IG1A 4PG7A 4CLKA 4UQTA 2M88A 3E2EA 3VAFA 4FBUA 3OL8A 4BCAA 1VI7A 1P9YA 5T7LB 1GMVA 4ISAA 2V34A 3KJNB 5K8NA 1OYRA 5C0XC 1S9EB 3LNUA 4ZLLA 4CH7A 3M30B 3H90A 1JLQB 2B8QA 2C42A 1LV5A 3THPA 4CRJA 3A13A 4HTJA 3RTVA 1S79A 4LF5E 1ACMB 4YR0A 3EZ5A 1X4CA 2O1PA 3TZYA 3G87A 3H7HB 3OR2A 4O4GB 2K7KA 4AUKA 5F8GA 3ITHB 4Y6IA 1B64A 4ERDA 2FLOA 4WU3A 4IG3B 4FDFA 3NGUA 4BA1A 1CPZA 4G3IA 5HQMA 3MEKA 2MGZB 5J2PA 1BD6A 1NUEA 2UUBF 4UY8T 4G6VB 4DQQA 2FJVA 3GLLA 5A8KA 3N5BA 2J7WA 5HMXA 3MMJA 3FMWA 2P9GA 4KPCA 2HEKA 2HHHE 1Q8KA 2LMIA 2ZOMA 1YJWS 2HW3A 3D3CJ 4KIAA 1P1TA 4RNMA 1ZM4A 1YKWA 1BY9A 3HDSA 3LANA 5JEAE 3D5MA 3W5ZA 4ZP7A 1N52B 4LF7F 3JAMC 4W4MA 1VR6A 1QAXA 3PNIA 4DFPA 4P9SA 1E6YB 1WG4A 1FKOB 1FRMA 4K4VA 1AZSA 4FF2A 1HBUB 1S6PB 3DM2A 4LUBA 4LIWA 2W1BA 5C42B 2RUGA 4G1QA 2G0JA 5KFTA 2MKKA 1RWNB 3KMSA 2ZZMA 1GTEA 1M5SA 8RUCA 2QEXS 2JEGA 2ZH6A 1ZZFA 4NA1A 2HFZA 2ZJQQ 2VBYA 3L7ZB 5K36B 5CYMB 2JFKA 4ZCIA 4GO7X 3W65A 5HVGA 1K1SA 1JKHA 2ZZTA 4N77A 3MMCA 2FDNA 1NHJA 3MAAA 2BDPA 4Q5VA 3CCLS 2DXFA 1KFSA 3ZNUA 3TA0A 2MTLA 3O2IA 3LALA 5IXUA 1BQMB 1JLGA 3IA0A 4J9MA 5JVHQ 3CDAA 4JUZA 5KFHA 3C15B 5J1EB 3CJ5A 1N0VC 2CPDA 4ETXA 3HSDA 1A9NB 2BKPA 5BYQA 4K2XA 1FWKA 2BA9A 2K2PA 4CH0S 1EHWA 3OV7A 5M2PA 1LK7A 2DGUA 2V9WA 5AE1A 2YNHB 2W2QP 2NS1B 3CO0P 4OO1D 1PJ5A 1U2CA 1REGX 3HT3A 4QNJA 4EUVA 1X5TA 2V63A 4CT9A 2UUCJ 3IAM9 2C39B 4HI1A 2F65A 5DRQA 2RU9A 3PW0A 4DR3I 2CQ4A 1O5JA 3EDRB 1XMQJ 4L3NA 4DPTA 4KKOA 2H4WB 1RABB 2Y1JA 2KVQE 2GVDA 3MM9B 4PRXA 2KJWA 3SCLE 3HPOA 1WC5A 3KK3A 4JI6E 4URLA 1EETB 5BR8J 3Q23A 2ZH2A 3HJVA 2ZUAA 3Q24A 3EGNA 2HS0A 1VRQC 5J2MB 4LFAI 1LWEB 2GQ2A 4LF8F 3PEJA 5K9FA 1XNRE 1TV6B 5D0GA 1QVGR 2JDJA 4QU6A 3QT5A 4USKA 4ED1A 2E1AA 4XAKA 5F8LA 4BWMA 2OPPA 4F50A 5F0WA 2XTJP 4FYXB 1HD0A 4DPWA 4U96A 2RF2B 4W92B 4LRDA 1KR4A 1A0OB 4LFCJ 4NE9C 3J81U 5T14A 1NRKA 1HBNB 4QIGA 4DU7A 1YI2S 2IDEA 5LMUI 4DV1J 3M8QB 2KRRA 4DF4A 4ES1A 2PNZB 5LXRA 1YZ6A 3R3TA 4UOHA 4JI7F 3V2UC 3C16A 2CYYA 4LFAJ 1H7XA 2VA2A 2IJNA 5D3GA 5LOQA 3K5PA 2IJFA 1K9MT 4ES2A 2A6OA 4C8NA 5LMNE 2BEFA 3AODA 3BSAA 2DPJA 3ZTSA 1QM9A 2Z2LA 4AFFA 2XGPA 4C3MA 3TUJC 2AYMA 4TLRA 5THWA 4RW6A 1BE4A 1REVA 4WKRA 1KN6A 5JEAD 2K1RA 3L7OA 5KT4A 4DPOA 2VPXB 3D2WA 3R5BA 5EDWA 2FVSA 3OFGA 3SSSA 4WP8A 4DLGA 3O44A 4QBUA 2AZ3A 3DGVA 1BLUA 1WI6A 5KFVA 5KG0A 2GIRA 7FDRA 4IH5A 2DR6A 1N33F 4MYUA 5AE3A 4GKKF 1BKNA 4HACB 4ANCA 4NI2A 1NHIA 2XULA 3VWSA 1CJVA 1QE1A 3JSBA 2O67A 4EEYA 4V19X 3BBBA 4DFJA 5KFYA 2O5DA 3BKFA 2BA0G 4Q44A 1X4GA 3J80C 1FD2A 3GSDA 5EKWA 4HI2A 2X36A 4W98A 1TL7A 1HWLA 3J81j 2DCUB 2LQ5A 1MX0A 3PV8A 3CC7S 3FZ2A 2DISA 1VRUA 4J9KA 2HHQA 2IA0A 1LQ9A 1UWBB 1USUA 1QUPA 1IBKI 1FHTA 1IKVA 3MMAB 4P71A 2VFRA 2JEBB 3B8HA 3BJYA 5HAOA 2LEAA 4JI3J 1I51B 3CWVA 4JV5F 3H5XA 3JTOA 2R8IA 1GK8A 3TOQA 3KUHA 2NXCA 1S77D 1FNOA 2J0XA 2NUUG 2HWIA 5T41A 5A8WA 4MMOA 4M5GA 1L3TA 2ZM6E 2OFHX 2IM2A 4I2QB 4NLQA 1WDTA 2ZBPA 4IOCQ 1HPZB 1HWIA 2HLTA 2EC2A 2BRKA 5J2NB 4CLSA 4F04B 2XQCA 3F44A 1NJXA 4DHVA 5EWGA 4NRTA 4DUYE 4LFBJ 5FIIA 1DTTB 2GC8A 5L1IA 1FD8A 1U8WA 4ZJQA 4J9UE 5KT3A 1L3SA 4DL4A 2RH3A 2XWYA 3PKYA 4JI0J 2JX2A 2C2OB 3WZ0A 2E66A 2FVQA 2BKNA 2M7SA 5HO4A 3I0RA 3VAMA 2BM1A 4OX6A 2M70A 3P5TL 1TZ0A 1SL0A 4ZPVR 1H7UA 1RAIB 2GQCA 2YNIA 4S0MA 2RDJA 3G86A 3H2LA 1V9OA 2CAJA 3W8GA 1NJYA 1UAWA 3SSQA 2R2UA 1HR0F 3Q2TC 1UJ6A 2XMWA 4QNKA 4B3MI 2B9XA 3MEGA 1VMBA 3U02A 4YY3J 4JI2J 2QC3A 3ETMA 2HIYA 2VESA 4IR9A 1JQGA 4NXME 3HHLA 1OJ4A 2PO0B 2Y1IA 1OIAA 2OPRB 4ILMA 5B0BA 4DV2F 4OHYA 3IRXB 2UVWA 4DEZA 3AQPA 5E41A 4OYBA 1I94I 2XB2D 5KG3A 5F8NA 3N9UC 3BS9A 2WSCC 1UJ5A 2HQGA 3OVAA 5AXNA 1QSLA 1R3NA 3C8YA 1K47A 4WZQA 1RAEB 4DV6I 2MY8A 4Q0BB 1RT5B 1X8DA 2GIFA 1HNXI 3TZXA 3MM5A 2HSEB 4R0EA 1WEXA 3S7RA 3MR3A 4K5SA 3DOLA 1R89A 2V2VA 4PG5A 3SQGA 4HYKA 1N5YA 4MFBB 2P6TA 3VALA 4DSLA 2XY6A 4DV7F 2YKMB 3CIMA 1HNWJ 3DMJB 2W4DA 5DLGA 2VIHA 2AMCB 4JI5E 2GO4A 1EQMA 1ZPVA 3A1YG 2AYEA 4BHQA 2F4VF 1JLCB 4DR4J 4F4KA 3QBCA 5C7PA 2Z57B 5M2UA 5AJ3J 2XM3A 1Q7LB 1TVRA 3CCES 1W7WA 2DK2A 3AA8A 1JK9B 2ROEA 4C2MA 3Q8PB 2RB7A 3QGHA 1HI8A 4NXNI 5DQGA 1TAUA 4ZVQB 1KKHA 1Y4ZB 1T03B 3N6LA 5B0GA 4YHHI 4LMZA 5KFBA 4NBQA 3AOAA 2K06A 4F4ZA 1RU1A 5IV3A 3R1HA 3HHDA 3R7NB 3H25A 2AQ4A 1U8SA 3OSNA 1I6JA 1KQGB 3LF0A 4DV5J 2CPFA 2DB1A 5F3ZA 1Q8IA 4Q8FA 2HHWA 2YQ1A 4MU0A 4KO0B 3P3DA 5I42B 2RIJA 3MPDA 2GAHC 5KFAA 5KFZA 2UXBI 1PILA 3BREA 1JXLA 4IZJB 1RR9A 1KQKA 5H9EJ 1U1NA 3D28A 2UXCE 4OI3A 1G3OA 4LSLB 2PSZA 2JLGA 1Q86T 2GZOA 3H5UA 2RRBA 5AXMA 2GCFA 2ZITA 3GYGA 1Z0VA 3LWMA 4JI8E 2HNZB 3IFEA 4LF4F 2G0CA 2HPUA 2GHWA 2D3UA 3CJ2A 1U2FA 4USUA 3DLKA 2UUAJ 4QPXA 4QCLA 2R8GA 1IKWB 1FJ7A 4A8QA 4FVCA 2FJAB 4YP3A 5HVFA 2GJIA 4Q2MA 2C37A 4OJ1A 4Y2MA 4JBCA 4DR5I 4CO4A 4ZCKA 3W1YC 3DOKB 1Z0CA 5I3PA 1IKXA 1I1GA 4CI0B 4KHPI 1SJ1A 1F60B 2XNQA 2P8IA 4FYWB 1CSJA 2KT3A 5A76A 3RU0A 1TMMA 3BO3A 1RAAB 1BXNA 4X4UA 5D4PA 4OYMA 4A8SA 1AA1B 4UOGA 5KOWA 5CCLA 3AHPA 4HDHA 1Y9OA 4HHUA 3LW5C 4C11B 2AGQA 2B8PA 1RLDA 1RBLA 2VFTA 3FRZA 4RW7B 1S5ZA 2FJWA 4F7VA 3F73A 4FBTA 2R4FA 2IJRA 4LRBA 3RGIA 4A8KA 4H4MA 3BKTA 3W9JA 2HK2A 2DGTA 5GMKa 4NA2A 3CJ0A 2GVZB 1TKZA 4AXIA 3IAS9 2DO4A 4WFAQ 1T9XA 3MXHP 3CCWA 3MEEA 2V67A 3I9V9 4UF4A 1RA6A 3MM6B 2W2NP 3A4TA 4GKJJ 5L9XA 2YNFA 3T1HI 1HI1A 2IM1A 2BANB 5ETNA 4X62F 4WYLA 2NN6E 4HH0A 4L73A 2HVIA 3PKMA 1S1XA 5KG6A 2MQ8A 2QMWA 1CS4B 3M8RA 4KY3A 3TZZA 2BE2B 2JT2A 4JV2A 3R27A 1BQNB 1D9DA 5KFJA 4A4JA 2QYCA 3M05A 2IDLA 1R27B 2LQBA 3T1YF 1B99A 4J90A 4E8UA 2V4RA 3QJLA 4X64E 2G2ZA 4DI6A 1ZXNA 4FWGA 1BQXA 4EU0A 4UOFA 3OUYA 4Y28C 1DARA 3JSMA 4DR7E 2PDAA 1H7SA 3SIPB 4LF5J 2HS4A 4LCFA 2I5JB 4ID5B 4F4XA 1RSCA 4F2RA 3CC2S 2I1RA 4ED0A 4O3NA 3ZTRA 3D7SB 3DHXA 3E01B 2EKYA 4UW2A 3HK2A 2QLWA 4IZKA 2YPYA 2LA4A 3NZKA 2V4JA 3UFCX 3HI9A 4NLYA 2OUGA 1LK5A 1F6TA 4MIBA 2LCWA 1FJCA 4YQWA 3CDJA 3HCXA 3RBDA 3OJUA 2FVRA 4DPYA 2FLPA 2ZVSA 3NEKA 4OHWA 3D9BA 4EO8A 2HHHJ 2RNEA 4LF9I 1DTQB 3AJDA 2BQRA 3DU5A 3NNAA 2F1FA 1FKPA 1PSDA 5F8IA 2M8DB 4LF6E 1RTHA 4WIIA 2MZSA 4I67A 4YN3B 1GEHA 2EFGA 5CA5A 4O23A 4NCGA 3P6YC 1V3SA 3I96A 2NXEA 3WX4A 1Z4UA 2JFDA 2RQMA 3CJKA 3QIDA 3NP5A 4B3SE 3WDOA 1WF1A 3TNVA 4JYAF 2JC1A 4XTJA 3DRRB 4M5NA 5M2RA 1S49A 1D9FA 1TKTA 1N36E 3NCPA 3KYLA 4DFKA 1QZRA 3H2UB 2GMLA 2WBRA 4NMLA 4K0KF 2J76E 3MPUB 1S10A 1J5OA 1JLAB 3ILJA 3OTDA 4OZ2A 2IIHA 2VU5A 2GHVC 1VQYA 1NKCA 3QAUA 3MPWA 4CO0A 4DBQA 1RHMB 1BHNA 4XK8C 2ILYA 4LIRA 3V6DA 1RT7A 2QE5A 4OI6A 3MDFA 2DNHA 3JYTA 3KWMA 5BYSA 2C3MA 1NKBA 3AA9A 4F67A 3AXMA 1YLXA 4UT4A 3QYYA 1G1XA 4DL0C 3BZQA 2OEKA 4N8OA 4NMXA 3UQSA 2UU9F 3UD4P 1NK0A 3OL6A 2BJ7A 3GIMA 3CCZA 3PACA 4EZ6A 3JTPA 1L3KA 1EARA 2IAJA 1KIJA 2KTQA 1EI1A 2JE6A 4XDDA 4DV3I 4YDDB 2CIMA 3Q2SC 3IWLA 2IYIA 4TVAB 1XNRI 2QGFB 2JEAA 2ALYB 4DPUA 4B3OB 2MJUA 2B9YA 2W01A 1HNZF 3DLLQ 2NN6D 4FP9A 3ZTQA 3SYZA 5ETKA 4WPAA 2C3OA 1RTIB 2PD1A 3KLFB 1RT3A 2HLUA 3RJMB 4IFDE 2XMAA 1JNRB 2QN6B 1ZBTA 2QLFB 4DX8H 1CJTB 1B3TA 3K7RA 3UNYA 2KYXA 4FYDA 3D0GE 2DGQA 1QSYA 2R7RA 2MYFA 3QPIA 4JI6J 5DG7A 5J2QA 1OO0B 5CD4A 4IR1A 1JXEA 3AB4B 4K4TA 3CF5Q 1TK8A 4NLGA 2C28A 1YRUA 4B3TI 2B7BB 4IG3A 3TX0A 2R7VA 3IG1B 4OJHA 2ZWOA 3IS9A 4D3HA 4OYXA 2AF6A 4E98A 1WNEA 3OTOE 2VQFI 2B43A 3K2YA 2PFFB 4KRWA 1S1TA 1NJZA 4N7TA 2DGWA 3MUVP 5ETTA 4NEZA 1VJWA 1RCXB 3DRSA 1QD1A 2RQCA 2XG8A 2GW8A 1IWAA 3LPSA 3KMQA 1GAOA 4LRAA 5LMNJ 1IM6A 2HFUA 3ENQA 3OR2B 5KFPA 1UVIA 2EG1A 1WOSA 2E7VA 2ZDOA 1MROA 2F5GA 3I31A 4M1KA 5B0AA 1Q78A 2DXDA 1Y10A 4A46A 1BGXT 4BA1B 1AFJA 4QU7A 1IUJA 4OL8A 3P5BP 2Q1LA 5DGBA 2QZ8A 5J2PB 3GJQB 1DY3A 1RT2A 3T3FA 5C0XA 1UFLA 2VL1A 2VDIA 1WKJA 4I68A 2OO4A 1N88A 1CG2A 2M4MA 2C2ZB 3NNCA 5A8KB 1SCJB 2JL9A 4U67Q 4U7UK 3RUBL 2FJEB 3FNNA 5IM0A 3TAMA 1SJFA 1F5CA 1YBUA 5FLXU 1OS5A 1BMQB 4CTAA 4Z2XA 4PG4A 4KPYA 2FJDB 3VV2B 2QA2A 4WTYA 4ZN3A 2KG1A 3MECA 1VQ6S 2RRAA 2DNPA 1KDNA 1PGZA 1UMJA 5KFMA 3DRYA 1XMOJ 2HGMA 4JV0A 2ZUGA 3LUYA 3M2VA 2EBGA 1NK9A 1IVZA 5CHCB 3A3PB 3Q89A 1AZSB 3P8BB 3W2VA 1PAUB 3DM2B 3ENVA 4Y2CA 3MUTP 1Y5YA 1RWMB 1NDPA 4G1QB 2WK4A 5GAEU 3HF5A 2RQKA 3HP6A 1FA0A 1YITS 3AB2B 2AGPA 4WU2A 4HXZA 4A8YA 4LR7A 1HQ2A 1UZDA 1JKHB 1YJRA 2IVMA 3WC2A 3MMCB 2IOQA 1D3WA 3THTA 1UA1A 3MAAB 2C3PA 4OX9E 4ZJLA 1U0SA 2KG0A 4C97A 3NGRA 1FE4A 2L08A 3GV7B 3KKFA 2LXIA 2E5LE 2BJ8A 1VQ8S 2VFSA 3UD3P 1JLGB 1ZTTA 1XNQE 3HSZA 4CO2A 1MU5A 4RU2A 2ZM6J 1DBDA 4IFDD 3BPSP 1HKAA 1HWKA 2IHR1 4UY85 4Q43A 2ZEJA 2BKOA 1R8BA 2PC6A 4DUYJ 3UHMA 4N41A 1PBAA 5HI7A 4X66I 1LWCA 4I6WA 1VRTA 3N6NA 1RT4A 4DX7A 4U8YA 1ZTWA 2OFGX 2MEWA 5E2QA 4LREA 3VHQA 2GGPA 1YZ7A 3DLEA 4OYAA 2CG4A 2YVSA 4KAIA 3BN4A 2MKYA 2MHEA 1YJTA 3NS7B 4FPIA 3H4BA 2LQ8A 4JI4E 1JJCB 1B7YB 2XMJA 3BYRA 2JVOA 2YKNA 5DRPA 2UUCF 4C4WA 2CQ0A 3IMQJ 1WACA 1N32E 2VPZB 2KM8B 1XMQF 4KKOB 2GVDB 3PIPQ 3FSXA 1VQ9S 1LKZA 2ASJA 1CC7A 4ZVPB 2CJYB 3KK3B 2MPUA 2MQLA 1VGYA 1N34E 1D9AA 2DRBA 4ED8A 4CQ1A 1RCOB 4M95A 5BR8F 3VVTA 2VPWB 4NXMJ 3JB9k 2NXJA 2IVFB 4MIWA 4KBIA 4L76A 2F4FA 1M1KT 4P2XA 4AIDA 2P6SA 2JC0A 1HBMA 1E3HA 2OPPB 4RW9A 1NH7A 2MLYA 2CNKB 3PRDA 4KV8A 4LSZB 3W62A 3ZFVA 3PW4A 2ROGA 4CLLA 5IWAI 1L3UA 3GSIA 4DG1A 4LFCF 3Q6MA 1KQSR 2VJVA 1QUVA 4DXLA 1EZZB 2CXEA 4OHVA 2QTWA 3CWJA 4DV1F 4NLDA 4EO6A 2CQIA 4OFZA 1NK5A 2ALZA 2WVCA 2RD5C 3W66A 2Z2YB 3C16B 1IQTA 3TQ1A 4CIOA 2AJ2A 4QZVB 2A1BA 5D3GB 4LFAF 3PG9A 3ZZZA 4KH0B 3C2PA 2FB0A 3E3XA 3T6BA 2XMMA 3E8OA 2JEJA 2XLIA 4PABA 3Q0AA 4DR2I 3EGZA 3R1LA 1VBKA 2WOMA 4Y2AA 1WC1A 2OMLA 4I69A 4JI5J 4RW6B 1ITPA 4P7AA 1REVB 1H2TZ 3EICA 1A6FA 4I6AA 3J7YI 3GJTB 1L3VA 4I3HA 4ZMMA 2DNYA 1X4DA 2KN4A 4I7FA 1U26A 1LWFB 4TXSA 1GMWA 2B4UA 4P72A 3KG0A 2HS3A 3NL0A 3R97A 3BKUA 3ZKBA 1C4AA 5ETRA 2POKA 3EPIA 3H1CA 5HBMA 3KLIA 4NI2B 5K8PA 1RUSA 1SJQA 1VQ7S 4OO1C 1VDHA 5H9FK 4JI8I 1RWUA 3W5YA 1CJVB 1M90T 3TRGA 4F4YA 4EMDA 1VLOA 2H4YB 1NAQA 3OW2R 1TL7B 4AQYI 2WW4A 2CDQA 2X3DA 1RHYA 1SUQA 2PO4A 2FUG9 1FJGI 1G2EA 1VRUB 2QSFA 2A10A 2UXCJ 4ZVUB 1HHQA 1IBLE 1PAEX 1LFWA 5MLCV 1ROFA 4Z7YA 1QAJA 3R7BB 2UVUA 1IKVB 3TAPA 2IMWP 1IR0A 4CLFA 2KI2A 3IR7B 1N56A 2RKIA 2Z2MA 4JI3F 3GLJA 3T5KA 3BR9A 2CUYA 4ZIWA 5E0OA 2Y1RI 3Q8SB 5A2QU 1H98A 3NMRA 1NK6A 3R5AA 1KLMA 2Y8YA 5K36E 2OJ3A 3UNGC 1WUUA 2XLJA 2XI3A 3G82A 3B82A 3GE9A 2ZE2A 2R8HA 2E44A 1RAHB 4C9DA 4LFBF 3ZM7A 2DPIA 5L46A 3PX4A 4URSA 4RW4A 3UR0A 1CJUA 3M9NB 3IWXA 3CB4A 2HVZA 3OR1A 4HYMA 2ILZA 4DV2E 5JEAC 4JI0F 1RHJB 4USWA 5L38A 2H9ZA 4DR3E 3NXZA 2AYGA 3I0RB 1XMBA 1R8CA 1HHTP 2BMBA 1RAGB 2CQ3A 4M94A 2AEJA 4EYIB 2QLBB 2RSQA 2YNIB 3G8SA 1H74A 4CM0A 1JX4A 2MZ1A 1X5OA 1WD6A 2CQPA 1CQNA 1NZ8A 5IC4B 3CJSA 3MEGB 2OLWA 3CT9A 3K5OA 3Q6NA 1FT8A 1FK9A 4DS4A 1M5VC 2VD3A 3VF0B 4YY3F 5MAOA 3H5YA 4JI2F 1DLOA 3I0SA 1U45A 3HHLB 3ET6A 1JJ2R 2HBZB 3AD8C 1TL5A 3QRPA 3QIPA 2QJ3A 4P10A 3MMBA 3PRBA 4C8OA 2XEXA 2F7VA 2ZJRQ 4PXEA 3AFGA 2MKSA 5LMUE 1NKEA 3M7ND 3RB3A 2YWFA 5KFWA 3D1HA 1PKPA 3C46A 4DV4E 3MOZA 4ECRA 2D3ZA 1RTDB 3R7SB 2BA1D 1UW4A 3QO9A 3MM5B 4UUWA 4X64J 1M5OC 1E3PA 3SQGB 4LF2A 1N5QA 1N5YB 2Z5EA 3GB0A 2HHXA 1X9WA 2LDYA 5HL7Q 1QVFR 2VKZG 4DR7J 1MN7A 2U1AA 3HKZD 1HNWF 4USHA 1X9SA 3FRYA 3EGVA 3R8YA 3G6YA 3VGSA 2DIUA 4NLOA 3GWCA 4DR4F 3NGKA 4QWEA 2F8HA 2L9NA 5A0YA 1TVRB 3DXBA 1MMDA 5AJ3F 4CM2A 5JMNA 3HSGA 1H72C 3PM9A 1M1GA 4FXWA 4G1IA 3C6UA 3VAIA 3W5XA 4DL5A 2QT7A 5LL6d 4L75A 5KOXA 2YQ0A 3G71S 1H3DA 1NK8A 1FKAF 3D1OA 1FFWB 1FXLA 1HD1A 3CDEA 3M85D 3ZZYA 2QA4S 4ED6A 1N36I 4KB7A 4DR6I 3GIIA 2HNYB 4OV1A 4H4OA 8AT1B 5L1KA 4ELVA 5SZTA 3QWUA 4DV5F 3NCRA 2DNLA 2O1UA 4FW4A 4LF6J 2CA9A 2MXYA 1NBEB 2VBXA 4DUZE 4J7CA 4CZCA 5HMYA 1F9HA 5K36D 4ATNA 3ZZPA 1IBKE 2MKJA 3KLVA 2VB6A 4C7QA 2NYHA 2AV5A 1FWPA 1T9TA 1OPIA 3V4IA 3NOGA 2DEJA 2WVFA 1FVQA 2YKQA 4NX9A 4WTOB 5DZ6A 4BC9A 3ZNJ1 2XS5A 4R5PA 4B3SJ 3T5HA 4DR1I 5IC6B 3SV3A 2KXNB 3NRBA 4ZVSB 3CJ4A 1QTMA 4TN2A 4JI1I 1VC0A 2VONA 3QSYB 2DIVA 1XTZA 1VQ5S 4X65I 3DLKB 1P6TA 4DV0I 3GJSB 2CVEA 1GNKA 2UUAF 4K4ZA 1U02A 3CO9A 2DKOB 2EXUA 2GQ0A 2GX8A 4A8WA 2VQEI 1R6MA 1H2UX 3QGGA 1APSA 2XMUA 2C37B 1UZHA 3CSKA 1VK8A 2GVZA 1JIHA 3ULHA 4BS2A 4ZPDA 1IKXB 2GA7A 3TVKA 2C2RA 3QJPA 2DGSA 2K3KA 3MF5A 3TJAA 1N54B 1FVSA 4MKAA 3H0PA 4Q2LA 1UVKA 3M6WA 2QL9B 3R2CJ 5IT9Y 4ZCMA 3I82A 1WSRA 3T6JA 3Q22A 3TA1A 3MCNA 5EN1A 4PCQA 3PXGa 3DLGA 5ETVA 3D6HB 4QYRA 2IOPA 3C6TA 3VTIA 1C1CA 3LP0A 1AYEA 1YH8A 3GFYA 4B3ME 4H4MB 3DXSX 1D6TA 4U7UD 1V6HA 4ELUA 4P2FA 1H73A 2FY8A 3UD5A 2DH9A 1FX2A 3U1MA 5GAEI 4PXBA 1TKZB 3EPGA 3KDNA 1K1QA 2UUBI 4DL7A 1NDKA 2HIQA 5KFFA 3MFHA 3TVZA 4RNNA 4LOMA 3MEEB 1Q81T 2MQOA 1Z0TA 3PTWA 5KFSA 1N48A 1I94E 4QWCA 2HVEA 2ZH8A 4ZVEA 2YNFB 4GKJF 2H48B 2AJ0A 3M32A 3K0JA 4X2BA 3E01A 4N3OA 4QYZK 2AJ1A 4OO1F 1YJUA 1S1XB 1IBME 2OGUA 1J5EE 4RW8A 1HNXE 4ZKAA 3M8PA 1EKSA 1XEZA 4LF7I 1HL6A 4P52A 3N28A 2HZVA 3IM9A 2OELA 2QFIA 3LH2S 1WKLA 1Z0BA 3H4LA 2V94A 4G65A 5KTQA 3OTOJ 4KQZA 2H51B 2WRMA 2D9PA 1TL4A 1RDRA 1SBRA 2MQQA 1S1UA 3U1LA 3NGSA 3OUYB 1KC8T 1RADB 2ADBA 1UWAA 3OL7A 1MMNA 2CKWA 3M7NG 4U3DA 4O0IA 3AT1B 1K0VA 5DNXA 2BJDA 2Q2EB 3LOUA 2R2TA 2QLJB 3WU5A 2B0GA 4LF5F 3CCTA 4HL9A 3CJ3A 4DQRA 3CGIA 2BA1G 1P1LA 2FD2A 2IRUA 5CZVA 4NXNE 3QRQA 3PX0A 3VAKA 4DUTA 2J9EA 2VV5A 3UWTA 4ES3A 2M0GB 4NLXA 3SQOP 1K44A 2V4JB 3S6EA 4NPOA 3JXOA 2AIRB 3CULA 3CCVS 4YHHE 3CIZA 4M5LA 3V81A 2BJ3A 3LAKA 1BWEA 1S16A 1Q79A 2EKNA 2M8HA 2MKCA 5G0RA 1IR2A 3SDEA 3PIOQ 3PJ9A 4ZVIA 3J7AM 4OZ0A 4B08A 3J81Y 2UXBE 4NLTA 5KT6A 4N56A 4WCEQ 3WIVA 4F02A 4FW7A 2HHHF 2RT3A 1FKPB 3A8IA 5IT4A 1RTHB 3NWGA 4X4VA 3PJWA 2W9AA 2YXLA 3GCMA 3CJ8A 3A8EA 3KXDA 3PHEA 1NK7A 3AY0A 5JEAF 1Q53A 1CC8A 4NCGB 3VGTA 3M85G 3PO5A 3CJKB 4IS9A 3MWBA 4TLQA 2D41A 1W25A 2JHEA 1RI7A 2GO8A 1TKTB 2DHHA 2LDIA 4NLRA 2DNMA 4ZLNA 1YDLA 1JLFA 5CQGA 2Q79A 1J5OB 2R2SA 4AIMA 2J8AA 2Q66A 2B9WA 4LF8I 1FDNA 1QLNA 1T11A 5HLFB 2CDRB 3PW5A 3M9OB 1Y0HA 4MT1A 4RR5A 3NGTA 3PRYA 4DR5E 5KFLA 3V6DB 4OX9J 6AT1B 1RT7B 4ZK7M 1YJ9S 2WNRA 4KHPE 1FNMA 2Y3YA 3N01A 1U1OA 3HVTA 4Q7AA 2HKEA 2E5LJ 2R8JA 4M5HA 1RAFB 1CJTA 3V5RA 1XNQJ 3KJQB 2GMHA 3NCQA 4NA3A 4LBIA 2XYPB 4K4WA 4QIWD 1TTHB 3OFFA 5FDLA 2NSBA 2VDHA 5CYJA 4BBYA 2MQMA 1DRZA 4XTTA 4HHHA 2IAJB 4ZCLA 4MK7A 2KT2A 1SPBP 4JI7I 1N34I 2L9WA 3RB6A 2JE6B 3DDIA 3JS9A 3H4DA 2Z5CA 3R9LA 1HMVA 2R7XA 4IRCA 2ASYA 2JEAB 3R6LB 3HO1A 4B9TA 2CZVC 1ZA2B 2DR9A 3S01A 1VQLS 1N5TA 2BOAA 3DOMA 2HHTA 5IQ6A 4JI4J 1AXQA 5GAHU 5JXSA 1RT3B 3LPEA 2XMTA 2HHSA 2M3DA 1NPPA 3W2WA 1T05A 3PYGA 4KGMA 2MLXA 1W2IA 1N32J 3M8YA 3U27A 3DC2A 5JJBA 4ENOA 2HGLA 3UDEA 3T1HE 5HJYA 1N33I 2CJBA 3Q83A 5J2QB 1BC6A 3G6ES 1N34J 4GKKI 3KHLA 4DU8A 4M63A 1Q5YA 4JI6F 2X1FA 3GYNA 3A3NB 1TP7A 5DJBA 3GIRA 4R25A 2FHJD 4A8XA 1OPZA 2VFUA 2R7OA 2MHNA 3NY0A 1D1UA 3G8QA 2VKRA 3LPYA 1KEKA 5E33A 3ZXWA 5LT5A 1UFKA 3TAQA 4OKGA 2HBQB 5DETA 2AEFA 1NU4A 2Q6CA 1NJIT 2C3YA 3HVRA 2B5JA 3IS9B 4WP9A 4DOZA 2I6WA 3B4MA 2CNOB 4USMA 2KZZA 3GONA 3FBEA 4ID8A 2BW2A 2PO1A 2EG2A 4WE1A 3R5JB 3HFVA 2CQ1A 2NUHA 5HROA 1TKDA 1Q0NA 1S1TB 3NNHA 4FW9A 2UUTA 4NYPA 1YIJS 3DRSB 3HKWA 1QJHA 3KK2A 2W2PP 3PDNA 5E3PA 4JV5I 4E0DA 2XO6A 5LMNF 2HQIA 3EUNA 3FDSA 3T41A 2KVIA 2V50A 1MROB 2ZKTA 3X1LB 3I6PA 5C2CA 4NLPA 3I32A 3D67A 3H42A 3OVSA 1DZ5A 3D66A 1RT2B 5C0XB 3TX8A 1VBYA 1SV5A 3QWPA 4G1PA 1FERA 2V8HA 1QAYA 2I9SA 2ZJPQ 1R6LA 1U1RA 2QIFA 3SSRA 1IBLI 4LF9E 4YDXA 1FO1A 4IZJD 5IM0B 3TAMB 3CJTA 4RJVA 2YKOA 3FCHA 4CTAB 2NN6C 1Z2LA 4ZOSA 3PZPA 3K5NA 3OQ2A 3MOJB 2CNNB 2LFVA 1XERA 1TUGB 1M5KC 5B0CA 1S6OA 4FZVA 1R7IA 3MECB 4FF4A 1H0HB 3GP9A 1PYTA 5HK4A 4F3QA 4FPRA 3K8WA 3KG4A 3HSJA 2QX0A 3ZC4A 1WHWA 3QQCD 1R8PA 1XMOF 4NYZA 3M2VB 5DRRA 4BLGA 1U47A 1T8EA 4FXVA 5AT1B 5LL6R 1UA0A 4QWDA 1YVFA 4FF3A 1BWVA 5AXLA 3W2VB 2HWHA 2Y0SD 2HFNA 2ZNYA 1HR0I 1IBLJ 5KFKA 4L74A 5IT0A 4P7VA 3P76A 3LP1A 4ZP9A 4X4PA 1OSDA 3AJ1A 2V8DA 1RAOA 3J7ZT 2WB1D 2XGQA 1S76D 3CDBA 3EX7B 1EB0A 4DV2I 3BEGB 3QLHB 4R1FA 1UDNA 8ATCB 2AKWB 2CG9A 1O6XA 1EIYB 4WUDA 1CULA 2FLLA 3KUGA 1DQAA 1FRHA 2D69A 2FHOB 1VQOS 4V1Ak 5DDRC 4ECYA 2CJAA 2BE9B 4WIQA 3UN3A 4JP8A 3DDKA 2ZM6F 2DO0A 5A8RA 4OZLA 4CNZA 2BX6A 2ACYA 4UUXA 1C0TA 4DV3E 4K4YA 5D8HB 2XNRA 4H4KA 5D78A 2DHSA 2OTJS 4DUYF 1LWCB 1SIZA 4GC7A 2KFZA 3TEGA 2NN6B 2OIHA 1VRTB 2NQPA 2R2RA 2V8PA 4F3MA 1AW0A 1RT4B 3SFGA 4FWDA 5E5NA 4WF9Q 4OQJA 1PVGA 1WHVA 3FKBA 4DV7I 4ZHRA 1U24A 2GGPB 3DLEB 1TMJA 3OLAA 5DGAA 4DDFA 4PQUA 1FEHA 3EXYA 4DR3J 3M6AA 3K58A 4FYYB 2YKNB 2F4VI 4DX5A 4ED2A 2N4CA 4M5IA 1FF2A 1U48A 2A18A 1D8YA 3FC9A 3FGVA 1T0TV 3ZZTA 2E29A 4KFBA 4ZDNA 2W2MP 4RUBA 1KVIA 2XHWA 2ATCB 3OTCA 5G4DA 4DV4I 4USTA 1TR0A 4IRDA 1VQPS 1TQLA 2IERA 4DV1E 1WHYA 2FZCB 3PVXA 1RHRB 4ECZA 2AJQA 3CUNA 3CEDA 1U1PA 3UCZP 4KC5A 3H8YA 3R6GB 1YBAA 2WAQD 4B3TE 2F1DA 4CCHA 2BV3A 5KFUA 2AGOA 4NXMF 1JLEA 1RK8A 4AT1B 1HBMB 5KG5A 3UPFA 2P9EA 4RW9B 3VAGA 3V4MA 3S8SA 4J9SA 3T19A 4KV8B 3CC4S 1LWFA 2O1TA 1S99A 4DG1B 5LMUJ 2VQFE 4URQU 2YWKA 5B08A 2HZCA 4DV4J 4L3KA 4LVOP 5H1SV 2B9EA 2OPQA 2E5HA 3D4JA 2YNGA 3L3CA 3ILLA 2R7SA 3FEYB 3OJSA 4BA2A 2EVZA 3ICLA 3X3UA 1GXTA 1JJHA 1NJWA 3ENAA 4GVLA 4MYTA 3OVBA 3TR5A 5JUMA 4M5DA 2KFNA 3PFEA 4LF4I 3UE2A 5CH7B 2XYHB 2WOMB 4AE5A 1VCTA 3CJRA 4JI5F 4TQRA 3KG1A 2VG7A 2HHVA 2ZZNA 4KTQA 4IFDC 3CNQP 1LOUA 3VQTA 5F3TA 3ZZ0A 4ZPTR 2PNMA 1VYAA 4DUZI 1AROP 4I7FB 2RE1A 3KUEA 3N0VA 1EX8A 3FSYA 1HWUA 2MZRA 4R8UA 2YWWA 1B0VA 2CJ9A 2O1VA 3AQOA 2KHDA 1G6BA 1YGYA 3OXLA 3QFWA 2DR5A 4PUOA 4K8RA 2B7CB 1O51A 3HMJG 5LJ5Y 4OLPA 2GV1A 5HBMB 1R8AA 3KLIB 3B78A 3ZO7A 1S7HA 3FBCA 3BGOP 1O8BA 3CMQA 2EK1A 1N6QA 5K8MA 4GQUA 4OI4A 3B6BA 3KK1A 4IYQA 1ZM3A 1D09B 1WELA 1XR6A 3L95X 4CWBA 3TJ9A 2H65B 5KFCA 3Q86A 1N4LA 2ZOFA 3V6HA 3WC0A 3POTA 2BM0A 4B9VA 2CQHA 1SUQB 4DUZJ 2J9DA 3FBFA 3FCWA 2IRYA 4QPTA 4UZBA 1IBKJ 3NBPA 4GRSA 1SIWB 4LBHA 2X51A 2QRRA 5IS2A 4OO1A 3TZWA 2J65A 3U1KA 2EFVA 4P73A 5KT2A 2UXCF 1B7FA 4ETZA 4PZVA 3FEXB 3M4XA 4C6AA 4WUCA 2OSQA 2EFNA 4H54A 3N4WA 5KT5A 1PYSB 3B54A 4DCPB 5C0XF 5B7WA 3K89A 2UZAA 2B4VA 2ZH5A 2RKIB 1FRJA 3RG6A 3RAXA 1VQKS 3EE3A 4U3BA 2LEBA 1C1BA 1EQ0A 2ZBIA 2VUGA 3BN7A 1TKXA 3KLHA 4X62I 4AD6A 5B0FA 1KLMB 2CQCA 4NOHA 2VH7A 2Q43A 2O66A 5RUBA 3G9CA 1KWMA 4X66E 1HW8A 4UOCA 4B9UA 3G82B 1F5BA 1TL1A 4UQGA 3EMTA 2ZE2B 2G2YA 4Y3CA 4TY8A 4WXWA 4KHMA 3T1YI 1VQMS 3P3GA 1FTRA 3OFEA 2FTRA 2ERRA 4WFYA 4RW4B 1PJ7A 1CJUB 3OR1B 2VOPA 3C19A 4ELTA 5ETMA 2M52A 3R5CA 2IPOB 2CPEA 1S4FA 1UFWA 3AD9C 3KHHA 1IBMI 4B3MJ 3EVMA 1RTDA 4F25A 1J5EI 4I2PA 3VVUA 2RAQA 2V2ZA 3OL9A 5D0RA 2C2EA 4WYWA 1U2RA 1FK9B 4GC6A 3LWLA 2V8GA 5DQHA 3TANA 1SJRA 2I2YA 4F0HA 5I4MA 3H98A 5JEAA 1DLOB 3I0SB 4N8NA 3ET6B 5C24A 1YK9A 3HVAA 2QLXA 1I94J 4MJKA 3QIPB 4CLUA 5IWAE 3MMBB 3JTNA 1RT1A 1V5IB 1KRPA 3TUZC 2DNQA 3CCUS 2X7IA 3BO4A 2VASA 5I3QA 4ALZA 4I56A 4DV6J 2NN6F 4CLYA 5ETLA 1IBMJ 4A8FA 1XBWA 1J5EJ 1Z5AA 2DCLA 3GPAA 2BJ9A 1HNXJ 1FDBA 1RB0A 4ZVFA 2WW8A 3IBWA 5H9FJ 3ELHA 3IR5B 5DQIA 4A48A 1B63A 3QO9B 7FD1A 5K20B 1U1MA 3EGWB 4DR2E 1YSJA 1WF0A 2E5IA 3I5BA 2YWEA 4PPZA 4X64F 2HNYA 3KRNA 4JYAI 5EX3A 5KFXA 1WC0A 1UDQA 2BACA 2KHCA 1RWXB 4F2SA 4DR7F 1GTHA 3K1JA 2N4DA 1VBZA 3CD0A 1RTJA 1KP6A 5HP1A 1XHKA 5A0YB 4NXNJ 3QSIA 1OY9A 1ZAWA 3TUPA 2J0WA 2XSJA 2VA3A 2W8KA 2BJ1A 4K4SA 4NLVA 4C8YA 3UDVA 5F8JA 4YHHJ 3C6UB 4F4WA 3UO0A 2JNJA 5EX0A 2UU9I 2HNDB 4TKTA 4DSKA 1S72S 3PX6A 5HMZA 1W2BR 1I3OB 3HM9A 2HURA 2ZD1A 4AQYE 1J2VA 4H4OB 2G9OA 3MTKA 2UXBJ 1QSSA 4WP3A 2LVWA 4J91A 5KG7A 2RS8A 2A6MA 1FJGE 3BYPA 4LF6F 4C8LA 2Z4PA 3IM8A 1S97A 2BABA 2HRYA 4WKYA 4QIEA 3V4IB 3P06A 3GU0A 4TU9A 4MU4A 1R0AA 1UVJA 3T5JA 4GMKA 4KH1B 4C48A 2FJBB 3NG8A 2C2KB 1RWPB 4R5PB 1Q95G 1LW2A 1K0TA 1VC5A 4B3SF 4AL5A 2LQJA 2LYVA 4MKVA 3TUIC 1DQ9A 1Z59A 5HN0A 2Q6BA 2KB2A 1NSAA 4IKAA 4KJIA 2HFOA 5EHHA 2O01C 3ISND 2CPXA 4ZVOB 4DR5J 3EVWA 1OQ3A 2ZHOA 3GMGA 4DL3A 1Y3JA 3GG1A 3SEOA 4KHPJ 5EGYA 1UTAA 1R6VA 4OZJA 4FKXA 5FLXY 4P74A 3BDEA 2FQQB 5FD1A 1KNZA 1YRTA 1NCLA 3ILOA 3WIUA 4HLBA 4IFVA 1R0CB 1T3OA 5F8MA 2XYGB 2DBBA 1TU0B 4X4SA 1FFSB 2GO9A 3DLGB 4RUHA 2ZWPA 2B56A 3QRRA 1Q5VA 3C6TB 3DCAA 4IRKA 1C1CB 3Q8RB 1SQFA 3LP0B 2RMLA 5L1JA 4NRUA 3N79A 3W61A 2V0NA 1HQUB 2FHKA 1KOHA 4ICLA 2XO7A 4LR9A 4XIUA 2FGCA 4IFDF 3IXQA 2M5YA 1CBKA 3SXLA 1TL3A 3DYAA 2J0QD 2NXNA 5CXTA 2RJZA 5IT9Q 2UXDE 1AFIA 3M8SA 4IG0A 3T1HJ 4OZ1A 4U8VA 2E1MC 1FESA 3QGPA 1CLFA 2OD6A 2EC0A 1Z0WA 2DH8A 3M32B 3MD1A 2CNLB 5E3CA 5HATA 4K7QA 3QT6A 3KHGA 2Z58B 4WBFA 5K36C 5KT7A 1RLCL 3DGPA 2BE7D 2WHOA 2RDDA 1QAIA 4RW8B 5B0EA 2FHMA 4C0HA 3TJ8A 3M8PB 4NLSA 4IDKA 4ZP8A 4CO5A 4OJGA 2CWXA 5D15A 4NEYA 3KHRA 3MAQA 3VGUA 4X4OA 1DAXA 2ZHBA 1G7CB 4B17A 2BA0D 4OV6A 5ETQA 4CO1A 1J27A 3ZTPA 3OTOF 1S1UB 2MLZA 1PYOB 4ECXA 2IESA 5A6PA 2BRLA 1NNDA 4B3RE 1VHIA 4EBCA 4FS2A 1PC4A 1S0NA 3BSCA 4YB7A 2LJPA 3HFZB 4RNFA 4HKQA 2ZBKB 5ADZA 1SKSA 2CVIA 2XCAA 2B4OA 1S7IA 5CYQA 5KFIA 2DHGA 4QJVA 3HT0A 3FJ2A 5IT9U 4EFAC 2IVYA 2HBRB 3AXKA 4HEA9 1OY8A 5BJRA 3HZGA 1WSVA 2A0FB 3GFHA 2A2CA 5DM7Q 2JRSA 4OJ3A 1RKJA 3V81B 4DR6E 3OHBA 1RISA 1P27B 3PY8A 1HFEL 2G13A 5G0RB 2AEMA 3P49B 3SDEB 4LF9J 2HKJA 4MTPA 3EYZA 2DEIA 3CD5A 3PR4A 1HNVA 3QATA 2AW0A 2OH2A 5HLFA 2RU3A 4YOEA 1MSWD 3KOAA 3ETOA 1LEOA 4EK2A 1ZYQA 4LCHA 4WK3A 2B6AA 1KQFB 3GMEA 1TUWA 1KD1T 5CABA 3DU6A 5KFOA 1Y60A 3QZ8A 2UUCI 3FSIA 1RT6A 3M2UA 4DR1E 1FEEA 2IC3A 1XWLA 4UZCA 1HIYA 5B0DA 4KR0B 2OI2A 4JI1E 1XMQI 2LA6A 2CWKA 4FYVB 2BZ2A 4X65E 4DV0E 1JLBA 3J81Q 1LFPA 2COLA 3DNCA 1JLFB 5BR8I 2WP8A 2VQEE 4KGZB 1K73T 3KLEA 1S1WA 4XPCA 2W7AA 3N6MA 1U7LA 4P75A 4Y65A 3I55S 1U1QA 4NLUA 1U1LA 1MU2A 5KFQA 2EEYA 3MCOA 2WNRB 1CQMA 3PW7A 4OX9F 4QIVA 4FW5A 3UVJA 3HVTB 2EFOA 2CPZA 2E5LF 4LFCI 1IBCB 1XNQF 4RNOA 3IWNC 1HBOA 3RZAA 1SJ4P 4F3OA 4DV3J 5FDLB 1XJWB 5KFEA 4DV1I 2MKHA 4QYZJ 1XNRJ 4KGVB 3GV5B 3D6FB 3CCQS 2Z5CB 2FVCA 1HMVB 1IKYB 5HQLA 4OI1A 3BSNA 4FN5A 4MK8A 3W60A 4F8RA 4I0WA 4O3PA 3DOMB 1ZPWX 1OSCA 3BF4A 4U6PA 2KL8A 2LXFA 2OSRA 1V3RA 3HHLD 4C8MA 4JI4F 1Q1KA 1FJEB 4WFXA 3W2WB 1T05B 2UUBE 5BXIA 2C38A 2YH0A 2VHGA 2MZTA 3VCDA 3NKYA 4DQPA 4IFYA 3HZEA 3PYEA 2BOPA 1TFYA 4MAKA 1N32F 3GIJA 4KE5A 5ETOA 3FMBA 2GQQA 1FXRA 4ZVGA 3I5AA 1HYSA 4ANEA 3NGDA 2EFPA 5GADU 3H5SA 3R5DA 5A2QY 3P45B 2HAFA 1KVJA 1N34F 2OD4A 2Y0BB 4B3TJ 4KQVA 4X4QA 1GQEA 1X4BA 2EWHA 3SFUA 4RO0A 1IJFB 4U95A 5HMWA 1S0MA 1XC9A 4LF7E 2LQ9A 2O3ZA 4GO5X 5JVGQ 5LSRA 4MIAA 2MSTA 2VPYB 3C14A 2VQFJ 2B5JB 1KOOA 5C25B 3M8WA 3NAIA 2OTLS 2WONA 1Y4SA 2JZ5A 1URNA 4EYHB 2PO1B 4WE1B 2XWXA 2EBEA 1PC5A 2N3LA 5HROB 1UEVA 3MM8B 1SL1A 3CDIA 2N7YA 1S6UA 3OSPA 2R7QA 3CW2C 1NHHA 4GVBA 3RB0A 1T9WA 2MB0B 2IYGA 1MWZA 1Y5NB 4QW9A 2W8LA 3KK2B 5LXYA 2V68A 5LM7E 2RRNA 1B0PA 4JI3I 2QL5B 3G96A 1SVDA 2F8EX 2MZJA 2Y1LB 5I3UA 4CP5A 1QY7A 4PYAA 2HFSA 4J5OA 5EL9A 2C2DA 1XMOE 4WFNQ 4ZA1A 3GFXA 1YTYA 3VZHA 2J8SA 1AT1B 1SV5B 1S6QA 2NSCA 1C2PA 2VJUA 4P6QA 1QDUB 3P3EA 3ILIA 2A3JA 3LP2B 4USVA 4CLWA 1FXDA 4H4KC 2V69A 1R0BG 3RBXA 2KT5A 4PXCA 2DITA 4LFBI 4KGXB 5GAGU 4USIA 2FPHX 4MH8A 1YJ7A 1JJ4A 1T7PA 1JMTA 4RBVA 1FE0A 2H5IB 3QLHA 3UN2A 4OZEA 1RA7A 3TWZA 4A8MP 4K2JA 1C4CA 4LSNA 1KTQA 5E3AA 4JI0I 3MM7A 4AL7A 1RU2A 1CJKA 3IC1A 3Q8VA 1GX6A 3TP2A 2DGOA 2C3UA 2V2QA 3EM1A 5DZ7A 4A47A 4CO3A 4FWHA 1U6ZA 2FYXA 2VC1A 1F5AA 4ED4A 1URRA 2NR0A 2AWZA 2NN6A 4LF8E 5CD4H 2DH7A 3RAMA 3TVYA 1IBLF 2UP1A 3BV8A 3LP1B 1VS3A 1EP4A 4DN9A 4YY3I 4O44A 1Y7PA 4DQIA 4JI2I 2XI2A 1S1VA 4DWIA 1Z5BA 3MAHA 1T95A 4WWSA 5IV4A 1VHFA 3IGNA 1HA1A 2PN6A 1AUSL 1CULB 1YHQS 2I0XA 4LCGA 2BJEA 1U4BA 1NDCA 5K36F 1IWGA 3JAMY 1N5SA 1HQEA 3KLGA 1TK0A 5A8RB 4JI7E 5J1NA 4X66J 1C0TB 5AXKA 2JH3A 5L9NA 4XDCA 3O1LA 1RZMA 3MR2A 1RHQB 5SUHA 4RUAA 1Q4RA 1FNXH 1E6VA 3Q1QA 1S48A 2W9BA 3FCVA 2HMIA 3UI3A 3A12A 2XZTB 4NCBA 1KTVA 5KG1A 4ZHRB 3PS3A 1T02A 2XCPA 3M7VA 3EVOA 1HNWI 4PQUB 2VG6A 4MDTA 3Q8UA 4IUFA 2DXEA 4DR3F 3Q8QB 3IRWP 1Z1ZA 4J9VA 2AHOB 5ELWA 4DR4I 4KFBB 1KHWA 1WC3A 1N33E 3BQ2A 1WWHA 4DPXA 4GKKE 2GJ2A 1RWVB 2VZ9A 1MWYA 2L41A 2K7JA 2W4CA 1IJEB 1NB2A 3TARA 2JLEA 2QFJA 1RXOB 2K8GA 4RX6A 1UVNA 5L39A 5CCMA 4DSIA 1JLEB 3J7Z5 4BC7A 1ZH5A 5IWAJ 2DNZA 6FD1A 5FWKA 2E5JA 2VG5A 3BB5A 2BR2A 4NZ6A 5IFMA 4DV5I 4NYOA 2AYBA 1WOOA 1D0EA 3BH6B 2MKIA 5L8RC 1M5HA 2H5JB 2W25A 3M1VA 5LMUF 4OMFG 2RDIA 3WU6A 2X1GA 5K14B 1XIQA 1HK7A 4O3OA 2BXJA 2VODA 1T9YA 2OPQB 4M8LA 4DV4F 2YNGB 4LQ9A 2YWGA 3C66A 3BGRA 3BSOA 5IT9C 2QO3A 4BA2B 2V6AA 2PMZD 2CGEA 4K4UA 4DR2J 4JV5E 1JB0C 4M5DB 3L09A 5ETPA 4ZPAA 2R7WA 3JQKA 3DI6B 2UV8A 1UVLA 4TYBA 5D6GA 1OWXA 1SB6A 1FDAA 2OKQA 2H5EA 1R8HA 1VOMA 4ED7A 3QMQA 2UUAI 2ZC4A 2VG7B 3G8TA 3IP0A 3MEDA 2J6TA 3CCSS 1VBXA 2V5HG 3P3CA 2NZCA 1U1KA 1HWJA 5FJ4A 2DNKA 3DHWC 4R8UB 1ZAVA 3SCKE 3DRPA 2V8VA 2HFVA 2R7UA 3CTRA 4PUOB 1VIXA 1LW0A 1A6LA 4JI8J 2KU7A 2XS2A 1RACB 3M8ZA 3KJVA 5ETSA 1S9GA 2UV8G 1XN9A 5C0XE 1LWXA 3RAQA 1N6QB 4RU9A 1F2HA 2BQUA 2RILA 3KK1B 3MUMP 4IFDA 4AQYJ 1RAJA 3G6VA 2Y9HA 4MU1A 2ASDA 1Z0EA 3D54A 3CCRS 4W90B 1JXVA 1FJGJ 1XR7A 2RHQB 3POTB 1U49A 4X4RA 1GX5A 4D3GA 1HR0E 2NCKL 4DUZF 4PWDA 4WUBA 3NBPB 3MCSA 3BQ0A 3RYLA 2QG9B 1IBKF 3HHNB 4OO1B 1GFWB 2CJQA 2NZ4A 5D4LA 2F3JA 2GNKA 1NO8A 2ABYA 3UW1A 2VBWA 1RYSA 3H2VE 4DZ6A 4C8KA 1QTNB 4YFUA 1C1BB 4GKJI 4YS2A 4OIXA 1HARA 4ZPBA 1TKXB 3KLHB 3D1QA 4CH1A 2J9CA 2VOOA 4MKYA 3PFOA 4ILLA 1NLKL 2NPIA 3LGNA 4M5MA 3J80Y 1WTFA 2RQ4A 4DFMA 1U0HA 3K59A 4PWWA 2QL7B 3J7YU 4WFBQ 4PQAA 2YX4A 2E7WA 1TL1B 4FS1A 1UW9A 3FBBA 2BQ3A 4TY8B 3ISZA 4OYPA 4O4RA 2KYZA 3J81C 4DV7E 1RWWB 3SV4A 3HVWA 1SH0A 3EXCX 2UXDI 1Y4UA 2QV6A 1SH2A 3I87A 3CCMS 2XS7A 3OD2A 4U7CA 2F4VE 3RBZA 4N76A 3G2XA 2BBEA 4MU3A 1RGVA 2E1PA 3BPDA 3SCIE 1F0XA 2EPIA 5DO2A 1UEUA 2NREA 2O1WA 3PHTA 4MK9A 4LF5I 3MFIA 1USVA 9RUBA 2FJXA 3EWGA 3BQ1A 2GFFA 1WHXA 3AH6A 4M5JA 1U6BA 4USJC 9ATCB 4K59A 2HK3A 4B3MF 1GMUA 3UN5A 4I2PB 3CD6S 3WU3A 2ASLA 4O3RA 3I9ZA 5F8HA 2E5GA 1WEZA 3DLJA 1C0UA 3UDLA 4OZ3A 4RZRA 2R3VA 1F3FA 5JEAB 2UXDJ 3W9HA 3OLBA 1FTCA 1NHKL 1SL2A 5C24B 3HJFA 2V9KA 3W9IA 2HHPA 4FKYA 4B3RI 1WF2A 3G4SS 1I94F 1RT1B 4HTIA 3LQVA 2OPSA 4PG6A 1KVKA 1FDDA 2HRTA 1NSPA 4F0KA 3FZBA 1NSKL 1WC6A 2HHHI 2L3MA 4RLEA 3MPYA 4QOTA 1M5PC 3CVKA 2KRBA 2Z5BA 2F9JA 5E7OB 2FZGB 4PAAA 4DV6F 1IBMF 3CCJS 1J5EF 3BGUA 3FFIA 4FVMA 1HNXF 1KBRA 3VAHA 4QWBA 4AYBD 2CFXA 1FRLA 4DL6A 2P5VA 4UTGA 3K17A 1SKRA 4RKUC 1NB7A 2HNDA 5EWEA 2P2CB 3MPVA 3IBFB 1NDLA 4HT5A 3QZ7A 1RE1B 3O3LA 4LF4E 4Q8EA 4CLPA 2R8KA 3DLHA 1PO6A 1T9VA 4B3RJ 5C0XD 2FC8A 3AAWB 3CPWR 4KHRA 1WC4A 4WJBA 2ZBCA 4WZMA 1W26A 2EFQA 1RTJB 5HP1B 4MKBA 4O3QA 2PGCA 3M2RA 4LVNP 2IFXA 3EJMA 4AXJA 2E9RX 1SXLA 3DFEA 4CYUA 3KJFB 2LXUA 4AL6A 4NXNF 3QT8A 2XSJB 5IOLA 1N5VA 2IY5B 2PEBA 2AD9A 2AU0A 2ZH9A 2U2FA 3AJ2A 5GADI 1XK8A 1TUVA 4XO0A 4YHHF 4Y34A 1HW9A 2HWTA 2WCXA 1N36J 4DR6J 2HVDA 4R0JA 3KDOA 1N8RT 2F9DA 2R9LA 1K8AT 3DDNA 2ZD1B 3Q8YA 4FW6A 1YBTA 3PRVA 1UKUA 3RR8A 1X60A 2ZNZA 2UXBF 4DN0A 4EBEA 2KH9A 1NH8A 3M6UA 2E9TA 3PCOB 2ZVIA 1KFDA 1EJ7L 4Y2IA 5EUHA 1XR5A 1OMSA 3H59A 2ZH7A 5HQ8A 2F8MA 2XMKA 5KAKA 1VQNS 1HNIA 4DR1J 1R0AB 2HQFA 1SH3A 3B4TA 4ZJOA 2MSSA 3BGLA 3SI8A 2PO2A 4JI1J 1KS2A 2OMOA 3BH7B 3SBMA 4OHXA 1ULRA 2LEPA 1LW2B 4X65J 4DV0J 3OXFA 1UL3A 3TO8A 4DS5A 2DGXA 4V19J 4WK1A 2W9CA 4JI6I 4X62E 1IR1A 4PKDB 4YB5A 3CDUA 2O3DA 1ZM9A 2VQEJ 1VQSA 3KFWX 3E51A 3L7PA 3OPKA 2PA3A 3PJXA 1NK4A 1SKWA 1ZZNA 1YJVA 4DR5F 4RNHA 1HQUA 2BVZA 1UJ4A 4KHPF 3T1YE 5HSPA 1KHVA 3F56A 3I5CA 5DLFA 1GXUA 2HYIB 2ZC3A 3HX9A 5D0EA 5T7LA 3RRKA 4RBTA 2Z8QA 2FLNA 3J7AG 4LT6A 4NLWA 2LU2A 3MCMA 5GMDA 1S9EA 3M30A 2OEJA 1WG1A 1JLQA 5GAGI 4IFVB 3TW0A 3HD2A 3JSYA 4XPEA 1X5PA 1WI8A 1FCAA 1V3ZA 4WFZA 4YUDA 2UUWA 3UDCA 3TYTA 1Z0GA 1PKUA 4CLZA 2ADCA 1NZAA 3NS6A 4O4GA 1XXEA 4J9QA 1RHUB 5LMNI 3ITHA 5J1PA 1Q7YT 2QA1A 2SXLA 2C2NA 1GH8A 3OBIA 4QQBA 3TA2A 1VC6A 5FLXQ 1VQ4S 2DT9A 1B4SA 3H40A 2MGZA 3HLUA 2PIIA 2UUBJ 3EDQB 1SC1B 3GTYX 2NXUA 1YG0A 3RR7A 4ICLB 3S1TA 1HI0P 2LKZA 1P42A 1YHCA 4TYAA 1SC3B 1TL3B 3DYAB 2WVBA 5L1LA 1VK3A 4B9MA 2YH1A 3VR1A 1RREA 4IG0B 5E3QA 2XY5A 2FZKB 1VIOA 5D4OA 3T1HF 1FWLA 3HFKA 2BW7A 2IBOA 2DY1A 3TEHB 1H7WA 1Q16B 4IO9Q 1GT8A 3PR5B 3T5LA 4TNOA 4C3LA 3DGPB 3AOCA 4LF7J 1YRXA 5GMEA 4ZLPA 2MZQA 4J9OA 4ILRA 2XZDB 1YWXA 4KYZA 4I64A 4IDKB 1E6YA 4CT8A 1IXKA 1FKOA 1XMOI 2XHCA 2W7PA 1HBUA 4FNHA 4JYAE 1S6PA 2V2KA 2GMJA 4BDPA 5C42A 3MR5A 4ZPCA 4K0KE 3FK4A 1RBAA 3DD6A 2JLFA 4PR6A 1ZS6A 5K36A 2A2DA 3KTQA 3L7ZA 2D3O1 5CYMA 2J6SA 2WVDA 4CNYA 3ISNC 3LGHA 1GMWD 3T9NA 5DDOC 5IQQA 4JOUA 2ZOGA 3MR6A 4QR2A 1TFWA 3UCGA 2CJXB 3QNWB 2DNGA 4PU9A 4P7TA 5CYQB 1BQMA 4OYWA 1MNEA 2UU9E 3MZIA 3SCJE 4JV1A 3C15A 5J1EA 3U1NA 2ZM6I 4DQSA 3J7AN 2AX1A 3PYDA 2KM8C 1DFDA 4FW3A 3CMAS 1F2GA 3AD7C 3V6JA 4LF9F 1HNVB 4DUYI 2YNHA 3ONQA 4X4NA 1HNZE 2MQPA 5KFNA 3CDWA 4OHZA 4DLEA 2DRDA 2W24A 3GCXP 1T3NA 2B6AB 4OZ5A 2C39A 1B62A 3RW7A 3WU4A 4IO1A 5HVHA 5AE2A 2CPYA 2YKPA 1RT6B 3M2UB 2IC3B 3BO2A 4DCJB 3NLCA 2GHPA 1WKKA 3MM9A 4E2FB 4ECWA 3UCUP 2AZ1A 4ZIVA 1WOPA 1JLBB 1IM4A 1EETA 1SI9A 2MMYA 4ZN1A 1IKYA 2RHSB 4LF8J 1S59A 5J2MA 1LWEA 1PG5B 4PWUA 1TV6A 2AJFE 4ITSA 2WP8B 2HAIA 3KLEB 1S1WB 4NXMI 1PBUA 3F0NA 5B09A 5DDPC 1MU2B 4TQSA 3HD1A 2RF2A 4K50A 2B4PA 2N7CA 1OQ6A 2FVPA 3UVJB 4ECVA 1VISA 1NZ0A 1HBNA 2PMHA 1Y11A 3RRHA 2QA4G 4IQXA 4PXDA 5DROA 4QW8A 3M8QA 4PRVA 4F36A 2LP4A 3MGJA 2PNZA 3MD3A 4JI7J 1HBOB 2ZH1A 1WDDA 3R5GA 2DJWA 3IBCB 4DV3F 2RS2A 1HHSA 4YMEA 1Z2ZA 1ZXMA 1XNRF 2HVHA 3B4DA 2ZKUA 1EA6A 3PO4A 3PS1A 2AT1B 3FUYA 4I1TA 2F63A 2M9KA 2ZH3A 5CAAA 1ICEB 2D1CA 2MY7A 3OT9A 1XQIA 4IQMA 4DX6A 3ADAC 4JI5I 1WEYA 4OYZA 5C25A 2NYIA 2OHDA 2VBZA 3D6MB 2C38B 4URGA 3P4UB 2DHAA 4IFYB 1N33J 3IN5A 2HQDA 4GKKJ 3MM8A 1X4HA 1RQ0A 2X1BA 3JQJA 3THVA 1HYSB 1FRIA 5F0UA 1NSQA 4HACA 4LF1A 3ZZRA 3MR7A 1S57A 1Y00A 3HKMA 3K57A 1Z5CA 2IM0A 4L6V3 1NXIA 4LBPA 5D0HA 2RVJA 3T1AA 1KSPA 4B3TF 2HBYB 4ER8A 2XSFA 3GJRB 2DNNA 3QFHA 2PE8A 3RW6A 3T9ZA 1RKIA 3L4BC 2G1DA 3OTBA 1RP5A 1FX4A 2VC0A 1RBOB 4NZ7A 1S0VA 4QWAA 3EZUA 2EI5A 5BYRA 5DS7A 3ZZOA 5LSOA 2Y8WA 4I6YA 3C14B 2K1RB 4PRFA 1AB8A 4J37A 4PPDA 5C2GA 2VQFF 2PI5A 5DG9A 4LR8A 1M1HA 3LP2A 2WONB 4Y00A 1SJ3P 1X4FA 1NHVA 1UWBA 2E9ZA 4HHJA 3N5FA 1RJJA 5A2QQ 2JSXA 2Z2ZA 3DN9A 1M0SA 1PCAA 4IH6A 1WTBA 1X4EA 5DM6Q 2UXCI 3MMAA 1R6YA 4GVBB 1FRKA 4JV5J 2JEBA 3CMES 1ELOA 4YR2A 2C22A 1ZOTA 1QE1B 3GR1A 2YX1A 3KNAA 1ZETA 3GIKA 1MG7A 5I3UB 5K5MA 2F40A 2ZH4A 3GR0A 4IOBA 1S0OA 2EK6A 1UEKA 4ED5A 3RRGA 3O6QA 4I4BA 4I2QA 3QGIA 4QR0A 1HPZA 1S6QB 4ED3A 5J2NA 1LXNA 4DF8A 3K85A 4ECSA 3PEHA 5H9EK 2J6UA 2IMOA 1DTTA 1H2VZ 4K5RA 3NOCA 3D6TB 1GXLA 4B02A 3QJJA 1X0PA 2QYGA 1DHMA 3WX8A 4OX7A 1Q8BA 1RWKB 3HHLC 1UCNA 3CD7A 4LSNB 4K4XA 2UUCE 3MM7B 2HHUA 1CJKB 4LQ3A 3RB4A 1XMQE 4HH1A 1IN0A 4ECUA 3WQPA 1T94A 2MQNA 1HR0J 5A8WB 2GS8A 1U09A 1Y5LB 1X0FA 1H6KX 5DNLA 1PJ6A 4QR1A 4N47A 2VICA 5BR8E 3FEZA 2DHXA 1WORA 3KNGA 4OLOA 3A8KA 1H38A 2H54B 1EP4B 2P9CA 4O44B 4WXOA 2PO0A 4OZNA 1S1VB 4LJMA 3IGVA 4DV2J 2OPRA 3K5MA 1NHUA 2N82B 1CVJA 3FQKA 3IRXA 2ROPA 2ACMA 3OHAA 4LFCE 2YBVA 2B3TB 1UVMA 1UDSA 4EI2A 5HJXA 5EWFA 4LRCA 1FFGB 4B9LA 4C3KA 2CQDA 2W4PA 1X9MA 2FHJA 1HQEB 4FXDA 1B0TA 5DRKA 3KLGB 4O0NA 4Q0BA 1RT5A 3QAEA 4RPFA 2H1YA 2W7OA 4PYDA 5KG4A 4X66F 1UETA
chains in the Genus database with same CATH topology
4LFAE 3JAMC 5IT9Q 2UXDE 1Y4SA 4DV2I 2PNLA 1H72C 5L3JA 1FKAE 4NXMI 4R1FA 2CG9A 3LTOA 2ZM6E 3F0NA 4X64I 4WUDA 1Z0WA 4K0KI 4B3TI 1NHHA 4DR2I 2HK2A 4DV5E 1VISA 3QT6A 1N0UA 1NZ0A 4DR7I 4DUYE 1IBMI 1N36I 4DR6I 1J5EI 4P7AA 4DV3E 3JAMQ 4PRVA 4JI3I 1A6FA 1NHJA 2Z5BB 4I3HA 2O1UA 4LF8I 3OTOE 2V2ZA 1U2RA 2VQFI 2HFSA 4DUZE 4JI6I 2V8PA 4X62E 1Z0EA 4FWDA 4IZKB 1XMOE 3PRYA 2E1RA 4DR5E 1ZM9A 3ZKDA 1ZXMA 1PVGA 1IBKE 1EA6A 3T1HI 3ZKBA 4DV7I 2BM1A 4JG4A 4KHPE 1FNMA 1HR0E 2DEJA 2HKEA 4WUBA 5IWAE 3M6AA 3LPSA 1H7UA 3V5RA 4B3RE 4Z7CA 2F4VI 2X7IA 3ZZUA 2HFUA 4DR1I 3T1YE 4JI8I 1N0VC 3ZZTA 2UUAE 4JI5I 1PIEA 4LFBI 4B3MI 4M1KA 4JI1I 2LJPA 4EMDA 2ZBKB 1FWKA 4DV4I 1Z5AA 2R42A 4IZJA 4X65I 3J7AG 4DV1E 4DV0I 1HNZI 4JI7I 5FLXC 1N34I 4NXME 4AQYI 5GMDA 2WW4A 2Z5CA 4LF6I 1OJ4A 4X64E 4JI0I 1B63A 1ZXNA 4FWGA 2NPFA 4HY1A 2GQ0A 4GKJI 2VQEI 4B3TE 4HACA 1FJGI 4OX9I 4DR2E 1DARA 2BV3A 2V2QA 4DR7E 1Z0GA 1Z5CA 2A2CA 1H7SA 4JYAI 1IBLE 1I94I 4DR6E 4DR3I 2E5LI 4Z7YA 4FWHA 3HJCA 5A2QC 5LMNI 4JI3E 4DPTA 1XNQI 2HKJA 4B3SI 4ED4A 3PYGA 2DEIA 4LF8E 4PRXA 5FLXQ 2O1TA 1Y6ZA 2VQFE 1K47A 4IZKA 3K1JA 4DV6I 4JI6E 4URLA 4YY3I 4JI2I 1XHKA 1HNXI 3T1HE 3J81C 4DV7E 4LFAI 1Z5BA 1XNRE 1N33I 3D4JA 2UXDI 1Y4UA 2V2VA 3QT5A 4USKA 4GKKI 1RREA 4DU8A 2F4VE 3QT7A 2IOPA 5A2QQ 1FWLA 2UUCI 4DPYA 4DR1E 4MYTA 1WUUA 4DPWA 2UXCI 4JI5E 2UU9I 4LFBE 4B3ME 2O1WA 4JI4I 2OI2A 4JI1E 4LF5I 4LF4I 1XMQI 1D6TA 3B82A 1USVA 1ELOA 1FI4A 4LF9I 1H73A 4X65E 3HULA 4DV0E 4JI7E 4AQYE 4DU7A 3J81Q 4HXZA 3ZM7A 4LF6E 2HK3A 5GMEA 1N32I 5LMUI 4JI0E 2IOQA 2UUBI 2VF3A 5BR8I 4GKJE 3WU3A 1MG7A 2EFGA 2VQEE 3ZZ0A 4USMA 1FJGE 4OX9E 2CZ9A 2PNMA 4DUZI 4NXNI 3GONA 4HYMA 3V2UC 3Q1QA 4DV2E 1Z0TA 1XMOI 1UEKA 4JYAE 1I94E 1KKHA 2R3VA 1KTVA 4DR3E 2E5LE 2O1VA 4FW9A 5LMNE 1XNQE 1ZM2A 3K85A 4YHHI 1MU5A 4B3SE 4K0KE 1HNWI 3P06A 4N3OA 4B3RI 4XTJA 2A2DA 1KVKA 3B78A 4LFCI 1IBME 1N36E 4JV5I 1H74A 4YY3E 1J5EE 2HHHI 4JI2E 1QZRA 4DR4I 1HNXE 4X66I 1S4EA 2Z5BA 1N33E 1ZM3A 3Q6NA 4DPXA 4LF7I 2UXBI 4P52A 4GKKE 1Z59A 2J7KA 4DV1I 2V34A 4IZJB 1RR9A 1Z0BA 4PU9A 3H4LA 3LNUA 2BM0A 2Z5CB 2UUCE 4UTGA 4MYUA 3K17A 2UXCE 2UU9E 1BKNA 4JI4E 4HACB 4FN5A 4LF5E 4LF4E 1XMQE 4UT4A 1IBLI 4LF9E 2XEXA 1NHIA 4IZJD 2Q2EB 2ZM6I 2ZITA 2GS8A 3PYDA 3WU5A 1Z0VA 5FWKA 4JI8E 1N32E 5LMUE 4WUCA 2UUBE 4DV5I 5BR8E 1PKPA 4DUYI 4DV4E 1KIJA 2AJ4A 4NXNE 3J80C 1EI1A 2X36A 3PYFA 3PYEA 4DV3I 1HNZE 1N34E 3WU6A 1MX0A 1XNRI 1HK7A 4DPUA 4YHHE 3OTOI 1HNWE 3QT8A 1B62A 4X62I 3WU4A 5IT9C 5LL6R 2Z5EA 1USUA 4DR5I 2CGEA 4KQVA 4LFCE 1IBKI 1S16A 4JV5E 1Z0CA 2HHHE 4KHPI 4DR4E 1HR0I 4ZVIA 3J7AM 4X66E 5IWAI 3J80Q 3B8HA 4LF7E 1ZM4A 2UXBE 3CWVA 3Q6MA 4DV6E 3T1YI 4RPFA 4DXLA 2UUAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA E;  3JAM C;  5IT9 Q;  2UXD E;  4DV2 I;  1H72 C;  5L3J A;  1FKA E;  4NXM I;  4R1F A;  3LTO A;  2ZM6 E;  3F0N A;  4X64 I;  4WUD A;  1Z0W A;  4K0K I;  4B3T I;  1NHH A;  4DR2 I;  2HK2 A;  4DV5 E;  1VIS A;  3QT6 A;  1N0U A;  1NZ0 A;  4DR7 I;  4DUY E;  1IBM I;  1N36 I;  4DR6 I;  1J5E I;  4P7A A;  4DV3 E;  3JAM Q;  4PRV A;  4JI3 I;  1A6F A;  1NHJ A;  4I3H A;  4LF8 I;  3OTO E;  2V2Z A;  1U2R A;  2VQF I;  2HFS A;  4DUZ E;  4JI6 I;  2V8P A;  4X62 E;  1Z0E A;  4FWD A;  1XMO E;  2E1R A;  4DR5 E;  1ZM9 A;  3ZKD A;  1ZXM A;  1PVG A;  1IBK E;  1EA6 A;  3T1H I;  3ZKB A;  4DV7 I;  2BM1 A;  4JG4 A;  4KHP E;  1FNM A;  1HR0 E;  2DEJ A;  2HKE A;  4WUB A;  5IWA E;  3M6A A;  3LPS A;  1H7U A;  3V5R A;  4B3R E;  4Z7C A;  2F4V I;  2X7I A;  3ZZU A;  2HFU A;  4DR1 I;  3T1Y E;  4JI8 I;  1N0V C;  3ZZT A;  2UUA E;  4JI5 I;  1PIE A;  4LFB I;  4B3M I;  4M1K A;  4JI1 I;  2LJP A;  4EMD A;  2ZBK B;  1FWK A;  4DV4 I;  1Z5A A;  2R42 A;  4X65 I;  3J7A G;  4DV1 E;  4DV0 I;  1HNZ I;  4JI7 I;  5FLX C;  1N34 I;  4NXM E;  4AQY I;  5GMD A;  2WW4 A;  4LF6 I;  1OJ4 A;  4X64 E;  4JI0 I;  1B63 A;  1ZXN A;  4FWG A;  2NPF A;  4HY1 A;  4GKJ I;  2VQE I;  4B3T E;  4HAC A;  1FJG I;  4OX9 I;  4DR2 E;  1DAR A;  2BV3 A;  2V2Q A;  4DR7 E;  1Z0G A;  1Z5C A;  2A2C A;  1H7S A;  4JYA I;  1IBL E;  1I94 I;  4DR6 E;  4DR3 I;  2E5L I;  4Z7Y A;  4FWH A;  5A2Q C;  5LMN I;  4JI3 E;  4DPT A;  1XNQ I;  2HKJ A;  4B3S I;  4ED4 A;  3PYG A;  2DEI A;  4LF8 E;  4PRX A;  5FLX Q;  2VQF E;  1K47 A;  3K1J A;  4DV6 I;  4JI6 E;  4URL A;  4YY3 I;  4JI2 I;  1XHK A;  1HNX I;  3T1H E;  3J81 C;  4DV7 E;  4LFA I;  1Z5B A;  1XNR E;  1N33 I;  3D4J A;  2UXD I;  2V2V A;  3QT5 A;  4USK A;  4GKK I;  1RRE A;  4DU8 A;  2F4V E;  3QT7 A;  5A2Q Q;  1FWL A;  2UUC I;  4DPY A;  4DR1 E;  4MYT A;  1WUU A;  4DPW A;  2UXC I;  4JI5 E;  2UU9 I;  4LFB E;  4B3M E;  4JI4 I;  2OI2 A;  4JI1 E;  4LF5 I;  4LF4 I;  1XMQ I;  1D6T A;  3B82 A;  1ELO A;  1FI4 A;  4LF9 I;  1H73 A;  4X65 E;  3HUL A;  4DV0 E;  4JI7 E;  4AQY E;  4DU7 A;  3J81 Q;  4HXZ A;  3ZM7 A;  4LF6 E;  2HK3 A;  5GME A;  1N32 I;  5LMU I;  4JI0 E;  2UUB I;  2VF3 A;  5BR8 I;  4GKJ E;  3WU3 A;  1MG7 A;  2EFG A;  2VQE E;  3ZZ0 A;  4USM A;  1FJG E;  4OX9 E;  2CZ9 A;  4DUZ I;  4NXN I;  3GON A;  4HYM A;  3V2U C;  3Q1Q A;  4DV2 E;  1Z0T A;  1XMO I;  1UEK A;  4JYA E;  1I94 E;  1KKH A;  2R3V A;  1KTV A;  4DR3 E;  2E5L E;  4FW9 A;  5LMN E;  1XNQ E;  1ZM2 A;  4YHH I;  1MU5 A;  4B3S E;  4K0K E;  1HNW I;  4B3R I;  4XTJ A;  2A2D A;  1KVK A;  3B78 A;  4LFC I;  1IBM E;  1N36 E;  4JV5 I;  1H74 A;  4YY3 E;  1J5E E;  2HHH I;  4JI2 E;  1QZR A;  4DR4 I;  1HNX E;  4X66 I;  1S4E A;  1N33 E;  1ZM3 A;  4DPX A;  4LF7 I;  2UXB I;  4P52 A;  4GKK E;  1Z59 A;  2J7K A;  4DV1 I;  2V34 A;  1RR9 A;  1Z0B A;  4PU9 A;  3H4L A;  3LNU A;  2BM0 A;  2UUC E;  4UTG A;  4MYU A;  3K17 A;  2UXC E;  2UU9 E;  1BKN A;  4JI4 E;  4HAC B;  4FN5 A;  4LF5 E;  4LF4 E;  1XMQ E;  4UT4 A;  1IBL I;  4LF9 E;  2XEX A;  1NHI A;  2Q2E B;  2ZM6 I;  2ZIT A;  2GS8 A;  3PYD A;  3WU5 A;  1Z0V A;  4JI8 E;  1N32 E;  5LMU E;  4WUC A;  2UUB E;  4DV5 I;  5BR8 E;  1PKP A;  4DUY I;  4DV4 E;  1KIJ A;  2AJ4 A;  4NXN E;  3J80 C;  1EI1 A;  2X36 A;  3PYF A;  3PYE A;  4DV3 I;  1HNZ E;  1N34 E;  3WU6 A;  1MX0 A;  1XNR I;  4DPU A;  4YHH E;  3OTO I;  1HNW E;  3QT8 A;  1B62 A;  4X62 I;  3WU4 A;  5IT9 C;  5LL6 R;  4DR5 I;  4KQV A;  4LFC E;  1IBK I;  1S16 A;  4JV5 E;  1Z0C A;  2HHH E;  4KHP I;  4DR4 E;  1HR0 I;  4ZVI A;  3J7A M;  4X66 E;  5IWA I;  3J80 Q;  3B8H A;  4LF7 E;  1ZM4 A;  2UXB E;  3CWV A;  4DV6 E;  3T1Y I;  4RPF A;  4DXL A;  2UUA I; 
#chains in the Genus database with same CATH topology
 2GJF A;  4DSF A;  5KFG A;  2ZDP A;  4LFA E;  3BBC A;  3MTJ A;  3DRX A;  1WG5 A;  2J7U A;  3A3O B;  2PNL A;  1E6V B;  4DV7 J;  2D3O R;  4MFB A;  3NMA A;  5L3J A;  5F41 A;  4ZLJ A;  2W9B B;  1R31 A;  2XZW A;  2HQ3 A;  2HMI B;  1O0P A;  1X31 C;  2YKM A;  3LTO A;  3DMJ A;  4X64 I;  4KSE B;  1RYR A;  4EBD A;  3OXG A;  3CXC R;  4YB1 P;  2F4V J;  2JVR A;  3K5L A;  2VG6 B;  1JLC A;  4DR7 I;  4B9S A;  4ECT A;  5KG2 A;  3LGM A;  3MUR P;  5K14 A;  1LXJ A;  2ZBR A;  1MLA A;  2WSF C;  3JAM Q;  1DQ8 A;  3ZTO A;  1BUX A;  2C1E B;  3M6X A;  1SC4 B;  2QMU B;  2HZA A;  4OYI A;  3WHI A;  4DJB A;  1OYE A;  3NS5 A;  4P2S A;  2JEF A;  3ZKD A;  1R43 A;  2CPI A;  2OAU A;  3G6X A;  4TU7 A;  4ZIT A;  2YWH A;  1Y3K A;  1RWO B;  1T03 A;  2NLW A;  3W8P A;  2WBM A;  2HRU A;  4RWX A;  4X4T A;  2XC9 A;  3DI6 A;  2VFV A;  4LPF A;  3DOL B;  4JB8 B;  5HAN A;  4Z7C A;  3GV8 B;  2JOQ A;  5A6W A;  3ZZU A;  1YJN S;  4QIF A;  4MQY A;  2DTJ A;  2WZ1 A;  2WVE A;  3ENW A;  1KLN A;  2VG5 B;  2BR2 B;  5IWA F;  4KO0 A;  5I42 A;  3SZ2 A;  4O3S A;  4B9N A;  4U9R A;  4DCO B;  2APO A;  4IZJ A;  5F9N A;  3C3L A;  3UR3 C;  5FLX C;  1U6F A;  3VQS A;  4DZD A;  3M1V B;  4LF6 I;  2AE8 A;  2LEC A;  1UPM B;  2J0S D;  1NPK A;  2NPF A;  4HY1 A;  4LSL A;  2KZM A;  2G2O A;  2R7T A;  1OYD A;  3BGR B;  2DRA A;  1P8G A;  3D0H E;  2Q3P A;  1VLY A;  2XY7 A;  1MN9 A;  1WJ9 A;  4LF4 J;  4DSE A;  2HNZ A;  4JI3 E;  4DR2 F;  2HGN A;  2FIU A;  3BDP A;  4B3S I;  2ZBQ A;  1X7V A;  5D77 A;  1NEE A;  3EZO A;  2IM3 A;  4EZ9 A;  5CZX A;  1Y6Z A;  4RBU A;  3JAM U;  2KO1 A;  1IKW A;  2FC9 A;  2DGV A;  4F0M A;  3BR8 A;  4ZS6 A;  1FRX A;  2EW9 A;  3MED B;  1MML A;  4F4A A;  1AUD A;  1MWQ A;  4J9R A;  2DYA A;  2Z0G A;  4DMZ A;  3DOK A;  2IRX A;  3LO3 A;  3DRP B;  2XLK A;  5U47 A;  4KT0 C;  4LFB E;  1VJQ A;  1TK5 A;  2I38 A;  5F9L A;  5KFR A;  1LW0 B;  4P2M A;  1FI4 A;  3GIL A;  3GYX B;  3I56 S;  4JI8 F;  3KJV B;  1S9G B;  2YY3 A;  3U1Y A;  4Y2K A;  2D74 B;  4JI0 E;  1DJ0 A;  2WTF A;  1Y5I B;  2DR8 A;  2GAG C;  2PA8 D;  1F1B B;  4CLT A;  1NME B;  4IFD B;  2KKH A;  2CZ9 A;  4ECQ A;  4C11 A;  4AQY F;  3FVY A;  2H3E B;  1G4C A;  4RW7 A;  2OEM A;  1FJG F;  2L9D A;  1JWW A;  2GO3 A;  4PWD B;  4NCA A;  2CRL A;  1SQG A;  4YY3 E;  4HVZ A;  1TAQ A;  4JI2 E;  2LU1 A;  2KDO A;  3AOB A;  1S4E A;  5K8O A;  4HR2 A;  4A8O A;  2J7K A;  3L7U A;  3IR6 B;  3MM6 A;  2KFY A;  4OI2 A;  2G4B A;  1D8Z A;  2QMX A;  2X3G A;  3BBF A;  4LRF A;  2B51 A;  2BAN A;  4X62 J;  4CDI A;  3BGF A;  2WB4 A;  4NL5 A;  4PG8 A;  4ZVR B;  1CS4 A;  2CG8 A;  2BE2 A;  2G1H A;  1U0H B;  2G0I A;  2PMW A;  1A7G E;  4RL1 A;  2YQ3 A;  1BQN A;  3PW2 A;  3T1Y J;  3D3B J;  3HHE A;  4OX8 A;  4ZVT B;  4NZ0 A;  1OYS A;  3CE8 A;  2AJ4 A;  2CQ2 A;  1EAY C;  3PYF A;  2MDA A;  1OY6 A;  4Z37 A;  3U7J A;  3R2D J;  3NWR A;  1NPR A;  3OTO I;  1HNW E;  3W63 A;  4J9N A;  3L9Z A;  4YR3 A;  3OTE A;  4PEO A;  5E3R A;  3M6V A;  2Z30 B;  2I5J A;  3M9M B;  4ID5 A;  1OYP A;  4DR4 E;  2V4Q A;  1V5V A;  1UP1 A;  3GCW P;  3JSR A;  3W7B A;  4TY9 A;  3J80 Q;  3FQL A;  3MHY A;  4HDG A;  4NWB A;  3W3S A;  1YX2 A;  1LNQ A;  2DY9 A;  2JJ4 D;  4RUC A;  3H20 A;  4DV6 E;  3JQM A;  4Y0F A;  1B70 B;  2K3I A;  3PS2 A;  2WSE C;  3D0I E;  4BWJ A;  4C8Z A;  4FF1 A;  1TEL A;  2LLZ A;  2M2B A;  4ZPW R;  1JNZ B;  2HQC A;  1F9E B;  2FY1 A;  3W64 A;  1UPP A;  2D9O A;  4J3D A;  2KXH A;  4EGL A;  1FKA E;  2YTC A;  1C0U B;  3I4P A;  2JWN A;  2UVV A;  4ZP6 A;  2UXD F;  4K0K I;  4YEA A;  3LA0 A;  4DV5 E;  1N0U A;  3SMZ A;  3JSM B;  1DTQ A;  2OPS B;  5LJ3 Y;  5GAH I;  1HLW A;  5D4N A;  2J5A A;  2JEI A;  2D7S A;  4ZVH A;  4J9L A;  2HG4 A;  2Z5B B;  1Q8L A;  1NM2 A;  4TU8 A;  3BM7 A;  3O5T B;  5DG8 A;  1U25 A;  2CPJ A;  1X5S A;  4IZK B;  3F41 A;  3FFI B;  2E1R A;  6FDR A;  5ITH A;  4M5K A;  2GIQ A;  3CJQ A;  3VAJ A;  2PI4 A;  1S12 A;  2PEH A;  4JG4 A;  1F3V A;  4JYA J;  1CEZ A;  1UDO A;  2UVR A;  2QSW A;  3DRR A;  2E1C A;  1S9F A;  2BYC A;  3MI7 X;  4K0K J;  1P9Q C;  3J80 U;  3GFZ A;  2KJV A;  2UUA E;  1PIE A;  1JLA A;  3VGV A;  3NAH A;  4DL2 A;  2DNO A;  2PT0 A;  4B3R F;  2R42 A;  4YB6 A;  4FNI A;  3HHK A;  1ZA1 B;  1HNZ I;  1T9U A;  7AT1 B;  3IO1 A;  2E7X A;  5C5J A;  2YKA A;  3M2R B;  1RHK B;  3DKD A;  2ZFH A;  4L72 B;  4F26 A;  2ATL A;  3I4H X;  4CYU B;  4OX9 I;  3GG0 A;  4OYO A;  2UU9 J;  2IA6 A;  3V6K A;  2E5L I;  3LAM A;  3HJC A;  5A2Q C;  1XNQ I;  3GQC A;  2YPZ A;  4KGK A;  4EWT A;  2CQG A;  1YQH A;  1EKR A;  1N36 F;  2IBK A;  4DR6 F;  4AND A;  5DDQ C;  3O8W A;  4OI0 A;  2CZ4 A;  2W2O P;  3D68 A;  1ZAX A;  4N5S A;  2OP5 A;  2DR7 A;  3K8V A;  2CPH A;  4X84 A;  2CJK A;  2FGO A;  5GVQ A;  2AP6 A;  2I8E A;  1HNZ J;  2XBP A;  4Q45 A;  2YX7 A;  2ZHA A;  4B3O A;  3P96 A;  2L48 A;  4HT7 A;  1I5O B;  1MW7 A;  2MJN A;  1L5U A;  1SC6 A;  2C2M B;  3QT7 A;  3OFH A;  1RTI A;  3KLF A;  3TQE A;  3TI0 A;  2N3O A;  4JI4 I;  3JYT B;  2BUN A;  1HNI B;  4C98 A;  4AM3 A;  3DLB A;  1IQZ A;  3RBE A;  4RWW A;  5IZH A;  3HUL A;  4DR1 F;  4C0O C;  2DD8 S;  2PO2 B;  4IOA Q;  2KXF A;  1N32 I;  3J7A 1;  1F9F A;  4JI1 F;  5KFD A;  2AX0 A;  1DUR A;  2J9D E;  5LSL A;  1SKU B;  2VF3 A;  4J9P A;  4GKJ E;  2RUS A;  3WBZ A;  3A8J A;  4X65 F;  3VZI A;  1KON A;  3GZ7 A;  4DV0 F;  2W9C B;  2CAD A;  4NAS A;  2PFD A;  1VFJ A;  2XMV A;  1X4A A;  4OO1 E;  4C0B A;  2Z56 B;  3HXM A;  1Q82 T;  2DNR A;  1SQE A;  2VQE F;  1RTZ A;  2X1A A;  2BR0 A;  1ZM2 A;  4DSJ A;  4IH7 A;  3US5 A;  2DVI A;  2CQB A;  3IG1 A;  4PG7 A;  4CLK A;  4UQT A;  2M88 A;  3E2E A;  3VAF A;  4FBU A;  3OL8 A;  4BCA A;  1VI7 A;  1P9Y A;  5T7L B;  1GMV A;  4ISA A;  2V34 A;  3KJN B;  5K8N A;  1OYR A;  5C0X C;  1S9E B;  3LNU A;  4ZLL A;  4CH7 A;  3M30 B;  3H90 A;  1JLQ B;  2B8Q A;  2C42 A;  1LV5 A;  3THP A;  4CRJ A;  3A13 A;  4HTJ A;  3RTV A;  1S79 A;  4LF5 E;  1ACM B;  4YR0 A;  3EZ5 A;  1X4C A;  2O1P A;  3TZY A;  3G87 A;  3H7H B;  3OR2 A;  4O4G B;  2K7K A;  4AUK A;  5F8G A;  3ITH B;  4Y6I A;  1B64 A;  4ERD A;  2FLO A;  4WU3 A;  4IG3 B;  4FDF A;  3NGU A;  4BA1 A;  1CPZ A;  4G3I A;  5HQM A;  3MEK A;  2MGZ B;  5J2P A;  1BD6 A;  1NUE A;  2UUB F;  4UY8 T;  4G6V B;  4DQQ A;  2FJV A;  3GLL A;  5A8K A;  3N5B A;  2J7W A;  5HMX A;  3MMJ A;  3FMW A;  2P9G A;  4KPC A;  2HEK A;  2HHH E;  1Q8K A;  2LMI A;  2ZOM A;  1YJW S;  2HW3 A;  3D3C J;  4KIA A;  1P1T A;  4RNM A;  1ZM4 A;  1YKW A;  1BY9 A;  3HDS A;  3LAN A;  5JEA E;  3D5M A;  3W5Z A;  4ZP7 A;  1N52 B;  4LF7 F;  3JAM C;  4W4M A;  1VR6 A;  1QAX A;  3PNI A;  4DFP A;  4P9S A;  1E6Y B;  1WG4 A;  1FKO B;  1FRM A;  4K4V A;  1AZS A;  4FF2 A;  1HBU B;  1S6P B;  3DM2 A;  4LUB A;  4LIW A;  2W1B A;  5C42 B;  2RUG A;  4G1Q A;  2G0J A;  5KFT A;  2MKK A;  1RWN B;  3KMS A;  2ZZM A;  1GTE A;  1M5S A;  8RUC A;  2QEX S;  2JEG A;  2ZH6 A;  1ZZF A;  4NA1 A;  2HFZ A;  2ZJQ Q;  2VBY A;  3L7Z B;  5K36 B;  5CYM B;  2JFK A;  4ZCI A;  4GO7 X;  3W65 A;  5HVG A;  1K1S A;  1JKH A;  2ZZT A;  4N77 A;  3MMC A;  2FDN A;  1NHJ A;  3MAA A;  2BDP A;  4Q5V A;  3CCL S;  2DXF A;  1KFS A;  3ZNU A;  3TA0 A;  2MTL A;  3O2I A;  3LAL A;  5IXU A;  1BQM B;  1JLG A;  3IA0 A;  4J9M A;  5JVH Q;  3CDA A;  4JUZ A;  5KFH A;  3C15 B;  5J1E B;  3CJ5 A;  1N0V C;  2CPD A;  4ETX A;  3HSD A;  1A9N B;  2BKP A;  5BYQ A;  4K2X A;  1FWK A;  2BA9 A;  2K2P A;  4CH0 S;  1EHW A;  3OV7 A;  5M2P A;  1LK7 A;  2DGU A;  2V9W A;  5AE1 A;  2YNH B;  2W2Q P;  2NS1 B;  3CO0 P;  4OO1 D;  1PJ5 A;  1U2C A;  1REG X;  3HT3 A;  4QNJ A;  4EUV A;  1X5T A;  2V63 A;  4CT9 A;  2UUC J;  3IAM 9;  2C39 B;  4HI1 A;  2F65 A;  5DRQ A;  2RU9 A;  3PW0 A;  4DR3 I;  2CQ4 A;  1O5J A;  3EDR B;  1XMQ J;  4L3N A;  4DPT A;  4KKO A;  2H4W B;  1RAB B;  2Y1J A;  2KVQ E;  2GVD A;  3MM9 B;  4PRX A;  2KJW A;  3SCL E;  3HPO A;  1WC5 A;  3KK3 A;  4JI6 E;  4URL A;  1EET B;  5BR8 J;  3Q23 A;  2ZH2 A;  3HJV A;  2ZUA A;  3Q24 A;  3EGN A;  2HS0 A;  1VRQ C;  5J2M B;  4LFA I;  1LWE B;  2GQ2 A;  4LF8 F;  3PEJ A;  5K9F A;  1XNR E;  1TV6 B;  5D0G A;  1QVG R;  2JDJ A;  4QU6 A;  3QT5 A;  4USK A;  4ED1 A;  2E1A A;  4XAK A;  5F8L A;  4BWM A;  2OPP A;  4F50 A;  5F0W A;  2XTJ P;  4FYX B;  1HD0 A;  4DPW A;  4U96 A;  2RF2 B;  4W92 B;  4LRD A;  1KR4 A;  1A0O B;  4LFC J;  4NE9 C;  3J81 U;  5T14 A;  1NRK A;  1HBN B;  4QIG A;  4DU7 A;  1YI2 S;  2IDE A;  5LMU I;  4DV1 J;  3M8Q B;  2KRR A;  4DF4 A;  4ES1 A;  2PNZ B;  5LXR A;  1YZ6 A;  3R3T A;  4UOH A;  4JI7 F;  3V2U C;  3C16 A;  2CYY A;  4LFA J;  1H7X A;  2VA2 A;  2IJN A;  5D3G A;  5LOQ A;  3K5P A;  2IJF A;  1K9M T;  4ES2 A;  2A6O A;  4C8N A;  5LMN E;  2BEF A;  3AOD A;  3BSA A;  2DPJ A;  3ZTS A;  1QM9 A;  2Z2L A;  4AFF A;  2XGP A;  4C3M A;  3TUJ C;  2AYM A;  4TLR A;  5THW A;  4RW6 A;  1BE4 A;  1REV A;  4WKR A;  1KN6 A;  5JEA D;  2K1R A;  3L7O A;  5KT4 A;  4DPO A;  2VPX B;  3D2W A;  3R5B A;  5EDW A;  2FVS A;  3OFG A;  3SSS A;  4WP8 A;  4DLG A;  3O44 A;  4QBU A;  2AZ3 A;  3DGV A;  1BLU A;  1WI6 A;  5KFV A;  5KG0 A;  2GIR A;  7FDR A;  4IH5 A;  2DR6 A;  1N33 F;  4MYU A;  5AE3 A;  4GKK F;  1BKN A;  4HAC B;  4ANC A;  4NI2 A;  1NHI A;  2XUL A;  3VWS A;  1CJV A;  1QE1 A;  3JSB A;  2O67 A;  4EEY A;  4V19 X;  3BBB A;  4DFJ A;  5KFY A;  2O5D A;  3BKF A;  2BA0 G;  4Q44 A;  1X4G A;  3J80 C;  1FD2 A;  3GSD A;  5EKW A;  4HI2 A;  2X36 A;  4W98 A;  1TL7 A;  1HWL A;  3J81 j;  2DCU B;  2LQ5 A;  1MX0 A;  3PV8 A;  3CC7 S;  3FZ2 A;  2DIS A;  1VRU A;  4J9K A;  2HHQ A;  2IA0 A;  1LQ9 A;  1UWB B;  1USU A;  1QUP A;  1IBK I;  1FHT A;  1IKV A;  3MMA B;  4P71 A;  2VFR A;  2JEB B;  3B8H A;  3BJY A;  5HAO A;  2LEA A;  4JI3 J;  1I51 B;  3CWV A;  4JV5 F;  3H5X A;  3JTO A;  2R8I A;  1GK8 A;  3TOQ A;  3KUH A;  2NXC A;  1S77 D;  1FNO A;  2J0X A;  2NUU G;  2HWI A;  5T41 A;  5A8W A;  4MMO A;  4M5G A;  1L3T A;  2ZM6 E;  2OFH X;  2IM2 A;  4I2Q B;  4NLQ A;  1WDT A;  2ZBP A;  4IOC Q;  1HPZ B;  1HWI A;  2HLT A;  2EC2 A;  2BRK A;  5J2N B;  4CLS A;  4F04 B;  2XQC A;  3F44 A;  1NJX A;  4DHV A;  5EWG A;  4NRT A;  4DUY E;  4LFB J;  5FII A;  1DTT