3PYGA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
GSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 83
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pygA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pygA01
4FWGA 4DV0E 1FKAE 4R1FA 2UXBI 4AQYE 4JG4A 4DUYE 1S16A 3J81Q 1Z0WA 4RPFA 4HACB 1K47A 4LFBE 2UXCI 3T1HE 1S4EA 1XMOI 1IBLE 4MYTA 4ED4A 2UUCI 2UUCE 4XTJA 4DUZE 4DPYA 3J7AM 4B3SI 4B3TI 5FLXC 1XMQE 1U2RA 2LJPA 4NXNE 5BR8E 5LMNE 3WU3A 4LF6E 3K1JA 2HFUA 3LTOA 2AJ4A 4B3RI 2UXDE 4LFAE 1NHJA 4DUZI 4USKA 4PRXA 3HULA 1J5EI 4DUYI 4DR6E 4JI2E 4DR1I 3ZZTA 4DPXA 3WU5A 1N34E 4DV4I 1HR0E 1Z5AA 3V2UC 4B3RE 5IT9Q 4NXMI 2BV3A 1H74A 2UXBE 3V5RA 4X66I 2CZ9A 2OI2A 4HY1A 4KQVA 3WU4A 4B3ME 1XMQI 4PRVA 1ZM9A 4JI3E 1XNQI 3H4LA 5LMNI 4PU9A 2ZM6E 4LFBI 2HHHI 3ZKBA 4JI5E 4WUBA 4JI1I 3ZZUA 4URLA 4X64I 2VQEE 2E1RA 1H7SA 1Z0CA 1I94I 4GKJE 4K0KE 1B62A 5GMEA 5LMUI 2HKJA 3B82A 1FWKA 1Z0GA 2VQFI 4LF7E 4LF7I 4I3HA 3JAMQ 4JI6I 1H73A 5A2QQ 1H72C 4JI0I 1IBKI 4FWHA 4JV5E 3PYFA 4DV7I 4DR7E 3J81C 4DV2I 1KIJA 2BM1A 2HFSA 5L3JA 2R3VA 1HNZI 2UUAI 4DV0I 1DARA 1FNMA 5FLXQ 2UU9E 4B3SE 1PVGA 1ZM2A 4M1KA 4UTGA 5LMUE 2A2CA 4DV5I 1NZ0A 4GKKI 4X65I 4HXZA 4DPTA 1N34I 5BR8I 4JI6E 1OJ4A 4Z7CA 1FJGE 1FJGI 4UT4A 1H7UA 2UUBE 5IWAE 2ZITA 5IWAI 2F4VI 2F4VE 3D4JA 1PIEA 1HNZE 1WUUA 4DXLA 1N0VC 3J7AG 1A6FA 2R42A 2HK2A 3PYDA 3F0NA 3PYEA 1KTVA 1Z59A 3J80C 4DR4E 1KKHA 4DR6I 4LF5E 4LF5I 1NHHA 4YHHI 3B8HA 3T1HI 1MX0A 1RREA 1RR9A 1IBMI 2UUBI 4DV1I 4YY3E 4LF9I 4JI7I 3LNUA 1PKPA 4USMA 4JI8I 5LL6R 1ZXNA 1ZXMA 5GMDA 2HK3A 4P7AA 1HNXI 4GKKE 1N36E 2DEJA 4DR5E 4DR5I 4X66E 4DV3E 4DV4E 4DR3I 1IBKE 3GONA 3CWVA 4DR2E 4LF8E 4LF8I 2V2ZA 1BKNA 4FW9A 3QT6A 4DV1E 4LFCE 4JI7E 1XMOE 1EI1A 1XHKA 1KVKA 4LF4I 4GKJI 3ZM7A 1J5EE 2X7IA 4B3MI 4DR4I 1Z0EA 4DPWA 3M6AA 3LPSA 4HYMA 3T1YI 1EA6A 2HHHE 2WW4A 4EMDA 2Q2EB 4NXNI 1IBME 4DR7I 4DV2E 4JV5I 4DU7A 1QZRA 2A2DA 3Q1QA 4DPUA 4DV6E 1HNWE 4DV6I 4LFCI 1HNWI 4LF4E 1Z0TA 2EFGA 2UUAE 1N33I 1N33E 4DV5E 2V8PA 1ELOA 1VISA 4JI0E 1MG7A 4YHHE 4JI2I 4ZVIA 1D6TA 1Z0VA 4JI5I 2XEXA 2UXCE 3K17A 1XNRE 2VF3A 3J80Q 3JAMC 4DU8A 4OX9E 1FI4A 4Z7YA 1I94E 1Z0BA 4JI4E 4JI4I 2V2QA 3OTOE 4NXME 2VQFE 5IT9C 4AQYI 1FWLA 4P52A 1Z5BA 4LF6I 4JI3I 1N0UA 4DV7E 4KHPI 1HR0I 1MU5A 4JYAI 2UXDI 1B63A 1Z5CA 1N32I 4X62E 4X62I 4YY3I 4LF9E 4FWDA 3B78A 2HKEA 1ZM3A 2X36A 3QT8A 3ZKDA 2NPFA 1N36I 3ZZ0A 4WUCA 4B3TE 4DR1E 1HNXE 4FN5A 1UEKA 4DR3E 1ZM4A 4DV3I 4DR2I 3PYGA 3QT7A 4HACA 2E5LI 4OX9I 2BM0A 3WU6A 4WUDA 1IBLI 4X64E 4LFAI 2V34A 3OTOI 2V2VA 2UU9I 1NHIA 1XNQE 2DEIA 3QT5A 2ZM6I 4X65E 4KHPE 2J7KA 2ZBKB 3T1YE 4JYAE 2VQEI 1XNRI 5A2QC 2E5LE 4MYUA 4JI1E 1N32E 2GS8A 4K0KI 4JI8E
chains in the Genus database with same CATH superfamily
2CGEA 2OLWA 1Z1ZA 2V69A 4ANEA 3FRZA 4URGA 5CD4A 3BO3A 1FKAE 2LMIA 3MM6A 5LM7E 4YOEA 1JKHB 4IFYA 2RDDA 3MPWA 3X1LB 5HMXA 2HQIA 1Q95G 1V9OA 1U25A 2UXBI 3GTYX 4R5PA 1GT8A 1K44A 2XWYA 4DLEA 4IUFA 3VAGA 4DUYE 2XTJP 2DGSA 3MFHA 1TK5A 3EGWB 5LSLA 3UQSA 2J8SA 2E7XA 4DMZA 3AQPA 1HNWJ 1F3FA 2LLZA 3HHLA 1YWXA 4JI7J 4I64A 2RQKA 1VBXA 1S49A 2Z2MA 5HROA 5JEAE 3T1HE 2DNPA 3R9LA 4YMEA 2V4QA 2BANB 3EVMA 2Q1LA 3BZQA 3C6TA 1J2VA 4I6WA 4X4SA 3PO5A 2BJ9A 1Y5NB 3LALA 1CG2A 3WX8A 2D7SA 2MHNA 3MPYA 4WIIA 4DQPA 4OI6A 2QMWA 4C8KA 1IBLE 4Y2IA 2OTJS 5DDOC 2EBGA 5D4PA 1VMBA 4PYAA 4NI2A 4ZPWR 2GGPA 1KVIA 1FKAF 3SCLE 4NMXA 2YX7A 3OTOE 1X0FA 2Y8YA 2PI5A 1APSA 3LA0A 1HW8A 3ILJA 2O01C 3MEKA 4FPIA 5K8OA 4LFBF 4B3SI 2V8DA 3SSSA 1TMMA 4PUOA 2V5HG 3H98A 3TNVA 4JI5J 2LFVA 5ETVA 4ZLJA 2B8QA 2ROPA 3HVTB 1KQGB 4UZCA 3NOGA 1TR0A 5JXSA 2KJWA 2V8GA 3HVRA 2GNKA 1V5IB 2QLBB 5FLXC 2UXDI 2QLFB 3FJ2A 3NOCA 1CBKA 4ZVPB 1U2RA 4M5HA 3E51A 1WOSA 1BHNA 2IJNA 2VFVA 4JI6F 1O0PA 3V4IB 1D0EA 3EGZA 4NXNE 5BR8E 2AZ3A 4DSIA 2NREA 5LMNE 5KG4A 5D4NA 5DRQA 2NYIA 3K1JA 4KJIA 2YKNB 3P4UB 4AIDA 1V3ZA 4C8ZA 3TJ9A 1SKWA 2VHGA 1Y5IB 5D3GB 2VDIA 3MMAA 1GFWB 1Q7YT 1NU4A 4KTQA 3P96A 1T3OA 4ETXA 1S9GB 2WSCC 2ZC4A 4WZMA 4TLRA 1PC4A 4AL5A 1FERA 5E3PA 1YTYA 3ZZRA 1AW0A 2H65B 2BA0D 2IY5B 4KPYA 2HNDB 3QWUA 3PRYA 3E01B 2C2OB 3W5ZA 3KDOA 5ETKA 2ZM6F 3L7ZB 2GIQA 3EPGA 3G9CA 2HHPA 3GU0A 4IQMA 4EBDA 3AODA 3MMBB 4OYXA 1FK9A 1TV6A 4IOAQ 3TW0A 3HJCA 4X64J 1MLAA 5T7LA 4CO2A 2OTLS 5DG9A 1VLYA 4DFMA 5M2RA 2HLUA 3Q89A 2XYGB 1ZOTA 2LQ8A 4DPXA 3RBEA 2G9OA 3DU6A 1VDHA 5DQGA 2B51A 3R3TA 1SL0A 4A4JA 3LWMA 2LKZA 3TP2A 1HR0E 4KYZA 1T9UA 2BZ2A 5I3PA 1WJ9A 1X4EA 4PXCA 4CWBA 4QWAA 2GJFA 4ECQA 1C1BB 1LW2B 3OTOF 3PM9A 2KI2A 3K8WA 4RNOA 2MGZA 2UXBF 3PS1A 1B0VA 2LA4A 4MKVA 3PDNA 1NH8A 5D78A 3V2UC 4WZQA 2WZ1A 1CJVB 4B3TJ 4JI6J 4LCFA 2DTJA 4IO9Q 4BC7A 2LXFA 3IRXA 3RR7A 5EDWA 4F4KA 4NXMI 1RAOA 3TVZA 1VQ8S 1GAOA 3DYAB 4DR3E 4JI5F 4FW3A 1S1TA 3ZO7A 2FJDB 3KLEB 4X66I 3AA9A 3H42A 4OHXA 4KQVA 3WU4A 2DNOA 1CJKA 1LOUA 2JX2A 3I5CA 5D15A 3TYTA 5IT0A 1D1UA 2GO3A 2PO0B 1PILA 4JI3E 1H2TZ 4CO0A 2K2PA 2VDHA 1UA1A 2DIVA 3UD4P 5KG1A 2KFNA 1UZHA 2YKNA 4PU9A 3CCTA 1AFIA 4GQUA 2MY8A 5KFJA 5A2QY 4LFBI 4IH5A 5KOXA 3PJ9A 2UUTA 4FS1A 3GPAA 2ZDOA 4DDFA 4MFBA 1TKTB 5HLFA 3K59A 4JI1I 3ONQA 2H54B 3W5YA 1S0VA 3C6UA 2FZCB 4PPZA 1E6VB 2CVIA 4YY3F 2UUCF 2BW7A 1HNWF 2NR0A 1DURA 1UZDA 2Z56B 4KFBB 2WTFA 2VQEE 2HW3A 3B6BA 1M5OC 3NNCA 1A9NB 4PRFA 2OPQB 2IPOB 2NSBA 2QIFA 3PACA 1NSPA 1U47A 5DJBA 1Z0CA 2IM2A 1R0BG 4I0WA 2W7OA 1B62A 1AROP 3MWBA 1KP6A 3OVSA 4OI0A 3JSMA 1EKRA 3ADAC 5GMEA 1Q81T 1A6LA 5DZ6A 4RJVA 1YK9A 4AXIA 4TU7A 5LMUI 3E8OA 5HJXA 2FJVA 3B82A 1VI7A 3FMBA 5HLFB 5CXTA 2XC9A 4X4OA 3QJJA 1Z0GA 2VQFI 4V1Ak 3PKMA 4LF7I 2AJ2A 3DHXA 2LQ9A 2FQQB 3VZIA 3RG6A 2Y9HA 1CJTB 4L74A 3SCKE 2GQ0A 4KGZB 3LAKA 1MMLA 1RWVB 3D0HE 3M8SA 4FWHA 1U2CA 1TP7A 3CMQA 4MK7A 4R8UA 3HHLB 2CUYA 2Q43A 3PNIA 3PYFA 4IH6A 2CJKA 5LJ3Y 3FCVA 2Z5BA 2ZWOA 1HWIA 2F8MA 4PG5A 3S1TA 3D54A 2CQ3A 3PO4A 2HFSA 3I6PA 2MPUA 3IMQJ 1NAQA 4WFZA 2OPPA 2OHDA 1YSJA 1N32F 2HIYA 5CZXA 2VODA 2COLA 2I1RA 3IM8A 3R97A 3KG4A 3OFFA 1DARA 4DV0I 3DCAA 2ZH7A 5H1SV 2Z30B 1VQMS 1S0OA 5G0RA 1H7WA 1OIAA 3N6LA 2FTRA 3DN9A 4RO0A 1RWWB 1FK9B 1Z2LA 2O1PA 4F3MA 4Q44A 1UDOA 4B3SE 1I51B 3R5CA 2O5DA 1VBYA 3D0GE 3HKWA 1PVGA 3UW1A 1T03B 3MOJB 3VGSA 5B0FA 3OJSA 4LF9J 3M2RB 5GAHU 5LMUE 1KTQA 4NCBA 4NLRA 5KT6A 1VFJA 1S6UA 2QSFA 2FVPA 4OV1A 1TL1B 1YI2S 4EO6A 1JLCA 3BKTA 3AHPA 2R9LA 4FBTA 5A8KA 1R8BA 1F3VA 1U6BA 3TZWA 1SVDA 5EWGA 1BQMA 1WI8A 7AT1B 1G3OA 1FTRA 1HQ2A 3BBCA 1FWPA 3DKDA 3MD1A 5J1PA 2ZH9A 4WYLA 4ZVIA 2DIUA 2BA0G 4KSEB 2FJBB 4JI8J 3OV7A 2DH7A 4RNMA 3PW7A 2W2NP 3TR5A 3U1NA 7FD1A 2ZITA 1RHKB 5C2GA 2BQRA 1U7LA 2F4VI 3S01A 2MLXA 4NLSA 1PIEA 1DTQB 3BKUA 3JXOA 4JI3J 1HBNB 2O3ZA 2MEWA 4LSLB 1N0VC 4I69A 1NKCA 4AD6A 4D3GA 3JSMB 1B0PA 1QE1A 1SXLA 1XR6A 1WORA 1IKVA 3GCXP 3MCMA 1Q8BA 1QJHA 3Q2SC 4GVBA 1WG5A 1HQEA 4LBPA 4MK8A 4TLQA 2ZM6J 2P9GA 3F0NA 1FE4A 3N9UC 4DX7A 3R1LA 2DNLA 4KV8B 1HNVB 4DR4E 2DT9A 1VQ5S 4DF4A 5F8IA 1RU2A 1TAQA 1VCTA 5U47A 2VG6B 4QWBA 2VICA 3VGTA 3AOCA 2DR9A 4LF4J 1SC1B 2CNOB 5DLGA 1NPKA 1YHCA 1ULRA 1GXUA 4OZ1A 1X0PA 2YBVA 1U1QA 3MAHA 1FJEB 4WP3A 1FXLA 4P7AA 4A8FA 4YHHI 1OSCA 2UXBJ 4EU0A 3T1HI 3GZ7A 2MZ1A 1SIZA 3C19A 3VAHA 2HG4A 4IZJA 1VQSA 4LIWA 1CULA 3BS9A 3DI6B 3Q8PB 1Y4UA 2RVJA 1SV5A 5KFMA 4U9RA 1E6VA 1HR0I 3TA0A 2IERA 2UUBI 1S1XB 2W4CA 3VAMA 4OYIA 2V67A 4HH0A 4RW9B 3CGIA 4JI7I 1H2UX 1ZBTA 4QNKA 2VPZB 1WC5A 2B6AB 3SXLA 5C24B 3EDQB 3JSYA 1WTBA 4K4VA 1Q8KA 2XSFA 5F0WA 2MY7A 2QN6B 3OFHA 1KOHA 3SZ2A 1IBKF 3CDIA 3PIPQ 2R7QA 2JSXA 4OKGA 2JVRA 4USMA 2NXNA 4LFBJ 5C0XA 1AFJA 1GMVA 4NYPA 2R7WA 1FNXH 5E2QA 3T9NA 3TEHB 5D0EA 2AJQA 1HNXI 2ROEA 2X1GA 4GKKE 4FPRA 4NCGB 3O5TB 4I6AA 3I55S 4JV1A 3PHEA 1GEHA 2EG2A 3KLEA 3VAJA 1HNXF 1XR7A 5T14A 3AD8C 1U4BA 3P6YC 3KNAA 2RQMA 1FDBA 5HMYA 4JI8F 1YITS 2XNQA 3LPEA 2QL5B 3OR1A 4J9PA 3GONA 1JIHA 3M8YA 2DHSA 3CJQA 2JEIA 4JOUA 2GVDA 3CWVA 1L3UA 4JP8A 2DHGA 3MMCB 1GK8A 2V2ZA 3BN4A 2ZBQA 3CEDA 4L76A 3OL7A 3C16A 5LMUJ 2ZNYA 1N36F 1FRLA 3DRSA 2W7PA 4N41A 2IM1A 4KKOA 1MROA 1Q5YA 1URNA 3DOKB 1ZYQA 2FJWA 1VHFA 1XMOE 1UKUA 1Q1KA 2OD6A 3CSKA 3HZGA 3VGUA 4YFUA 2HHHF 5DRPA 3P49B 3PTWA 2B6AA 3TUZC 3NY0A 2MMYA 4YB7A 1N4LA 1KHVA 5ETNA 3J81j 3TAMB 2JFDA 5BYSA 3CCQS 3ZM7A 3GSDA 4BA2B 3PFEA 4J5OA 4EYIB 2K7KA 2RS2A 1FRKA 2B5JB 4EFAC 4M94A 4B3MI 1Z0EA 4DS5A 3CUNA 4NLQA 4OMFG 4AUKA 2DNNA 2UVVA 2YWHA 3AJDA 1GMUA 3GFYA 4DBQA 5SUHA 4WFXA 1H3DA 3U1KA 3T1YI 5KG0A 1KHWA 2BKPA 4RLEA 4C8LA 1EA6A 4ECSA 1T95A 4I1TA 1LXNA 4DSLA 2C2MB 2V50A 3ZNJ1 4ED0A 4U3BA 5FDLB 2GAGC 2GIRA 2VBWA 2RKIA 1KR4A 4M5IA 3UDCA 4YR0A 3ZZPA 3KK1A 2VB6A 4OL8A 1EETA 1YHQS 1T8EA 1WSRA 1Y3KA 3D0IE 2C2KB 4ZK7M 4DU7A 4LSNA 1RA7A 3UDVA 1WC6A 1F5AA 2CQBA 4W92B 2MZQA 4DPUA 2R7RA 2FGOA 4DV6E 3BDPA 1HNWI 4JBCA 1HNXJ 2VPWB 3C14B 2FVSA 4Q0BB 4ISAA 3MAQA 4CLKA 2NUUG 4CLWA 4TKTA 3KUHA 4DQSA 2HAIA 3O1LA 5ETMA 4BLGA 5GVQA 5F9NA 2IA0A 4ED1A 1F2HA 4HHJA 2G1HA 2JJ4D 4WIQA 5HVGA 4O4GA 3DMJB 3OFGA 4OHWA 3D6TB 4EI2A 2UUCJ 1N33E 2V8PA 2BA1G 5IT4A 2XLJA 4CLZA 1RTZA 3T41A 5A8RB 2I2YA 4JI0E 4L72B 3DRPA 3CDUA 3VV2B 3D3BJ 2HS0A 2K1RB 1U8SA 1YJRA 1TKXB 3FZ2A 5HROB 2CVEA 3D3CJ 1UMJA 2HWIA 3HFZB 4MT1A 1NJIT 2UUAF 2PA3A 1R0AB 1Z0VA 1X4GA 2CJXB 1S1XA 2BOPA 2J0QD 2VKRA 4DFKA 4NXMF 4IFDC 3K17A 2UVUA 4CNYA 3OLAA 2UXCE 3CXCR 2HHTA 3GG1A 5IM0B 1SKUB 4DN0A 3J80Q 2KZZA 1QE1B 1GMWD 4IG3A 1SI9A 2KYXA 3KOAA 4QIGA 1FI4A 1REVB 2Y0SD 2ZEJA 3EVOA 4PWUA 4A8QA 1I94E 5E0OA 1Y10A 1NJXA 2J9CA 4Q7AA 1P6TA 2KM8B 4I6YA 3KK2B 1WC0A 4CLUA 1U1MA 2RUSA 1IBMJ 5HANA 2ZJRQ 4RW7B 3HK2A 2LYVA 3N01A 2V2QA 5HAOA 4EBEA 2HIQA 2XLIA 4WF9Q 2C39A 3VCDA 2VQFF 2VQFE 1MMDA 5K14A 2E5JA 2GHPA 2BYCA 2MDAA 2A10A 1RAGB 2YNFA 2V63A 2YKPA 2PNZA 4JI1J 1JMTA 2OKQA 3LWLA 2HFOA 2N7YA 2BUNA 2XZTB 1LW2A 3LP1A 3TZYA 1YJ7A 4N7TA 3OR2B 4NRUA 3ITHB 3UD5A 3I0SB 5FLXY 1KD1T 1TFWA 4UF4A 2HGNA 5JJBA 1S1UB 2QRRA 3QAEA 1RWMB 2BANA 4OX6A 4QR1A 4CO5A 5EGYA 3OTBA 2PO0A 4V19J 3MEGA 4ELTA 4DV5F 1ZETA 4JI1F 3U1MA 3TI0A 1QTMA 2C3YA 3R7BB 1B4SA 1RXOB 4JYAI 4LRBA 1B63A 4NX9A 1USVA 3M05A 3HXMA 1RT7B 2VQFJ 1B70B 2QFJA 2C3OA 5ADZA 2FVCA 1OPZA 3CPWR 2J6UA 4LF9F 4YY3I 4LF9E 3GYNA 4UOGA 1ZM3A 2HKEA 4N5SA 5A0YB 3C14A 1FFGB 1LWEB 3MCOA 3IRXB 3MTJA 3UN3A 4DV7F 1IBMF 3QNWB 3HO1A 4FNIA 3DDIA 4ECWA 4PKDB 4DL3A 3RB6A 2JEBA 1N6QA 1RTIA 2HBRB 3KJVB 3ZZ0A 2CA9A 1PBUA 1F60B 2CYYA 1D9DA 2RHQB 2FGCA 1V3RA 4ZOSA 4F0MA 2V9WA 1CVJA 3RRGA 4K0KJ 2CQ0A 4FN5A 1J27A 3KLHB 1JXVA 1UEKA 2Q79A 4FXVA 4USJC 1H7XA 5BXIA 2ASJA 1PJ6A 2HPUA 1N5SA 1WDTA 4FYDA 2YKMB 3DOMB 1RGVA 3DNCA 4P2SA 4MU0A 1RQ0A 4F02A 1EETB 4C8OA 5F8JA 2BKOA 1RAEB 4B3MJ 1M1GA 1FESA 3QT7A 5LOQA 4Q45A 4UY8T 2PO1A 1W2IA 4HACA 2DB1A 3KLGA 3ZTOA 2DNZA 3BB5A 4L6V3 1WSVA 1KQKA 5EWEA 4OX9I 1B0TA 2ZBRA 4DL2A 5DG8A 3R7SB 4RW8A 4OZ5A 4NLDA 2XMWA 4WUDA 2ASLA 2V9KA 4ZN1A 3PR4A 4DR1J 1SJ4P 4K4ZA 2QYGA 3UR3C 4QR0A 3CJ2A 2B43A 1RCOB 2IM0A 4ZKAA 3H5YA 1CQNA 4YR2A 2CQ2A 3QO9B 3R5DA 1MW7A 2AYBA 5CYQA 4J9VA 3RR8A 4B08A 2EK1A 1YRXA 3R8YA 4HTJA 5L38A 5IWAJ 1HLWA 1RHRB 4USIA 3QLHB 1HFEL 2H4WB 5F3ZA 1K0VA 1RT1B 4LCHA 1XNQE 4OI1A 2Z8QA 4IFDA 5KFBA 1AUSL 3I0SA 2BXJA 1RHYA 1KNZA 3DLLQ 4EEYA 1FHTA 4X65E 3G71S 3L7PA 3OFEA 4FBUA 2IDEA 3CCVS 2MJUA 3IP0A 1TKXA 3CJKA 3ET6B 4K5RA 5M2PA 2PMWA 3OTEA 3U27A 5F9LA 4UQGA 3CCLS 2VOPA 5CA5A 3CIZA 2XSJB 4QPTA 4N47A 3TJ8A 4F4AA 1N88A 1RP5A 2JC0A 3OQ2A 1OQ3A 2VQEI 2R7VA 5A2QC 1VRUB 3KJQB 1N32E 2RS8A 2P6SA 3HSGA 2GS8A 4LSZB 3HHKA 5L1IA 5L39A 2F40A 1NCLA 3GJQB 3LGNA 3TO8A 1X5SA 1NB7A 1XNQJ 2KH9A 2WVDA 1RT7A 4IFVA 5L1LA 4FWGA 4DV0E 1D3WA 2HHHJ 4QNJA 4ZCKA 2MKKA 5KT5A 2OEJA 3A8EA 4RUAA 1M5VC 2DPIA 4B3TF 2D41A 4GMKA 3MI7X 1RAIB 4DUZJ 4C11A 1A7GE 5A76A 3N6MA 2VESA 1RT1A 2ABYA 3OR2A 5F8MA 3W66A 2W9BA 2KT5A 3BPSP 1SJ1A 2HMIB 1FD8A 1RAAB 3CTRA 1N34F 4E8UA 3OTOJ 4HHUA 4DG1B 4RUCA 4B02A 1TFYA 4B9MA 3CDEA 5IQQA 4ZIVA 2XZWA 3C8YA 3TX8A 2IRYA 4O3QA 3KK3A 3LGHA 2NN6B 4S0MA 3G6XA 4B3SF 4B9UA 4LFBE 1HHTP 2F8HA 2L9WA 3RBZA 2ZKTA 4OYMA 1FKPB 4RNHA 4HEA9 4NLYA 3OXFA 2HHUA 1C0UA 3FSYA 2HHQA 1XMOI 2BE2A 3H2VE 2NN6F 1HI8A 1X60A 4MYTA 3HT3A 2IHR1 4LF6I 2Q3PA 1XQIA 5ELWA 4X64F 2YXLA 4K5SA 3IAM9 2V8HA 3BSAA 3KXDA 4Y2MA 3TRGA 1PYTA 2YQ0A 2QA4G 1TELA 2GO9A 3K8VA 1NB2A 4DV0F 3NG8A 2KVQE 3MM7B 4LF7J 1IBKJ 1WI6A 1GXTA 2MJNA 3GWCA 4C2MA 1T9WA 1U09A 4CM0A 4M5NA 1VBZA 3LP1B 1MMNA 2N7CA 3CJ0A 1D9FA 2GW8A 1FRMA 1RHMB 2M3DA 2QC3A 3OTCA 3SV3A 1N48A 4EYHB 1X9WA 1N33F 1U6ZA 2F9JA 2H4YB 2WAQD 3BGUA 3S8SA 4TQSA 5L1JA 4J9KA 2CADA 5ETTA 2R2UA 1XMQE 4B17A 3G6VA 4JI4F 1VRTA 5KTQA 4OI3A 1KVJA 1IKYA 2GQQA 4NE9C 3WU3A 4LF6E 2C42A 2VFUA 8ATCB 2R7UA 5IT9U 3WC0A 4A8SA 1RACB 4A46A 1WC1A 3HD1A 3W2VB 1UVKA 4GC6A 2YH1A 1XNRF 2HFUA 1HWUA 3LF0A 1VQLS 1FXRA 1KWMA 1T0TV 2FZKB 1Y7PA 3B4MA 3RJMB 2W2OP 3M32B 5FIIA 3MDFA 1S59A 1Y00A 4LFAE 4O3RA 2HQ3A 3CDAA 1NHJA 1KLNA 1RWNB 2VASA 4PG7A 4QIWD 3T6JA 1I5OB 4JV0A 1T03A 3HULA 4FF3A 2KZMA 1T9YA 3Q8VA 3ZXWA 4ZP8A 1F9HA 4A8MP 3IG1A 4DR7J 2PEHA 4EGLA 3P3CA 1LWCB 1VOMA 3BSCA 4CO4A 2AD9A 2YNHB 2X3GA 5F41A 3DM2B 1FX2A 2A3JA 1HW9A 3EGVA 5CQGA 4DG1A 1ZTTA 1SL2A 4DR6E 1RUSA 3F73A 3BYPA 3ZZTA 4FYYB 2LP4A 5K8MA 2XMTA 4JI2E 2JLFA 1QLNA 2W9BB 1H98A 4RW6B 1REGX 2YQ1A 2CQHA 1J5EF 4K2XA 4FF1A 3WU5A 4DV4I 5B0CA 4IG0B 2F3JA 3DGPB 4OZ3A 5KFHA 2Z5CB 1I94J 2NS1B 4FXDA 3BGOP 1RK8A 5D4LA 2BQUA 3H7HB 2E5LF 4ZA1A 1LKZA 1YJUA 3NNHA 3D66A 1ZPVA 1RTHB 5FDLA 2WVEA 3WIVA 1IQTA 4L3NA 3CCSS 4JI0J 5I3UB 1OWXA 1HYSB 1Z5AA 4AFFA 3WX4A 4LPFA 1IJEB 1C0UB 1HWLA 3T1AA 1DTTB 4RUHA 4OLOA 3K7RA 1IKVB 2GA7A 1S97A 5KFTA 4ZN3A 4CZCA 4KH1B 3T5KA 4O44B 4LF5J 3BF4A 3MM5B 3RAXA 1QAYA 1FDDA 1U0SA 1R0CB 5F3TA 2HS4A 2BV3A 3W64A 4CLPA 3NKYA 2AZ1A 1VR6A 4RW4B 2BA9A 3EYZA 4HY1A 2XULA 3R5BA 4B3ME 3ET6A 2R8GA 5KT3A 3D1HA 4RL1A 2VJVA 3OR1B 2OO4A 4MU1A 1UFLA 3C15A 4WP8A 1C1CB 2LEPA 1VC6A 3GMEA 5AJ3F 1WHWA 1C0TA 5JVHQ 2HHHI 3FZBA 1WG4A 1CS4B 1KBRA 3EICA 1HMVB 3ZKBA 4HDHA 2FJAB 1FD2A 1KS2A 2A6OA 3MR2A 2HZCA 2FJXA 3HSJA 4WUBA 2DO4A 4J9RA 1IBLF 1HI0P 2HFNA 3I5AA 2JE6A 2JEFA 3MECB 3I82A 4DV6F 5KG6A 2E1RA 5B08A 2ZVIA 4USWA 1D9AA 2QLJB 2L08A 1P27B 3GILA 2BR0A 1FEEA 1XIQA 4LBIA 1SUQA 3THVA 3V6DB 2WNRA 4B3OB 1I94I 4GKJE 1S6OA 2G13A 4A8YA 1TU0B 4OYPA 1VQOS 4MJKA 5K20B 2BEFA 4OZNA 4ALZA 5K36B 4YY3J 4IKAA 5KG7A 5IOLA 2HKJA 1FWKA 2MZSA 1K1SA 3I4HX 4RW4A 2BRLA 4P74A 3EUNA 2P9EA 5CZVA 3VZHA 4AQYF 5CCMA 2V68A 1ZZFA 1PGZA 2FHMA 2DPJA 2HGMA 1V3SA 4ZP9A 2L9NA 2C37A 4JI0I 4N8NA 1IBKI 2PDAA 3GQCA 3PIOQ 2ZC3A 3Q8QB 2CPDA 2C2ZB 4C0OC 2ASDA 4FVCA 1SL1A 2Z57B 4ID5B 1PAEX 1RWKB 1Q7LB 1TL5A 3V4MA 3W63A 4DV2I 4DV7I 4UW2A 4DR7E 1XMQJ 5L3JA 4Y28C 1RWPB 1IBCB 1TKZA 3KUGA 4OO1A 1QSSA 5KFOA 1D8ZA 1SBRA 5KG3A 4Q43A 1QVFR 1P42A 4C3MA 1XMQI 3H2UB 4A47A 1JLEB 1JX4A 5BYQA 2VKZG 3RRHA 3IBWA 3UR0A 3CT9A 3EXYA 2HVDA 3F44A 2NLWA 3KK3B 1S9GA 4R0JA 1HD1A 5FLXQ 3CMES 1JLGB 3AY0A 3K57A 2LCWA 3IBCB 3IWNC 2R8HA 3F41A 2J0WA 1PO6A 3GG0A 2CPXA 3GCWP 4OJHA 3W2WB 2IJFA 1JLAB 4ICLB 5G4DA 4MKYA 3L7ZA 4JV5J 1LXJA 5C0XD 4DV5I 1NZ0A 2YNHA 3QAUA 1YJ9S 3UFCX 3K85A 4X65I 2DHHA 1HNVA 4U95A 1Y4SA 4M5KA 2MZJA 3RW6A 1MSWD 3T6BA 3DLHA 2F7VA 1BWEA 4DPTA 2WSEC 3DGPA 2H5JB 3FSXA 4X66E 5BR8I 2J5AA 3JB9k 2PO2A 2NCKL 3AT1B 4ZS6A 1KFSA 1GTHA 2VC1A 2UU9F 5KG5A 5KFKA 2IJRA 4Z7CA 4ES3A 4ECXA 3KLHA 2UUCE 1FJGE 1H7UA 2R8KA 2XO6A 3CCMS 1NKBA 2FLLA 2F4VE 3GLJA 2EFNA 2OEKA 3OPKA 3DDNA 1XC9A 4MIWA 1U1LA 2WNRB 5K9FA 1RABB 1WUUA 3M8PB 5A6PA 1IUJA 2HQDA 3KLFA 3Q6MA 5KFLA 2XS5A 1RTJB 3D7SB 2OPSB 5A0YA 3WIUA 3K2YA 4DV2J 4OYZA 2ASYA 5HP1B 1NDPA 4USHA 5F8HA 5H9FK 3CCJS 1S6PA 1VIXA 1XBWA 3PYEA 5E3RA 2CQCA 5C42A 4B9LA 1NO8A 3K58A 1RJJA 2B9WA 1OYEA 3TWZA 4BC9A 4WFBQ 3JQKA 2OEMA 4JI4E 3AA8A 1NHHA 2RD5C 1IKWA 1V5VA 2D69A 2MTLA 3C15B 3TARA 2DRBA 1SQGA 2CQ4A 1BD6A 1SQFA 3B8HA 5B0DA 5HMZA 3UNYA 1LWXA 3KUEA 4IZJB 2K3KA 1MX0A 1CPZA 4PRVA 1RREA 4CRJA 5HL7Q 1IBMI 1XTZA 4LMZA 3PKYA 4F26A 2B4OA 3G8QA 4YB5A 2NQPA 2YTCA 4ZPAA 4IRKA 4YY3E 2WB1D 1HBOB 3TVKA 4LF9I 1FA0A 2W1BA 1NHVA 2P6TA 4PWWA 2WRMA 2AEJA 1R6MA 3PJXA 1DTTA 4DUYJ 2UXDF 2BKNA 4KFBA 4X4QA 3LNUA 1ZAWA 3N5FA 4IFDF 1PKPA 5MLCV 1U1KA 5LL6R 4KO0B 1ZXNA 4FKYA 5CH7B 5KFCA 1ZXMA 2HK3A 4ZCMA 3MFIA 2MQLA 1N36E 1F0XA 4G6VB 4CDIA 3H8YA 2RH3A 5L46A 2GMLA 5K36E 4U67Q 3J81U 1PSDA 2B4VA 3ILLA 4Y34A 2EFQA 4RKUC 5HBMB 1N5TA 1S4FA 5IQ6A 4DR5F 2OUGA 2WCXA 3POTB 3BR9A 4X65F 5M2UA 2DVIA 2MXYA 3MPUB 3DMJA 3PVXA 4DV3E 2QA2A 3SDEB 1LWFB 2ZBKB 5JEAC 3MMJA 3OVBA 5RUBA 5T7LB 4DSKA 4IS9A 3PZPA 3A8IA 2WOMB 2ZJPQ 4LF8E 3GLLA 3UWTA 1KLMB 2NPIA 3BO4A 2UUAJ 2JC1A 2N3OA 4PABA 4USUA 1AUDA 1L5UA 4FW9A 4DSEA 4ZPCA 4DWIA 3NMRA 1WWHA 2APOA 1XWLA 1HWKA 1VQ9S 1F5CA 4I56A 1OYDA 2GFFA 1CJVA 1JXEA 2YWGA 5CABA 1KVKA 3R5AA 1KFDA 2ACMA 4ITSA 2FC8A 1ZAVA 6FDRA 1Y9OA 2YKQA 4GKJI 1N52B 4YHHJ 5LMNF 1WELA 2B9YA 1VC5A 1M5KC 4DV3J 2GQCA 3FVYA 4J91A 4TVAB 3QWPA 4H4KC 2XMUA 3HJVA 1HBMA 1N5QA 1WF1A 5A8WA 3EWGA 5JVGQ 1PC5A 5HSPA 2O1TA 1HNZJ 5AE3A 1DRZA 2J76E 1G1XA 3QIPA 1N54B 2IIHA 3THPA 2Q6BA 5C42B 3A4TA 1U48A 1B64A 4J3DA 3BBBA 3HKZD 3PFOA 2D3OR 2X51A 2HNYB 5A8RA 1VHIA 2EWHA 2KM8C 2J0XA 4EMDA 4EUVA 4DR3F 3PV8A 4HKQA 5D4OA 5C0XC 4NZ6A 1BMQB 1NEEA 3HHLD 3TX0A 5B09A 2L41A 3QSYB 1R6YA 4DV2E 2L3MA 2HVIA 4PR6A 4HI2A 2ROGA 1C1BA 1H38A 2KXFA 1SQEA 3BN7A 1Q86T 1KC8T 4JV5I 2DCLA 4ED8A 2RUGA 4HDGA 2A2DA 3FFIA 3NWGA 1E6YB 1MWYA 2FJEB 4CLYA 5I4MA 3G8SA 4H4KA 3SCIE 4DV4J 4I2PB 4DV6I 1JLEA 3CD5A 3M32A 5SZTA 4KAIA 4ECUA 2K8GA 5BR8F 4C98A 4NLUA 1Z0TA 3GFZA 1VQKS 4PG6A 3K5LA 2ZUAA 2UUAE 3KHRA 1RT5A 2QX0A 2XCPA 2FY1A 2BR2A 4HLBA 2FHKA 2Z0GA 3BM7A 3MHYA 1KDNA 1IKXA 1S1VA 2HBYB 4X84A 4IRCA 4GKKF 5L9XA 3RGIA 1X4CA 2UUBF 4K4YA 3Q22A 4QPXA 2VOOA 2XYHB 3NL0A 1N5VA 3W3SA 4QU7A 4TXSA 1Y6ZA 1WACA 3DRPB 3CDJA 4DR6F 1RADB 1X4AA 5E7OB 4QR2A 4AIMA 1QDUB 1RTIB 3OLBA 4BS2A 4JI2F 4BDPA 2CIMA 2B9XA 5DDQC 4JI2I 2BE7D 4ZDNA 1CC8A 2A0FB 2KXNB 1ITPA 2JLEA 1EB0A 1RT2B 3EZUA 3IA0A 3JYTB 5E33A 1PYOB 1VRUA 3AXMA 4QIEA 1UJ4A 2DNRA 3G8TA 1HPZA 2JEGA 1XNRE 3UDLA 3GIIA 3PW2A 3RB0A 1UDQA 2E1AA 1DJ0A 4A8WA 3H5XA 2W01A 4DU8A 2HHXA 5EX0A 2XLKA 3MXHP 4Z7YA 5GAGI 2RQ4A 2AV5A 1BE4A 1YRTA 4KY3A 3R5JB 4USTA 1HBNA 1X31C 4X66J 1HQUA 1UWBB 3QRQA 1OY9A 5ETRA 3OSPA 1N5YA 1Y11A 2EKYA 5DDPC 1YZ7A 3IS9A 1TUWA 5B0AA 5DO2A 3MUTP 3Q23A 4O0NA 9ATCB 3DLBA 2R7SA 2E5GA 2G2YA 2B8PA 3IR6B 4K4TA 4DR2J 2Q6CA 4C97A 3QGPA 1D8YA 4K4UA 4U7UK 3QO9A 1F1BB 1SC3B 1UJ5A 2EXUA 3CDBA 3QGGA 1X4BA 2HNYA 4WFYA 3P8BB 4R8UB 2AE8A 2Y1RI 2HRUA 3IGVA 5A8KB 5AXMA 4J9OA 2RQCA 4X4UA 1NRKA 2AW0A 2AEMA 2OMLA 1S1UA 3QIPB 2HQCA 1FCAA 3OHBA 1NSAA 3QJLA 3SBMA 4A8KA 4DV7E 4AM3A 1IR0A 1UWAA 2JZ5A 4H4OA 2SXLA 1U2FA 4I68A 3D5MA 3ITHA 2VG5B 3AFGA 4OI2A 4KH0B 5I3UA 1E3HA 3AB2B 2KU7A 5H9EK 4XDDA 3DLGB 4F0KA 2Y1JA 2F1DA 1NZAA 2K7JA 2D3ZA 2IYIA 1W25A 3LP2A 5D0RA 3BV8A 1C2PA 3MMAB 2QMXA 1H6KX 1QUPA 1Z5CA 1HNIB 1JLFA 2M52A 4IO1A 4X62I 2VFRA 4K4XA 4FWDA 3P76A 3KHLA 2X36A 5AE2A 1H0HB 2DJWA 1S1WA 3AAWB 1R89A 4WFNQ 2IVFB 2C22A 4ELUA 4NBQA 1OMSA 2NPFA 3T1HJ 3IRWP 1Q8LA 1NSKL 2ZZMA 4WUCA 3SMZA 3A8JA 3DLEA 5E3CA 2OIHA 2VL1A 3GR1A 3KHHA 1RWOB 3JS9A 4G1QA 1IVZA 1YLXA 3FBEA 3HVTA 1JB0C 2CJQA 3AJ1A 4OYAA 3POTA 3W9JA 3BJYA 2M5YA 4DJBA 3PS2A 1NMEB 3BGFA 2ZD1A 1LW0A 3NCRA 4ZPDA 2C2RA 2N4DA 3I9V9 5DNXA 4FNHA 3Q6NA 1ZM4A 2ZUGA 4HT7A 3BPDA 1K9MT 4DQIA 3DC2A 2GHVC 5EKWA 4Q2LA 4IZJD 1EJ7L 3HCXA 2NXUA 1LNQA 2XS7A 3NWRA 3EVWA 4UUXA 4OO1F 4CP5A 4L75A 3FFIB 1RU1A 2B4PA 3ISND 4QIVA 2M9KA 4OO1D 2AX0A 1WD6A 3GV7B 2G1DA 5KFGA 2XYPB 5C24A 4QCLA 3WU6A 2XB2D 4ED2A 4J9MA 4XPCA 4ZHRB 1YJNS 4RW8B 3KJFB 4OI4A 4JUZA 1F5BA 3UCUP 3HJFA 3VALA 1HL6A 2AEFA 2YH0A 4X4RA 2W9CA 2ZH6A 2V2VA 3H90A 4LF6J 1O5JA 1JLAA 1T9TA 4ICLA 2G0JA 3AQOA 8AT1B 5J2MB 4DV1F 2RF2A 3V81B 1U1NA 5DNLA 2D9OA 3DM2A 2LXIA 1FDNA 3A12A 2VZ9A 2DEIA 4B9TA 2XMJA 4X62J 3QT5A 2O3DA 4J9NA 4IR1A 1PJ7A 3L95X 2DXFA 4FZVA 3P06A 2FVQA 5BYRA 1Q78A 4X66F 4IOBA 1Y60A 2HWTA 2XBPA 2J7KA 2LXUA 2FC9A 2QA1A 4I4BA 4C8NA 2IBOA 3FNNA 3MGJA 3NGTA 1E6YA 4KE5A 3NP5A 2Q66A 2QMUB 4F0HA 3DRRB 3BEGB 3DXBA 3DXSX 1HYSA 1Q82T 2RDJA 2Y3YA 3MM8B 3DRSB 4ZLLA 1JLGA 1LWEA 1WDDA 3N0VA 5C25B 4RZRA 4DR4J 3NCQA 3M8RA 1TK0A 3W61A 2OGUA 3M8PA 2EC0A 4MK9A 3K0JA 3QYYA 3U1LA 1S77D 2JL9A 2C2EA 1WG1A 2I5JA 2WONA 2VJUA 4ZVSB 4AE5A 4R1FA 1X4HA 2C2NA 2RRNA 3KYLA 5E5NA 1IKXB 1S1VB 1UA0A 1EIYB 2YPZA 5J1EA 2PD1A 2CWXA 3MD3A 3UCGA 2MKCA 3BO2A 2M2BA 2W9AA 2QLXA 5HATA 1U26A 3ENAA 3J80Y 4AQYE 1CLFA 3ETOA 2HS3A 2CPIA 2BRKA 4LVOP 1CJTA 3PY8A 3MMCA 2ADBA 4CYUA 4DQRA 1NJYA 4U7UD 4X4PA 1Z0WA 2MB0B 2WBRA 4LFAJ 3H4DA 4NLOA 3SSQA 3NGSA 2C38B 3J7A1 3J7Z5 2CZVC 2Y0BB 2UXCI 3P3DA 4ZP7A 1L3VA 3EGNA 4ZVRB 2JH3A 3HFKA 4R25A 3TEGA 3Q0AA 3UCZP 5I42A 1YJTA 3DRRA 4XAKA 4KHMA 5HI7A 1X5OA 2IC3A 3LP0B 5CD4H 5LXYA 4LUBA 2UUCI 2WP8A 1TUGB 4C0HA 1T9VA 3OW2R 4XTJA 3PRVA 3WQPA 4OX9F 3T5HA 3CE8A 2OPPB 3SYZA 2CJAA 4LCGA 1U1PA 1MU2B 3CMAS 4JYAJ 1S5ZA 1UEUA 2CJYB 3BDEA 3TAQA 4Y6IA 4F67A 5KAKA 4U3DA 3ILOA 3TUPA 1TL3A 2G0CA 4B3TI 2LEBA 3PX6A 1PAUB 4I7FA 5KFAA 2HVEA 4AXJA 1M5PC 2MQNA 3SCJE 4XO0A 3JTNA 2F4FA 2RDIA 2CXEA 5ETQA 3RW7A 5T41A 2M0GB 3BBFA 4Y65A 4U8VA 4YEAA 4MKAA 1RKIA 3H4BA 2P5VA 3LP2B 4M5MA 2IAJB 2ZH8A 9RUBA 1HBOA 1ZA1B 4GKJJ 1PBAA 4QW8A 2DNGA 1YRUA 3QSIA 5JMNA 1W26A 3KDNA 4G65A 5DQHA 5GAHI 4LREA 2VQEF 4M5JA 3CO0P 1RBOB 4FKXA 3HI9A 4B3RI 3KWMA 1Y5LB 2IBKA 3VAFA 2W24A 3GP9A 1DZ5A 1UVJA 2RIJA 3HP6A 5LMNI 2UXDE 3DLKB 2HHSA 5K8PA 1NSQA 2CZ4A 2FHJA 1IM6A 4XDCA 2IFXA 4GVBB 4USKA 1K8AT 1S9EA 2HZVA 3EM1A 4G1QB 1LWCA 1K73T 3PRDA 1UVLA 4NXNJ 1VRQC 5D0GA 1OYSA 2IMOA 3QZ8A 3SFUA 2JEBB 3UE2A 4DUYI 5J1EB 4IFDD 2N82B 5KFZA 5IFMA 2XQCA 1M90T 3KJNB 4FW5A 2PE8A 1R3NA 2NXJA 3UN2A 2E29A 4A8XA 4ANCA 2CG9A 2HEKA 3D68A 1GXLA 2LVWA 1FE0A 1J5OA 1BQMB 2AP6A 2Z2LA 5I42B 4RBUA 4I67A 2YWEA 1R8PA 4LR7A 5JEAD 1DBDA 4DZDA 3GCMA 3JAMU 1BLUA 1NK0A 1VQ6S 3MM8A 4NLGA 4NYZA 1Y0HA 3ZNUA 4QW9A 4WWSA 2W8KA 4B3RF 4B3RE 5IT9Q 4QZVB 1Z4UA 4B9NA 1R8HA 3NXZA 1FKOA 1XJWB 3T9ZA 2AWZA 2GC8A 3SSRA 4NA2A 3VR1A 2R2RA 3BQ2A 1HHQA 4MIBA 4ECYA 1WEXA 1G4CA 3L09A 3JSRA 4R0EA 2DR6A 4J37A 5G0RB 3UNGC 3V6KA 1TKDA 3G96A 1H74A 3LANA 3IXQA 5K14B 4DCPB 5K36F 1HQEB 4P2FA 2CZ9A 4IRDA 2OI2A 3BQ1A 1NDLA 3IGNA 1SJQA 2MKIA 4DR5E 2IRXA 2LU2A 3N28A 1ZM9A 4ECTA 2HBQB 4OHZA 2V8VA 4RR5A 4C3KA 4ETZA 1N6QB 3H4LA 1FRXA 3L7UA 4A8OA 2PI4A 2VG6A 2AX1A 2GIFA 1SPBP 4CLSA 2XO7A 2Z5CA 4F3OA 2XNRA 3UHMA 2HURA 2ZM6E 4FW6A 5C25A 5D8HB 1CJUB 2AT1B 3A3NB 1B7YB 2DR5A 1NK7A 1RB0A 3R6LB 1EKSA 3G82A 1XN9A 5J2QA 3PW5A 2YPYA 3I0RA 4WK1A 3ZZUA 1M1KT 1U02A 3AOAA 2QYCA 3NBPB 3H20A 4FDFA 4Y00A 4ER8A 2VV5A 1PJ5A 1FFWB 3O3LA 4GO5X 5DETA 2VA2A 3R2CJ 2YWWA 4OIXA 1RYSA 2LQBA 3JAMY 2R7OA 1H7SA 3NGDA 3TANA 2HLTA 4ZVTB 3M7ND 3DHWC 3N5BA 1HR0F 1UVNA 3J7YI 3HT0A 3L7OA 1TL7B 5E41A 2W4PA 2CQGA 2QFIA 2YNGB 4G1PA 5GADI 4MH8A 2ZH1A 1T05A 1X8DA 2J0SD 4KHPJ 2Z5BB 2VPXB 5DRRA 1RTJA 4WYWA 2F63A 2LECA 1NNDA 4OX7A 2RJZA 5AXLA 3EMTA 2DRAA 3V4IA 2F4VJ 4I3HA 1S6PB 2J9DE 3NLCA 5GAGU 2DR8A 3SV4A 3JAMQ 2FPHX 4KHRA 4KGMA 5DGAA 5A2QQ 3M6WA 2H9ZA 3RRKA 2IAJA 4JV5E 4OZLA 3OJUA 4LRAA 3US5A 2JHEA 1RTDA 1BQXA 2PO2B 5EX3A 1KIJA 2BM1A 3NAHA 2H48B 2YVSA 2VC0A 2NZCA 5D6GA 2GHWA 4DL6A 3ELHA 3RTVA 1MNEA 3OXLA 3UO0A 2HQFA 2MGZB 4JI2J 3FQKA 4KQZA 1IWGA 1SCJB 3LUYA 4QWCA 4DR4F 2UUAI 4DR6J 1RSCA 2ZKUA 2ZOMA 3A3PB 4P2XA 4C3LA 2VONA 1GX6A 4RBTA 2UU9E 2BE9B 2JWNA 3KNGA 2AJFE 1P8GA 3TOQA 4B9SA 3M30B 4C8YA 3L4BC 3HD2A 1ZM2A 4DV1J 2FB0A 3DDKA 4FF2A 1EQ0A 2G0IA 2R8JA 1X9SA 3D9BA 5FD1A 2A2CA 2D3O1 4P10A 3I31A 4F4YA 2E5IA 3CJTA 4PG4A 2E44A 3CJKB 2NZ4A 5C0XF 5C0XE 2CPJA 5GADU 1EZZB 5A6WA 1P1TA 1RA6A 2ILYA 1JLBA 3ENVA 1N34I 2F9DA 1RE1B 5HMWA 3QIDA 3GIJA 3GFXA 3A3OB 1ZS6A 3BH7B 1OJ4A 4LT6A 4WFAQ 2LJPA 1AZSB 2LU1A 1FJGI 4NLPA 2HMIA 3EZOA 2K06A 2PFFB 4URSA 2HHVA 5IWAE 2AJ0A 2JEAA 1MN9A 1R8AA 1WF2A 1NPRA 4K50A 1Q0NA 1HNZE 5FJ4A 4LFCF 2HZAA 3TA2A 4BA1A 3FBCA 4H4MA 5JEAB 4PPDA 4B9VA 3CCRS 1GQEA 4DEZA 4P73A 4OHVA 4CCHA 3T1YF 3CCZA 3CD0A 4DL4A 5J2NB 2B7CB 2BW2A 1RWXB 2KTQA 3BSNA 1GX5A 3VTIA 1S1TB 2DHAA 3FUYA 1S48A 4ZMMA 4QJVA 3M30A 3T1HF 5JEAF 3M9MB 3M9OB 4U6PA 1L3TA 2BA1D 1FJ7A 1RT3A 2KB2A 6FD1A 1G7CB 2ALYB 1C4CA 4O4GB 5K5MA 4DR6I 4LF5E 4LF5F 2L48A 4ZIWA 4CLTA 4DL5A 2PN6A 4QYZJ 5HBMA 2RB7A 4WK3A 3RBXA 1RDRA 2ZZNA 1IWAA 1KN6A 2W8LA 3SDEA 1Q5VA 2EFVA 4KGXB 5B0GA 3HSDA 2XCAA 3CCUS 1XK8A 1DAXA 1SIWB 1IQZA 2EFPA 4TYBA 3RAMA 3QZ7A 2HSEB 2ILZA 5KFIA 1RTDB 1MROB 4GC7A 3I0RB 3W9HA 3QJPA 1IKYB 4DSJA 1XR5A 4C7QA 2GMHA 2OPQA 2KFYA 3CJ3A 4M5DA 2I0XA 2AHOB 5J2MA 1QAIA 4ZVFA 3OL8A 3BGRB 4ELVA 2E9TA 2W2MP 2CRLA 1FJGJ 1QUVA 1S7IA 1SB6A 4JI8I 4HT5A 3VAIA 4LF8F 4PWDA 1YIJS 2PNMA 5EHHA 3VGVA 2V2KA 2XMAA 3VF0B 2A18A 2VPYB 5FLXU 1B3TA 4LFCJ 1S7HA 2HQGA 4R5PB 3KG1A 2KJVA 3E3XA 3GYGA 2E7WA 1Q16B 4PG8A 2ERRA 4Z2XA 1RLDA 2CPZA 3M2RA 1DQ8A 3JSBA 4PXDA 4TQRA 3FMWA 1RT6B 3CW2C 3J7YU 3GMGA 2ZH4A 1RYRA 2IOPA 1XERA 4IR9A 2QL7B 2X1AA 4RBVA 3BQ0A 5KFRA 1ACMB 3TZXA 1F9EB 4ED5A 2VG5A 4DR3I 4CO3A 4CH1A 4CLLA 2CDRB 3HDSA 5BJRA 1N8RT 2AKWB 2O66A 2VU5A 3M1VB 4HHHA 5LSRA 1NM2A 2AYMA 2DO0A 2IMWP 2E9RX 4F3QA 4LF8I 2LEAA 2W2QP 3H59A 1BKNA 4CT8A 3K89A 4DV1E 1C4AA 1AT1B 4DCJB 2D1CA 2DXDA 3OT9A 4DL0C 2HYIB 1IXKA 1HBUA 1AA1B 4NEYA 5B0EA 1OYPA 2QG9B 3GIKA 1XHKA 2PC6A 3JQMA 4G1IA 5J2NA 4YB6A 2AYGA 4HH1A 4HL9A 1S0MA 2GAHC 4OJ1A 3PXGa 3Q8YA 2CPEA 3V81A 1NK4A 2R7XA 4FYXB 4RUBA 1SJRA 2H1YA 1NHUA 2HNZA 1T05B 4ZPBA 2HAFA 2NYHA 3R5GA 3OTDA 3Q2TC 4JYAF 1SJ3P 2BR2B 5EUHA 1NDCA 4DR4I 1TQLA 2YKOA 1TTHB 4MU3A 2BVZA 2O67A 4ZLPA 1RT4B 4XPEA 3M6AA 2KHCA 4KGKA 3H2LA 1PYSB 3G6YA 1JLCB 4DV0J 1B99A 1FEHA 5KOWA 3MR5A 2AGPA 4LF7F 1Y5YA 3U02A 2M70A 3IN5A 2JLGA 2WW4A 4DOZA 2Q2EB 1TMJA 2XY7A 1KEKA 1WOPA 2Z5EA 4JG4A 2ZVSA 1IBME 4DR7I 3I9ZA 3PRBA 2VD3A 1KQFB 2F4VF 1OPIA 5ETOA 1DTQA 5AT1B 4U7CA 1VC0A 1C0TB 1QZRA 4FP9A 2GVZA 4GRSA 3Q1QA 3ENQA 3T5JA 2MSTA 4DR3J 2IRUA 4LFCI 2XGPA 2WK4A 2FLOA 3RZAA 5JEAA 2UXCJ 2WONB 4LF4E 4OYBA 3MR7A 1ZA2B 5CYMB 2IDLA 3W5XA 4LF8J 4O3NA 2J6TA 5D3GA 1HNIA 1OS5A 2XI3A 5KFQA 3PW4A 4KKOB 3P3GA 1HBMB 1LFWA 2BJEA 3N4WA 1JQGA 1UETA 3FK4A 3QQCD 1P9QC 1S99A 3HHEA 3Q8RB 4NLWA 2G4BA 4KPCA 1FJGF 1IR2A 4PWDB 4F36A 4DV5E 1Y4ZB 1FRIA 2MKJA 4AYBD 1HHSA 4USVA 1VLOA 5KG2A 1ELOA 4J90A 4IDKB 3D67A 1VISA 2G2ZA 3IC1A 3GYXB 4ID8A 1YZ6A 4PCQA 3S7RA 4N8OA 4YHHE 2G2OA 4X4TA 4OO1B 4TU9A 2BJ3A 1D6TA 4OFZA 4JI5I 1R8CA 2CPYA 2OELA 5KFUA 4CM2A 2QV6A 1X9MA 4RU2A 3OBIA 2KVIA 2VF3A 3LPSA 4H54A 4M5DB 1NZ8A 2DISA 2DNMA 4DUTA 4DLGA 2QSWA 1DY3A 4NI2B 1RBAA 4CNZA 2NXEA 2VG7B 4OV6A 2POKA 5B7WA 5KFDA 2BMBA 2C28A 1AYEA 4H4MB 1JWWA 2XG8A 4X65J 2WSFC 4OYWA 1Z0BA 2HNZB 1IJFB 2DHXA 2HWHA 4L3KA 4JI4I 2MKHA 2UVWA 4NCGA 3T1YJ 3FSIA 3I5BA 4WJBA 4WTYA 1YGYA 4PEOA 4KT0C 2MQQA 4Q5VA 1FNOA 5IWAF 2XY6A 3LOUA 1VQPS 1UTAA 2D74B 4AT1B 4ERDA 1VYAA 2WB4A 4P52A 3H25A 3OD2A 4DUYF 4P7TA 2OPRA 3CNQP 3ISNC 2FY8A 4HR2A 4NZ0A 3M1VA 4OZ0A 4O3OA 2ZH5A 1IBLJ 1OQ6A 4FW4A 2DH9A 1VQYA 2ZD1B 5J2PA 4RNFA 3ISZA 1FXDA 3KFWX 5IXUA 5KFPA 4RU9A 3KLGB 3M8WA 2H51B 2YNIB 3KMSA 4LQ3A 4WE1B 1S6QB 4DZ6A 2KFZA 4B3MF 1MU5A 1FT8A 1TKZB 3C6UB 1LQ9A 4NEZA 2UUBE 1BY9A 2EEYA 4DCOB 4P72A 4ZVEA 1VQNS 2E9ZA 2YKAA 1XMBA 5CYMA 1VQ4S 1USUA 5H9FJ 1RAJA 3ZTRA 5DM6Q 1DLOB 1EHWA 5DQIA 3QRRA 3W62A 3GSIA 1YJWS 1JLQB 2EKNA 2JRSA 5KFFA 3ZKDA 2C1EB 4MKBA 4XTTA 4ZCIA 3D6MB 5IS2A 1MN7A 1NXIA 1FJCA 1N36I 1RBLA 2AJ1A 1GTEA 2ZDPA 3RYLA 2MLYA 4UOHA 1X5PA 2RRBA 2RF2B 1M0SA 3I96A 4ATNA 4D3HA 2RU3A 2BDPA 4MU4A 3B4DA 2WW8A 3DOLA 3CULA 4LF1A 2PA8D 3O44A 3SEOA 2OSQA 4JI0F 3CWJA 3PEHA 4H4OB 2MZRA 3BR8A 3TJAA 4E98A 4Y3CA 6AT1B 1EARA 4TU8A 1I6JA 1L3KA 3QBCA 4UOFA 2GMJA 3PYGA 2J65A 2RU9A 2ZOGA 1B7FA 4J7CA 2NN6A 2J6SA 2JDJA 4QOTA 3I4PA 4NMLA 4JB8B 2AF6A 2PMHA 3KRNA 1T11A 3I87A 2BM0A 3QFHA 3GJRB 3KMQA 1IBLI 3M6XA 4ZP6A 1JNRB 3AD7C 1WC3A 3W8PA 2VBXA 1HD0A 3GB0A 3QATA 4QIFA 5KT4A 1FVSA 1RKJA 3A1YG 3ZC4A 4ZJQA 2E5HA 4LFAI 3MEDB 4M8LA 4Z37A 5C5JA 2R4FA 5HP1A 2RILA 1RWUA 3C66A 2UV8G 2NUHA 3M8QA 2KG1A 2UU9I 2I9SA 2CJ9A 3PCOB 2KN4A 3NEKA 5J1NA 1OY8A 5DROA 4F25A 2DKOB 5EN1A 1O8BA 1U0HB 5D0HA 2GX8A 4O3SA 4M63A 4JI6I 4QQBA 1S79A 5L8RC 2F8EX 4Y0FA 2UV8A 5IT9Y 3AJ2A 2ZM6I 1MWQA 2MYFA 3OL6A 1EAYC 1UDSA 2DGVA 3NGRA 4NZ7A 4RWWA 3DLGA 3HFVA 1U6FA 1ZAXA 1W7WA 2YY3A 4KC5A 1ICEB 4Q2MA 2ZHAA 4LFAF 2BOAA 4X4VA 2ACYA 3MM9B 5DRKA 2XI2A 4UY85 1OYRA 2LDYA 3D28A 4OZEA 3V6HA 4JYAE 1SJFA 4ILLA 1ROFA 2Z2ZA 3M8ZA 4LIRA 1K1QA 2X1BA 1RTHA 3U7JA 4JI1E 2JOQA 1YJVA 3MEGB 5DLFA 4DX5A 1NJWA 4CI0B 1U24A 1FKOB 1HNZF 2B0GA 2QJ3A 3FKBA 3UDEA 4EK2A 1UFWA 4JI8E 1DHMA 4DN9A 5LXRA 2UUBJ 2MSSA 2C39B 1O51A 2GQ2A 3DLEB 4W90B 2DNHA 3NRBA 1LEOA 2KT2A 3DGVA 2A1BA 4OJGA 5LMNJ 4OO1C 4MAKA 3AB4B 4YS2A 4NL5A 5A8WB 2PNZB 3ZZYA 2AIRB 2VUGA 1G6BA 3KKFA 5JUMA 1NK8A 4B3RJ 4E2FB 2B4UA 2I8EA 4F7VA 4LF2A 1U0HA 1CQMA 1AB8A 2MQMA 4YN3B 2PSZA 1K0TA 1R43A 1BUXA 2EFOA 2N4CA 4DV4F 1NUEA 4E0DA 1S16A 3J81Q 4URQU 5HK4A 4DV6J 2XHWA 4CIOA 2XWXA 1QVGR 3PS3A 4RPFA 3Q83A 2DGXA 4HACB 4AL7A 1K47A 3QRPA 3MCNA 1KOOA 2EVZA 1S4EA 1TL4A 2HRTA 2YNIA 4LSLA 3V6JA 1W2BR 2H3EB 2FDNA 5LSOA 2MKSA 1X4DA 3IFEA 5IV3A 1U1OA 4PQUA 1RHJB 2HVHA 2PT0A 3PX0A 1YBUA 4DR5J 1HPZB 2X3DA 1J5OB 1NBEB 3C6TB 1P9YA 3GR0A 4ED4A 1MWZA 2CG4A 2E7VA 3HHDA 1SV5B 2W2PP 3ETMA 2KO1A 2VBZA 2HVZA 3MAAB 4FYWB 1EP4B 5ETPA 3SIPB 3MUVP 4DUZF 4DFPA 3M8QB 4DUZE 4NXMJ 4K4SA 2WP8B 2YNGA 3O8WA 4DPYA 3J7AM 4X4NA 1OY6A 3OUYA 1RT5B 3FEYB 3KJVA 2RE1A 4B3OA 1DFDA 3GJTB 1VIOA 3ZZZA 2MKYA 3DD6A 2BABA 3VVUA 3R27A 2UXDJ 3NS5A 2WVFA 3LGMA 2J7WA 4OJ3A 4PAAA 2UVRA 4OZ2A 2VQEJ 1TK8A 1LK5A 2CNNB 3OL9A 2DGTA 2NXCA 3FGVA 3D2WA 4IFDB 3K5NA 4YR3A 3K5OA 1HMVA 2IVMA 3UI3A 3RB4A 2DNQA 1WHXA 3CD7A 1YQHA 2H5IB 4K2JA 4C0BA 4AL6A 1RT6A 2DK2A 1VQ7S 4K0KE 3CD6S 4ZPVR 1RISA 3G4SS 5LMUF 3HX9A 3BH6B 4TN2A 3UN5A 3Q24A 1QSYA 3QGIA 4DPOA 3LTOA 4Q0BA 3B4TA 2AJ4A 2BX6A 3EJMA 1QD1A 1FKPA 1UFKA 3IR7B 2BJ7A 1DQ9A 4BCAA 4ECRA 1YG0A 3EE3A 3PG9A 1FRJA 2ZBPA 4ED3A 1S9EB 3M9NB 4LOMA 4KBIA 3FRYA 5CYQB 2PIIA 4YP3A 2J8AA 4DUZI 3VAKA 1T3NA 1L3SA 2E1CA 1JLQA 2RNEA 3DLKA 5C2CA 3LH2S 2KL8A 5D77A 2N3LA 1SUQB 3I56S 2OJ3A 2KG0A 4XIUA 2XHCA 4PRXA 5ETLA 3G6ES 1J5EI 1FX4A 2KHDA 2VFSA 1S57A 2PNLA 4OLPA 2DXEA 1WF0A 2DNYA 4KB7A 3ZFVA 1JXLA 5F0UA 4OO1E 3W1YC 4J9LA 3UVJA 2CFXA 4BA2A 2Z4PA 1JJCB 2XY5A 4DR1I 2ZFHA 1XXEA 2AQ4A 2ZHBA 4O3PA 1CS4A 2CWKA 3P45B 3P5TL 5L1KA 2NN6D 1N34E 3DOMA 5HQLA 4FYVB 4QWDA 4CH7A 4YB1P 2GVDB 3AXKA 5HJYA 3VWSA 2EI5A 3DOKA 5E3AA 4NLVA 3LO3A 2OFGX 3DRYA 3J80U 2IOQA 3R1HA 1UPPA 3BYRA 3MPVA 4QYRA 2DH8A 3MEDA 3M6VA 2WHOA 4ILMA 2JEJA 4ES2A 5B0BA 2CDQA 3L3CA 4KRWA 4UUWA 4NA1A 4MTPA 2R2SA 3OUYB 1RHUB 2PMZD 3WC2A 3GIRA 4WXWA 3TUJC 1O6XA 2W4DA 2YX1A 3NS7B 4ES1A 4HYKA 2RMLA 1EP4A 3VQSA 4KHPI 5K36A 2EW9A 1SC6A 2X1FA 3KG0A 2OP5A 4NRTA 1TL7A 2BBEA 2XZDB 5CCLA 2M8DB 2DRDA 4DV7J 3V5RA 3NGUA 2UXBE 2GJIA 1HIYA 2VH7A 2VA3A 1RT4A 3M2UB 4U96A 4ZVHA 5IV4A 1HKAA 5LJ5Y 1VJQA 4O23A 1I3OB 2DD8S 4EZ9A 4GO7X 4DR2F 1XNQI 2FUG9 3Q8UA 3PJWA 1R7IA 3J81Y 4NOHA 3LW5C 4XK8C 4DFJA 1HWJA 1RZMA 3TA1A 2ZHOA 4CYUB 3G82B 4MMOA 1EX8A 3SQOP 2DR7A 1WOOA 2OH2A 2Y8WA 4N56A 2DY1A 2KRRA 4JI5E 2IESA 4V19X 4DX8H 5IM0A 4OZJA 4RW9A 3RU0A 5KFVA 2MLZA 1NHKL 4J9QA 4URLA 4X64I 4CTAA 2GVZB 2IM3A 2J9EA 1S1WB 1JNZB 2M4MA 2KYZA 3F56A 3IAS9 1CC7A 2GV1A 1REVA 4KGVB 2ZE2B 4NWBA 4X62F 3LAMA 1NJZA 2WVBA 1N34J 4ENOA 1QM9A 5HO4A 4KHPF 1FDAA 2CPFA 1OSDA 1YDLA 3KHGA 3SFGA 1NKEA 1HR0J 4W4MA 4LF6F 1Z2ZA 4JV5F 2OSRA 2LQJA 3WHIA 3ILIA 5F8GA 5BR8J 4RWXA 1SH0A 4F4ZA 4IOCQ 1NH7A 1VK3A 3IO1A 4DX6A 3CJ5A 2MQ8A 3MM5A 2L9DA 7FDRA 3MM6B 3T19A 4DQQA 3J7AN 1F6TA 2K1RA 5AE1A 3GJSB 3HZEA 1SH2A 4TNOA 4DF8A 4LF7E 2D3UA 5CHCB 1QAJA 4I2QB 2C3MA 4LRFA 1KQSR 3CJSA 5GMKa 3GV8B 2FLPA 4L73A 4PXBA 1BQNA 3HVWA 2P9CA 4CLFA 4IQXA 1H73A 2B3TB 1H72C 3GE9A 5E3QA 2MQOA 4N76A 1VRTB 3Q86A 4P71A 5FWKA 2RT3A 4IFDE 2ZBIA 3BREA 4TYAA 1QAXA 4EZ6A 1KLMA 4LSNB 3J81C 5ETSA 3ZTQA 4IG0A 4P9SA 3UPFA 3MR3A 1UP1A 2W7AA 4DHVA 4C6AA 2PO4A 1HBUB 2R3VA 2B56A 1Y3JA 4LRCA 3MEEB 3X3UA 4Q8FA 3FDSA 3K5MA 1HNZI 1A0OB 4YDDB 1X4FA 4MIAA 2ALZA 1QSLA 4C9DA 2JT2A 2B7BB 1TVRA 3FCWA 4OX9E 1FNMA 1Q8IA 4C8MA 1RLCL 2DGUA 2FIUA 1IM4A 4BBYA 5HVHA 3OVAA 1N33J 3E2EA 4YHHF 1EQMA 3MM7A 2I5JB 1SC4B 3IG1B 1CJKB 4N77A 2GGPB 2UXCF 1UEVA 1XEZA 3M2VA 1FF2A 4M1KA 4BWJA 1X5TA 4UTGA 3THTA 1F9FA 4KO0A 1ZTWA 1H2VZ 3W60A 2ZH3A 4M95A 1IR1A 1Q79A 3M85G 2YNFB 4GKKI 1FRHA 4OYOA 4ILRA 5K36C 2LQ5A 4HXZA 1JLBB 1PKUA 1FO1A 1YBTA 3HHNB 2U1AA 5GAEI 2EPIA 3EDRB 3KLIA 2E5LJ 2QEXS 4KR0B 2WOMA 2OMOA 3A13A 3CVKA 1S72S 2FYXA 1S9FA 4JI6E 3FQLA 3VHQA 3EXCX 2XMVA 2JEAB 1LWFA 4ECVA 2FVRA 4UT4A 1WHVA 4FW7A 2PO1B 3VQTA 2V4RA 3LQVA 5KT7A 4WKRA 2PEBA 4EWTA 2DCUB 1AZSA 3G87A 4IG3B 2BJ8A 3NZKA 4K4WA 3D4JA 4BA1B 1M1HA 5IWAI 3IWXA 4ZITA 4LBHA 5CAAA 2EBEA 2MQPA 2KXHA 4PZVA 4ZJLA 4F04B 4DXLA 3HMJG 3C46A 4NXNF 1S76D 1JKHA 1LV5A 3NNAA 5HVFA 3J7AG 4DI6A 1LFPA 2J9DA 4BWMA 4F8RA 1A6FA 4LF5I 2R42A 3C3LA 4K0KF 2AMCB 2HK2A 2AGQA 3EZ5A 3LP0A 1KONA 4KV8A 3RB3A 5K36D 2BACA 3IM9A 3PYDA 4WU2A 1Q4RA 4N3OA 1KTVA 2XMMA 2DY9A 1VS3A 1TUVA 2KRBA 4UZBA 1VK8A 4TY8A 2CNKB 2FLNA 1Z59A 3J80C 1KKHA 5DS7A 1N5YB 1Q53A 1RAFB 2R2TA 2UP1A 2C38A 1BQNB 2KKHA 4Y2CA 1WC4A 2Z2YB 2B5JA 3OSNA 3M85D 1R6VA 2K3IA 3DOLB 2WBMA 4NLTA 4PQAA 5J2PB 1KSPA 2CQDA 1XNRJ 4GKJF 3H40A 3PX4A 1U49A 1YBAA 5MAOA 2FD2A 3FC9A 4RW6A 1N36J 4LR9A 3HLUA 1N56A 4P2MA 3ICLA 2YX4A 3GIMA 4OHYA 4DV5J 1S0NA 4Y2KA 2XGQA 2ZJQQ 4JI4J 1RR9A 2JE6B 4ZCLA 3C2PA 4DV1I 1UL3A 4HI1A 1WNEA 1UW9A 4OX8A 2GJ2A 1TKTA 3U1YA 4KIAA 5F8LA 5CYJA 2V4JB 2QTWA 2EK6A 4C48A 4IFVB 2RRAA 3CC7S 1JK9B 1IN0A 1HARA 4I2PA 1UWBA 2F1FA 3ULHA 4O0IA 1R6LA 2QE5A 3N6NA 4DR7F 2H5EA 1GH8A 2OPSA 4ZVGA 1S12A 4ANDA 3HSZA 3MMBA 5GMDA 3ENWA 3EPIA 4DL7A 3H5SA 3DRXA 2CNLB 4WP9A 2P2CB 3AD9C 4U8YA 4PUOB 3E01A 2QL9B 2DEJA 2ZWPA 2UUWA 1BC6A 3IWLA 1YVFA 1T7PA 2M88A 2OPRB 5ITHA 5AXNA 1T02A 1R0AA 4PQUB 4WTOB 2F5GA 2IA6A 5K8NA 4DV4E 4DR5I 2NSCA 3MF5A 4YQWA 1IBKE 2UU9J 3BKFA 3G86A 3K5PA 4B3SJ 2DBBA 2R7TA 2ZH2A 5EWFA 3J7ZT 1NK9A 2E1MC 4A48A 3IBFB 1YH8A 4DR2E 1T94A 2XM3A 4K8RA 1U1RA 2DGWA 4F4WA 2WVCA 2UZAA 3M7VA 1CJUA 2DGOA 3MOZA 1R31A 2D9PA 3L9ZA 3NCPA 3QT6A 4GVLA 4NA3A 3MEEA 3C16B 3G2XA 2IYGA 2CJBA 1SKSA 4LFCE 4JI7E 2MZTA 5LL6d 3RBDA 3T5LA 4QU6A 1EI1A 4TY9A 4X2BA 2BJ1A 2C3UA 3CIMA 1TV6B 4LF4I 1T9XA 3IS9B 1GMWA 5HN0A 3WDOA 1J5EE 2CG8A 3HPOA 1U8WA 2V6AA 1HQUB 2LDIA 2X7IA 4NYOA 1GNKA 3ZTPA 4I2QA 3CCWA 2HFVA 1UAWA 3LPYA 3A8KA 3JQJA 3O6QA 4HVZA 4CT9A 4DPWA 8RUCA 5L9NA 1VGYA 3KLIB 3BSOA 1U45A 4TY8B 2DNKA 2F65A 3S6EA 1ZZNA 4BHQA 4HYMA 2QO3A 1TL1A 5A2QU 4JI3F 2HHHE 2JFKA 4LQ9A 4IDKA 3I32A 3MPDA 1SH3A 3MM9A 3V6DA 3R6GB 1HK7A 5KT2A 2KDOA 3WBZA 1VJWA 3H1CA 4CO1A 4ED6A 1UVMA 4NXNI 2O1VA 1BXNA 3NGKA 4UOCA 1JJHA 2HRYA 4J9SA 4AQYJ 1BGXT 4CH0S 1YKWA 4LRDA 2RKIB 4PXEA 5GAEU 5DM7Q 2FHJD 4UQTA 2ATLA 3NBPA 2I38A 3CO9A 1FVQA 4WBFA 3HF5A 4JI7F 1UVIA 3MZIA 1HNWE 2CQPA 1URRA 4WE1A 3W2WA 3MAAA 3KLFB 1UJ6A 3UD3P 4Q8EA 2EFGA 1NK6A 2W9CB 3R7NB 3KK2A 2Z58B 1JJ2R 5C7PA 3VVTA 4QWEA 3DYAA 2Y1LB 4IFYB 3Q8SB 3O2IA 3SQGA 1N33I 5THWA 4WCEQ 3OHAA 1YX2A 1ZH5A 4IZKA 2HGLA 2RAQA 1XNQF 2ZZTA 4ZLNA 4NASA 1DQAA 2VIHA 1MG7A 3CC2S 1IKWB 1PG5B 1RCXB 2MHEA 2EC2A 4J9UE 4PYDA 1N32J 4P7VA 1I1GA 3DU5A 2ADCA 3MCSA 2ZOFA 4IH7A 4NCAA 5KFWA 4WKYA 2FZGB 1V6HA 3W8GA 1LW0B 2AU0A 2XEXA 1NK5A 5EL9A 2BE2B 4MFBB 1FFSB 1CULB 2M8HA 2QT7A 3DI6A 3PHTA 3RUBL 3D1QA 4F2SA 3CB4A 1P1LA 3SI8A 3CJ4A 1RAHB 3NAIA 1WKJA 2P8IA 1QY7A 3JAMC 4P75A 3DLJA 2C3PA 3PW0A 3TAPA 5IC6B 1LK7A 1S10A 4C4WA 1QTNB 2QGFB 4ZJOA 4YDXA 1CSJA 3BGRA 3QGHA 4NLXA 3FEXB 2B9EA 4WU3A 3ZZOA 4ZHRA 5I3QA 3CF5Q 1RHQB 2DYAA 2JVOA 4QBUA 1WHYA 4DV2F 4G3IA 2XS2A 4NXME 2HBZB 1UPMB 3H5UA 4RW7A 4C11B 3HVAA 3BGLA 3UVJB 3KTQA 4RNNA 1MU2A 2GO8A 3FBFA 3MR6A 4FXWA 3W7BA 4DR1F 5IT9C 2AYEA 1E3PA 4AQYI 3N79A 1FWLA 2EG1A 3D6FB 1Z5BA 1TL3B 1I94F 4RX6A 1XMOJ 1VBKA 2A6MA 3TVYA 5J2QB 4NPOA 4M5GA 2BJDA 1N0UA 4JI3I 5AXKA 4ZVUB 5KFNA 1J5EJ 1NLKL 2R8IA 4M5LA 4Y2AA 1WKLA 2E66A 3FEZA 4ZVOB 3W2VA 3DFEA 3FBBA 3QMQA 3M6UA 1UW4A 2CQ1A 3TQEA 1WEYA 3H0PA 2GZOA 3CJ8A 4DSFA 2V0NA 4CTAB 1D09B 2IC3B 3OXGA 2I6WA 4DS4A 4LJMA 2DITA 4WXOA 2NN6E 4F4XA 4X62E 1N32I 2V4JA 4P6QA 3B78A 4LF4F 2AGOA 3AOBA 3RAQA 1ZPWX 4O44A 3MECA 3QT8A 1NPPA 2CKWA 1HI1A 2PGCA 2HHWA 2VFTA 2GCFA 4OQJA 4K7QA 1TAUA 2CAJA 5DDRC 2HFZA 3CJRA 4ZVQB 2KT3A 3GV5B 1F2GA 1R27B 1PCAA 4QYZK 1M5HA 2DGQA 2C2DA 4B3TE 4DR1E 4LVNP 3TUIC 4I7FB 3NS6A 3QLHA 2ZBCA 2BQ3A 2J7UA 1HNXE 2OD4A 3HHLC 3MUMP 2E1PA 2YQ3A 3MURP 4ED7A 1C1CA 4FVMA 1XMQF 3KLVA 1UCNA 4LR8A 3HM9A 1RT3B 4DV3I 3CDWA 1NDKA 3NMAA 4DR2I 1S6QA 2FHOB 2M7SA 2YKMA 2ZNZA 2ZE2A 3TZZA 1M5SA 2QA4S 5DG7A 1G2EA 4WPAA 3M7NG 2IVYA 2XSJA 3D6HB 3M4XA 2E5LI 5IZHA 5IC4B 5KFEA 1RI7A 3D1OA 4GKKJ 1WKKA 3ZTSA 1DLOA 3EX7B 4MQYA 2Y1IA 5HQ8A 4X64E 4HTIA 1WTFA 1XMOF 3MTKA 1JLFB 3B54A 3JTPA 2O1UA 2HNDA 2W25A 5C0XB 2V34A 4OX9J 3HKMA 2RHSB 5F8NA 3JTOA 1X7VA 2JNJA 2LA6A 1CEZA 4IZKB 3IR5B 1TZ0A 3M2VB 3AH6A 3PR5B 3CCES 3TAMA 3PEJA 3SQGB 4CQ1A 2CQIA 3M2UA 4YUDA 5HQMA 4F2RA 1NHIA 5KFXA 3CC4S 3R2DJ 5DGBA 1HA1A 2OFHX 3GFHA 3QFWA 2E5LE 5KFYA 1OO0B 3P3EA 4ID5A 3W65A 2VBYA 2RSQA 2YWFA 4W98A 3T3FA 1RT2A 3JYTA 4KHPE 4ZPTR 1SKRA 1BWVA 4ECZA 2C37B 3QPIA 2GO4A 2O1WA 3T1YE 4F50A 1KRPA 5KFSA 4FF4A 2YWKA 2QZ8A 5DZ7A 2OAUA 4O4RA 5AJ3J 5H9EJ 2NN6C 1XNRI 1UDNA 3W9IA 4FS2A 3TQ1A 3OTOI 3KK1B 2ATCB 2V94A 4MYUA 2QLWA 3P5BP 4K59A 1WEZA 2U2FA 4IYQA 1FTCA 1AXQA 4MDTA 3FCHA 4JV2A 2XMKA 4K0KI 3WZ0A 1TVRB 2CPHA 2PFDA 4EO8A 5LT5A 4DV3F 1JJ4A 2VG7A 4EBCA
chains in the Genus database with same CATH topology
2CGEA 4FWGA 4DV0E 1FKAE 4R1FA 2UXBI 4AQYE 4JG4A 4DUYE 1S16A 3J81Q 1Z0WA 4RPFA 4HACB 1K47A 4LFBE 2UXCI 3T1HE 1S4EA 1XMOI 1IBLE 4MYTA 4ED4A 2UUCI 2UUCE 4XTJA 4DUZE 4DPYA 3J7AM 4B3SI 4B3TI 5FLXC 1XMQE 1U2RA 2LJPA 4NXNE 5BR8E 5LMNE 3WU3A 4LF6E 3K1JA 2HFUA 3LTOA 2AJ4A 4B3RI 2UXDE 4LFAE 1NHJA 4DUZI 3PRYA 4USKA 4PRXA 3HULA 1J5EI 3HJCA 2PNLA 4DUYI 4DR6E 4JI2E 4DR1I 3ZZTA 4DPXA 2CG9A 3WU5A 1N34E 4DV4I 1HR0E 2Z5CB 2IOQA 1Z5AA 3V2UC 4B3RE 5IT9Q 4NXMI 2BV3A 1H74A 2UXBE 3V5RA 4X66I 2CZ9A 2OI2A 4HY1A 4KQVA 3WU4A 4B3ME 1XMQI 4PRVA 1ZM9A 4JI3E 1XNQI 3H4LA 5LMNI 2Z5CA 4PU9A 2ZM6E 4LFBI 2HHHI 3ZKBA 4JI5E 4WUBA 4JI1I 3ZZUA 4URLA 4X64I 2VQEE 2E1RA 1H7SA 1Z0CA 1I94I 4GKJE 4K0KE 1Y4UA 1B62A 5GMEA 5LMUI 2HKJA 3B82A 1FWKA 1Z0GA 2VQFI 4LF7E 4LF7I 4I3HA 2GQ0A 3JAMQ 4JI6I 1H73A 5A2QQ 1H72C 4JI0I 5FWKA 4FWHA 1IBKI 4JV5E 3PYFA 2Z5BA 4DV7I 4DR7E 3J81C 4DV2I 1KIJA 2BM1A 2HFSA 5L3JA 2R3VA 1HNZI 2UUAI 4DV0I 1DARA 1FNMA 5FLXQ 2UU9E 4B3SE 1PVGA 1ZM2A 4M1KA 4UTGA 5LMUE 2A2CA 4DV5I 1NZ0A 4GKKI 3K85A 4X65I 4HXZA 1Y4SA 4DPTA 1N34I 5BR8I 4JI6E 1OJ4A 4Z7CA 1FJGE 1FJGI 4UT4A 1H7UA 2UUBE 5IWAE 2ZITA 5IWAI 2F4VI 2F4VE 3D4JA 1PIEA 1HNZE 1WUUA 4DXLA 1N0VC 3Q6MA 3J7AG 1A6FA 2R42A 2HK2A 3PYDA 3F0NA 3PYEA 1KTVA 4N3OA 1Z59A 3J80C 4DR4E 1KKHA 4DR6I 4LF5E 4LF5I 1NHHA 4YHHI 4IZJB 3B8HA 3T1HI 1MX0A 4IZJA 1RREA 1RR9A 1IBMI 2UUBI 4DV1I 4YY3E 4LF9I 4JI7I 3LNUA 1PKPA 4USMA 4JI8I 5LL6R 1ZXNA 2PNMA 1ZXMA 5GMDA 2HK3A 4P7AA 1HNXI 4GKKE 1N36E 2DEJA 4DR5E 4DR5I 2IOPA 4X66E 4DV3E 4DV4E 4DR3I 1IBKE 3GONA 3CWVA 4DR2E 4LF8E 4LF8I 2V2ZA 2Z5BB 1BKNA 4FW9A 3QT6A 4DV1E 4LFCE 4JI7E 1XMOE 1EI1A 1XHKA 1KVKA 4LF4I 4GKJI 3ZM7A 1J5EE 2X7IA 4B3MI 4DR4I 1Z0EA 2O1TA 4DPWA 3M6AA 3LPSA 3T1YI 4HYMA 1EA6A 2HHHE 1HK7A 2WW4A 4EMDA 2Q2EB 2Z5EA 4NXNI 2O1VA 1IBME 4DR7I 4DV2E 4JV5I 4DU7A 1QZRA 2A2DA 3Q1QA 4DPUA 4DV6E 1HNWE 4DV6I 4LFCI 1HNWI 1Z0TA 4LF4E 2EFGA 2UUAE 1N33I 1N33E 4DV5E 4IZKA 2V8PA 1Y6ZA 1ELOA 1VISA 4JI0E 1MG7A 4YHHE 4JI2I 4ZVIA 1D6TA 1Z0VA 4JI5I 2XEXA 2UXCE 3K17A 1XNRE 2VF3A 3J80Q 3JAMC 4DU8A 4OX9E 1FI4A 4Z7YA 1I94E 1Z0BA 4JI4E 4JI4I 2V2QA 3OTOE 4NXME 2VQFE 5IT9C 4AQYI 1FWLA 4P52A 1Z5BA 4LF6I 4JI3I 1N0UA 4DV7E 4KHPI 1HR0I 1MU5A 4JYAI 2UXDI 1B63A 1USVA 1Z5CA 1N32I 4X62E 1USUA 4X62I 4YY3I 4LF9E 4FWDA 3B78A 2HKEA 1ZM3A 2X36A 3QT8A 3ZKDA 2NPFA 1N36I 3ZZ0A 4WUCA 4B3TE 4DR1E 1HNXE 4FN5A 1UEKA 4DR3E 3Q6NA 1ZM4A 4DV3I 4DR2I 3PYGA 3QT7A 4IZJD 4HACA 2E5LI 4OX9I 2BM0A 3WU6A 4WUDA 1IBLI 4X64E 4LFAI 2O1UA 2V34A 3OTOI 2V2VA 4IZKB 2UU9I 1NHIA 1XNQE 2DEIA 3QT5A 3P06A 2ZM6I 4X65E 4KHPE 2J7KA 2O1WA 2ZBKB 3T1YE 4JYAE 2VQEI 1XNRI 5A2QC 2E5LE 4MYUA 4JI1E 1N32E 2GS8A 4K0KI 4JI8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWG A;  4DV0 E;  1FKA E;  4R1F A;  2UXB I;  4AQY E;  4JG4 A;  4DUY E;  1S16 A;  3J81 Q;  1Z0W A;  4RPF A;  4HAC B;  1K47 A;  4LFB E;  2UXC I;  3T1H E;  1S4E A;  1XMO I;  1IBL E;  4MYT A;  4ED4 A;  2UUC I;  2UUC E;  4XTJ A;  4DUZ E;  4DPY A;  3J7A M;  4B3S I;  4B3T I;  5FLX C;  1XMQ E;  1U2R A;  2LJP A;  4NXN E;  5BR8 E;  5LMN E;  3WU3 A;  4LF6 E;  3K1J A;  2HFU A;  3LTO A;  2AJ4 A;  4B3R I;  2UXD E;  4LFA E;  1NHJ A;  4DUZ I;  4USK A;  4PRX A;  3HUL A;  1J5E I;  4DUY I;  4DR6 E;  4JI2 E;  4DR1 I;  3ZZT A;  4DPX A;  3WU5 A;  1N34 E;  4DV4 I;  1HR0 E;  1Z5A A;  3V2U C;  4B3R E;  5IT9 Q;  4NXM I;  2BV3 A;  1H74 A;  2UXB E;  3V5R A;  4X66 I;  2CZ9 A;  2OI2 A;  4HY1 A;  4KQV A;  3WU4 A;  4B3M E;  1XMQ I;  4PRV A;  1ZM9 A;  4JI3 E;  1XNQ I;  3H4L A;  5LMN I;  4PU9 A;  2ZM6 E;  4LFB I;  2HHH I;  3ZKB A;  4JI5 E;  4WUB A;  4JI1 I;  3ZZU A;  4URL A;  4X64 I;  2VQE E;  2E1R A;  1H7S A;  1Z0C A;  1I94 I;  4GKJ E;  4K0K E;  1B62 A;  5GME A;  5LMU I;  2HKJ A;  3B82 A;  1FWK A;  1Z0G A;  2VQF I;  4LF7 E;  4LF7 I;  4I3H A;  3JAM Q;  4JI6 I;  1H73 A;  5A2Q Q;  1H72 C;  4JI0 I;  1IBK I;  4FWH A;  4JV5 E;  3PYF A;  4DV7 I;  4DR7 E;  3J81 C;  4DV2 I;  1KIJ A;  2BM1 A;  2HFS A;  5L3J A;  2R3V A;  1HNZ I;  2UUA I;  4DV0 I;  1DAR A;  1FNM A;  5FLX Q;  2UU9 E;  4B3S E;  1PVG A;  1ZM2 A;  4M1K A;  4UTG A;  5LMU E;  2A2C A;  4DV5 I;  1NZ0 A;  4GKK I;  4X65 I;  4HXZ A;  4DPT A;  1N34 I;  5BR8 I;  4JI6 E;  1OJ4 A;  4Z7C A;  1FJG E;  1FJG I;  4UT4 A;  1H7U A;  2UUB E;  5IWA E;  2ZIT A;  5IWA I;  2F4V I;  2F4V E;  3D4J A;  1PIE A;  1HNZ E;  1WUU A;  4DXL A;  1N0V C;  3J7A G;  1A6F A;  2R42 A;  2HK2 A;  3PYD A;  3F0N A;  3PYE A;  1KTV A;  1Z59 A;  3J80 C;  4DR4 E;  1KKH A;  4DR6 I;  4LF5 E;  4LF5 I;  1NHH A;  4YHH I;  3B8H A;  3T1H I;  1MX0 A;  1RRE A;  1RR9 A;  1IBM I;  2UUB I;  4DV1 I;  4YY3 E;  4LF9 I;  4JI7 I;  3LNU A;  1PKP A;  4USM A;  4JI8 I;  5LL6 R;  1ZXN A;  1ZXM A;  5GMD A;  2HK3 A;  4P7A A;  1HNX I;  4GKK E;  1N36 E;  2DEJ A;  4DR5 E;  4DR5 I;  4X66 E;  4DV3 E;  4DV4 E;  4DR3 I;  1IBK E;  3GON A;  3CWV A;  4DR2 E;  4LF8 E;  4LF8 I;  2V2Z A;  1BKN A;  4FW9 A;  3QT6 A;  4DV1 E;  4LFC E;  4JI7 E;  1XMO E;  1EI1 A;  1XHK A;  1KVK A;  4LF4 I;  4GKJ I;  3ZM7 A;  1J5E E;  2X7I A;  4B3M I;  4DR4 I;  1Z0E A;  4DPW A;  3M6A A;  3LPS A;  4HYM A;  3T1Y I;  1EA6 A;  2HHH E;  2WW4 A;  4EMD A;  2Q2E B;  4NXN I;  1IBM E;  4DR7 I;  4DV2 E;  4JV5 I;  4DU7 A;  1QZR A;  2A2D A;  3Q1Q A;  4DPU A;  4DV6 E;  1HNW E;  4DV6 I;  4LFC I;  1HNW I;  4LF4 E;  1Z0T A;  2EFG A;  2UUA E;  1N33 I;  1N33 E;  4DV5 E;  2V8P A;  1ELO A;  1VIS A;  4JI0 E;  1MG7 A;  4YHH E;  4JI2 I;  4ZVI A;  1D6T A;  1Z0V A;  4JI5 I;  2XEX A;  2UXC E;  3K17 A;  1XNR E;  2VF3 A;  3J80 Q;  3JAM C;  4DU8 A;  4OX9 E;  1FI4 A;  4Z7Y A;  1I94 E;  1Z0B A;  4JI4 E;  4JI4 I;  2V2Q A;  3OTO E;  4NXM E;  2VQF E;  5IT9 C;  4AQY I;  1FWL A;  4P52 A;  1Z5B A;  4LF6 I;  4JI3 I;  1N0U A;  4DV7 E;  4KHP I;  1HR0 I;  1MU5 A;  4JYA I;  2UXD I;  1B63 A;  1Z5C A;  1N32 I;  4X62 E;  4X62 I;  4YY3 I;  4LF9 E;  4FWD A;  3B78 A;  2HKE A;  1ZM3 A;  2X36 A;  3QT8 A;  3ZKD A;  2NPF A;  1N36 I;  3ZZ0 A;  4WUC A;  4B3T E;  4DR1 E;  1HNX E;  4FN5 A;  1UEK A;  4DR3 E;  1ZM4 A;  4DV3 I;  4DR2 I;  3PYG A;  3QT7 A;  4HAC A;  2E5L I;  4OX9 I;  2BM0 A;  3WU6 A;  4WUD A;  1IBL I;  4X64 E;  4LFA I;  2V34 A;  3OTO I;  2V2V A;  2UU9 I;  1NHI A;  1XNQ E;  2DEI A;  3QT5 A;  2ZM6 I;  4X65 E;  4KHP E;  2J7K A;  2ZBK B;  3T1Y E;  4JYA E;  2VQE I;  1XNR I;  5A2Q C;  2E5L E;  4MYU A;  4JI1 E;  1N32 E;  2GS8 A;  4K0K I;  4JI8 E; 
#chains in the Genus database with same CATH topology
 2CGE A;  2OLW A;  1Z1Z A;  2V69 A;  4ANE A;  3FRZ A;  4URG A;  5CD4 A;  3BO3 A;  1FKA E;  2LMI A;  3MM6 A;  5LM7 E;  4YOE A;  1JKH B;  4IFY A;  2RDD A;  3MPW A;  3X1L B;  5HMX A;  2HQI A;  1Q95 G;  1V9O A;  1U25 A;  2UXB I;  3GTY X;  4R5P A;  1GT8 A;  1K44 A;  2XWY A;  4DLE A;  4IUF A;  3VAG A;  4DUY E;  2XTJ P;  2DGS A;  3MFH A;  1TK5 A;  3EGW B;  5LSL A;  3UQS A;  2J8S A;  2E7X A;  4DMZ A;  3AQP A;  1HNW J;  1F3F A;  2LLZ A;  3HHL A;  1YWX A;  4JI7 J;  4I64 A;  2RQK A;  1VBX A;  1S49 A;  2Z2M A;  5HRO A;  5JEA E;  3T1H E;  2DNP A;  3R9L A;  4YME A;  2V4Q A;  2BAN B;  3EVM A;  2Q1L A;  3BZQ A;  3C6T A;  1J2V A;  4I6W A;  4X4S A;  3PO5 A;  2BJ9 A;  1Y5N B;  3LAL A;  1CG2 A;  3WX8 A;  2D7S A;  2MHN A;  3MPY A;  4WII A;  4DQP A;  4OI6 A;  2QMW A;  4C8K A;  1IBL E;  4Y2I A;  2OTJ S;  5DDO C;  2EBG A;  5D4P A;  1VMB A;  4PYA A;  4NI2 A;  4ZPW R;  2GGP A;  1KVI A;  1FKA F;  3SCL E;  4NMX A;  2YX7 A;  3OTO E;  1X0F A;  2Y8Y A;  2PI5 A;  1APS A;  3LA0 A;  1HW8 A;  3ILJ A;  2O01 C;  3MEK A;  4FPI A;  5K8O A;  4LFB F;  4B3S I;  2V8D A;  3SSS A;  1TMM A;  4PUO A;  2V5H G;  3H98 A;  3TNV A;  4JI5 J;  2LFV A;  5ETV A;  4ZLJ A;  2B8Q A;  2ROP A;  3HVT B;  1KQG B;  4UZC A;  3NOG A;  1TR0 A;  5JXS A;  2KJW A;  2V8G A;  3HVR A;  2GNK A;  1V5I B;  2QLB B;  5FLX C;  2UXD I;  2QLF B;  3FJ2 A;  3NOC A;  1CBK A;  4ZVP B;  1U2R A;  4M5H A;  3E51 A;  1WOS A;  1BHN A;  2IJN A;  2VFV A;  4JI6 F;  1O0P A;  3V4I B;  1D0E A;  3EGZ A;  4NXN E;  5BR8 E;  2AZ3 A;  4DSI A;  2NRE A;  5LMN E;  5KG4 A;  5D4N A;  5DRQ A;  2NYI A;  3K1J A;  4KJI A;  2YKN B;  3P4U B;  4AID A;  1V3Z A;  4C8Z A;  3TJ9 A;  1SKW A;  2VHG A;  1Y5I B;  5D3G B;  2VDI A;  3MMA A;  1GFW B;  1Q7Y T;  1NU4 A;  4KTQ A;  3P96 A;  1T3O A;  4ETX A;  1S9G B;  2WSC C;  2ZC4 A;  4WZM A;  4TLR A;  1PC4 A;  4AL5 A;  1FER A;  5E3P A;  1YTY A;  3ZZR A;  1AW0 A;  2H65 B;  2BA0 D;  2IY5 B;  4KPY A;  2HND B;  3QWU A;  3PRY A;  3E01 B;  2C2O B;  3W5Z A;  3KDO A;  5ETK A;  2ZM6 F;  3L7Z B;  2GIQ A;  3EPG A;  3G9C A;  2HHP A;  3GU0 A;  4IQM A;  4EBD A;  3AOD A;  3MMB B;  4OYX A;  1FK9 A;  1TV6 A;  4IOA Q;  3TW0 A;  3HJC A;  4X64 J;  1MLA A;  5T7L A;  4CO2 A;  2OTL S;  5DG9 A;  1VLY A;  4DFM A;  5M2R A;  2HLU A;  3Q89 A;  2XYG B;  1ZOT A;  2LQ8 A;  4DPX A;  3RBE A;  2G9O A;  3DU6 A;  1VDH A;  5DQG A;  2B51 A;  3R3T A;  1SL0 A;  4A4J A;  3LWM A;  2LKZ A;  3TP2 A;  1HR0 E;  4KYZ A;  1T9U A;  2BZ2 A;  5I3P A;  1WJ9 A;  1X4E A;  4PXC A;  4CWB A;  4QWA A;  2GJF A;  4ECQ A;  1C1B B;  1LW2 B;  3OTO F;  3PM9 A;  2KI2 A;  3K8W A;  4RNO A;  2MGZ A;  2UXB F;  3PS1 A;  1B0V A;  2LA4 A;  4MKV A;  3PDN A;  1NH8 A;  5D78 A;  3V2U C;  4WZQ A;  2WZ1 A;  1CJV B;  4B3T J;  4JI6 J;  4LCF A;  2DTJ A;  4IO9 Q;  4BC7 A;  2LXF A;  3IRX A;  3RR7 A;  5EDW A;  4F4K A;  4NXM I;  1RAO A;  3TVZ A;  1VQ8 S;  1GAO A;  3DYA B;  4DR3 E;  4JI5 F;  4FW3 A;  1S1T A;  3ZO7 A;  2FJD B;  3KLE B;  4X66 I;  3AA9 A;  3H42 A;  4OHX A;  4KQV A;  3WU4 A;  2DNO A;  1CJK A;  1LOU A;  2JX2 A;  3I5C A;  5D15 A;  3TYT A;  5IT0 A;  1D1U A;  2GO3 A;  2PO0 B;  1PIL A;  4JI3 E;  1H2T Z;  4CO0 A;  2K2P A;  2VDH A;  1UA1 A;  2DIV A;  3UD4 P;  5KG1 A;  2KFN A;  1UZH A;  2YKN A;  4PU9 A;  3CCT A;  1AFI A;  4GQU A;  2MY8 A;  5KFJ A;  5A2Q Y;  4LFB I;  4IH5 A;  5KOX A;  3PJ9 A;  2UUT A;  4FS1 A;  3GPA A;  2ZDO A;  4DDF A;  4MFB A;  1TKT B;  5HLF A;  3K59 A;  4JI1 I;  3ONQ A;  2H54 B;  3W5Y A;  1S0V A;  3C6U A;  2FZC B;  4PPZ A;  1E6V B;  2CVI A;  4YY3 F;  2UUC F;  2BW7 A;  1HNW F;  2NR0 A;  1DUR A;  1UZD A;  2Z56 B;  4KFB B;  2WTF A;  2VQE E;  2HW3 A;  3B6B A;  1M5O C;  3NNC A;  1A9N B;  4PRF A;  2OPQ B;  2IPO B;  2NSB A;  2QIF A;  3PAC A;  1NSP A;  1U47 A;  5DJB A;  1Z0C A;  2IM2 A;  1R0B G;  4I0W A;  2W7O A;  1B62 A;  1ARO P;  3MWB A;  1KP6 A;  3OVS A;  4OI0 A;  3JSM A;  1EKR A;  3ADA C;  5GME A;  1Q81 T;  1A6L A;  5DZ6 A;  4RJV A;  1YK9 A;  4AXI A;  4TU7 A;  5LMU I;  3E8O A;  5HJX A;  2FJV A;  3B82 A;  1VI7 A;  3FMB A;  5HLF B;  5CXT A;  2XC9 A;  4X4O A;  3QJJ A;  1Z0G A;  2VQF I;  4V1A k;  3PKM A;  4LF7 I;  2AJ2 A;  3DHX A;  2LQ9 A;  2FQQ B;  3VZI A;  3RG6 A;  2Y9H A;  1CJT B;  4L74 A;  3SCK E;  2GQ0 A;  4KGZ B;  3LAK A;  1MML A;  1RWV B;  3D0H E;  3M8S A;  4FWH A;  1U2C A;  1TP7 A;  3CMQ A;  4MK7 A;  4R8U A;  3HHL B;  2CUY A;  2Q43 A;  3PNI A;  3PYF A;  4IH6 A;  2CJK A;  5LJ3 Y;  3FCV A;  2Z5B A;  2ZWO A;  1HWI A;  2F8M A;  4PG5 A;  3S1T A;  3D54 A;  2CQ3 A;  3PO4 A;  2HFS A;  3I6P A;  2MPU A;  3IMQ J;  1NAQ A;  4WFZ A;  2OPP A;  2OHD A;  1YSJ A;  1N32 F;  2HIY A;  5CZX A;  2VOD A;  2COL A;  2I1R A;  3IM8 A;  3R97 A;  3KG4 A;  3OFF A;  1DAR A;  4DV0 I;  3DCA A;  2ZH7 A;  5H1S V;  2Z30 B;  1VQM S;  1S0O A;  5G0R A;  1H7W A;  1OIA A;  3N6L A;  2FTR A;  3DN9 A;  4RO0 A;  1RWW B;  1FK9 B;  1Z2L A;  2O1P A;  4F3M A;  4Q44 A;  1UDO A;  4B3S E;  1I51 B;  3R5C A;  2O5D A;  1VBY A;  3D0G E;  3HKW A;  1PVG A;  3UW1 A;  1T03 B;  3MOJ B;  3VGS A;  5B0F A;  3OJS A;  4LF9 J;  3M2R B;  5GAH U;  5LMU E;  1KTQ A;  4NCB A;  4NLR A;  5KT6 A;  1VFJ A;  1S6U A;  2QSF A;  2FVP A;  4OV1 A;  1TL1 B;  1YI2 S;  4EO6 A;  1JLC A;  3BKT A;  3AHP A;  2R9L A;  4FBT A;  5A8K A;  1R8B A;  1F3V A;  1U6B A;  3TZW A;  1SVD A;  5EWG A;  1BQM A;  1WI8 A;  7AT1 B;  1G3O A;  1FTR A;  1HQ2 A;  3BBC A;  1FWP A;  3DKD A;  3MD1 A;  5J1P A;  2ZH9 A;  4WYL A;  4ZVI A;  2DIU A;  2BA0 G;  4KSE B;  2FJB B;  4JI8 J;  3OV7 A;  2DH7 A;  4RNM A;  3PW7 A;  2W2N P;  3TR5 A;  3U1N A;  7FD1 A;  2ZIT A;  1RHK B;  5C2G A;  2BQR A;  1U7L A;  2F4V I;  3S01 A;  2MLX A;  4NLS A;  1PIE A;  1DTQ B;  3BKU A;  3JXO A;  4JI3 J;  1HBN B;  2O3Z A;  2MEW A;  4LSL B;  1N0V C;  4I69 A;  1NKC A;  4AD6 A;  4D3G A;  3JSM B;  1B0P A;  1QE1 A;  1SXL A;  1XR6 A;  1WOR A;  1IKV A;  3GCX P;  3MCM A;  1Q8B A;  1QJH A;  3Q2S C;  4GVB A;  1WG5 A;  1HQE A;  4LBP A;  4MK8 A;  4TLQ A;  2ZM6 J;  2P9G A;  3F0N A;  1FE4 A;  3N9U C;  4DX7 A;  3R1L A;  2DNL A;  4KV8 B;  1HNV B;  4DR4 E;  2DT9 A;  1VQ5 S;  4DF4 A;  5F8I A;  1RU2 A;  1TAQ A;  1VCT A;  5U47 A;  2VG6 B;  4QWB A;  2VIC A;  3VGT A;  3AOC A;  2DR9 A;  4LF4 J;  1SC1 B;  2CNO B;  5DLG A;  1NPK A;  1YHC A;  1ULR A;  1GXU A;  4OZ1 A;  1X0P A;  2YBV A;  1U1Q A;  3MAH A;  1FJE B;  4WP3 A;  1FXL A;  4P7A A;  4A8F A;  4YHH I;  1OSC A;  2UXB J;  4EU0 A;  3T1H I;  3GZ7 A;  2MZ1 A;  1SIZ A;  3C19 A;  3VAH A;  2HG4 A;  4IZJ A;  1VQS A;  4LIW A;  1CUL A;  3BS9 A;  3DI6 B;  3Q8P B;  1Y4U A;  2RVJ A;  1SV5 A;  5KFM A;  4U9R A;  1E6V A;  1HR0 I;  3TA0 A;  2IER A;  2UUB I;  1S1X B;  2W4C A;  3VAM A;  4OYI A;  2V67 A;  4HH0 A;  4RW9 B;  3CGI A;  4JI7 I;  1H2U X;  1ZBT A;  4QNK A;  2VPZ B;  1WC5 A;  2B6A B;  3SXL A;  5C24 B;  3EDQ B;  3JSY A;  1WTB A;  4K4V A;  1Q8K A;  2XSF A;  5F0W A;  2MY7 A;  2QN6 B;  3OFH A;  1KOH A;  3SZ2 A;  1IBK F;  3CDI A;  3PIP Q;  2R7Q A;  2JSX A;  4OKG A;  2JVR A;  4USM A;  2NXN A;  4LFB J;  5C0X A;  1AFJ A;  1GMV A;  4NYP A;  2R7W A;  1FNX H;  5E2Q A;  3T9N A;  3TEH B;  5D0E A;  2AJQ A;  1HNX I;  2ROE A;  2X1G A;  4GKK E;  4FPR A;  4NCG B;  3O5T B;  4I6A A;  3I55 S;  4JV1 A;  3PHE A;  1GEH A;  2EG2 A;  3KLE A;  3VAJ A;  1HNX F;  1XR7 A;  5T14 A;  3AD8 C;  1U4B A;  3P6Y C;  3KNA A;  2RQM A;  1FDB A;  5HMY A;  4JI8 F;  1YIT S;  2XNQ A;  3LPE A;  2QL5 B;  3OR1 A;  4J9P A;  3GON A;  1JIH A;  3M8Y A;  2DHS A;  3CJQ A;  2JEI A;  4JOU A;  2GVD A;  3CWV A;  1L3U A;  4JP8 A;  2DHG A;  3MMC B;  1GK8 A;  2V2Z A;  3BN4 A;  2ZBQ A;  3CED A;  4L76 A;  3OL7 A;  3C16 A;  5LMU J;  2ZNY A;  1N36 F;  1FRL A;  3DRS A;  2W7P A;  4N41 A;  2IM1 A;  4KKO A;  1MRO A;  1Q5Y A;  1URN A;  3DOK B;  1ZYQ A;  2FJW A;  1VHF A;  1XMO E;  1UKU A;  1Q1K A;  2OD6 A;  3CSK A;  3HZG A;  3VGU A;  4YFU A;  2HHH F;  5DRP A;  3P49 B;  3PTW A;  2B6A A;  3TUZ C;  3NY0 A;  2MMY A;  4YB7 A;  1N4L A;  1KHV A;  5ETN A;  3J81 j;  3TAM B;  2JFD A;  5BYS A;  3CCQ S;  3ZM7 A;  3GSD A;  4BA2 B;  3PFE A;  4J5O A;  4EYI B;  2K7K A;  2RS2 A;  1FRK A;  2B5J B;  4EFA C;  4M94 A;  4B3M I;  1Z0E A;  4DS5 A;  3CUN A;  4NLQ A;  4OMF G;  4AUK A;  2DNN A;  2UVV A;  2YWH A;  3AJD A;  1GMU A;  3GFY A;  4DBQ A;  5SUH A;  4WFX A;  1H3D A;  3U1K A;  3T1Y I;  5KG0 A;  1KHW A;  2BKP A;  4RLE A;  4C8L A;  1EA6 A;  4ECS A;  1T95 A;  4I1T A;  1LXN A;  4DSL A;  2C2M B;  2V50 A;  3ZNJ 1;  4ED0 A;  4U3B A;  5FDL B;  2GAG C;  2GIR A;  2VBW A;  2RKI A;  1KR4 A;  4M5I A;  3UDC A;  4YR0 A;  3ZZP A;  3KK1 A;  2VB6 A;  4OL8 A;  1EET A;  1YHQ S;  1T8E A;  1WSR A;  1Y3K A;  3D0I E;  2C2K B;  4ZK7 M;  4DU7 A;  4LSN A;  1RA7 A;  3UDV A;  1WC6 A;  1F5A A;  2CQB A;  4W92 B;  2MZQ A;  4DPU A;  2R7R A;  2FGO A;  4DV6 E;  3BDP A;  1HNW I;  4JBC A;  1HNX J;  2VPW B;  3C14 B;  2FVS A;  4Q0B B;  4ISA A;  3MAQ A;  4CLK A;  2NUU G;  4CLW A;  4TKT A;  3KUH A;  4DQS A;  2HAI A;  3O1L A;  5ETM A;  4BLG A;  5GVQ A;  5F9N A;  2IA0 A;  4ED1 A;  1F2H A;  4HHJ A;  2G1H A;  2JJ4 D;  4WIQ A;  5HVG A;  4O4G A;  3DMJ B;  3OFG A;  4OHW A;  3D6T B;  4EI2 A;  2UUC J;  1N33 E;  2V8P A;  2BA1 G;  5IT4 A;  2XLJ A;  4CLZ A;  1RTZ A;  3T41 A;  5A8R B;  2I2Y A;  4JI0 E;  4L72 B;  3DRP A;  3CDU A;  3VV2 B;  3D3B J;  2HS0 A;  2K1R B;  1U8S A;  1YJR A;  1TKX B;  3FZ2 A;  5HRO B;  2CVE A;  3D3C J;  1UMJ A;  2HWI A;  3HFZ B;  4MT1 A;  1NJI T;  2UUA F;  2PA3 A;  1R0A B;  1Z0V A;  1X4G A;  2CJX B;  1S1X A;  2BOP A;  2J0Q D;  2VKR A;  4DFK A;  4NXM F;  4IFD C;  3K17 A;  2UVU A;  4CNY A;  3OLA A;  2UXC E;  3CXC R;  2HHT A;  3GG1 A;  5IM0 B;  1SKU B;  4DN0 A;  3J80 Q;  2KZZ A;  1QE1 B;  1GMW D;  4IG3 A;  1SI9 A;  2KYX A;  3KOA A;  4QIG A;  1FI4 A;  1REV B;  2Y0S D;  2ZEJ A;  3EVO A;  4PWU A;  4A8Q A;  1I94 E;  5E0O A;  1Y10 A;  1NJX A;  2J9C A;  4Q7A A;  1P6T A;  2KM8 B;  4I6Y A;  3KK2 B;  1WC0 A;  4CLU A;  1U1M A;  2RUS A;  1IBM J;  5HAN A;  2ZJR Q;  4RW7 B;  3HK2 A;  2LYV A;  3N01 A;  2V2Q A;  5HAO A;  4EBE A;  2HIQ A;  2XLI A;  4WF9 Q;  2C39 A;  3VCD A;  2VQF F;  2VQF E;  1MMD A;  5K14 A;  2E5J A;  2GHP A;  2BYC A;  2MDA A;