3PYGA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
b'GSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 83
structure length 298
sequence length 298
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pygA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pygA01
1FWLA 4WUBA 4JI0E 1XNRE 2UXDE 4JI6I 1FJGE 4YY3I 1H72C 2V8PA 4LF7I 4DV1I 4LF6E 4OX9I 4WUDA 2GS8A 1HNXE 4P52A 4GKKE 1H7SA 4DUYI 2UUCI 3T1HI 1N33I 3ZZ0A 1HNWI 3F0NA 2VQFI 2UUBI 4B3SE 1HNZI 2LJPA 1H74A 4DV6I 2HFUA 1Z59A 3HULA 4K0KI 2VF3A 4X65E 4YHHI 1EA6A 3PYDA 4JI3E 1I94E 2UU9I 4X62E 1PVGA 4FW9A 4JI1I 4LF5I 2F4VE 1ELOA 4LFAI 4JYAI 3V2UC 4X64I 4ED4A 1NHHA 5FLXC 2UUAE 2V34A 2HHHI 1Z0EA 4JV5E 2ZM6I 2WW4A 1ZM9A 2Q2EB 4LF8E 4JI8I 4DV7E 4DR5E 4DR7I 1N34E 3T1YI 5LMNI 2E5LE 3M6AA 2J7KA 4Z7CA 1S16A 1QZRA 4DR3I 1VISA 4AQYE 4PU9A 2R3VA 4JI5E 2UXCE 4DR4I 2ZBKB 4HACB 1HR0I 1XMOI 2VQEI 4JI2E 1N32E 3QT6A 1B62A 3PYEA 2OI2A 5IT9C 3V5RA 1N0VC 4DPTA 2ZITA 4FWGA 2XEXA 3ZKBA 3CWVA 1N36I 4DUZI 4X66E 4LFBE 1IBKE 3J80Q 4DU8A 1PKPA 4KHPI 4DV0E 5IWAI 1ZXMA 1KVKA 4NXME 1H7UA 1EI1A 4HY1A 5LMUE 2NPFA 3LPSA 4LF4E 1MX0A 3B8HA 4NXNI 4DR1E 1XNQI 4DV4E 1HNXI 1XMQE 1NHJA 4GKKI 3QT5A 5BR8I 1H73A 4DPYA 1NHIA 4DV2I 4DV5E 1IBMI 5IT9Q 1FNMA 4B3RE 2HK2A 4XTJA 4DR2E 3WU6A 4WUCA 4X65I 3QT7A 4DR6E 1I94I 4X62I 1J5EE 2F4VI 3LNUA 3H4LA 4M1KA 2HFSA 4DV1E 2UUAI 3JAMQ 1K47A 5L3JA 4DUYE 3T1HE 2UUCE 4JI4E 1N33E 1DARA 1HNWE 4FN5A 3WU4A 2VQFE 1KTVA 2UUBE 4DV3E 4LF8I 3ZZTA 1HNZE 4DV6E 4K0KE 1N34I 4YHHE 4HYMA 3PYFA 2BM1A 4JI1E 4B3ME 4RPFA 3J80C 2CZ9A 4URLA 4X64E 4AQYI 1WUUA 2UXCI 2UXBI 2EFGA 2HHHE 1FWKA 2ZM6E 2V2ZA 1N32I 1RR9A 4JI8E 4JI7E 4FWHA 4HXZA 3T1YE 5LMNE 3WU5A 3ZZUA 3LTOA 3OTOE 1B63A 4DPUA 1ZM2A 2X7IA 4LFCI 4X66I 4LFBI 1RREA 4MYTA 4B3TE 4DR3E 4LF9I 4PRVA 1IBLI 4DPWA 4DR4E 4EMDA 1MG7A 1HR0E 1XMOE 4JI0I 2VQEE 2R42A 1XNRI 2UXDI 4R1FA 4HACA 1PIEA 1FJGI 3JAMC 1XHKA 1Z0TA 4KQVA 1N0UA 5LL6R 1XMQI 4LF6I 4DV5I 1D6TA 4B3RI 2V2VA 1N36E 2BM0A 2A2CA 4I3HA 4B3SI 1UEKA 4Z7YA 4DR6I 3QT8A 1S4EA 4KHPE 1J5EI 4GKJE 1Z0VA 3GONA 2BV3A 5IWAE 3B78A 4JI3I 3ZKDA 3J7AM 4JI6E 1NZ0A 4YY3E 1Z0BA 1Z0CA 4NXNE 1XNQE 1ZM4A 4JI4I 4LF7E 5BR8E 4USKA 4DV2E 4OX9E 1A6FA 4ZVIA 1Z5CA 1KIJA 4DV3I 1IBME 1BKNA 1Z0WA 4JV5I 1ZM3A 1KKHA 1OJ4A 3J7AG 4DV7I 4DR5I 3PYGA 4B3MI 2UU9E 2E5LI 4LF5E 1U2RA 4LFAE 4JYAE 2V2QA 3B82A 4JI5I 4UTGA 4JI7I 5A2QC 2HKJA 5GMDA 4USMA 4JI2I 4PRXA 3D4JA 2X36A 4DR7E 3OTOI 3J81C 1Z5AA 2DEJA 4B3TI 4FWDA 2AJ4A 3WU3A 1IBKI 2UXBE 1MU5A 1Z5BA 4DPXA 3K1JA 5FLXQ 4DV0I 4JG4A 4UT4A 4NXMI 4DU7A 4P7AA 5LMUI 4MYUA 4DXLA 1Z0GA 4LF4I 2HKEA 4DR1I 4DV4I 5GMEA 5A2QQ 3Q1QA 1ZXNA 2A2DA 3ZM7A 4LFCE 1FI4A 3K17A 4LF9E 3J81Q 1FKAE 4DR2I 1IBLE 2HK3A 2E1RA 2DEIA 4DUZE 4GKJI
chains in the Genus database with same CATH superfamily
1YHQS 3PRBA 1BQXA 3TYTA 3BBBA 2NS1B 4LF6E 3MEGA 1BMQB 5CQGA 3MD1A 4JV0A 3N6MA 5IM0B 1L5UA 1N33I 3TUZC 1PBAA 5I3QA 3M6XA 3M7VA 2YWKA 5EUHA 4YHHI 1KHVA 2O67A 4FW9A 2F4VE 3CDEA 4Z37A 4OZ5A 1RE1B 2C38B 4ZA1A 2ZH5A 4IQMA 1NK0A 4ED4A 5KFLA 4IZJD 3D6HB 1KQKA 2GJIA 1RTIA 4N8OA 1WTBA 5C25A 4OHYA 2V69A 4LFAF 5E3CA 1TUWA 4AIMA 1RHUB 1SQGA 2EWHA 2F65A 1TQLA 4NA1A 3NS5A 5SZTA 2ZBIA 3MPWA 4PWWA 4M5KA 1S16A 5KFFA 3OFHA 4F4KA 2F8MA 2AYBA 4DMZA 3LPEA 2QTWA 3BGUA 1DRZA 1XMOI 2ZKUA 1RWWB 3GFXA 1RWKB 4QOTA 3TEHB 1UDNA 3M8SA 4TY8A 5IT9C 1WG5A 4DL5A 3FDSA 4NX9A 3ETMA 2IVMA 5H1SV 3CD6S 2DRAA 1F9EB 2XC9A 4ZLLA 4LBPA 5J2QB 2XS7A 1KDNA 2G0JA 1IR1A 4ECRA 1VS3A 4DL2A 4TKTA 5KFKA 1F5BA 4DS5A 2I6WA 5EGYA 3CCWA 1LWEB 1KSPA 2JOQA 1H7UA 1Y5NB 5DG9A 3LPSA 3L09A 3VAKA 5B08A 2YPZA 4RWWA 3GE9A 3POTB 5A76A 2L41A 2POKA 2ZH7A 4Y0FA 3PG9A 3ULHA 1HNXF 1NEEA 4X65I 4ES2A 2BA9A 3W5YA 1Y5IB 1C1CA 2LQ9A 1HWIA 1SL1A 5FJ4A 4ZP8A 4EU0A 2EK6A 2Z58B 2AIRB 1I94F 4RLEA 2VICA 4BWJA 1J2VA 3PS2A 2MGZA 1DLOA 3LGMA 2RMLA 4R0EA 2VQFE 2RF2A 2OH2A 2XWYA 3Q2SC 3TWZA 1FRMA 3T19A 3BSOA 2ERRA 1F6TA 4HYMA 4HH0A 3NKYA 3MD3A 1XERA 1UJ4A 1Z1ZA 2H51B 2IVYA 1Q16B 2YWHA 3KUHA 3GZ7A 3GLLA 4O44B 1R6LA 1RAEB 4ED3A 3R5AA 3CDWA 2OO4A 4LIRA 2AX0A 3KK2B 2RRNA 5KFEA 2UXCF 1R8HA 1X4BA 1LW2A 2DNRA 1FRIA 3X3UA 4DPUA 3A3PB 3IGVA 2Z5BB 3AB4B 4LRAA 4DR3E 3AJ1A 1C4AA 5L46A 1XNRI 1NMEB 3IR7B 1FJGI 4ZHRA 1B7FA 3E3XA 2GMHA 1N0UA 2V8HA 3MR2A 5JEAA 4DFMA 5G0RB 5E3QA 5JEAE 2QSFA 4OZEA 1S48A 4QYZJ 3JXOA 1HNVB 2J9DA 2D1CA 1VQ7S 4QBUA 1NDLA 4ZPVR 3KG1A 4NYOA 4JBCA 1JLFB 4E2FB 2V4JB 1PCAA 4JV5I 4LMZA 3QMQA 1I3OB 3GMGA 2YKMB 4DR5I 5HROA 1VR6A 2B6AB 1JKHB 2VG6B 4W4MA 4X65J 1PC5A 1PC4A 1S1TB 3PYGA 3CULA 2VG5B 4OX7A 3W2WA 1YRXA 4H4KA 4O3QA 4CLUA 2GQQA 3CD5A 3Q6NA 5C5JA 4WTOB 3CEDA 4LRFA 1B99A 4J9LA 3RAMA 2RHSB 3GU0A 5B0EA 2DNZA 1OPZA 3DRPB 2H65B 4JI8F 5J1PA 3RZAA 4C8NA 3CCZA 1B0PA 1N5VA 3TVYA 3FMBA 4QPXA 3VVUA 2IJNA 1SJFA 3B6BA 2C3UA 1K8AT 2VU5A 4USVA 2JEBA 2H1YA 3V4IA 1QAJA 1CQMA 4H4MB 1WC4A 4DU7A 4NOHA 2A2DA 3PCOB 1E6VB 2ZE2A 2VPWB 5BJRA 4LF9E 4IRCA 4WWSA 1SPBP 3NOGA 2CUYA 3JSYA 4J9UE 1S77D 2DGSA 2ZFHA 2UXDE 3BH6B 4IR9A 4NBQA 3EZUA 2I5JA 1RWMB 2DR5A 4ZPBA 1HMVA 5HMXA 1FESA 1QY7A 4BDPA 3FVYA 1OQ6A 2CQ3A 3T1HI 4TQSA 2G0CA 3T6BA 2UUBI 1U1KA 3CMES 1H74A 4WPAA 2DH7A 4U8YA 3CNQP 4NLTA 4F3OA 4LF5I 4AM3A 3K57A 3RJMB 3R6LB 2YNGA 4FXDA 1HBNB 4Q8FA 3OQ2A 1EETA 4XIUA 5FDLA 2UU9F 1QLNA 2EFQA 4J37A 3ILLA 2BA1G 1H2VZ 4GVBB 1AUDA 1G6BA 1TV6A 1GXTA 2R7XA 1U6ZA 3QSIA 4IO1A 4M5GA 3UFCX 1AZSA 3GJTB 1Q95G 4P10A 4K0KJ 4OI6A 3BDEA 1NSPA 1APSA 3HPOA 3EVOA 2PEHA 3M6AA 2XMMA 4JUZA 2YWWA 2FZGB 4DR7F 1SUQB 2ZZNA 2GZOA 1IKYA 1HLWA 1LW0B 4WJBA 1HHSA 4HACB 2DGXA 4C3KA 4ILRA 3N5BA 2QFIA 2UXBF 3O5TB 2JVRA 4ZJOA 1RKJA 1MMDA 1D9FA 5IFMA 4M5LA 2N4CA 2PEBA 1NKEA 4E0DA 3PEJA 4S0MA 2LFVA 1RAGB 4FBTA 4X66E 1NAQA 2VASA 4URGA 4M5MA 2NUUG 4ZPTR 1HWJA 2KRRA 5DZ7A 2KDOA 3O1LA 1NDCA 1YRTA 2AMCB 2RAQA 4G1QA 2CZ4A 3GIRA 4JI0F 1VCTA 1AUSL 3MTKA 1IWAA 4U7UD 2RJZA 1LV5A 3IBCB 2XI3A 1HYSB 1N56A 2VPXB 3FMWA 1VRUB 3DRSB 2C39B 1C0UA 3KK1B 2MSTA 4PG4A 4QU6A 1T3NA 1HWKA 2IRYA 1YJ7A 1FX4A 2PO1A 5F8NA 2QIFA 2V5HG 4C0BA 1RHKB 1G2EA 3TR5A 5LT5A 3SIPB 2YNFB 2DCLA 1HBOB 3R7BB 3ONQA 1N34I 3Q89A 3NGTA 2FLOA 4DX5A 4IG0A 2Y0BB 4CLFA 3UN2A 4RNFA 4DFPA 1VBXA 1N8RT 3PS1A 3AY0A 1RUSA 3DI6A 4ED5A 4HEA9 1P6TA 2JLEA 1O51A 3MMAA 2CQ4A 4OHWA 3AJ2A 1N32F 1YWXA 5CYQB 1G4CA 3QRPA 3BB5A 1MLAA 1F1BB 2DNHA 3V6HA 1SC3B 2DTJA 2D9PA 5K8NA 1FKOA 3MPDA 1O0PA 2BA1D 1NK5A 1ZPVA 4HT5A 4CM0A 2OUGA 4F4AA 2WVBA 1Z0TA 2OTJS 4DF4A 4N56A 1PILA 2CQ1A 5D0HA 1XMQI 5K20B 3BBFA 1CULB 5L9NA 4LF4F 2WSEC 4ZVEA 2FLPA 4F3MA 3UE2A 2MB0B 1HQUB 1TKTA 4HKQA 4KE5A 4UY8T 3TANA 4D3HA 2Q6BA 1RAJA 4CWBA 1CJKA 2V4QA 3VAGA 1ZM4A 1FRLA 2QSWA 4QW8A 2FC9A 4PYAA 3NGUA 3PRDA 3AD8C 2PNMA 5KFQA 4B3SJ 4DV7I 3GV8B 2MHNA 1VJQA 3QLHB 1ZH5A 1HNWF 2JEGA 1D0EA 3EYZA 1S49A 3RRKA 1QVFR 2ILYA 2EFVA 1X4HA 2DYAA 3GFYA 2DCUB 4NLXA 2A0FB 1HBMA 4ICLA 4WE1B 1M1GA 1QAXA 4PQAA 3MZIA 1S9GB 2CA9A 4OZ3A 1S9EA 5A2QC 1PYOB 1EIYB 4PRXA 2HHHF 4O0NA 3NWRA 4DQSA 4ZS6A 4TU7A 2C2RA 4OYZA 1VQ5S 2KN4A 1OSCA 1VYAA 2FZCB 1IBKI 2ZDOA 3OTOF 4GC6A 4DZDA 4DJBA 2IPOB 3LGHA 4U7UK 4A8QA 3I5BA 3UVJB 1F0XA 2WOMB 2VG7A 4WU2A 1IKVB 5LMUI 3KHHA 1Z0GA 3L4BC 3BDPA 3CDUA 3D1HA 1VHIA 1VQ9S 3ZM7A 2BANB 3CGIA 4BC7A 3J81Q 1KLNA 2HK3A 3QZ7A 3CCRS 1FWLA 1KFSA 3K7RA 5KT4A 1IUJA 2CRLA 2WB4A 4QIVA 2JWNA 3DLJA 4FVCA 1VBKA 4YR3A 2GAHC 2GS8A 2IAJA 2FC8A 3C15A 4JI6F 3DRRA 1XMQJ 2OEJA 1H7SA 3SQOP 1FJ7A 2KJWA 2ATLA 1ZOTA 1RTJA 3T41A 1WACA 2PFFB 4A4JA 2W9BB 1GEHA 4X65E 2C37B 2E7VA 2HBZB 4B3OA 4EK2A 4M5DA 1RU1A 1NSQA 1WEZA 4LFAI 4X4VA 2V0NA 3H90A 1RWNB 5AXLA 4CQ1A 3VALA 1UA0A 1XXEA 5F3TA 1LEOA 4JYAF 5DETA 2C2ZB 4X4TA 3GFHA 4IDKB 1YZ7A 3BV8A 2RDIA 5KG5A 4U8VA 1F9HA 4FW5A 2RQ4A 2HAFA 1NZAA 5LMNF 2ZH9A 2WONA 2FJDB 4ZMMA 3A4TA 4NLSA 2QLXA 3IM8A 4QWDA 1C1BA 4OL8A 2EBGA 3T9NA 2EPIA 3MECB 5KFUA 1S0VA 1RHRB 4QR0A 1C0TA 3KJNB 1BQMA 4IG3A 1NSAA 1H0HB 4KY3A 2IIHA 1EP4A 3DYAB 3Q22A 2FVRA 1KVKA 1TU0B 2IERA 3EGNA 3OL6A 2L9DA 3KG0A 4ECQA 3PDNA 3QWPA 1HNXI 4IRDA 1J5OB 2ASYA 5FWKA 4URSA 1QE1B 4DV2I 1HIYA 2KHDA 1USVA 2RKIA 2XHWA 2UVVA 1I5OB 1XNQF 2ZHOA 3CJ2A 3E01B 2MZRA 5KT5A 3QT7A 3PTWA 1I94I 2B7CB 5JEAD 2UVUA 5I3PA 2B7BB 3H4LA 3JQKA 1TL7B 1KBRA 1RTDB 1UVIA 2BJ7A 3BSAA 1FERA 1TK0A 3RB0A 4NLYA 3RBXA 1U1NA 1FXDA 2B3TB 2ZWPA 1EB0A 4K0KE 2JE6A 1WKLA 3BYPA 3AJDA 4F25A 2M8DB 1HWUA 1REVA 3ICLA 1PYSB 2HAIA 5C0XF 4H4OB 1KR4A 4PG8A 4LFAJ 1WWHA 1X31C 3I0SA 1RT7A 3H4DA 2E5LF 4C8ZA 2UXCI 2JSXA 1W26A 3GWCA 1JLAA 1MMNA 3MI7X 4NPOA 1D9AA 1JNZB 1F5CA 4X4NA 4FXVA 2BQUA 3KJFB 5DO2A 4CO1A 2Q1LA 3GFZA 4X4PA 3ZZPA 3NY0A 4DPWA 3NBPB 1N5QA 4KKOB 3QJPA 2E5IA 4R5PB 2W7PA 5LL6R 1SJQA 2DNMA 5L38A 2U2FA 1MN7A 2CG4A 3G6VA 3HSGA 3KWMA 4L74A 3BQ0A 2BM0A 1QUPA 4F8RA 4LRDA 3CC7S 4I2QB 3M1VB 1Z0VA 5H9FJ 4WP9A 2KYZA 1VQOS 4QPTA 1TKXA 2HZCA 4V19J 5HSPA 2DNYA 1AT1B 1RABB 1SKWA 2JJ4D 1HNXJ 5IM0A 1SXLA 3KDNA 3GR0A 3MOJB 2DITA 3SQGB 1A9NB 1I94J 3CCTA 1RLCL 4LF5E 2D3O1 2OFGX 5L39A 3FEYB 1U0HB 4HYKA 3QRRA 1T9XA 2BUNA 5A8KB 3CIMA 2AEMA 2VBYA 2Y8WA 1XR7A 2KHCA 4JI2I 2HMIB 2D69A 4K2JA 1WELA 3SFGA 1WI6A 1HQEB 4QWCA 1K0VA 3AA9A 3AQPA 4PQUA 1R43A 4B3MJ 2BE2B 2VKRA 2BX6A 2SXLA 2YKNB 3LAMA 2UXCJ 1TFYA 5JVGQ 2O1UA 4MDTA 5KFWA 4ETXA 2EKYA 2N82B 3C16B 3DLBA 4P7AA 2ZKTA 3MCSA 3V81B 4A8MP 1MMLA 4DV4I 1OQ3A 3RW7A 4K4SA 1AFJA 1JLQB 2F8HA 2LCWA 4DR2I 4HI2A 5D4NA 3DLKB 4LQ9A 2RQKA 4CLTA 4CNYA 2JNJA 4CO5A 4DV0J 2YWGA 3UCGA 4NLGA 2ALYB 4QNJA 1XK8A 4GKJF 4UF4A 5IWAF 3AD9C 2MEWA 2C2KB 2HSEB 3HCXA 2L48A 1X4FA 3POTA 1VQMS 3L9ZA 1EX8A 4B3SE 3DU6A 4ECZA 2OIHA 2WW8A 3HULA 2VF3A 3PYDA 4WYLA 2PGCA 2UU9I 1PVGA 3CC2S 5J2PA 4DN0A 3G2XA 2HGMA 1JLGB 2CPDA 2CQCA 4O3SA 4NCGB 3LUYA 3D28A 4X64I 3PJWA 2O1PA 2BJ9A 2B4OA 2CQ2A 4L6V3 2NN6F 4DR7I 2EVZA 1I51B 1N34E 3T1YI 3Q23A 1U26A 2VC0A 3CDAA 5EL9A 5DDOC 5A8WB 3D7SB 3N79A 1Y60A 1RT1B 4O44A 5K36A 4O0IA 5DM7Q 4DG1A 3E2EA 2GIFA 2BR2A 4JI8J 3TJAA 2VFSA 3KK2A 1SV5A 3C6UA 1S1VB 4OZLA 1T0TV 1SKRA 2Y9HA 5C42B 1V3ZA 2VFRA 3DU5A 4NLRA 1F9FA 2EC0A 3L7PA 1X0PA 3GTYX 3CVKA 3N0VA 4FW7A 2WP8A 2LYVA 1H2TZ 3SV3A 1V9OA 4KSEB 4CH7A 2PO4A 3FQKA 4EZ9A 4TNOA 1XMQE 3DRYA 3T3FA 1X9MA 1UL3A 3L95X 3H20A 2W7OA 4MJKA 1FNMA 2IOQA 4XTJA 2Z8QA 1UVKA 3SEOA 4GKKF 4B9TA 4ILLA 2IDLA 2IC3A 3US5A 2ASJA 1TVRB 5I4MA 1LWCB 3UD4P 3AFGA 4JI3F 3I4HX 5C0XB 3NZKA 3UN3A 1JLFA 3IXQA 2V4JA 2BZ2A 2PIIA 1WHWA 2VV5A 2JT2A 4FS1A 4ZCKA 1W7WA 2KTQA 2ZC3A 2H5IB 5D8HB 3R5DA 2B6AA 1A7GE 3FCHA 2UU9J 4U7CA 4HVZA 1CJUA 2UUAJ 4AD6A 1JXEA 4Q44A 3O8WA 2C3YA 3KKFA 3NNCA 1N32I 2AEFA 3MEDA 3K8WA 4TXSA 1F2HA 4C9DA 1X4GA 2WAQD 2C2MB 3LP1B 1K1QA 4N8NA 1T95A 3G71S 3DLEA 2W1BA 2H48B 1RCOB 1E3HA 2CQGA 1O5JA 1EJ7L 2UXBJ 4RW9B 2CFXA 3M8ZA 3M8RA 3MM8B 4LFBF 5L1JA 2WVCA 3OR2A 2HZAA 4H4MA 4ZJLA 3G86A 2M2BA 4FYVB 2QG9B 4MU3A 2R7RA 4PWDB 4FPRA 1WHYA 1UWBA 3CCLS 4DR1F 3BR9A 2A2CA 1FKPB 1E6VA 4WKYA 1TTHB 3FK4A 1L3UA 4M94A 3GIJA 2BV3A 1FHTA 4JI0J 3HD2A 3R3TA 4LREA 5DDRC 4MKYA 3KLGB 1QD1A 1WEYA 4J9PA 4DR6F 2C28A 4Y6IA 1KQFB 3J81j 1KQGB 4USKA 2AX1A 2NXNA 2IM3A 3GP9A 1R0AA 1Y5LB 4DV1F 1CC8A 3HHLB 2KXHA 2DNPA 3JSMA 4JI4F 2O1VA 2HVIA 1HNZF 3I32A 3RGIA 2CNOB 4LFAE 4HR2A 3EE3A 2OMLA 2GJ2A 1RTHB 1HI1A 3W7BA 4DWIA 3ITHA 2YH0A 5CA5A 5C2CA 2BJ3A 1VIXA 3OTOI 3QWUA 5IV4A 5HI7A 3I9V9 3LF0A 2QO3A 2RH3A 2VHGA 1ACMB 3Q6MA 3A13A 2XZWA 4YUDA 1Q81T 2W9CA 5J1EA 1LW0A 4JI5J 4B3TF 1N6QB 4NXMI 1WEXA 1N32J 2BJ1A 5GMEA 3SCJE 4BLGA 2APOA 1X4DA 1T9VA 4USUA 3MEEB 5T41A 4IFDC 3W60A 3PR4A 3EXYA 4M5NA 4CRJA 4JI6I 5HVHA 2CNLB 3IBFB 2MY7A 3TAPA 4U67Q 2PDAA 2V8PA 4LF4J 4MK9A 1HNXE 4RU9A 1OYSA 1S99A 4P52A 3ZZ0A 4NXNF 3WHIA 2O1TA 2RB7A 4B9NA 1BQNB 5IS2A 3H98A 5HATA 1RAHB 5BR8F 2W9AA 3G87A 3G8TA 2ZWOA 2CPFA 1I94E 2NN6B 1IXKA 1M5PC 4C8OA 2HNYB 2HYIB 2Z56B 4JYAI 3KK1A 3NLCA 3PRYA 1CS4B 2M4MA 3M2UB 3QFHA 1TKZA 4P6QA 2ZOGA 2Q2EB 1HNWJ 2RSQA 3CJKA 5AE1A 2AT1B 1CJTA 2FY8A 4Y34A 1HBOA 4U95A 5LMNI 3DOMA 2ZM6F 3A3NB 1F3VA 4WFAQ 5F8MA 4Z7CA 2B4UA 1WC6A 4X2BA 1T02A 2OPSB 3BGFA 3D1OA 4PYDA 4ZVTB 2UXCE 2HHHJ 3KTQA 3QSYB 2V63A 1VGYA 4O4RA 3PYEA 3P3DA 1KRPA 3MPVA 2AE8A 3NCRA 1ICEB 5GADU 4QYZK 1UDSA 2BR0A 2LEAA 5CYQA 2Y1IA 1S10A 2YWFA 1GNKA 4LFCF 2W4DA 4KHPI 2MKIA 4DV0E 3CUNA 3ET6B 2N4DA 1N36F 5IC4B 1EI1A 1WOOA 1LWXA 3OSNA 3P4UB 1RI7A 1XNQI 1XTZA 5LXYA 4ECYA 1NHIA 1FDDA 2GNKA 1CULA 3ENAA 3DLGB 3JS9A 3LP0B 1Y10A 4WUCA 2OPRB 4LVNP 1KOHA 2XSJA 2BDPA 3M7NG 1RT4B 3L7ZA 2FIUA 4DSFA 2J76E 4LBHA 2LA4A 2R7WA 4JI6J 5ETNA 4X4OA 2DKOB 3JAMQ 3SXLA 1DZ5A 2JC0A 1GMWA 3G6ES 3UHMA 4FN5A 4F2RA 4ZN3A 1KTVA 2DO0A 1NO8A 5HMYA 5B0FA 4YB1P 1SKSA 5K14A 1RBLA 2HWHA 4K4VA 2Z2ZA 4TYBA 2BRLA 3BQ1A 5EX0A 3CJ8A 1TMMA 3DM2B 1AB8A 2K2PA 3OVSA 4JYAJ 2VONA 1QAYA 4EGLA 2XMJA 5DQHA 3BYRA 4WE1A 4FYWB 4JI8E 2FHOB 1S9GA 2GVDB 1MU2B 4CLZA 2ACMA 3VV2B 4OZ2A 2MZQA 2JFDA 4PUOB 2PD1A 1V5VA 3S7RA 1Q4RA 1J27A 4WP3A 5KFOA 2V67A 5IV3A 3OFFA 2FHKA 2MKYA 1RREA 2IYIA 3DOKA 1S79A 4RW4B 4IH6A 3H4BA 3IRWP 1UTAA 1LWFA 1DHMA 2QMXA 1UZHA 2A6OA 4DFKA 2KU7A 1M1HA 1XHKA 4WYWA 1EHWA 2RRBA 5I42B 1IKVA 3A12A 4DX7A 1S1XB 1WOPA 1D6TA 2D3ZA 2GCFA 1B0VA 3GSDA 2DPIA 2OMOA 5CYMA 2L08A 4EZ6A 1SH2A 3CB4A 2DXFA 2BBEA 3NS7B 4RWXA 2LQBA 1WDTA 3QYYA 2GO8A 4RBVA 1N33F 3N28A 3NS6A 1GT8A 3KXDA 2HEKA 3LPYA 2LECA 3I31A 2UU9E 2CPHA 2YQ0A 4NZ0A 1VQLS 1DTQA 3N5FA 5KT6A 4TN2A 4ED6A 2GHWA 1WG1A 5ETMA 1FNOA 3QNWB 2QGFB 1WC1A 4UOHA 5KFSA 2RUSA 1OO0B 5AXMA 2AJQA 1BLUA 2QL5B 1VMBA 4HHUA 4DR7E 3C14B 1IWGA 4KGVB 4URQU 2MHEA 1VQKS 4X84A 2CJ9A 3P49B 3M7ND 2E5LJ 2GIRA 1PGZA 2A6MA 4FBUA 2HGNA 2UXBE 3AT1B 1RISA 3TEGA 2LDIA 3F41A 4ITSA 5ETRA 1VLOA 3HP6A 4IFDF 3R5BA 5F8JA 3DGVA 1XMOF 2MZ1A 3MUVP 3J81Y 2CZVC 3AXKA 1IM6A 2GVZA 1FI4A 1X5TA 3MECA 3TAMA 1MNEA 4GKJI 3EICA 2NZCA 4YB6A 2OEMA 2D9OA 4JI0E 2EW9A 2CDQA 1UA1A 3CDBA 3PX0A 2W24A 2K7KA 3ADAC 4O4GA 2XULA 2F8EX 4XPEA 3UDVA 4DUYI 2UUCI 3IG1A 2MKKA 4IZJA 2JEIA 3R5GA 5D4PA 1Q79A 2J5AA 2DH9A 4ZPCA 2HHUA 2W7AA 8AT1B 3Q8RB 4IFVA 3F44A 3CF5Q 3BKFA 1GFWB 1R6VA 3M8QA 1RGVA 1RTDA 1R6MA 1NZ8A 1R0BG 4FYXB 4ZIWA 1KTQA 1KN6A 5HBMB 3HM9A 1S7HA 1PBUA 1VK8A 2C3MA 2E5HA 2DISA 4CTAB 2MTLA 4F7VA 3CJRA 4MT1A 2CQDA 3QIPB 4KO0A 2J7KA 4K8RA 1SQFA 1Q8KA 2AU0A 2RU3A 1OYRA 4NL5A 4JI5E 4ECSA 3WC2A 1HR0I 4MIAA 2J9EA 2VQEI 1SB6A 2V94A 3FZBA 3L3CA 2VFTA 1JLCB 1N32E 3D68A 1B62A 3T5LA 3KK3B 3CJQA 3MTJA 2HRTA 3UR0A 2EI5A 3M6WA 3SDEB 3VQSA 4NZ7A 3GV5B 2ZUGA 4BA1B 1URNA 2RQMA 4AUKA 4LPFA 4X4UA 4MIWA 1VQ8S 1JK9B 2AEJA 3NBPA 4ZDNA 2ZNZA 2NPFA 4NLQA 3NXZA 4LF4E 1XNRF 4DL4A 4GKKI 1FJGF 1JJCB 5KFGA 2QMWA 4CLWA 2X3DA 1NH7A 4FP9A 3WU6A 2C22A 2FQQB 4GKJJ 1GMVA 5IWAJ 2H5JB 1S12A 2FB0A 1Y9OA 2GMLA 2H5EA 3RRHA 1HNWE 1KD1T 4JV5F 2CJXB 1H6KX 2C3PA 4K4YA 2PI4A 3HKWA 4I7FB 4PWUA 3SQGA 2BQ3A 2O3DA 4PEOA 1Q86T 4M8LA 1TL3A 3DHXA 2N7YA 2ZJQQ 3Q8SB 2HHHE 3JTPA 1CQNA 4H4KC 1HKAA 4C11B 4B02A 3M8WA 1IVZA 4J9SA 5JMNA 2ZNYA 2WRMA 2HMIA 2VA2A 3OTOE 1LKZA 2HRUA 5DRQA 1ZTTA 4KIAA 4LFBI 3W2VA 2LXUA 2QC3A 2L9NA 2QLJB 3OVAA 3KHRA 3PEHA 5E3AA 1D09B 4NI2B 1N5TA 2OAUA 1UVJA 3V81A 2XGQA 1H2UX 1SJ3P 2V2VA 1AFIA 4AYBD 4I3HA 2QE5A 4IFYB 4Z7YA 4DR6I 2OGUA 4XTTA 2YKAA 4DV5F 2FVCA 2G2YA 4QWAA 2B56A 3DLKA 1JXVA 4JI6E 2QL9B 4Q0BB 3V6JA 1U1OA 3CCES 2K1RA 2DNKA 2DXEA 1T9UA 4JI4I 1SC1B 3CMQA 1RAFB 1CJVA 2FJVA 3OL8A 3LANA 3ZTPA 2WBMA 1S7IA 3W65A 4J9RA 3M2RB 2ACYA 1OJ4A 1K44A 3J7AG 3EGWB 1TR0A 4UUXA 1FXRA 3FBCA 4I64A 2UUBF 4RW7B 4ELTA 3CMAS 5ETSA 4JI3J 3AODA 1R6YA 1UFLA 1YJ9S 4JYAE 2VPYB 1Q5VA 4NCGA 2BA0G 3DC2A 5ADZA 4CIOA 4G65A 4LOMA 1FE0A 3H7HB 3NGKA 4RNOA 3PHEA 2YNIA 1UDQA 4HTIA 1XBWA 4IFDB 4B3TI 1T9TA 2ZJRQ 2AJ4A 1K9MT 4K4XA 1YDLA 3I0RB 1PAEX 3CDJA 4QIFA 2NCKL 3ISNC 4ED0A 3I55S 3THVA 4PXDA 4NE9C 2B5JA 3BGOP 2ZH4A 2HVEA 3R8YA 4K59A 3E51A 5M2UA 4UQGA 5KG6A 3PXGa 4B08A 4EUVA 3T5KA 3TZWA 3WC0A 3BGRA 2DRBA 1OMSA 4QW9A 2GMJA 2LEPA 3D6FB 2DRDA 3M32A 2MY8A 4DR1J 5BYSA 4OV1A 3H25A 2UVWA 4YY3F 1N4LA 2R8JA 4KBIA 2BE7D 2OD4A 3KRNA 4DV6I 3RAQA 5HANA 1RAAB 1YJTA 4DR6J 3QGGA 2VQFF 4JI1I 2VESA 4ECTA 3DLLQ 2CXEA 1LWCA 4DV1J 1SH0A 3LALA 4JI4J 3OUYB 2ZM6I 2W8KA 1KEKA 2IFXA 3DDNA 3DN9A 1M5OC 1ZA1B 2Z2YB 1HNZJ 2DNGA 4MK8A 1GH8A 5C0XE 4QR2A 3M4XA 4F26A 3ZFVA 3OPKA 1MN9A 2DVIA 3W64A 2E5LE 5D3GB 2XS5A 1GMWD 3CCSS 4MMOA 4WFXA 3JYTA 1Z2LA 2HFVA 4Y28C 4NRTA 1HL6A 4M5HA 4DR4I 3M9MB 2XYPB 4DR3F 4PCQA 2A10A 4R8UA 4A8XA 2AP6A 1FFGB 4K50A 4DX8H 2X1FA 3SYZA 3V5RA 4FW6A 2NXUA 2ZITA 3TZXA 3LP1A 1UEUA 4LCGA 1N36I 4U3DA 3MPYA 4IQXA 2Q6CA 2K06A 4U3BA 3J80Q 5H9FK 1VIOA 4WFNQ 2BA0D 1SBRA 4NRUA 1NU4A 3S8SA 1JJ4A 1S1UA 3UW1A 4DPYA 3EZOA 1NBEB 2KT5A 1U25A 5IT9Q 1F60B 2XYHB 1IR0A 4RW6B 1IBCB 5D4OA 4USHA 4CCHA 1ULRA 1XWLA 3QO9A 2HFSA 2F9DA 2PMZD 4NXNJ 4X62F 4K7QA 5IQQA 1U1LA 2IA0A 5BR8J 3GQCA 4NMXA 1D9DA 2BACA 2YKOA 5IZHA 2ZBRA 5DRKA 4UY85 4DV7F 1YVFA 4RPFA 2X1AA 3H59A 4WTYA 5B7WA 3EGVA 3KLHB 2PMHA 1RTHA 1L3VA 1FWKA 2V2ZA 2LMIA 4OLOA 4A46A 2AWZA 3G82B 3P3EA 2M52A 4I4BA 1ZAXA 1Y4SA 1RXOB 2E66A 2G9OA 3MCMA 1SIWB 3LTOA 2V8DA 1RYSA 3J7YI 1WSRA 2NLWA 5J2NA 3W63A 2XWXA 1SKUB 5A0YA 2A1BA 5D0EA 2K3IA 1BWVA 1IBLI 4IZKA 4WFZA 1IBKF 3PJ9A 5LM7E 4OQJA 3TVZA 3OD2A 1QAIA 4KQVA 3KJVA 2XNRA 1NHVA 3H2LA 1QVGR 1YK9A 2R7OA 4F67A 5LMUF 3DD6A 1QTNB 4LFCJ 4Q5VA 2IDEA 1PG5B 1RWUA 1UEKA 1IKXA 2F3JA 1GMUA 4LQ3A 2UUWA 1S6PB 1S4EA 5LXRA 3PW4A 4GKJE 2YH1A 4CT8A 3D3CJ 4HL9A 3VVTA 5IWAE 1Y11A 5AE2A 3BJYA 2E9RX 2YVSA 1Z0CA 1VDHA 3VAJA 2C2EA 1JLEB 1IKWA 3MMCB 5C25B 1RA7A 1BKNA 4CI0B 5KOXA 5T14A 4ZPWR 3AOCA 2Z5CA 2OLWA 3HI9A 1VBYA 1NDKA 3KLFA 1FJEB 4DV3F 3O2IA 1NJWA 3UWTA 3FBBA 1VQ6S 4GO7X 3I4PA 3KJQB 2FHJA 1PJ5A 2NN6E 4LR7A 3BPSP 5KFMA 1CS4A 2QV6A 3D9BA 4FKYA 3EDRB 3FQLA 3EMTA 4OYWA 3I9ZA 4WK3A 2X36A 4ILMA 3U1YA 1FTCA 2ROGA 1DTTA 1NJIT 2AKWB 4RX6A 4AE5A 3IWNC 3GG0A 3EXCX 1YSJA 1HBUA 1FJCA 2NSBA 1Z5BA 5FLXQ 1UAWA 1X0FA 2LQ8A 1X9SA 4MYUA 4EEYA 3PIOQ 3CTRA 1FA0A 1RT3A 2J6TA 4FZVA 4Y2AA 4Y2CA 1K1SA 3G8SA 1XJWB 3OR1A 5IC6B 4G3IA 4RNMA 1PKUA 2IBOA 2ZD1A 4KAIA 4M5JA 4P73A 4C7QA 1DQ8A 4PG5A 1ZBTA 3QIDA 2AV5A 2MGZB 2FLNA 4OZNA 4GKKE 1T11A 3PR5B 2MKSA 2RF2B 2NUHA 4CLYA 2HS0A 4PKDB 1ZA2B 1TP7A 4DV2F 2W2QP 1HK7A 4L76A 1U6FA 2CPIA 4JI3E 4Y2KA 1K73T 1OYDA 2JZ5A 2HRYA 4P2FA 2B9XA 1RT4A 3V2UC 5KFRA 4MU0A 1RT5A 4DS4A 1Q78A 2XHCA 2FGCA 1N33J 2ZUAA 2Y8YA 2HHWA 2Z0GA 2XY5A 1GXLA 4DSKA 1LW2B 5K9FA 1MW7A 4CP5A 4YHHJ 2IY5B 2MQQA 2DGUA 3GPAA 1L3SA 3DM2A 2W25A 2R3VA 2X1GA 2VFUA 4C2MA 5C2GA 4WP8A 1S76D 3P76A 4ZHRB 4K4WA 2VODA 4A8WA 2ZVSA 3MM9A 3KLVA 1S59A 2P6SA 3FNNA 4N5SA 1N5YB 4P2MA 1CG2A 2GVDA 1FRHA 1MU2A 4RNHA 1B3TA 1M5HA 5CXTA 3BSNA 1E6YB 1NK4A 4LFBE 2DO4A 2V8GA 2E1PA 3P3CA 3B4DA 1CEZA 5B09A 6FD1A 4RW4A 5ETTA 1ZXMA 1XMOJ 3B4TA 1FWPA 3PV8A 4W90B 2MJUA 4DR1E 4F4WA 4OHXA 2HHXA 5GAGI 3S6EA 4LF1A 1IBMI 4ZLPA 5HLFA 3ILOA 1FT8A 4DR6E 4G1PA 4U96A 3JAMY 3LNUA 5KFNA 2QLWA 2GV1A 4DV1E 2XY7A 4JI4E 1DARA 4RR5A 2IYGA 1Q82T 1HNZE 5EDWA 5HL7Q 5DLGA 2YNHA 2GQ0A 1JXLA 3CJ4A 4AFFA 2KYXA 1RHYA 5J1NA 2V4RA 4P2XA 4FF3A 1DY3A 3VZHA 3CJSA 5K8MA 2JEBB 3V4IB 4RUBA 3MFIA 5EHHA 1EQMA 3WDOA 4AQYF 5DJBA 3VQTA 2XMKA 1JLBB 2F63A 2AQ4A 5LJ3Y 3HVWA 4USTA 1BY9A 4LF2A 3BS9A 4JI2F 1Y3KA 2ZE2B 4WKRA 2AZ1A 4ECWA 4B3TE 5HO4A 2OPPA 2QJ3A 3V6DA 1YLXA 3IRXB 3KUGA 3PW0A 2F9JA 2I5JB 4YDDB 3JAMC 1HMVB 1HARA 2XZTB 3OTDA 4LF6I 4DV5I 1SJ4P 2GQCA 2AYEA 4NLOA 1X4AA 4DV4F 1YJWS 2IA6A 5K8OA 3FEXB 3DMJA 2DGTA 4KV8A 1FDBA 3RRGA 3RB3A 2E9ZA 4YMEA 3BF4A 1XNRJ 4DR2F 2YNGB 1NZ0A 1FJGJ 3VR1A 4NXNE 3HK2A 1EETB 5FDLB 2ZBPA 5BR8E 1T05A 4ZVIA 1TV6B 5HJYA 1NLKL 3ENQA 1KKHA 1U09A 4XO0A 2HURA 3CO0P 3QPIA 1AZSB 1YRUA 1NB7A 2X1BA 3ZO7A 3GCWP 2DY1A 3BREA 3HSJA 1M0SA 3MEKA 4TU8A 2LXIA 4MFBA 4NA3A 1T03A 2NYIA 1WF2A 4DEZA 3UN5A 1UWAA 4UOGA 3NNHA 3OTBA 1Z2ZA 3RB6A 2IM2A 2EK1A 2QYCA 4G1IA 4A8SA 4X64F 3TO8A 4JV5J 2OPQA 4PPZA 4CO3A 3PVXA 1D3WA 1UVLA 3G6YA 4CLLA 2XLIA 4DR5J 4FKXA 2EKNA 4LBIA 4CTAA 4MU1A 1HA1A 3BEGB 4JP8A 4FWDA 3T1YF 2DGQA 5CAAA 1H3DA 2YKPA 2GIQA 3H5SA 1O8BA 2BE9B 3LWLA 3GLJA 2KRBA 4JG4A 3MMJA 2G4BA 4G1QB 4ZP7A 5LSRA 2CYYA 2EG2A 3R5JB 5A2QQ 5EX3A 3KK3A 4L3NA 4LFCE 4DF8A 5B0CA 1NJXA 4J5OA 4DQRA 2BQRA 3SDEA 3HZGA 2DEIA 1QSSA 2PT0A 1C0UB 2JFKA 2HBRB 2KT3A 4YY3I 2CKWA 1RP5A 3GYGA 3AD7C 2PO1B 1NCLA 2HFZA 4K4ZA 1RACB 3HF5A 4ZVHA 2VJUA 6AT1B 4DV5J 2VQFI 2CQ0A 2ZZTA 1U24A 1JJ2R 3I87A 4OO1C 1EA6A 3KLIA 2MLZA 2DR7A 4IG0B 3IN5A 2CPYA 1KLMA 2XBPA 3LGNA 2MMYA 5FD1A 2YX1A 3DI6B 3N6NA 2WK4A 3T1HJ 2UUBJ 5GAEI 3GJRB 2J9CA 4LF5J 3U1NA 4ID5A 1L3KA 1NRKA 4MIBA 4I7FA 1UZDA 3GIMA 1UP1A 4DR3I 1LFPA 3HHLD 2FPHX 1FKOB 2DHHA 1Q8IA 2DHSA 1AROP 2UP1A 4OYPA 5C0XC 2ZH8A 4DL0C 2HW3A 2ROEA 4UZBA 2GGPB 4RKUC 3ZTQA 2HS3A 4AIDA 1FRKA 4PG7A 2QA4G 1D8ZA 3W61A 1S6QA 2FTRA 5CZVA 2XM3A 2J7UA 1H38A 3D0GE 4FF4A 4CDIA 1TKTB 2M88A 2FDNA 4HY1A 2C42A 3VTIA 4ZVQB 1LOUA 2DJWA 2MQ8A 4ZN1A 3HKMA 3R2CJ 4IOBA 2CJKA 4RUCA 2MKCA 1N5SA 3ZTRA 4ENOA 5L1KA 3R2DJ 4QQBA 5KG7A 2XNQA 2KVIA 4K5SA 2BMBA 4X62I 2XGPA 2VD3A 1S97A 2CQIA 3MAAB 1TKDA 4YY3J 1NUEA 3W9IA 1B70B 2OSQA 2NREA 2P5VA 2EG1A 1N33E 4ZVRB 4ED2A 1S9EB 4Y2MA 3TQEA 2E1AA 3P8BB 3M2RA 4YHHE 3KDOA 3Q8VA 2R7VA 4OI0A 3MUMP 3MAHA 3RYLA 2E1MC 4K2XA 1WF1A 2DR6A 2V6AA 2HQ3A 5FIIA 2CDRB 2VG7B 4C0HA 4C8KA 2NN6D 5AJ3F 4CM2A 1N34J 2XG8A 1A6LA 2FHJD 3HHLC 3U1LA 2QLFB 1UW9A 1IQZA 1XR6A 2ROPA 2PMWA 4LF9I 4FXWA 2JDJA 3VAFA 1BC6A 1VLYA 2IBKA 4IFDE 2RDJA 1XMOE 2ASLA 2UXDI 4WXOA 5A6PA 4JV1A 2FYXA 4N7TA 4KR0B 4LVOP 1WC3A 1QTMA 4Y3CA 2BKOA 4F04B 5F8IA 2IAJB 3C15B 4NXMF 2B4PA 3NGSA 1FK9A 3NGRA 3EVMA 5CYJA 1R31A 4RL1A 2Z30B 1RTJB 1WKKA 3HJVA 4I6WA 4P75A 3OL7A 3R5CA 1VQSA 2QLBB 4B3OB 4UQTA 3RG6A 3RW6A 1QSYA 4M5DB 2CJAA 1S1WA 2EC2A 3HFVA 3JSRA 4B3SF 4DCJB 2ILZA 1T9YA 1ZZFA 4QCLA 3PKYA 3BN7A 4DV3I 3PX6A 1Z0WA 3R97A 5J2MA 1T8EA 1H98A 4ETZA 2R4FA 4HDGA 1UKUA 2GO4A 3Q8UA 4LR9A 4MK7A 2E7XA 3D6MB 2HGLA 3TI0A 4WXWA 4ZJQA 2M0GB 3EJMA 2WONB 5F9LA 4ELVA 2DHXA 5HP1A 4UTGA 4P7VA 3MOZA 1WC0A 2KI2A 2COLA 1C4CA 5GMDA 3K59A 4JV2A 4DV7J 5HAOA 4NASA 2UZAA 4JI7F 2AD9A 4JOUA 4WK1A 1G3OA 3TUJC 4CLPA 5EWGA 4J3DA 3OHBA 1C0TB 4FYDA 5K36F 3D0HE 5D3GA 1BQMB 3LQVA 3MM5A 3M6UA 4IG3B 2NN6C 2Y1LB 5DLFA 3T5HA 4BA2A 3Q86A 2MQLA 2JX2A 2ZVIA 4RUAA 3CCMS 5RUBA 1RQ0A 2KFYA 4C3LA 2O66A 4KFBB 1SJRA 1JIHA 2RKIB 1LNQA 2J7WA 5I3UA 3M8PA 1X4EA 3ENVA 1IBKJ 1YBTA 4OLPA 1S6OA 3DOLB 1XNRE 4L75A 4B9MA 4AXIA 3C2PA 3GCMA 2PO2A 1FJGE 1TL1A 4OO1F 4RBUA 4KHPF 5LMUJ 2H54B 1U0SA 5M2RA 2LA6A 1RBAA 4TQRA 2CIMA 3C6TA 3FSIA 3K89A 1VI7A 2XO7A 2F40A 5ETQA 2JE6B 4I2PA 4ERDA 3RB4A 1REVB 2F4FA 4YR2A 4OJHA 4WZQA 2WTFA 2BYCA 3QAEA 3NEKA 3I0SB 1Q0NA 1ZETA 1RT7B 2F7VA 1JLAB 3WX4A 2E9TA 2FJBB 4JV5E 2ZBQA 1NKBA 1P9QC 3Q24A 2ZC4A 1BXNA 4DR5E 1JQGA 2HNDA 1R0CB 3GIKA 3C19A 5IT0A 3N01A 3KMQA 3M30A 4DCPB 3D3BJ 3ENWA 2FGOA 2RUGA 4F0HA 2ZBKB 4N41A 3KYLA 1VBZA 2RNEA 1VRQC 4PZVA 1W2IA 3A8IA 4C0OC 4IRKA 2DBBA 3D66A 3J80Y 3MM6A 3OXFA 3GV7B 3DNCA 4LSLA 1T3OA 5H9EJ 4ZKAA 3Q0AA 3TOQA 1PAUB 3M2VA 3CJ5A 1RWVB 2HLTA 4TU9A 1TKXB 2BW7A 2HNZA 1USUA 5KFTA 5HMWA 2YBVA 2EFNA 3CT9A 3LW5C 5IT9Y 3A8EA 1NHJA 2JLGA 1TZ0A 4DV5E 2DHAA 4CZCA 2GHPA 3Q8PB 3MM7B 1P8GA 1XC9A 3OSPA 4MTPA 1YI2S 1S6PA 5HQ8A 2YTCA 3UR3C 1R7IA 4UZCA 3GSIA 2DIVA 1XMBA 1JLEA 5E7OB 3T1HE 4DV2J 3SCKE 3RUBL 3T6JA 2UUBE 5E0OA 3MMCA 1YQHA 1ZTWA 3P06A 1QSLA 2YPYA 3MGJA 4PXCA 4PQUB 5T7LB 2P2CB 3J80C 3HDSA 3VWSA 2HVHA 3KNAA 2C38A 4AQYI 3CSKA 2IOPA 3M9NB 4DL3A 4QJVA 1U1PA 3TJ8A 1OYPA 2BKNA 2OFHX 3M85G 1U2CA 1YITS 4DX6A 3UD5A 1FVSA 3MR7A 4IO9Q 4HXZA 5HVFA 4J9OA 4ELUA 1S0NA 4I67A 3HSZA 2CWXA 5IOLA 5DDQC 4NEYA 4BS2A 4LCFA 2AYMA 2FVQA 4PRVA 1VQPS 3I56S 1WNEA 4EMDA 3JAMU 4OYXA 2CPEA 1RWXB 4HH1A 2MDAA 4QZVB 1NK9A 3N4WA 2EBEA 2GFFA 5J2QA 2K7JA 3AA8A 3CW2C 4OYMA 4B3RF 4K4UA 3IFEA 4I56A 5J2PB 1LWEA 3J7AM 4KB7A 4YY3E 4KC5A 4IKAA 4KGKA 3W1YC 4WU3A 3H5XA 1X5SA 1A6FA 4LSZB 2B43A 2E5GA 1FFSB 1KVJA 1RHMB 1ZM3A 2XO6A 1UVMA 2FHMA 1Y5YA 2DR8A 1RADB 4DUYF 2UUCF 4CYUB 2PSZA 3JTNA 2AYGA 5SUHA 3R1LA 2FJXA 4FNIA 4Y00A 3HVAA 5DNXA 1MSWD 2PNZB 1P9YA 1X8DA 5KG3A 4B3MF 2KG0A 5K36B 4QU7A 4DG1B 2AJ2A 2GC8A 2CNNB 2BR2B 4NLPA 2HKJA 1XIQA 1O6XA 2KL8A 1SV5B 3DGPB 2FLLA 1Y0HA 3C6UB 3FCVA 1LK5A 3DXBA 5FLXY 1HPZB 5KFIA 3N6LA 3SSSA 1HHTP 3ZZRA 3NAHA 4AQYJ 1MU5A 2KKHA 1NKCA 4DHVA 2JL9A 2WP8B 2B8QA 2PA8D 2BOAA 2XMWA 2LP4A 5KT2A 2O01C 4JI2J 1NSKL 2HKEA 4PG6A 1HR0F 2VQEF 2CNKB 4DV0F 3K5PA 1N5YA 4ID8A 4OO1B 2P9GA 4RO0A 3FRZA 4AXJA 1OS5A 2Z5BA 2CQBA 3NP5A 1E6YA 2R2SA 1Y7PA 2IC3B 3M85D 3HFKA 2IRXA 3PW2A 5DGBA 4JB8B 4A8FA 2J9DE 1IJEB 4HDHA 3IS9B 4FVMA 4FNHA 4ISAA 4DV4J 1NK6A 4KHRA 2W4PA 5AE3A 3OT9A 9ATCB 5G0RA 5KFPA 2R9LA 4EYHB 2AZ3A 2OELA 5CHCB 4LF7F 4DR2J 1DQ9A 1F3FA 3EM1A 4KGZB 4K0KI 1HNVA 3IMQJ 3IA0A 4X62E 2AGQA 5GVQA 5FLXC 1CJUB 1FF2A 3EGZA 3IAS9 3TA2A 3CCVS 1ZM9A 1TELA 3MEDB 4P74A 1GAOA 2MPUA 2EFOA 4ANDA 4DV7E 3Q2TC 2H4WB 2ATCB 3EX7B 2YKMA 1JKHA 2VG6A 2R2TA 5M2PA 1S1TA 2VG5A 3VGTA 3DLEB 3MMBB 1RU2A 4P71A 3DKDA 3EDQB 3RR8A 4L73A 3HX9A 4WFYA 4X64J 3MR3A 3MDFA 3PO5A 4BBYA 3J7AN 5KG1A 5F8HA 1MROB 2LU2A 3PM9A 4Q2MA 2VZ9A 3OR2B 4DR7J 3TQ1A 1JLBA 5HK4A 4WBFA 4HHHA 1QJHA 3FFIB 3T1YJ 3Q8QB 3DRPA 4LRBA 3TUPA 2DXDA 2M5YA 3WBZA 1UWBB 4DBQA 1IBKE 5HVGA 2HHTA 4RW8B 1PKPA 1ZAVA 2H9ZA 3HHKA 2HIYA 3IRXA 3LOUA 1BD6A 4IFDD 5LMUE 1I1GA 2DK2A 2GA7A 2KZZA 2WVFA 1NXIA 2YQ1A 1GX6A 1BWEA 3V4MA 1VJWA 3H5YA 1R0AB 3VAMA 4MKVA 2HK2A 1QM9A 4MQYA 3JSMB 1CSJA 3NCPA 4USIA 3NCQA 1SI9A 2A18A 2R7SA 1X9WA 3MR6A 4GC7A 1S6UA 1M5VC 1P42A 3JSBA 4ES3A 3ITHB 2IESA 2HFNA 2FJAB 5KFYA 3HT0A 4DV3E 1SC4B 2L3MA 2M70A 2UUAF 3OXGA 4V1Ak 2R2UA 2BJEA 3F73A 2X3GA 3HHEA 3MPUB 4LF8F 2JVOA 4URLA 1HBNA 3BZQA 3OLAA 4OI1A 1DURA 3AOAA 4EBEA 2W9CB 4HT7A 5J1EB 5D78A 4L72B 2Z4PA 2QN6B 1X5OA 4GVBA 1UJ6A 3IR5B 2VOPA 1L3TA 2FZKB 2HVDA 2JEAB 2PC6A 4FDFA 3ZZUA 2KT2A 2BW2A 4NCAA 3LWMA 1SUQA 2BEFA 4OZ1A 4EWTA 4ATNA 1NB2A 1RKIA 2Y3YA 4DOZA 1MG7A 4R1FA 4HACA 2UV8A 1WDDA 1SIZA 1YBAA 5KG4A 1NPRA 2AF6A 4HI1A 3OL9A 3R6GB 1WSVA 3NNAA 4KJIA 2VC1A 4PRFA 4B3SI 2HG4A 1VOMA 3UCUP 1V3RA 1B7YB 2MKJA 5CZXA 3B78A 1JMTA 4GRSA 1TFWA 5DNLA 2HQFA 1TUGB 2G0IA 4OKGA 5KFXA 4AL6A 4DV2E 1TKZB 5F0UA 1U47A 4W92B 2MXYA 4QR1A 3CJKB 3M6VA 1CJTB 1HYSA 3CWJA 3WQPA 1YH8A 2OJ3A 1VRUA 3DOMB 4OYOA 3DRSA 5JVHQ 2C39A 4DV6F 4FPIA 3AB2B 4YEAA 2FVPA 1TK8A 1C2PA 2YWEA 4EI2A 4OYBA 3R27A 4JI1F 3GMEA 2RQCA 4JI7I 5B0AA 3MUTP 1MWZA 2YNFA 1RB0A 4KRWA 2CJBA 4KGMA 1DJ0A 3D4JA 4LJMA 2KH9A 4JI5F 1JNRB 4AT1B 1RJJA 4NCBA 4M63A 3PO4A 1TAUA 5KG0A 3WU3A 1H7XA 2QA1A 2WVDA 4RJVA 2ZH2A 5IQ6A 4YOEA 1AA1B 5AJ3J 3W5ZA 5A2QY 4DR4F 4J9MA 2IMOA 3HMJG 2AJFE 5THWA 2IMWP 2C3OA 2OSRA 3OTOJ 3QAUA 4DUTA 2GGPA 4ECVA 3MR5A 2HBYB 3RBEA 2O1WA 3QRQA 3UPFA 2E1RA 2P9EA 2BKPA 3P5BP 3M9OB 1S0MA 2Q66A 2XSJB 3D6TB 4DZ6A 2ZEJA 3L7ZB 1RA6A 2RILA 2HLUA 2FD2A 3OTCA 2DPJA 2I38A 4OZ0A 1VC5A 2BRKA 3KOAA 1H72C 4NXMJ 1R8BA 1DQAA 3W8PA 3THPA 2VA3A 2IVFB 2NYHA 5KFHA 3UDEA 4NYPA 2XCPA 2K8GA 2VKZG 2HFUA 4OX9F 5K14B 4YQWA 1N52B 3TZZA 4AL7A 2ABYA 1BUXA 2CADA 3QATA 1HQUA 1KWMA 2F5GA 3K0JA 4HHJA 1Q5YA 4EO6A 2KM8B 3MAAA 4B9SA 2HBQB 3PW7A 3BQ2A 1Z0EA 1JX4A 2WW4A 1BGXT 2B51A 4RU2A 2ZBCA 5AXKA 1Y00A 1FO1A 3CPWR 3FKBA 3PNIA 3QLHA 3K58A 3TZYA 3W66A 2K3KA 2GO3A 3FBEA 2GX8A 2HQCA 3SCLE 3DOKB 2P9CA 4OX6A 1RHJB 5DZ6A 2AJ1A 4AQYE 4PU9A 2C1EB 1FEEA 4N77A 3W9JA 3WIVA 1LWFB 2IHR1 2VDHA 4ED1A 2DNNA 3RBZA 5KFAA 4JI2E 1HNIB 4JI7J 4QIWD 1FCAA 1GX5A 1KONA 5LMNJ 4FWGA 1U02A 2XEXA 3FUYA 2RT3A 3QGHA 4DU8A 1R3NA 4F36A 5CYMB 5CCMA 1Q8BA 5KFCA 3C46A 3OTEA 1FKAF 2CQHA 1IBLF 4DUZF 2ZHAA 3VAHA 3UVJA 2WNRB 1GXUA 1U6BA 2WOMA 4TYAA 1UEVA 1MX0A 5KAKA 4MAKA 4DV4E 3OLBA 3KUEA 3QFWA 1H73A 4DQQA 2BANA 4DR2E 4I6AA 1RT2B 2LDYA 4DN9A 3FJ2A 2DY9A 4KHPJ 3UNGC 3DRXA 1DTQB 4KT0C 3OW2R 2OEKA 1XNQJ 1V5IB 4DQIA 3T5JA 5D4LA 2ZZMA 2W9BA 3PYFA 3KFWX 3J80U 2C37A 3HHNB 4CNZA 2MLXA 3GYXB 4X64E 3QZ8A 2DR9A 2HQDA 3PKMA 3IWLA 1XQIA 2ZH1A 4YR0A 4BWMA 2CG8A 2XB2D 3RTVA 1MWYA 3PJXA 3UQSA 5IT9U 4IDKA 3ZNUA 4FWHA 3T1YE 2ZJPQ 2VPZB 3CJ3A 4ALZA 4IR1A 1IN0A 2FY1A 2GVZB 5ETLA 5KT3A 2RDDA 3TAMB 2ADCA 1Y3JA 1HWLA 3K85A 2AW0A 2L9WA 2X51A 2ASDA 4QNKA 4O3NA 3ZZZA 1KHWA 1PIEA 2OKQA 2R7QA 2AGPA 3AOBA 3J7Z5 4O4GB 4OX8A 1W25A 3B4MA 1ZZNA 3IG1B 4KFBA 4IZJB 4B3RI 5B0BA 3HVTB 1VQ4S 2WHOA 3DHWC 3SZ2A 3ETOA 4DLEA 3ZTSA 3GJSB 5F0WA 1WHXA 3GONA 3IGNA 4IFVB 3DYAA 3DOLA 3M8QB 2RVJA 4IH7A 1X4CA 2ZOFA 3LO3A 4ZPAA 5DRPA 4KPCA 1J5EF 4DFJA 3NMAA 1J5OA 2LVWA 2JEFA 4UOFA 1QE1A 1UCNA 4O23A 4D3GA 4C98A 5KFVA 3NL0A 4ZP9A 2DGWA 2HZVA 3E01A 2QL7B 1NH8A 1XEZA 2O5DA 2W8LA 4B3MI 4OI4A 4KO0B 2XCAA 4WZMA 1TL7A 1YTYA 1U2RA 4YDXA 2DIUA 4J9NA 2MQMA 2RRAA 1R89A 1TUVA 2B9YA 3B82A 2M9KA 1RSCA 1TL5A 4XAKA 4M5IA 3J81C 3QJJA 1IR2A 4ECXA 5CH7B 1QDUB 3VZIA 2UV8G 3R7NB 6FDRA 3PHTA 4H4OA 2D74B 1NPPA 2R2RA 7AT1B 2E7WA 3QJLA 1IM4A 1NJZA 2OD6A 5DGAA 3IBWA 1WC5A 4DV0I 3ZNJ1 4R25A 3PIPQ 3MCNA 4UT4A 4C97A 2ZOMA 3MF5A 1UW4A 4DXLA 4CO2A 1AYEA 2MSSA 4YB5A 4CO4A 5ELWA 3O6QA 4ZITA 1V3SA 5E5NA 3CC4S 2GAGC 2KVQE 2NSCA 2Q79A 3H0PA 2LLZA 4BCAA 2YQ3A 3BGLA 3SV4A 4NWBA 2AHOB 2KZMA 4KGXB 3KLEB 1PSDA 4ED7A 4NMLA 2JC1A 4KKOA 1F5AA 4EBCA 1RWOB 4R5PA 2DGVA 4LF7I 3TRGA 3U02A 3NRBA 4LSNB 5DROA 5JEAC 2B8PA 1D1UA 5EN1A 3TNVA 4B3RJ 4RZRA 2LJPA 1OPIA 3FSXA 4Y65A 4I2QA 3MM7A 1IBMF 5E3PA 3M1VA 1S0OA 4N76A 5FLXU 1TL3B 4ER8A 3FGVA 5ETKA 2V34A 4DUYJ 2UUCJ 4NEZA 4PXBA 1A0OB 2HHQA 2W2MP 3OJUA 4JI8I 1M5KC 2Q3PA 5E2QA 5DQIA 1N54B 3U1KA 3FBFA 4ZVGA 1B64A 3V6KA 2KFNA 2JEJA 5DQGA 5T7LA 3W2VB 2J8SA 3G8QA 3NWGA 1QZRA 4FF1A 1VISA 2I9SA 1YJUA 1U0HA 4YFUA 4IOCQ 2XSFA 3GG1A 2VDIA 5A8KA 2Q43A 3VGSA 2PO0B 4WCEQ 2HS4A 1HQEA 5B0DA 1VQYA 1RK8A 4MH8A 4OIXA 1N0VC 3TA0A 3HVRA 3UD3P 3ISND 2BE2A 3ZKBA 4F4XA 2IM0A 4PAAA 4P72A 2W01A 2BJDA 2YKNA 2VBXA 2RS8A 2XS2A 2JHEA 4CH0S 1HR0J 2VQEJ 4NXME 4C48A 1ROFA 2K1RB 2QT7A 3C16A 3J7YU 3B8HA 4IH5A 1YG0A 9RUBA 2QA4S 1KFDA 1IJFB 4TLQA 2GQ2A 1CJVB 2VJVA 3TX0A 1JLQA 3G4SS 4LF6F 3SSQA 3A8KA 1GTEA 1WD6A 5D0GA 4DSEA 2J8AA 2N3OA 1UVNA 3AH6A 3OV7A 3ISZA 1E3PA 2UUAI 3SCIE 2F4VF 1YZ6A 4GKKJ 4LF7J 4Q2LA 3G96A 4KTQA 4LF8I 3U27A 3I5CA 3P6YC 2YNIB 3FCWA 2LQ5A 3VCDA 2DB1A 2QX0A 4CYUA 2RIJA 5K5MA 1U8WA 2CZ9A 5U47A 4LR8A 1T9WA 3OHAA 1ITPA 1JLGA 3UNYA 2GHVC 1WTFA 5KOWA 2WCXA 2PNZA 2UXBI 3T1AA 3HKZD 2B9WA 5AXNA 2VIHA 3HT3A 2AGOA 4JI7E 2CJQA 5D0RA 3D5MA 2B5JB 5K36E 4M95A 2FJWA 5LMNE 2WSCC 2IJFA 1RLDA 3DGPA 2EXUA 8RUCA 1DAXA 1PJ6A 2D7SA 4MYTA 2DNLA 1OWXA 4WIQA 5A8WA 3BPDA 1HPZA 5K8PA 1WORA 3I82A 4XK8C 3BKUA 1RT1A 3BGRB 3HD1A 3THTA 2OHDA 4JI0I 4BHQA 3HJCA 1Q53A 5KFDA 3M32B 3MWBA 2GW8A 2E1CA 4V19X 3EVWA 1S1VA 3PZPA 4OO1A 5C42A 4LFBJ 1FE4A 1FVQA 3LP2B 4ZLJA 4OO1E 4KHPE 3ZZOA 2FUG9 5IT4A 4J9QA 1S57A 3A8JA 2JRSA 4I6YA 2MKHA 1HI0P 2D3UA 4B9LA 2I0XA 1XNQE 3NAIA 3IS9A 2DHGA 1Z5CA 2H4YB 1Y4ZB 1VRTB 2KXNB 1KP6A 1Y4UA 3H2UB 1RT6B 3OVBA 1HW8A 3O3LA 2Z2MA 3PW5A 3JYTB 4B9VA 1TVRA 3BM7A 3P5TL 3I6PA 4EFAC 4JI5I 5C0XA 4J91A 3ZC4A 2E5JA 4R8UB 1CBKA 2G1DA 2CAJA 4LRCA 4LF8J 3DDIA 4XDDA 3R7SB 4EO8A 2LKZA 5MAOA 2VOOA 5H9EK 3MMBA 3CCUS 2MZTA 3MURP 1EQ0A 2RS2A 5DM6Q 2ALZA 2C2OB 1KOOA 2CPXA 1FDNA 1MROA 1S1UB 4LF4I 3RR7A 3EUNA 3Q1QA 2R7UA 5DRRA 3FFIA 2VUGA 4B3TJ 4PABA 5C24B 2DNQA 3R1HA 1UETA 5JEAF 3RBDA 1RCXB 4RW9A 4RW8A 3S1TA 3MM8A 3H40A 2FVSA 3QO9B 2DGOA 5KG2A 4OX9I 1LQ9A 3UI3A 1HFEL 2N7CA 4ECUA 1HNWI 4PWDA 2PA3A 4RNNA 3HJFA 3MAQA 1D8YA 1FKPA 4RBTA 3WZ0A 1Z59A 1H7WA 1FD2A 5A6WA 3G9CA 3HZEA 4GVLA 1LXJA 3H2VE 4ED8A 3KLGA 5DS7A 5GAGU 5HQMA 2VBZA 1BHNA 1UFKA 2KJVA 3BBCA 2HHHI 5A2QU 5A8RB 1TK5A 4DSLA 2ZH3A 3HHLA 2Y0SD 1REGX 4TY9A 4DV6J 5C7PA 2MQOA 3G6XA 1VFJA 3J7A1 3PFOA 1YJRA 4E8UA 4ZPDA 1U7LA 3U1MA 4JI1J 4ZIVA 5J2NB 3C66A 1VHFA 5A0YB 2YXLA 3BN4A 3LA0A 5ETVA 4IZKB 5DDPC 1FTRA 2CWKA 4R0JA 3ZZYA 3MCOA 2ZM6J 2CJYB 2CQPA 3K2YA 1RHQB 5F3ZA 2VB6A 2QFJA 3SSRA 2AJ0A 3KJVB 5JJBA 4UUWA 5L8RC 2V8VA 2JEAA 4O3PA 1Q7LB 4DPTA 2CPZA 3C8YA 3CWVA 4USWA 1U1RA 3FRYA 4DUZI 4NA2A 1IKXB 4QWEA 4C8YA 2VL1A 1YJNS 5ETOA 1EARA 4CLKA 4DR4J 4KQZA 4LF9F 1M1KT 1N6QA 2O3ZA 3AAWB 7FD1A 3MEGB 1G1XA 2UXDF 1IKWB 2WSFC 2UUTA 4K4TA 4ZCLA 2R8IA 2OP5A 4TVAB 3L7UA 3U7JA 2JH3A 4B3RE 2KG1A 3K5OA 1N36J 2Z5CB 1QUVA 3KLFB 1IQTA 3MEEA 3CE8A 3VHQA 3CCQS 4X4RA 1YBUA 1R27B 4A8YA 2W4CA 5GAHU 3H42A 1RTIB 4L3KA 1GQEA 2OTLS 1K47A 2MZJA 5L3JA 4DUYE 2UUCE 3MFHA 2XMUA 2MZSA 4OX9J 3WU4A 1SL2A 3ZZTA 2D3OR 1BQNA 4C8MA 1UPMB 5D77A 2BM1A 4OZJA 1DTTB 2NN6A 4B3ME 4A47A 2HNYA 4IUFA 1FRJA 1WUUA 1HBUB 4ZVUB 2HWIA 3EWGA 1RTZA 2EFGA 3M2UA 5LJ5Y 1Q7YT 2H3EB 1RR9A 4TY8B 3J7ZT 2M8HA 1AW0A 1PO6A 1RT3B 1FRXA 3WU5A 2PFDA 3BSCA 2X7IA 5IXUA 1WOSA 3OR1B 2OPSA 2ZD1B 2HQGA 2BOPA 1HR0E 2VQEE 2R42A 1WF0A 4X66F 4DDFA 1TMJA 4N3OA 1SVDA 2GJFA 1GK8A 5MLCV 4F50A 2I8EA 4J9VA 2J0XA 1C1CB 2B9EA 1SC6A 1WI8A 2BJ8A 1IBLJ 4DUZJ 3QT8A 3NMRA 1J5EI 4CT9A 4Q43A 5L9XA 4Q45A 3ZKDA 3ET6A 3ZTOA 1Z0BA 4F2SA 1RT5B 4I69A 1FX2A 1DLOB 2XLKA 2RU9A 4LF7E 3QGPA 2QA2A 3IC1A 1KIJA 1Q1KA 4WF9Q 3DLGA 2CVIA 3LP0A 4J9KA 2DD8S 2IJRA 2OPRA 1YKWA 1SJ1A 3D67A 3R9LA 2E5LI 1I6JA 1N88A 4OJGA 5G4DA 2HHVA 4OV6A 2Z5EA 4Q8EA 4KPYA 2QEXS 2NZ4A 4H54A 3MM9B 2LEBA 4DQPA 3J81U 4YP3A 2JLFA 2V9KA 2A3JA 1UMJA 2HQIA 3AQOA 4OMFG 3GCXP 4P7TA 2XMAA 4I68A 2LXFA 4DPXA 2BABA 5GAEU 2XLJA 3ILIA 2LU1A 4B17A 2CGEA 5JEAB 2CPJA 3CCJS 4USJC 4YB7A 1HNIA 3VF0B 1JWWA 2NPIA 3BO2A 1ZXNA 4PUOA 2W2NP 2M3DA 1T7PA 4NZ6A 5HLFB 5DG8A 2R8KA 3C3LA 1ZS6A 4HLBA 2Y1RI 4IYQA 3K5LA 2KXFA 4MKBA 4LUBA 3UO0A 3E8OA 4AL5A 3T9ZA 2WNRA 3NGDA 2RHQB 4FS2A 2KFZA 5I42A 1URRA 2MQNA 2W2OP 2HPUA 1S1XA 3F0NA 4J90A 1YGYA 4G6VB 5HROB 2YNHB 7FDRA 1JJHA 1RT2A 3W2WB 3PY8A 1J5EJ 5LL6d 1ELOA 3FZ2A 4U6PA 5EKWA 2HWTA 1NHHA 4YN3B 4YHHF 2UUAE 4O3RA 5BYRA 3K8VA 4F3QA 3CJ0A 1HQ2A 3I5AA 4LF8E 3A1YG 3FSYA 2NQPA 4C4WA 3DCAA 1WHVA 1MWQA 3BO4A 2OPPB 3V6DB 5CD4H 2FJEB 4A8OA 1WKJA 4ZVSB 2IM1A 3SI8A 4HTJA 3QT6A 1EKRA 3GYNA 4GQUA 2WVEA 3IO1A 3KMSA 2WZ1A 4X4SA 3C14A 3PX4A 4C8LA 1OY8A 2CVEA 1CLFA 3W9HA 1U2FA 5K36D 2I1RA 2MYFA 3DMJB 4GO5X 5KFZA 1RWPB 2J0WA 4KV8B 3CJTA 3UDLA 5ITHA 3UCZP 2PN6A 5IWAI 4EYIB 2J6UA 5GAHI 4NLVA 1WJ9A 1ZYQA 1UJ5A 3TA1A 1T05B 3QT5A 3MHYA 1X5PA 2V68A 2XMVA 1G7CB 3WX8A 3FC9A 3HVTA 5F9NA 1EAYC 3IWXA 2F4VI 5KFBA 3QGIA 1PYTA 2BVZA 4MFBB 1T03B 2J0QD 3HFZB 1EZZB 1LK7A 4X65F 4XPCA 4OO1D 5LOQA 3KNGA 4FW3A 1KC8T 1OY6A 1F2GA 3X1LB 3IR6B 1IBMJ 2OPQB 4DV6E 3CD0A 1GTHA 2E44A 3RAXA 1R8PA 2EFPA 3LAKA 4JI1E 3VAIA 2F1FA 1IKYB 2IRUA 5GADI 2ZM6E 5KFJA 5HBMA 1VK3A 3W62A 1UFWA 3D0IE 1VC6A 2M7SA 2PI5A 5F41A 3WIUA 4DSJA 5EWFA 5E3RA 1B63A 1ZM2A 5C0XD 3QIPA 1FD8A 4O3OA 2P8IA 4A48A 4DI6A 4DR4E 5JUMA 1SH3A 3S01A 1UDOA 3IAM9 1LXNA 4B9UA 5HN0A 2QRRA 1HD1A 5K36C 2G2OA 1JLCA 4OHZA 4LCHA 3BH7B 3EPGA 4Z2XA 1HHQA 2HFOA 3TARA 4F4ZA 4F4YA 3PRVA 1NM2A 1N36E 2QMUB 2VFVA 4BA1A 4ES1A 1FXLA 3DXSX 4DPOA 3PS3A 3IP0A 4ZP6A 3KLIB 3W3SA 5JXSA 5HMZA 4JI3I 3A3OB 3KLEA 1K0TA 2J0SD 1OY9A 1KLMB 2XQCA 4F02A 1LFWA 3W5XA 4LF6J 4OX9E 4LSNA 3HHDA 3F56A 2B4VA 8ATCB 1OSDA 1NK7A 1FNXH 3O44A 4ID5B 2WBRA 1HI8A 1OYEA 4ZCIA 2F4VJ 4K0KF 3K5NA 4DR5F 4ANCA 1FDAA 2V2QA 2RE1A 4NLWA 2ZHBA 2HIQA 1X7VA 1Y6ZA 3MMAB 5BXIA 5E33A 1AXQA 2NXCA 3AHPA 1TL4A 1XN9A 3I96A 4I1TA 2P6TA 2ZH6A 2UVRA 3D54A 3DDKA 1FFWB 4ZVOB 1Z5AA 2DEJA 3ELHA 3BR8A 4C3MA 4GMKA 4KHMA 1S6QB 2C2DA 2E29A 3K1JA 4J7CA 4IOAQ 2YY3A 1OIAA 1RZMA 5KTQA 2XMTA 1DFDA 1R8CA 3OBIA 4C11A 3AXMA 1S72S 2Z2LA 2PO0A 4DR1I 3ILJA 4DLGA 2DNOA 3EZ5A 3PACA 1ZPWX 3P3GA 1FKAE 4EBDA 3Q8YA 4DUZE 4NLUA 1IBLE 4ZK7M 5LSOA 2WB1D 4WUBA 3JTOA 3JQMA 4Y2IA 1RAOA 3SMZA 1X60A 3LH2S 3B54A 1CJKB 5L1LA 2B0GA 4RUHA 4DL7A 1DBDA 1NNDA 4DV1I 4WUDA 4NI2A 1SCJB 1VC0A 2Y1JA 2HHPA 3BO3A 1U4BA 4P9SA 4FW4A 2HVZA 1CC7A 3SFUA 1HNZI 4MKAA 1S4FA 4IFYA 1P1TA 5HQLA 5F8GA 3T1HF 5KT7A 1KNZA 5EWEA 4OYIA 3PFEA 2YX7A 4Q0BA 1HBMB 4ICLB 3DLHA 4CH1A 1TAQA 2Z57B 2CG9A 4QYRA 2VBWA 4LF5F 2NXEA 1WG4A 1RDRA 2VQFJ 4BC9A 4U9RA 3IM9A 2J6SA 2V9WA 2MQPA 5E41A 1YJVA 4RW7A 3RU0A 2G1HA 2NXJA 4QIGA 5CD4A 4ZCMA 1M90T 2N3LA 5D15A 2RD5C 3TJ9A 3JQJA 5ETPA 4OI3A 4DSIA 3W8GA 1NPKA 4DL6A 4FYYB 3K5MA 2OI2A 1BE4A 4K5RA 2VH7A 5CABA 4CLSA 4IFDA 1FK9B 3HSDA 2MLYA 2D41A 3OJSA 2HHSA 2XY6A 3I0RA 4DR3J 4WFBQ 5B0GA 3DFEA 1W2BR 3M8YA 1P27B 4A8KA 4DCOB 2XZDB 4OJ1A 4KYZA 1HW9A 2QZ8A 1S1WB 3QQCD 1B4SA 3DRRB 4NXNI 1Z4UA 2I2YA 2GO9A 1SL0A 1XR5A 1RYRA 5BR8I 2YKQA 3CIZA 5GMKa 2LQJA 5J2MB 1U45A 1T94A 4WIIA 1N48A 3OFGA 3LP2A 1J5EE 4IS9A 1V6HA 2V50A 1RBOB 4C6AA 4M1KA 3OXLA 3TAQA 4W98A 4I0WA 4KH1B 4KH0B 5HP1B 1YHCA 3GR1A 1U1QA 2NR0A 3OFEA 4OFZA 2V2KA 3CDIA 1VRTA 4F0MA 1U48A 3QBCA 1RT6A 4X62J 4E98A 4LIWA 3KHLA 4PR6A 4ANEA 2G2ZA 3VGVA 1CPZA 1M5SA 3MM5B 1N34F 3H5UA 4ZLNA 4ZVPB 2F1DA 3TP2A 4BA2B 1C1BB 3BKTA 5AT1B 3OUYA 2PNLA 3M05A 4PXEA 3H1CA 4N47A 1NHUA 1EKSA 3VGUA 3NG8A 4LT6A 3N9UC 1P1LA 3NOCA 4NYZA 3GB0A 4NLDA 4Q7AA 3ZXWA 5I3UB 3M8PB 1YIJS 1U49A 4LFCI 4X66I 2C2NA 1U1MA 3P45B 3KHGA 1JB0C 4CO0A 4ZVFA 1EP4B 5CCLA 2QYGA 1HD0A 3D1QA 4QIEA 2PO2B 1Q8LA 1TL1B 4OHVA 3H8YA 1CVJA 5F8LA 1VQNS 1FEHA 3C6TB 3KG4A 2DT9A 1R8AA 1XMQF 1KQSR 4LF9J 2R8HA 4I2PB 5C24A 3Q83A 4OJ3A 2PE8A 3GIIA 2U1AA 2XYGB 1SQEA 2UXDJ 3MXHP 2MJNA 3GJQB 2R7TA 3TVKA 4TLRA 3L7OA 4UOCA 4P2SA 2KO1A 1NHKL 1RAIB 1UPPA 1IBME 1S9FA 2XTJP 3TW0A 3EPIA 4XDCA 3GILA 1B0TA 2HNDB 1PJ7A 4RW6A 3SBMA 3M30B 1KVIA 5LSLA 2DH8A 5D6GA 1YX2A 3HLUA 4MU4A 2G13A 4F0KA 3P96A 4FF2A 1NDPA 4DV3J 2XI2A 1S5ZA 1NJYA 4USMA 5A8RA 4QWBA 1U8SA 4PPDA 3HXMA 2J65A 3MM6B 2KB2A 4LSLB 3D2WA 5DG7A 2ZDPA 5BYQA 4X4QA 2EEYA 3FEZA 3UDCA 3TUIC 4OI2A 3KLHA 3M2VB 2KM8C 2ADBA 2W2PP 2BXJA 2HNZB 3G82A 2YX4A 1KS2A 3CO9A 5HJXA 1ZAWA 1NK8A 4OYAA 4YS2A 3JB9k 3CXCR 3K17A 3HO1A 4UW2A 3TX8A 4X66J 3CD7A 5L1IA 4ZOSA 2R8GA
chains in the Genus database with same CATH topology
1FWLA 4WUBA 4JI0E 1XNRE 2UXDE 4JI6I 1FJGE 4YY3I 1H72C 2V8PA 4LF7I 4DV1I 4LF6E 4OX9I 4WUDA 2GS8A 1HNXE 4P52A 4GKKE 1H7SA 4DUYI 2UUCI 3T1HI 1N33I 3ZZ0A 1HNWI 3F0NA 4IZJA 2O1TA 2VQFI 2UUBI 4B3SE 1HNZI 4DV6I 2LJPA 1H74A 2HFUA 1Z59A 3HULA 1HK7A 4K0KI 2VF3A 4X65E 4YHHI 1EA6A 3PYDA 4JI3E 1I94E 2UU9I 4X62E 1PVGA 4FW9A 4JI1I 4LF5I 2F4VE 1ELOA 4LFAI 4JYAI 3V2UC 4X64I 4ED4A 1NHHA 5FLXC 4IZJD 3PRYA 2UUAE 2V34A 2CG9A 2HHHI 1Z0EA 4JV5E 2ZM6I 2WW4A 1ZM9A 2Q2EB 4LF8E 4JI8I 4DV7E 4DR5E 4DR7I 1N34E 3T1YI 5LMNI 2E5LE 3M6AA 2J7KA 4Z7CA 1S16A 1QZRA 4DR3I 1VISA 4AQYE 4PU9A 2R3VA 4IZKB 4JI5E 2UXCE 4DR4I 2ZBKB 4HACB 1HR0I 1XMOI 2VQEI 4JI2E 1N32E 3QT6A 1B62A 3PYEA 2OI2A 5IT9C 3V5RA 1N0VC 4DPTA 2ZITA 4FWGA 2XEXA 3ZKBA 3CWVA 1N36I 4DUZI 4X66E 4LFBE 1IBKE 3J80Q 4DU8A 1PKPA 4KHPI 4DV0E 5IWAI 1ZXMA 1KVKA 4NXME 1H7UA 1EI1A 1USUA 4HY1A 5LMUE 2NPFA 3LPSA 4LF4E 1MX0A 3B8HA 4NXNI 4DR1E 1XNQI 4DV4E 1HNXI 1XMQE 1NHJA 5FWKA 4GKKI 3QT5A 5BR8I 1H73A 4DPYA 1NHIA 4DV2I 4DV5E 1USVA 1IBMI 5IT9Q 1FNMA 2IOQA 4B3RE 2HK2A 4XTJA 4DR2E 2Z5CB 3WU6A 4WUCA 4X65I 3QT7A 4DR6E 1I94I 4X62I 1J5EE 2F4VI 3LNUA 3H4LA 4M1KA 2HFSA 4DV1E 2UUAI 3JAMQ 1K47A 5L3JA 4DUYE 3T1HE 2UUCE 4JI4E 1N33E 1DARA 1HNWE 4FN5A 3WU4A 2VQFE 1KTVA 2UUBE 4DV3E 4LF8I 3ZZTA 1HNZE 3P06A 4DV6E 4K0KE 1N34I 4YHHE 2GQ0A 4HYMA 3PYFA 2BM1A 4JI1E 4B3ME 4RPFA 3J80C 2CZ9A 4URLA 4X64E 4AQYI 2IOPA 1WUUA 2UXCI 2UXBI 2EFGA 2HHHE 1FWKA 2ZM6E 2PNLA 2V2ZA 1N32I 1RR9A 4JI8E 4JI7E 4FWHA 1Y4SA 4HXZA 3T1YE 5LMNE 3WU5A 3ZZUA 3LTOA 3OTOE 1B63A 4DPUA 1ZM2A 2X7IA 4LFCI 4X66I 4LFBI 1RREA 4MYTA 2Z5BB 4B3TE 4DR3E 4LF9I 4PRVA 3K85A 1IBLI 4DPWA 4IZKA 4DR4E 4EMDA 1MG7A 1HR0E 1XMOE 4JI0I 2VQEE 2R42A 1XNRI 3HJCA 4R1FA 2UXDI 4HACA 1PIEA 1FJGI 3JAMC 1XHKA 1Z0TA 4KQVA 1XMQI 1N0UA 5LL6R 4N3OA 4LF6I 4DV5I 4IZJB 4B3RI 1D6TA 2V2VA 1N36E 2BM0A 2A2CA 4I3HA 4B3SI 1UEKA 4Z7YA 4DR6I 3QT8A 1S4EA 4KHPE 1J5EI 4GKJE 1Z0VA 3GONA 2BV3A 5IWAE 3B78A 4JI3I 3ZKDA 3J7AM 4JI6E 1NZ0A 4YY3E 1Z0BA 1Z0CA 4NXNE 1XNQE 1ZM4A 4JI4I 4LF7E 5BR8E 4USKA 4DV2E 4OX9E 1A6FA 4ZVIA 1Z5CA 1KIJA 4DV3I 1IBME 1BKNA 1Z0WA 4JV5I 1ZM3A 1KKHA 2PNMA 1OJ4A 2Z5CA 1Y4UA 3J7AG 4DV7I 4DR5I 2O1VA 3PYGA 4B3MI 2UU9E 2E5LI 4LF5E 1U2RA 4LFAE 4JYAE 2V2QA 3Q6NA 3B82A 2Z5EA 4JI5I 4UTGA 4JI7I 5A2QC 1Y6ZA 2HKJA 5GMDA 4USMA 4JI2I 4PRXA 3D4JA 2X36A 4DR7E 3OTOI 3J81C 1Z5AA 2DEJA 4B3TI 4FWDA 2AJ4A 3Q6MA 3WU3A 1IBKI 2UXBE 1MU5A 1Z5BA 4DPXA 3K1JA 5FLXQ 4DV0I 4JG4A 2O1UA 4UT4A 4NXMI 4DU7A 2CGEA 4P7AA 5LMUI 4MYUA 4DXLA 1Z0GA 4LF4I 2HKEA 4DR1I 4DV4I 5GMEA 5A2QQ 3Q1QA 1ZXNA 2A2DA 3ZM7A 4LFCE 1FI4A 3K17A 4LF9E 2Z5BA 2O1WA 3J81Q 1FKAE 4DR2I 1IBLE 2HK3A 2E1RA 2DEIA 4DUZE 4GKJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWL A;  4WUB A;  4JI0 E;  1XNR E;  2UXD E;  4JI6 I;  1FJG E;  4YY3 I;  1H72 C;  2V8P A;  4LF7 I;  4DV1 I;  4LF6 E;  4OX9 I;  4WUD A;  2GS8 A;  1HNX E;  4P52 A;  4GKK E;  1H7S A;  4DUY I;  2UUC I;  3T1H I;  1N33 I;  3ZZ0 A;  1HNW I;  3F0N A;  2VQF I;  2UUB I;  4B3S E;  1HNZ I;  2LJP A;  1H74 A;  4DV6 I;  2HFU A;  1Z59 A;  3HUL A;  4K0K I;  2VF3 A;  4X65 E;  4YHH I;  1EA6 A;  3PYD A;  4JI3 E;  1I94 E;  2UU9 I;  4X62 E;  1PVG A;  4FW9 A;  4JI1 I;  4LF5 I;  2F4V E;  1ELO A;  4LFA I;  4JYA I;  3V2U C;  4X64 I;  4ED4 A;  1NHH A;  5FLX C;  2UUA E;  2V34 A;  2HHH I;  1Z0E A;  4JV5 E;  2ZM6 I;  2WW4 A;  1ZM9 A;  2Q2E B;  4LF8 E;  4JI8 I;  4DV7 E;  4DR5 E;  4DR7 I;  1N34 E;  3T1Y I;  5LMN I;  2E5L E;  3M6A A;  2J7K A;  4Z7C A;  1S16 A;  1QZR A;  4DR3 I;  1VIS A;  4AQY E;  4PU9 A;  2R3V A;  4JI5 E;  2UXC E;  4DR4 I;  2ZBK B;  4HAC B;  1HR0 I;  1XMO I;  2VQE I;  4JI2 E;  1N32 E;  3QT6 A;  1B62 A;  3PYE A;  2OI2 A;  5IT9 C;  3V5R A;  1N0V C;  4DPT A;  2ZIT A;  4FWG A;  2XEX A;  3ZKB A;  3CWV A;  1N36 I;  4DUZ I;  4X66 E;  4LFB E;  1IBK E;  3J80 Q;  4DU8 A;  1PKP A;  4KHP I;  4DV0 E;  5IWA I;  1ZXM A;  1KVK A;  4NXM E;  1H7U A;  1EI1 A;  4HY1 A;  5LMU E;  2NPF A;  3LPS A;  4LF4 E;  1MX0 A;  3B8H A;  4NXN I;  4DR1 E;  1XNQ I;  4DV4 E;  1HNX I;  1XMQ E;  1NHJ A;  4GKK I;  3QT5 A;  5BR8 I;  1H73 A;  4DPY A;  1NHI A;  4DV2 I;  4DV5 E;  1IBM I;  5IT9 Q;  1FNM A;  4B3R E;  2HK2 A;  4XTJ A;  4DR2 E;  3WU6 A;  4WUC A;  4X65 I;  3QT7 A;  4DR6 E;  1I94 I;  4X62 I;  1J5E E;  2F4V I;  3LNU A;  3H4L A;  4M1K A;  2HFS A;  4DV1 E;  2UUA I;  3JAM Q;  1K47 A;  5L3J A;  4DUY E;  3T1H E;  2UUC E;  4JI4 E;  1N33 E;  1DAR A;  1HNW E;  4FN5 A;  3WU4 A;  2VQF E;  1KTV A;  2UUB E;  4DV3 E;  4LF8 I;  3ZZT A;  1HNZ E;  4DV6 E;  4K0K E;  1N34 I;  4YHH E;  4HYM A;  3PYF A;  2BM1 A;  4JI1 E;  4B3M E;  4RPF A;  3J80 C;  2CZ9 A;  4URL A;  4X64 E;  4AQY I;  1WUU A;  2UXC I;  2UXB I;  2EFG A;  2HHH E;  1FWK A;  2ZM6 E;  2V2Z A;  1N32 I;  1RR9 A;  4JI8 E;  4JI7 E;  4FWH A;  4HXZ A;  3T1Y E;  5LMN E;  3WU5 A;  3ZZU A;  3LTO A;  3OTO E;  1B63 A;  4DPU A;  1ZM2 A;  2X7I A;  4LFC I;  4X66 I;  4LFB I;  1RRE A;  4MYT A;  4B3T E;  4DR3 E;  4LF9 I;  4PRV A;  1IBL I;  4DPW A;  4DR4 E;  4EMD A;  1MG7 A;  1HR0 E;  1XMO E;  4JI0 I;  2VQE E;  2R42 A;  1XNR I;  2UXD I;  4R1F A;  4HAC A;  1PIE A;  1FJG I;  3JAM C;  1XHK A;  1Z0T A;  4KQV A;  1N0U A;  5LL6 R;  1XMQ I;  4LF6 I;  4DV5 I;  1D6T A;  4B3R I;  2V2V A;  1N36 E;  2BM0 A;  2A2C A;  4I3H A;  4B3S I;  1UEK A;  4Z7Y A;  4DR6 I;  3QT8 A;  1S4E A;  4KHP E;  1J5E I;  4GKJ E;  1Z0V A;  3GON A;  2BV3 A;  5IWA E;  3B78 A;  4JI3 I;  3ZKD A;  3J7A M;  4JI6 E;  1NZ0 A;  4YY3 E;  1Z0B A;  1Z0C A;  4NXN E;  1XNQ E;  1ZM4 A;  4JI4 I;  4LF7 E;  5BR8 E;  4USK A;  4DV2 E;  4OX9 E;  1A6F A;  4ZVI A;  1Z5C A;  1KIJ A;  4DV3 I;  1IBM E;  1BKN A;  1Z0W A;  4JV5 I;  1ZM3 A;  1KKH A;  1OJ4 A;  3J7A G;  4DV7 I;  4DR5 I;  3PYG A;  4B3M I;  2UU9 E;  2E5L I;  4LF5 E;  1U2R A;  4LFA E;  4JYA E;  2V2Q A;  3B82 A;  4JI5 I;  4UTG A;  4JI7 I;  5A2Q C;  2HKJ A;  5GMD A;  4USM A;  4JI2 I;  4PRX A;  3D4J A;  2X36 A;  4DR7 E;  3OTO I;  3J81 C;  1Z5A A;  2DEJ A;  4B3T I;  4FWD A;  2AJ4 A;  3WU3 A;  1IBK I;  2UXB E;  1MU5 A;  1Z5B A;  4DPX A;  3K1J A;  5FLX Q;  4DV0 I;  4JG4 A;  4UT4 A;  4NXM I;  4DU7 A;  4P7A A;  5LMU I;  4MYU A;  4DXL A;  1Z0G A;  4LF4 I;  2HKE A;  4DR1 I;  4DV4 I;  5GME A;  5A2Q Q;  3Q1Q A;  1ZXN A;  2A2D A;  3ZM7 A;  4LFC E;  1FI4 A;  3K17 A;  4LF9 E;  3J81 Q;  1FKA E;  4DR2 I;  1IBL E;  2HK3 A;  2E1R A;  2DEI A;  4DUZ E;  4GKJ I; 
#chains in the Genus database with same CATH topology
 1YHQ S;  3PRB A;  1BQX A;  3TYT A;  3BBB A;  2NS1 B;  4LF6 E;  3MEG A;  1BMQ B;  5CQG A;  3MD1 A;  4JV0 A;  3N6M A;  5IM0 B;  1L5U A;  1N33 I;  3TUZ C;  1PBA A;  5I3Q A;  3M6X A;  3M7V A;  2YWK A;  5EUH A;  4YHH I;  1KHV A;  2O67 A;  4FW9 A;  2F4V E;  3CDE A;  4Z37 A;  4OZ5 A;  1RE1 B;  2C38 B;  4ZA1 A;  2ZH5 A;  4IQM A;  1NK0 A;  4ED4 A;  5KFL A;  4IZJ D;  3D6H B;  1KQK A;  2GJI A;  1RTI A;  4N8O A;  1WTB A;  5C25 A;  4OHY A;  2V69 A;  4LFA F;  5E3C A;  1TUW A;  4AIM A;  1RHU B;  1SQG A;  2EWH A;  2F65 A;  1TQL A;  4NA1 A;  3NS5 A;  5SZT A;  2ZBI A;  3MPW A;  4PWW A;  4M5K A;  1S16 A;  5KFF A;  3OFH A;  4F4K A;  2F8M A;  2AYB A;  4DMZ A;  3LPE A;  2QTW A;  3BGU A;  1DRZ A;  1XMO I;  2ZKU A;  1RWW B;  3GFX A;  1RWK B;  4QOT A;  3TEH B;  1UDN A;  3M8S A;  4TY8 A;  5IT9 C;  1WG5 A;  4DL5 A;  3FDS A;  4NX9 A;  3ETM A;  2IVM A;  5H1S V;  3CD6 S;  2DRA A;  1F9E B;  2XC9 A;  4ZLL A;  4LBP A;  5J2Q B;  2XS7 A;  1KDN A;  2G0J A;  1IR1 A;  4ECR A;  1VS3 A;  4DL2 A;  4TKT A;  5KFK A;  1F5B A;  4DS5 A;  2I6W A;  5EGY A;  3CCW A;  1LWE B;  1KSP A;  2JOQ A;  1H7U A;  1Y5N B;  5DG9 A;  3LPS A;  3L09 A;  3VAK A;  5B08 A;  2YPZ A;  4RWW A;  3GE9 A;  3POT B;  5A76 A;  2L41 A;  2POK A;  2ZH7 A;  4Y0F A;  3PG9 A;  3ULH A;  1HNX F;  1NEE A;  4X65 I;  4ES2 A;  2BA9 A;  3W5Y A;  1Y5I B;  1C1C A;  2LQ9 A;  1HWI A;  1SL1 A;  5FJ4 A;  4ZP8 A;  4EU0 A;  2EK6 A;  2Z58 B;  2AIR B;  1I94 F;  4RLE A;  2VIC A;  4BWJ A;  1J2V A;  3PS2 A;  2MGZ A;  1DLO A;  3LGM A;  2RML A;  4R0E A;  2VQF E;  2RF2 A;  2OH2 A;  2XWY A;  3Q2S C;  3TWZ A;  1FRM A;  3T19 A;  3BSO A;  2ERR A;  1F6T A;  4HYM A;  4HH0 A;  3NKY A;  3MD3 A;  1XER A;  1UJ4 A;  1Z1Z A;  2H51 B;  2IVY A;  1Q16 B;  2YWH A;  3KUH A;  3GZ7 A;  3GLL A;  4O44 B;  1R6L A;  1RAE B;  4ED3 A;  3R5A A;  3CDW A;  2OO4 A;  4LIR A;  2AX0 A;  3KK2 B;  2RRN A;  5KFE A;  2UXC F;  1R8H A;  1X4B A;  1LW2 A;  2DNR A;  1FRI A;  3X3U A;  4DPU A;  3A3P B;  3IGV A;  2Z5B B;  3AB4 B;  4LRA A;  4DR3 E;  3AJ1 A;  1C4A A;  5L46 A;  1XNR I;  1NME B;  3IR7 B;  1FJG I;  4ZHR A;  1B7F A;  3E3X A;  2GMH A;  1N0U A;  2V8H A;  3MR2 A;  5JEA A;  4DFM A;  5G0R B;  5E3Q A;  5JEA E;  2QSF A;  4OZE A;  1S48 A;  4QYZ J;  3JXO A;  1HNV B;  2J9D A;  2D1C A;  1VQ7 S;  4QBU A;  1NDL A;  4ZPV R;  3KG1 A;  4NYO A;  4JBC A;  1JLF B;  4E2F B;  2V4J B;  1PCA A;  4JV5 I;  4LMZ A;  3QMQ A;  1I3O B;  3GMG A;  2YKM B;  4DR5 I;  5HRO A;  1VR6 A;  2B6A B;  1JKH B;  2VG6 B;  4W4M A;  4X65 J;  1PC5 A;  1PC4 A;  1S1T B;  3PYG A;  3CUL A;  2VG5 B;  4OX7 A;  3W2W A;  1YRX A;  4H4K A;  4O3Q A;  4CLU A;  2GQQ A;  3CD5 A;  3Q6N A;  5C5J A;  4WTO B;  3CED A;  4LRF A;  1B99 A;  4J9L A;  3RAM A;  2RHS B;  3GU0 A;  5B0E A;  2DNZ A;  1OPZ A;  3DRP B;  2H65 B;  4JI8 F;  5J1P A;  3RZA A;  4C8N A;  3CCZ A;  1B0P A;  1N5V A;  3TVY A;  3FMB A;  4QPX A;  3VVU A;  2IJN A;  1SJF A;  3B6B A;  2C3U A;  1K8A T;  2VU5 A;  4USV A;  2JEB A;  2H1Y A;  3V4I A;  1QAJ A;  1CQM A;  4H4M B;  1WC4 A;  4DU7 A;  4NOH A;  2A2D A;  3PCO B;  1E6V B;  2ZE2 A;  2VPW B;  5BJR A;  4LF9 E;  4IRC A;  4WWS A;  1SPB P;  3NOG A;  2CUY A;  3JSY A;  4J9U E;  1S77 D;  2DGS A;  2ZFH A;  2UXD E;  3BH6 B;  4IR9 A;  4NBQ A;  3EZU A;  2I5J A;  1RWM B;  2DR5 A;  4ZPB A;  1HMV A;  5HMX A;  1FES A;  1QY7 A;  4BDP A;  3FVY A;  1OQ6 A;  2CQ3 A;  3T1H I;  4TQS A;  2G0C A;  3T6B A;  2UUB I;  1U1K A;  3CME S;  1H74 A;  4WPA A;  2DH7 A;  4U8Y A;  3CNQ P;  4NLT A;  4F3O A;  4LF5 I;  4AM3 A;  3K57 A;  3RJM B;  3R6L B;  2YNG A;  4FXD A;  1HBN B;  4Q8F A;  3OQ2 A;  1EET A;  4XIU A;  5FDL A;  2UU9 F;  1QLN A;  2EFQ A;  4J37 A;  3ILL A;  2BA1 G;  1H2V Z;  4GVB B;  1AUD A;  1G6B A;  1TV6 A;  1GXT A;  2R7X A;  1U6Z A;  3QSI A;  4IO1 A;  4M5G A;  3UFC X;  1AZS A;  3GJT B;  1Q95 G;  4P10 A;  4K0K J;  4OI6 A;  3BDE A;  1NSP A;  1APS A;  3HPO A;  3EVO A;  2PEH A;  3M6A A;  2XMM A;  4JUZ A;  2YWW A;  2FZG B;  4DR7 F;  1SUQ B;  2ZZN A;  2GZO A;  1IKY A;  1HLW A;  1LW0 B;  4WJB A;  1HHS A;  4HAC B;  2DGX A;  4C3K A;  4ILR A;  3N5B A;  2QFI A;  2UXB F;  3O5T B;  2JVR A;  4ZJO A;  1RKJ A;  1MMD A;  1D9F A;  5IFM A;  4M5L A;  2N4C A;  2PEB A;  1NKE A;  4E0D A;  3PEJ A;  4S0M A;  2LFV A;  1RAG B;  4FBT A;  4X66 E;  1NAQ A;  2VAS A;  4URG A;  4M5M A;  2NUU G;  4ZPT R;  1HWJ A;  2KRR A;  5DZ7 A;  2KDO A;  3O1L A;  1NDC A;  1YRT A;  2AMC B;  2RAQ A;  4G1Q A;  2CZ4 A;  3GIR A;  4JI0 F;  1VCT A;  1AUS L;  3MTK A;  1IWA A;  4U7U D;  2RJZ A;  1LV5 A;  3IBC B;  2XI3 A;  1HYS B;  1N56 A;  2VPX B;  3FMW A;  1VRU B;  3DRS B;  2C39 B;  1C0U A;  3KK1 B;  2MST A;  4PG4 A;  4QU6 A;  1T3N A;  1HWK A;  2IRY A;  1YJ7 A;  1FX4 A;  2PO1 A;  5F8N A;  2QIF A;  2V5H G;  4C0B A;  1RHK B;  1G2E A;  3TR5 A;  5LT5 A;  3SIP B;  2YNF B;  2DCL A;  1HBO B;  3R7B B;  3ONQ A;  1N34 I;  3Q89 A;  3NGT A;  2FLO A;  4DX5 A;  4IG0 A;  2Y0B B;  4CLF A;  3UN2 A;  4RNF A;  4DFP A;  1VBX A;  1N8R T;  3PS1 A;  3AY0 A;  1RUS A;  3DI6 A;  4ED5 A;  4HEA 9;  1P6T A;  2JLE A;  1O51 A;  3MMA A;  2CQ4 A;  4OHW A;  3AJ2 A;  1N32 F;  1YWX A;  5CYQ B;  1G4C A;  3QRP A;  3BB5 A;  1MLA A;  1F1B B;  2DNH A;  3V6H A;  1SC3 B;  2DTJ A;  2D9P A;  5K8N A;  1FKO A;  3MPD A;  1O0P A;  2BA1 D;  1NK5 A;  1ZPV A;  4HT5 A;  4CM0 A;  2OUG A;  4F4A A;  2WVB A;  1Z0T A;  2OTJ S;  4DF4 A;  4N56 A;  1PIL A;  2CQ1 A;  5D0H A;  1XMQ I;  5K20 B;  3BBF A;  1CUL B;  5L9N A;  4LF4 F;  2WSE C;  4ZVE A;  2FLP A;  4F3M A;  3UE2 A;  2MB0 B;  1HQU B;  1TKT A;  4HKQ A;  4KE5 A;  4UY8 T;  3TAN A;  4D3H A;  2Q6B A;  1RAJ A;  4CWB A;  1CJK A;  2V4Q A;  3VAG A;  1ZM4 A;  1FRL A;  2QSW A;  4QW8 A;  2FC9 A;  4PYA A;  3NGU A;  3PRD A;  3AD8 C;  2PNM A;  5KFQ A;  4B3S J;  4DV7 I;  3GV8 B;  2MHN A;  1VJQ A;  3QLH B;  1ZH5 A;  1HNW F;  2JEG A;  1D0E A;  3EYZ A;  1S49 A;  3RRK A;  1QVF R;  2ILY A;  2EFV A;  1X4H A;  2DYA A;  3GFY A;  2DCU B;  4NLX A;  2A0F B;  1HBM A;  4ICL A;  4WE1 B;  1M1G A;  1QAX A;  4PQA A;  3MZI A;  1S9G B;  2CA9 A;  4OZ3 A;  1S9E A;  5A2Q C;  1PYO B;  1EIY B;  4PRX A;  2HHH F;  4O0N A;  3NWR A;  4DQS A;  4ZS6 A;  4TU7 A;  2C2R A;  4OYZ A;  1VQ5 S;  2KN4 A;  1OSC A;  1VYA A;  2FZC B;  1IBK I;  2ZDO A;  3OTO F;  4GC6 A;  4DZD A;  4DJB A;  2IPO B;  3LGH A;  4U7U K;  4A8Q A;  3I5B A;  3UVJ B;  1F0X A;  2WOM B;  2VG7 A;  4WU2 A;  1IKV B;  5LMU I;  3KHH A;  1Z0G A;  3L4B C;  3BDP A;  3CDU A;  3D1H A;  1VHI A;  1VQ9 S;  3ZM7 A;  2BAN B;  3CGI A;  4BC7 A;  3J81 Q;  1KLN A;  2HK3 A;  3QZ7 A;  3CCR S;  1FWL A;  1KFS A;  3K7R A;  5KT4 A;  1IUJ A;  2CRL A;  2WB4 A;  4QIV A;  2JWN A;  3DLJ A;  4FVC A;  1VBK A;  4YR3 A;  2GAH C;  2GS8 A;  2IAJ A;  2FC8 A;  3C15 A;  4JI6 F;  3DRR A;  1XMQ J;  2OEJ A;  1H7S A;  3SQO P;  1FJ7 A;  2KJW A;  2ATL A;  1ZOT A;  1RTJ A;  3T41 A;  1WAC A;  2PFF B;  4A4J A;  2W9B B;  1GEH A;  4X65 E;  2C37 B;  2E7V A;  2HBZ B;  4B3O A;  4EK2 A;  4M5D A;  1RU1 A;  1NSQ A;  1WEZ A;  4LFA I;  4X4V A;  2V0N A;  3H90 A;  1RWN B;  5AXL A;  4CQ1 A;  3VAL A;  1UA0 A;  1XXE A;  5F3T A;  1LEO A;  4JYA F;  5DET A;  2C2Z B;  4X4T A;  3GFH A;  4IDK B;  1YZ7 A;  3BV8 A;  2RDI A;  5KG5 A;  4U8V A;  1F9H A;  4FW5 A;  2RQ4 A;  2HAF A;  1NZA A;  5LMN F;  2ZH9 A;  2WON A;  2FJD B;  4ZMM A;  3A4T A;  4NLS A;  2QLX A;  3IM8 A;  4QWD A;  1C1B A;  4OL8 A;  2EBG A;  3T9N A;  2EPI A;  3MEC B;  5KFU A;  1S0V A;  1RHR B;  4QR0 A;  1C0T A;  3KJN B;  1BQM A;  4IG3 A;  1NSA A;  1H0H B;  4KY3 A;  2IIH A;  1EP4 A;  3DYA B;  3Q22 A;  2FVR A;  1KVK A;  1TU0 B;  2IER A;  3EGN A;  3OL6 A;  2L9D A;  3KG0 A;  4ECQ A;  3PDN A;  3QWP A;  1HNX I;  4IRD A;  1J5O B;  2ASY A;  5FWK A;  4URS A;  1QE1 B;  4DV2 I;  1HIY A;  2KHD A;  1USV A;  2RKI A;  2XHW A;  2UVV A;  1I5O B;  1XNQ F;  2ZHO A;  3CJ2 A;  3E01 B;  2MZR A;  5KT5 A;  3QT7 A;  3PTW A;  1I94 I;  2B7C B;  5JEA D;  2UVU A;  5I3P A;  2B7B B;  3H4L A;  3JQK A;  1TL7 B;  1KBR A;  1RTD B;  1UVI A;  2BJ7 A;  3BSA A;  1FER A;  1TK0 A;  3RB0 A;  4NLY A;  3RBX A;  1U1N A;  1FXD A;  2B3T B;  2ZWP A;  1EB0 A;  4K0K E;  2JE6 A;  1WKL A;  3BYP A;  3AJD A;  4F25 A;  2M8D B;  1HWU A;  1REV A;  3ICL A;  1PYS B;  2HAI A;  5C0X F;  4H4O B;  1KR4 A;  4PG8 A;  4LFA J;  1WWH A;  1X31 C;  3I0S A;  1RT7 A;  3H4D A;  2E5L F;  4C8Z A;  2UXC I;  2JSX A;  1W26 A;  3GWC A;  1JLA A;  1MMN A;  3MI7 X;  4NPO A;  1D9A A;  1JNZ B;  1F5C A;  4X4N A;  4FXV A;  2BQU A;  3KJF B;  5DO2 A;  4CO1 A;  2Q1L A;  3GFZ A;  4X4P A;  3ZZP A;  3NY0 A;  4DPW A;  3NBP B;  1N5Q A;  4KKO B;  3QJP A;  2E5I A;  4R5P B;  2W7P A;  5LL6 R;  1SJQ A;  2DNM A;  5L38 A;  2U2F A;  1MN7 A;  2CG4 A;  3G6V A;  3HSG A;  3KWM A;  4L74 A;  3BQ0 A;  2BM0 A;  1QUP A;  4F8R A;  4LRD A;  3CC7 S;  4I2Q B;  3M1V B;  1Z0V A;  5H9F J;  4WP9 A;  2KYZ A;  1VQO S;  4QPT A;  1TKX A;  2HZC A;  4V19 J;  5HSP A;  2DNY A;  1AT1 B;  1RAB B;  1SKW A;  2JJ4 D;  1HNX J;  5IM0 A;  1SXL A;  3KDN A;  3GR0 A;  3MOJ B;  2DIT A;  3SQG B;  1A9N B;  1I94 J;  3CCT A;  1RLC L;  4LF5 E;  2D3O 1;  2OFG X;  5L39 A;  3FEY B;  1U0H B;  4HYK A;  3QRR A;  1T9X A;  2BUN A;  5A8K B;  3CIM A;  2AEM A;  2VBY A;  2Y8W A;  1XR7 A;  2KHC A;  4JI2 I;  2HMI B;  2D69 A;  4K2J A;  1WEL A;  3SFG A;  1WI6 A;  1HQE B;  4QWC A;  1K0V A;  3AA9 A;  3AQP A;  4PQU A;  1R43 A;  4B3M J;  2BE2 B;  2VKR A;  2BX6 A;  2SXL A;  2YKN B;  3LAM A;  2UXC J;  1TFY A;  5JVG Q;  2O1U A;  4MDT A;  5KFW A;  4ETX A;  2EKY A;  2N82 B;  3C16 B;  3DLB A;  4P7A A;  2ZKT A;  3MCS A;  3V81 B;  4A8M P;  1MML A;  4DV4 I;  1OQ3 A;  3RW7 A;  4K4S A;  1AFJ A;  1JLQ B;  2F8H A;  2LCW A;  4DR2 I;  4HI2 A;  5D4N A;  3DLK B;  4LQ9 A;  2RQK A;  4CLT A;  4CNY A;  2JNJ A;  4CO5 A;  4DV0 J;  2YWG A;  3UCG A;  4NLG A;  2ALY B;  4QNJ A;  1XK8 A;  4GKJ F;  4UF4 A;  5IWA F;  3AD9 C;  2MEW A;  2C2K B;  2HSE B;  3HCX A;  2L48 A;  1X4F A;  3POT A;  1VQM S;  3L9Z A;  1EX8 A;  4B3S E;  3DU6 A;  4ECZ A;  2OIH A;  2WW8 A;  3HUL A;  2VF3 A;  3PYD A;  4WYL A;  2PGC A;  2UU9 I;  1PVG A;  3CC2 S;  5J2P A;  4DN0 A;  3G2X A;  2HGM A;  1JL