4GKJE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4gkjE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkjE02
1STUA 3OTOE 3B82A 4R1FA 2UU9E 4JI3E 1Z5CA 4LF9I 3J81Q 1HNXE 4KHPE 4DPTA 4X64E 2UUCE 1FWLA 2VQEE 1N33E 3J7AM 1H7UA 2DB2A 4X8WA 1XNRE 1NHJA 4P52A 4DUZI 1IBKI 2L3JA 4EMDA 2AJ4A 3ZZTA 2VQFE 4JI7E 1Z5AA 4JYAI 4DR4E 3VYYA 4B3SE 3B8HA 1Z0BA 3ZZUA 2V34A 3CWVA 4B3RI 1H7SA 4DV6E 3LNUA 4WUCA 3K1JA 1Z0GA 1PKPA 1N32I 4KQVA 4X65E 4JV5I 3WU5A 2CPNA 1VISA 1HNWI 3HULA 4DR7E 3ADIA 4K0KE 4DV7E 3QT5A 4LF6E 2BM1A 1X48A 4LF8I 4LF4E 1RC7A 4WUBA 4MYTA 3ADGA 4DV0I 1XMOI 4DV5I 3HTXA 1EKZA 4HXZA 2ZITA 5A2QC 2V2ZA 4DPWA 3ZKBA 1IBME 1FJGE 2A2DA 2A2CA 4OX9E 3T1HI 4JI4I 1N36E 5A2QQ 4DU8A 1WHNA 3ZKDA 2NA2A 2UXCI 1XNQE 3JAMC 4X62I 2UXDI 4JI1I 4LFAE 4RPFA 4DXLA 4Z7YA 2EZ6A 2E1RA 2Q2EB 1RQ0A 1N0VC 1ELOA 2JY9A 4DKKA 2UUAE 1KIJA 4ZVIA 5GMEA 1S16A 4JI8I 1ZM3A 5LL6R 4JI2I 5LMUI 2HHHI 4DR6E 5LMNE 3J7AG 2VF3A 4P7AA 1B62A 1FWKA 4NXME 4B3ME 4DV3I 2N3HA 2UXBE 1J26A 4WUDA 3F0NA 4B3TE 2LTSA 1Z0EA 1PIEA 4DR1E 1XMQI 1Z59A 3J81C 4DV4I 1D6TA 2L3CA 1T4OA 1UILA 4DR3I 1H73A 1Z5BA 4HACB 1Z0VA 3OTOI 4XTJA 4LF5E 1NHHA 5IT9C 4JI3I 3ZZ0A 1HNXI 1I94E 2V8PA 4KHPI 4X64I 1U2RA 5BR8E 4LFBE 5GMDA 1KVKA 1WHQA 5IT9Q 1IBLI 4NXNI 2XEXA 4LF9E 3WU3A 4GKJI 4M30A 4LF7E 1YYWA 2LJPA 2IHR1 4DR4I 4B3SI 2L2KB 4DV1E 4DV2E 3LLHA 4URLA 4DUZE 4LFCI 3ZM7A 4WYQB 3QT7A 2JVAA 4PRXA 2RTXA 2RSMA 1ZM4A 4JYAE 2L2NA 2CZ9A 4X65I 3VYXA 1H72C 4Z7CA 1YYKA 2B7VA 4UT4A 4YHHI 4DR7I 4UTGA 4DU7A 1X49A 2F4VI 4K0KI 4DV7I 4LF6I 2LTRA 4JI6E 4DPXA 3D4JA 4OOGC 2KHXA 1MG7A 2LUPB 3T1YE 1N32E 1RREA 4JI0E 1J5EE 1RR9A 4YY3E 1HR0E 4FWHA 3ADLA 1IBMI 2L33A 2UUBE 2LJHA 5FLXQ 4OX9I 1XMOE 4DV0E 1N36I 4DV5E 2B7TA 2R42A 2ZBKB 3B78A 4JI5I 2DMYA 4GKKE 4LFAI 1ZM9A 2DEJA 1FKAE 2R3VA 4PRVA 1X47A 1H74A 4M1KA 2UXCE 2UUAI 4DR2E 4X66I 4X62E 2X36A 2DEIA 3WU6A 1Z0TA 4AQYI 4USMA 5IWAE 1T4LB 4HYMA 2EFGA 2N3GA 4DR5I 4NXMI 4B3MI 4ED4A 2RS7A 1K47A 2UXBI 1NZ0A 2LUQA 5LMUE 2HHHE 1OJ4A 4DUYE 3ADJA 1N34I 3C4BA 4DR1I 3H4LA 2HK3A 2MDRA 4DV3E 1DI2A 2X7IA 1HNZE 4PU9A 2ZM6E 1FI4A 1ZXNA 3J80C 3PYEA 4USKA 2LRSA 1NHIA 2UU9I 2L2MA 2E5LE 2BV3A 2V2VA 2UUCI 3PYGA 2VQEI 1N33I 4DV4E 3J80Q 1O0WA 5BR8I 1XNRI 5CFFE 4DR3E 2BM0A 4JG4A 2YT4A 1UHZA 2VQFI 4JI7I 4HY1A 1FNMA 1ZM2A 1A6FA 1DARA 4LF7I 1IBKE 4DV1I 4DV6I 4DV2I 2LBSB 3Q1QA 1QZRA 1IBLE 4NXNE 1ZBTA 4I3HA 1MX0A 2HFUA 4GKJE 2HKJA 2GS8A 4B3RE 1EI1A 2HK2A 4LF4I 1UEKA 1XHKA 4JI6I 1EA6A 4LFCE 3PYDA 3V2UC 1WUUA 3T1YI 5FLXC 4JV5E 1HNWE 2OI2A 4JI0I 1J5EI 4LF8E 4YHHE 2F4VE 4YY3I 1HR0I 1T4NA 2V2QA 1FJGI 1ZXMA 2UUBI 1QU6A 4MYUA 3WU4A 3QT8A 4FW9A 3K17A 1XNQI 3P1XA 4GKKI 1KKHA 4JI4E 3T1HE 1MU5A 2NUFA 1S4EA 2NUGA 3C4TA 2NPFA 2UXDE 1GQEA 4JI5E 2HKEA 2B3TB 4JI1E 2J7KA 4FWGA 4DR2I 1BKNA 5LMNI 4DR6I 3LPSA 4DPYA 1B63A 5IWAI 3M6AA 3PYFA 3LTOA 3JAMQ 4FN5A 1Z0WA 4JI8E 4X66E 4JI2E 5L3JA 1N0UA 4HACA 4B3TI 4AQYE 1KTVA 4DUYI 1YZ9A 2NUEA 3V5RA 2RS6A 4DR5E 3QT6A 1Z0CA 3J7Yp 4WFTA 2HFSA 1YYOA 4DPUA 1HNZI 2ZM6I 1N34E 3GONA 4LF5I 2E5LI 1XMQE 1I94I 4FWDA 4LFBI 1PVGA 2DIXA 4M2ZA 2WW4A
chains in the Genus database with same CATH superfamily
4HTGA 2F8BA 1STUA 3OTOE 3B82A 4R1FA 3DJWA 2UU9E 4JI3E 1Z5CA 3K85A 4LF9I 3J81Q 1GTKA 1HNXE 4KHPE 4FK5C 2YU5A 4X64E 1OYSA 4DPTA 2UUCE 1FWLA 5C0XC 2VQEE 2WBSA 5KL4A 1N33E 3Q6MA 3J7AM 4ZYGA 2DB2A 1H7UA 4JI8I 1G2FC 4X8WA 3GLLA 5A6BA 1XNRE 1TF6A 1UDNA 1BBOA 1NHJA 4P52A 5C0XB 4DUZI 1IBKI 2L3JA 3H1CA 4EMDA 4MDTA 2R1FA 2EOJA 2AJ4A 3PS1A 3ZZTA 2VQFE 2H36X 4JI7E 2NN6D 2J65A 4LOMA 1Z5AA 2N8XA 4RH8A 2EPRA 4JYAI 4DR4E 2EMHA 5DROA 3VYYA 4B3SE 3KZYA 2EE8A 2EORA 3B8HA 5EL9A 1Z0BA 3ZZUA 4HEIA 2I13A 2LCEA 2V34A 1WRJA 2WP8B 3CWVA 5A69A 2NN6C 4B3RI 1H7SA 4DV6E 3LNUA 4WUCA 3K1JA 1PDAA 1Z0GA 4MU3A 1PKPA 2JR1A 2PNZB 1A1KA 1N32I 4KQVA 4X65E 4IFDA 3WU5A 2LVHA 4M9VC 4JV5I 2CPNA 1VI7A 2WCC3 2EM6A 1VISA 4OKGA 2EOOA 1HNWI 3HULA 4DR7E 1KJKA 4BS9A 1Y6ZA 5A6AA 3ADIA 4DV7E 4K0KE 3P06A 4LF6E 2BM1A 1X48A 3EQ1A 3QT5A 5DRRA 3H09A 4BBYA 4LF8I 5JEAE 4LF4E 1TF3A 3PRYA 2EM8A 1RC7A 4WUBA 3EPKA 1GZ6A 2FGGA 2Z5CA 5C0XF 2VE7C 4MYTA 4IZJB 3EPJA 2LO3A 3ADGA 2EWLA 5AASA 1A1IA 4DV0I 1XMOI 4DV5I 3HTXA 2YZTA 5AE3A 1EKZA 4HXZA 4NBQA 3HXLA 2ZITA 2EMCA 1PJSA 3U1KA 5A2QC 2O1VA 4LCFA 2V2ZA 2EPNA 4DPWA 3ZKBA 1IBME 4ZYEA 3CDJA 4BA2B 3JU0A 1FJGE 2A2DA 4R2QA 2A2CA 4OX9E 3B4TA 5EKWA 3T1HI 3GMEA 2EOQA 4JI4I 1N36E 2EOSA 2NN6F 2PO2A 5A2QQ 4DU8A 1WHNA 3ZKDA 2NA2A 5K36B 2YRMA 3U1YA 2UXCI 3ZOQB 1X6EA 3JAMC 1XNQE 3EPLA 4X62I 2C39A 1ZAAC 2LJUA 2UXDI 4JI1I 4U3DA 4LFAE 4RPFA 4DXLA 4Z7YA 1X3CA 4O4KA 2MKNA 2YTOA 2EZ6A 2E1RA 1BB8A 2Q2EB 3L7ZA 2EOEA 3MHHC 1WJPA 4MLVA 1RQ0A 4KZSA 1N0VC 2NABA 4TUGA 1ELOA 2EPLX 2JY9A 4DKKA 2UUAE 1KIJA 1UDQA 4ZVIA 5GMEA 2LE2A 1E3HA 2YTDA 2EOHA 2JXPA 3BIDA 2M1SA 2ODRD 1DQ3A 2YTNA 2EPMX 5LL6R 4F2JC 1P47A 1AAYA 1ZM3A 2BR2A 5LMUI 2HHHI 4JI2I 4DR6E 5LMNE 3J7AG 4Q28A 1EH6A 1EH8A 5DNLA 2FTXB 1BBGA 4P78A 4BCAA 2ODRC 4WPYA 2VF3A 4P7AA 2EM4A 2CVEA 2MDGA 1B62A 1FWKA 4NXME 4BMJA 4B3ME 4N3OA 4R2CA 2EPOA 4DV3I 4IFDE 2N3HA 2UXBE 5K36F 2Q8UA 1J26A 2R76A 1OYRA 3PS3A 4WUDA 3HPZA 3F0NA 4B3TE 3CDIA 2WZOA 2JE6A 2LTSA 2BB8A 2EOIA 1Z0EA 1JK1A 1PIEA 2MC5A 4DR1E 2O3ZA 2JEAA 2EPKX 2L8TA 1XMQI 4OO1D 1Z59A 1QNTA 3J81C 3HJCA 4DV4I 1G2DC 1D6TA 2L3CA 2K4VA 3PS2A 2D9HA 1T4OA 1UILA 3M85D 4DR3I 4QNKA 1H73A 5JEAD 5C0XA 1Z5BA 3Q6NA 1T38A 4HACB 4OO1C 2V8QB 1Z0VA 4FW4A 4MQYA 1UBDC 4WX9A 3OTOI 2EMAA 4XTJA 5IT9C 4LF5E 1NHHA 4JI3I 3ZZ0A 2DMIA 4N4RB 1HNXI 5DRPA 1I94E 2V8PA 1F2IG 4OO1B 4KHPI 4X64I 1U2RA 2V87A 5BR8E 4OZEA 4LFBE 1X6HA 3DD6A 4FW6A 2PO0B 1E3PA 5GMDA 1KVKA 1WHQA 2JT2A 2E72A 5JEAB 5IT9Q 5AC4A 1IBLI 4GEQB 4NXNI 2EM2A 1WXRA 1S16A 2NN6A 2XEXA 2PNZA 1IQSA 5KL5A 4LF9E 1YHCA 2ELYA 3WU3A 4GKJI 2V88A 4LU9A 4M30A 4RHBB 5ADZA 4LF7E 2MC6A 1YYWA 2IHR1 2LJPA 4LCHA 4DR4I 4B3SI 2C37A 2L2KB 4LTYA 4J8ZA 4DV1E 4DV2E 3LLHA 4URLA 2K7IA 2EPPA 2F1DA 5A6BD 4DUZE 4LPFA 2M9AA 4L5NC 2JEBA 4LFCI 2EPZA 3ZM7A 4WYQB 4IZJD 3QT7A 2JVAA 4R2RA 2IESA 4PRXA 2EMGA 2RTXA 1IMUA 1Y4UA 2RSMA 1ZM4A 4JYAE 2L2NA 2CZ9A 3KRNA 4X65I 3LMLA 2EN7A 3VYXA 1H72C 4Z7CA 2JP9A 4OO1F 2YRKA 4M0VA 1YYKA 2B7VA 4UT4A 4YHHI 4DR7I 4UTGA 4DU7A 1X49A 2FV4B 4WSPA 2F4VI 2RPCA 4DV7I 4K0KI 4LF6I 2LTRA 4LCGA 2EMFA 4JI6E 4DPXA 2KONA 3D4JA 3GCMA 5JEAF 4OOGC 2KHXA 3QG5C 2LUPB 2JOXA 1MG7A 4P7DA 2YWQA 1XXEA 3T1YE 2GQ0A 3F6HA 1N32E 2EL6A 2EOMA 1RREA 2C38A 4F6MA 5K36D 2ELZA 2DSYA 2EN6A 2WBTA 1YUJA 4JI0E 4I8OA 3F6GA 1YH8A 1J5EE 1RR9A 1T39A 2LMZA 4IZKA 4L8NA 4BHBA 2EL4A 4YY3E 5KL2A 1HR0E 2Z5BA 1DGCA 4FWHA 3ADLA 1YPNA 1RHYA 5K36C 2GHFA 1SR9A 1IBMI 2L33A 2UUBE 2LJHA 5FLXQ 5C0XE 1IQOA 2EM7A 3IWBA 4ZYHA 2EM5A 2HJJA 2M7QA 2HGHA 5A6JA 4OX9I 4DV0E 1XMOE 1N36I 2IOQA 4DV5E 2E1MA 2EPCA 2B7TA 2R42A 1Y4SA 1NCSA 2ZBKB 3B78A 4JI5I 2DMYA 2GO4A 2PNMA 2YTQA 3HQ1A 4GKKE 4J3DA 1X5WA 2WNRA 4BA1A 4TUIA 2EJ4A 4LFAI 1ZM9A 1JK2A 1A1FA 2MKDA 2DEJA 4O43A 2Z5CB 2EOFA 1FKAE 2JOBA 4Q35B 2NN6E 2R3VA 4PRVA 1X47A 1UN6B 1H74A 4M1KA 5A6KA 2UXCE 2UUAI 4DR2E 4X66I 4X62E 2O1TA 1B69A 3THOB 2X36A 2DEIA 2YTEA 3WU6A 2VRDA 4DMIA 1Z0TA 4USMA 5IWAE 2EMXA 4AQYI 3MSWA 1T4LB 2EN8A 5IV8B 4HYMA 2EQ0A 1R6MA 2CGEA 2EFGA 1N3GA 2ADRA 2N3GA 1UDSA 4F9BB 4DR5I 2PO2B 4ZYDA 2JPAA 1L4SA 2PO1A 4NXMI 4B3MI 3AV0A 4ED4A 2RS7A 1K47A 2UXBI 1NZ0A 2C39B 2LUQA 5LMUE 2HHHE 2PRTA 1OJ4A 3EPHA 2YTJA 4R8OA 2GLIA 3P3GA 1TN9A 2PNLA 4DUYE 3ADJA 1N34I 2BBGA 1Y60A 2IERA 3C4BA 2O1UA 3BBGA 5KL3A 4DR1I 2ENCA 3H4LA 4OO1A 3JTZA 2MDRA 2HK3A 2L92A 4DV3E 3AUZA 2HC5A 1DI2A 2X7IA 1ZU1A 2YTGA 4F9AB 4O5GA 4IS1C 1A1HA 2KOUA 1R6LA 2BR2B 2EOZA 1HNZE 2CTDA 3THNA 2ZM6E 3J80C 3KWRA 1FI4A 1ZXNA 3P76A 3PYEA 4MU0A 4PU9A 2LRSA 4USKA 5ELWA 1NHIA 2EOYA 2UU9I 2L2MA 2E5LE 2EM3A 2BV3A 4O24A 2VESA 2V2VA 2EMIA 5JEAC 2JYAA 2EPXA 4IJDA 3MHSC 5AE2A 1X6FA 3M99B 2UUCI 3PYGA 2VQEI 3FIGA 3TQMA 4DV4E 2WP8A 2EM9A 3J80Q 1N33I 1O0WA 2GO3A 4NZVA 5BR8I 1XNRI 2RSIA 5CFFE 4DR3E 2BM0A 4JG4A 2V85A 1USVA 1EH7A 3RMPA 3HKMA 2YT4A 2EQ1A 1UHZA 1YFHA 3P3CA 2JE6B 2VQFI 2V89A 4HY1A 4F9CB 4JI7I 1SFEA 1FNMA 1ZM2A 1A6FA 2A25A 2V83A 3DF6A 5KL7A 2EPUA 1DARA 3P3EA 2JEAB 4MU4A 4U3BA 4GZNC 4LF7I 2DRPA 4F54A 5IXMB 4R2SA 1IBKE 4DV1I 1MEYC 4DV2I 2LBSB 1Y5YA 2IOPA 5DRQA 4FW7A 4DV6I 2EN3A 2RQLA 5AC5A 4WXDA 1QZRA 3Q1QA 1ZBQA 2VF1A 1IBLE 4NXNE 1ZBTA 3VK6A 4R2AA 2EOXA 4IZJA 4I3HA 2EMYA 1MX0A 2HFUA 4GKJE 2YPNA 2HKJA 2CSHA 2EPAA 1HK7A 2GS8A 4KWYA 2EL5A 4B3RE 2EP3A 1EI1A 2O1WA 5DNXA 2EN4A 2DLKA 2HK2A 4AIDA 4LF4I 1UEKA 1XHKA 4BA2A 4JI6I 2B9DA 4LFCE 1EA6A 3PYDA 3V2UC 4R2DA 1WUUA 5DNYA 2NN6B 1PJQA 3T1YI 5FLXC 4JV5E 1Z1BA 1UDOA 3BF2A 5K36A 1HNWE 4NHRA 4IFDD 2OI2A 4JI0I 5LLQA 3UHMA 2M4IA 4OO1E 3IWDA 2AE8A 3IWCA 1P42A 4LF8E 2GPIA 2C37B 4FW5A 4YHHE 1J5EI 2EM0A 2F4VE 2EN2A 3C6MA 4YY3I 1HR0I 1T4NA 2V2QA 4GQUA 4IFDC 2J7JA 4MLQA 4R2PA 1FJGI 1ZXMA 2JEBB 4FW3A 2UUBI 3M7NG 1NEIA 1QU6A 2EMZA 5F3WA 1KYQA 4MYUA 3WU4A 4BHCA 4IFDB 3QT8A 2EMBA 4FW9A 3K17A 4AIMA 1XNQI 3P1XA 2EMLA 2DLQA 4GKKI 1AH5A 1KKHA 4IS9A 2EMWA 2YRHA 3HPSA 3T1HE 4JI4E 1MU5A 2NUFA 2ENHA 1S4EA 3UK3C 1OYPA 4AM3A 3M7ND 2NUGA 2YTFA 2C38B 2YTIA 3C4TA 2I9IA 2NPFA 4QNJA 2UXDE 1GQEA 5AE1A 4JI5E 4IZKB 2HKEA 2B3TB 4JI1E 2J7KA 4FWGA 4DR2I 4WXCA 1LLMC 2YU8A 1BKNA 5LMNI 2Z5BB 2YTPA 4DR6I 3LPSA 1MGTA 2ENAA 4DPYA 1USUA 4R2EA 1ZR9A 3VHTB 1B63A 5IWAI 4R03A 2YSOA 2BA1G 1YUIA 3M6AA 3PYFA 2BA0G 3LTOA 3JAMQ 4F6NA 4FN5A 4ISAA 1Z0WA 4JI8E 4X66E 4IFDF 4JI2E 5L3JA 2V86A 1YSAC 2JWOA 4BC9A 2LT7A 1N0UA 2Z5EA 3OMLA 3C6KA 1PJTA 2WNRB 4HACA 4BA1B 2YSPA 4B3TI 4AQYE 3L7ZB 1A1LA 1KTVA 4X9JA 4DUYI 1A1GA 4BC7A 1YZ9A 2NUEA 3NZKA 3V5RA 2RS6A 5FWKA 2CG9A 2WBUA 4DR5E 3ECRA 3QT6A 1Z0CA 2BA1D 5K36E 2BA0D 3J7Yp 3M85G 4MU1A 4WFTA 2HFSA 2PO0A 2L6MA 2LV2A 5JEAA 2CT1A 1YYOA 4DPUA 5TSEA 5KL6A 1HNZI 2ZM6I 5T6JA 3BGHA 1N34E 3GONA 2EMKA 2EQ3A 4LF5I 2E5LI 2EN1A 1XMQE 1I94I 4FWDA 2PO1B 2G7HA 4WSGA 2DGCA 4LFBI 1PVGA 2DIXA 4M2ZA 3L00A 3KZZA 2WW4A 3K6QA 1RMDA 1A1JA 5C0XD
chains in the Genus database with same CATH topology
2F8BA 1STUA 3OTOE 3B82A 4R1FA 3DJWA 2UU9E 4JI3E 1Z5CA 3K85A 4LF9I 3J81Q 1HNXE 4KHPE 4DPTA 4X64E 2UUCE 1FWLA 2VQEE 1N33E 3Q6MA 3J7AM 1H7UA 2DB2A 4X8WA 1XNRE 1NHJA 4P52A 4DUZI 1IBKI 2L3JA 4EMDA 2AJ4A 3ZZTA 2VQFE 2H36X 4JI7E 1Z5AA 4JYAI 4DR4E 3VYYA 4B3SE 3B8HA 1Z0BA 3ZZUA 2V34A 3CWVA 4B3RI 1H7SA 4DV6E 3LNUA 4WUCA 3K1JA 1Z0GA 1PKPA 2JR1A 1N32I 4KQVA 4X65E 4JV5I 3WU5A 2CPNA 1VISA 1HNWI 3HULA 4DR7E 4BS9A 1Y6ZA 3ADIA 4K0KE 4DV7E 3P06A 4LF6E 2BM1A 1X48A 3QT5A 4LF8I 3H09A 4BBYA 4LF4E 3PRYA 1RC7A 4WUBA 1GZ6A 2FGGA 2Z5CA 2VE7C 4MYTA 4IZJB 3ADGA 2EWLA 5AASA 4DV0I 1XMOI 4DV5I 3HTXA 2YZTA 5AE3A 1EKZA 4HXZA 3HXLA 2ZITA 5A2QC 2O1VA 2V2ZA 4DPWA 3ZKBA 1IBME 3JU0A 1FJGE 2A2DA 2A2CA 4OX9E 3T1HI 4JI4I 1N36E 5A2QQ 4DU8A 1WHNA 3ZKDA 2NA2A 2UXCI 3ZOQB 3JAMC 1XNQE 4X62I 2UXDI 4JI1I 4LFAE 4RPFA 4DXLA 4Z7YA 2EZ6A 2E1RA 2Q2EB 1RQ0A 4KZSA 1N0VC 1ELOA 4TUGA 2JY9A 4DKKA 2UUAE 1KIJA 4ZVIA 5GMEA 2LE2A 1S16A 2M1SA 2ODRD 1ZM3A 1DQ3A 4JI8I 5LL6R 4JI2I 5LMUI 2HHHI 4DR6E 5LMNE 3J7AG 4Q28A 2FTXB 4P78A 4BCAA 2ODRC 4WPYA 2VF3A 4P7AA 1B62A 1FWKA 4NXME 4BMJA 4B3ME 4N3OA 4DV3I 2N3HA 2UXBE 1J26A 4WUDA 3HPZA 3F0NA 4B3TE 2WZOA 2LTSA 1Z0EA 1PIEA 2MC5A 4DR1E 2L8TA 1XMQI 1Z59A 3J81C 3HJCA 4DV4I 1D6TA 2L3CA 2K4VA 1T4OA 1UILA 4DR3I 1H73A 1Z5BA 3Q6NA 4HACB 2V8QB 1Z0VA 3OTOI 4XTJA 5IT9C 4LF5E 1NHHA 4JI3I 3ZZ0A 1HNXI 1I94E 2V8PA 4KHPI 4X64I 1U2RA 2V87A 5BR8E 4LFBE 5GMDA 1KVKA 1WHQA 5IT9Q 1IBLI 4GEQB 4NXNI 1WXRA 2XEXA 4LF9E 3WU3A 4GKJI 2V88A 4LU9A 4M30A 5ADZA 4LF7E 2MC6A 1YYWA 2IHR1 2LJPA 4DR4I 4B3SI 2L2KB 4LTYA 4J8ZA 4DV1E 4DV2E 3LLHA 4URLA 4DUZE 4L5NC 4LFCI 3ZM7A 4WYQB 4IZJD 3QT7A 2JVAA 4PRXA 2RTXA 1Y4UA 2RSMA 1ZM4A 4JYAE 2L2NA 2CZ9A 4X65I 3LMLA 3VYXA 1H72C 4Z7CA 4M0VA 1YYKA 2B7VA 4UT4A 4YHHI 4DR7I 4UTGA 4DU7A 1X49A 2FV4B 4WSPA 2F4VI 4DV7I 4K0KI 4LF6I 2LTRA 4JI6E 4DPXA 2KONA 3D4JA 4OOGC 2KHXA 1MG7A 2LUPB 2JOXA 4P7DA 3T1YE 2GQ0A 3F6HA 1N32E 1RREA 4JI0E 2DSYA 4I8OA 3F6GA 1J5EE 1RR9A 2LMZA 4IZKA 4L8NA 4YY3E 1HR0E 2Z5BA 4FWHA 3ADLA 1SR9A 1IBMI 2L33A 2UUBE 2LJHA 5FLXQ 3IWBA 2M7QA 4OX9I 1XMOE 4DV0E 1N36I 2IOQA 4DV5E 2E1MA 2B7TA 2R42A 1Y4SA 2ZBKB 3B78A 4JI5I 2DMYA 2PNMA 3HQ1A 4GKKE 4TUIA 4LFAI 1ZM9A 2DEJA 2Z5CB 1FKAE 2JOBA 2R3VA 4PRVA 1X47A 1H74A 4M1KA 2UXCE 2UUAI 4DR2E 4X66I 4X62E 2O1TA 2X36A 2DEIA 3WU6A 4DMIA 1Z0TA 4USMA 5IWAE 4AQYI 3MSWA 1T4LB 4HYMA 2CGEA 2EFGA 2N3GA 4F9BB 4DR5I 4NXMI 4B3MI 3AV0A 4ED4A 2RS7A 1K47A 2UXBI 1NZ0A 2LUQA 5LMUE 2HHHE 1OJ4A 4R8OA 2PNLA 4DUYE 3ADJA 1N34I 3C4BA 2O1UA 4DR1I 3H4LA 3JTZA 2MDRA 2HK3A 2L92A 4DV3E 1DI2A 3AUZA 2X7IA 4F9AB 2KOUA 1HNZE 4PU9A 2ZM6E 3J80C 3KWRA 1FI4A 1ZXNA 3PYEA 4USKA 2LRSA 1NHIA 2UU9I 2L2MA 2E5LE 2BV3A 2V2VA 5AE2A 2UUCI 3PYGA 2VQEI 3FIGA 1N33I 4DV4E 3J80Q 1O0WA 5BR8I 1XNRI 5CFFE 4DR3E 2BM0A 4JG4A 2V85A 1USVA 3RMPA 2YT4A 1UHZA 2VQFI 2V89A 4HY1A 4F9CB 4JI7I 1FNMA 1ZM2A 1A6FA 2V83A 3DF6A 1DARA 4LF7I 4F54A 1IBKE 4DV1I 4DV6I 4DV2I 2LBSB 2IOPA 3Q1QA 1QZRA 1ZBQA 2VF1A 1IBLE 4NXNE 1ZBTA 3VK6A 4IZJA 4I3HA 1MX0A 2HFUA 4GKJE 2HKJA 1HK7A 2GS8A 4B3RE 1EI1A 2O1WA 2HK2A 4LF4I 1UEKA 1XHKA 4JI6I 2B9DA 4LFCE 1EA6A 3PYDA 3V2UC 1WUUA 5DNYA 3T1YI 5FLXC 4JV5E 1HNWE 2OI2A 4JI0I 2M4IA 3IWDA 1J5EI 3IWCA 4LF8E 4YHHE 2F4VE 4YY3I 1HR0I 1T4NA 2V2QA 1FJGI 1ZXMA 2UUBI 1QU6A 5F3WA 4MYUA 3WU4A 3QT8A 4FW9A 3K17A 1XNQI 3P1XA 4GKKI 1KKHA 3HPSA 3T1HE 4JI4E 1MU5A 2NUFA 1S4EA 2NUGA 3C4TA 2NPFA 2UXDE 1GQEA 5AE1A 4JI5E 4IZKB 2HKEA 2B3TB 4JI1E 2J7KA 4FWGA 4DR2I 1BKNA 5LMNI 2Z5BB 4DR6I 3LPSA 4DPYA 1USUA 1B63A 5IWAI 4R03A 3M6AA 3PYFA 3LTOA 3JAMQ 4FN5A 1Z0WA 4JI8E 4X66E 4JI2E 5L3JA 2V86A 2JWOA 4BC9A 1N0UA 2Z5EA 3OMLA 4HACA 4B3TI 4AQYE 1KTVA 4DUYI 4BC7A 1YZ9A 2NUEA 3V5RA 2RS6A 5FWKA 2CG9A 4DR5E 3QT6A 1Z0CA 3J7Yp 4WFTA 2HFSA 2L6MA 1YYOA 4DPUA 1HNZI 2ZM6I 5T6JA 1N34E 3GONA 4LF5I 2E5LI 1XMQE 1I94I 4FWDA 2G7HA 4LFBI 1PVGA 2DIXA 4M2ZA 2WW4A 3K6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STU A;  3OTO E;  3B82 A;  4R1F A;  2UU9 E;  4JI3 E;  1Z5C A;  4LF9 I;  3J81 Q;  1HNX E;  4KHP E;  4DPT A;  4X64 E;  2UUC E;  1FWL A;  2VQE E;  1N33 E;  3J7A M;  1H7U A;  2DB2 A;  4X8W A;  1XNR E;  1NHJ A;  4P52 A;  4DUZ I;  1IBK I;  2L3J A;  4EMD A;  2AJ4 A;  3ZZT A;  2VQF E;  4JI7 E;  1Z5A A;  4JYA I;  4DR4 E;  3VYY A;  4B3S E;  3B8H A;  1Z0B A;  3ZZU A;  2V34 A;  3CWV A;  4B3R I;  1H7S A;  4DV6 E;  3LNU A;  4WUC A;  3K1J A;  1Z0G A;  1PKP A;  1N32 I;  4KQV A;  4X65 E;  4JV5 I;  3WU5 A;  2CPN A;  1VIS A;  1HNW I;  3HUL A;  4DR7 E;  3ADI A;  4K0K E;  4DV7 E;  3QT5 A;  4LF6 E;  2BM1 A;  1X48 A;  4LF8 I;  4LF4 E;  1RC7 A;  4WUB A;  4MYT A;  3ADG A;  4DV0 I;  1XMO I;  4DV5 I;  3HTX A;  1EKZ A;  4HXZ A;  2ZIT A;  5A2Q C;  2V2Z A;  4DPW A;  3ZKB A;  1IBM E;  1FJG E;  2A2D A;  2A2C A;  4OX9 E;  3T1H I;  4JI4 I;  1N36 E;  5A2Q Q;  4DU8 A;  1WHN A;  3ZKD A;  2NA2 A;  2UXC I;  1XNQ E;  3JAM C;  4X62 I;  2UXD I;  4JI1 I;  4LFA E;  4RPF A;  4DXL A;  4Z7Y A;  2EZ6 A;  2E1R A;  2Q2E B;  1RQ0 A;  1N0V C;  1ELO A;  2JY9 A;  4DKK A;  2UUA E;  1KIJ A;  4ZVI A;  5GME A;  1S16 A;  4JI8 I;  1ZM3 A;  5LL6 R;  4JI2 I;  5LMU I;  2HHH I;  4DR6 E;  5LMN E;  3J7A G;  2VF3 A;  4P7A A;  1B62 A;  1FWK A;  4NXM E;  4B3M E;  4DV3 I;  2N3H A;  2UXB E;  1J26 A;  4WUD A;  3F0N A;  4B3T E;  2LTS A;  1Z0E A;  1PIE A;  4DR1 E;  1XMQ I;  1Z59 A;  3J81 C;  4DV4 I;  1D6T A;  2L3C A;  1T4O A;  1UIL A;  4DR3 I;  1H73 A;  1Z5B A;  4HAC B;  1Z0V A;  3OTO I;  4XTJ A;  4LF5 E;  1NHH A;  5IT9 C;  4JI3 I;  3ZZ0 A;  1HNX I;  1I94 E;  2V8P A;  4KHP I;  4X64 I;  1U2R A;  5BR8 E;  4LFB E;  5GMD A;  1KVK A;  1WHQ A;  5IT9 Q;  1IBL I;  4NXN I;  2XEX A;  4LF9 E;  3WU3 A;  4GKJ I;  4M30 A;  4LF7 E;  1YYW A;  2LJP A;  2IHR 1;  4DR4 I;  4B3S I;  2L2K B;  4DV1 E;  4DV2 E;  3LLH A;  4URL A;  4DUZ E;  4LFC I;  3ZM7 A;  4WYQ B;  3QT7 A;  2JVA A;  4PRX A;  2RTX A;  2RSM A;  1ZM4 A;  4JYA E;  2L2N A;  2CZ9 A;  4X65 I;  3VYX A;  1H72 C;  4Z7C A;  1YYK A;  2B7V A;  4UT4 A;  4YHH I;  4DR7 I;  4UTG A;  4DU7 A;  1X49 A;  2F4V I;  4K0K I;  4DV7 I;  4LF6 I;  2LTR A;  4JI6 E;  4DPX A;  3D4J A;  4OOG C;  2KHX A;  1MG7 A;  2LUP B;  3T1Y E;  1N32 E;  1RRE A;  4JI0 E;  1J5E E;  1RR9 A;  4YY3 E;  1HR0 E;  4FWH A;  3ADL A;  1IBM I;  2L33 A;  2UUB E;  2LJH A;  5FLX Q;  4OX9 I;  1XMO E;  4DV0 E;  1N36 I;  4DV5 E;  2B7T A;  2R42 A;  2ZBK B;  3B78 A;  4JI5 I;  2DMY A;  4GKK E;  4LFA I;  1ZM9 A;  2DEJ A;  1FKA E;  2R3V A;  4PRV A;  1X47 A;  1H74 A;  4M1K A;  2UXC E;  2UUA I;  4DR2 E;  4X66 I;  4X62 E;  2X36 A;  2DEI A;  3WU6 A;  1Z0T A;  4AQY I;  4USM A;  5IWA E;  1T4L B;  4HYM A;  2EFG A;  2N3G A;  4DR5 I;  4NXM I;  4B3M I;  4ED4 A;  2RS7 A;  1K47 A;  2UXB I;  1NZ0 A;  2LUQ A;  5LMU E;  2HHH E;  1OJ4 A;  4DUY E;  3ADJ A;  1N34 I;  3C4B A;  4DR1 I;  3H4L A;  2HK3 A;  2MDR A;  4DV3 E;  1DI2 A;  2X7I A;  1HNZ E;  4PU9 A;  2ZM6 E;  1FI4 A;  1ZXN A;  3J80 C;  3PYE A;  4USK A;  2LRS A;  1NHI A;  2UU9 I;  2L2M A;  2E5L E;  2BV3 A;  2V2V A;  2UUC I;  3PYG A;  2VQE I;  1N33 I;  4DV4 E;  3J80 Q;  1O0W A;  5BR8 I;  1XNR I;  5CFF E;  4DR3 E;  2BM0 A;  4JG4 A;  2YT4 A;  1UHZ A;  2VQF I;  4JI7 I;  4HY1 A;  1FNM A;  1ZM2 A;  1A6F A;  1DAR A;  4LF7 I;  1IBK E;  4DV1 I;  4DV6 I;  4DV2 I;  2LBS B;  3Q1Q A;  1QZR A;  1IBL E;  4NXN E;  1ZBT A;  4I3H A;  1MX0 A;  2HFU A;  4GKJ E;  2HKJ A;  2GS8 A;  4B3R E;  1EI1 A;  2HK2 A;  4LF4 I;  1UEK A;  1XHK A;  4JI6 I;  1EA6 A;  4LFC E;  3PYD A;  3V2U C;  1WUU A;  3T1Y I;  5FLX C;  4JV5 E;  1HNW E;  2OI2 A;  4JI0 I;  1J5E I;  4LF8 E;  4YHH E;  2F4V E;  4YY3 I;  1HR0 I;  1T4N A;  2V2Q A;  1FJG I;  1ZXM A;  2UUB I;  1QU6 A;  4MYU A;  3WU4 A;  3QT8 A;  4FW9 A;  3K17 A;  1XNQ I;  3P1X A;  4GKK I;  1KKH A;  4JI4 E;  3T1H E;  1MU5 A;  2NUF A;  1S4E A;  2NUG A;  3C4T A;  2NPF A;  2UXD E;  1GQE A;  4JI5 E;  2HKE A;  2B3T B;  4JI1 E;  2J7K A;  4FWG A;  4DR2 I;  1BKN A;  5LMN I;  4DR6 I;  3LPS A;  4DPY A;  1B63 A;  5IWA I;  3M6A A;  3PYF A;  3LTO A;  3JAM Q;  4FN5 A;  1Z0W A;  4JI8 E;  4X66 E;  4JI2 E;  5L3J A;  1N0U A;  4HAC A;  4B3T I;  4AQY E;  1KTV A;  4DUY I;  1YZ9 A;  2NUE A;  3V5R A;  2RS6 A;  4DR5 E;  3QT6 A;  1Z0C A;  3J7Y p;  4WFT A;  2HFS A;  1YYO A;  4DPU A;  1HNZ I;  2ZM6 I;  1N34 E;  3GON A;  4LF5 I;  2E5L I;  1XMQ E;  1I94 I;  4FWD A;  4LFB I;  1PVG A;  2DIX A;  4M2Z A;  2WW4 A; 
#chains in the Genus database with same CATH topology
 4HTG A;  2F8B A;  1STU A;  3OTO E;  3B82 A;  4R1F A;  3DJW A;  2UU9 E;  4JI3 E;  1Z5C A;  3K85 A;  4LF9 I;  3J81 Q;  1GTK A;  1HNX E;  4KHP E;  4FK5 C;  2YU5 A;  4X64 E;  1OYS A;  4DPT A;  2UUC E;  1FWL A;  5C0X C;  2VQE E;  2WBS A;  5KL4 A;  1N33 E;  3Q6M A;  3J7A M;  4ZYG A;  2DB2 A;  1H7U A;  4JI8 I;  1G2F C;  4X8W A;  3GLL A;  5A6B A;  1XNR E;  1TF6 A;  1UDN A;  1BBO A;  1NHJ A;  4P52 A;  5C0X B;  4DUZ I;  1IBK I;  2L3J A;  3H1C A;  4EMD A;  4MDT A;  2R1F A;  2EOJ A;  2AJ4 A;  3PS1 A;  3ZZT A;  2VQF E;  2H36 X;  4JI7 E;  2NN6 D;  2J65 A;  4LOM A;  1Z5A A;  2N8X A;  4RH8 A;  2EPR A;  4JYA I;  4DR4 E;  2EMH A;  5DRO A;  3VYY A;  4B3S E;  3KZY A;  2EE8 A;  2EOR A;  3B8H A;  5EL9 A;  1Z0B A;  3ZZU A;  4HEI A;  2I13 A;  2LCE A;  2V34 A;  1WRJ A;  2WP8 B;  3CWV A;  5A69 A;  2NN6 C;  4B3R I;  1H7S A;  4DV6 E;  3LNU A;  4WUC A;  3K1J A;  1PDA A;  1Z0G A;  4MU3 A;  1PKP A;  2JR1 A;  2PNZ B;  1A1K A;  1N32 I;  4KQV A;  4X65 E;  4IFD A;  3WU5 A;  2LVH A;  4M9V C;  4JV5 I;  2CPN A;  1VI7 A;  2WCC 3;  2EM6 A;  1VIS A;  4OKG A;  2EOO A;  1HNW I;  3HUL A;  4DR7 E;  1KJK A;  4BS9 A;  1Y6Z A;  5A6A A;  3ADI A;  4DV7 E;  4K0K E;  3P06 A;  4LF6 E;  2BM1 A;  1X48 A;  3EQ1 A;  3QT5 A;  5DRR A;  3H09 A;  4BBY A;  4LF8 I;  5JEA E;  4LF4 E;  1TF3 A;  3PRY A;  2EM8 A;  1RC7 A;  4WUB A;  3EPK A;  1GZ6 A;  2FGG A;  2Z5C A;  5C0X F;  2VE7 C;  4MYT A;  4IZJ B;  3EPJ A;  2LO3 A;  3ADG A;  2EWL A;  5AAS A;  1A1I A;  4DV0 I;  1XMO I;  4DV5 I;  3HTX A;  2YZT A;  5AE3 A;  1EKZ A;  4HXZ A;  4NBQ A;  3HXL A;  2ZIT A;  2EMC A;  1PJS A;  3U1K A;  5A2Q C;  2O1V A;  4LCF A;  2V2Z A;  2EPN A;  4DPW A;  3ZKB A;  1IBM E;  4ZYE A;  3CDJ A;  4BA2 B;  3JU0 A;  1FJG E;  2A2D A;  4R2Q A;  2A2C A;  4OX9 E;  3B4T A;  5EKW A;  3T1H I;  3GME A;  2EOQ A;  4JI4 I;  1N36 E;  2EOS A;  2NN6 F;  2PO2 A;  5A2Q Q;  4DU8 A;  1WHN A;  3ZKD A;  2NA2 A;  5K36 B;  2YRM A;  3U1Y A;  2UXC I;  3ZOQ B;  1X6E A;  3JAM C;  1XNQ E;  3EPL A;  4X62 I;  2C39 A;  1ZAA C;  2LJU A;  2UXD I;  4JI1 I;  4U3D A;  4LFA E;  4RPF A;  4DXL A;  4Z7Y A;  1X3C A;  4O4K A;  2MKN A;  2YTO A;  2EZ6 A;  2E1R A;  1BB8 A;  2Q2E B;  3L7Z A;  2EOE A;  3MHH C;  1WJP A;  4MLV A;  1RQ0 A;  4KZS A;  1N0V C;  2NAB A;  4TUG A;  1ELO A;  2EPL X;  2JY9 A;  4DKK A;  2UUA E;  1KIJ A;  1UDQ A;  4ZVI A;  5GME A;  2LE2 A;  1E3H A;  2YTD A;  2EOH A;  2JXP A;  3BID A;  2M1S A;  2ODR D;  1DQ3 A;  2YTN A;  2EPM X;  5LL6 R;  4F2J C;  1P47 A;  1AAY A;  1ZM3 A;  2BR2 A;  5LMU I;  2HHH I;  4JI2 I;  4DR6 E;  5LMN E;  3J7A G;  4Q28 A;  1EH6 A;  1EH8 A;  5DNL A;  2FTX B;  1BBG A;  4P78 A;  4BCA A;  2ODR C;  4WPY A;  2VF3 A;  4P7A A;  2EM4 A;  2CVE A;  2MDG A;  1B62 A;  1FWK A;  4NXM E;  4BMJ A;  4B3M E;  4N3O A;  4R2C A;  2EPO A;  4DV3 I;  4IFD E;  2N3H A;  2UXB E;  5K36 F;  2Q8U A;  1J26 A;  2R76 A;  1OYR A;  3PS3 A;  4WUD A;  3HPZ A;  3F0N A;  4B3T E;  3CDI A;  2WZO A;  2JE6 A;  2LTS A;  2BB8 A;  2EOI A;  1Z0E A;  1JK1 A;  1PIE A;  2MC5 A;  4DR1 E;  2O3Z A;  2JEA A;  2EPK X;  2L8T A;  1XMQ I;  4OO1 D;  1Z59 A;  1QNT A;  3J81 C;  3HJC A;  4DV4 I;  1G2D C;  1D6T A;  2L3C A;  2K4V A;  3PS2 A;  2D9H A;  1T4O A;  1UIL A;  3M85 D;  4DR3 I;  4QNK A;  1H73 A;  5JEA D;  5C0X A;  1Z5B A;  3Q6N A;  1T38 A;  4HAC B;  4OO1 C;  2V8Q B;  1Z0V A;  4FW4 A;  4MQY A;  1UBD C;  4WX9 A;  3OTO I;  2EMA A;  4XTJ A;  5IT9 C;  4LF5 E;  1NHH A;  4JI3 I;  3ZZ0 A;  2DMI A;  4N4R B;  1HNX I;  5DRP A;  1I94 E;  2V8P A;  1F2I G;  4OO1 B;  4KHP I;  4X64 I;  1U2R A;  2V87 A;  5BR8 E;  4OZE A;  4LFB E;  1X6H A;  3DD6 A;  4FW6 A;  2PO0 B;  1E3P A;  5GMD A;  1KVK A;  1WHQ A;  2JT2 A;  2E72 A;  5JEA B;  5IT9 Q;  5AC4 A;  1IBL I;  4GEQ B;  4NXN I;  2EM2 A;  1WXR A;  1S16 A;  2NN6 A;  2XEX A;  2PNZ A;  1IQS A;  5KL5 A;  4LF9 E;  1YHC A;  2ELY A;  3WU3 A;  4GKJ I;  2V88 A;  4LU9 A;  4M30 A;  4RHB B;  5ADZ A;  4LF7 E;  2MC6 A;  1YYW A;  2IHR 1;  2LJP A;  4LCH A;  4DR4 I;  4B3S I;  2C37 A;  2L2K B;  4LTY A;  4J8Z A;  4DV1 E;  4DV2 E;  3LLH A;  4URL A;  2K7I A;  2EPP A;  2F1D A;  5A6B D;  4DUZ E;  4LPF A;  2M9A A;  4L5N C;  2JEB A;  4LFC I;  2EPZ A;  3ZM7 A;  4WYQ B;  4IZJ D;  3QT7 A;  2JVA A;  4R2R A;  2IES A;  4PRX A;  2EMG A;  2RTX A;  1IMU A;  1Y4U A;  2RSM A;  1ZM4 A;  4JYA E;  2L2N A;  2CZ9 A;  3KRN A;  4X65 I;  3LML A;  2EN7 A;  3VYX A;  1H72 C;  4Z7C A;  2JP9 A;  4OO1 F;  2YRK A;  4M0V A;  1YYK A;  2B7V A;  4UT4 A;  4YHH I;  4DR7 I;  4UTG A;  4DU7 A;  1X49 A;  2FV4 B;  4WSP A;  2F4V I;  2RPC A;  4DV7 I;  4K0K I;  4LF6 I;  2LTR A;  4LCG A;  2EMF A;  4JI6 E;  4DPX A;  2KON A;  3D4J A;  3GCM A;  5JEA F;  4OOG C;  2KHX A;  3QG5 C;  2LUP B;  2JOX A;  1MG7 A;  4P7D A;  2YWQ A;  1XXE A;  3T1Y E;  2GQ0 A;  3F6H A;  1N32 E;  2EL6 A;  2EOM A;  1RRE A;  2C38 A;  4F6M A;  5K36 D;  2ELZ A;  2DSY A;  2EN6 A;  2WBT A;  1YUJ A;  4JI0 E;  4I8O A;  3F6G A;  1YH8 A;  1J5E E;  1RR9 A;  1T39 A;  2LMZ A;  4IZK A;  4L8N A;  4BHB A;  2EL4 A;  4YY3 E;  5KL2 A;  1HR0 E;  2Z5B A;  1DGC A;  4FWH A;  3ADL A;  1YPN A;  1RHY A;  5K36 C;  2GHF A;  1SR9 A;  1IBM I;  2L33 A;  2UUB E;  2LJH A;  5FLX Q;  5C0X E;  1IQO A;  2EM7 A;  3IWB A;  4ZYH A;  2EM5 A;  2HJJ A;  2M7Q A;  2HGH A;  5A6J A;  4OX9 I;  4DV0 E;  1XMO E;  1N36 I;  2IOQ A;  4DV5 E;  2E1M A;  2EPC A;  2B7T A;  2R42 A;  1Y4S A;  1NCS A;  2ZBK B;  3B78 A;  4JI5 I;  2DMY A;  2GO4 A;  2PNM A;  2YTQ A;  3HQ1 A;  4GKK E;  4J3D A;  1X5W A;  2WNR A;  4BA1 A;  4TUI A;  2EJ4 A;  4LFA I;  1ZM9 A;  1JK2 A;  1A1F A;  2MKD A;  2DEJ A;  4O43 A;  2Z5C B;  2EOF A;  1FKA E;  2JOB A;  4Q35 B;  2NN6 E;  2R3V A;  4PRV A;  1X47 A;  1UN6 B;  1H74 A;  4M1K A;  5A6K A;  2UXC E;  2UUA I;  4DR2 E;  4X66 I;  4X62 E;  2O1T A;  1B69 A;  3THO B;  2X36 A;  2DEI A;  2YTE A;  3WU6 A;  2VRD A;  4DMI A;  1Z0T A;  4USM A;  5IWA E;  2EMX A;  4AQY I;  3MSW A;  1T4L B;  2EN8 A;  5IV8 B;  4HYM A;  2EQ0 A;  1R6M A;  2CGE A;  2EFG A;  1N3G A;  2ADR A;  2N3G A;  1UDS A;  4F9B B;  4DR5 I;  2PO2 B;  4ZYD A;  2JPA A;  1L4S A;  2PO1 A;  4NXM I;  4B3M I;  3AV0 A;  4ED4 A;  2RS7 A;  1K47 A;  2UXB I;  1NZ0 A;  2C39 B;  2LUQ A;  5LMU E;  2HHH E;  2PRT A;  1OJ4 A;  3EPH A;  2YTJ A;  4R8O A;  2GLI A;  3P3G A;  1TN9 A;  2PNL A;  4DUY E;  3ADJ A;  1N34 I;  2BBG A;  1Y60 A;  2IER A;  3C4B A;  2O1U A;  3BBG A;  5KL3 A;  4DR1 I;  2ENC A;  3H4L A;  4OO1 A;  3JTZ A;  2MDR A;  2HK3 A;  2L92 A;  4DV3 E;  3AUZ A;  2HC5 A;  1DI2 A;  2X7I A;  1ZU1 A;  2YTG A;  4F9A B;  4O5G A;  4IS1 C;  1A1H A;  2KOU A;  1R6L A;  2BR2 B;  2EOZ A;  1HNZ E;  2CTD A;  3THN A;  2ZM6 E;  3J80 C;  3KWR A;  1FI4 A;  1ZXN A;  3P76 A;  3PYE A;  4MU0 A;  4PU9 A;  2LRS A;  4USK A;  5ELW A;  1NHI A;  2EOY A;  2UU9 I;  2L2M A;  2E5L E;  2EM3 A;  2BV3 A;  4O24 A;  2VES A;  2V2V A;  2EMI A;  5JEA C;  2JYA A;  2EPX A;  4IJD A;  3MHS C;  5AE2 A;  1X6F A;  3M99 B;  2UUC I;  3PYG A;  2VQE I;  3FIG A;  3TQM A;  4DV4 E;  2WP8 A;  2EM9 A;  3J80 Q;  1N33 I;  1O0W A;  2GO3 A;  4NZV A;  5BR8 I;  1XNR I;  2RSI A;  5CFF E;  4DR3 E;  2BM0 A;  4JG4 A;  2V85 A;  1USV A;  1EH7 A;  3RMP A;  3HKM A;  2YT4 A;  2EQ1 A;  1UHZ A;  1YFH A;  3P3C A;  2JE6 B;  2VQF I;  2V89 A;  4HY1 A;  4F9C B;  4JI7 I;  1SFE A;  1FNM A;  1ZM2 A;  1A6F A;  2A25 A;  2V83 A;  3DF6 A;  5KL7 A;  2EPU A;  1DAR A;  3P3E A;  2JEA B;  4MU4 A;  4U3B A;  4GZN C;  4LF7 I;  2DRP A;  4F54 A;  5IXM B;  4R2S A;  1IBK E;  4DV1 I;  1MEY C;  4DV2 I;  2LBS B;  1Y5Y A;  2IOP A;  5DRQ A;  4FW7 A;  4DV6 I;  2EN3 A;  2RQL A;  5AC5 A;  4WXD A;  1QZR A;  3Q1Q A;  1ZBQ A;  2VF1 A;  1IBL E;  4NXN E;  1ZBT A;  3VK6 A;  4R2A A;  2EOX A;  4IZJ A;  4I3H A;  2EMY A;  1MX0 A;  2HFU A;  4GKJ E;  2YPN A;  2HKJ A;  2CSH A;  2EPA A;  1HK7 A;  2GS8 A;  4KWY A;  2EL5 A;  4B3R E;  2EP3 A;  1EI1 A;  2O1W A;  5DNX A;  2EN4 A;  2DLK A;  2HK2 A;  4AID A;  4LF4 I;  1UEK A;  1XHK A;  4BA2 A;  4JI6 I;  2B9D A;  4LFC E;  1EA6 A;  3PYD A;  3V2U C;  4R2D A;  1WUU A;  5DNY A;  2NN6 B;  1PJQ A;  3T1Y I;  5FLX C;  4JV5 E;  1Z1B A;  1UDO A;  3BF2 A;  5K36 A;  1HNW E;  4NHR A;  4IFD D;  2OI2 A;  4JI0 I;  5LLQ A;  3UHM A;  2M4I A;  4OO1 E;  3IWD A;  2AE8 A;  3IWC A;  1P42 A;  4LF8 E;  2GPI A;  2C37 B;  4FW5 A;  4YHH E;  1J5E I;  2EM0 A;  2F4V E;  2EN2 A;  3C6M A;  4YY3 I;  1HR0 I;  1T4N A;  2V2Q A;  4GQU A;  4IFD C;  2J7J A;  4MLQ A;  4R2P A;  1FJG I;  1ZXM A;  2JEB B;  4FW3 A;  2UUB I;  3M7N G;  1NEI A;  1QU6 A;  2EMZ A;  5F3W A;  1KYQ A;  4MYU A;  3WU4 A;  4BHC A;  4IFD B;  3QT8 A;  2EMB A;  4FW9 A;  3K17 A;  4AIM A;  1XNQ I;  3P1X A;  2EML A;  2DLQ A;  4GKK I;  1AH5 A;  1KKH A;  4IS9 A;  2EMW A;  2YRH A;  3HPS A;  3T1H E;  4JI4 E;  1MU5 A;  2NUF A;  2ENH A;  1S4E A;  3UK3 C;  1OYP A;  4AM3 A;  3M7N D;  2NUG A;  2YTF A;  2C38 B;  2YTI A;  3C4T A;  2I9I A;  2NPF A;  4QNJ A;  2UXD E;  1GQE A;  5AE1 A;  4JI5 E;  4IZK B;  2HKE A;  2B3T B;  4JI1 E;  2J7K A;  4FWG A;  4DR2 I;  4WXC A;  1LLM C;  2YU8 A;  1BKN A;  5LMN I;  2Z5B B;  2YTP A;  4DR6 I;  3LPS A;  1MGT A;  2ENA A;  4DPY A;  1USU A;  4R2E A;  1ZR9 A;  3VHT B;  1B63 A;  5IWA I;  4R03 A;  2YSO A;  2BA1 G;  1YUI A;  3M6A A;  3PYF A;  2BA0 G;  3LTO A;  3JAM Q;  4F6N A;  4FN5 A;  4ISA A;  1Z0W A;  4JI8 E;  4X66 E;  4IFD F;  4JI2 E;  5L3J A;  2V86 A;  1YSA C;  2JWO A;  4BC9 A;  2LT7 A;  1N0U A;  2Z5E A;  3OML A;  3C6K A;  1PJT A;  2WNR B;  4HAC A;  4BA1 B;  2YSP A;  4B3T I;  4AQY E;  3L7Z B;  1A1L A;  1KTV A;  4X9J A;  4DUY I;  1A1G A;  4BC7 A;  1YZ9 A;  2NUE A;  3NZK A;  3V5R A;  2RS6 A;  5FWK A;  2CG9 A;  2WBU A;  4DR5 E;  3ECR A;  3QT6 A;  1Z0C A;  2BA1 D;  5K36 E;  2BA0 D;  3J7Y p;  3M85 G;  4MU1 A;  4WFT A;  2HFS A;  2PO0 A;  2L6M A;  2LV2 A;  5JEA A;  2CT1 A;  1YYO A;  4DPU A;  5TSE A;  5KL6 A;  1HNZ I;  2ZM6 I;  5T6J A;  3BGH A;  1N34 E;  3GON A;  2EMK A;  2EQ3 A;  4LF5 I;  2E5L I;  2EN1 A;  1XMQ E;  1I94 I;  4FWD A;  2PO1 B;  2G7H A;  4WSG A;  2DGC A;  4LFB I;  1PVG A;  2DIX A;  4M2Z A;  3L00 A;  3KZZ A;  2WW4 A;  3K6Q A;  1RMD A;  1A1J A;  5C0X D; 
#chains in the Genus database with same CATH homology
 2F8B A;  1STU A;  3OTO E;  3B82 A;  4R1F A;  3DJW A;  2UU9 E;  4JI3 E;  1Z5C A;  3K85 A;  4LF9 I;  3J81 Q;  1HNX E;  4KHP E;  4DPT A;  4X64 E;  2UUC E;  1FWL A;  2VQE E;  1N33 E;  3Q6M A;  3J7A M;  1H7U A;  2DB2 A;  4X8W A;  1XNR E;  1NHJ A;  4P52 A;  4DUZ I;  1IBK I;  2L3J A;  4EMD A;  2AJ4 A;  3ZZT A;  2VQF E;  2H36 X;  4JI7 E;  1Z5A A;  4JYA I;  4DR4 E;  3VYY A;  4B3S E;  3B8H A;  1Z0B A;  3ZZU A;  2V34 A;  3CWV A;  4B3R I;  1H7S A;  4DV6 E;  3LNU A;  4WUC A;  3K1J A;  1Z0G A;  1PKP A;  2JR1 A;  1N32 I;  4KQV A;  4X65 E;  4JV5 I;  3WU5 A;  2CPN A;  1VIS A;  1HNW I;  3HUL A;  4DR7 E;  4BS9 A;  1Y6Z A;  3ADI A;  4K0K E;  4DV7 E;  3P06 A;  4LF6 E;  2BM1 A;  1X48 A;  3QT5 A;  4LF8 I;  3H09 A;  4BBY A;  4LF4 E;  3PRY A;  1RC7 A;  4WUB A;  1GZ6 A;  2FGG A;  2Z5C A;  2VE7 C;  4MYT A;  4IZJ B;  3ADG A;  2EWL A;  5AAS A;  4DV0 I;  1XMO I;  4DV5 I;  3HTX A;  2YZT A;  5AE3 A;  1EKZ A;  4HXZ A;  3HXL A;  2ZIT A;  5A2Q C;  2O1V A;  2V2Z A;  4DPW A;  3ZKB A;  1IBM E;  3JU0 A;  1FJG E;  2A2D A;  2A2C A;  4OX9 E;  3T1H I;  4JI4 I;  1N36 E;  5A2Q Q;  4DU8 A;  1WHN A;  3ZKD A;  2NA2 A;  2UXC I;  3ZOQ B;  3JAM C;  1XNQ E;  4X62 I;  2UXD I;  4JI1 I;  4LFA E;  4RPF A;  4DXL A;  4Z7Y A;  2EZ6 A;  2E1R A;  2Q2E B;  1RQ0 A;  4KZS A;  1N0V C;  1ELO A;  4TUG A;  2JY9 A;  4DKK A;  2UUA E;  1KIJ A;  4ZVI A;  5GME A;  2LE2 A;  1S16 A;  2M1S A;  2ODR D;  1ZM3 A;  1DQ3 A;  4JI8 I;  5LL6 R;  4JI2 I;  5LMU I;  2HHH I;  4DR6 E;  5LMN E;  3J7A G;  4Q28 A;  2FTX B;  4P78 A;  4BCA A;  2ODR C;  4WPY A;  2VF3 A;  4P7A A;  1B62 A;  1FWK A;  4NXM E;  4BMJ A;  4B3M E;  4N3O A;  4DV3 I;  2N3H A;  2UXB E;  1J26 A;  4WUD A;  3HPZ A;  3F0N A;  4B3T E;  2WZO A;  2LTS A;  1Z0E A;  1PIE A;  2MC5 A;  4DR1 E;  2L8T A;  1XMQ I;  1Z59 A;  3J81 C;  3HJC A;  4DV4 I;  1D6T A;  2L3C A;  2K4V A;  1T4O A;  1UIL A;  4DR3 I;  1H73 A;  1Z5B A;  3Q6N A;  4HAC B;  2V8Q B;  1Z0V A;  3OTO I;  4XTJ A;  5IT9 C;  4LF5 E;  1NHH A;  4JI3 I;  3ZZ0 A;  1HNX I;  1I94 E;  2V8P A;  4KHP I;  4X64 I;  1U2R A;  2V87 A;  5BR8 E;  4LFB E;  5GMD A;  1KVK A;  1WHQ A;  5IT9 Q;  1IBL I;  4GEQ B;  4NXN I;  1WXR A;  2XEX A;  4LF9 E;  3WU3 A;  4GKJ I;  2V88 A;  4LU9 A;  4M30 A;  5ADZ A;  4LF7 E;  2MC6 A;  1YYW A;  2IHR 1;  2LJP A;  4DR4 I;  4B3S I;  2L2K B;  4LTY A;  4J8Z A;  4DV1 E;  4DV2 E;  3LLH A;  4URL A;  4DUZ E;  4L5N C;  4LFC I;  3ZM7 A;  4WYQ B;  4IZJ D;  3QT7 A;  2JVA A;  4PRX A;  2RTX A;  1Y4U A;  2RSM A;  1ZM4 A;  4JYA E;  2L2N A;  2CZ9 A;  4X65 I;  3LML A;  3VYX A;  1H72 C;  4Z7C A;  4M0V A;  1YYK A;  2B7V A;  4UT4 A;  4YHH I;  4DR7 I;  4UTG A;  4DU7 A;  1X49 A;  2FV4 B;  4WSP A;  2F4V I;  4DV7 I;  4K0K I;  4LF6 I;  2LTR A;  4JI6 E;  4DPX A;  2KON A;  3D4J A;  4OOG C;  2KHX A;  1MG7 A;  2LUP B;  2JOX A;  4P7D A;  3T1Y E;  2GQ0 A;  3F6H A;  1N32 E;  1RRE A;  4JI0 E;  2DSY A;  4I8O A;  3F6G A;  1J5E E;  1RR9 A;  2LMZ A;  4IZK A;  4L8N A;  4YY3 E;  1HR0 E;  2Z5B A;  4FWH A;  3ADL A;  1SR9 A;  1IBM I;  2L33 A;  2UUB E;  2LJH A;  5FLX Q;  3IWB A;  2M7Q A;  4OX9 I;  1XMO E;  4DV0 E;  1N36 I;  2IOQ A;  4DV5 E;  2E1M A;  2B7T A;  2R42 A;  1Y4S A;  2ZBK B;  3B78 A;  4JI5 I;  2DMY A;  2PNM A;  3HQ1 A;  4GKK E;  4TUI A;  4LFA I;  1ZM9 A;  2DEJ A;  2Z5C B;  1FKA E;  2JOB A;  2R3V A;  4PRV A;  1X47 A;  1H74 A;  4M1K A;  2UXC E;  2UUA I;  4DR2 E;  4X66 I;  4X62 E;  2O1T A;  2X36 A;  2DEI A;  3WU6 A;  4DMI A;  1Z0T A;  4USM A;  5IWA E;  4AQY I;  3MSW A;  1T4L B;  4HYM A;  2CGE A;  2EFG A;  2N3G A;  4F9B B;  4DR5 I;  4NXM I;  4B3M I;  3AV0 A;  4ED4 A;  2RS7 A;  1K47 A;  2UXB I;  1NZ0 A;  2LUQ A;  5LMU E;  2HHH E;  1OJ4 A;  4R8O A;  2PNL A;  4DUY E;  3ADJ A;  1N34 I;  3C4B A;  2O1U A;  4DR1 I;  3H4L A;  3JTZ A;  2MDR A;  2HK3 A;  2L92 A;  4DV3 E;  1DI2 A;  3AUZ A;  2X7I A;  4F9A B;  2KOU A;  1HNZ E;  4PU9 A;  2ZM6 E;  3J80 C;  3KWR A;  1FI4 A;  1ZXN A;  3PYE A;  4USK A;  2LRS A;  1NHI A;  2UU9 I;  2L2M A;  2E5L E;  2BV3 A;  2V2V A;  5AE2 A;  2UUC I;  3PYG A;  2VQE I;  3FIG A;  1N33 I;  4DV4 E;  3J80 Q;  1O0W A;  5BR8 I;  1XNR I;  5CFF E;  4DR3 E;  2BM0 A;  4JG4 A;  2V85 A;  1USV A;  3RMP A;  2YT4 A;  1UHZ A;  2VQF I;  2V89 A;  4HY1 A;  4F9C B;  4JI7 I;  1FNM A;  1ZM2 A;  1A6F A;  2V83 A;  3DF6 A;  1DAR A;  4LF7 I;  4F54 A;  1IBK E;  4DV1 I;  4DV6 I;  4DV2 I;  2LBS B;  2IOP A;  3Q1Q A;  1QZR A;  1ZBQ A;  2VF1 A;  1IBL E;  4NXN E;  1ZBT A;  3VK6 A;  4IZJ A;  4I3H A;  1MX0 A;  2HFU A;  4GKJ E;  2HKJ A;  1HK7 A;  2GS8 A;  4B3R E;  1EI1 A;  2O1W A;  2HK2 A;  4LF4 I;  1UEK A;  1XHK A;  4JI6 I;  2B9D A;  4LFC E;  1EA6 A;  3PYD A;  3V2U C;  1WUU A;  5DNY A;  3T1Y I;  5FLX C;  4JV5 E;  1HNW E;  2OI2 A;  4JI0 I;  2M4I A;  3IWD A;  1J5E I;  3IWC A;  4LF8 E;  4YHH E;  2F4V E;  4YY3 I;  1HR0 I;  1T4N A;  2V2Q A;  1FJG I;  1ZXM A;  2UUB I;  1QU6 A;  5F3W A;  4MYU A;  3WU4 A;  3QT8 A;  4FW9 A;  3K17 A;  1XNQ I;  3P1X A;  4GKK I;  1KKH A;  3HPS A;  3T1H E;  4JI4 E;  1MU5 A;  2NUF A;  1S4E A;  2NUG A;  3C4T A;  2NPF A;  2UXD E;  1GQE A;  5AE1 A;  4JI5 E;  4IZK B;  2HKE A;  2B3T B;  4JI1 E;  2J7K A;  4FWG A;  4DR2 I;  1BKN A;  5LMN I;  2Z5B B;  4DR6 I;  3LPS A;  4DPY A;  1USU A;  1B63 A;  5IWA I;  4R03 A;  3M6A A;  3PYF A;  3LTO A;  3JAM Q;  4FN5 A;  1Z0W A;  4JI8 E;  4X66 E;  4JI2 E;  5L3J A;  2V86 A;  2JWO A;  4BC9 A;  1N0U A;  2Z5E A;  3OML A;  4HAC A;  4B3T I;  4AQY E;  1KTV A;  4DUY I;  4BC7 A;  1YZ9 A;  2NUE A;  3V5R A;  2RS6 A;  5FWK A;  2CG9 A;  4DR5 E;  3QT6 A;  1Z0C A;  3J7Y p;  4WFT A;  2HFS A;  2L6M A;  1YYO A;  4DPU A;  1HNZ I;  2ZM6 I;  5T6J A;  1N34 E;  3GON A;  4LF5 I;  2E5L I;  1XMQ E;  1I94 I;  4FWD A;  2G7H A;  4LFB I;  1PVG A;  2DIX A;  4M2Z A;  2WW4 A;  3K6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...