4GKJE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4gkjE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkjE02
4LF8I 3D4JA 5GMEA 1T4NA 1QZRA 2UU9E 4I3HA 4DR7I 4DV0I 4HYMA 2DB2A 1HNWI 4LF4E 1T4LB 2EZ6A 3PYDA 1H73A 5GMDA 1PKPA 2LRSA 3T1HE 4JG4A 3GONA 1XMQI 2HFSA 1MG7A 2GS8A 3HULA 1IBKE 2ZBKB 4GKKE 2VQEE 4DV2I 1D6TA 2UXDE 1K47A 2UXBI 4X62E 1HR0I 4LF6I 3V2UC 2UUBI 2VQFE 1N33I 5LMNI 1N32I 2AJ4A 2LTSA 4PRVA 2NA2A 4JV5E 4KHPI 2BM0A 2HKJA 4DR5E 1ZM2A 3WU5A 1Z5BA 4DU8A 3WU6A 4UTGA 4DPXA 2X36A 4WFTA 5BR8I 2F4VI 4JI0E 4X64I 4Z7YA 3LPSA 2NPFA 4JI5I 2DEIA 4DR6E 4B3MI 4M30A 4LF5E 1U2RA 3V5RA 4XTJA 2X7IA 1GQEA 5L3JA 2LTRA 4MYTA 2RSMA 2B7TA 3K17A 3LNUA 1HNXI 4JI4E 4JI1I 1XNQI 4M2ZA 4JI7I 4LF7E 2HKEA 1B63A 2UUCI 1PVGA 1T4OA 5CFFE 4FWHA 4FW9A 2HFUA 3OTOI 4DUZI 2EFGA 4WUBA 4DR3I 3B8HA 3QT8A 1Z0WA 4URLA 4B3ME 1UHZA 3PYGA 2E1RA 5LMUE 4DUYE 2HHHE 3J80C 3J81C 2LBSB 2UUAI 4EMDA 4NXME 3ADGA 2UXCI 4DV7I 1IBME 1N34I 1XNRE 4DR4E 4DV6E 4PRXA 3ADJA 1STUA 4LF9I 4JI3E 3JAMC 4X66E 4KQVA 2UUCE 2A2CA 2B3TB 4NXNI 1N0UA 2BV3A 2IHR1 4DV3I 4JI8E 2E5LE 4MYUA 1H74A 2VF3A 4YHHE 4X8WA 1KTVA 4JI6I 2NUGA 3LLHA 1NZ0A 2LUQA 4LFAI 4K0KI 4DV5I 1X48A 1VISA 3PYEA 1FWLA 4ZVIA 4WYQB 4DR2E 2UUAE 4OX9E 1FKAE 4DV1E 4HXZA 4HY1A 1IBLE 3P1XA 1N36E 4OOGC 4ED4A 5LL6R 4DXLA 4X65E 1FI4A 1H7SA 1NHJA 1I94E 4LFBE 5IT9C 2CPNA 2L2MA 1HNZE 4JI2E 1J26A 4LF8E 4WUCA 4LFAE 1O0WA 4DR1I 1WHNA 1B62A 4DU7A 4DR7E 4DV0E 1HNWE 3J7Yp 3ZZUA 3B78A 1YYWA 1WHQA 3C4TA 1ZM4A 1XMQE 5A2QC 1A6FA 3Q1QA 1UILA 3ZZTA 2DIXA 4R1FA 4DV2E 3J7AG 3F0NA 2ZM6I 2V2QA 1Z0BA 2UXBE 2Q2EB 1HR0E 4LF6E 2UUBE 2RS6A 4DPWA 5IWAI 4B3SI 1N33E 3T1YI 5LMNE 1N32E 4P7AA 1Z5CA 4DPTA 1KKHA 4KHPE 4GKJI 2HK3A 2HK2A 3B82A 1FJGI 3H4LA 4DV4I 2NUEA 2YT4A 1XMOI 5BR8E 4AQYI 2F4VE 5FLXC 2RS7A 4X64E 3ADIA 4JI5E 2LJPA 4YY3I 4LFCI 1X49A 3M6AA 3VYXA 2MDRA 4B3RI 1J5EI 1Z5AA 1YZ9A 2DMYA 3J7AM 3ZZ0A 2N3GA 1RC7A 4Z7CA 2OI2A 4JYAI 4B3TI 3ADLA 1DARA 2B7VA 1YYOA 1HNXE 4JI1E 1XNQE 4JI7E 2UU9I 3PYFA 2N3HA 3OTOE 4DUZE 4HACA 3J80Q 4LF4I 2JY9A 3J81Q 4DR3E 1YYKA 4DPYA 1KVKA 4FWGA 4DKKA 3T1HI 2JVAA 2V8PA 3VYYA 1Z0CA 1IBKI 4GKKI 2VQEI 2J7KA 2UXDI 3JAMQ 1ZM9A 2CZ9A 4X62I 1EKZA 2UXCE 4DV7E 1N34E 1MX0A 1N0VC 2VQFI 4FWDA 1Z0GA 4LF9E 4JV5I 1EA6A 3ZKBA 1X47A 4UT4A 4DR5I 3CWVA 4NXNE 4DV3E 4USKA 4JI0I 4JI6E 4K0KE 4DV5E 1ZXNA 4WUDA 4DR6I 1KIJA 1RREA 4RPFA 1S16A 4LF5I 3ZM7A 2XEXA 2LJHA 1NHIA 2LUPB 1PIEA 5IT9Q 2L3JA 4JI4I 4USMA 3LTOA 4LF7I 2V34A 1S4EA 3ZKDA 2A2DA 4DPUA 2L2KB 1Z0EA 4DR1E 5A2QQ 1ELOA 1OJ4A 1H72C 3K1JA 3WU3A 1ZXMA 1H7UA 2RTXA 5LMUI 4DUYI 1ZM3A 2HHHI 4HACB 1RQ0A 4NXMI 1EI1A 1IBMI 1XNRI 4DR4I 4DV6I 1WUUA 2DEJA 3HTXA 4M1KA 2WW4A 2ZM6E 2ZITA 4JI3I 4X66I 1UEKA 1FNMA 3QT6A 4B3SE 5IWAE 3T1YE 5FLXQ 4JI8I 2V2ZA 1FWKA 2E5LI 3WU4A 4YHHI 4GKJE 1Z59A 2KHXA 1FJGE 3QT5A 4DV4E 2L2NA 1XMOE 4AQYE 4DR2I 2L3CA 2V2VA 1DI2A 4YY3E 3QT7A 4LFCE 4P52A 4OX9I 4PU9A 4DV1I 2R42A 1BKNA 4B3RE 1J5EE 4FN5A 1ZBTA 1IBLI 1XHKA 1Z0VA 2BM1A 1MU5A 1N36I 1RR9A 4JYAE 1NHHA 3C4BA 4B3TE 4X65I 2L33A 1I94I 4LFBI 1Z0TA 1QU6A 1HNZI 2R3VA 2NUFA 4JI2I
chains in the Genus database with same CATH superfamily
4P7DA 4LF8I 4R2AA 1MEYC 4ZYGA 3D4JA 4O5GA 1A1FA 5GMEA 1T4NA 2EM6A 1QZRA 2UU9E 4I3HA 4OO1D 3B4TA 2NN6D 2WBUA 2NN6C 4F9AB 4DR7I 4DV0I 2PO1B 1ZAAC 4HYMA 2DB2A 1HNWI 4LF4E 1T4LB 4AIDA 2EZ6A 1X5WA 2CSHA 1H73A 3PYDA 5EKWA 5GMDA 2IOPA 3MSWA 3UK3C 5TSEA 5A69A 3HXLA 4LCHA 1PKPA 2EPRA 2LRSA 3T1HE 4JG4A 3GONA 1YUIA 2PO0B 2HFSA 2EN4A 1XMQI 2GO4A 1MG7A 2GS8A 4F54A 1IBKE 3HULA 4IFDB 2PRTA 1SR9A 2ZBKB 4GKKE 3M85D 2VQEE 4DV2I 5ADZA 1D6TA 2UXDE 2C37B 2YTNA 4KZSA 4FW7A 1K47A 2BB8A 2EN6A 2ELYA 2EMYA 2HGHA 4IFDC 2NABA 2BR2B 2UXBI 4X62E 4F2JC 1HR0I 2JOBA 1YFHA 4LF6I 3V2UC 2UUBI 2O1UA 4OO1A 2NN6A 1A1IA 2VQFE 1N33I 2YTIA 5JEAD 5LMNI 1N32I 2AJ4A 5JEAC 3DF6A 2LTSA 2E72A 4PRVA 1NEIA 2CGEA 2I13A 1VI7A 2NA2A 4JV5E 4KHPI 2BM0A 3IWDA 2HKJA 2BA1G 4DR5E 1ZM2A 3WU5A 2LVHA 1Z5BA 2HJJA 4DU8A 3WU6A 5T6JA 1B69A 2R1FA 2VE7C 4UTGA 4DPXA 2X36A 4WFTA 2O3ZA 5BR8I 2F4VI 2YRHA 5EL9A 5K36F 4JI0E 4X64I 4Z7YA 1X6FA 3LPSA 2NPFA 3IWBA 4JI5I 3HPSA 3M7NG 2LMZA 2YRKA 1DGCA 4DR6E 2DEIA 4M30A 4B3MI 3MHSC 5KL5A 3CDIA 1ZBQA 2EMCA 3ZOQB 1F2IG 4LF5E 5JEAA 4Q28A 1U2RA 1YSAC 3V5RA 1L4SA 2EMFA 1A1JA 3GLLA 4XTJA 5K36E 4BHBA 2DGCA 1ZU1A 5LLQA 2X7IA 2EP3A 4R2DA 5AASA 2JYAA 1P47A 3L00A 3L7ZB 1GQEA 5L3JA 2WNRA 4F9BB 2LTRA 4MYTA 2EWLA 2EOYA 2RSMA 2B7TA 3K17A 3LNUA 1HNXI 4JI4E 4JI1I 4WSPA 2WP8B 1XNQI 3H09A 4M2ZA 4JI7I 1A1GA 4LF7E 1E3HA 2YTDA 2HKEA 2MC6A 1B63A 2UUCI 1PVGA 1T4OA 5CFFE 4FWHA 4FW9A 2HFUA 2R76A 3OTOI 4DUZI 4O4KA 3VK6A 2EFGA 4LPFA 1BBOA 2GPIA 4ZYHA 4IZKB 4WUBA 5C0XF 1MGTA 4O43A 5A6BA 4DR3I 2Z5EA 2EE8A 4OZEA 3B8HA 3QT8A 2PNZA 1Z0WA 4URLA 4B3ME 2EPXA 2IERA 4BA1A 1USUA 2EPMX 2EMWA 2EM3A 1UHZA 3PYGA 3H1CA 3EPLA 4R2PA 2KONA 2E1RA 2EN2A 2EPUA 5LMUE 3U1YA 4DUYE 2EMXA 2PNMA 5C0XE 3J80C 2HHHE 3J81C 3L7ZA 2LBSB 2UUAI 4EMDA 4NXME 1G2DC 2A25A 4DMIA 3ADGA 2UXCI 4DV7I 3HPZA 1IBME 4IJDA 4R03A 1N34I 3KZZA 1XNRE 2ENAA 1G2FC 4DV6E 4DR4E 4L5NC 2GO3A 2EOHA 5KL3A 5K36B 2L6MA 4PRXA 3ADJA 3Q6NA 1STUA 4LF9I 2EPCA 3JAMC 4JI3E 4X66E 4KQVA 2UUCE 2A2CA 4WX9A 2B3TB 4IZKA 2JEAA 5K36D 4IZJD 1N0UA 2BV3A 2IHR1 2I9IA 4L8NA 1TN9A 4MDTA 4NXNI 4DV3I 5K36C 4JI8E 3K6QA 2D9HA 2E1MA 2E5LE 4MYUA 1H74A 1A1LA 2VF3A 4YHHE 4X8WA 3OMLA 4OO1B 1KTVA 4JI6I 2Q8UA 4R2CA 2NUGA 3LLHA 1NZ0A 3PS2A 2LUQA 4LFAI 4K0KI 2EMAA 2EPLX 1Y4SA 4DV5I 1X48A 1LLMC 1VISA 3PYEA 1FWLA 4OO1C 4WPYA 4Q35B 2YPNA 2EPAA 2V89A 4ZVIA 2HC5A 3ECRA 3P3GA 4WYQB 4MQYA 4DR2E 1R6LA 3P3EA 5DNYA 2UUAE 1KYQA 2VRDA 2EQ1A 3JTZA 4OX9E 1FKAE 4DV1E 2B9DA 1UN6B 4NBQA 4X9JA 1A1KA 2O1WA 4WSGA 4HXZA 1JK2A 5K36A 2JE6A 4IZJA 4HY1A 1WJPA 1X6EA 5AC5A 2JPAA 2O1VA 1T38A 4R2EA 1IBLE 5KL2A 5FWKA 3P1XA 1N36E 5C0XD 4KWYA 4OOGC 2J65A 5JEAB 4ED4A 5LL6R 4DXLA 4BA2A 1PJQA 4X65E 1FI4A 3RMPA 1H7SA 1NHJA 2V86A 4R2SA 1I94E 2VF1A 4LFBE 5IT9C 2CPNA 2L2MA 1HNZE 3PS3A 4JI2E 1J26A 4LF8E 3P76A 4LCGA 4WUCA 4LFAE 1NCSA 1O0WA 2V85A 2WNRB 4DR1I 1WHNA 2K4VA 1B62A 2LT7A 1E3PA 2YU8A 4DR7E 4DV0E 4DU7A 2EMLA 2M7QA 1HNWE 3UHMA 3J7Yp 3ZZUA 3B78A 4R2QA 5F3WA 5KL7A 2YWQA 1YYWA 5AE3A 2EOXA 1WHQA 2EN3A 2RQLA 3P06A 2EMIA 4P78A 2JXPA 3C4TA 1IMUA 2FV4B 3BBGA 2M1SA 5C0XA 1ZM4A 3EQ1A 1XMQE 1USVA 4BS9A 5A2QC 2G7HA 2RPCA 2MKNA 1A6FA 2PNZB 1UILA 3ZZTA 3Q1QA 2DIXA 3M99B 4ZYDA 4R1FA 4DV2E 4GQUA 5A6BD 3J7AG 4BA1B 2DMIA 3BGHA 3TQMA 3F0NA 2F1DA 2ZM6I 2V2QA 1BBGA 1Z0BA 2EJ4A 2YZTA 2UXBE 2Q2EB 2YU5A 1HR0E 3KRNA 5AC4A 2LCEA 2EM5A 4LF6E 2UUBE 2RS6A 1XXEA 4DPWA 5IWAI 4B3SI 2EL5A 2C39A 1N33E 3T1YI 5LMNE 1N32E 4P7AA 4IS1C 4BHCA 2V88A 1Z5CA 2EL6A 4DPTA 2WCC3 3KZYA 3EPHA 4RH8A 1KKHA 3LMLA 4KHPE 2PO2A 4GKJI 2HK3A 2Z5CA 2HK2A 3B82A 4J8ZA 2WBSA 1FJGI 3MHHC 3H4LA 4BCAA 4DV4I 2NUEA 2YTPA 4MU1A 4U3BA 2DLKA 2YT4A 2LV2A 1XMOI 5AE1A 4F6NA 5BR8E 4OKGA 4AQYI 2F4VE 5FLXC 1X3CA 2RS7A 2JEAB 4X64E 4FW4A 3ADIA 1YH8A 4I8OA 2PNLA 1UDQA 4LU9A 4JI5E 2LJPA 2EM7A 4YY3I 4LFCI 1SFEA 1X49A 1Y4UA 3M6AA 3VYXA 2MDRA 4NHRA 1DQ3A 3BIDA 2EL4A 4B3RI 1OYPA 1J5EI 1Z5AA 1T39A 1YZ9A 2DMYA 3J7AM 3ZZ0A 2N3GA 1RC7A 3M85G 2C38B 2ENCA 5DRQA 4Z7CA 2OI2A 2JWOA 4JYAI 1HK7A 4MU3A 4IFDF 4B3TI 3ADLA 4N4RB 2B7VA 1DARA 3DD6A 4M9VC 1YYOA 4NZVA 3GMEA 2YSOA 2BA1D 3U1KA 2IESA 1HNXE 4JI1E 1XNQE 2JE6B 4IZJB 4JI7E 4ZYEA 1PJSA 4BC7A 2UU9I 3PYFA 5A6JA 2N3HA 3KWRA 3OTOE 2LJUA 4DUZE 4HACA 4IFDE 3J80Q 1JK1A 2JY9A 4LF4I 3VHTB 3J81Q 2IOQA 4DR3E 2JR1A 1YYKA 2RSIA 4DPYA 4BA2B 1KVKA 3M7ND 1R6MA 4FWGA 4BBYA 4DKKA 2F8BA 2EM0A 3T1HI 2EN1A 2JVAA 3PS1A 2MKDA 4GEQB 4HEIA 3VYYA 1Y60A 2CG9A 2V8PA 4J3DA 1OYRA 1Z0CA 2C38A 1IBKI 1PDAA 4GKKI 1EH6A 4BC9A 2VQEI 2FGGA 2L92A 2J7KA 2UXDI 2BBGA 3JAMQ 2CT1A 1Y5YA 1ZM9A 4FW6A 2EPNA 2EOQA 1TF3A 1P42A 2CZ9A 2V83A 4X62I 1EKZA 4MLQA 2UXCE 4M0VA 4DV7E 4RHBB 2EM9A 1N34E 1MX0A 2EOOA 1N0VC 3HJCA 2VQFI 4FWDA 1Z0GA 2YTOA 2EQ0A 4F6MA 5C0XB 5DNLA 2Z5BA 2JP9A 4LF9E 2L8TA 4JV5I 1X6HA 1EA6A 3ZKBA 2EQ3A 1X47A 4UT4A 4DR5I 4QNJA 3CWVA 2EMBA 4NXNE 5C0XC 4DV3E 2EMGA 3NZKA 4IS9A 2BA0D 5AE2A 4USKA 2EPOA 5KL6A 5DNXA 4JI0I 4JI6E 2C39B 3JU0A 2ODRD 2ODRC 4K0KE 2YTQA 4DV5E 1ZXNA 4WUDA 4DR6I 2EMHA 1YUJA 2JEBA 2PO2B 5A6AA 1KIJA 2Z5CB 2EMKA 2CVEA 4GZNC 1RREA 4RPFA 1S16A 4LF5I 3ZM7A 4TUGA 4IFDD 2EN7A 2XEXA 2LJHA 4N3OA 1NHIA 2ENHA 2JOXA 1RHYA 2LUPB 1PIEA 1RMDA 2EOSA 2EOFA 5IT9Q 1UBDC 4F9CB 2V8QB 1Y6ZA 2DSYA 2L3JA 3AUZA 2YRMA 2PO1A 3EPKA 2EPKX 2GHFA 4JI4I 2YTEA 4USMA 2WBTA 3LTOA 3FIGA 4O24A 4LF7I 2EPZA 1YHCA 1EH8A 2V34A 1AH5A 1S4EA 2MDGA 3Q6MA 3ZKDA 2A2DA 4DPUA 1Z1BA 1YPNA 2M4IA 1GZ6A 2PO0A 2L2KB 1Z0EA 2V87A 3THNA 4LOMA 4IFDA 2H36X 3IWCA 4DR1E 2M9AA 5A2QQ 5KL4A 1ELOA 3HQ1A 2EOEA 2FTXB 1OJ4A 2C37A 1H72C 2EOZA 3K1JA 1WXRA 3WU3A 2EMZA 5DRPA 4BMJA 2BR2A 1ZXMA 4AIMA 1H7UA 4U3DA 2RTXA 5DRRA 5LMUI 4OO1F 4DUYI 2N8XA 3THOB 2NN6F 1ZM3A 2HHHI 1GTKA 4HACB 3CDJA 2ADRA 1RQ0A 3K85A 3P3CA 2K7IA 4NXMI 1ZR9A 2DLQA 1PJTA 2EM2A 5IV8B 1EI1A 1IBMI 2EN8A 2YTJA 2J7JA 3BF2A 3C6MA 3C6KA 1XNRI 4DR4I 4DV6I 1WUUA 5DROA 4TUIA 3QG5C 2DEJA 3HTXA 2YTFA 2WW4A 4M1KA 1A1HA 2EORA 2ZM6E 4ISAA 4MU0A 2ZITA 4OO1E 1N3GA 3AV0A 2NN6E 4JI3I 4X66I 1UEKA 1FNMA 3QT6A 4B3SE 5IWAE 3DJWA 3T1YE 2CTDA 5FLXQ 4JI8I 2V2ZA 1FWKA 1WRJA 2E5LI 2GQ0A 3WU4A 2EM4A 5A6KA 4YHHI 2EPPA 1TF6A 2BA0G 4GKJE 1IQSA 5ELWA 2JT2A 3F6GA 3EPJA 1Z59A 1UDNA 2KHXA 2EOMA 5JEAF 1FJGE 1AAYA 3QT5A 4DV4E 4AM3A 4HTGA 3HKMA 2Z5BB 2L2NA 1XMOE 4FK5C 2KOUA 1OYSA 2EOJA 4AQYE 4LTYA 4MU4A 4DR2I 2L3CA 2V2VA 1EH7A 1IQOA 1DI2A 2EOIA 4YY3E 3QT7A 4FW3A 4LFCE 4P52A 4OX9I 4FW5A 4PU9A 4DV1I 2MC5A 4R8OA 5JEAE 2R42A 2ELZA 2WZOA 1BKNA 4B3RE 2LO3A 2WP8A 1J5EE 4FN5A 1ZBTA 1KJKA 4WXCA 4QNKA 4R2RA 1UDOA 2DRPA 2LE2A 1IBLI 1XHKA 1Z0VA 2JEBB 2O1TA 3GCMA 2BM1A 1MU5A 1N36I 2YTGA 1RR9A 1UDSA 4JYAE 1NHHA 2EM8A 3C4BA 4B3TE 4X65I 4MLVA 2AE8A 2L33A 1BB8A 3PRYA 4LCFA 1QNTA 4WXDA 3F6HA 2GLIA 1Z0TA 2VESA 2YSPA 1I94I 1QU6A 1HNZI 2R3VA 4LFBI 2NUFA 5IXMB 2NN6B 4JI2I
chains in the Genus database with same CATH topology
4P7DA 4LF8I 3D4JA 5GMEA 1T4NA 1QZRA 2UU9E 4I3HA 4F9AB 4DR7I 4DV0I 4HYMA 2DB2A 1HNWI 4LF4E 1T4LB 2EZ6A 3PYDA 1H73A 5GMDA 2IOPA 3MSWA 3HXLA 1PKPA 2LRSA 3T1HE 4JG4A 3GONA 1XMQI 2HFSA 1MG7A 2GS8A 4F54A 1IBKE 3HULA 1SR9A 2ZBKB 4GKKE 2VQEE 4DV2I 5ADZA 1D6TA 2UXDE 4KZSA 1K47A 2UXBI 4X62E 1HR0I 2JOBA 4LF6I 3V2UC 2UUBI 2O1UA 2VQFE 1N33I 5LMNI 1N32I 2AJ4A 3DF6A 2LTSA 4PRVA 2CGEA 2NA2A 4JV5E 4KHPI 2BM0A 3IWDA 2HKJA 4DR5E 1ZM2A 3WU5A 1Z5BA 4DU8A 3WU6A 5T6JA 2VE7C 4UTGA 4DPXA 2X36A 4WFTA 5BR8I 2F4VI 4JI0E 4X64I 4Z7YA 3LPSA 2NPFA 3IWBA 4JI5I 3HPSA 2LMZA 2DEIA 4DR6E 4B3MI 4M30A 1ZBQA 3ZOQB 4LF5E 4Q28A 1U2RA 3V5RA 4XTJA 2X7IA 5AASA 1GQEA 5L3JA 4F9BB 2LTRA 4MYTA 2EWLA 2RSMA 2B7TA 3K17A 3LNUA 1HNXI 4JI4E 4JI1I 4WSPA 1XNQI 3H09A 4M2ZA 4JI7I 4LF7E 2HKEA 2MC6A 1B63A 2UUCI 1PVGA 1T4OA 5CFFE 4FWHA 4FW9A 2HFUA 3OTOI 4DUZI 3VK6A 2EFGA 4IZKB 4WUBA 4DR3I 2Z5EA 3B8HA 3QT8A 1Z0WA 4URLA 4B3ME 1USUA 1UHZA 3PYGA 2E1RA 2KONA 5LMUE 4DUYE 2PNMA 2HHHE 3J80C 3J81C 2LBSB 2UUAI 4EMDA 4NXME 4DMIA 3ADGA 2UXCI 4DV7I 3HPZA 1IBME 4R03A 1N34I 1XNRE 4DR4E 4DV6E 4L5NC 2L6MA 4PRXA 3ADJA 3Q6NA 1STUA 4LF9I 3JAMC 4JI3E 4X66E 4KQVA 2UUCE 2A2CA 4IZKA 2B3TB 4IZJD 1N0UA 2BV3A 2IHR1 4L8NA 4NXNI 4DV3I 4JI8E 3K6QA 2E1MA 2E5LE 4MYUA 1H74A 2VF3A 4YHHE 4X8WA 3OMLA 1KTVA 4JI6I 2NUGA 3LLHA 1NZ0A 2LUQA 4LFAI 4K0KI 1Y4SA 4DV5I 1X48A 1VISA 3PYEA 1FWLA 4WPYA 2V89A 4ZVIA 4WYQB 4DR2E 5DNYA 2UUAE 3JTZA 4OX9E 1FKAE 4DV1E 2B9DA 2O1WA 4HXZA 4IZJA 4HY1A 2O1VA 1IBLE 5FWKA 3P1XA 1N36E 4OOGC 4ED4A 5LL6R 4DXLA 4X65E 1FI4A 3RMPA 1H7SA 1NHJA 2V86A 1I94E 2VF1A 4LFBE 5IT9C 2CPNA 2L2MA 1HNZE 4JI2E 1J26A 4LF8E 4WUCA 4LFAE 1O0WA 4DR1I 2V85A 1WHNA 2K4VA 1B62A 4DU7A 4DR7E 4DV0E 2M7QA 1HNWE 3J7Yp 3ZZUA 3B78A 5F3WA 1YYWA 5AE3A 1WHQA 3P06A 4P78A 3C4TA 2FV4B 2M1SA 1ZM4A 1XMQE 1USVA 4BS9A 5A2QC 2G7HA 1A6FA 3Q1QA 1UILA 3ZZTA 2DIXA 4R1FA 4DV2E 3J7AG 3F0NA 2ZM6I 2V2QA 1Z0BA 2YZTA 2UXBE 2Q2EB 1HR0E 4LF6E 2UUBE 2RS6A 4DPWA 5IWAI 4B3SI 1N33E 3T1YI 5LMNE 1N32E 4P7AA 2V88A 1Z5CA 4DPTA 1KKHA 3LMLA 4KHPE 4GKJI 2HK3A 2Z5CA 2HK2A 3B82A 4J8ZA 1FJGI 3H4LA 4BCAA 4DV4I 2NUEA 2YT4A 1XMOI 5AE1A 5BR8E 4AQYI 2F4VE 5FLXC 2RS7A 4X64E 3ADIA 4I8OA 2PNLA 4LU9A 4JI5E 2LJPA 4YY3I 4LFCI 1X49A 3M6AA 1Y4UA 3VYXA 2MDRA 1DQ3A 4B3RI 1J5EI 1Z5AA 1YZ9A 2DMYA 3J7AM 3ZZ0A 2N3GA 1RC7A 4Z7CA 2OI2A 2JWOA 4JYAI 1HK7A 4B3TI 3ADLA 1DARA 2B7VA 1YYOA 1HNXE 4JI1E 1XNQE 4IZJB 4JI7E 4BC7A 2UU9I 3PYFA 2N3HA 3KWRA 3OTOE 4DUZE 4HACA 3J80Q 4LF4I 2JY9A 3J81Q 2IOQA 4DR3E 2JR1A 1YYKA 4DPYA 1KVKA 4FWGA 4BBYA 4DKKA 2F8BA 3T1HI 2JVAA 2V8PA 4GEQB 3VYYA 2CG9A 1Z0CA 1IBKI 4GKKI 4BC9A 2VQEI 2FGGA 2L92A 2J7KA 2UXDI 3JAMQ 1ZM9A 2CZ9A 2V83A 4X62I 1EKZA 2UXCE 4M0VA 4DV7E 1N34E 1MX0A 3HJCA 1N0VC 2VQFI 4FWDA 1Z0GA 2Z5BA 4LF9E 4JV5I 2L8TA 1EA6A 3ZKBA 1X47A 4UT4A 4DR5I 3CWVA 4NXNE 4DV3E 5AE2A 4USKA 4JI0I 4JI6E 3JU0A 2ODRD 2ODRC 4K0KE 4DV5E 1ZXNA 4WUDA 4DR6I 1KIJA 2Z5CB 1RREA 4RPFA 1S16A 4LF5I 3ZM7A 4TUGA 2XEXA 2LJHA 4N3OA 1NHIA 2JOXA 2LUPB 1PIEA 5IT9Q 4F9CB 2V8QB 1Y6ZA 2DSYA 2L3JA 3AUZA 4JI4I 4USMA 3LTOA 3FIGA 4LF7I 2V34A 1S4EA 3Q6MA 3ZKDA 2A2DA 4DPUA 2M4IA 1GZ6A 2L2KB 1Z0EA 2V87A 2H36X 3IWCA 4DR1E 5A2QQ 1ELOA 3HQ1A 2FTXB 1OJ4A 1H72C 3K1JA 1WXRA 3WU3A 4BMJA 1ZXMA 1H7UA 2RTXA 5LMUI 4DUYI 1ZM3A 2HHHI 4HACB 1RQ0A 3K85A 4NXMI 1EI1A 1IBMI 1XNRI 4DR4I 4DV6I 1WUUA 4TUIA 2DEJA 3HTXA 4M1KA 2WW4A 2ZM6E 2ZITA 3AV0A 4JI3I 4X66I 1UEKA 1FNMA 3QT6A 4B3SE 5IWAE 3DJWA 3T1YE 5FLXQ 4JI8I 2V2ZA 1FWKA 2E5LI 2GQ0A 3WU4A 4YHHI 4GKJE 3F6GA 1Z59A 2KHXA 1FJGE 3QT5A 4DV4E 2Z5BB 2L2NA 1XMOE 2KOUA 4AQYE 4LTYA 4DR2I 2L3CA 2V2VA 1DI2A 4YY3E 3QT7A 4LFCE 4P52A 4OX9I 4PU9A 4DV1I 2MC5A 4R8OA 2R42A 2WZOA 1BKNA 4B3RE 1J5EE 4FN5A 1ZBTA 2LE2A 1IBLI 1XHKA 1Z0VA 2O1TA 2BM1A 1MU5A 1N36I 1RR9A 4JYAE 1NHHA 3C4BA 4B3TE 4X65I 2L33A 3PRYA 3F6HA 1I94I 1Z0TA 4LFBI 1QU6A 1HNZI 2R3VA 2NUFA 4JI2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 I;  3D4J A;  5GME A;  1T4N A;  1QZR A;  2UU9 E;  4I3H A;  4DR7 I;  4DV0 I;  4HYM A;  2DB2 A;  1HNW I;  4LF4 E;  1T4L B;  2EZ6 A;  3PYD A;  1H73 A;  5GMD A;  1PKP A;  2LRS A;  3T1H E;  4JG4 A;  3GON A;  1XMQ I;  2HFS A;  1MG7 A;  2GS8 A;  3HUL A;  1IBK E;  2ZBK B;  4GKK E;  2VQE E;  4DV2 I;  1D6T A;  2UXD E;  1K47 A;  2UXB I;  4X62 E;  1HR0 I;  4LF6 I;  3V2U C;  2UUB I;  2VQF E;  1N33 I;  5LMN I;  1N32 I;  2AJ4 A;  2LTS A;  4PRV A;  2NA2 A;  4JV5 E;  4KHP I;  2BM0 A;  2HKJ A;  4DR5 E;  1ZM2 A;  3WU5 A;  1Z5B A;  4DU8 A;  3WU6 A;  4UTG A;  4DPX A;  2X36 A;  4WFT A;  5BR8 I;  2F4V I;  4JI0 E;  4X64 I;  4Z7Y A;  3LPS A;  2NPF A;  4JI5 I;  2DEI A;  4DR6 E;  4B3M I;  4M30 A;  4LF5 E;  1U2R A;  3V5R A;  4XTJ A;  2X7I A;  1GQE A;  5L3J A;  2LTR A;  4MYT A;  2RSM A;  2B7T A;  3K17 A;  3LNU A;  1HNX I;  4JI4 E;  4JI1 I;  1XNQ I;  4M2Z A;  4JI7 I;  4LF7 E;  2HKE A;  1B63 A;  2UUC I;  1PVG A;  1T4O A;  5CFF E;  4FWH A;  4FW9 A;  2HFU A;  3OTO I;  4DUZ I;  2EFG A;  4WUB A;  4DR3 I;  3B8H A;  3QT8 A;  1Z0W A;  4URL A;  4B3M E;  1UHZ A;  3PYG A;  2E1R A;  5LMU E;  4DUY E;  2HHH E;  3J80 C;  3J81 C;  2LBS B;  2UUA I;  4EMD A;  4NXM E;  3ADG A;  2UXC I;  4DV7 I;  1IBM E;  1N34 I;  1XNR E;  4DR4 E;  4DV6 E;  4PRX A;  3ADJ A;  1STU A;  4LF9 I;  4JI3 E;  3JAM C;  4X66 E;  4KQV A;  2UUC E;  2A2C A;  2B3T B;  4NXN I;  1N0U A;  2BV3 A;  2IHR 1;  4DV3 I;  4JI8 E;  2E5L E;  4MYU A;  1H74 A;  2VF3 A;  4YHH E;  4X8W A;  1KTV A;  4JI6 I;  2NUG A;  3LLH A;  1NZ0 A;  2LUQ A;  4LFA I;  4K0K I;  4DV5 I;  1X48 A;  1VIS A;  3PYE A;  1FWL A;  4ZVI A;  4WYQ B;  4DR2 E;  2UUA E;  4OX9 E;  1FKA E;  4DV1 E;  4HXZ A;  4HY1 A;  1IBL E;  3P1X A;  1N36 E;  4OOG C;  4ED4 A;  5LL6 R;  4DXL A;  4X65 E;  1FI4 A;  1H7S A;  1NHJ A;  1I94 E;  4LFB E;  5IT9 C;  2CPN A;  2L2M A;  1HNZ E;  4JI2 E;  1J26 A;  4LF8 E;  4WUC A;  4LFA E;  1O0W A;  4DR1 I;  1WHN A;  1B62 A;  4DU7 A;  4DR7 E;  4DV0 E;  1HNW E;  3J7Y p;  3ZZU A;  3B78 A;  1YYW A;  1WHQ A;  3C4T A;  1ZM4 A;  1XMQ E;  5A2Q C;  1A6F A;  3Q1Q A;  1UIL A;  3ZZT A;  2DIX A;  4R1F A;  4DV2 E;  3J7A G;  3F0N A;  2ZM6 I;  2V2Q A;  1Z0B A;  2UXB E;  2Q2E B;  1HR0 E;  4LF6 E;  2UUB E;  2RS6 A;  4DPW A;  5IWA I;  4B3S I;  1N33 E;  3T1Y I;  5LMN E;  1N32 E;  4P7A A;  1Z5C A;  4DPT A;  1KKH A;  4KHP E;  4GKJ I;  2HK3 A;  2HK2 A;  3B82 A;  1FJG I;  3H4L A;  4DV4 I;  2NUE A;  2YT4 A;  1XMO I;  5BR8 E;  4AQY I;  2F4V E;  5FLX C;  2RS7 A;  4X64 E;  3ADI A;  4JI5 E;  2LJP A;  4YY3 I;  4LFC I;  1X49 A;  3M6A A;  3VYX A;  2MDR A;  4B3R I;  1J5E I;  1Z5A A;  1YZ9 A;  2DMY A;  3J7A M;  3ZZ0 A;  2N3G A;  1RC7 A;  4Z7C A;  2OI2 A;  4JYA I;  4B3T I;  3ADL A;  1DAR A;  2B7V A;  1YYO A;  1HNX E;  4JI1 E;  1XNQ E;  4JI7 E;  2UU9 I;  3PYF A;  2N3H A;  3OTO E;  4DUZ E;  4HAC A;  3J80 Q;  4LF4 I;  2JY9 A;  3J81 Q;  4DR3 E;  1YYK A;  4DPY A;  1KVK A;  4FWG A;  4DKK A;  3T1H I;  2JVA A;  2V8P A;  3VYY A;  1Z0C A;  1IBK I;  4GKK I;  2VQE I;  2J7K A;  2UXD I;  3JAM Q;  1ZM9 A;  2CZ9 A;  4X62 I;  1EKZ A;  2UXC E;  4DV7 E;  1N34 E;  1MX0 A;  1N0V C;  2VQF I;  4FWD A;  1Z0G A;  4LF9 E;  4JV5 I;  1EA6 A;  3ZKB A;  1X47 A;  4UT4 A;  4DR5 I;  3CWV A;  4NXN E;  4DV3 E;  4USK A;  4JI0 I;  4JI6 E;  4K0K E;  4DV5 E;  1ZXN A;  4WUD A;  4DR6 I;  1KIJ A;  1RRE A;  4RPF A;  1S16 A;  4LF5 I;  3ZM7 A;  2XEX A;  2LJH A;  1NHI A;  2LUP B;  1PIE A;  5IT9 Q;  2L3J A;  4JI4 I;  4USM A;  3LTO A;  4LF7 I;  2V34 A;  1S4E A;  3ZKD A;  2A2D A;  4DPU A;  2L2K B;  1Z0E A;  4DR1 E;  5A2Q Q;  1ELO A;  1OJ4 A;  1H72 C;  3K1J A;  3WU3 A;  1ZXM A;  1H7U A;  2RTX A;  5LMU I;  4DUY I;  1ZM3 A;  2HHH I;  4HAC B;  1RQ0 A;  4NXM I;  1EI1 A;  1IBM I;  1XNR I;  4DR4 I;  4DV6 I;  1WUU A;  2DEJ A;  3HTX A;  4M1K A;  2WW4 A;  2ZM6 E;  2ZIT A;  4JI3 I;  4X66 I;  1UEK A;  1FNM A;  3QT6 A;  4B3S E;  5IWA E;  3T1Y E;  5FLX Q;  4JI8 I;  2V2Z A;  1FWK A;  2E5L I;  3WU4 A;  4YHH I;  4GKJ E;  1Z59 A;  2KHX A;  1FJG E;  3QT5 A;  4DV4 E;  2L2N A;  1XMO E;  4AQY E;  4DR2 I;  2L3C A;  2V2V A;  1DI2 A;  4YY3 E;  3QT7 A;  4LFC E;  4P52 A;  4OX9 I;  4PU9 A;  4DV1 I;  2R42 A;  1BKN A;  4B3R E;  1J5E E;  4FN5 A;  1ZBT A;  1IBL I;  1XHK A;  1Z0V A;  2BM1 A;  1MU5 A;  1N36 I;  1RR9 A;  4JYA E;  1NHH A;  3C4B A;  4B3T E;  4X65 I;  2L33 A;  1I94 I;  4LFB I;  1Z0T A;  1QU6 A;  1HNZ I;  2R3V A;  2NUF A;  4JI2 I; 
#chains in the Genus database with same CATH topology
 4P7D A;  4LF8 I;  4R2A A;  1MEY C;  4ZYG A;  3D4J A;  4O5G A;  1A1F A;  5GME A;  1T4N A;  2EM6 A;  1QZR A;  2UU9 E;  4I3H A;  4OO1 D;  3B4T A;  2NN6 D;  2WBU A;  2NN6 C;  4F9A B;  4DR7 I;  4DV0 I;  2PO1 B;  1ZAA C;  4HYM A;  2DB2 A;  1HNW I;  4LF4 E;  1T4L B;  4AID A;  2EZ6 A;  1X5W A;  2CSH A;  1H73 A;  3PYD A;  5EKW A;  5GMD A;  2IOP A;  3MSW A;  3UK3 C;  5TSE A;  5A69 A;  3HXL A;  4LCH A;  1PKP A;  2EPR A;  2LRS A;  3T1H E;  4JG4 A;  3GON A;  1YUI A;  2PO0 B;  2HFS A;  2EN4 A;  1XMQ I;  2GO4 A;  1MG7 A;  2GS8 A;  4F54 A;  1IBK E;  3HUL A;  4IFD B;  2PRT A;  1SR9 A;  2ZBK B;  4GKK E;  3M85 D;  2VQE E;  4DV2 I;  5ADZ A;  1D6T A;  2UXD E;  2C37 B;  2YTN A;  4KZS A;  4FW7 A;  1K47 A;  2BB8 A;  2EN6 A;  2ELY A;  2EMY A;  2HGH A;  4IFD C;  2NAB A;  2BR2 B;  2UXB I;  4X62 E;  4F2J C;  1HR0 I;  2JOB A;  1YFH A;  4LF6 I;  3V2U C;  2UUB I;  2O1U A;  4OO1 A;  2NN6 A;  1A1I A;  2VQF E;  1N33 I;  2YTI A;  5JEA D;  5LMN I;  1N32 I;  2AJ4 A;  5JEA C;  3DF6 A;  2LTS A;  2E72 A;  4PRV A;  1NEI A;  2CGE A;  2I13 A;  1VI7 A;  2NA2 A;  4JV5 E;  4KHP I;  2BM0 A;  3IWD A;  2HKJ A;  2BA1 G;  4DR5 E;  1ZM2 A;  3WU5 A;  2LVH A;  1Z5B A;  2HJJ A;  4DU8 A;  3WU6 A;  5T6J A;  1B69 A;  2R1F A;  2VE7 C;  4UTG A;  4DPX A;  2X36 A;  4WFT A;  2O3Z A;  5BR8 I;  2F4V I;  2YRH A;  5EL9 A;  5K36 F;  4JI0 E;  4X64 I;  4Z7Y A;  1X6F A;  3LPS A;  2NPF A;  3IWB A;  4JI5 I;  3HPS A;  3M7N G;  2LMZ A;  2YRK A;  1DGC A;  4DR6 E;  2DEI A;  4M30 A;  4B3M I;  3MHS C;  5KL5 A;  3CDI A;  1ZBQ A;  2EMC A;  3ZOQ B;  1F2I G;  4LF5 E;  5JEA A;  4Q28 A;  1U2R A;  1YSA C;  3V5R A;  1L4S A;  2EMF A;  1A1J A;  3GLL A;  4XTJ A;  5K36 E;  4BHB A;  2DGC A;  1ZU1 A;  5LLQ A;  2X7I A;  2EP3 A;  4R2D A;  5AAS A;  2JYA A;  1P47 A;  3L00 A;  3L7Z B;  1GQE A;  5L3J A;  2WNR A;  4F9B B;  2LTR A;  4MYT A;  2EWL A;  2EOY A;  2RSM A;  2B7T A;  3K17 A;  3LNU A;  1HNX I;  4JI4 E;  4JI1 I;  4WSP A;  2WP8 B;  1XNQ I;  3H09 A;  4M2Z A;  4JI7 I;  1A1G A;  4LF7 E;  1E3H A;  2YTD A;  2HKE A;  2MC6 A;  1B63 A;  2UUC I;  1PVG A;  1T4O A;  5CFF E;  4FWH A;  4FW9 A;  2HFU A;  2R76 A;  3OTO I;  4DUZ I;  4O4K A;  3VK6 A;  2EFG A;  4LPF A;  1BBO A;  2GPI A;  4ZYH A;  4IZK B;  4WUB A;  5C0X F;  1MGT A;  4O43 A;  5A6B A;  4DR3 I;  2Z5E A;  2EE8 A;  4OZE A;  3B8H A;  3QT8 A;  2PNZ A;  1Z0W A;  4URL A;  4B3M E;  2EPX A;  2IER A;  4BA1 A;  1USU A;  2EPM X;  2EMW A;  2EM3 A;  1UHZ A;  3PYG A;  3H1C A;  3EPL A;  4R2P A;  2KON A;  2E1R A;  2EN2 A;  2EPU A;  5LMU E;  3U1Y A;  4DUY E;  2EMX A;  2PNM A;  5C0X E;  3J80 C;  2HHH E;  3J81 C;  3L7Z A;  2LBS B;  2UUA I;  4EMD A;  4NXM E;  1G2D C;  2A25 A;  4DMI A;  3ADG A;  2UXC I;  4DV7 I;  3HPZ A;  1IBM E;  4IJD A;  4R03 A;  1N34 I;  3KZZ A;  1XNR E;  2ENA A;  1G2F C;  4DV6 E;  4DR4 E;  4L5N C;  2GO3 A;  2EOH A;  5KL3 A;  5K36 B;  2L6M A;  4PRX A;  3ADJ A;  3Q6N A;  1STU A;  4LF9 I;  2EPC A;  3JAM C;  4JI3 E;  4X66 E;  4KQV A;  2UUC E;  2A2C A;  4WX9 A;  2B3T B;  4IZK A;  2JEA A;  5K36 D;  4IZJ D;  1N0U A;  2BV3 A;  2IHR 1;  2I9I A;  4L8N A;  1TN9 A;  4MDT A;  4NXN I;  4DV3 I;  5K36 C;  4JI8 E;  3K6Q A;  2D9H A;  2E1M A;  2E5L E;  4MYU A;  1H74 A;  1A1L A;  2VF3 A;  4YHH E;  4X8W A;  3OML A;  4OO1 B;  1KTV A;  4JI6 I;  2Q8U A;  4R2C A;  2NUG A;  3LLH A;  1NZ0 A;  3PS2 A;  2LUQ A;  4LFA I;  4K0K I;  2EMA A;  2EPL X;  1Y4S A;  4DV5 I;  1X48 A;  1LLM C;  1VIS A;  3PYE A;  1FWL A;  4OO1 C;  4WPY A;  4Q35 B;  2YPN A;  2EPA A;  2V89 A;  4ZVI A;  2HC5 A;  3ECR A;  3P3G A;  4WYQ B;  4MQY A;  4DR2 E;  1R6L A;  3P3E A;  5DNY A;  2UUA E;  1KYQ A;  2VRD A;  2EQ1 A;  3JTZ A;  4OX9 E;  1FKA E;  4DV1 E;  2B9D A;  1UN6 B;  4NBQ A;  4X9J A;  1A1K A;  2O1W A;  4WSG A;  4HXZ A;  1JK2 A;  5K36 A;  2JE6 A;  4IZJ A;  4HY1 A;  1WJP A;  1X6E A;  5AC5 A;  2JPA A;  2O1V A;  1T38 A;  4R2E A;  1IBL E;  5KL2 A;  5FWK A;  3P1X A;  1N36 E;  5C0X D;  4KWY A;  4OOG C;  2J65 A;  5JEA B;  4ED4 A;  5LL6 R;  4DXL A;  4BA2 A;  1PJQ A;  4X65 E;  1FI4 A;  3RMP A;  1H7S A;  1NHJ A;  2V86 A;  4R2S A;  1I94 E;  2VF1 A;  4LFB E;  5IT9 C;  2CPN A;  2L2M A;  1HNZ E;  3PS3 A;  4JI2 E;  1J26 A;  4LF8 E;  3P76 A;  4LCG A;  4WUC A;  4LFA E;  1NCS A;  1O0W A;  2V85 A;  2WNR B;  4DR1 I;  1WHN A;  2K4V A;  1B62 A;  2LT7 A;  1E3P A;  2YU8 A;  4DR7 E;  4DV0 E;  4DU7 A;  2EML A;  2M7Q A;  1HNW E;  3UHM A;  3J7Y p;  3ZZU A;  3B78 A;  4R2Q A;  5F3W A;  5KL7 A;  2YWQ A;  1YYW A;  5AE3 A;  2EOX A;  1WHQ A;  2EN3 A;  2RQL A;  3P06 A;  2EMI A;  4P78 A;  2JXP A;  3C4T A;  1IMU A;  2FV4 B;  3BBG A;  2M1S A;  5C0X A;  1ZM4 A;  3EQ1 A;  1XMQ E;  1USV A;  4BS9 A;  5A2Q C;  2G7H A;  2RPC A;  2MKN A;  1A6F A;  2PNZ B;  1UIL A;  3ZZT A;  3Q1Q A;  2DIX A;  3M99 B;  4ZYD A;  4R1F A;  4DV2 E;  4GQU A;  5A6B D;  3J7A G;  4BA1 B;  2DMI A;  3BGH A;  3TQM A;  3F0N A;  2F1D A;  2ZM6 I;  2V2Q A;  1BBG A;  1Z0B A;  2EJ4 A;  2YZT A;  2UXB E;  2Q2E B;  2YU5 A;  1HR0 E;  3KRN A;  5AC4 A;  2LCE A;  2EM5 A;  4LF6 E;  2UUB E;  2RS6 A;  1XXE A;  4DPW A;  5IWA I;  4B3S I;  2EL5 A;  2C39 A;  1N33 E;  3T1Y I;  5LMN E;  1N32 E;  4P7A A;  4IS1 C;  4BHC A;  2V88 A;  1Z5C A;  2EL6 A;  4DPT A;  2WCC 3;  3KZY A;  3EPH A;  4RH8 A;  1KKH A;  3LML A;  4KHP E;  2PO2 A;  4GKJ I;  2HK3 A;  2Z5C A;  2HK2 A;  3B82 A;  4J8Z A;  2WBS A;  1FJG I;  3MHH C;  3H4L A;  4BCA A;  4DV4 I;  2NUE A;  2YTP A;  4MU1 A;  4U3B A;  2DLK A;  2YT4 A;  2LV2 A;  1XMO I;  5AE1 A;  4F6N A;  5BR8 E;  4OKG A;  4AQY I;  2F4V E;  5FLX C;  1X3C A;  2RS7 A;  2JEA B;  4X64 E;  4FW4 A;  3ADI A;  1YH8 A;  4I8O A;  2PNL A;  1UDQ A;  4LU9 A;  4JI5 E;  2LJP A;  2EM7 A;  4YY3 I;  4LFC I;  1SFE A;  1X49 A;  1Y4U A;  3M6A A;  3VYX A;  2MDR A;  4NHR A;  1DQ3 A;  3BID A;  2EL4 A;  4B3R I;  1OYP A;  1J5E I;  1Z5A A;  1T39 A;  1YZ9 A;  2DMY A;  3J7A M;  3ZZ0 A;  2N3G A;  1RC7 A;  3M85 G;  2C38 B;  2ENC A;  5DRQ A;  4Z7C A;  2OI2 A;  2JWO A;  4JYA I;  1HK7 A;  4MU3 A;  4IFD F;  4B3T I;  3ADL A;  4N4R B;  2B7V A;  1DAR A;  3DD6 A;  4M9V C;  1YYO A;  4NZV A;  3GME A;  2YSO A;  2BA1 D;  3U1K A;  2IES A;  1HNX E;  4JI1 E;  1XNQ E;  2JE6 B;  4IZJ B;  4JI7 E;  4ZYE A;  1PJS A;  4BC7 A;  2UU9 I;  3PYF A;  5A6J A;  2N3H A;  3KWR A;  3OTO E;  2LJU A;  4DUZ E;  4HAC A;  4IFD E;  3J80 Q;  1JK1 A;  2JY9 A;  4LF4 I;  3VHT B;  3J81 Q;  2IOQ A;  4DR3 E;  2JR1 A;  1YYK A;  2RSI A;  4DPY A;  4BA2 B;  1KVK A;  3M7N D;  1R6M A;  4FWG A;  4BBY A;  4DKK A;  2F8B A;  2EM0 A;  3T1H I;  2EN1 A;  2JVA A;  3PS1 A;  2MKD A;  4GEQ B;  4HEI A;  3VYY A;  1Y60 A;  2CG9 A;  2V8P A;  4J3D A;  1OYR A;  1Z0C A;  2C38 A;  1IBK I;  1PDA A;  4GKK I;  1EH6 A;  4BC9 A;  2VQE I;  2FGG A;  2L92 A;  2J7K A;  2UXD I;  2BBG A;  3JAM Q;  2CT1 A;  1Y5Y A;  1ZM9 A;  4FW6 A;  2EPN A;  2EOQ A;  1TF3 A;  1P42 A;  2CZ9 A;  2V83 A;  4X62 I;  1EKZ A;  4MLQ A;  2UXC E;  4M0V A;  4DV7 E;  4RHB B;  2EM9 A;  1N34 E;  1MX0 A;  2EOO A;  1N0V C;  3HJC A;  2VQF I;  4FWD A;  1Z0G A;  2YTO A;  2EQ0 A;  4F6M A;  5C0X B;  5DNL A;  2Z5B A;  2JP9 A;  4LF9 E;  2L8T A;  4JV5 I;  1X6H A;  1EA6 A;  3ZKB A;  2EQ3 A;  1X47 A;  4UT4 A;  4DR5 I;  4QNJ A;  3CWV A;  2EMB A;  4NXN E;  5C0X C;  4DV3 E;  2EMG A;  3NZK A;  4IS9 A;  2BA0 D;  5AE2 A;  4USK A;  2EPO A;  5KL6 A;  5DNX A;  4JI0 I;  4JI6 E;  2C39 B;  3JU0 A;  2ODR D;  2ODR C;  4K0K E;  2YTQ A;  4DV5 E;  1ZXN A;  4WUD A;  4DR6 I;  2EMH A;  1YUJ A;  2JEB A;  2PO2 B;  5A6A A;  1KIJ A;  2Z5C B;  2EMK A;  2CVE A;  4GZN C;  1RRE A;  4RPF A;  1S16 A;  4LF5 I;  3ZM7 A;  4TUG A;  4IFD D;  2EN7 A;  2XEX A;  2LJH A;  4N3O A;  1NHI A;  2ENH A;  2JOX A;  1RHY A;  2LUP B;  1PIE A;  1RMD A;  2EOS A;  2EOF A;  5IT9 Q;  1UBD C;  4F9C B;  2V8Q B;  1Y6Z A;  2DSY A;  2L3J A;  3AUZ A;  2YRM A;  2PO1 A;  3EPK A;  2EPK X;  2GHF A;  4JI4 I;  2YTE A;  4USM A;  2WBT A;  3LTO A;  3FIG A;  4O24 A;  4LF7 I;  2EPZ A;  1YHC A;  1EH8 A;  2V34 A;  1AH5 A;  1S4E A;  2MDG A;  3Q6M A;  3ZKD A;  2A2D A;  4DPU A;  1Z1B A;  1YPN A;  2M4I A;  1GZ6 A;  2PO0 A;  2L2K B;  1Z0E A;  2V87 A;  3THN A;  4LOM A;  4IFD A;  2H36 X;  3IWC A;  4DR1 E;  2M9A A;  5A2Q Q;  5KL4 A;  1ELO A;  3HQ1 A;  2EOE A;  2FTX B;  1OJ4 A;  2C37 A;  1H72 C;  2EOZ A;  3K1J A;  1WXR A;  3WU3 A;  2EMZ A;  5DRP A;  4BMJ A;  2BR2 A;  1ZXM A;  4AIM A;  1H7U A;  4U3D A;  2RTX A;  5DRR A;  5LMU I;  4OO1 F;  4DUY I;  2N8X A;  3THO B;  2NN6 F;  1ZM3 A;  2HHH I;  1GTK A;  4HAC B;  3CDJ A;  2ADR A;  1RQ0 A;  3K85 A;  3P3C A;  2K7I A;  4NXM I;  1ZR9 A;  2DLQ A;  1PJT A;  2EM2 A;  5IV8 B;  1EI1 A;  1IBM I;  2EN8 A;  2YTJ A;  2J7J A;  3BF2 A;  3C6M A;  3C6K A;  1XNR I;  4DR4 I;  4DV6 I;  1WUU A;  5DRO A;  4TUI A;  3QG5 C;  2DEJ A;  3HTX A;  2YTF A;  2WW4 A;  4M1K A;  1A1H A;  2EOR A;  2ZM6 E;  4ISA A;  4MU0 A;  2ZIT A;  4OO1 E;  1N3G A;  3AV0 A;  2NN6 E;  4JI3 I;  4X66 I;  1UEK A;  1FNM A;  3QT6 A;  4B3S E;  5IWA E;  3DJW A;  3T1Y E;  2CTD A;  5FLX Q;  4JI8 I;  2V2Z A;  1FWK A;  1WRJ A;  2E5L I;  2GQ0 A;  3WU4 A;  2EM4 A;  5A6K A;  4YHH I;  2EPP A;  1TF6 A;  2BA0 G;  4GKJ E;  1IQS A;  5ELW A;  2JT2 A;  3F6G A;  3EPJ A;  1Z59 A;  1UDN A;  2KHX A;  2EOM A;  5JEA F;  1FJG E;  1AAY A;  3QT5 A;  4DV4 E;  4AM3 A;  4HTG A;  3HKM A;  2Z5B B;  2L2N A;  1XMO E;  4FK5 C;  2KOU A;  1OYS A;  2EOJ A;  4AQY E;  4LTY A;  4MU4 A;  4DR2 I;  2L3C A;  2V2V A;  1EH7 A;  1IQO A;  1DI2 A;  2EOI A;  4YY3 E;  3QT7 A;  4FW3 A;  4LFC E;  4P52 A;  4OX9 I;  4FW5 A;  4PU9 A;  4DV1 I;  2MC5 A;  4R8O A;  5JEA E;  2R42 A;  2ELZ A;  2WZO A;  1BKN A;  4B3R E;  2LO3 A;  2WP8 A;  1J5E E;  4FN5 A;  1ZBT A;  1KJK A;  4WXC A;  4QNK A;  4R2R A;  1UDO A;  2DRP A;  2LE2 A;  1IBL I;  1XHK A;  1Z0V A;  2JEB B;  2O1T A;  3GCM A;  2BM1 A;  1MU5 A;  1N36 I;  2YTG A;  1RR9 A;  1UDS A;  4JYA E;  1NHH A;  2EM8 A;  3C4B A;  4B3T E;  4X65 I;  4MLV A;  2AE8 A;  2L33 A;  1BB8 A;  3PRY A;  4LCF A;  1QNT A;  4WXD A;  3F6H A;  2GLI A;  1Z0T A;  2VES A;  2YSP A;  1I94 I;  1QU6 A;  1HNZ I;  2R3V A;  4LFB I;  2NUF A;  5IXM B;  2NN6 B;  4JI2 I; 
#chains in the Genus database with same CATH homology
 4P7D A;  4LF8 I;  3D4J A;  5GME A;  1T4N A;  1QZR A;  2UU9 E;  4I3H A;  4F9A B;  4DR7 I;  4DV0 I;  4HYM A;  2DB2 A;  1HNW I;  4LF4 E;  1T4L B;  2EZ6 A;  3PYD A;  1H73 A;  5GMD A;  2IOP A;  3MSW A;  3HXL A;  1PKP A;  2LRS A;  3T1H E;  4JG4 A;  3GON A;  1XMQ I;  2HFS A;  1MG7 A;  2GS8 A;  4F54 A;  1IBK E;  3HUL A;  1SR9 A;  2ZBK B;  4GKK E;  2VQE E;  4DV2 I;  5ADZ A;  1D6T A;  2UXD E;  4KZS A;  1K47 A;  2UXB I;  4X62 E;  1HR0 I;  2JOB A;  4LF6 I;  3V2U C;  2UUB I;  2O1U A;  2VQF E;  1N33 I;  5LMN I;  1N32 I;  2AJ4 A;  3DF6 A;  2LTS A;  4PRV A;  2CGE A;  2NA2 A;  4JV5 E;  4KHP I;  2BM0 A;  3IWD A;  2HKJ A;  4DR5 E;  1ZM2 A;  3WU5 A;  1Z5B A;  4DU8 A;  3WU6 A;  5T6J A;  2VE7 C;  4UTG A;  4DPX A;  2X36 A;  4WFT A;  5BR8 I;  2F4V I;  4JI0 E;  4X64 I;  4Z7Y A;  3LPS A;  2NPF A;  3IWB A;  4JI5 I;  3HPS A;  2LMZ A;  2DEI A;  4DR6 E;  4B3M I;  4M30 A;  1ZBQ A;  3ZOQ B;  4LF5 E;  4Q28 A;  1U2R A;  3V5R A;  4XTJ A;  2X7I A;  5AAS A;  1GQE A;  5L3J A;  4F9B B;  2LTR A;  4MYT A;  2EWL A;  2RSM A;  2B7T A;  3K17 A;  3LNU A;  1HNX I;  4JI4 E;  4JI1 I;  4WSP A;  1XNQ I;  3H09 A;  4M2Z A;  4JI7 I;  4LF7 E;  2HKE A;  2MC6 A;  1B63 A;  2UUC I;  1PVG A;  1T4O A;  5CFF E;  4FWH A;  4FW9 A;  2HFU A;  3OTO I;  4DUZ I;  3VK6 A;  2EFG A;  4IZK B;  4WUB A;  4DR3 I;  2Z5E A;  3B8H A;  3QT8 A;  1Z0W A;  4URL A;  4B3M E;  1USU A;  1UHZ A;  3PYG A;  2E1R A;  2KON A;  5LMU E;  4DUY E;  2PNM A;  2HHH E;  3J80 C;  3J81 C;  2LBS B;  2UUA I;  4EMD A;  4NXM E;  4DMI A;  3ADG A;  2UXC I;  4DV7 I;  3HPZ A;  1IBM E;  4R03 A;  1N34 I;  1XNR E;  4DR4 E;  4DV6 E;  4L5N C;  2L6M A;  4PRX A;  3ADJ A;  3Q6N A;  1STU A;  4LF9 I;  3JAM C;  4JI3 E;  4X66 E;  4KQV A;  2UUC E;  2A2C A;  4IZK A;  2B3T B;  4IZJ D;  1N0U A;  2BV3 A;  2IHR 1;  4L8N A;  4NXN I;  4DV3 I;  4JI8 E;  3K6Q A;  2E1M A;  2E5L E;  4MYU A;  1H74 A;  2VF3 A;  4YHH E;  4X8W A;  3OML A;  1KTV A;  4JI6 I;  2NUG A;  3LLH A;  1NZ0 A;  2LUQ A;  4LFA I;  4K0K I;  1Y4S A;  4DV5 I;  1X48 A;  1VIS A;  3PYE A;  1FWL A;  4WPY A;  2V89 A;  4ZVI A;  4WYQ B;  4DR2 E;  5DNY A;  2UUA E;  3JTZ A;  4OX9 E;  1FKA E;  4DV1 E;  2B9D A;  2O1W A;  4HXZ A;  4IZJ A;  4HY1 A;  2O1V A;  1IBL E;  5FWK A;  3P1X A;  1N36 E;  4OOG C;  4ED4 A;  5LL6 R;  4DXL A;  4X65 E;  1FI4 A;  3RMP A;  1H7S A;  1NHJ A;  2V86 A;  1I94 E;  2VF1 A;  4LFB E;  5IT9 C;  2CPN A;  2L2M A;  1HNZ E;  4JI2 E;  1J26 A;  4LF8 E;  4WUC A;  4LFA E;  1O0W A;  4DR1 I;  2V85 A;  1WHN A;  2K4V A;  1B62 A;  4DU7 A;  4DR7 E;  4DV0 E;  2M7Q A;  1HNW E;  3J7Y p;  3ZZU A;  3B78 A;  5F3W A;  1YYW A;  5AE3 A;  1WHQ A;  3P06 A;  4P78 A;  3C4T A;  2FV4 B;  2M1S A;  1ZM4 A;  1XMQ E;  1USV A;  4BS9 A;  5A2Q C;  2G7H A;  1A6F A;  3Q1Q A;  1UIL A;  3ZZT A;  2DIX A;  4R1F A;  4DV2 E;  3J7A G;  3F0N A;  2ZM6 I;  2V2Q A;  1Z0B A;  2YZT A;  2UXB E;  2Q2E B;  1HR0 E;  4LF6 E;  2UUB E;  2RS6 A;  4DPW A;  5IWA I;  4B3S I;  1N33 E;  3T1Y I;  5LMN E;  1N32 E;  4P7A A;  2V88 A;  1Z5C A;  4DPT A;  1KKH A;  3LML A;  4KHP E;  4GKJ I;  2HK3 A;  2Z5C A;  2HK2 A;  3B82 A;  4J8Z A;  1FJG I;  3H4L A;  4BCA A;  4DV4 I;  2NUE A;  2YT4 A;  1XMO I;  5AE1 A;  5BR8 E;  4AQY I;  2F4V E;  5FLX C;  2RS7 A;  4X64 E;  3ADI A;  4I8O A;  2PNL A;  4LU9 A;  4JI5 E;  2LJP A;  4YY3 I;  4LFC I;  1X49 A;  3M6A A;  1Y4U A;  3VYX A;  2MDR A;  1DQ3 A;  4B3R I;  1J5E I;  1Z5A A;  1YZ9 A;  2DMY A;  3J7A M;  3ZZ0 A;  2N3G A;  1RC7 A;  4Z7C A;  2OI2 A;  2JWO A;  4JYA I;  1HK7 A;  4B3T I;  3ADL A;  1DAR A;  2B7V A;  1YYO A;  1HNX E;  4JI1 E;  1XNQ E;  4IZJ B;  4JI7 E;  4BC7 A;  2UU9 I;  3PYF A;  2N3H A;  3KWR A;  3OTO E;  4DUZ E;  4HAC A;  3J80 Q;  4LF4 I;  2JY9 A;  3J81 Q;  2IOQ A;  4DR3 E;  2JR1 A;  1YYK A;  4DPY A;  1KVK A;  4FWG A;  4BBY A;  4DKK A;  2F8B A;  3T1H I;  2JVA A;  2V8P A;  4GEQ B;  3VYY A;  2CG9 A;  1Z0C A;  1IBK I;  4GKK I;  4BC9 A;  2VQE I;  2FGG A;  2L92 A;  2J7K A;  2UXD I;  3JAM Q;  1ZM9 A;  2CZ9 A;  2V83 A;  4X62 I;  1EKZ A;  2UXC E;  4M0V A;  4DV7 E;  1N34 E;  1MX0 A;  3HJC A;  1N0V C;  2VQF I;  4FWD A;  1Z0G A;  2Z5B A;  4LF9 E;  4JV5 I;  2L8T A;  1EA6 A;  3ZKB A;  1X47 A;  4UT4 A;  4DR5 I;  3CWV A;  4NXN E;  4DV3 E;  5AE2 A;  4USK A;  4JI0 I;  4JI6 E;  3JU0 A;  2ODR D;  2ODR C;  4K0K E;  4DV5 E;  1ZXN A;  4WUD A;  4DR6 I;  1KIJ A;  2Z5C B;  1RRE A;  4RPF A;  1S16 A;  4LF5 I;  3ZM7 A;  4TUG A;  2XEX A;  2LJH A;  4N3O A;  1NHI A;  2JOX A;  2LUP B;  1PIE A;  5IT9 Q;  4F9C B;  2V8Q B;  1Y6Z A;  2DSY A;  2L3J A;  3AUZ A;  4JI4 I;  4USM A;  3LTO A;  3FIG A;  4LF7 I;  2V34 A;  1S4E A;  3Q6M A;  3ZKD A;  2A2D A;  4DPU A;  2M4I A;  1GZ6 A;  2L2K B;  1Z0E A;  2V87 A;  2H36 X;  3IWC A;  4DR1 E;  5A2Q Q;  1ELO A;  3HQ1 A;  2FTX B;  1OJ4 A;  1H72 C;  3K1J A;  1WXR A;  3WU3 A;  4BMJ A;  1ZXM A;  1H7U A;  2RTX A;  5LMU I;  4DUY I;  1ZM3 A;  2HHH I;  4HAC B;  1RQ0 A;  3K85 A;  4NXM I;  1EI1 A;  1IBM I;  1XNR I;  4DR4 I;  4DV6 I;  1WUU A;  4TUI A;  2DEJ A;  3HTX A;  4M1K A;  2WW4 A;  2ZM6 E;  2ZIT A;  3AV0 A;  4JI3 I;  4X66 I;  1UEK A;  1FNM A;  3QT6 A;  4B3S E;  5IWA E;  3DJW A;  3T1Y E;  5FLX Q;  4JI8 I;  2V2Z A;  1FWK A;  2E5L I;  2GQ0 A;  3WU4 A;  4YHH I;  4GKJ E;  3F6G A;  1Z59 A;  2KHX A;  1FJG E;  3QT5 A;  4DV4 E;  2Z5B B;  2L2N A;  1XMO E;  2KOU A;  4AQY E;  4LTY A;  4DR2 I;  2L3C A;  2V2V A;  1DI2 A;  4YY3 E;  3QT7 A;  4LFC E;  4P52 A;  4OX9 I;  4PU9 A;  4DV1 I;  2MC5 A;  4R8O A;  2R42 A;  2WZO A;  1BKN A;  4B3R E;  1J5E E;  4FN5 A;  1ZBT A;  2LE2 A;  1IBL I;  1XHK A;  1Z0V A;  2O1T A;  2BM1 A;  1MU5 A;  1N36 I;  1RR9 A;  4JYA E;  1NHH A;  3C4B A;  4B3T E;  4X65 I;  2L33 A;  3PRY A;  3F6H A;  1I94 I;  1Z0T A;  4LFB I;  1QU6 A;  1HNZ I;  2R3V A;  2NUF A;  4JI2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...