4AQYI

Structure of ribosome-apramycin complexes
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4aqyI00
2ZITA 2ZBKB 4NXMI 4DV5I 4GKKI 4LF6E 1Z0BA 4DV1E 2DEJA 1K47A 4LF4E 1H73A 1N0UA 4HXZA 4LF9E 5IT9C 2UXBE 4DUYE 4ZVIA 4X62I 1D6TA 4LFBE 4DV4I 2VQFI 4JI7E 3ZZUA 1NZ0A 1ZXNA 1FKAE 4RPFA 2HFSA 1N34E 1N33E 2HK2A 4HYMA 4LF8I 2EFGA 4PU9A 3V5RA 3QT7A 4YY3E 4DR1I 4DR4I 4DR6I 3ZZTA 2BV3A 4JI1E 4DR2I 4DR7E 4DUZE 3ZKDA 2X36A 2UUBE 1XHKA 5BR8E 4B3RE 4JV5E 1QZRA 2V2VA 4DPUA 1Z0GA 3OTOE 5A2QC 4DV6I 4P7AA 2A2CA 2UUAI 5IWAE 1HNXI 4USMA 3F0NA 4AQYI 2UUCE 1NHHA 1PVGA 1MX0A 4HY1A 3PYDA 2LJPA 1N36I 1J5EI 3HULA 3PYEA 1Z0EA 3T1YE 1FWKA 2OI2A 1IBKE 4X66I 2R42A 4JI6I 2UXCE 3PYGA 4KHPI 3PYFA 4B3TI 4NXNI 4JI3E 1KVKA 3JAMC 1N32I 2V2ZA 3GONA 3WU6A 4B3MI 2UXDE 5IT9Q 4FW9A 4LF5I 4X64I 1IBLE 4LFAE 3ZZ0A 4JYAI 4HACA 4DV2E 1RREA 4DR5E 1U2RA 1XMOI 2F4VI 1I94I 4EMDA 4OX9I 4NXME 4DV5E 1PKPA 4DV0I 3K17A 2E5LE 2R3VA 3B8HA 3J81C 1N0VC 3CWVA 4XTJA 1HNZI 2V34A 4X62E 4LFCI 4DV4E 4FWHA 2VQFE 4P52A 3D4JA 4GKJI 1FWLA 1ZXMA 4LF8E 2UU9I 4K0KI 1KIJA 2VF3A 5A2QQ 1EA6A 2Q2EB 4DU7A 4DR1E 4DR4E 4JI5I 4DR6E 4DR2E 4DV7I 1KTVA 4JI8I 3QT6A 2HHHI 4DV6E 4LF7I 2UUAE 4KQVA 3JAMQ 1HNXE 1HR0I 3LNUA 4AQYE 5LL6R 2X7IA 3WU3A 1XNQI 1N36E 1HNWI 1J5EE 1Z5BA 1IBMI 3J80Q 4FWGA 3ZM7A 4DPXA 2XEXA 2AJ4A 4X66E 4B3SI 4JI6E 4KHPE 2J7KA 4B3TE 4NXNE 4X65I 1WUUA 1S16A 4YHHI 5LMNI 5GMDA 1N32E 3J7AG 4DPWA 4B3ME 3J81Q 1BKNA 2BM1A 1Z0TA 5LMUI 4LF5E 4X64E 4M1KA 4JYAE 3ZKBA 1H7UA 4R1FA 1FNMA 1XMQI 1XMOE 2F4VE 4JI0I 1I94E 1B63A 3J80C 4OX9E 4DV0E 1XNRI 4URLA 2HKJA 3V2UC 4DU8A 3T1HI 2V2QA 1FJGI 4USKA 4WUDA 4DR3I 1OJ4A 4DXLA 4GKKE 1H7SA 2ZM6I 1H74A 1Z5AA 1HNZE 4JI2I 2BM0A 1MU5A 4LFCE 2VQEI 4DV3I 3LPSA 4JI4I 4GKJE 4DPYA 3LTOA 2UU9E 4K0KE 1S4EA 1Z59A 1Z5CA 2E5LI 4MYTA 1PIEA 4LF6I 4DV1I 3B82A 5FLXQ 4LF4I 1EI1A 4JI5E 4LF9I 1A6FA 2CZ9A 4PRXA 4DV7E 2UXBI 4DUYI 4JI8E 1RR9A 2HHHE 4LFBI 3K1JA 2HK3A 3Q1QA 2V8PA 4JI7I 4UTGA 3J7AM 4PRVA 1UEKA 4LF7E 2DEIA 1HR0E 1N34I 1N33I 4FN5A 1XNQE 1HNWE 2E1RA 1IBME 4ED4A 1Z0CA 5FLXC 1FI4A 5L3JA 4B3SE 4YY3I 4MYUA 4X65E 2NPFA 2A2DA 4UT4A 1KKHA 1Z0VA 4YHHE 4JI1I 5LMNE 4DR7I 1H72C 2HKEA 4DUZI 3QT5A 2UUBI 5LMUE 5BR8I 4B3RI 4JV5I 4DPTA 1Z0WA 5GMEA 4I3HA 4WUCA 3OTOI 3B78A 3M6AA 1XMQE 4JI0E 4FWDA 5IWAI 4Z7CA 1XNRE 2WW4A 4WUBA 2UUCI 1ZM3A 3T1HE 1NHJA 1DARA 1FJGE 4DR3E 1ELOA 3T1YI 4JG4A 2ZM6E 1IBKI 1VISA 2UXCI 1ZM9A 4JI2E 3QT8A 2HFUA 2VQEE 3H4LA 4DV3E 3WU4A 4JI3I 1MG7A 4HACB 4JI4E 3WU5A 2UXDI 2GS8A 1IBLI 4Z7YA 4LFAI 1NHIA 1B62A 4DV2I 1ZM4A 1ZM2A 4DR5I
chains in the Genus database with same CATH superfamily
2PNLA 3DD6A 2ZITA 2GO4A 2PO1B 2NN6E 2ZBKB 4NXMI 4DV5I 2C38A 4OO1A 4GKKI 4LF6E 1Z0BA 2Z5EA 4DV1E 2DEJA 1K47A 3P3CA 4LF4E 4BA2A 1H73A 1N0UA 4MU0A 4HXZA 4LF9E 5IT9C 1P42A 2UXBE 4DUYE 4ZVIA 2CG9A 3L7ZB 3PS2A 4X62I 1D6TA 4LFBE 2WP8A 4DV4I 2VQFI 4JI7E 3ZZUA 1NZ0A 1ZXNA 2PO0A 1FKAE 2C37A 4RPFA 2HFSA 1N34E 1N33E 2HK2A 4HYMA 5FWKA 4LF8I 2BA1D 2EFGA 4BA1B 4PU9A 3V5RA 3GMEA 5DRPA 3QT7A 2NN6D 2GQ0A 4YY3E 4FW6A 4DR1I 2NN6B 4DR4I 4DR6I 2CGEA 3ZZTA 2BV3A 4JI1E 4DR2I 4DR7E 4DUZE 3ZKDA 2X36A 2PO2A 3P3EA 2UUBE 1XHKA 5BR8E 4B3RE 4JV5E 5C0XE 1QZRA 2V2VA 4DPUA 1Z0GA 3OTOE 3U1YA 5A2QC 4DV6I 4P7AA 2A2CA 2GO3A 4MU1A 2UUAI 5IWAE 1HNXI 4USMA 3F0NA 4AQYI 2UUCE 4IZKB 1NHHA 1PVGA 1MX0A 4HY1A 4U3BA 3PYDA 2LJPA 1N36I 1J5EI 5C0XC 3HULA 3PYEA 1Z0EA 2BA0D 3T1YE 1FWKA 2JEAA 4AM3A 2OI2A 5DRQA 1IBKE 4X66I 4IZJA 2R42A 1Y4UA 4JI6I 2UXCE 5C0XF 3PYGA 4KHPI 3PYFA 4QNJA 4NXNI 2O3ZA 4B3TI 5EKWA 4JI3E 1KVKA 3GLLA 3JAMC 3B4TA 1N32I 2CVEA 2V2ZA 3NZKA 3GONA 4NBQA 4ISAA 3WU6A 4B3MI 2UXDE 5IT9Q 2IERA 5K36E 4IS9A 4FW9A 4LF5I 4X64I 4GQUA 1IBLE 4LFAE 3ZZ0A 5DNLA 4JYAI 4HACA 4DV2E 1RREA 4DR5E 1U2RA 1XMOI 2F4VI 1I94I 2JT2A 2PNMA 4EMDA 5C0XB 4OX9I 4J3DA 4NXME 4DV5E 1PKPA 4DV0I 4LOMA 3K17A 2E5LE 2R3VA 1Y60A 3B8HA 3J81C 2PO1A 1N0VC 2JEBB 3CWVA 5ELWA 4XTJA 1HNZI 2V34A 4X62E 4LFCI 4DV4E 3M7ND 4FWHA 2VQFE 2WNRB 4P52A 3D4JA 2NN6C 5DROA 4GKJI 2IESA 2C39B 3M85G 3L7ZA 1FWLA 1ZXMA 3Q6NA 2JE6B 4LF8E 2UU9I 3Q6MA 5K36D 2NN6F 4OKGA 2JE6A 4K0KI 1KIJA 1R6LA 5K36B 2VF3A 3CDJA 5A2QQ 2IOPA 1EA6A 4BA1A 2Z5BB 2Q2EB 4FW5A 4DU7A 4DR1E 5JEAD 4DR4E 4JI5I 4DR6E 4DR2E 5JEAB 4DV7I 1KTVA 3KRNA 4JI8I 2O1UA 1YHCA 3QT6A 2NN6A 2HHHI 2PNZB 4DV6E 4LF7I 1Y4SA 2UUAE 4KQVA 3JAMQ 1HNXE 1HR0I 3LNUA 4LCGA 4AQYE 5LL6R 2X7IA 3WU3A 1XNQI 1N36E 1HNWI 1J5EE 1Z5BA 1IBMI 2BR2B 3J80Q 4FWGA 3ZM7A 4DPXA 2XEXA 2AJ4A 4IZKA 4X66E 4B3SI 4JI6E 4KHPE 2J7KA 4B3TE 4NXNE 4X65I 1WUUA 3HJCA 1S16A 4YHHI 4IFDD 5LMNI 2J65A 5GMDA 1N32E 3J7AG 4DPWA 4B3ME 3J81Q 4IFDB 1BKNA 2BM1A 1Z0TA 5LMUI 4LF5E 5DRRA 1YH8A 4X64E 4M1KA 3M7NG 4JYAE 3ZKBA 3PRYA 1H7UA 4R1FA 1FNMA 1XMQI 1RHYA 2O1WA 1XMOE 1E3PA 2F4VE 4JI0I 1I94E 1B63A 3J80C 4OX9E 1Y5YA 4DV0E 2Z5CB 1XNRI 4URLA 2HKJA 3V2UC 4DU8A 3T1HI 2V2QA 3P76A 1FJGI 4USKA 4MU4A 4WUDA 4DR3I 1OJ4A 4DXLA 4GKKE 1H7SA 5C0XA 2BA1G 5JEAE 5K36C 2AE8A 2ZM6I 1H74A 1Z5AA 1HNZE 4JI2I 2BM0A 1MU5A 4LFCE 2VQEI 4DV3I 5K36F 4FW7A 3LPSA 2JEBA 4JI4I 3P06A 4AIDA 4GKJE 4DPYA 4OO1D 5JEAC 4LCHA 1UDSA 3LTOA 4MU3A 2C38B 2UU9E 4OO1B 2WNRA 4AIMA 4K0KE 1S4EA 3U1KA 1Z59A 2C39A 4BA2B 1Z5CA 2O1TA 5JEAF 2E5LI 4MYTA 1PIEA 3PS3A 4LF6I 1OYPA 4DV1I 3B82A 4LPFA 5FLXQ 4LF4I 5K36A 1EI1A 4JI5E 2WP8B 4LF9I 1A6FA 2CZ9A 5EL9A 4PRXA 1HK7A 4DV7E 4IFDE 2UXBI 2PO0B 2BA0G 4JI8E 4DUYI 2Z5BA 2C37B 3GCMA 1RR9A 2HHHE 4LFBI 3K1JA 2HK3A 3Q1QA 2V8PA 1OYSA 4JI7I 4UTGA 3J7AM 5JEAA 4PRVA 1UEKA 4LF7E 5DNXA 1Y6ZA 2O1VA 2DEIA 3UHMA 1HR0E 1N34I 1N33I 4IFDC 4FN5A 4FW4A 4OZEA 2VESA 1XNQE 1HNWE 2E1RA 2PNZA 1IBME 4ED4A 1VI7A 1Z0CA 5FLXC 1OYRA 4FW3A 1FI4A 5L3JA 4IFDF 4B3SE 1E3HA 2PO2B 2BR2A 4YY3I 4MYUA 3HKMA 2NPFA 4X65E 2A2DA 4UT4A 3M85D 1KKHA 1Z0VA 4YHHE 4JI1I 5LMNE 4DR7I 1H72C 1UDQA 2HKEA 2IOQA 4DUZI 3QT5A 3H1CA 2UUBI 4OO1E 5LMUE 5BR8I 4B3RI 4JV5I 4DPTA 1Z0WA 5GMEA 4I3HA 4WUCA 2F1DA 3OTOI 3B78A 3M6AA 1XMQE 1USUA 4IFDA 4JI0E 4IZJD 4FWDA 2JEAB 5IWAI 4Z7CA 4LCFA 1XNRE 2WW4A 4WUBA 2UUCI 4IZJB 1ZM3A 3CDIA 3T1HE 4OO1C 1NHJA 1DARA 1FJGE 4DR3E 1ELOA 3T1YI 4JG4A 2Z5CA 4QNKA 2ZM6E 1IBKI 4MDTA 4OO1F 1VISA 2UXCI 1ZM9A 4JI2E 3K85A 3QT8A 2HFUA 3PS1A 1UDNA 2VQEE 3H4LA 4DV3E 3WU4A 4JI3I 1MG7A 4HACB 4JI4E 3WU5A 1UDOA 2UXDI 4N3OA 2GS8A 1R6MA 5C0XD 1USVA 3P3GA 1IBLI 4Z7YA 4LFAI 1XXEA 1NHIA 4U3DA 1B62A 4MQYA 4DV2I 1ZM4A 1ZM2A 4DR5I
chains in the Genus database with same CATH topology
2PNLA 2ZITA 2ZBKB 4NXMI 4DV5I 4GKKI 4LF6E 1Z0BA 2Z5EA 4DV1E 2DEJA 1K47A 4LF4E 1H73A 1N0UA 4HXZA 4LF9E 5IT9C 2UXBE 4DUYE 4ZVIA 2CG9A 4X62I 1D6TA 4LFBE 4DV4I 2VQFI 4JI7E 3ZZUA 1NZ0A 1ZXNA 1FKAE 4RPFA 2HFSA 1N34E 1N33E 2HK2A 4HYMA 5FWKA 4LF8I 2EFGA 4PU9A 3V5RA 3QT7A 2GQ0A 4YY3E 4DR1I 4DR4I 4DR6I 2CGEA 3ZZTA 2BV3A 4JI1E 4DR2I 4DR7E 4DUZE 3ZKDA 2X36A 2UUBE 1XHKA 5BR8E 4B3RE 4JV5E 1QZRA 2V2VA 4DPUA 1Z0GA 3OTOE 5A2QC 4DV6I 4P7AA 2A2CA 2UUAI 5IWAE 1HNXI 4USMA 3F0NA 4AQYI 2UUCE 1NHHA 4IZKB 1PVGA 1MX0A 4HY1A 3PYDA 2LJPA 1N36I 1J5EI 3HULA 3PYEA 1Z0EA 3T1YE 1FWKA 2OI2A 1IBKE 4X66I 4IZJA 2R42A 1Y4UA 4JI6I 2UXCE 3PYGA 4KHPI 3PYFA 4NXNI 4B3TI 4JI3E 1KVKA 3JAMC 1N32I 2V2ZA 3GONA 3WU6A 4B3MI 2UXDE 5IT9Q 4FW9A 4LF5I 4X64I 1IBLE 4LFAE 3ZZ0A 4JYAI 4HACA 4DV2E 1RREA 4DR5E 1U2RA 1XMOI 2F4VI 1I94I 2PNMA 4EMDA 4OX9I 4NXME 4DV5E 1PKPA 4DV0I 3K17A 2E5LE 2R3VA 3B8HA 3J81C 1N0VC 3CWVA 4XTJA 1HNZI 2V34A 4X62E 4LFCI 4DV4E 4FWHA 2VQFE 4P52A 3D4JA 4GKJI 1FWLA 1ZXMA 3Q6NA 4LF8E 2UU9I 3Q6MA 4K0KI 1KIJA 2VF3A 5A2QQ 2IOPA 1EA6A 2Z5BB 2Q2EB 4DU7A 4DR1E 4DR4E 4JI5I 4DR6E 4DR2E 4DV7I 1KTVA 4JI8I 2O1UA 3QT6A 2HHHI 4DV6E 4LF7I 1Y4SA 2UUAE 4KQVA 3JAMQ 1HNXE 1HR0I 3LNUA 4AQYE 5LL6R 2X7IA 3WU3A 1XNQI 1N36E 1HNWI 1J5EE 1Z5BA 1IBMI 3J80Q 4FWGA 3ZM7A 4DPXA 2XEXA 2AJ4A 4IZKA 4X66E 4B3SI 4JI6E 4KHPE 2J7KA 4B3TE 4NXNE 4X65I 1WUUA 3HJCA 1S16A 4YHHI 5LMNI 5GMDA 1N32E 3J7AG 4DPWA 4B3ME 3J81Q 1BKNA 2BM1A 1Z0TA 5LMUI 4LF5E 4X64E 4M1KA 4JYAE 3ZKBA 3PRYA 1H7UA 4R1FA 1FNMA 1XMQI 2O1WA 1XMOE 2F4VE 4JI0I 1I94E 1B63A 3J80C 4OX9E 4DV0E 2Z5CB 1XNRI 4URLA 2HKJA 3V2UC 4DU8A 3T1HI 2V2QA 1FJGI 4USKA 4WUDA 4DR3I 1OJ4A 4DXLA 4GKKE 1H7SA 2ZM6I 1H74A 1Z5AA 1HNZE 4JI2I 2BM0A 1MU5A 4LFCE 2VQEI 4DV3I 3LPSA 4JI4I 3P06A 4GKJE 4DPYA 3LTOA 2UU9E 4K0KE 1S4EA 1Z59A 1Z5CA 2O1TA 2E5LI 4MYTA 1PIEA 4LF6I 4DV1I 3B82A 5FLXQ 4LF4I 1EI1A 4JI5E 4LF9I 1A6FA 2CZ9A 4PRXA 4DV7E 1HK7A 2UXBI 4DUYI 4JI8E 2Z5BA 1RR9A 2HHHE 4LFBI 3K1JA 2HK3A 3Q1QA 2V8PA 4JI7I 4UTGA 3J7AM 4PRVA 1UEKA 4LF7E 1Y6ZA 2O1VA 2DEIA 1HR0E 1N34I 1N33I 4FN5A 1XNQE 1HNWE 2E1RA 1IBME 4ED4A 1Z0CA 5FLXC 1FI4A 5L3JA 4B3SE 4YY3I 4MYUA 4X65E 2NPFA 2A2DA 4UT4A 1KKHA 1Z0VA 4YHHE 4JI1I 5LMNE 4DR7I 1H72C 2HKEA 2IOQA 4DUZI 3QT5A 2UUBI 5LMUE 5BR8I 4B3RI 4JV5I 4DPTA 1Z0WA 5GMEA 4I3HA 4WUCA 3OTOI 3B78A 3M6AA 1XMQE 1USUA 4JI0E 4IZJD 4FWDA 5IWAI 4Z7CA 1XNRE 2WW4A 4WUBA 2UUCI 4IZJB 1ZM3A 3T1HE 1NHJA 1DARA 1FJGE 4DR3E 1ELOA 3T1YI 4JG4A 2Z5CA 2ZM6E 1IBKI 1VISA 2UXCI 1ZM9A 4JI2E 3K85A 3QT8A 2HFUA 2VQEE 3H4LA 4DV3E 3WU4A 4JI3I 1MG7A 4HACB 4JI4E 3WU5A 2UXDI 4N3OA 2GS8A 1USVA 1IBLI 4Z7YA 4LFAI 1NHIA 1B62A 4DV2I 1ZM4A 1ZM2A 4DR5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  2ZBK B;  4NXM I;  4DV5 I;  4GKK I;  4LF6 E;  1Z0B A;  4DV1 E;  2DEJ A;  1K47 A;  4LF4 E;  1H73 A;  1N0U A;  4HXZ A;  4LF9 E;  5IT9 C;  2UXB E;  4DUY E;  4ZVI A;  4X62 I;  1D6T A;  4LFB E;  4DV4 I;  2VQF I;  4JI7 E;  3ZZU A;  1NZ0 A;  1ZXN A;  1FKA E;  4RPF A;  2HFS A;  1N34 E;  1N33 E;  2HK2 A;  4HYM A;  4LF8 I;  2EFG A;  4PU9 A;  3V5R A;  3QT7 A;  4YY3 E;  4DR1 I;  4DR4 I;  4DR6 I;  3ZZT A;  2BV3 A;  4JI1 E;  4DR2 I;  4DR7 E;  4DUZ E;  3ZKD A;  2X36 A;  2UUB E;  1XHK A;  5BR8 E;  4B3R E;  4JV5 E;  1QZR A;  2V2V A;  4DPU A;  1Z0G A;  3OTO E;  5A2Q C;  4DV6 I;  4P7A A;  2A2C A;  2UUA I;  5IWA E;  1HNX I;  4USM A;  3F0N A;  4AQY I;  2UUC E;  1NHH A;  1PVG A;  1MX0 A;  4HY1 A;  3PYD A;  2LJP A;  1N36 I;  1J5E I;  3HUL A;  3PYE A;  1Z0E A;  3T1Y E;  1FWK A;  2OI2 A;  1IBK E;  4X66 I;  2R42 A;  4JI6 I;  2UXC E;  3PYG A;  4KHP I;  3PYF A;  4B3T I;  4NXN I;  4JI3 E;  1KVK A;  3JAM C;  1N32 I;  2V2Z A;  3GON A;  3WU6 A;  4B3M I;  2UXD E;  5IT9 Q;  4FW9 A;  4LF5 I;  4X64 I;  1IBL E;  4LFA E;  3ZZ0 A;  4JYA I;  4HAC A;  4DV2 E;  1RRE A;  4DR5 E;  1U2R A;  1XMO I;  2F4V I;  1I94 I;  4EMD A;  4OX9 I;  4NXM E;  4DV5 E;  1PKP A;  4DV0 I;  3K17 A;  2E5L E;  2R3V A;  3B8H A;  3J81 C;  1N0V C;  3CWV A;  4XTJ A;  1HNZ I;  2V34 A;  4X62 E;  4LFC I;  4DV4 E;  4FWH A;  2VQF E;  4P52 A;  3D4J A;  4GKJ I;  1FWL A;  1ZXM A;  4LF8 E;  2UU9 I;  4K0K I;  1KIJ A;  2VF3 A;  5A2Q Q;  1EA6 A;  2Q2E B;  4DU7 A;  4DR1 E;  4DR4 E;  4JI5 I;  4DR6 E;  4DR2 E;  4DV7 I;  1KTV A;  4JI8 I;  3QT6 A;  2HHH I;  4DV6 E;  4LF7 I;  2UUA E;  4KQV A;  3JAM Q;  1HNX E;  1HR0 I;  3LNU A;  4AQY E;  5LL6 R;  2X7I A;  3WU3 A;  1XNQ I;  1N36 E;  1HNW I;  1J5E E;  1Z5B A;  1IBM I;  3J80 Q;  4FWG A;  3ZM7 A;  4DPX A;  2XEX A;  2AJ4 A;  4X66 E;  4B3S I;  4JI6 E;  4KHP E;  2J7K A;  4B3T E;  4NXN E;  4X65 I;  1WUU A;  1S16 A;  4YHH I;  5LMN I;  5GMD A;  1N32 E;  3J7A G;  4DPW A;  4B3M E;  3J81 Q;  1BKN A;  2BM1 A;  1Z0T A;  5LMU I;  4LF5 E;  4X64 E;  4M1K A;  4JYA E;  3ZKB A;  1H7U A;  4R1F A;  1FNM A;  1XMQ I;  1XMO E;  2F4V E;  4JI0 I;  1I94 E;  1B63 A;  3J80 C;  4OX9 E;  4DV0 E;  1XNR I;  4URL A;  2HKJ A;  3V2U C;  4DU8 A;  3T1H I;  2V2Q A;  1FJG I;  4USK A;  4WUD A;  4DR3 I;  1OJ4 A;  4DXL A;  4GKK E;  1H7S A;  2ZM6 I;  1H74 A;  1Z5A A;  1HNZ E;  4JI2 I;  2BM0 A;  1MU5 A;  4LFC E;  2VQE I;  4DV3 I;  3LPS A;  4JI4 I;  4GKJ E;  4DPY A;  3LTO A;  2UU9 E;  4K0K E;  1S4E A;  1Z59 A;  1Z5C A;  2E5L I;  4MYT A;  1PIE A;  4LF6 I;  4DV1 I;  3B82 A;  5FLX Q;  4LF4 I;  1EI1 A;  4JI5 E;  4LF9 I;  1A6F A;  2CZ9 A;  4PRX A;  4DV7 E;  2UXB I;  4DUY I;  4JI8 E;  1RR9 A;  2HHH E;  4LFB I;  3K1J A;  2HK3 A;  3Q1Q A;  2V8P A;  4JI7 I;  4UTG A;  3J7A M;  4PRV A;  1UEK A;  4LF7 E;  2DEI A;  1HR0 E;  1N34 I;  1N33 I;  4FN5 A;  1XNQ E;  1HNW E;  2E1R A;  1IBM E;  4ED4 A;  1Z0C A;  5FLX C;  1FI4 A;  5L3J A;  4B3S E;  4YY3 I;  4MYU A;  4X65 E;  2NPF A;  2A2D A;  4UT4 A;  1KKH A;  1Z0V A;  4YHH E;  4JI1 I;  5LMN E;  4DR7 I;  1H72 C;  2HKE A;  4DUZ I;  3QT5 A;  2UUB I;  5LMU E;  5BR8 I;  4B3R I;  4JV5 I;  4DPT A;  1Z0W A;  5GME A;  4I3H A;  4WUC A;  3OTO I;  3B78 A;  3M6A A;  1XMQ E;  4JI0 E;  4FWD A;  5IWA I;  4Z7C A;  1XNR E;  2WW4 A;  4WUB A;  2UUC I;  1ZM3 A;  3T1H E;  1NHJ A;  1DAR A;  1FJG E;  4DR3 E;  1ELO A;  3T1Y I;  4JG4 A;  2ZM6 E;  1IBK I;  1VIS A;  2UXC I;  1ZM9 A;  4JI2 E;  3QT8 A;  2HFU A;  2VQE E;  3H4L A;  4DV3 E;  3WU4 A;  4JI3 I;  1MG7 A;  4HAC B;  4JI4 E;  3WU5 A;  2UXD I;  2GS8 A;  1IBL I;  4Z7Y A;  4LFA I;  1NHI A;  1B62 A;  4DV2 I;  1ZM4 A;  1ZM2 A;  4DR5 I; 
#chains in the Genus database with same CATH topology
 2PNL A;  3DD6 A;  2ZIT A;  2GO4 A;  2PO1 B;  2NN6 E;  2ZBK B;  4NXM I;  4DV5 I;  2C38 A;  4OO1 A;  4GKK I;  4LF6 E;  1Z0B A;  2Z5E A;  4DV1 E;  2DEJ A;  1K47 A;  3P3C A;  4LF4 E;  4BA2 A;  1H73 A;  1N0U A;  4MU0 A;  4HXZ A;  4LF9 E;  5IT9 C;  1P42 A;  2UXB E;  4DUY E;  4ZVI A;  2CG9 A;  3L7Z B;  3PS2 A;  4X62 I;  1D6T A;  4LFB E;  2WP8 A;  4DV4 I;  2VQF I;  4JI7 E;  3ZZU A;  1NZ0 A;  1ZXN A;  2PO0 A;  1FKA E;  2C37 A;  4RPF A;  2HFS A;  1N34 E;  1N33 E;  2HK2 A;  4HYM A;  5FWK A;  4LF8 I;  2BA1 D;  2EFG A;  4BA1 B;  4PU9 A;  3V5R A;  3GME A;  5DRP A;  3QT7 A;  2NN6 D;  2GQ0 A;  4YY3 E;  4FW6 A;  4DR1 I;  2NN6 B;  4DR4 I;  4DR6 I;  2CGE A;  3ZZT A;  2BV3 A;  4JI1 E;  4DR2 I;  4DR7 E;  4DUZ E;  3ZKD A;  2X36 A;  2PO2 A;  3P3E A;  2UUB E;  1XHK A;  5BR8 E;  4B3R E;  4JV5 E;  5C0X E;  1QZR A;  2V2V A;  4DPU A;  1Z0G A;  3OTO E;  3U1Y A;  5A2Q C;  4DV6 I;  4P7A A;  2A2C A;  2GO3 A;  4MU1 A;  2UUA I;  5IWA E;  1HNX I;  4USM A;  3F0N A;  4AQY I;  2UUC E;  4IZK B;  1NHH A;  1PVG A;  1MX0 A;  4HY1 A;  4U3B A;  3PYD A;  2LJP A;  1N36 I;  1J5E I;  5C0X C;  3HUL A;  3PYE A;  1Z0E A;  2BA0 D;  3T1Y E;  1FWK A;  2JEA A;  4AM3 A;  2OI2 A;  5DRQ A;  1IBK E;  4X66 I;  4IZJ A;  2R42 A;  1Y4U A;  4JI6 I;  2UXC E;  5C0X F;  3PYG A;  4KHP I;  3PYF A;  4QNJ A;  4NXN I;  2O3Z A;  4B3T I;  5EKW A;  4JI3 E;  1KVK A;  3GLL A;  3JAM C;  3B4T A;  1N32 I;  2CVE A;  2V2Z A;  3NZK A;  3GON A;  4NBQ A;  4ISA A;  3WU6 A;  4B3M I;  2UXD E;  5IT9 Q;  2IER A;  5K36 E;  4IS9 A;  4FW9 A;  4LF5 I;  4X64 I;  4GQU A;  1IBL E;  4LFA E;  3ZZ0 A;  5DNL A;  4JYA I;  4HAC A;  4DV2 E;  1RRE A;  4DR5 E;  1U2R A;  1XMO I;  2F4V I;  1I94 I;  2JT2 A;  2PNM A;  4EMD A;  5C0X B;  4OX9 I;  4J3D A;  4NXM E;  4DV5 E;  1PKP A;  4DV0 I;  4LOM A;  3K17 A;  2E5L E;  2R3V A;  1Y60 A;  3B8H A;  3J81 C;  2PO1 A;  1N0V C;  2JEB B;  3CWV A;  5ELW A;  4XTJ A;  1HNZ I;  2V34 A;  4X62 E;  4LFC I;  4DV4 E;  3M7N D;  4FWH A;  2VQF E;  2WNR B;  4P52 A;  3D4J A;  2NN6 C;  5DRO A;  4GKJ I;  2IES A;  2C39 B;  3M85 G;  3L7Z A;  1FWL A;  1ZXM A;  3Q6N A;  2JE6 B;  4LF8 E;  2UU9 I;  3Q6M A;  5K36 D;  2NN6 F;  4OKG A;  2JE6 A;  4K0K I;  1KIJ A;  1R6L A;  5K36 B;  2VF3 A;  3CDJ A;  5A2Q Q;  2IOP A;  1EA6 A;  4BA1 A;  2Z5B B;  2Q2E B;  4FW5 A;  4DU7 A;  4DR1 E;  5JEA D;  4DR4 E;  4JI5 I;  4DR6 E;  4DR2 E;  5JEA B;  4DV7 I;  1KTV A;  3KRN A;  4JI8 I;  2O1U A;  1YHC A;  3QT6 A;  2NN6 A;  2HHH I;  2PNZ B;  4DV6 E;  4LF7 I;  1Y4S A;  2UUA E;  4KQV A;  3JAM Q;  1HNX E;  1HR0 I;  3LNU A;  4LCG A;  4AQY E;  5LL6 R;  2X7I A;  3WU3 A;  1XNQ I;  1N36 E;  1HNW I;  1J5E E;  1Z5B A;  1IBM I;  2BR2 B;  3J80 Q;  4FWG A;  3ZM7 A;  4DPX A;  2XEX A;  2AJ4 A;  4IZK A;  4X66 E;  4B3S I;  4JI6 E;  4KHP E;  2J7K A;  4B3T E;  4NXN E;  4X65 I;  1WUU A;  3HJC A;  1S16 A;  4YHH I;  4IFD D;  5LMN I;  2J65 A;  5GMD A;  1N32 E;  3J7A G;  4DPW A;  4B3M E;  3J81 Q;  4IFD B;  1BKN A;  2BM1 A;  1Z0T A;  5LMU I;  4LF5 E;  5DRR A;  1YH8 A;  4X64 E;  4M1K A;  3M7N G;  4JYA E;  3ZKB A;  3PRY A;  1H7U A;  4R1F A;  1FNM A;  1XMQ I;  1RHY A;  2O1W A;  1XMO E;  1E3P A;  2F4V E;  4JI0 I;  1I94 E;  1B63 A;  3J80 C;  4OX9 E;  1Y5Y A;  4DV0 E;  2Z5C B;  1XNR I;  4URL A;  2HKJ A;  3V2U C;  4DU8 A;  3T1H I;  2V2Q A;  3P76 A;  1FJG I;  4USK A;  4MU4 A;  4WUD A;  4DR3 I;  1OJ4 A;  4DXL A;  4GKK E;  1H7S A;  5C0X A;  2BA1 G;  5JEA E;  5K36 C;  2AE8 A;  2ZM6 I;  1H74 A;  1Z5A A;  1HNZ E;  4JI2 I;  2BM0 A;  1MU5 A;  4LFC E;  2VQE I;  4DV3 I;  5K36 F;  4FW7 A;  3LPS A;  2JEB A;  4JI4 I;  3P06 A;  4AID A;  4GKJ E;  4DPY A;  4OO1 D;  5JEA C;  4LCH A;  1UDS A;  3LTO A;  4MU3 A;  2C38 B;  2UU9 E;  4OO1 B;  2WNR A;  4AIM A;  4K0K E;  1S4E A;  3U1K A;  1Z59 A;  2C39 A;  4BA2 B;  1Z5C A;  2O1T A;  5JEA F;  2E5L I;  4MYT A;  1PIE A;  3PS3 A;  4LF6 I;  1OYP A;  4DV1 I;  3B82 A;  4LPF A;  5FLX Q;  4LF4 I;  5K36 A;  1EI1 A;  4JI5 E;  2WP8 B;  4LF9 I;  1A6F A;  2CZ9 A;  5EL9 A;  4PRX A;  1HK7 A;  4DV7 E;  4IFD E;  2UXB I;  2PO0 B;  2BA0 G;  4JI8 E;  4DUY I;  2Z5B A;  2C37 B;  3GCM A;  1RR9 A;  2HHH E;  4LFB I;  3K1J A;  2HK3 A;  3Q1Q A;  2V8P A;  1OYS A;  4JI7 I;  4UTG A;  3J7A M;  5JEA A;  4PRV A;  1UEK A;  4LF7 E;  5DNX A;  1Y6Z A;  2O1V A;  2DEI A;  3UHM A;  1HR0 E;  1N34 I;  1N33 I;  4IFD C;  4FN5 A;  4FW4 A;  4OZE A;  2VES A;  1XNQ E;  1HNW E;  2E1R A;  2PNZ A;  1IBM E;  4ED4 A;  1VI7 A;  1Z0C A;  5FLX C;  1OYR A;  4FW3 A;  1FI4 A;  5L3J A;  4IFD F;  4B3S E;  1E3H A;  2PO2 B;  2BR2 A;  4YY3 I;  4MYU A;  3HKM A;  2NPF A;  4X65 E;  2A2D A;  4UT4 A;  3M85 D;  1KKH A;  1Z0V A;  4YHH E;  4JI1 I;  5LMN E;  4DR7 I;  1H72 C;  1UDQ A;  2HKE A;  2IOQ A;  4DUZ I;  3QT5 A;  3H1C A;  2UUB I;  4OO1 E;  5LMU E;  5BR8 I;  4B3R I;  4JV5 I;  4DPT A;  1Z0W A;  5GME A;  4I3H A;  4WUC A;  2F1D A;  3OTO I;  3B78 A;  3M6A A;  1XMQ E;  1USU A;  4IFD A;  4JI0 E;  4IZJ D;  4FWD A;  2JEA B;  5IWA I;  4Z7C A;  4LCF A;  1XNR E;  2WW4 A;  4WUB A;  2UUC I;  4IZJ B;  1ZM3 A;  3CDI A;  3T1H E;  4OO1 C;  1NHJ A;  1DAR A;  1FJG E;  4DR3 E;  1ELO A;  3T1Y I;  4JG4 A;  2Z5C A;  4QNK A;  2ZM6 E;  1IBK I;  4MDT A;  4OO1 F;  1VIS A;  2UXC I;  1ZM9 A;  4JI2 E;  3K85 A;  3QT8 A;  2HFU A;  3PS1 A;  1UDN A;  2VQE E;  3H4L A;  4DV3 E;  3WU4 A;  4JI3 I;  1MG7 A;  4HAC B;  4JI4 E;  3WU5 A;  1UDO A;  2UXD I;  4N3O A;  2GS8 A;  1R6M A;  5C0X D;  1USV A;  3P3G A;  1IBL I;  4Z7Y A;  4LFA I;  1XXE A;  1NHI A;  4U3D A;  1B62 A;  4MQY A;  4DV2 I;  1ZM4 A;  1ZM2 A;  4DR5 I; 
#chains in the Genus database with same CATH homology
 2PNL A;  2ZIT A;  2ZBK B;  4NXM I;  4DV5 I;  4GKK I;  4LF6 E;  1Z0B A;  2Z5E A;  4DV1 E;  2DEJ A;  1K47 A;  4LF4 E;  1H73 A;  1N0U A;  4HXZ A;  4LF9 E;  5IT9 C;  2UXB E;  4DUY E;  4ZVI A;  2CG9 A;  4X62 I;  1D6T A;  4LFB E;  4DV4 I;  2VQF I;  4JI7 E;  3ZZU A;  1NZ0 A;  1ZXN A;  1FKA E;  4RPF A;  2HFS A;  1N34 E;  1N33 E;  2HK2 A;  4HYM A;  5FWK A;  4LF8 I;  2EFG A;  4PU9 A;  3V5R A;  3QT7 A;  2GQ0 A;  4YY3 E;  4DR1 I;  4DR4 I;  4DR6 I;  2CGE A;  3ZZT A;  2BV3 A;  4JI1 E;  4DR2 I;  4DR7 E;  4DUZ E;  3ZKD A;  2X36 A;  2UUB E;  1XHK A;  5BR8 E;  4B3R E;  4JV5 E;  1QZR A;  2V2V A;  4DPU A;  1Z0G A;  3OTO E;  5A2Q C;  4DV6 I;  4P7A A;  2A2C A;  2UUA I;  5IWA E;  1HNX I;  4USM A;  3F0N A;  4AQY I;  2UUC E;  1NHH A;  4IZK B;  1PVG A;  1MX0 A;  4HY1 A;  3PYD A;  2LJP A;  1N36 I;  1J5E I;  3HUL A;  3PYE A;  1Z0E A;  3T1Y E;  1FWK A;  2OI2 A;  1IBK E;  4X66 I;  4IZJ A;  2R42 A;  1Y4U A;  4JI6 I;  2UXC E;  3PYG A;  4KHP I;  3PYF A;  4NXN I;  4B3T I;  4JI3 E;  1KVK A;  3JAM C;  1N32 I;  2V2Z A;  3GON A;  3WU6 A;  4B3M I;  2UXD E;  5IT9 Q;  4FW9 A;  4LF5 I;  4X64 I;  1IBL E;  4LFA E;  3ZZ0 A;  4JYA I;  4HAC A;  4DV2 E;  1RRE A;  4DR5 E;  1U2R A;  1XMO I;  2F4V I;  1I94 I;  2PNM A;  4EMD A;  4OX9 I;  4NXM E;  4DV5 E;  1PKP A;  4DV0 I;  3K17 A;  2E5L E;  2R3V A;  3B8H A;  3J81 C;  1N0V C;  3CWV A;  4XTJ A;  1HNZ I;  2V34 A;  4X62 E;  4LFC I;  4DV4 E;  4FWH A;  2VQF E;  4P52 A;  3D4J A;  4GKJ I;  1FWL A;  1ZXM A;  3Q6N A;  4LF8 E;  2UU9 I;  3Q6M A;  4K0K I;  1KIJ A;  2VF3 A;  5A2Q Q;  2IOP A;  1EA6 A;  2Z5B B;  2Q2E B;  4DU7 A;  4DR1 E;  4DR4 E;  4JI5 I;  4DR6 E;  4DR2 E;  4DV7 I;  1KTV A;  4JI8 I;  2O1U A;  3QT6 A;  2HHH I;  4DV6 E;  4LF7 I;  1Y4S A;  2UUA E;  4KQV A;  3JAM Q;  1HNX E;  1HR0 I;  3LNU A;  4AQY E;  5LL6 R;  2X7I A;  3WU3 A;  1XNQ I;  1N36 E;  1HNW I;  1J5E E;  1Z5B A;  1IBM I;  3J80 Q;  4FWG A;  3ZM7 A;  4DPX A;  2XEX A;  2AJ4 A;  4IZK A;  4X66 E;  4B3S I;  4JI6 E;  4KHP E;  2J7K A;  4B3T E;  4NXN E;  4X65 I;  1WUU A;  3HJC A;  1S16 A;  4YHH I;  5LMN I;  5GMD A;  1N32 E;  3J7A G;  4DPW A;  4B3M E;  3J81 Q;  1BKN A;  2BM1 A;  1Z0T A;  5LMU I;  4LF5 E;  4X64 E;  4M1K A;  4JYA E;  3ZKB A;  3PRY A;  1H7U A;  4R1F A;  1FNM A;  1XMQ I;  2O1W A;  1XMO E;  2F4V E;  4JI0 I;  1I94 E;  1B63 A;  3J80 C;  4OX9 E;  4DV0 E;  2Z5C B;  1XNR I;  4URL A;  2HKJ A;  3V2U C;  4DU8 A;  3T1H I;  2V2Q A;  1FJG I;  4USK A;  4WUD A;  4DR3 I;  1OJ4 A;  4DXL A;  4GKK E;  1H7S A;  2ZM6 I;  1H74 A;  1Z5A A;  1HNZ E;  4JI2 I;  2BM0 A;  1MU5 A;  4LFC E;  2VQE I;  4DV3 I;  3LPS A;  4JI4 I;  3P06 A;  4GKJ E;  4DPY A;  3LTO A;  2UU9 E;  4K0K E;  1S4E A;  1Z59 A;  1Z5C A;  2O1T A;  2E5L I;  4MYT A;  1PIE A;  4LF6 I;  4DV1 I;  3B82 A;  5FLX Q;  4LF4 I;  1EI1 A;  4JI5 E;  4LF9 I;  1A6F A;  2CZ9 A;  4PRX A;  4DV7 E;  1HK7 A;  2UXB I;  4DUY I;  4JI8 E;  2Z5B A;  1RR9 A;  2HHH E;  4LFB I;  3K1J A;  2HK3 A;  3Q1Q A;  2V8P A;  4JI7 I;  4UTG A;  3J7A M;  4PRV A;  1UEK A;  4LF7 E;  1Y6Z A;  2O1V A;  2DEI A;  1HR0 E;  1N34 I;  1N33 I;  4FN5 A;  1XNQ E;  1HNW E;  2E1R A;  1IBM E;  4ED4 A;  1Z0C A;  5FLX C;  1FI4 A;  5L3J A;  4B3S E;  4YY3 I;  4MYU A;  4X65 E;  2NPF A;  2A2D A;  4UT4 A;  1KKH A;  1Z0V A;  4YHH E;  4JI1 I;  5LMN E;  4DR7 I;  1H72 C;  2HKE A;  2IOQ A;  4DUZ I;  3QT5 A;  2UUB I;  5LMU E;  5BR8 I;  4B3R I;  4JV5 I;  4DPT A;  1Z0W A;  5GME A;  4I3H A;  4WUC A;  3OTO I;  3B78 A;  3M6A A;  1XMQ E;  1USU A;  4JI0 E;  4IZJ D;  4FWD A;  5IWA I;  4Z7C A;  1XNR E;  2WW4 A;  4WUB A;  2UUC I;  4IZJ B;  1ZM3 A;  3T1H E;  1NHJ A;  1DAR A;  1FJG E;  4DR3 E;  1ELO A;  3T1Y I;  4JG4 A;  2Z5C A;  2ZM6 E;  1IBK I;  1VIS A;  2UXC I;  1ZM9 A;  4JI2 E;  3K85 A;  3QT8 A;  2HFU A;  2VQE E;  3H4L A;  4DV3 E;  3WU4 A;  4JI3 I;  1MG7 A;  4HAC B;  4JI4 E;  3WU5 A;  2UXD I;  4N3O A;  2GS8 A;  1USV A;  1IBL I;  4Z7Y A;  4LFA I;  1NHI A;  1B62 A;  4DV2 I;  1ZM4 A;  1ZM2 A;  4DR5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...