4AQYI

Structure of ribosome-apramycin complexes
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4aqyI00
2HK3A 1UEKA 2V2QA 1N32I 1N36E 5LMUE 4WUBA 1I94I 4X64E 1HNZE 1H74A 1KVKA 4DV1I 2BM1A 2HFUA 4NXME 4LF7I 4OX9I 5LMNE 4HY1A 4DR3E 4DUZE 2HFSA 3WU4A 5L3JA 4LFAE 1NHIA 4DV5E 2R3VA 1Z0CA 2UUAE 3PYDA 4FN5A 3QT5A 5GMEA 1DARA 4B3SE 4X66E 4DV3I 1MX0A 4JI4I 2X7IA 4JI2E 1RR9A 3J80Q 1Z5BA 1WUUA 2UUCI 4LF5I 3V5RA 1N33E 1HNWE 1U2RA 4JG4A 2V2ZA 1KTVA 4NXNI 3ZZUA 4LF8I 4Z7CA 2HHHI 3QT8A 5IT9C 4AQYI 2ZBKB 2XEXA 4DV6E 4LF4I 1BKNA 1IBKI 2VF3A 4K0KI 1N36I 2HK2A 5LMUI 1ZM2A 4X64I 1HNZI 4DR4E 4FW9A 2VQFE 2UXCE 3LPSA 4NXMI 5A2QC 5LMNI 4M1KA 4DR3I 4B3ME 3GONA 4I3HA 4USMA 3T1HE 4DUYE 4JI8I 1N34E 3PYGA 4LFAI 4X62I 1PVGA 4DV5I 4DV7E 2UUAI 1KKHA 4B3TE 5FLXQ 4DR6I 4B3SI 1Z59A 2HKJA 4X66I 4JI2I 3J81C 4DU7A 3F0NA 2UXDE 1FWKA 4P52A 4FWDA 1XNQE 3Q1QA 1HNWI 1Z0EA 4DR1E 4PRXA 4DR5I 3ZKBA 1S16A 3B82A 3PYFA 4X65E 4DPXA 4KHPE 3CWVA 4ZVIA 1XMQE 4DV6I 1HR0E 2CZ9A 4DU8A 4LF9E 5IWAE 2E5LE 4DPWA 1Z0GA 4URLA 4DR4I 2VQFI 4FWHA 2Q2EB 2UU9E 2ZITA 2GS8A 2UXCI 1K47A 1J5EE 4B3MI 4DR2E 5GMDA 3T1HI 4DUYI 4JYAE 1N34I 1ZM4A 3B8HA 3ZKDA 4PU9A 4UT4A 4DV7I 1PKPA 4B3TI 4JV5E 4EMDA 4RPFA 4HYMA 2UXDI 4LF6E 4ED4A 1XNRI 1ZXNA 1MG7A 5BR8I 1N32E 1ELOA 1H7UA 1I94E 1XNQI 4JI3E 4DR1I 2A2DA 1Z0BA 2X36A 4PRVA 1EI1A 4X65I 4DV0E 4JI1E 4JI7E 3D4JA 4KHPI 1XMQI 3H4LA 3ZZTA 4DUZI 3J7AG 1ZM3A 1HR0I 2LJPA 4HACB 5IWAI 1D6TA 2E5LI 1IBLE 4JI4E 1NZ0A 4YHHE 4LFCE 3QT7A 2V8PA 2DEIA 1Z5CA 1A6FA 2UU9I 1FWLA 1VISA 1IBME 4USKA 1FJGE 3OTOE 1PIEA 4DR2I 3WU6A 2ZM6E 2HKEA 1FI4A 4DPTA 4P7AA 1N33I 1B63A 4B3RE 3WU3A 2BV3A 4JV5I 4DV2E 1QZRA 3JAMC 1XHKA 1XMOE 2DEJA 4JI5E 1S4EA 4JI6E 4LF6I 4WUDA 3V2UC 1IBKE 4K0KE 4YY3E 4FWGA 4JI3I 3ZZ0A 4GKKE 4DV4E 2AJ4A 4LFBE 1N0VC 4JI0E 2E1RA 2F4VE 2UUBE 2VQEE 2BM0A 1N0UA 1ZXMA 2UXBE 2V2VA 4DXLA 3T1YE 4JI1I 4DV0I 1H72C 4JI8E 4JI7I 4GKJE 1FNMA 4DPUA 4X62E 4MYTA 5IT9Q 2A2CA 4DR6E 1FKAE 1HNXE 1IBLI 1NHHA 4YHHI 3M6AA 4LFCI 3B78A 3K17A 4DR7E 4KQVA 1IBMI 2WW4A 3K1JA 1H7SA 1FJGI 3J80C 3OTOI 2ZM6I 1Z0VA 4DR5E 1H73A 4DV1E 4HACA 5A2QQ 4B3RI 3LNUA 1Z0WA 1Z0TA 4LF7E 4OX9E 3PYEA 4DV2I 3QT6A 4Z7YA 1ZM9A 1B62A 1XMOI 4R1FA 4JI5I 2OI2A 4MYUA 4JI6I 2NPFA 4LF9I 4YY3I 3J81Q 4DV3E 4HXZA 3J7AM 4GKKI 4DV4I 4LFBI 4JI0I 3WU5A 2F4VI 2UUBI 4UTGA 2VQEI 2UUCE 4LF5E 4WUCA 1NHJA 4DPYA 2UXBI 4GKJI 3T1YI 1J5EI 5LL6R 2EFGA 3LTOA 1Z5AA 2J7KA 1KIJA 1RREA 4XTJA 2V34A 3ZM7A 4JYAI 1MU5A 3HULA 3JAMQ 4NXNE 2R42A 4LF8E 2HHHE 1HNXI 1OJ4A 4AQYE 1XNRE 5FLXC 1EA6A 5BR8E 4DR7I 4LF4E
chains in the Genus database with same CATH superfamily
2HK3A 1UEKA 2V2QA 1E3HA 1N32I 1N36E 5LMUE 4WUBA 1I94I 4X64E 1HNZE 1H74A 1KVKA 4DV1I 2BM1A 2HFUA 1P42A 3GLLA 4NXME 4LF7I 4OX9I 4MDTA 5LMNE 4MQYA 4HY1A 4DR3E 4DUZE 2HFSA 3WU4A 5L3JA 4LFAE 1NHIA 4BA2B 4DV5E 2R3VA 5DROA 1Z0CA 2UUAE 3PYDA 4FN5A 1R6LA 3QT5A 5C0XA 5GMEA 1DARA 4B3SE 3U1YA 4X66E 1MX0A 1YHCA 4DV3I 4JI4I 4IZKA 2X7IA 4JI2E 1RR9A 3H1CA 3J80Q 1Z5BA 1WUUA 4OO1E 2PO1A 2UUCI 1R6MA 4LF5I 3V5RA 2PO0A 2J65A 1N33E 5C0XE 1HNWE 5K36C 5K36F 1U2RA 4IZKB 5JEAA 4JG4A 2V2ZA 1KTVA 5K36D 4NXNI 3ZZUA 4LF8I 4Z7CA 2HHHI 3Q6NA 3QT8A 5IT9C 3U1KA 2Z5CB 3PS3A 4AQYI 2ZBKB 2XEXA 2Z5BA 4DV6E 2PO0B 4LF4I 1BKNA 5JEAE 1IBKI 2VF3A 4K0KI 1N36I 2HK2A 5LMUI 3HJCA 4IZJD 1ZM2A 4X64I 1HK7A 2O1WA 1HNZI 2BA1D 4DR4E 4FW9A 2VQFE 2UXCE 3LPSA 4NXMI 5A2QC 2O1UA 4M1KA 5LMNI 4FW3A 4DR3I 4MU0A 3GONA 4I3HA 4USMA 4B3ME 3T1HE 3B4TA 4DUYE 4JI8I 1N34E 3PYGA 3P3GA 4LFAI 4X62I 1PVGA 4DV5I 2NN6B 4DV7E 2JEBA 1KKHA 2UUAI 4B3TE 3M7ND 5FLXQ 4DR6I 2PNMA 4B3SI 1Z59A 2HKJA 4X66I 3P76A 4JI2I 5DRQA 3J81C 4DU7A 2CVEA 3F0NA 2UXDE 2O3ZA 1FWKA 4MU3A 4P52A 4FWDA 1E3PA 4OO1C 4OO1F 1XNQE 3Q1QA 2JE6A 2CGEA 4IFDB 1VI7A 4OO1D 1HNWI 1Z0EA 4DR1E 4PRXA 4DR5I 4BA2A 5C0XF 3ZKBA 5C0XC 4MU1A 1S16A 3B82A 3PYFA 4X65E 5C0XD 4DPXA 4KHPE 3CWVA 4ZVIA 1XMQE 2JE6B 4OZEA 4AIDA 4DV6I 1HR0E 2CZ9A 4DU8A 4LF9E 5IWAE 2E5LE 2PO2B 2JEAB 3PRYA 2C38B 4IS9A 4DPWA 1Z0GA 4URLA 3Q6MA 5JEAF 5JEAC 2CG9A 4DR4I 2VQFI 4FWHA 3UHMA 2Q2EB 2UU9E 2O1TA 2ZITA 5JEAD 2GS8A 2UXCI 3CDIA 3M85D 1K47A 1J5EE 3GMEA 4QNJA 4B3MI 4DR2E 5GMDA 3T1HI 2Z5CA 4DUYI 2O1VA 4JYAE 1N34I 1ZM4A 3B8HA 3ZKDA 4PU9A 4LCFA 4UT4A 4DV7I 3KRNA 4J3DA 4AIMA 1PKPA 4B3TI 2JT2A 4JV5E 4EMDA 4LPFA 2BA0D 4RPFA 4HYMA 4QNKA 2UXDI 4LF6E 4ED4A 1XNRI 1Y4SA 1ZXNA 1MG7A 5BR8I 1N32E 1ELOA 1H7UA 1I94E 1Y4UA 1XNQI 2BR2A 4JI3E 1XXEA 2WP8B 2C39A 5DNXA 3DD6A 4DR1I 2A2DA 2NN6A 1Z0BA 1YH8A 2X36A 5DRRA 4PRVA 1EI1A 4X65I 4DV0E 4JI1E 4JI7E 3D4JA 4KHPI 1XMQI 5K36A 2BR2B 3H4LA 3ZZTA 4DUZI 3J7AG 1ZM3A 2C39B 1HR0I 2AE8A 2LJPA 4HACB 3PS2A 1USUA 5IWAI 1D6TA 2E5LI 1IBLE 2C37B 1OYPA 4JI4E 1NZ0A 4YHHE 2NN6E 5EKWA 4LFCE 3QT7A 4IFDA 2IOPA 2V8PA 4LCGA 3P3CA 5K36B 2DEIA 1Z5CA 1A6FA 2UU9I 1FWLA 3HKMA 1VISA 1IBME 2Z5EA 4USKA 4ISAA 1FJGE 3OTOE 1PIEA 4DR2I 3GCMA 3WU6A 2ZM6E 2HKEA 1FI4A 2GO4A 4DPTA 5FWKA 4P7AA 1USVA 1N33I 1B63A 4B3RE 4IFDE 2IERA 2PO2A 3WU3A 2BV3A 2JEAA 2C38A 4JV5I 3PS1A 4DV2E 1QZRA 4IZJB 3JAMC 1XHKA 3P06A 1UDQA 4U3DA 2GQ0A 1XMOE 2DEJA 4JI5E 1S4EA 4JI6E 4LF6I 1Y6ZA 4WUDA 3V2UC 1IBKE 2PNZA 2BA1G 4K0KE 4YY3E 2IESA 4BA1B 4FWGA 5EL9A 4JI3I 3ZZ0A 4U3BA 4GKJE 4GKKE 3L7ZA 4DV4E 2AJ4A 4LFBE 5ELWA 1N0VC 4JI0E 2E1RA 2F4VE 2UUBE 2VQEE 2BM0A 1UDOA 1N0UA 5DRPA 1ZXMA 4OO1A 2UXBE 2V2VA 4DXLA 4DV0I 4JI1I 3T1YE 1H72C 2PNZB 4JI8E 4JI7I 4AM3A 2VESA 1FNMA 4DPUA 4X62E 3M7NG 4MYTA 3L7ZB 5IT9Q 2A2CA 4DR6E 1FKAE 1HNXE 1IBLI 1NHHA 4YHHI 1UDSA 3M6AA 4OO1B 2WP8A 4LFCI 4MU4A 2GO3A 3B78A 4N3OA 2NN6F 2NN6C 3K17A 4DR7E 4KQVA 5DNLA 1IBMI 2WW4A 3K1JA 2NN6D 5C0XB 1H7SA 3NZKA 1FJGI 3J80C 3OTOI 2ZM6I 1Z0VA 4DR5E 1Y60A 1Y5YA 1H73A 3K85A 4HACA 5A2QQ 4DV1E 4B3RI 2PO1B 3LNUA 1Z0WA 1Z0TA 4LF7E 4OX9E 2C37A 3PYEA 4DV2I 4IFDF 4IFDC 3QT6A 4LCHA 4Z7YA 1ZM9A 1B62A 2WNRA 4IFDD 5JEAB 1XMOI 1UDNA 2F1DA 4GQUA 4R1FA 4JI5I 2OI2A 4MYUA 4JI6I 2NPFA 1RHYA 4LF9I 4YY3I 2IOQA 3J81Q 4DV3E 4HXZA 3J7AM 4GKKI 3M85G 2Z5BB 4DV4I 4LFBI 4JI0I 3WU5A 2WNRB 2F4VI 2UUBI 1OYRA 4UTGA 2VQEI 4FW6A 2UUCE 4FW7A 4FW4A 4LF5E 4WUCA 4LOMA 5K36E 1NHJA 4DPYA 2UXBI 4GKJI 3T1YI 4IZJA 1J5EI 2PNLA 2EFGA 3LTOA 5LL6R 1Z5AA 2J7KA 1KIJA 1RREA 4XTJA 2V34A 3ZM7A 4JYAI 1MU5A 3HULA 3JAMQ 2BA0G 4NXNE 3P3EA 2R42A 4LF8E 2HHHE 4OKGA 1HNXI 1OJ4A 4BA1A 1OYSA 4AQYE 1XNRE 4NBQA 5FLXC 1EA6A 5BR8E 3CDJA 4DR7I 4LF4E 2JEBB 4FW5A
chains in the Genus database with same CATH topology
2HK3A 1UEKA 2V2QA 1N32I 1N36E 5LMUE 4WUBA 1I94I 4X64E 1HNZE 1H74A 1KVKA 4DV1I 2BM1A 2HFUA 4NXME 4LF7I 4OX9I 5LMNE 4HY1A 4DR3E 4DUZE 2HFSA 3WU4A 5L3JA 4LFAE 1NHIA 4DV5E 2R3VA 1Z0CA 2UUAE 3PYDA 4FN5A 3QT5A 5GMEA 1DARA 4B3SE 4X66E 4DV3I 1MX0A 4JI4I 4IZKA 2X7IA 4JI2E 1RR9A 3J80Q 1Z5BA 1WUUA 2UUCI 4LF5I 3V5RA 1N33E 1HNWE 1U2RA 4IZKB 4JG4A 2V2ZA 1KTVA 4NXNI 3ZZUA 4LF8I 4Z7CA 2HHHI 3Q6NA 3QT8A 5IT9C 2Z5CB 4AQYI 2ZBKB 2XEXA 2Z5BA 4DV6E 4LF4I 1BKNA 1IBKI 2VF3A 4K0KI 1N36I 2HK2A 5LMUI 3HJCA 4IZJD 1ZM2A 4X64I 1HK7A 2O1WA 1HNZI 4DR4E 4FW9A 2VQFE 2UXCE 3LPSA 4NXMI 5A2QC 2O1UA 4M1KA 5LMNI 4DR3I 4B3ME 3GONA 4I3HA 4USMA 3T1HE 4DUYE 4JI8I 1N34E 3PYGA 4LFAI 4X62I 1PVGA 4DV5I 4DV7E 2UUAI 1KKHA 4B3TE 5FLXQ 4DR6I 2PNMA 4B3SI 1Z59A 2HKJA 4X66I 4JI2I 3J81C 4DU7A 3F0NA 2UXDE 1FWKA 4P52A 4FWDA 1XNQE 3Q1QA 2CGEA 1HNWI 1Z0EA 4DR1E 4PRXA 4DR5I 3ZKBA 1S16A 3B82A 3PYFA 4X65E 4DPXA 4KHPE 3CWVA 4ZVIA 1XMQE 4DV6I 1HR0E 2CZ9A 4DU8A 4LF9E 5IWAE 2E5LE 3PRYA 4DPWA 1Z0GA 4URLA 3Q6MA 2CG9A 4DR4I 2VQFI 4FWHA 2Q2EB 2UU9E 2O1TA 2ZITA 2GS8A 2UXCI 1K47A 1J5EE 4B3MI 4DR2E 5GMDA 3T1HI 2Z5CA 4DUYI 2O1VA 4JYAE 1N34I 1ZM4A 3B8HA 3ZKDA 4PU9A 4UT4A 4DV7I 1PKPA 4B3TI 4JV5E 4EMDA 4RPFA 4HYMA 2UXDI 4LF6E 4ED4A 1XNRI 1Y4SA 1ZXNA 1MG7A 5BR8I 1N32E 1ELOA 1H7UA 1I94E 1Y4UA 1XNQI 4JI3E 4DR1I 2A2DA 1Z0BA 2X36A 4PRVA 1EI1A 4X65I 4DV0E 4JI1E 4JI7E 3D4JA 4KHPI 1XMQI 3H4LA 3ZZTA 4DUZI 3J7AG 1ZM3A 1HR0I 2LJPA 4HACB 1USUA 5IWAI 1D6TA 2E5LI 1IBLE 4JI4E 1NZ0A 4YHHE 4LFCE 3QT7A 2IOPA 2V8PA 2DEIA 1Z5CA 1A6FA 2UU9I 1FWLA 1VISA 1IBME 2Z5EA 4USKA 1FJGE 3OTOE 1PIEA 4DR2I 3WU6A 2ZM6E 2HKEA 1FI4A 4DPTA 5FWKA 4P7AA 1USVA 1N33I 1B63A 4B3RE 3WU3A 2BV3A 4JV5I 4DV2E 1QZRA 4IZJB 3JAMC 1XHKA 3P06A 2GQ0A 1XMOE 2DEJA 4JI5E 1S4EA 4JI6E 4LF6I 1Y6ZA 4WUDA 3V2UC 1IBKE 4K0KE 4YY3E 4FWGA 4JI3I 3ZZ0A 4GKKE 4DV4E 2AJ4A 4LFBE 1N0VC 4JI0E 2E1RA 2F4VE 2UUBE 2VQEE 2BM0A 1N0UA 1ZXMA 2UXBE 2V2VA 4DV0I 3T1YE 4DXLA 4JI1I 1H72C 4JI8E 4JI7I 4GKJE 1FNMA 4DPUA 4X62E 4MYTA 5IT9Q 2A2CA 4DR6E 1FKAE 1HNXE 1IBLI 1NHHA 4YHHI 3M6AA 4LFCI 3B78A 4N3OA 3K17A 4DR7E 4KQVA 1IBMI 2WW4A 3K1JA 1H7SA 1FJGI 3J80C 3OTOI 2ZM6I 1Z0VA 4DR5E 1H73A 3K85A 4HACA 5A2QQ 4DV1E 4B3RI 3LNUA 1Z0WA 1Z0TA 4LF7E 4OX9E 3PYEA 4DV2I 3QT6A 4Z7YA 1ZM9A 1B62A 1XMOI 4R1FA 4JI5I 2OI2A 4MYUA 4JI6I 2NPFA 4LF9I 4YY3I 2IOQA 3J81Q 4DV3E 4HXZA 3J7AM 4GKKI 2Z5BB 4DV4I 4LFBI 4JI0I 3WU5A 2F4VI 2UUBI 4UTGA 2VQEI 2UUCE 4LF5E 4WUCA 1NHJA 4DPYA 2UXBI 4GKJI 3T1YI 4IZJA 1J5EI 2PNLA 2EFGA 3LTOA 5LL6R 1Z5AA 2J7KA 1KIJA 1RREA 4XTJA 2V34A 3ZM7A 4JYAI 1MU5A 3HULA 3JAMQ 4NXNE 2R42A 4LF8E 2HHHE 1HNXI 1OJ4A 4AQYE 1XNRE 5FLXC 1EA6A 5BR8E 4DR7I 4LF4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  1UEK A;  2V2Q A;  1N32 I;  1N36 E;  5LMU E;  4WUB A;  1I94 I;  4X64 E;  1HNZ E;  1H74 A;  1KVK A;  4DV1 I;  2BM1 A;  2HFU A;  4NXM E;  4LF7 I;  4OX9 I;  5LMN E;  4HY1 A;  4DR3 E;  4DUZ E;  2HFS A;  3WU4 A;  5L3J A;  4LFA E;  1NHI A;  4DV5 E;  2R3V A;  1Z0C A;  2UUA E;  3PYD A;  4FN5 A;  3QT5 A;  5GME A;  1DAR A;  4B3S E;  4X66 E;  4DV3 I;  1MX0 A;  4JI4 I;  2X7I A;  4JI2 E;  1RR9 A;  3J80 Q;  1Z5B A;  1WUU A;  2UUC I;  4LF5 I;  3V5R A;  1N33 E;  1HNW E;  1U2R A;  4JG4 A;  2V2Z A;  1KTV A;  4NXN I;  3ZZU A;  4LF8 I;  4Z7C A;  2HHH I;  3QT8 A;  5IT9 C;  4AQY I;  2ZBK B;  2XEX A;  4DV6 E;  4LF4 I;  1BKN A;  1IBK I;  2VF3 A;  4K0K I;  1N36 I;  2HK2 A;  5LMU I;  1ZM2 A;  4X64 I;  1HNZ I;  4DR4 E;  4FW9 A;  2VQF E;  2UXC E;  3LPS A;  4NXM I;  5A2Q C;  5LMN I;  4M1K A;  4DR3 I;  4B3M E;  3GON A;  4I3H A;  4USM A;  3T1H E;  4DUY E;  4JI8 I;  1N34 E;  3PYG A;  4LFA I;  4X62 I;  1PVG A;  4DV5 I;  4DV7 E;  2UUA I;  1KKH A;  4B3T E;  5FLX Q;  4DR6 I;  4B3S I;  1Z59 A;  2HKJ A;  4X66 I;  4JI2 I;  3J81 C;  4DU7 A;  3F0N A;  2UXD E;  1FWK A;  4P52 A;  4FWD A;  1XNQ E;  3Q1Q A;  1HNW I;  1Z0E A;  4DR1 E;  4PRX A;  4DR5 I;  3ZKB A;  1S16 A;  3B82 A;  3PYF A;  4X65 E;  4DPX A;  4KHP E;  3CWV A;  4ZVI A;  1XMQ E;  4DV6 I;  1HR0 E;  2CZ9 A;  4DU8 A;  4LF9 E;  5IWA E;  2E5L E;  4DPW A;  1Z0G A;  4URL A;  4DR4 I;  2VQF I;  4FWH A;  2Q2E B;  2UU9 E;  2ZIT A;  2GS8 A;  2UXC I;  1K47 A;  1J5E E;  4B3M I;  4DR2 E;  5GMD A;  3T1H I;  4DUY I;  4JYA E;  1N34 I;  1ZM4 A;  3B8H A;  3ZKD A;  4PU9 A;  4UT4 A;  4DV7 I;  1PKP A;  4B3T I;  4JV5 E;  4EMD A;  4RPF A;  4HYM A;  2UXD I;  4LF6 E;  4ED4 A;  1XNR I;  1ZXN A;  1MG7 A;  5BR8 I;  1N32 E;  1ELO A;  1H7U A;  1I94 E;  1XNQ I;  4JI3 E;  4DR1 I;  2A2D A;  1Z0B A;  2X36 A;  4PRV A;  1EI1 A;  4X65 I;  4DV0 E;  4JI1 E;  4JI7 E;  3D4J A;  4KHP I;  1XMQ I;  3H4L A;  3ZZT A;  4DUZ I;  3J7A G;  1ZM3 A;  1HR0 I;  2LJP A;  4HAC B;  5IWA I;  1D6T A;  2E5L I;  1IBL E;  4JI4 E;  1NZ0 A;  4YHH E;  4LFC E;  3QT7 A;  2V8P A;  2DEI A;  1Z5C A;  1A6F A;  2UU9 I;  1FWL A;  1VIS A;  1IBM E;  4USK A;  1FJG E;  3OTO E;  1PIE A;  4DR2 I;  3WU6 A;  2ZM6 E;  2HKE A;  1FI4 A;  4DPT A;  4P7A A;  1N33 I;  1B63 A;  4B3R E;  3WU3 A;  2BV3 A;  4JV5 I;  4DV2 E;  1QZR A;  3JAM C;  1XHK A;  1XMO E;  2DEJ A;  4JI5 E;  1S4E A;  4JI6 E;  4LF6 I;  4WUD A;  3V2U C;  1IBK E;  4K0K E;  4YY3 E;  4FWG A;  4JI3 I;  3ZZ0 A;  4GKK E;  4DV4 E;  2AJ4 A;  4LFB E;  1N0V C;  4JI0 E;  2E1R A;  2F4V E;  2UUB E;  2VQE E;  2BM0 A;  1N0U A;  1ZXM A;  2UXB E;  2V2V A;  4DXL A;  3T1Y E;  4JI1 I;  4DV0 I;  1H72 C;  4JI8 E;  4JI7 I;  4GKJ E;  1FNM A;  4DPU A;  4X62 E;  4MYT A;  5IT9 Q;  2A2C A;  4DR6 E;  1FKA E;  1HNX E;  1IBL I;  1NHH A;  4YHH I;  3M6A A;  4LFC I;  3B78 A;  3K17 A;  4DR7 E;  4KQV A;  1IBM I;  2WW4 A;  3K1J A;  1H7S A;  1FJG I;  3J80 C;  3OTO I;  2ZM6 I;  1Z0V A;  4DR5 E;  1H73 A;  4DV1 E;  4HAC A;  5A2Q Q;  4B3R I;  3LNU A;  1Z0W A;  1Z0T A;  4LF7 E;  4OX9 E;  3PYE A;  4DV2 I;  3QT6 A;  4Z7Y A;  1ZM9 A;  1B62 A;  1XMO I;  4R1F A;  4JI5 I;  2OI2 A;  4MYU A;  4JI6 I;  2NPF A;  4LF9 I;  4YY3 I;  3J81 Q;  4DV3 E;  4HXZ A;  3J7A M;  4GKK I;  4DV4 I;  4LFB I;  4JI0 I;  3WU5 A;  2F4V I;  2UUB I;  4UTG A;  2VQE I;  2UUC E;  4LF5 E;  4WUC A;  1NHJ A;  4DPY A;  2UXB I;  4GKJ I;  3T1Y I;  1J5E I;  5LL6 R;  2EFG A;  3LTO A;  1Z5A A;  2J7K A;  1KIJ A;  1RRE A;  4XTJ A;  2V34 A;  3ZM7 A;  4JYA I;  1MU5 A;  3HUL A;  3JAM Q;  4NXN E;  2R42 A;  4LF8 E;  2HHH E;  1HNX I;  1OJ4 A;  4AQY E;  1XNR E;  5FLX C;  1EA6 A;  5BR8 E;  4DR7 I;  4LF4 E; 
#chains in the Genus database with same CATH topology
 2HK3 A;  1UEK A;  2V2Q A;  1E3H A;  1N32 I;  1N36 E;  5LMU E;  4WUB A;  1I94 I;  4X64 E;  1HNZ E;  1H74 A;  1KVK A;  4DV1 I;  2BM1 A;  2HFU A;  1P42 A;  3GLL A;  4NXM E;  4LF7 I;  4OX9 I;  4MDT A;  5LMN E;  4MQY A;  4HY1 A;  4DR3 E;  4DUZ E;  2HFS A;  3WU4 A;  5L3J A;  4LFA E;  1NHI A;  4BA2 B;  4DV5 E;  2R3V A;  5DRO A;  1Z0C A;  2UUA E;  3PYD A;  4FN5 A;  1R6L A;  3QT5 A;  5C0X A;  5GME A;  1DAR A;  4B3S E;  3U1Y A;  4X66 E;  1MX0 A;  1YHC A;  4DV3 I;  4JI4 I;  4IZK A;  2X7I A;  4JI2 E;  1RR9 A;  3H1C A;  3J80 Q;  1Z5B A;  1WUU A;  4OO1 E;  2PO1 A;  2UUC I;  1R6M A;  4LF5 I;  3V5R A;  2PO0 A;  2J65 A;  1N33 E;  5C0X E;  1HNW E;  5K36 C;  5K36 F;  1U2R A;  4IZK B;  5JEA A;  4JG4 A;  2V2Z A;  1KTV A;  5K36 D;  4NXN I;  3ZZU A;  4LF8 I;  4Z7C A;  2HHH I;  3Q6N A;  3QT8 A;  5IT9 C;  3U1K A;  2Z5C B;  3PS3 A;  4AQY I;  2ZBK B;  2XEX A;  2Z5B A;  4DV6 E;  2PO0 B;  4LF4 I;  1BKN A;  5JEA E;  1IBK I;  2VF3 A;  4K0K I;  1N36 I;  2HK2 A;  5LMU I;  3HJC A;  4IZJ D;  1ZM2 A;  4X64 I;  1HK7 A;  2O1W A;  1HNZ I;  2BA1 D;  4DR4 E;  4FW9 A;  2VQF E;  2UXC E;  3LPS A;  4NXM I;  5A2Q C;  2O1U A;  4M1K A;  5LMN I;  4FW3 A;  4DR3 I;  4MU0 A;  3GON A;  4I3H A;  4USM A;  4B3M E;  3T1H E;  3B4T A;  4DUY E;  4JI8 I;  1N34 E;  3PYG A;  3P3G A;  4LFA I;  4X62 I;  1PVG A;  4DV5 I;  2NN6 B;  4DV7 E;  2JEB A;  1KKH A;  2UUA I;  4B3T E;  3M7N D;  5FLX Q;  4DR6 I;  2PNM A;  4B3S I;  1Z59 A;  2HKJ A;  4X66 I;  3P76 A;  4JI2 I;  5DRQ A;  3J81 C;  4DU7 A;  2CVE A;  3F0N A;  2UXD E;  2O3Z A;  1FWK A;  4MU3 A;  4P52 A;  4FWD A;  1E3P A;  4OO1 C;  4OO1 F;  1XNQ E;  3Q1Q A;  2JE6 A;  2CGE A;  4IFD B;  1VI7 A;  4OO1 D;  1HNW I;  1Z0E A;  4DR1 E;  4PRX A;  4DR5 I;  4BA2 A;  5C0X F;  3ZKB A;  5C0X C;  4MU1 A;  1S16 A;  3B82 A;  3PYF A;  4X65 E;  5C0X D;  4DPX A;  4KHP E;  3CWV A;  4ZVI A;  1XMQ E;  2JE6 B;  4OZE A;  4AID A;  4DV6 I;  1HR0 E;  2CZ9 A;  4DU8 A;  4LF9 E;  5IWA E;  2E5L E;  2PO2 B;  2JEA B;  3PRY A;  2C38 B;  4IS9 A;  4DPW A;  1Z0G A;  4URL A;  3Q6M A;  5JEA F;  5JEA C;  2CG9 A;  4DR4 I;  2VQF I;  4FWH A;  3UHM A;  2Q2E B;  2UU9 E;  2O1T A;  2ZIT A;  5JEA D;  2GS8 A;  2UXC I;  3CDI A;  3M85 D;  1K47 A;  1J5E E;  3GME A;  4QNJ A;  4B3M I;  4DR2 E;  5GMD A;  3T1H I;  2Z5C A;  4DUY I;  2O1V A;  4JYA E;  1N34 I;  1ZM4 A;  3B8H A;  3ZKD A;  4PU9 A;  4LCF A;  4UT4 A;  4DV7 I;  3KRN A;  4J3D A;  4AIM A;  1PKP A;  4B3T I;  2JT2 A;  4JV5 E;  4EMD A;  4LPF A;  2BA0 D;  4RPF A;  4HYM A;  4QNK A;  2UXD I;  4LF6 E;  4ED4 A;  1XNR I;  1Y4S A;  1ZXN A;  1MG7 A;  5BR8 I;  1N32 E;  1ELO A;  1H7U A;  1I94 E;  1Y4U A;  1XNQ I;  2BR2 A;  4JI3 E;  1XXE A;  2WP8 B;  2C39 A;  5DNX A;  3DD6 A;  4DR1 I;  2A2D A;  2NN6 A;  1Z0B A;  1YH8 A;  2X36 A;  5DRR A;  4PRV A;  1EI1 A;  4X65 I;  4DV0 E;  4JI1 E;  4JI7 E;  3D4J A;  4KHP I;  1XMQ I;  5K36 A;  2BR2 B;  3H4L A;  3ZZT A;  4DUZ I;  3J7A G;  1ZM3 A;  2C39 B;  1HR0 I;  2AE8 A;  2LJP A;  4HAC B;  3PS2 A;  1USU A;  5IWA I;  1D6T A;  2E5L I;  1IBL E;  2C37 B;  1OYP A;  4JI4 E;  1NZ0 A;  4YHH E;  2NN6 E;  5EKW A;  4LFC E;  3QT7 A;  4IFD A;  2IOP A;  2V8P A;  4LCG A;  3P3C A;  5K36 B;  2DEI A;  1Z5C A;  1A6F A;  2UU9 I;  1FWL A;  3HKM A;  1VIS A;  1IBM E;  2Z5E A;  4USK A;  4ISA A;  1FJG E;  3OTO E;  1PIE A;  4DR2 I;  3GCM A;  3WU6 A;  2ZM6 E;  2HKE A;  1FI4 A;  2GO4 A;  4DPT A;  5FWK A;  4P7A A;  1USV A;  1N33 I;  1B63 A;  4B3R E;  4IFD E;  2IER A;  2PO2 A;  3WU3 A;  2BV3 A;  2JEA A;  2C38 A;  4JV5 I;  3PS1 A;  4DV2 E;  1QZR A;  4IZJ B;  3JAM C;  1XHK A;  3P06 A;  1UDQ A;  4U3D A;  2GQ0 A;  1XMO E;  2DEJ A;  4JI5 E;  1S4E A;  4JI6 E;  4LF6 I;  1Y6Z A;  4WUD A;  3V2U C;  1IBK E;  2PNZ A;  2BA1 G;  4K0K E;  4YY3 E;  2IES A;  4BA1 B;  4FWG A;  5EL9 A;  4JI3 I;  3ZZ0 A;  4U3B A;  4GKJ E;  4GKK E;  3L7Z A;  4DV4 E;  2AJ4 A;  4LFB E;  5ELW A;  1N0V C;  4JI0 E;  2E1R A;  2F4V E;  2UUB E;  2VQE E;  2BM0 A;  1UDO A;  1N0U A;  5DRP A;  1ZXM A;  4OO1 A;  2UXB E;  2V2V A;  4DXL A;  4DV0 I;  4JI1 I;  3T1Y E;  1H72 C;  2PNZ B;  4JI8 E;  4JI7 I;  4AM3 A;  2VES A;  1FNM A;  4DPU A;  4X62 E;  3M7N G;  4MYT A;  3L7Z B;  5IT9 Q;  2A2C A;  4DR6 E;  1FKA E;  1HNX E;  1IBL I;  1NHH A;  4YHH I;  1UDS A;  3M6A A;  4OO1 B;  2WP8 A;  4LFC I;  4MU4 A;  2GO3 A;  3B78 A;  4N3O A;  2NN6 F;  2NN6 C;  3K17 A;  4DR7 E;  4KQV A;  5DNL A;  1IBM I;  2WW4 A;  3K1J A;  2NN6 D;  5C0X B;  1H7S A;  3NZK A;  1FJG I;  3J80 C;  3OTO I;  2ZM6 I;  1Z0V A;  4DR5 E;  1Y60 A;  1Y5Y A;  1H73 A;  3K85 A;  4HAC A;  5A2Q Q;  4DV1 E;  4B3R I;  2PO1 B;  3LNU A;  1Z0W A;  1Z0T A;  4LF7 E;  4OX9 E;  2C37 A;  3PYE A;  4DV2 I;  4IFD F;  4IFD C;  3QT6 A;  4LCH A;  4Z7Y A;  1ZM9 A;  1B62 A;  2WNR A;  4IFD D;  5JEA B;  1XMO I;  1UDN A;  2F1D A;  4GQU A;  4R1F A;  4JI5 I;  2OI2 A;  4MYU A;  4JI6 I;  2NPF A;  1RHY A;  4LF9 I;  4YY3 I;  2IOQ A;  3J81 Q;  4DV3 E;  4HXZ A;  3J7A M;  4GKK I;  3M85 G;  2Z5B B;  4DV4 I;  4LFB I;  4JI0 I;  3WU5 A;  2WNR B;  2F4V I;  2UUB I;  1OYR A;  4UTG A;  2VQE I;  4FW6 A;  2UUC E;  4FW7 A;  4FW4 A;  4LF5 E;  4WUC A;  4LOM A;  5K36 E;  1NHJ A;  4DPY A;  2UXB I;  4GKJ I;  3T1Y I;  4IZJ A;  1J5E I;  2PNL A;  2EFG A;  3LTO A;  5LL6 R;  1Z5A A;  2J7K A;  1KIJ A;  1RRE A;  4XTJ A;  2V34 A;  3ZM7 A;  4JYA I;  1MU5 A;  3HUL A;  3JAM Q;  2BA0 G;  4NXN E;  3P3E A;  2R42 A;  4LF8 E;  2HHH E;  4OKG A;  1HNX I;  1OJ4 A;  4BA1 A;  1OYS A;  4AQY E;  1XNR E;  4NBQ A;  5FLX C;  1EA6 A;  5BR8 E;  3CDJ A;  4DR7 I;  4LF4 E;  2JEB B;  4FW5 A; 
#chains in the Genus database with same CATH homology
 2HK3 A;  1UEK A;  2V2Q A;  1N32 I;  1N36 E;  5LMU E;  4WUB A;  1I94 I;  4X64 E;  1HNZ E;  1H74 A;  1KVK A;  4DV1 I;  2BM1 A;  2HFU A;  4NXM E;  4LF7 I;  4OX9 I;  5LMN E;  4HY1 A;  4DR3 E;  4DUZ E;  2HFS A;  3WU4 A;  5L3J A;  4LFA E;  1NHI A;  4DV5 E;  2R3V A;  1Z0C A;  2UUA E;  3PYD A;  4FN5 A;  3QT5 A;  5GME A;  1DAR A;  4B3S E;  4X66 E;  4DV3 I;  1MX0 A;  4JI4 I;  4IZK A;  2X7I A;  4JI2 E;  1RR9 A;  3J80 Q;  1Z5B A;  1WUU A;  2UUC I;  4LF5 I;  3V5R A;  1N33 E;  1HNW E;  1U2R A;  4IZK B;  4JG4 A;  2V2Z A;  1KTV A;  4NXN I;  3ZZU A;  4LF8 I;  4Z7C A;  2HHH I;  3Q6N A;  3QT8 A;  5IT9 C;  2Z5C B;  4AQY I;  2ZBK B;  2XEX A;  2Z5B A;  4DV6 E;  4LF4 I;  1BKN A;  1IBK I;  2VF3 A;  4K0K I;  1N36 I;  2HK2 A;  5LMU I;  3HJC A;  4IZJ D;  1ZM2 A;  4X64 I;  1HK7 A;  2O1W A;  1HNZ I;  4DR4 E;  4FW9 A;  2VQF E;  2UXC E;  3LPS A;  4NXM I;  5A2Q C;  2O1U A;  4M1K A;  5LMN I;  4DR3 I;  4B3M E;  3GON A;  4I3H A;  4USM A;  3T1H E;  4DUY E;  4JI8 I;  1N34 E;  3PYG A;  4LFA I;  4X62 I;  1PVG A;  4DV5 I;  4DV7 E;  2UUA I;  1KKH A;  4B3T E;  5FLX Q;  4DR6 I;  2PNM A;  4B3S I;  1Z59 A;  2HKJ A;  4X66 I;  4JI2 I;  3J81 C;  4DU7 A;  3F0N A;  2UXD E;  1FWK A;  4P52 A;  4FWD A;  1XNQ E;  3Q1Q A;  2CGE A;  1HNW I;  1Z0E A;  4DR1 E;  4PRX A;  4DR5 I;  3ZKB A;  1S16 A;  3B82 A;  3PYF A;  4X65 E;  4DPX A;  4KHP E;  3CWV A;  4ZVI A;  1XMQ E;  4DV6 I;  1HR0 E;  2CZ9 A;  4DU8 A;  4LF9 E;  5IWA E;  2E5L E;  3PRY A;  4DPW A;  1Z0G A;  4URL A;  3Q6M A;  2CG9 A;  4DR4 I;  2VQF I;  4FWH A;  2Q2E B;  2UU9 E;  2O1T A;  2ZIT A;  2GS8 A;  2UXC I;  1K47 A;  1J5E E;  4B3M I;  4DR2 E;  5GMD A;  3T1H I;  2Z5C A;  4DUY I;  2O1V A;  4JYA E;  1N34 I;  1ZM4 A;  3B8H A;  3ZKD A;  4PU9 A;  4UT4 A;  4DV7 I;  1PKP A;  4B3T I;  4JV5 E;  4EMD A;  4RPF A;  4HYM A;  2UXD I;  4LF6 E;  4ED4 A;  1XNR I;  1Y4S A;  1ZXN A;  1MG7 A;  5BR8 I;  1N32 E;  1ELO A;  1H7U A;  1I94 E;  1Y4U A;  1XNQ I;  4JI3 E;  4DR1 I;  2A2D A;  1Z0B A;  2X36 A;  4PRV A;  1EI1 A;  4X65 I;  4DV0 E;  4JI1 E;  4JI7 E;  3D4J A;  4KHP I;  1XMQ I;  3H4L A;  3ZZT A;  4DUZ I;  3J7A G;  1ZM3 A;  1HR0 I;  2LJP A;  4HAC B;  1USU A;  5IWA I;  1D6T A;  2E5L I;  1IBL E;  4JI4 E;  1NZ0 A;  4YHH E;  4LFC E;  3QT7 A;  2IOP A;  2V8P A;  2DEI A;  1Z5C A;  1A6F A;  2UU9 I;  1FWL A;  1VIS A;  1IBM E;  2Z5E A;  4USK A;  1FJG E;  3OTO E;  1PIE A;  4DR2 I;  3WU6 A;  2ZM6 E;  2HKE A;  1FI4 A;  4DPT A;  5FWK A;  4P7A A;  1USV A;  1N33 I;  1B63 A;  4B3R E;  3WU3 A;  2BV3 A;  4JV5 I;  4DV2 E;  1QZR A;  4IZJ B;  3JAM C;  1XHK A;  3P06 A;  2GQ0 A;  1XMO E;  2DEJ A;  4JI5 E;  1S4E A;  4JI6 E;  4LF6 I;  1Y6Z A;  4WUD A;  3V2U C;  1IBK E;  4K0K E;  4YY3 E;  4FWG A;  4JI3 I;  3ZZ0 A;  4GKK E;  4DV4 E;  2AJ4 A;  4LFB E;  1N0V C;  4JI0 E;  2E1R A;  2F4V E;  2UUB E;  2VQE E;  2BM0 A;  1N0U A;  1ZXM A;  2UXB E;  2V2V A;  4DV0 I;  3T1Y E;  4DXL A;  4JI1 I;  1H72 C;  4JI8 E;  4JI7 I;  4GKJ E;  1FNM A;  4DPU A;  4X62 E;  4MYT A;  5IT9 Q;  2A2C A;  4DR6 E;  1FKA E;  1HNX E;  1IBL I;  1NHH A;  4YHH I;  3M6A A;  4LFC I;  3B78 A;  4N3O A;  3K17 A;  4DR7 E;  4KQV A;  1IBM I;  2WW4 A;  3K1J A;  1H7S A;  1FJG I;  3J80 C;  3OTO I;  2ZM6 I;  1Z0V A;  4DR5 E;  1H73 A;  3K85 A;  4HAC A;  5A2Q Q;  4DV1 E;  4B3R I;  3LNU A;  1Z0W A;  1Z0T A;  4LF7 E;  4OX9 E;  3PYE A;  4DV2 I;  3QT6 A;  4Z7Y A;  1ZM9 A;  1B62 A;  1XMO I;  4R1F A;  4JI5 I;  2OI2 A;  4MYU A;  4JI6 I;  2NPF A;  4LF9 I;  4YY3 I;  2IOQ A;  3J81 Q;  4DV3 E;  4HXZ A;  3J7A M;  4GKK I;  2Z5B B;  4DV4 I;  4LFB I;  4JI0 I;  3WU5 A;  2F4V I;  2UUB I;  4UTG A;  2VQE I;  2UUC E;  4LF5 E;  4WUC A;  1NHJ A;  4DPY A;  2UXB I;  4GKJ I;  3T1Y I;  4IZJ A;  1J5E I;  2PNL A;  2EFG A;  3LTO A;  5LL6 R;  1Z5A A;  2J7K A;  1KIJ A;  1RRE A;  4XTJ A;  2V34 A;  3ZM7 A;  4JYA I;  1MU5 A;  3HUL A;  3JAM Q;  4NXN E;  2R42 A;  4LF8 E;  2HHH E;  1HNX I;  1OJ4 A;  4AQY E;  1XNR E;  5FLX C;  1EA6 A;  5BR8 E;  4DR7 I;  4LF4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...