4AQYI

Structure of ribosome-apramycin complexes
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4aqyI00
4LF7E 1Z0WA 1VISA 2VQEI 1FWLA 4JV5I 1N0VC 4LF9I 4GKKE 4JYAI 4JG4A 3JAMC 2UUCI 3B8HA 2BV3A 3WU3A 2V2ZA 1N32I 2CZ9A 4LF5E 2UUAI 2AJ4A 3V5RA 1Z0VA 4B3SE 4DV5I 4GKKI 4DV1I 1H72C 2BM0A 2UXCE 1N0UA 4FWHA 1EA6A 4YHHE 2BM1A 4JI6E 4DV4E 1Z59A 1NHHA 2X36A 1Z0EA 3PYDA 3T1HE 3WU4A 1U2RA 2NPFA 2UXDE 5LMNI 1J5EE 1RREA 1Z0BA 4LFAI 5LL6R 4K0KE 4I3HA 1N33E 4OX9I 2HKEA 2E5LE 3J7AG 4DR2E 2J7KA 1N34E 4JI1E 1ELOA 2XEXA 4JI5E 2LJPA 1HNWI 2A2DA 1N33I 4MYUA 1H7SA 1ZXMA 2HHHI 4JI0I 4DR3I 1HNXI 4DR5E 4DR1E 1I94I 4JI2I 3J80Q 3ZM7A 3QT8A 1ZXNA 5BR8E 4JI5I 1Z0TA 4X65I 1IBLE 4DXLA 3J81Q 4DV0E 3ZKDA 1XNQI 4DR5I 4JI7E 4YY3E 4DPTA 1ZM9A 4DR1I 2HFUA 1XNRI 1H7UA 1K47A 2ZM6E 2UU9E 4Z7CA 1FKAE 4LF8I 1QZRA 4LF4E 2DEJA 4X64I 4JI7I 5A2QC 1EI1A 3OTOE 4DV6I 2F4VI 2UU9I 4B3ME 4DUZE 4GKJE 3D4JA 1HNZE 4DR6I 1Z0GA 1Z0CA 2A2CA 4X62I 4DR4I 5IT9C 4WUBA 4LF7I 5A2QQ 4B3MI 4NXNE 2ZBKB 1B62A 1Z5AA 4RPFA 4X66E 4NXME 4B3TE 1XMQE 1NHIA 3T1YE 4HY1A 4AQYE 4LF5I 4B3SI 4M1KA 1NHJA 3JAMQ 5IT9Q 4LFBE 5IWAE 2UUBE 4PRVA 2UXCI 4HYMA 3T1YI 1N36E 1MU5A 1IBME 4YHHI 2OI2A 4JI6I 4DPYA 4JI4E 3ZZTA 4DV4I 2UXBE 3T1HI 4WUCA 1N36I 1IBMI 4JI8E 2V2VA 4USMA 1ZM3A 2UXDI 4HACA 1RR9A 4LF6E 1J5EI 1OJ4A 1IBKE 3ZZ0A 4JI4I 1Z5BA 2HK2A 1S4EA 3QT7A 4K0KI 1FJGE 1XMOE 3B82A 2E5LI 4DR2I 4USKA 1N34I 1H74A 1HR0E 4JI1I 1IBKI 4DV3E 2VQFE 5FLXC 1KKHA 4WUDA 4DUYE 1S16A 1H73A 5L3JA 1D6TA 4MYTA 1ZM4A 4URLA 4DV3I 5BR8I 2V2QA 4DV2E 1KVKA 4DUYI 2HK3A 1PVGA 1A6FA 2Q2EB 4JI3E 1IBLI 4DV0I 1Z5CA 1UEKA 4KHPE 4YY3I 2WW4A 3K1JA 5FLXQ 4FW9A 4DR7E 3LPSA 2VF3A 3LNUA 4P7AA 2ZM6I 3WU5A 4FWGA 3ZZUA 4JI3I 1KIJA 4LF4I 4PU9A 3V2UC 2VQEE 4JV5E 3OTOI 5LMUE 4HACB 4LF9E 4EMDA 4KQVA 4HXZA 4JYAE 1FI4A 2UUCE 1B63A 4DUZI 4GKJI 3HULA 4XTJA 1N32E 2GS8A 1HNZI 2ZITA 2UUAE 2DEIA 5LMUI 2V34A 2X7IA 3QT5A 4DV5E 4DV1E 3QT6A 4Z7YA 4DU8A 4UT4A 4NXNI 4X66I 4NXMI 4B3TI 1XMQI 5GMEA 1DARA 4DV7E 4R1FA 2R42A 3WU6A 4DPWA 4AQYI 4PRXA 4LFBI 5IWAI 5LMNE 2UUBI 4LFAE 2HFSA 4DV7I 4OX9E 4UTGA 3B78A 1PIEA 2UXBI 4B3RE 3F0NA 4ED4A 1KTVA 1HNWE 3J80C 2HHHE 4FWDA 1BKNA 4JI0E 4JI8I 4DR3E 1HNXE 4LF6I 4ZVIA 4DU7A 3CWVA 1I94E 4JI2E 1ZM2A 4P52A 2R3VA 3J81C 4B3RI 2HKJA 2V8PA 4DPUA 1FJGI 1XMOI 3M6AA 4X65E 4FN5A 3Q1QA 4LFCE 2E1RA 1XNQE 1MX0A 1HR0I 1WUUA 2VQFI 3GONA 1XHKA 1FWKA 1XNRE 4DPXA 3J7AM 4LFCI 4LF8E 1MG7A 4X64E 4DV2I 1FNMA 4DV6E 3ZKBA 2F4VE 3K17A 4KHPI 4DR7I 1NZ0A 4DR6E 5GMDA 3H4LA 4X62E 3PYEA 1PKPA 3PYFA 4DR4E 3PYGA 3LTOA 2EFGA
chains in the Genus database with same CATH superfamily
4IFDB 4LF7E 1Z0WA 1VISA 2VQEI 1FWLA 4FW4A 4JV5I 1N0VC 4BA1A 4LF9I 4GKKE 4JYAI 2WP8B 1R6MA 3PS2A 4JG4A 3JAMC 2UUCI 3B8HA 2BV3A 3WU3A 4MQYA 2WNRA 2V2ZA 1N32I 2CVEA 2CZ9A 5C0XA 4LF5E 5DROA 4LCGA 2UUAI 2AJ4A 2BA1G 3V5RA 1Z0VA 4B3SE 2JEBA 4DV5I 4GKKI 3KRNA 4DV1I 1H72C 2BM0A 2Z5EA 2UXCE 1N0UA 4FWHA 2GO4A 4LOMA 1EA6A 3Q6NA 2Z5CA 4NBQA 4YHHE 4OO1D 5K36D 2BM1A 4JI6E 4DV4E 1Z59A 1NHHA 2IESA 5JEAF 2X36A 1Z0EA 3PYDA 3T1HE 3WU4A 4MU3A 1U2RA 2NPFA 5C0XF 2PO0A 4IS9A 2UXDE 5LMNI 1J5EE 1RREA 1Z0BA 4LFAI 2C39A 5LL6R 4K0KE 4I3HA 1N33E 4OX9I 2HKEA 5JEAE 2E5LE 3K85A 3L7ZB 4N3OA 3J7AG 2PO1B 4OO1A 4DR2E 5JEAC 2J7KA 5C0XE 1N34E 4JI1E 1ELOA 2XEXA 5C0XC 4JI5E 2LJPA 4BA1B 1HNWI 2A2DA 1N33I 4MYUA 1H7SA 1ZXMA 2HHHI 4JI0I 4DR3I 4AIDA 1HNXI 5JEAB 4DR5E 1Y6ZA 4DR1E 1I94I 4JI2I 3J80Q 5C0XB 3ZM7A 3QT8A 3M85D 2O1TA 4OKGA 1ZXNA 4IZJD 5BR8E 4JI5I 3P3GA 1Z0TA 4X65I 2O3ZA 4QNKA 3J81Q 4DXLA 4DV0E 1IBLE 3ZKDA 1XNQI 4DR5I 4OO1F 4JI7E 4YY3E 4DPTA 3UHMA 1ZM9A 4DR1I 2Z5CB 2HFUA 1Y4UA 4ISAA 1XNRI 2Z5BB 3HJCA 2GQ0A 1H7UA 1K47A 2ZM6E 1XXEA 4FW6A 2UU9E 4Z7CA 2JEAA 1FKAE 4LF8I 1QZRA 4LF4E 2DEJA 4X64I 4JI7I 5A2QC 2PO2A 4OO1E 1EI1A 3OTOE 2C38B 4DV6I 2AE8A 4OO1C 5K36C 2F4VI 2C39B 1E3HA 2UU9I 4B3ME 4DUZE 4GKJE 2C37A 4J3DA 2F1DA 4LCHA 3D4JA 1HNZE 4DR6I 4OO1B 5K36B 1Z0GA 1Z0CA 2A2CA 4X62I 4DR4I 5IT9C 4WUBA 2PNZA 4LF7I 5A2QQ 4B3MI 2IERA 3B4TA 3M7ND 5DRPA 4NXNE 1R6LA 2ZBKB 5DNLA 1B62A 1Z5AA 4RPFA 3U1YA 4X66E 4NXME 2NN6D 4B3TE 1XMQE 2BR2A 1NHIA 3CDIA 3T1YE 4HY1A 4AQYE 4LF5I 4B3SI 4M1KA 1NHJA 3PS1A 3JAMQ 5IT9Q 4LFBE 4LCFA 5IWAE 2UUBE 4PRVA 2IOQA 2UXCI 4HYMA 3T1YI 1N36E 1MU5A 2JE6A 4IZKB 1IBME 4YHHI 1OYPA 2OI2A 4JI6I 2JEAB 4DPYA 4JI4E 3ZZTA 4DV4I 2UXBE 2BA1D 2NN6A 3T1HI 4U3BA 4IZJB 4WUCA 1Y5YA 1UDOA 1N36I 1IBMI 4JI8E 2V2VA 4USMA 1ZM3A 2UXDI 1OYRA 4HACA 1RR9A 4LF6E 1OJ4A 1J5EI 4MU1A 1IBKE 3ZZ0A 4JI4I 1YH8A 1Z5BA 2C37B 2HK2A 1S4EA 3QT7A 4K0KI 1FJGE 1XMOE 1Y60A 3B82A 3GMEA 2E5LI 2PNZB 2WNRB 1UDSA 4DR2I 4GQUA 4USKA 1N34I 1H74A 1HR0E 4JI1I 1IBKI 4DV3E 2BA0D 2VQFE 2NN6F 2JEBB 5FLXC 1KKHA 4WUDA 4DUYE 1S16A 1H73A 5L3JA 1D6TA 4MYTA 1ZM4A 4URLA 4DV3I 5BR8I 2V2QA 3GLLA 4DV2E 1KVKA 3U1KA 4DUYI 2HK3A 1PVGA 2NN6E 1A6FA 2Q2EB 4JI3E 1IBLI 3GCMA 4DV0I 1Z5CA 1UEKA 4KHPE 2NN6C 4YY3I 2WW4A 4MU0A 3K1JA 5FLXQ 4FW9A 2PO0B 4DR7E 3LPSA 2VF3A 3LNUA 3PRYA 2JT2A 4P7AA 2ZM6I 3H1CA 5DRQA 3WU5A 4FWGA 2NN6B 3ZZUA 4JI3I 1KIJA 4LF4I 4PU9A 3V2UC 2VQEE 4JV5E 3OTOI 5LMUE 4HACB 4LF9E 4EMDA 4KQVA 4HXZA 3NZKA 3Q6MA 4JYAE 1FI4A 2UUCE 1B63A 4DUZI 4GKJI 2PO1A 3HULA 4XTJA 1N32E 2GS8A 4BA2A 2CGEA 2GO3A 1VI7A 2J65A 1HNZI 2ZITA 2UUAE 5DRRA 2DEIA 5LMUI 2V34A 2X7IA 3QT5A 4DV5E 4DV1E 3QT6A 1UDQA 5JEAA 4AM3A 4Z7YA 4DU8A 1USUA 4UT4A 4NXNI 3P06A 1YHCA 4X66I 4NXMI 3PS3A 4B3TI 1XMQI 5GMEA 4IFDD 2O1VA 1DARA 4DV7E 4R1FA 2O1UA 4FW3A 2R42A 3WU6A 4DPWA 4AQYI 4PRXA 3HKMA 4LFBI 5IWAI 5LMNE 2UUBI 2Z5BA 2PO2B 4LFAE 2HFSA 2CG9A 1UDNA 3CDJA 4DV7I 4OX9E 1Y4SA 4UTGA 3B78A 3M85G 4MDTA 2BA0G 2C38A 1PIEA 2UXBI 4B3RE 3F0NA 4ED4A 1KTVA 4IFDA 4U3DA 1HNWE 3J80C 2HHHE 4FWDA 1BKNA 4JI0E 4JI8I 4DR3E 2O1WA 1HNXE 1RHYA 4LF6I 4ZVIA 4DU7A 2WP8A 5K36A 3CWVA 1I94E 4JI2E 4BA2B 1ZM2A 4P52A 2R3VA 5EKWA 3J81C 4B3RI 1E3PA 2HKJA 2V8PA 4DPUA 1FJGI 1XMOI 4MU4A 3M6AA 2VESA 4X65E 3P3CA 2BR2B 4FN5A 3Q1QA 4LFCE 2E1RA 1XNQE 1MX0A 3P3EA 2PNMA 5FWKA 1HR0I 1WUUA 2VQFI 3GONA 1XHKA 4IFDF 1FWKA 1XNRE 4AIMA 4DPXA 1OYSA 5EL9A 3J7AM 4LFCI 2JE6B 4LF8E 1P42A 4LPFA 5K36F 1MG7A 4X64E 4DV2I 1FNMA 4DV6E 1USVA 5JEAD 4IFDE 3M7NG 3ZKBA 4IZKA 2F4VE 3K17A 4KHPI 4QNJA 5DNXA 5ELWA 5C0XD 4IFDC 4FW5A 3P76A 1HK7A 4DR7I 1NZ0A 4FW7A 2PNLA 4DR6E 5K36E 2IOPA 3DD6A 5GMDA 3H4LA 4OZEA 3L7ZA 1PKPA 3PYFA 3PYEA 4IZJA 4X62E 4DR4E 3PYGA 3LTOA 2EFGA
chains in the Genus database with same CATH topology
4LF7E 1Z0WA 1VISA 2VQEI 1FWLA 4JV5I 1N0VC 4LF9I 4GKKE 4JYAI 4JG4A 3JAMC 2UUCI 3B8HA 2BV3A 3WU3A 2V2ZA 1N32I 2CZ9A 4LF5E 2UUAI 2AJ4A 3V5RA 1Z0VA 4B3SE 4DV5I 4GKKI 4DV1I 1H72C 2BM0A 2Z5EA 2UXCE 1N0UA 4FWHA 1EA6A 3Q6NA 2Z5CA 4YHHE 2BM1A 4JI6E 4DV4E 1Z59A 1NHHA 2X36A 1Z0EA 3PYDA 3T1HE 3WU4A 1U2RA 2NPFA 2UXDE 5LMNI 1J5EE 1RREA 1Z0BA 4LFAI 5LL6R 4K0KE 4I3HA 1N33E 4OX9I 2HKEA 2E5LE 3K85A 4N3OA 3J7AG 4DR2E 2J7KA 1N34E 4JI1E 1ELOA 2XEXA 4JI5E 2LJPA 1HNWI 2A2DA 1N33I 4MYUA 1H7SA 1ZXMA 2HHHI 4JI0I 4DR3I 1HNXI 4DR5E 1Y6ZA 4DR1E 1I94I 4JI2I 3J80Q 3ZM7A 3QT8A 2O1TA 1ZXNA 4IZJD 5BR8E 4JI5I 1Z0TA 4X65I 3J81Q 4DXLA 4DV0E 1IBLE 3ZKDA 1XNQI 4DR5I 4JI7E 4YY3E 4DPTA 1ZM9A 4DR1I 2Z5CB 2HFUA 1Y4UA 1XNRI 2Z5BB 3HJCA 2GQ0A 1H7UA 1K47A 2ZM6E 2UU9E 4Z7CA 1FKAE 4LF8I 1QZRA 4LF4E 2DEJA 4X64I 4JI7I 5A2QC 1EI1A 3OTOE 4DV6I 2F4VI 2UU9I 4B3ME 4DUZE 4GKJE 3D4JA 1HNZE 4DR6I 1Z0GA 1Z0CA 2A2CA 4X62I 4DR4I 5IT9C 4WUBA 4LF7I 5A2QQ 4B3MI 4NXNE 2ZBKB 1B62A 1Z5AA 4RPFA 4X66E 4NXME 4B3TE 1XMQE 1NHIA 3T1YE 4HY1A 4AQYE 4LF5I 4B3SI 4M1KA 1NHJA 3JAMQ 5IT9Q 4LFBE 5IWAE 2UUBE 4PRVA 2IOQA 2UXCI 4HYMA 3T1YI 1N36E 1MU5A 4IZKB 1IBME 4YHHI 2OI2A 4JI6I 4DPYA 4JI4E 3ZZTA 4DV4I 2UXBE 3T1HI 4IZJB 4WUCA 1N36I 1IBMI 4JI8E 2V2VA 4USMA 1ZM3A 2UXDI 4HACA 1RR9A 4LF6E 1OJ4A 1J5EI 1IBKE 3ZZ0A 4JI4I 1Z5BA 2HK2A 1S4EA 3QT7A 4K0KI 1FJGE 1XMOE 3B82A 2E5LI 4DR2I 4USKA 1N34I 1H74A 1HR0E 4JI1I 1IBKI 4DV3E 2VQFE 5FLXC 1KKHA 4WUDA 4DUYE 1S16A 1H73A 5L3JA 1D6TA 4MYTA 1ZM4A 4URLA 4DV3I 5BR8I 2V2QA 4DV2E 1KVKA 4DUYI 2HK3A 1PVGA 1A6FA 2Q2EB 4JI3E 1IBLI 4DV0I 1Z5CA 1UEKA 4KHPE 4YY3I 2WW4A 3K1JA 5FLXQ 4FW9A 4DR7E 3LPSA 2VF3A 3LNUA 3PRYA 4P7AA 2ZM6I 3WU5A 4FWGA 3ZZUA 4JI3I 1KIJA 4LF4I 4PU9A 3V2UC 2VQEE 4JV5E 3OTOI 5LMUE 4HACB 4LF9E 4EMDA 4KQVA 4HXZA 3Q6MA 4JYAE 1FI4A 2UUCE 1B63A 4DUZI 4GKJI 3HULA 4XTJA 1N32E 2GS8A 2CGEA 1HNZI 2ZITA 2UUAE 2DEIA 5LMUI 2V34A 2X7IA 3QT5A 4DV5E 4DV1E 3QT6A 4Z7YA 4DU8A 1USUA 4UT4A 4NXNI 3P06A 4X66I 4NXMI 4B3TI 1XMQI 5GMEA 2O1VA 1DARA 4DV7E 4R1FA 2O1UA 2R42A 3WU6A 4DPWA 4AQYI 4PRXA 4LFBI 5IWAI 5LMNE 2UUBI 2Z5BA 4LFAE 2HFSA 2CG9A 4DV7I 4OX9E 1Y4SA 4UTGA 3B78A 1PIEA 2UXBI 4B3RE 3F0NA 4ED4A 1KTVA 1HNWE 3J80C 2HHHE 4FWDA 1BKNA 4JI0E 4JI8I 4DR3E 2O1WA 1HNXE 4LF6I 4ZVIA 4DU7A 3CWVA 1I94E 4JI2E 1ZM2A 4P52A 2R3VA 3J81C 4B3RI 2HKJA 2V8PA 4DPUA 1FJGI 1XMOI 3M6AA 4X65E 4FN5A 3Q1QA 4LFCE 2E1RA 1XNQE 1MX0A 2PNMA 5FWKA 1HR0I 1WUUA 2VQFI 3GONA 1XHKA 1FWKA 1XNRE 4DPXA 3J7AM 4LFCI 4LF8E 1MG7A 4X64E 4DV2I 1FNMA 4DV6E 1USVA 3ZKBA 4IZKA 2F4VE 3K17A 4KHPI 1HK7A 4DR7I 1NZ0A 2PNLA 4DR6E 2IOPA 5GMDA 3H4LA 4X62E 3PYEA 1PKPA 3PYFA 4IZJA 4DR4E 3PYGA 3LTOA 2EFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 E;  1Z0W A;  1VIS A;  2VQE I;  1FWL A;  4JV5 I;  1N0V C;  4LF9 I;  4GKK E;  4JYA I;  4JG4 A;  3JAM C;  2UUC I;  3B8H A;  2BV3 A;  3WU3 A;  2V2Z A;  1N32 I;  2CZ9 A;  4LF5 E;  2UUA I;  2AJ4 A;  3V5R A;  1Z0V A;  4B3S E;  4DV5 I;  4GKK I;  4DV1 I;  1H72 C;  2BM0 A;  2UXC E;  1N0U A;  4FWH A;  1EA6 A;  4YHH E;  2BM1 A;  4JI6 E;  4DV4 E;  1Z59 A;  1NHH A;  2X36 A;  1Z0E A;  3PYD A;  3T1H E;  3WU4 A;  1U2R A;  2NPF A;  2UXD E;  5LMN I;  1J5E E;  1RRE A;  1Z0B A;  4LFA I;  5LL6 R;  4K0K E;  4I3H A;  1N33 E;  4OX9 I;  2HKE A;  2E5L E;  3J7A G;  4DR2 E;  2J7K A;  1N34 E;  4JI1 E;  1ELO A;  2XEX A;  4JI5 E;  2LJP A;  1HNW I;  2A2D A;  1N33 I;  4MYU A;  1H7S A;  1ZXM A;  2HHH I;  4JI0 I;  4DR3 I;  1HNX I;  4DR5 E;  4DR1 E;  1I94 I;  4JI2 I;  3J80 Q;  3ZM7 A;  3QT8 A;  1ZXN A;  5BR8 E;  4JI5 I;  1Z0T A;  4X65 I;  1IBL E;  4DXL A;  3J81 Q;  4DV0 E;  3ZKD A;  1XNQ I;  4DR5 I;  4JI7 E;  4YY3 E;  4DPT A;  1ZM9 A;  4DR1 I;  2HFU A;  1XNR I;  1H7U A;  1K47 A;  2ZM6 E;  2UU9 E;  4Z7C A;  1FKA E;  4LF8 I;  1QZR A;  4LF4 E;  2DEJ A;  4X64 I;  4JI7 I;  5A2Q C;  1EI1 A;  3OTO E;  4DV6 I;  2F4V I;  2UU9 I;  4B3M E;  4DUZ E;  4GKJ E;  3D4J A;  1HNZ E;  4DR6 I;  1Z0G A;  1Z0C A;  2A2C A;  4X62 I;  4DR4 I;  5IT9 C;  4WUB A;  4LF7 I;  5A2Q Q;  4B3M I;  4NXN E;  2ZBK B;  1B62 A;  1Z5A A;  4RPF A;  4X66 E;  4NXM E;  4B3T E;  1XMQ E;  1NHI A;  3T1Y E;  4HY1 A;  4AQY E;  4LF5 I;  4B3S I;  4M1K A;  1NHJ A;  3JAM Q;  5IT9 Q;  4LFB E;  5IWA E;  2UUB E;  4PRV A;  2UXC I;  4HYM A;  3T1Y I;  1N36 E;  1MU5 A;  1IBM E;  4YHH I;  2OI2 A;  4JI6 I;  4DPY A;  4JI4 E;  3ZZT A;  4DV4 I;  2UXB E;  3T1H I;  4WUC A;  1N36 I;  1IBM I;  4JI8 E;  2V2V A;  4USM A;  1ZM3 A;  2UXD I;  4HAC A;  1RR9 A;  4LF6 E;  1J5E I;  1OJ4 A;  1IBK E;  3ZZ0 A;  4JI4 I;  1Z5B A;  2HK2 A;  1S4E A;  3QT7 A;  4K0K I;  1FJG E;  1XMO E;  3B82 A;  2E5L I;  4DR2 I;  4USK A;  1N34 I;  1H74 A;  1HR0 E;  4JI1 I;  1IBK I;  4DV3 E;  2VQF E;  5FLX C;  1KKH A;  4WUD A;  4DUY E;  1S16 A;  1H73 A;  5L3J A;  1D6T A;  4MYT A;  1ZM4 A;  4URL A;  4DV3 I;  5BR8 I;  2V2Q A;  4DV2 E;  1KVK A;  4DUY I;  2HK3 A;  1PVG A;  1A6F A;  2Q2E B;  4JI3 E;  1IBL I;  4DV0 I;  1Z5C A;  1UEK A;  4KHP E;  4YY3 I;  2WW4 A;  3K1J A;  5FLX Q;  4FW9 A;  4DR7 E;  3LPS A;  2VF3 A;  3LNU A;  4P7A A;  2ZM6 I;  3WU5 A;  4FWG A;  3ZZU A;  4JI3 I;  1KIJ A;  4LF4 I;  4PU9 A;  3V2U C;  2VQE E;  4JV5 E;  3OTO I;  5LMU E;  4HAC B;  4LF9 E;  4EMD A;  4KQV A;  4HXZ A;  4JYA E;  1FI4 A;  2UUC E;  1B63 A;  4DUZ I;  4GKJ I;  3HUL A;  4XTJ A;  1N32 E;  2GS8 A;  1HNZ I;  2ZIT A;  2UUA E;  2DEI A;  5LMU I;  2V34 A;  2X7I A;  3QT5 A;  4DV5 E;  4DV1 E;  3QT6 A;  4Z7Y A;  4DU8 A;  4UT4 A;  4NXN I;  4X66 I;  4NXM I;  4B3T I;  1XMQ I;  5GME A;  1DAR A;  4DV7 E;  4R1F A;  2R42 A;  3WU6 A;  4DPW A;  4AQY I;  4PRX A;  4LFB I;  5IWA I;  5LMN E;  2UUB I;  4LFA E;  2HFS A;  4DV7 I;  4OX9 E;  4UTG A;  3B78 A;  1PIE A;  2UXB I;  4B3R E;  3F0N A;  4ED4 A;  1KTV A;  1HNW E;  3J80 C;  2HHH E;  4FWD A;  1BKN A;  4JI0 E;  4JI8 I;  4DR3 E;  1HNX E;  4LF6 I;  4ZVI A;  4DU7 A;  3CWV A;  1I94 E;  4JI2 E;  1ZM2 A;  4P52 A;  2R3V A;  3J81 C;  4B3R I;  2HKJ A;  2V8P A;  4DPU A;  1FJG I;  1XMO I;  3M6A A;  4X65 E;  4FN5 A;  3Q1Q A;  4LFC E;  2E1R A;  1XNQ E;  1MX0 A;  1HR0 I;  1WUU A;  2VQF I;  3GON A;  1XHK A;  1FWK A;  1XNR E;  4DPX A;  3J7A M;  4LFC I;  4LF8 E;  1MG7 A;  4X64 E;  4DV2 I;  1FNM A;  4DV6 E;  3ZKB A;  2F4V E;  3K17 A;  4KHP I;  4DR7 I;  1NZ0 A;  4DR6 E;  5GMD A;  3H4L A;  4X62 E;  3PYE A;  1PKP A;  3PYF A;  4DR4 E;  3PYG A;  3LTO A;  2EFG A; 
#chains in the Genus database with same CATH topology
 4IFD B;  4LF7 E;  1Z0W A;  1VIS A;  2VQE I;  1FWL A;  4FW4 A;  4JV5 I;  1N0V C;  4BA1 A;  4LF9 I;  4GKK E;  4JYA I;  2WP8 B;  1R6M A;  3PS2 A;  4JG4 A;  3JAM C;  2UUC I;  3B8H A;  2BV3 A;  3WU3 A;  4MQY A;  2WNR A;  2V2Z A;  1N32 I;  2CVE A;  2CZ9 A;  5C0X A;  4LF5 E;  5DRO A;  4LCG A;  2UUA I;  2AJ4 A;  2BA1 G;  3V5R A;  1Z0V A;  4B3S E;  2JEB A;  4DV5 I;  4GKK I;  3KRN A;  4DV1 I;  1H72 C;  2BM0 A;  2Z5E A;  2UXC E;  1N0U A;  4FWH A;  2GO4 A;  4LOM A;  1EA6 A;  3Q6N A;  2Z5C A;  4NBQ A;  4YHH E;  4OO1 D;  5K36 D;  2BM1 A;  4JI6 E;  4DV4 E;  1Z59 A;  1NHH A;  2IES A;  5JEA F;  2X36 A;  1Z0E A;  3PYD A;  3T1H E;  3WU4 A;  4MU3 A;  1U2R A;  2NPF A;  5C0X F;  2PO0 A;  4IS9 A;  2UXD E;  5LMN I;  1J5E E;  1RRE A;  1Z0B A;  4LFA I;  2C39 A;  5LL6 R;  4K0K E;  4I3H A;  1N33 E;  4OX9 I;  2HKE A;  5JEA E;  2E5L E;  3K85 A;  3L7Z B;  4N3O A;  3J7A G;  2PO1 B;  4OO1 A;  4DR2 E;  5JEA C;  2J7K A;  5C0X E;  1N34 E;  4JI1 E;  1ELO A;  2XEX A;  5C0X C;  4JI5 E;  2LJP A;  4BA1 B;  1HNW I;  2A2D A;  1N33 I;  4MYU A;  1H7S A;  1ZXM A;  2HHH I;  4JI0 I;  4DR3 I;  4AID A;  1HNX I;  5JEA B;  4DR5 E;  1Y6Z A;  4DR1 E;  1I94 I;  4JI2 I;  3J80 Q;  5C0X B;  3ZM7 A;  3QT8 A;  3M85 D;  2O1T A;  4OKG A;  1ZXN A;  4IZJ D;  5BR8 E;  4JI5 I;  3P3G A;  1Z0T A;  4X65 I;  2O3Z A;  4QNK A;  3J81 Q;  4DXL A;  4DV0 E;  1IBL E;  3ZKD A;  1XNQ I;  4DR5 I;  4OO1 F;  4JI7 E;  4YY3 E;  4DPT A;  3UHM A;  1ZM9 A;  4DR1 I;  2Z5C B;  2HFU A;  1Y4U A;  4ISA A;  1XNR I;  2Z5B B;  3HJC A;  2GQ0 A;  1H7U A;  1K47 A;  2ZM6 E;  1XXE A;  4FW6 A;  2UU9 E;  4Z7C A;  2JEA A;  1FKA E;  4LF8 I;  1QZR A;  4LF4 E;  2DEJ A;  4X64 I;  4JI7 I;  5A2Q C;  2PO2 A;  4OO1 E;  1EI1 A;  3OTO E;  2C38 B;  4DV6 I;  2AE8 A;  4OO1 C;  5K36 C;  2F4V I;  2C39 B;  1E3H A;  2UU9 I;  4B3M E;  4DUZ E;  4GKJ E;  2C37 A;  4J3D A;  2F1D A;  4LCH A;  3D4J A;  1HNZ E;  4DR6 I;  4OO1 B;  5K36 B;  1Z0G A;  1Z0C A;  2A2C A;  4X62 I;  4DR4 I;  5IT9 C;  4WUB A;  2PNZ A;  4LF7 I;  5A2Q Q;  4B3M I;  2IER A;  3B4T A;  3M7N D;  5DRP A;  4NXN E;  1R6L A;  2ZBK B;  5DNL A;  1B62 A;  1Z5A A;  4RPF A;  3U1Y A;  4X66 E;  4NXM E;  2NN6 D;  4B3T E;  1XMQ E;  2BR2 A;  1NHI A;  3CDI A;  3T1Y E;  4HY1 A;  4AQY E;  4LF5 I;  4B3S I;  4M1K A;  1NHJ A;  3PS1 A;  3JAM Q;  5IT9 Q;  4LFB E;  4LCF A;  5IWA E;  2UUB E;  4PRV A;  2IOQ A;  2UXC I;  4HYM A;  3T1Y I;  1N36 E;  1MU5 A;  2JE6 A;  4IZK B;  1IBM E;  4YHH I;  1OYP A;  2OI2 A;  4JI6 I;  2JEA B;  4DPY A;  4JI4 E;  3ZZT A;  4DV4 I;  2UXB E;  2BA1 D;  2NN6 A;  3T1H I;  4U3B A;  4IZJ B;  4WUC A;  1Y5Y A;  1UDO A;  1N36 I;  1IBM I;  4JI8 E;  2V2V A;  4USM A;  1ZM3 A;  2UXD I;  1OYR A;  4HAC A;  1RR9 A;  4LF6 E;  1OJ4 A;  1J5E I;  4MU1 A;  1IBK E;  3ZZ0 A;  4JI4 I;  1YH8 A;  1Z5B A;  2C37 B;  2HK2 A;  1S4E A;  3QT7 A;  4K0K I;  1FJG E;  1XMO E;  1Y60 A;  3B82 A;  3GME A;  2E5L I;  2PNZ B;  2WNR B;  1UDS A;  4DR2 I;  4GQU A;  4USK A;  1N34 I;  1H74 A;  1HR0 E;  4JI1 I;  1IBK I;  4DV3 E;  2BA0 D;  2VQF E;  2NN6 F;  2JEB B;  5FLX C;  1KKH A;  4WUD A;  4DUY E;  1S16 A;  1H73 A;  5L3J A;  1D6T A;  4MYT A;  1ZM4 A;  4URL A;  4DV3 I;  5BR8 I;  2V2Q A;  3GLL A;  4DV2 E;  1KVK A;  3U1K A;  4DUY I;  2HK3 A;  1PVG A;  2NN6 E;  1A6F A;  2Q2E B;  4JI3 E;  1IBL I;  3GCM A;  4DV0 I;  1Z5C A;  1UEK A;  4KHP E;  2NN6 C;  4YY3 I;  2WW4 A;  4MU0 A;  3K1J A;  5FLX Q;  4FW9 A;  2PO0 B;  4DR7 E;  3LPS A;  2VF3 A;  3LNU A;  3PRY A;  2JT2 A;  4P7A A;  2ZM6 I;  3H1C A;  5DRQ A;  3WU5 A;  4FWG A;  2NN6 B;  3ZZU A;  4JI3 I;  1KIJ A;  4LF4 I;  4PU9 A;  3V2U C;  2VQE E;  4JV5 E;  3OTO I;  5LMU E;  4HAC B;  4LF9 E;  4EMD A;  4KQV A;  4HXZ A;  3NZK A;  3Q6M A;  4JYA E;  1FI4 A;  2UUC E;  1B63 A;  4DUZ I;  4GKJ I;  2PO1 A;  3HUL A;  4XTJ A;  1N32 E;  2GS8 A;  4BA2 A;  2CGE A;  2GO3 A;  1VI7 A;  2J65 A;  1HNZ I;  2ZIT A;  2UUA E;  5DRR A;  2DEI A;  5LMU I;  2V34 A;  2X7I A;  3QT5 A;  4DV5 E;  4DV1 E;  3QT6 A;  1UDQ A;  5JEA A;  4AM3 A;  4Z7Y A;  4DU8 A;  1USU A;  4UT4 A;  4NXN I;  3P06 A;  1YHC A;  4X66 I;  4NXM I;  3PS3 A;  4B3T I;  1XMQ I;  5GME A;  4IFD D;  2O1V A;  1DAR A;  4DV7 E;  4R1F A;  2O1U A;  4FW3 A;  2R42 A;  3WU6 A;  4DPW A;  4AQY I;  4PRX A;  3HKM A;  4LFB I;  5IWA I;  5LMN E;  2UUB I;  2Z5B A;  2PO2 B;  4LFA E;  2HFS A;  2CG9 A;  1UDN A;  3CDJ A;  4DV7 I;  4OX9 E;  1Y4S A;  4UTG A;  3B78 A;  3M85 G;  4MDT A;  2BA0 G;  2C38 A;  1PIE A;  2UXB I;  4B3R E;  3F0N A;  4ED4 A;  1KTV A;  4IFD A;  4U3D A;  1HNW E;  3J80 C;  2HHH E;  4FWD A;  1BKN A;  4JI0 E;  4JI8 I;  4DR3 E;  2O1W A;  1HNX E;  1RHY A;  4LF6 I;  4ZVI A;  4DU7 A;  2WP8 A;  5K36 A;  3CWV A;  1I94 E;  4JI2 E;  4BA2 B;  1ZM2 A;  4P52 A;  2R3V A;  5EKW A;  3J81 C;  4B3R I;  1E3P A;  2HKJ A;  2V8P A;  4DPU A;  1FJG I;  1XMO I;  4MU4 A;  3M6A A;  2VES A;  4X65 E;  3P3C A;  2BR2 B;  4FN5 A;  3Q1Q A;  4LFC E;  2E1R A;  1XNQ E;  1MX0 A;  3P3E A;  2PNM A;  5FWK A;  1HR0 I;  1WUU A;  2VQF I;  3GON A;  1XHK A;  4IFD F;  1FWK A;  1XNR E;  4AIM A;  4DPX A;  1OYS A;  5EL9 A;  3J7A M;  4LFC I;  2JE6 B;  4LF8 E;  1P42 A;  4LPF A;  5K36 F;  1MG7 A;  4X64 E;  4DV2 I;  1FNM A;  4DV6 E;  1USV A;  5JEA D;  4IFD E;  3M7N G;  3ZKB A;  4IZK A;  2F4V E;  3K17 A;  4KHP I;  4QNJ A;  5DNX A;  5ELW A;  5C0X D;  4IFD C;  4FW5 A;  3P76 A;  1HK7 A;  4DR7 I;  1NZ0 A;  4FW7 A;  2PNL A;  4DR6 E;  5K36 E;  2IOP A;  3DD6 A;  5GMD A;  3H4L A;  4OZE A;  3L7Z A;  1PKP A;  3PYF A;  3PYE A;  4IZJ A;  4X62 E;  4DR4 E;  3PYG A;  3LTO A;  2EFG A; 
#chains in the Genus database with same CATH homology
 4LF7 E;  1Z0W A;  1VIS A;  2VQE I;  1FWL A;  4JV5 I;  1N0V C;  4LF9 I;  4GKK E;  4JYA I;  4JG4 A;  3JAM C;  2UUC I;  3B8H A;  2BV3 A;  3WU3 A;  2V2Z A;  1N32 I;  2CZ9 A;  4LF5 E;  2UUA I;  2AJ4 A;  3V5R A;  1Z0V A;  4B3S E;  4DV5 I;  4GKK I;  4DV1 I;  1H72 C;  2BM0 A;  2Z5E A;  2UXC E;  1N0U A;  4FWH A;  1EA6 A;  3Q6N A;  2Z5C A;  4YHH E;  2BM1 A;  4JI6 E;  4DV4 E;  1Z59 A;  1NHH A;  2X36 A;  1Z0E A;  3PYD A;  3T1H E;  3WU4 A;  1U2R A;  2NPF A;  2UXD E;  5LMN I;  1J5E E;  1RRE A;  1Z0B A;  4LFA I;  5LL6 R;  4K0K E;  4I3H A;  1N33 E;  4OX9 I;  2HKE A;  2E5L E;  3K85 A;  4N3O A;  3J7A G;  4DR2 E;  2J7K A;  1N34 E;  4JI1 E;  1ELO A;  2XEX A;  4JI5 E;  2LJP A;  1HNW I;  2A2D A;  1N33 I;  4MYU A;  1H7S A;  1ZXM A;  2HHH I;  4JI0 I;  4DR3 I;  1HNX I;  4DR5 E;  1Y6Z A;  4DR1 E;  1I94 I;  4JI2 I;  3J80 Q;  3ZM7 A;  3QT8 A;  2O1T A;  1ZXN A;  4IZJ D;  5BR8 E;  4JI5 I;  1Z0T A;  4X65 I;  3J81 Q;  4DXL A;  4DV0 E;  1IBL E;  3ZKD A;  1XNQ I;  4DR5 I;  4JI7 E;  4YY3 E;  4DPT A;  1ZM9 A;  4DR1 I;  2Z5C B;  2HFU A;  1Y4U A;  1XNR I;  2Z5B B;  3HJC A;  2GQ0 A;  1H7U A;  1K47 A;  2ZM6 E;  2UU9 E;  4Z7C A;  1FKA E;  4LF8 I;  1QZR A;  4LF4 E;  2DEJ A;  4X64 I;  4JI7 I;  5A2Q C;  1EI1 A;  3OTO E;  4DV6 I;  2F4V I;  2UU9 I;  4B3M E;  4DUZ E;  4GKJ E;  3D4J A;  1HNZ E;  4DR6 I;  1Z0G A;  1Z0C A;  2A2C A;  4X62 I;  4DR4 I;  5IT9 C;  4WUB A;  4LF7 I;  5A2Q Q;  4B3M I;  4NXN E;  2ZBK B;  1B62 A;  1Z5A A;  4RPF A;  4X66 E;  4NXM E;  4B3T E;  1XMQ E;  1NHI A;  3T1Y E;  4HY1 A;  4AQY E;  4LF5 I;  4B3S I;  4M1K A;  1NHJ A;  3JAM Q;  5IT9 Q;  4LFB E;  5IWA E;  2UUB E;  4PRV A;  2IOQ A;  2UXC I;  4HYM A;  3T1Y I;  1N36 E;  1MU5 A;  4IZK B;  1IBM E;  4YHH I;  2OI2 A;  4JI6 I;  4DPY A;  4JI4 E;  3ZZT A;  4DV4 I;  2UXB E;  3T1H I;  4IZJ B;  4WUC A;  1N36 I;  1IBM I;  4JI8 E;  2V2V A;  4USM A;  1ZM3 A;  2UXD I;  4HAC A;  1RR9 A;  4LF6 E;  1OJ4 A;  1J5E I;  1IBK E;  3ZZ0 A;  4JI4 I;  1Z5B A;  2HK2 A;  1S4E A;  3QT7 A;  4K0K I;  1FJG E;  1XMO E;  3B82 A;  2E5L I;  4DR2 I;  4USK A;  1N34 I;  1H74 A;  1HR0 E;  4JI1 I;  1IBK I;  4DV3 E;  2VQF E;  5FLX C;  1KKH A;  4WUD A;  4DUY E;  1S16 A;  1H73 A;  5L3J A;  1D6T A;  4MYT A;  1ZM4 A;  4URL A;  4DV3 I;  5BR8 I;  2V2Q A;  4DV2 E;  1KVK A;  4DUY I;  2HK3 A;  1PVG A;  1A6F A;  2Q2E B;  4JI3 E;  1IBL I;  4DV0 I;  1Z5C A;  1UEK A;  4KHP E;  4YY3 I;  2WW4 A;  3K1J A;  5FLX Q;  4FW9 A;  4DR7 E;  3LPS A;  2VF3 A;  3LNU A;  3PRY A;  4P7A A;  2ZM6 I;  3WU5 A;  4FWG A;  3ZZU A;  4JI3 I;  1KIJ A;  4LF4 I;  4PU9 A;  3V2U C;  2VQE E;  4JV5 E;  3OTO I;  5LMU E;  4HAC B;  4LF9 E;  4EMD A;  4KQV A;  4HXZ A;  3Q6M A;  4JYA E;  1FI4 A;  2UUC E;  1B63 A;  4DUZ I;  4GKJ I;  3HUL A;  4XTJ A;  1N32 E;  2GS8 A;  2CGE A;  1HNZ I;  2ZIT A;  2UUA E;  2DEI A;  5LMU I;  2V34 A;  2X7I A;  3QT5 A;  4DV5 E;  4DV1 E;  3QT6 A;  4Z7Y A;  4DU8 A;  1USU A;  4UT4 A;  4NXN I;  3P06 A;  4X66 I;  4NXM I;  4B3T I;  1XMQ I;  5GME A;  2O1V A;  1DAR A;  4DV7 E;  4R1F A;  2O1U A;  2R42 A;  3WU6 A;  4DPW A;  4AQY I;  4PRX A;  4LFB I;  5IWA I;  5LMN E;  2UUB I;  2Z5B A;  4LFA E;  2HFS A;  2CG9 A;  4DV7 I;  4OX9 E;  1Y4S A;  4UTG A;  3B78 A;  1PIE A;  2UXB I;  4B3R E;  3F0N A;  4ED4 A;  1KTV A;  1HNW E;  3J80 C;  2HHH E;  4FWD A;  1BKN A;  4JI0 E;  4JI8 I;  4DR3 E;  2O1W A;  1HNX E;  4LF6 I;  4ZVI A;  4DU7 A;  3CWV A;  1I94 E;  4JI2 E;  1ZM2 A;  4P52 A;  2R3V A;  3J81 C;  4B3R I;  2HKJ A;  2V8P A;  4DPU A;  1FJG I;  1XMO I;  3M6A A;  4X65 E;  4FN5 A;  3Q1Q A;  4LFC E;  2E1R A;  1XNQ E;  1MX0 A;  2PNM A;  5FWK A;  1HR0 I;  1WUU A;  2VQF I;  3GON A;  1XHK A;  1FWK A;  1XNR E;  4DPX A;  3J7A M;  4LFC I;  4LF8 E;  1MG7 A;  4X64 E;  4DV2 I;  1FNM A;  4DV6 E;  1USV A;  3ZKB A;  4IZK A;  2F4V E;  3K17 A;  4KHP I;  1HK7 A;  4DR7 I;  1NZ0 A;  2PNL A;  4DR6 E;  2IOP A;  5GMD A;  3H4L A;  4X62 E;  3PYE A;  1PKP A;  3PYF A;  4IZJ A;  4DR4 E;  3PYG A;  3LTO A;  2EFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...