3PRYA

Crystal structure of the middle domain of human hsp90-beta refined at 2.3 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
255
Chain Sequence
b'KTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELAEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock protein HSP 90-beta
publication title Crystal structure of the middle domain of human HSP90-beta refined at 2.3 A resolution
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 81
structure length 255
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pryA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pryA02
2CGEA 1Y4UA 3Q6NA 5FWKA 1HK7A 3HJCA 3Q6MA 2IOPA 2IOQA 2O1UA 3PRYA 2O1WA 2O1TA 1USUA 1USVA 1Y4SA 2O1VA 2CG9A 1Y6ZA 2GQ0A
chains in the Genus database with same CATH superfamily
2VYCA 2Q3HA 5FBRB 1HNXE 2BPOA 3A6LA 4YA6A 3I01A 5A5FA 2CDRA 3U09A 2CNWD 2OQ2A 2Z5FA 1TF7A 1EVEA 1GHTA 3EEYA 4KVGA 1DB3A 4LRTB 4N0PA 4YB8A 5ALMA 4BN4A 2XCSB 3LWBA 1V8BA 3UHAA 1S2GA 2EBUA 4DQXA 2XNCA 1FUEA 2VQSA 3JARB 5EIFA 4ZALA 1V1RB 4MYDA 3F6BX 4UTZA 1F1JA 3WU4A 4RJJA 3T7CA 4C0WA 1M74A 3V5RA 1GPKA 3O8DA 4YX9A 4ARUA 1SC4A 1HNWI 1FYWA 4GXTA 3FZYA 4L6CA 4RJTA 1ZOSA 4D3YA 4PBSA 3TKAA 5BSHA 1LQ2A 3ZG6A 4IS2A 4D7AA 4MO9A 4DIFA 2VOJA 3ABRB 1U1DA 1VZ3A 4IFIA 4EMTA 5IWAE 2ZBPA 5EE3A 3WB0A 2EBHX 1YVDA 3QT6A 1CG6A 1D2RA 2P69A 4LZJA 4L7QA 1E4VA 2NOAA 3V33A 1NP6A 2LCQA 1ZCJA 4NE2A 1FP2A 3RARA 2AMJA 2I4IA 3TLYA 2Z3WA 3IQXA 1DZIA 2X4LA 2V7UA 2Z5CB 3OE4A 5KNBA 2XD9A 3R6WA 2V5VA 4EGFA 3QW2A 1KEPA 4UVDA 1O6CA 2A0YA 2AHRA 1UZUA 4LJ5A 3HCFA 1CPYA 4IEIA 2HQBA 4MA5A 5KNBH 3EARA 4RENA 4C0BA 2RHHA 4B73A 5ECGC 3WR5A 5BV7A 4I9NA 2BEWA 3KJFA 3LFUA 4ZXPA 1FPQA 4FYIA 2VHUA 1VPDA 4V2IA 3JPWA 2JGIA 4B85A 3P3EA 1KZ6A 3QEKA 1OIXA 1RZ3A 5BPHA 1P45A 2D0PB 2QAJA 1ZWKA 3L0PA 2P2LA 4PYJA 4QYWA 5IVDA 2R8ZA 2BEUA 4MWDA 3COWA 4CV2A 2JZOA 1A9YA 1E2LA 4MIEA 2GBPA 3RSOA 4LWQA 3OKPA 2GLUA 3DOHA 2XLBA 3SJ7A 2GUWA 2CFRA 1WUIS 4YV0A 4J7AA 2XMQA 3CISA 5HIIA 4JXKA 5JH7F 1C7QA 1W76A 3IIIA 1EFPB 2ZRKA 3UW3A 4CUJA 5JSUA 3OEED 2CVPA 1ANKA 3WDKA 4AS2A 1NNI1 4HADA 1D7AA 1FPMA 3AKDA 2IS1A 4M54A 4EHIA 2PX5A 2BE7A 3ACBA 3C3AA 5A7FA 4YK7A 2PUAA 1GRVA 5T8KA 2OBFA 3ITDA 2ZPAA 5HFNA 2A88A 1L8XA 2XRMA 3L6BA 1G5PA 3GXOA 4PQEA 5CT6A 2LJPA 3KYCB 1L1FA 1W88B 3GWGA 3WLSA 1RLMA 2HXGA 3H84A 3H97A 4A8JA 4DJAA 5LNK6 3LUFA 4BFUA 3QHPA 2ZWMA 3UF0A 1MXFA 5F21A 4L9RA 2C0PA 2OSVA 4EZIA 3AQIA 2XEXA 4RMHA 1Y7PA 3UFXB 1B26A 2I1QA 4U7FA 4DW8A 5BORA 2VQFI 4MW0A 3K15A 1J4AA 4BKRA 2Q4EA 3VU1A 4GLJA 3GB9A 5H1YA 4MKHA 1T29A 4UNPA 3OFKA 2X9VA 2HSZA 3BXFA 4B80A 5C0XE 3QUTA 1Z37A 1QKIA 2BFBA 5KCMA 1UK6A 1Y7HA 2HIMA 4FYJA 4L08A 1ULHA 4GYJA 5GM1A 3BTUA 2ZS7A 4HEA6 2PZEA 3QI2A 3NWOA 1YBMA 1RQRA 3ADKA 3KOYA 2JFVA 4F71A 5T4HA 4EHKA 1XNJA 2DBZA 2WG0A 3HRKA 3PKJA 4CIBA 5KOJA 3FFXA 1TLFA 2C5LA 2I7CA 2RKBA 4IXTA 1RXUA 2WWFA 4EMSA 4QA9A 3N2KA 4UM7A 2EBFX 2VDPB 1N3YA 2Z5VA 4O0LA 5SZHB 1Z0CA 1ZEJA 5C81A 2GNPA 2ZRIA 3TPZA 3LRTA 2CSUA 4XUDA 2AN5A 1ZGZA 3FPEA 3BIOA 4ND6A 4R8SA 4FI3C 4YUVA 5JTTA 1FJGB 4GNRA 4D45A 3KQLA 3D8TA 4RABA 1XWFA 2NTYC 4JY7A 4B40A 2JEOA 2W0SA 2VXOA 3MMSA 4YN3A 5BQXA 3BM5A 4FNGA 3I5XA 2HXSA 5ER9A 1DPFA 5EVJA 2ZRHA 1RJEA 1QIHA 3VR0A 4HFRA 1YHCA 2Z6QA 4QJIA 3KS9A 1IEWA 4KZPA 2C29D 2QYHA 3OEYA 1L5HB 4FSDA 3K0SA 3MAGA 3ED5A 4QDTA 3PHGA 1QO0D 2ROQA 2W7TA 4GBJA 5DLDA 1MDFA 1VJ0A 3RC3A 2BN4A 3TRHA 5LQUA 5MGNA 1VLHA 1KTIA 1V43A 4D25A 5FV7A 4U2GA 2WUEA 1P77A 2JD0A 2BFWA 1QHNA 3CX3A 1HR0B 5EHNA 3SQLA 4MA0A 3STWA 3BRQA 1YCDA 3T99A 2G1UA 2ZJ3A 1IXYA 2I5PO 4KYUA 2XMSA 1PVVA 2X0KA 3DLAA 2CBZA 3HN7A 3E53A 3IUSA 3U3MA 4ERXA 1NYTA 4RDXA 2CLFB 2IKQA 4GQBA 4N9QA 1EX9A 4P4LA 4TMZA 1X15A 3VU8A 3BGDA 2A9VA 1BEEA 1L5SA 2ZFUA 3HY4A 4JDUA 1YR6A 4NL4H 5FB3A 2WVGA 1JI3A 4GLLA 3DTVA 4L4ZA 5HBGA 1D3AA 1Y4ZA 2G06A 2HZ7A 3U1TA 1AKRA 1MOZA 3O7WA 1X1DA 4DLZA 5JZOA 3E05A 1C3OB 2GMWA 2W90A 1CVRA 3M85G 1JAIA 3C15C 4IDBA 3T3HA 2HQRA 3VTAA 3W05A 4YMSA 3KZOA 2MDTA 3K70B 2FP4B 3Q7IA 1DMRA 2F1KA 1MZPA 4D3XA 1T36B 1WE2A 4W1PA 1QQTA 2D5LA 3AONB 2HMWA 4Q1EA 2IFTA 4LRUA 3H9BA 4FW6A 4RZUA 3TAXA 5IH7A 2J3DA 2NXWA 3KTFA 2RK4A 4FYKA 2IS4A 2ZCUA 3MWLA 1EFRA 1KA9H 2XMRA 5ALQA 1ZP6A 2C5AA 3GD5A 1YK1A 2IUUA 4YLYA 1B8VA 5GJBA 1RM5A 2E4XA 1RRCA 4I6EA 2DHQA 1II8B 1P4HA 3PJDA 4LN1A 4CNBA 2WAOA 1XJ0A 1NFRA 4H7EA 5KVCA 1JQ3A 4X0EA 1X3SA 2GSDA 1V48A 4N0QA 4M21A 4P33A 4A0GA 1FTYA 4LF7B 2YVKA 3MXTA 4KR2A 4C87A 2C3OA 3HADA 4ME6A 3DZHA 4LQCA 1GTL1 4K9NA 2I55A 1GA4A 2JGJA 4KBFA 4NAUA 2V55B 3TR6A 1C4WA 2X14A 4EECA 3IEIA 3FCYA 3PHBE 3VKWA 2XCOA 4JVOA 3LZCA 1V5WA 2H1WA 3AYXB 3G82C 4MA4A 2I9PA 1W85A 3U7JA 5EMJA 2RJOA 1A5BB 3EDYA 5ALPA 3KLNA 3W2HA 1DZ3A 4HK4A 3D0KA 1EDZA 4JYZA 1MJ5A 4RSMA 3LCVB 1LRKA 1U2QA 3CT6A 1CF4A 3MGKA 1LI7A 3IUPA 4JXJA 4JMLA 5B7QA 3DE3X 2ZM5A 4MQEB 3RTAA 4QLOA 2FFBA 2KWIA 3NKLA 2R65A 2WVAA 2ALJA 4ER0A 1EFUA 1UIRA 2V5UA 3N8KA 2W4QA 4RQTA 1NI4A 4BO5A 4D9JA 2IH4A 1E0DA 3PRYA 2OFWA 3ANSA 4IH9A 4RV5A 1G7TA 2A0XA 2G8LA 4U63A 1HY3A 1SHZA 2IE8A 2JIMA 3AT1A 4OHMA 2HU8A 3PDHA 4DMUB 1LBQA 3LPAA 1I2CA 3TLJA 3LSYA 4LV8B 2XNHA 3BF7A 3THOA 4TPKA 3DVAB 4RDCA 1Y8ZA 4DJFC 3GBVA 1RIFA 2QRGA 3FLMA 4WJKB 1U7UA 1JJ7A 4UM5A 3K9BA 5K20A 2WB2A 2BCGY 2A6PA 2C4MA 3D4PA 5JDIC 4BMOB 1UZLA 1TQ8A 1ZD1A 1A77A 3V7YA 1YA6A 1EWQA 4NCBA 3RFUA 4TUYF 1CR1A 5KNBD 2C5FA 3ZV4A 3GJ5A 5CB6A 3ZZMA 2CT8A 1XNRB 3FYUB 2XTJA 2Z2KA 5BQ3A 4WMLA 5IT9A 1XG5A 5ESDA 3V1TC 5ADUS 4I5EA 4Z1OA 3A3OA 1N34B 1I4LD 2O5CA 4FYXA 5BMVB 2ZUSA 3L84A 4UUMA 1RLOA 3DC7A 3HJBA 4KMRA 4IZKB 4M8IA 4ZC8A 3LLSA 1EVYA 2EU8A 2HA5A 1DV1A 3K92A 5DGXA 3CLRD 2Q0SA 1ZJ6A 1J0AA 4FN4A 1Y8RA 3AEUB 2DFLA 4IW3B 4RIGA 4Z8YA 3U7FB 4KX5A 1NU6A 4CRWB 2C7RA 4LF8B 3NALA 1GUZA 1V3TA 2EAUA 3DW1X 2QAGA 3IQFA 5BW4A 2DPMA 1ORTA 2VZLA 2HR1A 1OLUA 4YC7A 2QY9A 4PPNA 1WB9A 2ZRFA 3PT5A 1P4RA 1QZXA 3HBAA 1M2FA 4TQGA 4NHEA 3CNEA 3T9DA 1XD2B 2HRCA 2OBYA 3W2GA 3DZBA 1HRDA 3ROPA 1U2SA 4MVYA 1GSOA 1QBGA 4Q4LA 1GZ4A 3JR7A 3UJ9A 4UNRA 1POWA 4OXYA 3CX6A 5BN5A 1OVGA 5C8ZA 3LS2A 2E2WA 2X41A 5I8ZA 3TQSA 4D42A 1EE2A 1Y3AA 3BIXA 4FUQA 4LWPA 4CM6A 4RVCA 1QB8A 4FN5A 2QRPA 3C1UA 2FQ1A 2Q29A 4TN1A 2WJGA 2JAHA 1LPSA 2XMCA 1G8PA 2C96A 3E9CA 1OD6A 2UZ1A 3AHFA 1UDNA 1FX1A 1RP7A 2MU1A 1X7ZA 2UUPA 2WV7A 3AW9A 3G2OA 1E98A 3IP5A 4O4LA 1II0A 1G0OA 1HZZC 1N6OA 3D0OA 1RWOA 4FGWA 4KLZA 5FNVB 2QRMA 2C1EA 4EI2A 1H9BA 1KQPA 1NF3A 1T9ZA 1Y9DA 1VE5A 2QXYA 4F06A 4JUCA 1XTUA 2EHJA 3HZZA 4BQIA 3KTAA 4EUHA 1RWNA 1V2HE 1SMKA 3A06A 3D6VA 3NNDA 3KXPA 1O0BA 4MX8A 4F96A 1WUYA 3TQQA 3E8XA 3H3XA 3U7GA 4UCWA 3EC2A 3W9BA 3MJHA 4YP1A 3NPMA 1IZYA 4KNWA 3AVTA 4Y1GA 2HMAA 2PX8A 2WU4A 3FPFA 4JLVA 2F8MA 3HB1A 3RVRA 4QJ4A 4J0EA 1C7IA 3WLPA 2PUEA 3D1VA 4WK0B 1RFLA 3QFSA 5IJAA 4GOMD 1OBVA 3DSRA 1JR3E 2J9XB 5IAOA 2IH2A 5T57A 2JEYA 5EJ5A 3K2IA 4DR1E 4EQ6B 2I2WA 3CCCA 4YBZA 3WNCA 2FKNA 5B4UA 1JPVA 2OLKA 4X6XA 2JFQA 4PGGA 1GGJA 2H7YA 2NO7A 2XQJA 3AZOA 4IZJA 5BYKA 2G9NA 1KI3A 1WCYA 3KZVA 1Q0ZA 2G72A 4R9RA 1KYTA 1MAUA 3FIUA 1RVV1 4P35A 5JDCC 3PPYA 3D7NA 1G59A 4B35A 1TU3A 4N6OA 4HS4A 3Q8XB 1QZTA 3KFVA 1I13A 2QTTA 3K2QA 1Z5OA 1TLLA 2I4TA 2QA5A 2NVUB 3D5TA 3JVVA 1OLXA 1DKNA 4H6WA 5E2AA 2TMYA 3R44A 4PLYA 3J7TA 2CZ9A 1BDBA 1UOPA 2FCRA 3BK2A 1HXHA 1ORHA 5K6TA 3OIVA 4JOQA 4JVSB 3DM5A 3V4ZA 4FHDA 4Q66C 4NDZA 4OO3A 3M7ND 4PWZA 1LEHA 3WIUA 1N77A 3O2SB 3WLFA 3BCRA 4GYWA 1L9KA 2CDCA 4V39A 5A7HA 3TN7A 4PC3A 4RZXA 3CCBA 5TQVA 3TS1A 4UFOA 1AQJA 3OJLA 4E7PA 2J0VA 4QARA 2M6SA 1Q1ZA 4F3RA 4REOA 4UCFA 1AUVA 4GKJE 1LBSA 1KBOA 1GZ3A 1O95D 1X8LA 4KDEA 4LDZA 4PVCA 1CETA 1D0IA 2R7LA 4XQGA 5M3BA 2H8KA 4F8YA 1YDFA 4AYTA 1NYRA 2ZROA 4KQKA 3LRPA 3LVFO 4IMRA 5EWJA 3GNQA 1GCOA 2GJ4A 2VI5A 4XPIA 1KO1A 3A4MA 3ZBQA 5AM2A 4HZUA 3I61A 4RY2A 4MHTA 2QGNA 5DLYA 4DADA 3F2IA 4US1R 4DG9A 3JQBA 2Y6VA 1P0FA 1VBFA 1VE1A 2X0EA 1U4NA 2VK4A 1JALA 4PCUA 4D0NA 5EJMA 1KTVA 4XVUA 2EHDA 4TYMA 1DP4A 3U3KA 4DUZB 3LY8A 3DZJA 1NJ5A 2EJCA 1T5BA 2W6NA 4TSFD 1EWYA 5IVKA 1FXSA 5AHOA 4YP9A 2YVUA 1F2TA 3AJAA 4GEKA 4N40A 1RAGA 4UBOA 3SQDA 3E82A 2OQVA 2VF3A 1Y1KE 1ZGAA 2JANA 4ISBA 3FI0A 5G02A 4X41A 4WNYA 1A9ZA 1RYZA 2HRZA 3IHKA 2KMLA 4RK1A 4K0KI 3ZE8A 1NI3A 1UJMA 2XMBA 2PH3A 1YUNA 2QN6A 2ZYSA 4QUDA 4W7IA 2GO7A 4X94A 4XVRA 1PYGA 1L4EA 1SAYA 2DUNA 2FTKE 1UC9A 4KN9S 1C41A 2BJHA 3FHOA 4KW7A 3EZYA 4BV9A 1FDWA 5ELLA 2HPZA 5TPZA 4OU5A 3MBIA 3K71B 1UOEA 2D6FA 2W4MA 2WJAA 3U13A 1Z13A 4XIFA 1X13A 3IQIX 2HJVA 2I78A 2PGXA 3B48A 3K1AB 4J16C 3SF8A 4O59O 5BNWA 2JH8A 4TLBA 3FPJA 1MGPA 3MWDA 2HIHA 4IIGA 1AHIA 3GJXC 4EHLA 3PYFA 5FOUA 3DZDA 3S44A 3EXG2 3CXUA 3X44A 2RGXA 2OMKA 3MF4A 3A9WA 4MVJP 3VRHA 3GYBA 3N0VA 4B32A 1DOHA 4PAMA 5K3BA 1JU9A 4NG5A 3ZE2B 3IBFA 1LH0A 4LOMA 3KZXA 4HFJA 5CYFA 4PG8A 2CUTA 4U2FA 1TMKA 4YT8A 1QF6A 4F93B 2I54A 1WVGA 1K3UB 2VUHB 1JWLA 5AH0A 4JHLA 2GCPA 1XTQA 3SIWA 4AJJA 2WT8A 1C30B 1TD1A 5F77A 2X2EA 4CF7A 4X1YA 2BMDA 1ORVA 3MT0A 4GSYA 5E9JA 1KDVA 1MW9X 1E6CA 2BA0G 3SVTA 4ZPXA 5JO9A 1L5OA 1O57A 4U2KA 3MS7A 2GEVA 3FR8A 3PUHA 5C34B 4F2HA 3GJ7A 3IIEA 1X0XA 5KQRA 3U4MA 4IFTA 5JVDF 2CL7X 3JZMA 5FP0A 5J2TA 3V2UC 1DQPA 1KEZA 3CF4A 5K3DA 5KNLA 4Q93A 3OZGA 1KMCA 2VTBB 2VK8A 3CPJB 1CU1A 1MG5A 1EVQA 1N2IA 3IOYA 5SYMA 3DKVA 3ND7A 2CNBA 4GI3A 1IONA 1OYVA 3AC0A 3FUUA 1XA4A 1ECGA 2CE2X 2O6LA 5DULA 3FTEA 4LWOA 1GG8A 1CE8A 3HYSA 4FFOA 3G2HA 4DLUA 2G09A 3KQNA 4OFZA 4I36A 2L0XA 5I4BA 2B4YA 3ZH9B 4KE9A 3ERCA 1RAAA 1YOVB 1AKTA 3N76A 3IO5A 3C6KA 5JY1A 2V2VA 3RREA 5IJ9A 4ND8B 2HSJA 4JJGA 1IVSA 3IS3A 4BNXA 2OHFA 4IJKA 2PO5A 1NFFA 4TVOA 2HLHA 1WG8A 1F8XA 1L5VA 5G4KA 2FDRA 4BMDA 4M8KA 1M6VA 5CA0A 1N0UA 2C31A 4EG5A 1E9AA 3B78A 2XBMA 3JCZA 4Q1VA 4DV0B 4WNAA 1TCUA 2NUPB 1PVGA 4ZAZA 1WSBA 1DPGA 3KD3A 5JMPA 5DSZA 5BR8I 5E7QA 4IJWA 1WNTA 5BW8A 5TMDA 3AI1A 2J9FA 3ZCVA 3NAZA 3TTSA 3DULA 3HNOA 4MS1B 2GHRA 2G6TA 2HIGA 3GI1A 4MGYR 1WDTA 3EIFA 1NPTO 3AF6A 5AUPB 3A05A 3RANA 1HGXA 2HBYA 1DTEA 4AQYB 4JQSA 2Q3EA 3NAQA 5KNCA 1M1XB 2P5UA 3AP3A 2QIPA 3WVNA 4NYJR 1WBJB 2FCAA 1YTLA 2QUBA 2ZUTA 3OJCA 2QWXA 3FYSA 4WI1A 4MR7B 3L1KA 1TXGA 1SKYE 3N0RA 3SHQA 4BB9A 5DRRA 1ZRNA 2X0FA 1J0DA 1FI4A 2XUGA 3F1LA 4I1UA 2FOXA 2JE6A 1YCFA 4D26A 1LJUA 2J9GA 3CKLA 3FTCA 5F3DA 1TLTA 3OQ1A 4J76A 4GLOA 4C7MA 2A0KA 2Z4RA 3ECSA 4IWNA 4HH1A 4JNCA 1MRNA 1Z0TA 2R86A 4PM4A 3S3TA 4H3SA 4EHFA 1HE5A 3FSRA 3MT8A 3DMPA 2W0MA 3UK1A 2VK2A 2FSVC 2P2CA 2JRLA 3H19A 4QASA 5ALVA 5AR1A 3T1HB 2NWQA 4J8PA 5CJ2A 1OVMA 1TYBE 1G9SA 1R9NA 4KV7A 1K63A 2C7QA 2VCEA 1H93A 4UUBA 4V0NA 3WK5A 1GZVA 1PEKE 2EOAA 2R2GA 3AF0A 5KC8A 1KRWA 1SM4A 1Y5IA 1DKMA 2NXNA 2G63A 1UPXA 1UF9A 3ICWA 3ORFA 4B3TI 1ZSYA 4HYYA 4LXHA 4OATA 4WGGA 3QYFA 3UNXA 3U2QA 1Q11A 4IZJD 3JQEA 1VMIA 1KGDA 5D1NA 4YMHA 3ZHRA 2Q28A 2JF0A 2MSKA 3DEYX 4WTOA 1V7ZA 5FR1A 4C5CA 4ED4A 5EYPA 1B23P 4J0CA 4NHOA 4GX5A 2LVBA 4G4IA 1W4BA 4KH0A 1Q3TA 3ER6A 2H2HA 3W4JA 3WBFA 1ESNA 3ENZA 4YFVA 1HMYA 1P72A 4DJ5X 1L5KA 8ATCA 2OCDA 3NM5A 1MBZA 1WXXA 2ACEA 4OKNA 4KSBA 2REQA 1OXKB 1SC9A 3GZNA 3L0CA 4UTRA 2I66A 4FHFA 1EP9A 2JGDA 4WDRA 1A8HA 1ZUD1 2C5GA 4N5DA 5JS8A 2G9UA 2VRWA 3OOYA 3WFIA 3C4JA 1H2RS 1V4NA 2M9MA 5CVEA 5DIFA 3ESXA 2XIQA 3S27A 3UW1A 4E5VA 3E9MA 1N5LA 5I7HA 5JD5A 1WAMA 3OQIA 5U4QA 4PSKA 4K9RA 2BGRA 1Q7GA 1RC0A 3IUBA 4D96A 5LP6B 3PEWA 2QM3A 4FJ0A 2HTFA 3OCWA 1A2KC 2FR1A 4ZO9A 3KFXA 4KV9A 4UTVA 3EODA 1VKJA 2JLZA 3NU1A 4URWR 4QBIA 4UE6A 2JZCA 4TUYB 4UU8A 4ZU3A 5TB5A 5FPPA 3D0QA 1TA9A 1U5CA 1WXDA 3M4XA 4JIMA 1T3HA 4TQUS 1P2SA 5IAKA 1V7QA 4DV6I 4E46A 3BFJA 4X7BA 3E03A 2R8OA 4KQGA 1TQDA 2QZPA 2R7KA 2AMFA 3EZNA 4FCTA 1E2DA 3NZKA 5HKBA 1ZM3A 1FX0A 5TSDA 4E1BA 1YMQA 1LC3A 3JQFA 4ND2A 2FWIA 2ZM6B 1YT5A 3ORRA 4OV6B 4TWZA 4FEAA 2OD2A 5K3CA 1NG9A 2I6TA 4MLPA 2WHYA 4CKCB 3QKRB 3CB2A 4QECA 5FBVB 1RTKA 3LWNA 2KPOA 2AZMA 3FOWA 2JNWA 4LY9A 3LOQA 3TYXA 4AJ2A 2UUAB 1IBLE 2O8FB 4JJAA 4AX8A 1G4HA 3ANMA 4X00A 1PYOA 2P77A 4AJ4A 1HA3A 1RD4A 2JCBA 1E8DA 2WFLA 6AT1A 1CDEA 3G5TA 4NBRA 4B4DA 4XTRA 3L4KA 5EXDA 4RSGA 1Z6ZA 4ACBA 3QUBA 4ER3A 1E0JA 1PR3A 2P1DA 2YS6A 4GL2A 5CM9C 3EXFA 3SC4A 4XX0A 1XEFA 1H0KA 2JEAB 1LC0A 5TPZD 4EUFA 2CFOA 4OK5A 5BNIA 4MWOA 2DHCA 4H7DA 3RSQA 1KQGA 3HCPA 4UE2A 3MJEA 3ZCPA 3GP3A 2O8CB 2I67A 4M7OA 4R0NA 1HEUA 3M70A 1QC5A 2WKQA 5FLKA 1DC7A 1UP6A 2DWOA 4OP2A 4YO8A 2O0HA 4BZWA 4RD2A 4LV5B 5KS2A 1UXKA 3R9WA 4P3NA 1O6GA 2ODAA 4Z9XA 1WXIA 2Z8YM 4UDOA 3I2IA 2MTBA 1JECA 4LISA 1K7YA 4B71A 3A6EA 1A5TA 4CW7A 1VYUA 4D3ZA 3RHTA 2WJ3A 1R0RE 3G8DA 4NZPA 1FFBA 1Z0GA 3EW7A 4YXFA 4Q02A 1BGXT 2M1XA 2C8JA 4WZBE 1T0HB 3OTOB 1Q50A 4DRXA 4M9XA 3RSZA 2YWDA 2AXPA 3G2IA 2BONA 1TA0A 1T0PA 2DX7A 1KAHA 1Z8DA 4PQFA 1PR4A 1WOMA 3D7SA 1OYSA 4HQKA 4F12A 4UHFA 4C0JA 1GGKA 2DPYA 4RGYA 5JROA 3FYDA 1FNNA 3B1VA 4P7GA 2K4MA 4FMCF 4G2TA 3H11A 4UMVA 3HNPA 2VJKA 5EJAA 4CUKA 1Z9BA 4L6IA 2Q21A 3G2JA 4DUYI 1GEEA 5BXYA 3BWMA 3UT0A 4WOKA 3ZIDA 3INGA 4Y2VA 4J0DA 2R5WA 4RH3A 4E21A 3BILA 4LBVA 4N41A 4QAJA 2J7PA 1J06A 1UC8A 1BWSA 1U04A 2WI8A 2ZWOA 4DV2I 3HJTA 4XEHA 2HA3A 2QIOA 2I7XA 3C8HA 4P0QB 1N7HA 3I39X 4MB6A 4C0HA 3AEQA 1V5EA 1OREA 3RUPA 1CJTC 4JI8I 1AX9A 1GTMA 3SYRA 1RYBA 3T34A 1IWPB 1OILA 4NXNI 2P9CA 4Z4QA 4TS4A 3EUAA 1UBNA 1XQWA 4MYRA 3VJMA 4AY6A 2IPLA 1V1JA 4QEDA 1GQYA 2Y76A 1AKYA 4I4LA 3EGOA 3UQZA 4JL6A 4UUQA 4ENQA 3JZAA 1S2OA 1QK3A 3BB4A 3SNKA 2I7VA 1Z83A 2HCBA 1Y4UA 1FW8A 3OZIA 3W3ZB 1E3TA 1KS2A 3PDJA 2E7ZA 3C3EA 3AJEA 1HNXI 1V7CA 2QU7A 2I3DA 3PC7A 3ZGNA 4EJ0A 4UBIA 1HSOA 1PNRA 4CEIA 1QDEA 3LPMA 4DJTA 1AIPA 1YZLA 2OAGA 4OMCA 4PNEA 1NWCA 3FA2A 1QF9A 4M98A 4YRLA 5H83A 3TBFA 1G41A 2OWDA 3QMVA 1N6RA 3NPAA 1ZAKA 3D7KA 4R5HA 3PVZA 2F4VE 4MRPA 1N5MA 1U3FA 1WXQA 1IUNA 1T2VA 2FMFA 1ZC3A 2ZTVA 4OJMX 2COEA 1HZJA 2H2FA 1OI3A 2OP1A 1YDEA 3SXJA 3WBKA 3P2JA 5KNCD 2WF7A 3RRZA 4B4WA 3PA6A 1F3LA 2FR8C 1E3HA 4J6FA 3VKGA 2BOVA 1IBKI 3ZHUA 3VR3A 2PDAA 1EEHA 1G5HA 2EERA 1N2BA 2JFPA 1FFSA 2WB4A 1IB0A 3MB8A 1L2TA 2CJYA 2Y6UA 4OHBA 5EP3A 3EEOA 4YUXA 3FNRA 5K3AA 3FVTA 4DV5E 3E7PA 3L40A 4FP9A 5AKZA 5IWAI 4HXFB 3C7AA 3AY6A 2EW2A 5JS7A 4ZTBA 4EF6A 5DN6D 1OOEA 2GKGA 3L7ZB 1KPIA 3KEOA 2AXNA 2FAXA 2YYYA 1XJWA 1F1BA 1NM5A 1T2CA 3PFCA 3X1MA 1Z4JA 5KWVA 1ONNA 1UANA 3LLCA 3DM9B 3IAM1 2Y1OA 4RKWA 5JE8A 1TVCA 4B17A 4M7PA 3UV7A 4A8PA 2PUFA 5EUMA 4EJ2A 4KQ2A 4C22A 2QTNA 3DHVA 4X95A 4FOLA 4WGFA 5FPHA 3TUIC 2ZUEA 3AG6A 4TZ0A 2V1UA 3LBIA 4BJ1A 3WJ7A 1F8GA 1OFVA 2FW1A 2BFBB 3DEHA 3HVRA 3O95A 3M89A 4JEMA 3G2LA 1DG3A 1R27A 1UR5A 2IXEA 3QXSA 1ZMTA 4R6XA 1OX5A 4QIHA 5JNTA 2XE7A 3J7AC 5HZHA 5FBHA 4KYIB 4ER5A 2UZ4A 1T2UA 1ZMRA 2ATIA 3M5WA 4JBYA 3KPVA 3L6CA 1GG5A 3V2HA 2VJPA 2XWSA 1PT9A 3H0EA 2IXFA 2VNJA 1XZIA 3C24A 1E2FA 2P0YA 4GKBA 4IQ8A 4M1TA 4NRDA 4Q3BA 4DV1B 3PRKE 1RJDA 3EULA 1UM8A 1JKJA 4PC7A 4ENUA 2C84A 4XYMA 2WSYB 3UZUA 5B6IA 5K3FA 1R18A 4IIYA 3A4IA 2ATVA 5AM0A 5CGZA 2JI8A 4EW1A 5EJ7A 5K7SA 2JLXA 5ALUA 1GKKA 2YMLA 1VSTA 1XRRA 3ELWA 2CCKA 3V1LA 2R6JA 1XCPA 4D43A 2VCHA 5ULLA 4B6SA 2JGKA 1P39A 4PRXA 1WETA 3DZFA 3F4KA 2D7JA 4L8WB 2BZSA 1TKAA 4YHHE 5BSWA 1RRVA 1XVIA 3PXBA 2VBFA 2HO4A 3FETA 3ZHTA 3ONFA 4ON9A 1HURA 2C2GA 1K6MA 4JT9A 3TL2A 4BDSA 1I2DA 2EP7A 2PNFA 1J07A 2ATXA 4O8CA 4P53A 2VWPA 3H5TA 2QL7A 3OUTA 5A6SA 1KRXA 1J23A 1Z0VA 4U02A 5CA0F 5I7UA 4LF6B 1ZOOA 3KE8A 4H1HA 5AM5A 4EI9A 3D4LA 4MUJA 3I01M 3IHLA 3M7IA 3TTVA 3TVYA 4MDEA 1N5DA 1EK0A 4RULA 9MHTA 4LNHA 1KEVA 4L72A 1U7XA 1UBOS 4V3CA 2A3RA 1AXGA 3R8FA 4PC6A 7ADHA 1XKTA 3H17A 3RYTC 4O2AA 4RXMA 2F1JA 1K7XB 5I9TA 1SKUA 5EE0A 4C29A 1WB5A 2MIIA 4FYYA 1EWRA 4F84A 2NPFA 2FN8A 5B7NA 4N03A 5JXIA 2DFTA 1LDYA 1UKYA 2JPDA 1U0LA 2P9BA 3G5AA 5EXXA 2A1TS 1P9RA 5GGYA 3HDYA 3U4QA 1LPAB 2ACKA 3LPSA 2V4ZA 5AO9A 4F2GA 1PWEA 2E5WA 5FI3A 5TARA 2NYUA 3R0VA 3RTGA 3R0IA 4KI7A 3U3XA 2X40A 1XU4A 4AZ3B 1SZCA 2ZYWX 1X1RA 1GUDA 5DYGA 2XNJA 3ZGYA 1Q5PA 2XVYA 3VR6H 2NTNA 2X9LA 4UPEA 1OH7A 4OHXA 1W25A 1R10A 1GNQA 1D1TA 4M1EA 4E15A 1ZL0A 1UKVY 1EP3B 3UMYA 1N5IA 4AG3A 3LVRE 2YINC 1AV7A 3DP9A 1BFKA 3INNA 1UPFA 4UVGA 1G66A 3ZDRA 2O2IA 5KTNA 3EUFA 4Y1RA 1P0IA 5TY0A 3OQOA 3S68A 3GLFA 1F2UB 1J5EB 2RBGA 2O52A 4FCWA 4CEJA 3ADOA 3PHHA 2H4HA 1T5SA 5C8DA 1H1TA 4OUDB 1E5QA 2AUMA 4CT5A 1KC1A 3LUAA 1H4QA 5GGXA 4B3BA 5JSKA 3G7SA 3ZCUA 3FI9A 4LYFA 2FX5A 1OBOA 3BMNA 1W1WA 3JQ8A 1NSFA 4KTTE 1K92A 4OI4A 2BM9A 1FF9A 3DLIA 1W85B 4KLAA 3R09A 1KBQA 1U0TA 2HBZA 2Y1CA 1DBQA 4ARSA 4L4XA 3D6HA 2A5LA 1ETUA 2ENUA 3KR2A 1WLYA 1NT4A 2PYDA 3G5UA 1GPH1 1I5OA 1LS6A 2KHZA 4TT8A 1QYRA 3I9LA 2QOEA 4IHKA 2WYUA 1V8ZA 4JIGA 2G28A 4KACA 5ALYA 2QUJA 5FIUA 5JPCA 4FOTA 1J99A 3RHSA 3QGMA 2Q8NA 3KSBC 2Z9DA 5THKA 1UP4A 5BOSA 1NI4B 2OORA 4JBXA 1H4SA 2WD8A 2WIKA 4HDNA 4BQPA 3N8GA 4H4EA 2C98A 1R5OA 1NP3A 2J7PD 3C48A 3ONDA 1ODSA 4KPUA 1PTJA 4R1NA 1FSPA 2Q1SA 1S8FA 4QVIA 2R2AA 2Y0CA 4MVJE 3JW8A 3W2TA 1RCFA 3SFTA 1BWQA 4R6WA 4UEJA 1WDWB 1ULZA 3LIPA 4MROA 3TNDA 4CUZA 4EB0A 2PSFA 4R7TA 3WQRA 3S5JA 3F46A 3T94A 4EG6A 2C2WA 2NT4A 2AEJA 3IIMA 1RZUA 5FADA 5I8PA 3ISTA 1NVMB 2VHTA 1H7UA 3VH1A 4C4PA 3NW9A 1Z08A 1BQ3A 3HJHA 1BROA 4UTXA 1F3OA 3BXPA 5AI4A 3ZWAA 1W1IA 3C74A 4C6SA 3OZDA 5CB4F 5SZJA 2ZSFA 3RK0A 2C8LA 5F73A 4J0JA 4AAYA 4JX8A 3KM0A 1OYPA 5J58A 4GBMA 4MV3A 3OJ0A 4IQGA 2B6HA 2OXRA 3F6CA 3TD2A 4OX9B 3PYDA 4TL9A 2R7MA 3B2NA 1Y8RB 3B6JA 3IA7A 4JUIA 3KZNA 3GEBA 3K1JA 2ICAA 3AHGA 1XEXB 4GMKA 4BLPA 4WY8A 4W5NA 2B83A 4OQEA 3N9IA 4CTNA 1IN4A 1OLUB 3IYLW 4G0QA 5AW8A 5HM6A 5A2GA 2WC1A 5F3WB 7REQA 1T4CA 3FHCB 1J70A 2W6ZA 4QT4A 1IUKA 1O6FA 3EGEA 4WK4B 3F73A 1TM2A 1G5FA 3GF4A 4KRGA 4NONA 2VYVD 2RIRA 1O94C 1HNWB 5LMUB 3S0JA 3WL5A 4KZKA 2JFZA 2NUTA 1HQYE 3VR3D 2A33A 3AOEC 4R2IA 4DCMA 5TGDA 2PLWA 3C1AA 3MOGA 4K3UA 5IDYA 3E5RA 1JHZA 3B1YA 2I6XA 3N3AC 1KKUA 1U1GA 3LOPA 1ZM2A 4HLNA 3RC1A 2C9YA 4RGQA 3RBXA 3DLCA 3HGMA 3WMFA 2ZRAA 4LDQA 1PJ2A 1PS9A 1KDRA 1UEIA 2DR0A 3N6VA 1WQ4A 2XTAA 2UZ1B 1K8QA 2BBSA 1SXGA 2KW5A 2LNDA 4Q21A 3WNQA 2B4AA 4CL3A 4PYQA 2PQ2A 5JCXA 3I58A 1Z39A 4I4CA 3BMQB 2O3SA 1H6CA 1KDZA 3R6LA 1K7SN 2X1LA 2NVWA 3VHXA 1SVNA 1S3FA 1IFXA 5THXA 2GDJA 4A6PA 3KKLA 4DU8A 1I7QB 2NQ2C 2YWFA 4AFNA 2WYOA 4BE4A 5KVVA 2CV1A 1JZQA 2DPLA 2D2FA 5IXSA 2A9QA 4RHXA 1FTGA 5TF0A 3K70C 1L7XA 2V97A 4R0MA 2X0JA 3PUYA 4FFSA 1YNOA 4GKVA 2GEKA 5HPYB 4C05A 1GZ5A 1Q3KA 3LDAA 1CKEA 1I6KA 2G9VA 4BNGA 4D92A 1U3CA 2EJTA 4NMWA 5DP2A 5EAIA 2D3TA 2IK8A 4Q4DA 1KQNA 3E9EA 2BMAA 5E1DA 3KVNA 3W2IA 2BM0A 2HREA 2AXEA 1T25A 2O2HA 2QVCA 3DBOB 2QTVA 3S2ZA 4K9MA 5CFLA 5I4KA 3ORHA 2O2JA 5AVJA 3MWJA 3EQ7A 3ND6A 2AYYA 3W3AH 1S2LA 1AY0A 1ZG3A 2MSEB 2GAOA 2WJJA 2ORED 3PQFA 4TVKA 4C3VA 2GILA 3NV9A 2MSNA 1LS1A 3DZCA 3P9YA 3MHTA 2G4LA 4X3PA 4BO2A 4EX6A 3O3MB 1TD9A 4JJIA 1WXFA 1P0QA 1UWKA 3TPFA 1G8HA 3WKDA 5C80A 1OLXB 4N47A 1GITA 2WA1A 3DVSX 4GHWA 5B1EA 2WW4A 4BRSA 3OAAA 2PMDA 5A02A 5CVUA 1XFDA 2P1ZA 3R0QA 1T2EA 2HA6A 5KBYA 3CNNA 1MB2A 2YL2A 4MUKA 4WZZA 4F4CA 1FFXA 1QP8A 3SQOA 2ZYVX 3PGKA 3Q7QA 1IXKA 3EF1A 4OU4A 4CMBA 1GZ6A 2HRBA 1OFUX 3DHYA 3FRIA 4EVSA 3EDRA 1HK7A 5J5CA 2IHTA 4O4JA 3QW4B 4ZIRB 5BQFA 2HBQA 3BE8A 2HT6A 5BY2A 5FDFA 4QNMA 1FQWA 3SF0A 1CB7A 3WDSA 1B8UA 4CG1A 5ICCA 3MJ4A 1BRTA 3AY0A 3RUAA 3RABA 1WMDA 3FPHA 2J5RA 4AYXA 3HP7A 1PR5A 3BQ9A 3K9GA 3MQ2A 3IULA 5LZ5A 3ODPA 1W5EA 1EJ2A 2WSBA 1HFEL 1Z34A 4DDUA 2PYZA 5EWJB 1ICIA 4TTPA 5AXBA 1A76A 1SQ0A 4K6CA 4XPIB 3W78A 1CUSA 5ISMA 4KL8S 2VBIA 3HI6A 4DIKA 4HZUB 4CXMA 1XPUA 4AUMA 5E2IA 4FDUA 2ZRMA 3N0TA 4EL5A 2LCIA 1G55A 1U7WA 3JQPA 4JC0A 4K1LA 4QPNA 3OWHA 4URVR 4DLSA 3KWMA 2YN0A 1JQDA 3QBJA 3SKYA 1M2NA 4N7RA 1NW5A 1ZBQA 1PGPA 3KAJA 2NV2B 4JI2E 2PUDA 3TGLA 3C85A 1T13A 2QVGA 2W2NA 1C0KA 3FYUC 4HYQA 1J2YA 2XTNA 1L5LA 4CLDA 5BWMA 3F8SA 2PE5A 5K1ZA 3Q0EA 1B76A 2J30A 3WQHA 1E8MA 1G2QA 2HGSA 5CMLA 5KYUB 3RYFB 4EZBA 1NVXQ 5CFQA 1KQ3A 1FBTA 2P27A 1FFAA 1G98A 3CVOA 2CC2A 4IIFA 4FWIB 5EJIA 1GSIA 2WMDA 3ED1A 1I32A 4FIZA 3JWJA 4JMPA 3QF7A 4MDFA 4V0ME 5AM3A 1AQNA 2Z6UA 2EZUA 4Q7EA 1T24A 3AX6A 1YRYE 2PZ8A 4RMIA 3U7EB 4BB5A 3M81A 5LOVF 4TV9A 2ZB8A 1IZ7A 4CIWA 2P6UA 1DBPA 3FDXA 2PIDA 3MUOA 1H3NA 1W35A 1OKKD 3E81A 4EW3A 1SQSA 1T35A 2PBLA 2QSUA 2VHCA 3DMRA 4QGHA 4HNRA 4CWAA 1LTQA 2Q1YA 4JLKA 3SF8B 1Y6QA 2DWPA 1E5VA 1BWRA 3CIFA 5DXJA 1XLVA 1U7ZA 3BFXA 4EHAA 5JI3E 2HD4A 4TXNA 3MWDB 4QUHA 2YQZA 3DB2A 3FNIA 1EHYA 1G8SA 1WUTA 5LXTA 3MVEA 2X8AA 1DKQA 2C4WA 2CXXA 5JANA 1TC2A 2Z6AA 4P58A 4IX9A 3A3PA 2XYPA 4B3RI 2BHLA 2EJBA 3I5AA 2PR7A 4LE1A 4PS0A 3TDMA 2WYIA 3W6NA 1UP7A 4QJBA 4UCQA 5TQ2A 5BVHA 3G3EA 1MAWA 2BSQA 2CYAA 3JQ7B 1PD0A 1ZNQO 2EX0A 2QPAA 4HPJB 4F6LA 3I6YA 4UQOA 3H75A 4QUBA 4ZZ3A 3FMVA 3GX1A 4J7XA 2VLIA 3RAEC 4J1TA 2G76A 4S1WA 1M6EX 2OL4A 3OPQA 3LQKA 4MWGA 4B0PA 3F49S 4IO1A 5ES3A 1SU8A 4OIMA 3ZK7A 5CBPA 1EGHA 2D4AA 5EPUA 1V41E 1UWCA 3WA7A 1BH2A 1FJ2A 1YQTA 2CHVA 3WGGA 2I33A 5J4VA 5IBQA 2IP2A 2FRVA 4Z3KA 4UTNA 3A70A 1KK1A 1X2EA 4C1BA 5BV2P 4TV8F 1PNVA 3Q9NA 4O1IA 3C7DB 1E3EA 1JG6A 1FQJA 3EMBA 1CCWA 1NF9A 2MSCB 2PNZA 4BVHA 4CHGA 1KR5A 1YL7A 1CE8B 3QLVC 3UUGA 4OYHA 4Q3DA 3L7MA 1RFGE 2WM2A 2Q6TA 4NYMQ 3ZV3A 4BEVA 1S2DA 1UZNA 1DQSA 1XA0A 3NT4A 1TTQB 3OEWA 3CUEF 4CG0A 2GGSA 3AR4A 1KE1A 4KVAA 1NXSA 3KB2A 2XDYA 3UICA 4AC9A 1E2HA 1J6UA 2GPAA 1LI5A 3IEPA 1VFPA 4H0CA 1I94E 4RZSA 5IUKC 1UH5A 2P9JA 2VDLB 5IJ9B 4JFAA 4DMGA 2GJSA 5FJIA 1UAYA 3OURA 1PZGA 4A23A 4TYWA 4ZO7A 3JVDA 5G4KB 1P7PA 3A1CA 3BJRA 2V0CA 3CRQA 1M6VB 2VWQA 2EC5A 1AU9A 1R6MA 2IEBA 2IIPA 2R6AA 1GQ2A 2UZ3A 2WOJA 4BRWA 3I2KA 4MW9A 4DVJA 4YI5A 2WSMA 4WNAB 1A8SA 2QUIA 4ESVA 4B6GA 4ZV9A 3G79A 1ZH4A 2PZMA 1SQ6A 1A1SA 4XQ9A 4F9FA 1M1UA 1BZYA 1VSUA 3E3NA 2J9FB 4TMVA 1YJXA 1XDDA 1N3BA 1LPNA 1KJNA 2OCGA 1VPLA 2XDWA 3A9TA 2HQ1A 2F4NA 4DCUA 4Q7QA 2N42A 1KIAA 3AU9A 5BR1A 4KR7A 3GVPA 1GAJA 2VEOA 3B9PA 4OQMA 4KFUA 2ZVPX 1EVKA 1QONA 3PGXA 1J33A 4AMYA 1IXZA 1XPJA 2DQKA 1CUVA 3A3NA 3B1XA 2WJYA 3EH1A 3QY9A 5F35A 4YRPA 3RODA 4DXAA 5IRCD 3OZBA 3A4TA 4H31A 2UYHA 1AO0A 5CHYA 2FB9A 1QK4A 3BSWA 1KMIY 2I99A 2P9ZA 3COZA 4FFVA 4U8HA 3VR1A 4JB3A 1LVUA 3H9JA 4LGVA 4D0RA 4K9SA 4QYTA 1USUA 1FDOA 2PRJA 2P9QA 3PFBA 1UBUS 1P0PA 4MI1A 3IOEA 2HX1A 3UFBA 2JE6B 5LN1A 1EXVA 2P90A 2FSSA 2ODEA 3N6RA 5HF9A 3MJVA 2ECOA 1QYCA 3DOIA 2RGBA 4JD5A 3MNFA 4QOSA 2JAQA 4D81A 1N57A 5I48A 4XJSA 5EUBA 3A36A 3W9YA 2UU9I 3TQTA 1PDWA 4HAYA 2ECPA 2Q46A 4OHZA 3WLKX 2GR9A 2JCXA 2P9EA 2PZBA 4HQ0A 3IGFA 5F64A 4I5FA 4X6YA 4KIFA 1FUYB 4LOIA 1A5SB 2WHPA 1TAGA 2FEPA 4ESEA 3JTEA 1MB4A 1TKRA 1TYAE 2UXDE 4PRYA 3CEJA 5T41A 2OD7A 1H69A 3W3AD 4HX5A 3RKRA 3IERA 3JQDA 5LC1A 1LDGA 1S7GA 2PMBA 4NBWA 4FFMA 3ZEIA 4DQDA 1GGEA 3ADPA 3L7JA 2Q3MA 4N01A 1UBRS 3KB6A 2A9JA 4I2NA 3I23A 4URUR 3LF2A 5KUTA 1I7DA 4DSAA 1TEVA 2EJUA 3I2HA 3DHWC 3OMWA 1M2KA 3UYLA 3QQ5A 1EYZA 2JK0A 2OFPA 4DAEA 3AKEA 4DY6A 3UM9A 2GPBA 3DUFB 2NXJA 1TKBA 1R4ZA 3OAAD 4WOCA 4EO9A 4KR0A 1YKFA 2Z83A 4X3CA 5B3AA 3G49A 1KO4A 4BNDA 3DE5X 1V5IA 1J0CA 1CUFA 2JGDB 2Z08A 2ZIZA 3S7ZA 3QFCA 4E5PA 1Z5VA 1RR6A 3EASA 4FKBA 4G81A 1HNZI 3K9LA 4DLVA 5T7BA 2GASA 4DIMA 3NHWA 4JBLA 5GP1A 3NB0A 4TTTS 2ZRGA 4YCLA 3AR5A 3CNOA 1XQXA 1W5TA 2HGZA 2EXXA 1KYIA 1EG7A 3N86A 3OQIB 4NXMI 1WX1A 2JI4A 4U2CA 4O1HA 4DSTA 4EJ6A 1IY1A 2ZJ7A 4IH1A 3BJIC 1N0WA 1UJNA 3FN4A 4JROA 3V4PB 4JL8A 2YHUA 4NJMA 5DCLA 1T26A 1E1DA 3V3TA 1N78A 2Y9PB 3CW2A 2WKWA 3WLHA 3O75A 4YXWA 5CB4B 2OPBA 3ZKWB 4J3JA 1VLQA 1JEAA 1P3Y1 1JVNA 3AYZB 3OEHA 4K86A 3DOCA 3CEAA 2A0FA 2H9IA 1R8XA 2VATA 2QQEA 3VO8A 5KYYA 2E5FA 4G56A 4GOND 3VPAA 2XZTA 1ZJWA 2X76A 1AKEA 3BWBA 3HDGA 3ILSA 3LUDA 3NNSA 3PE4A 4ACAA 1FX0B 5IYZF 4GBED 4BLOA 2CY0A 1RMQA 2X4DA 4LG1A 1Z5AA 5CITA 4C14A 1Z0SA 1FDIA 4BLUA 5KJFA 5TGZA 1ZU4A 2IBMA 3KBOA 1DI0A 1WY7A 1XAGA 1B3BA 1I1OA 1UAGA 1NR5A 2FK7A 4WZAA 2DFDA 4QDOA 3FPCA 3GFVA 2XSZA 2WFLB 3IBSA 4JR0A 3LLUA 4LTDA 4NBUA 5HCIA 3IIJA 1VMEA 4BMPB 2HHAA 4QAQA 3B85A 3C5VA 3EXG1 4BTVA 1ULAA 3MJCA 3LK6A 4ZQCB 3LYHA 4LF9E 4C4YA 4DT1A 5HUQA 1XRJA 3H3FA 2IESA 2PT5A 1PX2A 1EP2B 1QRRA 2OYCA 1KKMA 2C5HA 3PQ8A 3NHPA 3KZCA 3R5HA 4XX0B 4H16A 4RUKA 3ZX5A 2VKQA 3GLKA 1WXWA 3FBGA 5K36A 3CA8A 4ISAA 2RDMA 1XDWA 4Q9NA 2J3MA 2R00A 5C0XD 4KODA 4MQ6A 3MT9A 3L18A 3SN6A 1QC5B 2GCOA 5HE8A 1JG2A 2Q7XA 5D5QA 2BDTA 3HS3A 4XDYA 1XU9A 3REQB 4FDAA 2WWRA 4PYOA 1KI4A 1DGQA 2SKEA 4LYJA 3ZNQA 2RCNA 1EU1A 2WFMA 4OUKX 3HXMA 2AC2A 3U62A 2QQGA 4X93A 1E32A 2VXYA 2NX2A 3NBAA 2YXBA 1RMTA 4J0IA 5AI5A 4F5ZA 4FB5A 4HQNA 1UDQA 2QMEA 5LFAA 3INRA 4IDFA 1DWPA 1NRWA 3AOGA 3EFBA 4PO1A 5LMNI 1MXHA 1OAOC 2QF7A 1YL5A 4YPOA 1EUCA 1TM4E 2R8RA 5D7NA 2A57A 5GZ6A 4GE3A 4P86A 3ZWOA 4L78A 2EEPA 4O33A 1CYEA 3ZHZA 3HDTA 3IVMA 4MB0A 5KPJA 3GZJA 3QVLA 1S2IA 3SVLA 4DG5A 2QLNA 3H11B 1QCYA 3UT5B 3B6EA 3DFIA 4IMJB 4GGMX 2W2LA 7GPBA 4C2UA 1EK6A 4ECEA 2OGUA 3EIXA 2GZMA 4M1MA 4K0KB 3I34X 3FNGA 1WPXA 3QPVA 5JLAA 3S2YA 5CNJA 1KIJA 1I10A 3JALA 2YC2C 3T7AA 3W90A 1ZA1A 1EMDA 5LQNA 1M83A 1JHMA 3EWAA 3P26A 1SHLA 4JOCA 3C6MA 3TZQA 2OKCA 2OA0A 1X1SA 3OZCA 4IQ4A 5J23A 3K9CA 3LCUA 2X0DA 3K9NA 3RT1A 3M6IA 4NENA 2OV6A 3CW8X 3DE4X 3KHUA 4U5XA 4C21A 5JADA 5F5NA 4X64E 1WTCA 4ZVQA 4E08A 4DR7I 2QUZA 3R0JA 2D2VA 5GOTA 5HR5A 4RCYA 4DLAA 1M1YA 3CNHA 2CHQA 2OCKA 5LZ2A 1NTRA 5IZCC 4QNJA 2GNOA 3EC7A 4CKBA 1YRAA 1ZN9A 4TM7A 4DTCA 1YC5A 1BS1A 1SZDA 1DCKA 4I8XA 2GFHA 1GYRA 4TS9A 5DGTA 4HAZA 2BSAA 4IM7A 4CQLB 3ZJUA 1Y4DE 1UMCB 1CQWA 2C04A 1DKPA 5HTKA 1FNBA 2WABA 3GJ4A 4M0CA 5ILQA 3YASA 4BMVA 3HSYA 4D6PA 2V9PA 3VX4A 2FX3A 4L2IA 4HH0A 4CN9A 4RBNA 3R41A 4KGVA 1E1RA 3HCWA 4LS3A 4NNPA 2JEZA 2Q5FA 2W42A 1Q12A 2QTBA 3H9CA 3W79A 1XMOI 3C3WA 4Q1AA 5KQSA 3RJ5A 4FDMA 4E12A 1NIPA 3PS3A 3KLBA 4NTZA 1ZQ1A 3RE1A 1XFAA 1HSZA 3DAYA 3P27A 4FT2A 1RPTA 2ON6A 1CUBA 2XRFA 3FKQA 3NHFA 3PUZA 3QQPA 2GQ0A 5LP6C 4DCSA 1YR8A 4MU1A 1IMJA 2PD6A 2X0IA 1N2CA 3HCBA 1B6RA 3MINB 5DRYA 3X0DA 2EFYA 5JAOA 1QFZA 3A2NA 3MPOA 1G4UR 2VPWA 1JXAA 1A82A 4M8SA 2G4CA 2P68A 2AD5A 3SHFA 4ZMBA 1COZA 2I65A 2ZDHA 2GZRA 1CJUC 4I7EA 5T6BA 2OBLA 2QRQA 1ECPA 4FBGA 3BMXA 5C0XF 3HYTA 2VDQB 1FJXA 3H5AA 3OCJA 4J07A 5FPSA 4ZA2A 3NS7A 2JJMA 4CQMA 4AWAA 1PSWA 2WM8A 3K0CA 4IZIA 5DLPA 3DE1X 3DYBA 5FUVA 1DAPA 3HACA 1ZW1A 4L8LA 5K6AC 4F0JA 2DY1A 1GNTA 2YV3A 1EFAA 2YVQA 1W2WB 1QJ4A 2RHTA 3PUKA 3OZWA 1MC5A 1FDSA 3I62A 5EJ8A 2A5DA 4JI4E 4LF5E 3MZ0A 5ECWA 3RU9A 3K96A 3DV9A 2WUGA 3EVCA 3QYPA 4MOWA 4QZVA 3QBDA 5IF3A 1C14A 5JO0A 2GERA 2ZLBA 1RRGA 1TO1E 5BR8B 3LBYA 3A14A 1K8ZB 5EI5A 3H4LA 3A6FA 3ZTWA 4EELA 1VL2A 3ZD9A 1XDBA 5KYGA 5IEJA 3WU3A 1TM7E 4HB3A 4P7AA 1NBWB 4IS9A 2QTHA 3KQQA 2AE2A 1C0EA 5LQKA 1R4MA 3U4IA 4GAEA 4RXTA 4HT3B 3RG2A 3HJNA 3LYAA 3RG8A 2H9YA 3EISA 4PZZA 3ZOZA 4D82A 3S1AB 1V39A 1QH8B 1VFNA 1P18A 3Q6IA 4FW7A 1QHFA 4FD2A 4QFCA 5IBRA 4GMXA 4DXLA 3EZFA 5FLYA 4DGQA 1JKJB 4AU1A 1WL8A 4FTWA 3PB3A 3IDAA 2ZBDA 4KBGA 2HLDD 3QEMB 1LK0A 2G40A 1K97A 1P8JA 3K9QO 2C4KA 4DR2E 4HJRA 3NEYA 4WLFA 2CXRA 4FYVA 3U4DA 7AT1A 4WWHA 4IDNA 1JLKA 1HOTA 4MW2A 4C5BA 2VHEA 3WLTA 2X2OA 3TD6A 2J0UA 1QIGA 3SFZA 3R75A 5K8VA 1KYYA 4L0CA 2C97A 2VH2A 4INPA 4B7ZA 3CUTA 4CG3A 1IJEA 4CFZA 3TZHA 3OIFA 1L1EA 4TV8B 1JX6A 3R2JA 3OEHD 4JQYA 2XODA 4MPTA 1MOPA 2PYIA 4A6EA 3GJ8A 4GX1A 2LV8A 4B81A 4B3TB 3UJDA 4JV5I 3SQXA 4QDXA 4LOLA 3IJ5A 3FAKA 3ZDAA 4U39A 1EPUA 2UXBE 1SXIA 3O84A 1H4TA 2JHPA 3T0IA 4BASA 4K03A 4D74A 1UXHA 3DNMA 4W8HA 4IZOA 4JLAA 3KXIA 4D9CA 2O8BB 3LBAA 1SKMA 4RYDA 4CG2A 1U0JA 4NFLA 3SS7X 1JIQA 3USCS 5H8WA 2GZ3A 1XZQA 3JD2A 2H1RA 3MAAC 1JEJA 2AV6A 4RS3A 3SZOA 2XSZD 5CX4A 4Z49A 2OYSA 1GGMA 4QRDA 1F6DA 4TT3D 5C7OO 4N1AA 4R81A 2GF0A 2P5YA 1A8QA 1PL0A 2WILA 3SKXA 4RC9A 4PYIA 3QBEA 1ZA2A 4Z0NA 1Z73A 4MP3A 4Y6QA 3FCCA 3CVWA 4OIFA 3INTA 3GEPA 2HJWA 3PBKA 4OG2A 3TZBA 2XADA 4BO1A 4GYKA 3SR3A 5FH9A 1NKVA 5KQLA 3E1GA 1EDOA 4XH9B 1H3FA 2ZB4A 2G9ZA 4F2WA 1I7SB 1FIUA 3CLRC 3CLSD 4KC0A 4NEHB 1JR4A 5F4BA 1M1NA 2OHOA 3CO5A 4GQUA 3NEPX 3GLFB 4CEJB 4PAWA 4QFDA 3OBIA 2RGYA 4DCGA 2D8MA 2ORWA 1XLTA 4J90A 5K8CA 4DV6B 4AJKA 3RVNA 3ORYA 3MCWA 1SG0A 1VI2A 2JAPA 2OHXA 1A4RA 3JQ8B 4C4TA 3HKMA 4TLMB 4E11A 4U0KA 1QVZA 1NJSA 3HTXA 3BFVA 3OZEA 1WV0A 4X8LA 4DS3A 1Z25A 4MPPA 4ENVA 4JLPA 1CZNA 1FDVA 2IW3A 1H85A 3PFFA 1JAHA 1JHPA 3H8VA 1YULA 1TDJA 3OZTA 3WL3A 5C53B 3TEJA 3RS7A 3KO8A 3U17A 4Z2AA 1F6WA 1UMDB 2IF2A 3L7CA 3HULA 1SNYA 1ESZA 1OA0A 5T8KC 1DO0A 1RTTA 1AZLA 3DDNA 3IBGA 4IDQA 4Z4GA 4M1OA 3V55A 2W2LD 2NO4A 4IVRA 421PA 4DC9A 3OJWA 4W5JA 3W7AA 4P4SB 3W34A 2WU3A 4CDRA 4A8JC 1BDJA 1VL1A 4X66B 1EK5A 1MO5A 4PQYA 2IE0A 3W8RA 4HDNB 4DHEA 2G1JA 3O8OB 4DREA 2WWGA 5I8WA 5JBQA 2XAAA 4KPUB 1A96A 5FOTA 5A3VA 4P54A 5F7ZA 2B4TO 3KL4A 4PZLA 2I2XB 3C4VA 1M34A 1CF2O 1HR0E 6PFKA 5EZQA 2BLNA 2V98A 3OX3A 3SLGA 2NG1A 3B1ZA 3E1KA 3PPWA 2HWKA 1ZRMA 4KOAA 4A36A 5M29A 3G0CA 1YFZA 2DBRA 3TGWA 4CTKA 2FPLA 1VG1A 2CVFA 2XR1A 3AESA 3CPHA 3OTQA 3A8TA 3AV3A 3AR8A 3OFSA 4AJNA 4KMSA 2B0CA 2Z43A 2DCUA 4ZVLA 5L3ZA 2B36A 4IIEA 4WBNF 2ISCA 1OE0A 3OJFA 1BMDA 1Z3CA 3KEMA 1PG5A 3EXEA 5C7IO 5AHKA 4HPXB 4J4HA 4DMRA 1L8QA 2EARA 1NR1A 4ICIA 4HEHA 1US8A 4JQZA 4RVSA 4GLBA 4UT4A 3VPSA 3WLEA 4D3DA 5HKOA 4JI0E 3KQMA 3GJSA 4BX0A 5FQOA 1F7UA 1QRSA 2QD4A 1Q57A 1RHUA 1VZ2A 1PK9A 1E1RD 2QVBA 3RIXA 5FOSA 1C9DB 3M82A 1M7BA 3N2LA 4AZ0A 1JQAA 5EJ4A 5F76A 3ECCA 4HMQA 4P22A 3DFUA 1BX0A 2GJKA 2Q8PA 1SRRA 5I9BA 1IMOA 1T4CB 1JXQA 4BKPA 1DAEA 2OXEA 2FJUA 1J09A 4PLFA 4ZVSA 2V7XA 5SZKB 3VNAA 2NUTB 4Q34A 2GK7A 2JAWA 2O1TA 3FLAA 5KDDA 3Q8WA 4JLNA 2NSLA 2OXTA 4DC1A 5LQRA 2BZ0A 3QVUA 4DV2B 5JFTA 1Q14A 4QUGA 2A4MA 3AR6A 2BFNA 1UDRA 3DDCA 3D4JA 3PUXA 4RE6A 1AG9A 4TOIA 3AP2A 3WBJA 2IERA 3ACDA 1BJRE 3GQBB 4JI8B 2XDQA 3UMFA 3KKZA 4BGUA 4R2MA 4CQMD 3HKBA 1XTIA 1GOTA 1ZK2A 1VHLA 1CUIA 1TK9A 2UKDA 4G4GA 1C9MA 4P4UA 2OPHA 2I4RA 5LDGA 1JHRA 4MYUA 1M1ZA 1GPUA 2C9CA 2VO1A 4LOAA 4M89A 4RO0A 4B79A 1YBFA 2QVLA 2J7KA 2RGRA 2W6MA 5HNKA 1U4SA 4H2DA 3K3PA 4ZOQI 4L3WA 5DVZA 1BD3A 2GBCA 2IPXA 3NQ41 4QUAA 4DF3A 4CM9D 3MCTA 2ZWPA 4S1PA 3KT6A 2ZTHA 4L8VA 1C8KA 4ZQBA 4NQZA 1J7JA 5ARDA 3LW7A 2WKRA 3ZV6A 1DO2A 1SUFA 3KWLA 1R0ZA 2WICA 5B12A 4Q9AA 3TIIA 3JWHA 3CR7A 2ISQA 3L7OA 4MEAA 2D7DA 1BU8A 2G8NA 5E3JA 2PU7A 1VIMA 3EVEA 3ZV5A 2WNRA 3FW1A 4WFJA 1N33I 3OIDA 1U1FA 4TXLA 4N5NA 3K5PA 3ESYA 5H0IA 1NXVA 4PU0A 3OUUA 2QTVB 5I7EA 2OC4A 5KSPA 4U2BA 4HI0E 1W4CA 2ZIWB 4MV5A 1CDZA 1PW7A 1XNRE 1NDQA 3H2BA 4R9SA 4YUYA 4RMNA 3IVCA 3LLVA 3VR2D 1YZKA 2IYNA 1N34E 1UMKA 3JVEA 2WTNA 1ZD4A 3BL8A 3IPRA 4OXNA 3ML1A 2CMKA 4M7RA 4PVDA 1RADA 2R96A 5FA6A 4C7OA 3NWPA 4EFLA 3P94A 3DV0A 4HDCA 3SHOA 3BD7A 2Y68A 3HZOA 3QWFA 4RIIA 4F4DA 4Z7OB 3Q88A 4FNAA 1FFXB 1NN3A 1V96A 2AWOA 2FR0A 3G2KA 4BNLA 4RWZA 4C20A 4EARA 3KXDA 4DUPA 1LBIA 1P2DA 1TADA 2OQIA 1XKXA 3DDUA 3OCCA 2NSHA 2XIJA 5FUBA 3WLQA 4DQVA 3LU1A 4W9NA 4WUTA 1PT7A 5CR9A 4E3WA 4IJ6A 4ZYZA 3KEQA 3AEYA 5C3UA 1SPBS 3H3JA 4IV5A 1YKSA 1I6LA 2YFQA 4LVOA 4YJKA 4HVCA 2QTCA 4JBIA 1LY1A 4BNTA 3TFOA 4KFSA 4L5YA 1K6EA 1FS5A 1ZMXA 2C3YA 1DIBA 1K88A 1MP0A 1AGPA 4MVXA 3RQSA 1SXQA 3GJTA 5FTMA 4QPZA 3T3IA 1CRZA 1JLHA 1CS4C 3U4HA 3TSCA 1MUUA 2XBLA 4ZJYA 1CNFA 4LXTA 3K0FB 2CJXA 5DX8A 1P62B 1T5IA 1QIIA 2UUCI 1NJ2A 1R0KA 3H4MA 2XKBA 4R2HA 1ZM9A 3QXCA 1RWVA 4P5EA 5LBTA 3UC9A 1X86B 1OU0A 3I9OA 1F5NA 2CUNA 4NFHA 1U31A 4FIDA 5FT9A 3K0BA 4Y67A 4G0OA 2LXNA 1O97D 5LD2B 4YDHB 2CJFA 4I9HA 2N0SA 2NW6A 1TCVA 3KV1A 1R74A 3QU9A 1P9LA 4MHSA 4PG5A 5HS4A 5KREA 2W11A 2W6QA 3OZ7A 2YN2A 3N1UA 4P98A 1Y1RA 1HT0A 4HGPA 2XNKA 3VDQA 4Q37A 3RUDA 1A98A 2UXCI 1V16A 2GVZC 3KVVA 1R6VA 3EEBA 3V2GA 1UJ6A 3B6IA 1N3IA 3FWKA 3C6ZA 1JVSA 1G21A 2ZAIA 4V1CI 2LZ0A 5JCZA 4R9UC 2ZBRA 3QUAA 1IJKA 4OM7A 4GKKB 1VA5A 2QAGC 4BZPA 4BNFA 1R12A 3CLUC 3MTBA 1YRBA 4FGLA 1JN0A 1WCWA 4R01A 2X6TA 2ZS8A 1SD2A 4TS1A 1I7PA 2E1RA 5JYCA 2Y1DA 3B9RA 5C0XB 2OAEA 2VWHA 3ETNA 3BN3A 5FXMA 1MRZA 5C32A 4D9NA 1SOUA 1PV4A 3HSKA 4I55F 1FS6A 2XUAA 5KWIA 1BJTA 5IP5A 2A9RA 3UAWA 1JA9A 2E21A 2EFJA 5I9LA 5LXTB 2YJNA 1QR6A 4U7HA 4HGYA 2DVMA 1Z47A 2QLMA 1JEEA 2FLVA 3DDSA 5JEEA 4JC5A 5TQ2B 1XMQI 2X2FA 3X2EA 2VNAA 4FWDA 5DDIP 3FOEC 4R9NA 1S1MA 5FTWA 3W06A 2BW0A 1EUYA 2Q1TA 3WKCA 3GEDA 5D3ZA 2REXB 4AYWA 3U7IA 3WKBA 4XSVA 2PH1A 3UUEA 1OWPA 1UWVA 3PCRB 4ZEXA 1YIDA 4DJEC 4RTLA 2OCYC 3T9FA 3T5AA 2Z2JA 4UUNA 2WJ6A 5TF4A 5CBPB 1LPMA 1W8DA 3B53X 4IV0A 1QG2A 3TPCA 1NHIA 4MEJA 1ENZA 3O0TA 1J2UA 4W5OA 1O1YA 3E2IA 1W93A 3L7KA 4XTJA 3VGPA 4HAVA 1PFGA 3KHKA 1Y3BE 1EEXB 2HL6A 2PNZB 1N8SA 3WLLA 1BVUA 3OSUA 4QU9A 3AZQA 3RBAA 2PA0A 2ZYGA 5ALWA 2Q6LA 4H7IA 1IUPA 4HX2A 1CJVC 1DC4A 1SELA 3N0XA 2B30A 4MWZA 4DUZE 1YH8A 2N47A 1MB0A 3DMYA 4JK3A 2V8BA 2BM1A 2R4TA 5DCYA 1ENOA 4HQRA 4J3FA 4PINA 2BSXA 3AUFA 3C3CA 3TG8A 2BC9A 4E5NA 1IBME 2A5YB 4JEIA 4L7VA 1GPWB 3F5MA 3AKYA 3HDQA 5IEBA 3F3MA 5L3JA 3A4YA 1IEVA 4WXMA 2VJNA 3KHTA 3UXMA 2YV1A 1HE2A 5E1BA 1S9DA 2JLAA 3C6XA 3ZH2A 4E5DA 5J47A 1L8OA 4AQ7A 4KGDA 3OPNA 1YOBA 3DGEC 5DXFA 1O7JA 3TVDA 4CKYA 1JVBA 2QBYA 3IUQA 1Y48E 3KZ1E 2JFNA 4LJSA 1T8SA 1UKZA 3HR7A 1OQAA 4XM2A 5IKOA 1DUIA 5ALSA 3M4NA 3DOEA 2E55A 3IPAA 3RK1A 2H65A 4BLQA 4ZZ2A 2IYFA 2VHXA 8ABPA 1VHDA 3VR4A 1ZGCA 4FC7A 4OBBA 2BKVA 4OGLA 5M7EA 3EE6A 3KAPA 4G8CA 1RPJA 4KUHA 4FMBB 4IAOA 4XIJA 1RI2A 2F1HA 3IQWA 3AK4A 5TT1A 1PUXA 2VBCA 3EAQA 4L22A 3Q98A 3AIIA 1M5TA 2VDRB 1XVLA 4LNUB 4IV8A 5HKKA 3F74A 1KJJA 3P1JA 1ZH0A 3WWZA 1SOVA 1Q17A 3WP1B 1QU2A 1V6CA 1DIAA 1YSCA 3ANLA 3PHCA 3JQBC 4OYYA 1WSWA 2JFUA 4YMWA 3C2QA 1B41A 4MQYA 2WJWA 4RPGA 4C0SA 1UXIA 8MHTA 2FZLA 4YPFA 1VJTA 4EG8A 3DVLA 5EHIA 2V6MA 2ZRDA 3KG2A 2H2GA 2IHBA 4AQDA 1PWHA 2WHPB 1VECA 3UOWA 4E1VA 4LPFA 4H1TA 2IF0A 4FEYA 1OWOA 3PITA 4ZDJA 1TIBA 3T3OA 4KO3S 4AZTA 4CT4B 2IS2A 3CNLA 4OF4A 5KJ6A 1E1QA 4QATA 3LM8A 1U28A 1STOA 2QMHA 2X8BA 4PE5B 3ZDDA 2H1OA 4CIYA 3KQKA 4Q03A 4AN4A 1TFRA 2WHEA 3OLXA 1RMYA 3GBPA 3TOXA 1ZUIA 3KYDA 5I9IA 5CW1A 1KKLA 4PFSA 3RJ9A 3VA7A 1W9MA 3ZDEA 3W77A 3E8MA 3FSJX 2Q5QA 1A7UA 4QSMA 3VZPA 1KZ9A 4YRMA 1WZ2A 4E1AA 1IAQA 4KQMA 1XQ9A 2AOVA 2D0IA 1LU9A 4I1OA 1C9NA 4REQB 5AOAA 4AULA 4R8LA 4BO3A 3E15A 3HCOA 3I12A 1MJHA 3QU4A 4MVJH 1Y63A 1P44A 4LRYA 3QMPA 4K8OA 3T9BA 4HSEA 3JYHA 5AJUA 3NHKA 1DG9A 3IR7A 2Q6VA 1QTRA 3RFXA 4JGGA 4WKNA 3GL9A 4P1ZA 2ZBEA 2PIAA 2ERYA 2ZR7A 4JQOA 1DJQA 2ACVA 3RFTA 1QQAA 3F98A 5COQA 2B1GA 4RIFA 4CM5A 4JYAE 4R3UC 3SOPA 1L0BA 3OPXA 1KVSA 1FRNA 2IITA 2Q5HA 1FNMA 1O4VA 2XI4A 4NJMB 1X87A 1Y1SA 3C3DA 3L8HA 4HYEA 3H1TA 2OHJA 4X60A 4D0LB 3M34A 2Q3LA 3TCKA 5B1HA 1MPTA 4KDCA 4WESA 4A8HA 4A82A 3VPXA 3RRJA 5B2FA 4KWCA 4LC1A 1E66A 4I4IA 4WBNB 3FZGA 1HDCA 1WUHS 2F48A 4MU0A 1V11A 2ZBQA 3ZDXB 4WT7A 1U1EA 3NLLA 5KYYB 3LT2A 1D7OA 4DDVA 3FGPA 3KLPX 5HCUA 3AUJB 5FOXA 2BISA 2ZXUA 2FWRA 3RDPA 4AF7A 5A71A 3ZHOA 1GPYA 3I8XA 2X7XA 2FUKA 3MLAA 4HDOB 3L8ZA 3QVWA 4MI9A 3TX6A 5IM4F 3AGPA 3AKZA 3S2IA 3KQSA 4W5HA 4A3SA 4UDXX 1P1BA 2OV1A 2DHRA 3HBLA 3HPRA 3ZLVA 2AEMA 2P2NA 1RYFA 3CU5A 3VNUA 1HORA 1P5JA 4WZAB 3P9KA 2C5BA 3C5CA 4PGAA 3RUEA 4DR6I 4MV8A 1E9CA 1KI1A 2ONCA 1OU4A 3J80Q 1YQUA 3E2MA 3LFTA 3M5DA 3SIRA 5CLIA 1IATA 3T1HE 1AXEA 3LXMA 3AEKA 4YAOA 1X7DA 3B7GA 4EYEA 5FUQA 4CV1A 2AQHA 3PLRA 5P8WA 2PRZA 3O03A 3WLNA 2GYVA 3ZXYA 3KYIB 1RZRA 1J56A 2WMYA 2CKMA 2B8TA 2FMKA 5BYAA 4NNJA 3V8RA 3T7IA 1J2RA 4MPRA 3U1YA 4WAUA 4EG0A 4LY6A 3KDSE 4CDMA 4W5QA 5JS1A 1ADBA 3VSDA 1AZSC 2CWDA 4FQ5A 4BNHA 3OESA 4Z0PA 2YRWA 4IGKA 5KSWB 3Q6NA 2QS9A 3LLMA 4HGRA 2GCOB 4XOUA 2FDXA 4ZYUA 1TNDA 2BFAA 1NLYA 3WY9A 4CM8A 4EDHA 5CCXA 2Q45A 1R37A 1MU5A 2AG1A 3QF4A 3TSAA 1H5NA 3PC3A 1KMQA 1X3LA 1PT8A 4RA9A 2XJ4A 5ALZA 3UAOA 3WO0A 4ZJUA 4FMPA 4B0OA 4DR1B 5C31A 1IPFA 1P5ZB 1AKVA 2HPVA 4PW0A 4DEYA 4N0EA 3CZPA 3IKLA 1YDGA 2WEKA 5BSFA 2HMUA 2JKZA 1EUCB 4FKZA 3CWCA 3FYHA 1FTWA 2VP0A 2QN2A 4YQYA 1KIFA 1MX0A 1H4VB 2PWAA 4G8JA 2Z8ZA 3FTNA 1NX9A 2O8VA 4NH4A 1UBHS 3S2GA 4ATNA 1G6KA 4BNNA 4G0WA 3PLAE 3VVBA 3E8SA 5FWKA 4FGSA 3Q2IA 1SN7A 4NC9A 3N70A 1JBEA 4WLVA 3FHTA 3U1VA 3J81k 2JGRA 4URZR 3JQ9A 4WL0A 2ZAGA 2AFHE 4B4OA 3TMKA 1VQ1A 1NVAA 1MN6A 1R9MA 4V1CA 1U8AA 1UFOA 2BF4A 3AUAA 3JALB 5K99A 3IP1A 3BSSA 4MPDA 4BBAA 3HB5X 4LF9I 1CX9B 1AE1A 2IEGA 3O1IC 1DXHA 3IXMA 1K47A 3MMPA 4EKGA 2AC4A 1SBHA 2P4SA 2VHJA 2WD7A 5CM8B 4MWCA 3WHPA 3OPMA 5DNWA 1C3JA 4GKJB 3ZWXA 2ZM6E 2QZZA 3EFOB 3S4YA 2IHVA 3L93A 3ASUA 1SUSA 4LGYA 4WKPA 1GAWA 3WV5A 5HQTA 4H7PA 5HBRA 5DNEA 3MOIA 2HU2A 3IDSA 1M1YB 3G2MA 1ECBA 4IDEA 5DO9A 4QJ3A 4KPGA 3ROKA 4N5IX 4E5KA 3BJMA 2NAFA 3ZKDA 1ARZA 4CKBB 1J2EA 1F0PA 4JUFA 5F33A 1N75A 4B3RB 2XE4A 3B6MA 2RHWA 4G23A 4IBOA 1YZUA 3UHFA 1NOIA 2E87A 4MB2A 2CYBA 4M9RA 1W0CA 4RZIA 5THQA 2B1JA 3KQYA 1Z5PA 4FI3F 4IF4A 2ETXA 2J3JA 5FYDA 1PJ8A 5IK2A 3UC5A 2H54A 4MV0A 2IV7A 1ULTA 2H4ZA 3GFTA 4L5JA 1G7SA 5I7SA 3QKIA 5AQ1A 2P79A 2JJQA 2RCYA 1XEWY 2VDWA 4DA6A 1YONA 3NATA 4G65A 5BSVA 1IOLA 5AUQA 1XJ5A 3GT7A 3R76A 3OX4A 4JI3I 5FYQA 3DOOA 2GJ9A 2M2IA 3K94A 1RWXA 4MKRA 5F78A 1SC6A 2VPQA 3V2UA 3VXKA 3VZQA 4CE6A 2IDZA 1YUBA 3KU4A 3NCTA 4MQFA 4YDRA 1MNQA 1J8VA 1N2CB 1TF5A 1ZPDA 3I9MA 4GPBA 5ALRA 4ZZ1A 2W6IA 4X65I 3Q1QA 3OU2A 4FMDB 2R7AA 4HDSB 5HKKD 1JLLA 4G5RA 3U4GA 4LVUA 2QYTA 4HXYA 2XZPA 4LVCA 1E9SA 1ZUNB 4UVHA 1CY2A 4RZ2A 5AMXA 3OTOE 5I7AA 2C39A 5B7PA 5FWAA 3OMXA 1KDPA 4KXXA 3DPUA 4C01A 4F86A 3RUFA 1R4NB 1DL5A 4WX2B 1MQ8B 2P9YA 4BVJA 4CQMB 1MEJA 2FXVA 3F6SA 2Z04A 1RHRA 4FJ1A 4JLUA 1XMSA 1C7ZA 3N8IA 3JSXA 2WTXA 3MWFA 4RF2A 1O6BA 4UDNA 1NRXA 3B51X 4ZKDA 1UKAA 5IMSA 5LWHA 4D1YA 2AJ4A 3JXEA 3OZSA 2D3WA 3ZWDA 2PTHA 4KE8A 1QQ7A 1L4GA 3MXOA 1TW3A 1BGVA 1XZCA 4ZO8A 1E1QD 3K4QA 2AH5A 5D00A 1PGNA 4LV6A 4CMGA 4LYYA 5DH9A 3JWPA 1SXJA 5FBZA 2I22A 4U3BA 3ZY3A 3IV9A 1G3RA 1NVBA 3D6JA 3FUWA 4UHCA 3L7AA 5F1PA 4B45A 3ZVKA 3PJRA 3IP9A 4J1SA 1A2OA 3DCYA 3F4LA 3FSEA 5ADWA 4WLNA 2Y1WA 3IUNA 1L4MA 3RT7A 2WJZB 3TAHA 4NBNA 1P2UA 3BVPA 2ZIXA 3N07A 2P3LA 4MVJD 1CNEA 1NJFA 1OJ4A 3PWSA 1C4KA 4DCTA 3FIJA 3PEEA 3JZDA 1E58A 5CNIA 4UOQA 4FZ3A 1T91A 1ZK3A 3AF2A 3PPXA 1EXNA 2PMWB 2GZ2A 4IIJA 1KNQA 2IZ6A 1U2TA 3UK2A 3M49A 1EA5A 3DYIA 1EFVA 3TOCA 4HDMA 4R2LA 5BRAA 2ECQA 3KUCA 1HWYA 1DBWA 1C8BA 3UJNA 2HBRA 1KVKA 4KAFA 1UINA 2VAMA 4LZZA 2DJ5A 3LA6A 4Q1CA 3V80A 5K8UA 4PRLA 4XM0A 4R1PA 4J2TA 4BNUA 3WGTA 3MLBA 2FSVA 1TTTA 1M2WA 4CIAA 1O03A 3ND5A 3DAFA 3DW3X 4QO8A 4ZD6A 2F3UA 4UTOA 3EXIB 5MHTA 5AQEA 5KYVA 4B34A 4UFPA 3SBEA 2PPVA 2YV4A 4D6YA 2GN4A 3GJRA 4OQDA 4RFLA 4GFDA 1KDTA 1DT3A 3TZKA 5U4XA 4ENPA 5FHQA 3I9V1 4OH1A 4BZQA 4XRGA 4OLAA 5GTDA 1IU9A 4JG4A 5DNVA 4LF5I 3L43A 4ARVA 2V9CA 4W8OA 3BYZA 5C8YB 2FY8A 3K73O 4XWOA 5C5EA 1QMPA 2IZ0A 3G0IA 3PQDA 2WTBA 4RPKA 4POOA 1S89A 4PBTA 4CLOA 3CH4B 1I4DD 3AFNA 5EERA 3B8HA 5JNVA 4E2YA 4K6KA 1W96A 2X9NA 1Z6YA 3ONEA 3Q7EA 2F3RA 2J08A 4HWKA 4R84A 5FO1A 5JC8A 4CLRB 2X1MA 4RNCA 3VC1A 4AUEA 4K2AA 4R71A 5IDQA 2DR2A 3RS2A 4M0EA 4NFYA 4ESHA 4FFRA 2B6NA 3KJNA 2NZ2A 3GH3A 1CQXA 3WYFA 5ENVA 5TDHA 1JLRA 1Z3IX 4R51A 2WG1A 3R3VA 1SKBA 5F3RA 4YASA 2R48A 4PLWA 2YWXA 1I3MA 1TU0A 3AO0B 4JP1A 4CGZA 4RCVA 3ZU2A 1RAHA 1RZRD 3W8NA 3BS4A 2PGIA 1N0VC 1UL1X 4YAJA 3SZLA 3UT6A 1MX1A 3ND9A 4DR2I 3W5IA 1QVAA 2WIBA 4IKPA 3DDWA 1R0WA 1XTKA 3PA8A 2ZVDA 2R1TA 3TSYA 3O47A 2IZZA 1GPNA 1HV8A 1JHDA 1EDDA 2YHAA 2INGX 5EKTA 4X97A 2F90A 2Y1EA 3Q4GA 3QZUA 1O2DA 1TEXA 4M1ZA 3II6X 3IUJA 3H8SA 1CR2A 1OGYA 1RI4A 3PGJA 3MRSA 4GXRA 1XMXA 2A86A 3MT7A 1T10A 2RSLA 5GJCA 4DNFA 2DKFA 2D5AA 3K53A 4NH0A 2NADA 1OIVA 1T9KA 5E7JA 3PRJA 3QPCA 4BX8A 1I1NA 4C88A 5BMOA 1YR2A 4LI0A 3QLJA 4MS3A 4X3OA 5AKGA 1FWLA 4RD1A 1E6MA 1XZHA 4XW2A 3T1VA 2IUEA 3VM6A 4RQAA 4Z9YA 3K5IA 3PHIA 4MVJF 4EB6A 4ECAA 3GFBA 2D2IA 4IP0A 4X6LA 2DFVA 2R6ZA 2D2EA 4F9GA 3I1FA 1CUYA 4PRZA 1XKLA 1P0MA 5D3KA 5JD6A 2OQRA 2XOXA 3AFIA 4Z4EA 4H18A 3AIKA 4BMXA 3TINA 1EM6A 1YRLA 1PQYA 2WIJA 3PNYA 4OH7A 4TMYA 1ENPA 1CIVA 1NM5C 2ZT6A 1T5DX 3IODA 4F1KA 2P75A 3ULKA 2H4FA 1T2NA 1O77A 2D13A 2XOEA 3E22B 3IX7A 4JASB 1MD9A 3L7LA 1EFLA 3VHQA 2XXJA 3BC1A 3GEEA 3LUGA 5TMEA 1M34B 1YB4A 1YS1X 2FPKA 4P8RA 1JDUA 1COWA 5C46F 4YCNA 4J2OA 3QE4A 2EQAA 3FG9A 4XGKA 1JHOA 4ODIA 3DHEA 5LZ9A 3OICA 2H5JA 4OHOA 4B9EA 2HHHE 2WT4A 3O82A 3EPRA 4BPRA 2DB3A 2GN8A 3V8QA 3AESB 2QX9A 4RD6A 2PNLA 4UMDA 3LQQA 4LFBE 4QNKA 4DV3I 2YJ3A 3OH8A 5AICA 2E5LI 3PNBA 2EWMA 1QX4A 1ZJYA 3V7UA 1RBZA 1N4AA 3LNCA 4M99A 5CJPA 4N39A 2IC5A 3EXEB 1TUGA 4CMHA 3A58B 1QG6A 3WK7A 1Y6FA 4ER6A 1AT1A 2B1QA 1US8B 4KPYA 3DDHA 4K46A 4RA6A 5IK2D 1ZMBA 3IMCA 5B36A 3P52A 3K16A 2KB0A 5EXSA 4C3ZA 1SJ9A 3FH0A 1K9VF 5I51A 8GPBA 1W52X 1XAHA 5C8YA 4D9FA 2EKLA 1G3UA 2VUSA 2XUOA 4F21A 3GDHA 4BJ3A 1Y3FE 2PLNA 4NZMA 3PC8A 1IY9A 3CLKA 4EHNA 1BXZA 1EVLA 2DQYA 1IBLB 2ZIGA 5BWCA 3GHHA 4I14A 1F20A 2M98A 4AQYE 3LP8A 4ZOEA 1GSAA 1UC5B 3N5CA 4N76A 1FFWA 1J5EE 3R3HA 2VPIA 1OCEA 4JX9A 2XEDA 3WLIA 1ZWLA 2W6ID 3RC7A 1SBCA 1FVOA 4LRSB 5KCZA 5JTUA 1AN9A 1XP8A 1KS9A 4G9EA 1YI8A 4XWWA 1MLDA 3N59A 3AVVA 3WHLA 1T6NA 4B8ZA 2HMTA 2UVPA 3DS8A 5AK5A 4Z9AA 1O9BA 1LRJA 4OK6A 4FBMA 4YALA 3ZUPA 4P38A 2IQ5A 4DPTA 1ZZEA 3ASZA 1TZJA 4DIBA 4E09A 2XDQB 4GF5A 2O9JA 2IZ1A 3AUSA 4NULA 3GRKA 4WCFA 4Q9KA 4L4UA 1I3KA 3SZUA 4DR7B 2WQ6A 2LR0A 2R9VA 4X62I 3G88A 1K0UA 2ZQZA 3ZJ4A 4AIDA 1MTZA 2QM7A 5H68A 3PXEA 2O0LA 3M4JA 3P32A 3VSEA 4RVNA 2OWEA 3QVGA 2XJ9A 2J3EA 3QH4A 1EZ1A 1GWNA 4HRXA 4RWEA 3V5NA 1SXJD 3EYAA 2JJ2A 3PDWA 3D1JA 1P9WA 3RUCA 1E0SA 2OGTA 4RHUA 3KWFA 4EF5A 6CHYA 4MGEA 4OQYA 1G8FA 5ERYA 2ZBKB 3WWDA 2E89A 4X54A 1OT3A 1XLWA 3MELA 3BWVA 2WNRB 5KQMA 1U8CB 4K6OA 2E4ZA 4NS1A 2DY0A 4LXYA 3LT0A 3Q2OA 1Q1GA