3PRYA

Crystal structure of the middle domain of human hsp90-beta refined at 2.3 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
255
Chain Sequence
KTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock protein HSP 90-beta
publication title Crystal structure of the middle domain of human HSP90-beta refined at 2.3 A resolution
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 81
structure length 255
sequence length 263
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pryA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pryA02
2O1TA 3PRYA 3Q6MA 2CGEA 2IOQA 2CG9A 1USVA 1Y6ZA 3HJCA 1Y4UA 2O1UA 2IOPA 1HK7A 5FWKA 1USUA 2O1WA 2GQ0A 2O1VA 3Q6NA 1Y4SA
chains in the Genus database with same CATH superfamily
3RSSA 3V4LA 2V58A 3I64A 1G21E 1EVQA 1N5IA 2B5OA 1I94B 1EXDA 4XGQA 2B2NA 1LW6E 2WFLA 2FFHA 4CMEC 4GVXA 2HSJA 2Q7OE 3LY9A 1E66A 2FWBA 3O1HB 4D80A 2YVQA 1K2WA 3RK0A 4DREA 3PLRA 1J70A 1WLSA 5F4ZA 4AMZA 5EERA 1JU9A 1NUQA 3KV3O 2D54A 1IJBA 4QBFA 4W5QA 1P9RA 3VTAA 3BXPA 3M1AA 3ORHA 2Q50A 3LU1A 1UKAA 5F98A 1U0GA 2NOAA 2W6PA 4MU4A 2PWZA 2SBTA 2XW6A 3F8WA 2JEOA 3KEGA 4G09A 3CUTA 4HHEA 1RQXA 4I9UA 4AP9A 1M33A 5KQGA 4Q3NA 2VPYA 1Z8NA 3RROA 5A7GA 3T3MB 4K1LA 1ONBA 1ZD8A 3OMXA 4KN5A 4W1PA 5CNKA 3KT3A 1R6VA 2B8NA 4F7WA 1Z0GA 1J09A 2ZJ4A 4C0AC 4F3YA 3CJTA 5LXTF 1FE8A 3ZK9A 5IUJC 5E9AA 5JDIC 1WBBA 1FLNA 1MQ8B 2EKDA 2ZE5A 5KTMA 4MZXA 4KL8S 3HWRA 1DGQA 1T25A 1X8KA 2KM1A 4B7CA 1MRSA 1N8TA 2C98A 1XCOA 2WT4A 3OFKA 2Z2JA 4L85A 4LYEA 4UBLA 1QS0B 3CLKA 1XPOA 1JI0A 2Q5LA 1F6BA 2ZJ0A 1FMJA 5AM3A 3THWB 1UOPA 3KEFA 2WT8A 3BMXA 1EX9A 1PUIA 1G0OA 3OP1A 4QYIA 1LUAA 4PHTA 1KFKB 3H2BA 1HEUA 1XLWA 4E2WA 2YYYA 2A9JA 4JI3E 4PNHA 1EDOA 2ILTA 3GGPA 3NVMB 4O63O 1GZHB 1QAQA 2R11A 1JGTA 2CVHA 3E2PA 4YJ3B 4KWIA 1T29A 3U4CA 1TYEB 2ZJ6A 4WIAA 1O6ZA 5CFRA 3VR6D 3FPCA 5LDHA 4IJKA 3W9BA 4DR5I 2XVXA 1IEXA 1UPCA 3PUYA 1EXMA 1RPJA 2QF7A 4ASUD 2A2CA 1QU3A 1IM8A 1XZCA 1ZI9A 2FSVA 2GXUA 4AJ1A 1RLMA 4YROA 4F72A 2Q5JA 2H2HA 1Z7WA 3GN1A 3PR3A 2OWEA 4MVJF 1JG3A 4XDHA 5JE8A 1MEJA 2HRCA 1ZCFA 4RMHA 2C95A 4ZK6A 2I9PA 2HA4A 3TZKA 2Y1FA 3WK9A 2ZUFA 3G2NA 3GEIA 4Q4HB 4K26A 3PB3A 5E6SB 2PQ6A 4XTRA 4EB0A 2F4VB 1WAMA 2AG8A 2ZJBA 4EO7A 1IXZA 3HZOA 1Z12A 2HXSA 1RTKA 3R0IA 4JYMA 4DCGA 4US2R 1T0BA 2VA9A 4XGKA 5DFAA 1I7DA 2QORA 4W6ZA 4FW8A 4CMEA 1BS2A 4YWJA 5ILOA 1CNEA 1A7AA 3LBAA 4Q18A 3RD5A 3TNFA 2DG2A 2OVFA 2QUBA 4MV7A 4EYGA 5LA6A 3P76A 2DFVA 2O0KA 4DPTA 4DUZE 2BKVA 1FOEB 2YWFA 4Y6GB 1U9JA 4RHTA 1Y3FE 3F7NA 1UJCA 4NX2A 4AP5A 2OCLA 4FZRA 4G5RA 2AXNA 1XIVA 2CDAA 3FYSA 3R24A 3DZHA 1OGIA 4RF2A 2Z43A 4EECA 3KDSE 3PQEA 4JJZA 3WNBA 2JFXA 5G3ZA 1V7ZA 5M29A 4GOOD 2FKNA 2D5AA 4NEGA 1YZNA 5IN4A 2JJ8A 1V8FA 2XUPA 1EGHA 2PS9A 3IMGA 3QEOA 1TK9A 2PR7A 4OMUA 3SXUB 3TTVA 2QWXA 5B4VA 2Q99A 5D5QA 1CVLA 3EXHC 4PU9A 2WILA 3VR5D 3VDXA 4V1CA 1H6AA 2BFEA 5JFOA 1V0JA 2JBAB 3IC5A 4XJSA 1AB6A 5GOZA 1CNFA 4XPZA 2NPIA 4QNJA 2EWMA 1DIRA 1PT6A 3AETA 4GLFA 4F84A 1PZNA 2DKOA 1BTOA 1KPHA 3LX6A 4GM4A 4OQXA 3AKYA 4I3HA 3PJGA 4OVKA 2M98A 4EHLA 5BRJA 4Y2SA 3Q3GE 5K0TA 3EXFB 3G2PA 3VSEA 2XHZA 3OVMA 1K4YA 1UDCA 2ATCA 2P8JA 4DANA 1PGPA 2Y9PB 5JJKA 1IQUA 4HL6A 2IZ6A 4IOKA 3HUUA 3DOJA 3R7SA 2D2XA 1DRKA 1DNPA 1PDOA 1OZGA 4FX5A 5CW1A 4NR0A 3TQQA 3V7NA 1K3FA 5E1DA 2OBLA 4FEAA 3A10A 1XDZA 2DFKB 2Y1WA 5LP6B 2YFKA 3QKWA 5EEGA 4IS2A 3BIFA 4UHFA 3FH0A 2OBBA 2Q5FA 3BT7A 3VH4A 1OKKD 4JELA 3U3KA 3G0HA 5JYBA 5BQPA 4DCVA 2FETA 4FI3F 3I6IA 4CTJA 3X3HA 3IEXA 1DAOA 5A0FA 1FDRA 4UTRA 1AQNA 5K36E 1Z6GA 5CDUA 4JS0A 3ZNPA 2ZIEA 2YMLA 3GZ4A 4FLEA 2C37A 2ASVA 4MHTA 1ULBA 4DN6A 4HK4A 3SHOA 3CRW1 1Z38A 3G1UA 1PFWA 5KO2A 4P2GA 3KTOA 1DKPA 1JP7A 3PWSA 5BXYA 2FUG6 5K3CA 2O7SA 3GRRA 2HREA 3IBCA 4ZO6A 1GTSA 1JKMA 2JI9A 4KXMA 1ZA1A 1N8NA 1GLGA 2FWNA 3DXZA 1Y98A 4MS3A 4UFNA 5HUHA 3O8LA 2GWRA 4ZMRA 4MI6A 3NRCA 2EX1A 3NBXX 3AINA 1KAEA 5ERYA 4DOMA 4YV1A 3FDFA 1N34E 4AC9A 4DZTA 1FPMA 1HGXA 1MVLA 3A4VA 3UQYS 5DRTA 4DV6B 3MGCA 2PRYA 3LX5A 1B00A 4DIKA 1KH1A 4MVCA 1PV1A 5BW5A 3IEUA 1AMNA 1F2UA 1PO7A 2EV9A 3ZV4A 4DSOA 4XCXA 5A4IS 2PA3A 4NNPA 2JFFA 3CUKA 3DVRX 4QARA 2H59A 1XOIA 3OQBA 5LM3A 3PQ8A 4E5DA 1KJZA 2XWSA 3LUKA 1X74A 4ENVA 1JHOA 4BZQA 4EJMA 2BGRA 4ZK2A 5JEAB 1TIKA 2RJOA 3FHCB 4S3MA 2V7GA 3ET5A 4HGYA 4IINA 4Q3KA 3RVPA 3ZJYA 1JXAA 3DAHA 2BZ1A 3ZWCA 4C2AA 5C1BA 4KQ1A 3FA2A 1KKLA 4UQPA 3MTIA 4MGEA 1YQEA 5FP0A 4MI1A 2Z2ZA 3HM2A 2PXCA 4ER0A 5GTDA 3HTXA 4L9WA 2PL3A 3U39A 4K3VA 4C4AA 3C8DA 1JBKA 2YS7A 3QWHA 1PWEA 3R4VA 3RV4A 2P0YA 1RHJA 2WSBA 4BQRA 1VP3A 1FYXA 5AVVA 5KQSA 2XRZA 2V7TA 5LOVB 1QCDA 4ZXPA 4XUGB 4GBMA 4U7WA 3RSQA 2HWYA 2BVNA 1NXWA 3RIMA 3QLJA 1HYBA 3OEYA 4X1OA 3K1AA 5TQVA 2JVKA 3TPCA 1RI5A 2NO0A 2P78A 3C98A 3E2IA 3R20A 3MJHA 3OU2A 3RLFA 1FYVA 4D44A 4LBWA 5DYTA 4ZYLA 1P73A 1PX2A 5CA1B 4OG2A 3FVQA 2DECA 2FSVC 3I1JA 5FPYA 1H1TA 2RAVA 1MC4A 4U6SA 4H3HB 4JOQA 3WIDA 2IZZA 2N9UA 4CFZA 2Q5HA 2PUTA 3LTNC 4V3BA 2WSMA 4HYQA 4XD7A 2YJ4A 3K16A 3Q3CA 3KXKA 4ILKA 3ZEAA 2D2IA 1ADCA 5LB4A 1QF9A 2Z5VA 1PEYA 1BE1A 1U8XX 2N1MA 4UASA 3SN6A 1L7BA 2CJWB 3FCSB 3WLAA 3P0FA 4TTRA 4KAXA 5AXBA 1KO8A 1FVOA 4HQKA 4R1MA 1FP2A 1J90A 3OLWA 4F5YA 2G70A 2Q3BA 4G5FA 4UD6A 2QN9A 2YV5A 3ZHZA 4A5SA 2YJGA 2YWGA 4O1IA 3A9SA 4J6EA 3GEGA 3JAKA 4PLCA 4L8WB 5FTNA 4C6SA 2GYUA 4DR5E 4GKJI 2D0IA 2HCJB 1SIWA 3L8DA 1NRJB 4JI0I 1XYYA 3I0MA 1IB0A 1V37A 1NU6A 4PYNA 3KBBA 1CX9B 1FJHA 2X3UA 3NNDA 3VVLA 4CQMA 4ME6A 3BFJA 2EFCB 2RHOA 1MW9X 2FCAA 2O20A 3CE6A 2GUGA 2B1QA 1NYTA 1UPBA 2FZEA 3KM0A 1ZUNA 1PKPA 4DPYA 2EBFX 4NCXA 2QV7A 4D8UA 4ETNA 1ZGCA 4Z1OA 4RFVA 5LL6R 2GEBA 4DSZA 3FY4A 2YX1A 5JISA 4ZEXA 3DBLA 4ZOEA 4ND4A 3OPNA 1TGVA 4MPDA 5ILGA 3U9TA 4POOA 3P3CA 1QTQA 2JVIA 4MA5A 1N6LA 1ZOLA 4OZEA 2FSGA 4O4IB 3DONA 5L4LA 3DDSA 4HWKA 4AY6A 5HW0A 1QYIA 5HCUA 4G4JA 1NT4A 1M2KA 2AMLA 4AJPA 2ZJ7A 3OZEA 5ETJA 4Y18A 4DV7B 1RCFA 4FFVA 4X1KA 2PSHA 3L02A 2F00A 3GG9A 1YE3A 3O1LA 4MR7A 5DLQC 3UTDA 3C74A 5HF8A 2QX7A 4GO1A 4TLAA 4P4GA 1XN4A 4UFPA 1NMSA 4BP3A 5L53A 1IL0A 3KVRA 1YJAA 1V6AA 2BMJA 2QX9A 4YJDA 1UMDA 4C3OB 1MOZA 3WK8A 3F6CA 3ORYA 3UTCA 1E3PA 2B3DA 4LJ8A 4OAPA 2PM8A 4B5KA 2MINB 4FW9A 1IAQA 1SU7A 2C8KA 3GT4A 4MVJI 4O2BF 1Z62A 1S4QA 4KX3A 4ZD6A 1HC7A 3FI9A 3H2IA 5EL0A 4RY8A 2YICA 4HXEB 4ZI2A 1OYRA 5D01A 5A3RA 2X9NA 3H5WA 3HWSA 5F5NA 3U37A 2IA5A 1RPNA 1J5EI 4HDQB 8AT1A 2HHCA 3FBWA 4PLWA 5DULA 1Z37A 1E2FA 1E4VA 1YFZA 3KPWA 4ZVSA 5BVGA 1K6IA 5IDXA 1X9HA 5JRJA 4X65B 4MK4A 2PO7A 2DWCA 3C45A 3MD9A 4GQIA 4A0GA 1MIOB 1J21A 1GUFA 4IJVA 1B6GA 3Q9UA 2W6QA 4FOSA 4D8TA 3UJHA 3OLCX 5H3HA 5ALLA 2IUTA 2HK2A 1P5HA 1Z0SA 3F8TA 4D3ZA 1BDHA 3NEPX 1ATIA 1Z6AA 2ZB8A 2DWUA 3QUTA 4IOMA 4ESVA 5AI4A 2BA0D 3K0FA 1PL0A 4KQ9A 3H3FA 3M85G 3U4MA 3I58A 1N3YA 4C0JA 2VEDA 1Z7BA 4QBKA 2ZM5A 1YH3A 4YLYA 3CVWA 1XJCA 3BICA 2UU9B 2J09A 4EQ6A 1KAMA 3IQDB 1ISHA 4CM4B 2R9VA 1QIMA 4LC1A 2AK3A 3I2FA 1GT6A 4G4IA 1NOKA 1UXIA 4Q82A 1KSGA 4BNFA 3PS2A 2BISA 2W48A 3H5AA 4MROA 2IWRA 1H2XA 2NO4A 4UHKA 4B6FA 3HB7A 3S81A 4YQYA 3HCWA 1XRSB 2B7CA 5TPWA 1E3JA 1X80A 3PHIA 1GCOA 3K5PA 1NMZA 4CKXA 4I55A 4JU9A 2FOIA 4IGFA 5EKXA 4Z54A 1B3BA 1KOLA 1PGNA 2HYIC 1JG2A 4U7JA 4NHOA 4EHJA 2D7JA 4KNWA 3VR4H 2R5NA 4RTPA 5FA5A 2C92A 5TVKA 2Q6VA 2V59A 1RKXA 2AN1A 5LJLA 1MJ5A 3LFHA 1R6BX 3ICCA 1UPTA 4YMGA 4BC0A 3TGLA 5EVCA 5AXCA 1UT5A 2DFDA 3EFHA 1AXRA 4LCBA 1V35A 2I6SA 3HSYA 4X00A 4YCDA 1TCCA 3R5FA 3SC6A 3DAYA 1KIMA 4JYAB 3OOSA 4KHPB 2ZBFA 3QVKA 1TZCA 3WAGA 4RMGA 3A1UA 1V26A 3SZMA 2HHJA 1IY9A 1GADO 4K9RA 1CUDA 1YQTA 3TRFA 5KOHA 3VPDA 3IHWA 3DZJA 3QRWA 3IMKA 4YRJA 4U00A 5LZ5A 1DUSA 2B92A 1X7XA 2DWQA 1VOTA 3B7WA 4GLLA 2AIRA 5GJCA 1MX0A 1XN1A 2IZ1A 2ZRBA 1E9SA 4RSMA 1AHNA 1N5KA 3CEMA 4DDWA 2Y1DA 1UKCA 1F0YA 4PPYA 5M04A 2BJHA 2F1KA 1ZQ9A 2C5LA 2CLLB 4UEOA 2AFIE 1PF7E 4WESA 1GQSA 5CT8A 2CMGA 2GCGA 4TLBA 5B53A 3WYFA 4PRKA 3WLFA 1BROA 1J9EA 2OCAA 1J7KA 4GBED 4IFBA 4UBIA 3SX2A 3GP5A 3LGXA 4IS3A 1MX9A 1BCRB 2WM2A 4G5HA 5HQ3B 1YQDA 3MGKA 5EIBC 3HYCA 4TYMA 3AR4A 4DARA 1X70A 1ATZA 2XXBA 1N1GA 2EATA 4B74A 4V0OA 4Y2HA 2CDBA 2JLUA 1CJBA 2NUAB 4EY3A 3W9YA 4QTXA 2ATXA 2B8JA 5F76A 3B1KA 1DO0A 1QTNA 4DLWA 5C0XE 4JMLA 3ZWQA 3LUHA 2FOLA 3BXEA 3GFBA 3LL4A 3SS9X 2IDKA 1X14A 3RTEA 1UQUA 2FWAA 4IHJB 4MUNA 3W7VA 5AHOA 3HU5A 2KLHA 4I4TF 2WY2D 3ZC3A 1QV7A 2XIQA 3GPBA 4HNQA 1ABEA 1H2EA 4FUQA 1JXMA 5LYJA 3C1AA 3KCQA 1A04A 3OE1A 4IVNA 5CR9A 2P8SA 3FVTA 4YAGA 1RT9A 2VYFA 2YHUA 4I1PA 3NC0C 3NDPA 1II8A 2JNWA 1XQ1A 3U1TA 3BH6A 2BHRA 2I2AA 3S4YA 4ZDIA 1KO1A 1P9LA 1W52X 5D1NA 2REXB 2YJNA 4N3AA 3L8FA 1HH4A 3LFTA 1N2GA 1P3Y1 4R16A 4M1QA 3T9AA 3LLUA 4PQEA 4URFA 3PGA1 2GOYA 2V3VA 3TLAA 3M70A 4DNFA 5D3ZA 4QNKA 1DMRA 3ZGLA 2RMKA 2VJPA 1PD1A 1TLLA 4GKJE 4JKOA 4R5HA 1IM2A 3C1UA 2QSZA 2J0UB 4YO7A 2GK3A 3NI2A 5D7NA 1Q2XA 4C1BA 1KY5A 1N4DA 4J9VA 1K9VF 4JEHA 3JXEA 4NBWA 4EENA 5A5FA 5CD9A 3D59A 1NTOA 4TUYA 8LDHA 2Q4EA 1OC2A 4IDGA 3PICA 1G20A 1Y7IA 1S8OA 1NA5A 2H4JA 4GSKA 4IZ6A 3CX3A 3S1LA 1UDWA 3SPXA 4OBEA 5B37A 4TMYA 3QM1A 3EAQA 2VQFB 2Y1KA 1ZN9A 121PA 1Q84A 1XAJA 3J7TA 4I4NA 1OWPA 3L7IA 3ZWAA 3G13A 4QUHA 1CS0B 4RHYA 1I8TA 4YRDA 4B47A 3EPKA 5IF9A 1C7IA 4YHHI 1W48A 4MS4A 2JFBA 1G5RA 1DXOA 1BHJA 1E60A 1RYFA 4MVJH 3ZBUA 1M5RA 4BXOA 3H65A 3NUQA 2GBPA 5FB3A 4X97A 5JEDA 4GYKA 2FDCA 1NLZA 3IJEB 4CCYA 4LXQA 4BQOA 5B3KA 2IZ5A 3DDHA 4D4LA 5K4GA 5F1YA 3DL2A 2VNKA 3I01A 4I3GA 3UMRA 5JXJA 3DMTA 3WICA 1X92A 1RCTE 1MQAA 2Z5LA 4LJYA 3JYNA 4UE3S 5CM2Z 1P75A 1VL5A 4YRKA 5BP7A 3LNCA 4GX0A 4Q9KA 4DY4A 3D0OA 3MBKA 3ZDXB 4XD7D 1GG5A 5JI3E 3VNVA 5EIBD 1T6NA 2AVDA 3PUKA 3LOUA 1R00A 4MRVA 3RIYA 2H1OA 1YR9A 1RHKA 3D6FA 4JI8I 3VA7A 1QTIA 2CFCA 2FRDA 1KSJA 2PKQO 3IOCA 4FDMA 2RONA 4IO0A 5BT8A 4MVJE 1YRLA 4H1UA 1BXKA 2VYNA 3OQ1A 4MVJG 4C0KA 3H9UA 3K0EA 2C2GA 2Z5BB 2SCUA 3GNLA 5JYEA 2W6OA 2ECOA 3ZWKA 3L6RA 4HDMB 4OUKX 1QHIA 4I2NA 4RS4A 5E6RA 4Z0TA 4DPMA 2PG3A 3FOWA 3O0DA 3R44A 2FPWA 1O03A 3C14C 3HY4A 4TRRA 3GN2A 4AVYA 5KHLB 1UZAA 1N5JA 2OK7A 4RJJA 3VC1A 3U60B 4LDPA 5JH7B 1ESMA 2EIHA 3MNFA 1OH6A 3DMHA 4D5GA 3IVGA 3COZA 3RJZA 3RWMB 1OYSA 3QY0A 4CQMD 1KF0A 3NFYA 3VU1A 1RRMA 1WP4A 3DS8A 3H1PA 4XTCS 3E7FA 2DKFA 1YL7A 2GF0A 4BNXA 4GPZA 5DGHA 3LIPA 2YOHA 2C0QA 5B30A 3EC7A 1SEVA 1LRLA 3U09A 4D4GA 3SX4A 2G25A 2CXHA 2O7QA 3M4NA 4M6WA 1ZICA 3NORA 4X71A 2Y9MB 2WPNA 5DI3B 3QVUA 1JDBB 2EAUA 2PNZB 3PXEA 3RVLA 4UC0A 4Y6PA 3JVDA 4K81B 1CHDA 1U31A 1X1DA 2X5XA 3MJVA 2GNPA 1RKQA 2MYPA 4FB5A 1JQ5A 1JEQB 1Y3CE 3R0XA 4OHOA 1VPTA 3E9RA 4CLRB 5HGXA 4L57A 1O7JA 3CONA 4S04A 3GRAA 3RAFC 3A6PC 4L6AA 1M3SA 2F4VE 3KZMA 4BNZA 2GS9A 3BEOA 4NE2A 1P2UA 4NJEA 3JASB 4DKJA 4YDSA 4ENRA 1M83A 4LYAA 1OH7A 5LBTA 3OZFA 1VI6A 4U6QA 1GUAA 1TM7E 4MQMA 4QBHA 4Y2PA 1YD7A 3CW2A 4MRMA 2O7VA 4ZJPA 1PR3A 2J32A 1ECCA 3DDWA 2Q2VA 5K0FA 1OA0A 2EF1A 1U3DA 2XLCA 3AR6A 1LC3A 2OHFA 2QLTA 4WD3A 3PGLA 2OYSA 4ZVPA 5EJ8A 2V2ZA 1FTWA 2HT6A 4FW6A 5CXSA 1EP2B 1GAJA 2BBWA 5KJCA 1WBJB 4CKWB 5C3MA 3PVZA 1ZC4A 5DXFA 5K8LA 1Y5RA 2D2EA 3I72A 5JMTA 5LD2B 2B1GA 2GBIA 2XDAA 3VKUA 2B8TA 3ASUA 1AKWA 1Q0QA 4UAJA 3GOQA 5CTJA 4FIDA 2OOKA 3GNQA 2ACKA 3QU7A 1TXGA 5EPUA 3GPLA 1X7YA 1E1CB 2VPWA 1YIDA 4GYYA 1DBRA 2OV4A 5DNEA 1G2OA 3RSZA 2J3HA 3HC7A 2OFFA 4LJ9A 3AEKB 2R86A 1UZLA 1OW3B 1ZMOA 3C8ZA 3KVYA 4UM8B 2NAFA 1P2SA 5K0ZA 1BAPA 3FSGD 2IDJA 3NHBA 3FGPA 1PFQA 1CY0A 1HE5A 3M6FA 5GPBA 3V6LA 2AC2A 4P33A 3VUFA 4BV8A 3PSAA 1YQQA 2AZTA 1P7YA 4K6FA 4PC1A 3B2EA 4DPLA 5TS3A 4O08A 3W7AA 1B62A 1Q1NA 2RHRA 2QM0A 2GZHA 1GPDG 1FXWF 3ORFA 4GUAA 3DDCA 3LBFA 4KUHA 1KY4A 3RB8A 4D9JA 3O8CA 1EP1B 2JL1A 4PV7A 1DFIA 1VCMA 1Z2EA 1L5MA 4NPAA 4ZVUA 4HFMA 5DOZA 2C96A 3NYQA 1GPAA 2R6GA 3M3PA 1R4ZA 1Y8QA 3B6MA 3N75A 1Y6FA 3CNBA 3FYUB 1MQ9A 4IZHA 2H06A 1DKUA 4J0DA 5IVDA 1UT6A 2HK9A 4HWPA 1J7JA 4A8HA 4CMCA 4MUJA 1JG7A 2EFHB 3C8UA 1LGYA 2J31A 4BO9A 5LMNI 1EA7A 2VJLA 3C41J 3HBAA 4ALKA 4QOHA 1UDAA 2VJNA 1OVMA 4LY6A 1IZZA 2D0OB 2WWGA 3LQQA 5DPMA 5A5EA 2JHPA 1T5SA 5FAKA 4K9QA 1IUNA 2IX9A 4BLVA 1NHHA 4HG2A 2WYHA 1P2BA 4BNJA 2QPOA 1EFAA 1T5TA 2DEIA 4O2AB 1FFXB 4G26A 2Z8ZA 4GR4A 3LBIA 5DK6A 3V3KA 5JXIA 2FA9A 2P27A 3JQQA 3DEJA 3DV2A 2I4LA 3ADOA 5DSZA 4CM8B 4MQFA 5L7WA 3SQXA 3GVIA 2GK4A 5ALNA 3CRRA 1OX4A 5LLSA 1OH8A 2OTCA 3RSFA 5A03A 2HO4A 4HQRA 3D3WA 1J49A 1KPGA 3I92A 3H8JA 3O2JA 1PBNA 4CHTA 2RH4A 3I12A 1E5XA 5BSEA 1LLQA 2G06A 3R9IA 4CQNA 2C00A 2PTHA 2PX6A 3IERA 4DYVA 3DMTC 1I7PA 4F2HA 1FQWA 2XIJA 1TTPB 4IV8A 2P3OA 3PG5A 4DV6E 4K0RA 1A9QA 5I3CA 3L0PA 3TRDA 2GJ8A 1CF4A 5AQ1A 4IMIB 4DLNA 2X8BA 2CMFA 3FSEA 4CLEA 5KVVA 2B1JA 4RWZA 4EG5A 4E3ZA 1DWQA 3DVLA 3R3WA 1GWNA 5ALTA 1UANA 4OO1B 1Q91A 4BKPA 3GU3A 3ZDEA 2ZJZA 1FVHA 3QWBA 5F78A 1BFUA 4CFYA 1TLTA 4R8MA 5LVAA 1SB8A 4UEKA 1QGUA 1XQYA 2FRDC 1X7ZB 4LFBI 3OCXA 2HGZA 2B6HA 4IXWA 5FOXA 4YHHE 2IYNA 2WJ6A 4Y3UA 2WTXA 3WB0A 3B1WA 3LYUA 3VR3A 4CKEA 1FDUA 5A02A 5B1YA 1PQYA 5BMOA 3WGTA 3RRYA 5JAMA 3LDAA 4OXNA 4AQDA 1EUDA 2VT2A 1Z2AA 2X19A 1RYYA 2IEYA 4FSXA 3SOZA 5FCDA 1YDEA 4BCBA 5ADVA 1YF3A 3O38A 4GOJA 1Q77A 2JEBA 4RC9A 1J8FA 5H16A 3R3YA 1P0IA 4WXRA 3ZTWA 3P9IA 4JLUA 4EHAA 1O57A 1GU1A 1QFSA 5FFFA 1I3LA 2Y6UA 4X5OA 1JZQA 2RGCA 2ZBQA 3OG9A 4D4IA 3FCUB 2ZTVA 2VF7A 4LFAI 1ZJ5A 3AVPA 5C81A 1P0CA 3M1YA 2YDXA 4L3VA 2QN6A 3NHLA 1CVRA 5IASA 4R1FA 1HYQA 1NWCA 2BDEA 1N5RA 3HUEA 4JI8E 4MUHA 2Z4TA 2B78A 4KR0A 3K8ZA 3E35A 4KAJA 3TL2A 1TQ6A 4EWLA 2WJIA 4II2A 4N5LA 4Z86A 1XEWX 2QTLA 3TW8B 3V4SA 4X20B 1V8PA 3LCMA 5CVEA 5HEKA 2H0RA 4IX9A 2J0VA 4GKKB 3BSWA 4CIWA 4C7JA 3GC6A 2E5LB 3DBVO 3GLGE 1QE0A 4LHZA 2SHKA 1CT9A 3LC0A 1RFLA 4FFBA 1JDNA 2QYSA 4I08A 3GY0A 3VYUB 3I37X 1IBMI 3QE0A 1PWHA 2QTVB 1KZ1A 1RXIA 3IMEA 2R84A 4HWTA 3LUAA 4ZJZA 1JSCA 4G9GA 4IUBS 1Q1EA 1LW7A 5BW4A 1XVTA 4YJ2F 4D97A 2RHGB 4PYLA 2N0SA 4GIBA 2O8DB 4LPKA 1G2QA 5IM4F 3CNEA 2IE0A 3AQ4A 1D2CA 3MW8A 4QICA 3WB2A 1JFLA 5K2OA 1YJBA 4YLGA 3UCXA 4CF3A 5HZMA 1G21A 3U44A 4XH9B 3BKXA 3PFGA 6LDHA 2VHWA 3L4SO 5EZ5A 3JZFA 5CDYA 4WJZA 4GGPA 1ZBQA 3AERA 4PYRA 1WCXA 1I32A 1NNI1 1S2OA 2W8BB 3FPEA 1C81A 3K0BA 4X3PA 1EKXA 2C1EA 4UEWA 5HFJA 2IWHA 4C06A 3QVJA 3D6VA 1MENA 4ZT2A 1EZ4A 3SBOA 6PFKA 4KSCA 3TXXA 3PD7A 2EEZA 2UXBB 3VKWA 1Z5UA 5K3FB 5CB6A 2J59A 4HJRA 3FKSA 3LX4A 3VAAA 4EKNB 3MCAA 1QQ6A 2ZANA 1W1WA 3LHDA 3QE4A 2E2WA 3P9NA 1QYRA 2J07A 2WJPA 1OPRA 2NVBA 1FUEA 3I9V6 1KRWA 3AVXA 2GTPA 3QBDA 2EKPA 4M89A 1QGED 2XNCA 3GLHE 4TYQA 4CMIB 2B0JA 5ITSA 4GKAA 4E2ZA 1T2AA 5GONA 3TRIA 4DV2I 2OO7A 3FDIA 4IZKB 1Q50A 2V7VA 4UD2A 2HA2A 4XM1A 3ZCXA 4AJHA 4LHSA 2VYND 4L4XA 2ZTLA 2WI8A 2PIDA 1S1MA 1X1AA 3D6NB 3GDHA 3L7DA 3N87A 4IRUB 4KLZA 4NH4A 4EKEA 1HDXA 3KQKA 1SBCA 1Z0JA 1SOWA 4D92A 4Y2QA 3I05A 4S1OA 3CZCA 3H4IA 2XRFA 3V5RA 1XEXA 4LDAA 3FIJA 2UZ4A 4HUJA 3T5PA 2YMQA 1AOXA 1W5TA 1NURA 3JQGA 4NQZA 1JWAB 2DPGA 2PUCA 2G9VA 1AK9A 3COVA 2JBHA 3SNKA 3I5XA 1H72C 3IE1A 4MO9A 5AI0A 3ASVA 3WGKA 1Z0VA 4FKBA 2XKKA 3UPUA 1JA0A 1JDZA 2KLBA 3F1KA 3OETA 4YVFA 4DTIA 3RBXA 3HXOA 4B5LA 4B4UA 4GH5A 3NHRA 5KNDD 1S4MA 5JT1A 3KO8A 2ZRFA 4L0MA 3RQIA 3L8HA 1Q1AA 1THZA 2O2XA 1NR1A 2B3TA 3HBNA 4PXSA 3S8YA 2CXRA 4X0EA 4O4HA 1FW6A 4LCHA 1LXCA 1U0TA 4DCCA 1WSDA 3KZXA 3CKMA 4N9WA 1Y5NA 3A6HA 4EF4A 4E88A 1X0VA 5EMNA 4DU7A 1NHJA 4UVDA 4GI1A 3HGQA 3W6NA 3GLFB 1IN8A 2FEPA 3HCBA 2PT7A 3DTVB 4RYDA 4ZU3A 2A9PA 4C4PA 3AF6A 4NDNE 1YGPA 2JZCA 4XPIA 2VDKB 4RKYA 1E4EA 2C0CA 1QIIA 2A3NA 2VP3A 1IOVA 4OK6A 3L92A 4LFBB 5H4HA 3RT1A 2ZRDA 4P1ZA 4C4XA 4IAOA 5L3VA 4KQHA 1O5IA 3IA7A 4JYCA 4UNSA 3N9IA 1XMQE 4DRXB 3GDFA 4FGKA 1TYZA 2W42A 4R2MA 4RM3A 4JHLA 1AGRA 4GOLD 3CZ4A 3WLLA 1LQUA 1RM4A 1G17A 2WF8A 3JQDA 1E89A 3UJPA 1BFKA 1CEQA 1I10A 2WMDA 3GCWA 3L1IA 1NN0A 4JT4A 5KYNA 3KQHA 1S3IA 2QM7A 1Z0EA 1HM5A 1JIIA 2F1IA 3IJ5A 2VDMB 4O5AA 3TIIA 3V8VA 1ZUHA 2IHYA 1J5XA 2VH5R 3H9GA 2JIBA 1TVKB 2ZWAA 3K0AA 3L8EA 2G28A 3ND7A 1K5HA 3T0IA 3FDJA 1OHHA 2OHOA 3QXHA 4HS4A 3W6UA 5B7QA 4GWKA 1OX6A 4JGBA 3IUBA 4CNQA 1N7IA 1J4AA 2Z4SA 4N8DA 4Q9HA 1C30A 4LGMA 1QMGA 4Y2VA 1H4QA 3CLRC 3FE2A 4HTFB 4Q39A 4DAOA 1E0DA 2P90A 1GA6A 5JLJA 3RBAA 3DE3X 4JYAE 1E0SA 2ZRPA 4LDJA 4I1OA 4Y6QA 1QXSA 2Q45A 2QT1A 2JH9A 2R8BA 3JWIA 1O8CA 4GU5A 2IY8A 2IYWA 5AW1A 4JFAA 1NHIA 2EZ8A 1J42A 1H5QA 2W2VA 3HB9A 5FPPA 5G0TA 4BU0A 5I5EA 4GSLA 1XZGA 1OIXA 4IKPA 2DMRA 2H5LA 4FHCA 2EG5A 4DSNA 3I53A 1FYEA 3MIIA 3U26A 2IU0A 3HNPA 1FTNA 1T8TA 1JHDA 2ZATA 4HNUA 2HFUA 1HKUA 4EYSA 3JTEA 3PSHA 1YZTA 4Q3AA 3UK6A 3PRYA 3BIJA 1GGVA 4QQ8A 3ZOZA 4BO1A 3H9QA 3NEAA 3NM6B 3EWNA 2LD4A 4NOLA 2HT1A 3K6SA 4PQYA 3B7PA 1MO6A 1GSIA 3DUFA 3SJZA 4AXXA 4C4RA 3OUUA 6GPBA 3JATA 2PMBA 4HPJB 3VDNB 4WW0A 4JB0A 2O5RA 4HZUA 4B34A 3LSYA 1CY6A 1R4NB 3CKKA 3LC2O 1M2JA 2BR3A 3L5KA 4AZ3A 1RM5A 2X7HA 4OF4A 3GFVA 3O8QA 4CN8A 4HNGA 1L9KA 3P9PA 1XCJA 3U3MA 1CXZA 3W34A 1DAPA 1Z3CA 3GV0A 3OTGA 4F4CA 3T4EA 4B7ZA 1FFYA 2JGRA 2XQIA 3THSA 2WM9B 3AFHA 4LFAE 4CIXA 3DMYA 2JF0A 2ZBKB 2V8OA 4DYHA 1ID8A 4E09A 4Q19A 4ZMBA 4KBGA 1O5OA 3DD5A 3VR0A 4DA8A 1T8WA 2EW8A 4TQUS 2BJVA 3BIWA 2O8EA 1QFZA 5I47A 3H99A 3W1VA 2EFJA 4PLFA 2DJIA 1KZ4A 4F8YA 1JMKC 2W37A 3LHKA 4X1IA 5G3YA 3PX7A 4A36A 1T34A 3HS3A 3PQ5A 3SSMA 2ZYVX 4DDHA 2PX4A 2F4NA 1WNTA 3ODPA 5NLLA 3NJRA 4BA2A 3GMEA 2WIDA 3SJBA 3T8YA 1KDVA 4LXUA 1C0KA 2YIJA 4KQGA 2AZXA 2IPXA 1ESCA 1WVIA 3PITA 2YFYA 4PE5B 2RGEA 4BJ1A 4HX2A 1G3IA 3JS5A 4CDNA 1EK0A 1T5DX 2ZU0C 4RY0A 3DXFA 4HN9A 1WM1A 1S16A 4L2IA 4RDHA 3GVPA 4CL0A 3TZHA 3WJ7A 5ISMA 4PG7A 2A30A 3EMDA 2ECQA 3MRXA 3UJ8A 2W70A 3VX3A 2Z2XA 2LR0A 1JSRA 5KOJB 2EQAA 3T7AA 3NWEA 5AWFC 5J4KA 3SJAA 5K8JB 3E1KA 1JECA 1Y7PA 5HF9A 5A2QC 5DHPA 3OICA 4QBIA 4Z9AA 4CIDA 4E33A 3VR3D 3W4KA 3SD7A 1KVRA 2GKSA 3E7WA 3SZUA 4E94A 3ZZUA 3CLRD 2CJYA 4QHSA 1FXSA 2B83A 5KSYA 1A7KA 3IPYA 3PWKA 5MGNA 2ZIXB 3VX4A 3VYRB 2ZYDA 3I2GA 4ZHQB 1THMA 1WLYA 2VQFE 2G4LA 2ZWOA 2F64A 5IXJA 4FIZA 1JEJA 4D56A 1DXQA 1FX1A 2V0CA 3D4IA 4H4EA 4UPDA 3X1KA 5IJ9A 5ES4B 1MO2A 3U3RA 1IQ0A 1KP2A 4WCDA 2BFFB 3SJCA 3D3QA 3I4CA 5IYZB 1DC6A 2H7YA 3PNMA 4JBNA 4WRRA 5H0IA 1IM5A 1MV8A 3CG0A 2Z6UA 4NICA 1YMVA 1W0JA 2BE9A 4F38A 5BOSB 3VH1A 3VPHA 5IC4A 1UM9A 2B25A 3DXXA 4GYJA 4RJLA 3W2TA 1EJ2A 2FW0A 2J3LA 4E5NA 1CY1A 2JAWA 2FDRA 3ASZA 3JYOA 1M8FA 4XX1A 1MG5A 5DE3A 5G1PA 4BV2A 5CVJA 1IY1A 3EGXA 3LO5A 4I1RA 4A16A 4RTQA 6ADHA 3B5EA 3G9XA 3A4NA 4UKDA 3WK6A 2BMFA 2E21A 2XLBA 1VGQA 5FPSA 3ZQUA 2FQWA 4FWTA 1CQIA 1OT5A 1F7UA 1OV6A 3QFSA 3RW9A 4IFEA 5AJTA 4D81A 2G09A 4K9DA 5ELXA 1ZEJA 1UJ2A 4L8GA 4C22A 4RV5A 4X66I 2W2XA 1YZLA 4YEDA 3PRKE 3OQOA 2V0GA 3CLTC 1BGXT 2B36A 2JCYA 3EIHA 5DT9A 4EHIA 1FBNA 3NEJA 2H63A 2QSYA 4YP5A 3IV7A 4HB4A 4B84A 2AFVA 3Q3JB 4LSWA 4H7PA 1DP4A 5IJAA 4BVKA 3OIDA 4MB2A 3ICVA 4QNRA 4PCVA 3SXPA 4QPDA 5LQMA 4MYDA 4K40A 2F3PA 1J00A 5J5VA 5B12A 1VMAA 4YRMA 1Q2UA 1S5PA 5ENDA 4QUIA 3DJYA 3PEWA 3PDUA 3THRA 3WWEA 3Q6NA 4WY8A 1HURA 1E3LA 4KGZA 2TYSB 2XE6A 5C8DA 2CNNA 1I2MA 3THYB 4DXHA 2W8ZA 4XSVA 3LF2A 5KNLA 4HDSB 4GSYA 4YMIA 3GA7A 3HO6A 1Z39A 3LD9A 4NV3A 1RSZA 4BNMA 4N5IX 5FNVF 4L28A 4LVOA 4DA9A 2G6BA 5JFGA 3V2UA 4DG5A 3O2SB 1D2MA 4Q00A 3AZOA 5DYWA 2D06A 1DTWB 1DQPA 1G3QA 1P45A 2A5DA 2G6TA 2G5CA 2PX0A 3AR7A 3A3PA 3CZQA 2MWMA 4E2FA 5EMJA 5KMGA 2WLTA 3WHKA 4ER5A 1D07A 2MDTA 5HKBA 2QI9F 1WDTA 4HGZA 5IAOA 1EGQA 2QTBA 2RKWA 3SJUA 2O57A 1H93A 2XSZA 2I5PO 2QTWB 1T5IA 3LY8A 4JI1I 1S7CA 2YJ3A 4B31A 2ZRAA 3U81A 5GZ1A 3JU3A 5AM4A 3WTBA 1IUOA 2PJZA 3HEMA 1TIPA 3LP5A 2OCDA 2WYWA 3OEWA 4M49A 3ZV3A 1C7ZA 3L6DA 3UMBA 3QW2A 2ODQA 4UARA 5LC1A 1WW8A 2EEPA 2YHSA 1EMDA 3SSNA 3W5IA 1NJ8A 3IODA 1ZFNA 4S1NA 4TTPA 3A31A 4F2DA 1QPGA 4I6GA 4OHYA 4KUEA 1CEXA 4FFDA 3RVJA 3AIIA 3H1FA 1I3MA 1A1VA 5DSXA 9ABPA 2P75A 4V0RA 3V7FA 3OIVA 1ZS9A 2VKTA 3A9CA 3KOUA 2VZ8A 4BTLA 2XWBF 4JBHA 1QIHA 2GN9A 1TZJA 1K89A 2IP2A 2OORA 1XBTA 2H4ZA 2I3DA 1W85A 3TEMA 1DCKA 2DERA 3SEQA 2HCTA 3B53X 1BVHA 1EFRA 4TTTS 4GI7A 5K36C 1F4VA 1G2IA 3JWPA 3I8XA 2P9JA 3FPLA 4BJHB 3EQ2A 2JFPA 5EJEA 3ACBA 1Q0TA 3UFXA 3T3GA 2QUIA 3WA7A 1U2PA 4B4VA 4E08A 2X0NA 4TZTA 4G0PA 1L4BA 1XRQA 1MOQA 1Y1PA 2Y66A 1PWXA 2IU6A 2NYVA 2ZJYA 3PGJA 4KQCA 4YFVA 5CX1B 4AG5A 3U4GA 4RLHA 5JFTA 2IIBA 3I01M 3SYLA 3B3GA 3IOBA 4MKXA 5H9VA 4LPFA 1G8AA 1YZUA 3LCCA 3CLTD 1Z5BA 3DE5X 4GM1A 4EFKA 3RF7A 3M6IA 3RT7A 4F11A 4B3SB 4BCDA 3M4YA 3QPUA 4KFRA 4KR9A 4O25A 4IIGA 1VSUA 1ZN8A 2R7AA 4H6PA 3M5WA 2AN3A 2OG1A 3GMDA 4CLOA 2AC7A 1P4RA 3E4CA 3QEJA 2G1AA 4MV5A 4TM8A 1B3RA 3IB3A 3QU4A 3PYLA 3IRVA 1OFIA 3R3XA 4LE1A 3ZXUB 1RR6A 3X2SA 3NJ8A 2BH9A 4A0SA 4WZBB 2EP7A 3V97A 1OHHD 1LV8A 1MJHA 1IZ8A 1XD2A 1CJKC 1W0CA 1W9HA 3DNMA 3DULA 3PFFA 4RFSB 5KKAA 4DCSA 1H2RS 2E5LE 2ZQYA 2WR8A 4RXMA 2ZM6B 1ZIPA 4YT8A 1KDZA 5KOIA 1Z0UA 2AOTB 4PWYA 5JNLA 4Q01A 2REQB 1YASA 4XVCA 1LVUA 1DJNA 3L7KA 1KS2A 5HFAA 1GAWA 4JLWA 5KCZA 2WP8J 3DL0A 3L7YA 1W1UA 2AGVA 1CRWG 1FA9A 1EWYA 2AZDA 2XYHA 3C8HA 5ELMA 3WLQA 1J39A 4X63A 2Q7DA 4ARVA 1VM6A 1K2VN 3QV1A 1GL3A 2WQZA 2QMOA 2O9JA 3J80A 2JGNA 1BYIA 1FJGB 3KTAA 3ZBTA 4XASA 1ECGA 2IUYA 2VYVA 1U65A 2Q5EA 4J1QA 4PPGA 5CA0B 5KYWA 3BHNA 1VMIA 3RRJA 2AFIA 3SVLA 1B41A 1LS6A 2ZRNA 2FR0A 3KVOA 3NKVA 3VO9A 1GCAA 3PVSA 4X9XA 3WYGA 2BTEA 1QC5B 4N3GA 2HPAA 3PA8A 4IJMA 4GPAA 1OLOA 5B3AA 4DW8A 3L0SA 1YB4A 4MVJP 2YYAA 3HBFA 3GEHA 3IQGX 3OZVA 3Q11A 1QZRA 3B78A 2AI3A 1NFQA 2H85A 4IHKA 3T4UA 1FY2A 1ADGA 3M5DA 4HFRA 4CR7A 3D8HA 2Q7XA 3BF8A 3K94A 4MIKA 3U2QA 3ZNQA 1NNUA 5K36D 4LJKA 1G63A 3TVDA 3ZE0B 2Z3VA 3M34A 3JQ8B 4HBGA 3T5DA 2C4NA 3IQWA 3AH8A 1FMTA 2J6CA 3BGSA 2CZ9A 3QE3A 4FINA 2I34A 4G5QA 3R9XA 1Z83A 1H6CA 1XTVA 5AM1A 2GF9A 1GCIA 2FWRA 3QX9A 4JDPA 4KO8A 1T6BY 3COPA 1GSAA 2OZLA 4HLNA 3A1CA 1KL7A 1YHCA 1NUAA 3RKSA 4YCLA 3NONA 3TJRA 3AY7A 1NYRA 4YMSA 1ZNYA 3CW8X 5JU6A 3BSSA 1E1RA 1DMSA 2JGAA 1L4MA 3R23A 4OXRA 4LAFA 3WL8A 4DBLE 3X1DA 1SCIA 1VYTA 1E6EA 4XYGA 4AYWA 4QUKA 3TINA 4BFTA 3W5AA 2V2QA 3L8MA 3SR4A 4X66E 4AO8A 4GR5A 2ZR9A 1S2MA 1E9DA 1F6WA 4NCKA 3V2UC 4QOFA 3REOA 1L4HA 3GGCA 3M4JA 2PSJA 5M3BA 5SYNA 2DR3A 5JC1A 4GKKE 1WHSA 2YMPA 4H7EA 4BNYA 1I6WA 2C4MA 1AKVA 2GJAA 1LBTA 2R8EA 5UKDA 2D1TA 1PJ4A 1XC7A 2YWXA 5DHSA 4CMAA 4JQCA 3A3OA 4B75A 4QU0A 3C6MA 1T2EA 3R7NA 2O1WA 4QFDA 2G83A 5HYVA 4KUGA 1RWMA 2Z08A 1QFYA 1RHQA 5KWVA 5GIPE 3ZD6A 1XRPA 2ESRA 3PKJA 2C1XA 5D6OA 3RS2A 4BNVA 3ZE6A 4N0QA 2CUTA 5KWJA 2QVZX 2Z6VA 4KQIA 2B0CA 3JQAB 4BVFA 3J7AC 2BMVA 1E7MA 3EDCA 4PZZA 2ISQA 2F1OA 1DU4A 3K4PA 5JIBA 4DR2B 1L2TA 2EW2A 1TZMA 1MRNA 2A8YA 2COEA 2LIPA 1Y9ZA 4M38A 1W0JD 1L5OA 2XTJA 2ZLBA 3A70A 3BE6A 4JJFA 4QO7A 1VJRA 1VLLA 2DBYA 3LPLA 1COZA 5MDHA 1YONA 1KR5A 3K8OE 2HKEA 2XEDA 2OORC 4FYMA 4JA0A 2VNAA 1HRDA 4GPD1 2J3QA 1JLHA 3DMGA 2GJ9A 2QW0X 3C0KA 4DTCA 1HQCA 1ZCBA 3D5TA 4LCEA 4BO8A 4CL2A 3WRXA 5DYIA 4MDEA 5A3SA 4LJ4A 2FEAA 1U0JA 2CZQA 3CWCA 3PDWA 4FEEA 3KLNA 3WIUA 4D0SA 2JK0A 2J3JA 4BUCA 1R27A 2CEKA 1KAOA 3UM9A 3S2YA 2UUBB 1GPLA 3AB8A 4V0NA 3O4HA 3CE9A 3Q2OA 3B5IA 3JALB 2P30A 4YQZA 2FTKE 1AKQA 4E70A 1YA4A 1L8XA 5COQA 3SLRA 1UBSB 3V1TC 4TWAA 1M0EA 4G0XA 4DUYB 1PT7A 3LYLA 1E62A 4AZWA 1QS0A 1U6IA 3PDJA 4MCAA 1KEEB 2CBXA 3THWA 4P35A 1SXIA 5GP1A 4X44A 5DGIA 1F2VA 3OQIB 3QV2A 4NZMA 4G8JA 1P39A 1XAGA 2WJYA 4LMRA 1E18A 3BEDA 4JLBA 4EMUA 4EUEA 4TGLA 3M4ZA 4M37A 1K1EA 2E37A 5J2TF 1M1NB 2NUTB 4B6QA 2J9YB 4MUEA 4C7MA 1SXPA 2OO3A 4HEJA 4KE7A 3NQ41 4PZDA 3QKUA 4A23A 1GNTA 1SELA 3AX6A 4A6XA 1AQJA 4WXEA 1KI4A 1N8SA 4JXJA 4BLPA 2X22A 3UHPA 4L8VA 2NTVA 2QM8A 3KPUA 1OAOA 2K6GA 1RVV1 4H4CA 3DM5A 5B1SA 1RQNA 2OV1A 3OZXA 1XHKA 2FG7C 4XZ3A 3ZU6A 4IQGA 4BZPA 4DUPA 2O1SA 2I67A 1PYOA 1G8SA 3IALA 5L3RA 3GLFE 1DHTA 1GHTA 4LGVA 3ZWXA 3SM3A 3DHWC 5BQ5A 3TL3A 2I65A 3G2KA 3WGNA 4Q4HA 3J80C 4DDTA 2O0MA 2VNIA 3IULA 3F3MA 1CDOA 3I2YX 3NC4A 4RQTA 2XSZD 3W6PA 1L8OA 4KO4S 3X2EA 4KLNA 1KE2A 1K97A 4ACAA 2HH9A 5GM2A 4FFRA 3VH3A 2G77B 3GEDA 4PC3A 3TE7A 1SC9A 1U94A 1B1CA 1T0JB 2WMNB 3DHEA 3EMBA 3EVBA 1QK5A 3FGZA 3L0OA 3O4IA 3LM8A 1Q0ZA 3G0OA 1N0VC 2A4KA 2KJQA 4NENB 1MHPA 5CIQA 3VJKA 1UK6A 1JWBB 2I03A 5B55A 4M8NE 4ZO4A 2WDZA 3KXLA 1V8OA 4AQYB 2RD2A 3PLAE 4B8YA 4E30A 1XTPA 3C48A 4UTNA 1Y0BA 1P5JA 3B2NA 3FHOA 2Q1YA 1UBRS 4NARA 5H82A 5ER6A 3IQEA 5CFOA 1EFRD 1RMTA 1WPGA 2J65A 2WD8A 2A0UA 1NVKA 4XWWA 4W8OA 2WG1A 1U7XA 4R68A 2F3UA 1J8YF 1GRQA 1E2IA 1DEHA 1HLPA 3A1VA 4N8EA 2C9OA 3VMFA 1F8FA 1NBIA 3PD1A 4RD2A 1N92A 3IOEA 4FSHA 3SC3A 5TF4A 5JEEA 1QG0A 2I33A 5J1TB 4X7RA 1M1UA 5EIWA 4F5DA 3G17A 2JBAA 3GCDA 5IWAI 3ZLJA 4PHGA 4DMFA 3WJAA 5B4UA 3PUZA 1IH8A 2GZAA 3OU6A 1ZVQA 5BUSA 4EEXA 4PXAA 4IF4A 1FJ2A 1PFYA 3EXFA 1QVZA 2JARA 3ZE2B 1AQYA 2WICA 3DW1X 3LHFA 1O94A 4RKFA 1KMQA 3RUEA 4M0PA 3RYCB 4DV3B 1SUBA 4ZCMA 3OJ0A 3UXHA 4Z2YA 2FEKA 1LK5A 4RK5A 4RIIA 4DILA 3UGJA 2E4VA 4KOAA 2WP8B 3AFIA 3WBJA 4B44A 5JY1A 2AHOA 1U98A 2AD5A 2GX6A 3N5CA 1PFGA 1R9MA 5KYUA 2CVEA 1IQPA 2Q1SA 5FBHA 5LWHA 5LP6A 1A8QA 3P9RA 1AUXA 2IDMA 4YT5A 4DLXA 1RM0A 4NXNI 4DS3A 5J4YA 3O21A 4P0QB 2YUTA 1KDPA 1VC2A 4XARA 1SB9A 5I4IA 5ARBA 1ZR2A 2YBDA 4QGGA 1KI7A 4IFDE 1M73E 3K4HA 4RY2A 4NXMI 2XMPA 4ZPXA 4QVKA 4CGZA 2X7XA 1TA0A 4N0PA 4O4LF 1GZVA 3RHSA 2QUJA 4NZZA 4TVOA 1D09A 1VL1A 2HGSA 3L06A 3ZNNA 1PQPA 4ZVNA 5SZHB 1CUBA 2HNBA 2DBRA 4ZT3A 1CUAA 2II6A 1XDUA 1ZC3A 4L72A 2H2AA 3OTOE 3E9MA 1L7MA 3B6EA 4QDTA 3QITA 4TLLB 4XLLA 3IEKA 1I01A 3MRVA 4X84A 4BHTA 2A57A 1BO6A 2WRZA 2VYVD 1I3CA 2PCLA 3HO1A 2C42A 2Y3IA 3RUHA 3VHRA 4MPJA 2VDWB 3ENVA 2WM3A 4WY5A 1EUYA 1N6NA 2H4WA 4N48A 4B48A 4LF6I 3WRXC 3IBFA 2RHTA 4R9SA 2OYRA 1Y7LA 5EMKA 2VJQA 1K0UA 2YCBA 4D3XA 3IVRA 4IIYA 3NRBA 4D9IA 4FDAA 4IWNA 3SE0A 1BCSB 3HXKA 4ZGGA 1T5LA 4EI2A 3IKLA 4QJBA 3JD1A 1IJKA 1N0WA 4EA8A 2Q0QA 5JEAA 1IPFA 1OB5A 3VPAA 3LCRA 1A0OA 1UDOA 2PH3A 5A04A 3DOUA 4TKUB 1IY0A 1CRPA 1D7AA 3IBYA 1R5JA 2CL7X 1HE1C 3W90A 2FK8A 4XD2A 5FO0A 2ZKLA 1E98A 3G6WA 2IIPA 1BN7A 1GYQA 2UZAA 3FXAA 3IDQA 4N3NA 5JW6A 1WD7A 1Q1QA 5CU7A 2NSLA 3RGGA 2IUFA 1QWSA 2R47A 4JNKA 3HJAA 5FLXQ 1L1RA 2FMHA 3EVTA 2ZSAA 2G8NA 4I4CA 3AL3A 4XCQA 2B4QA 1GTG1 1K6JA 3CW9A 5LOVA 4C01A 3HKMA 4KVFA 4P84A 3I2IA 3IAM6 4H6VA 4Q7LA 5JRDS 1SKMA 1B6RA 5KNBH 1Y6RA 3S2ZA 1L8LA 5GVSA 4CQJA 1LJ8A 1YDGA 3OPYB 1RVDA 4LOIA 4UMDA 4E5UA 3GFSA 2WU8A 1JH8A 1WZNA 1IBLB 5CA1A 4C7VA 4JLDA 1J2RA 2VVTA 1DO2A 1EI1A 2ZYGA 4E2YA 1LDMA 2X0RA 1NYLA 4LNUB 1XJWA 2HU8A 3LPNA 5KVSA 3D3NA 1XPRA 4LF4I 1E8DA 1CY8A 1PIEA 1G6Q1 1QBKC 2DFNA 1K47A 3A7EA 3HB5X 1MOSA 3QYPA 2C99A 3KL4A 3MUFA 3QF4B 4G97A 2Y1XA 4DE5A 1DUVG 3N0TA 4LEIA 4E7OA 4NCHA 1SCQA 4O2BB 3ELUA 3LI2A 2QUZA 3MMSA 3F96A 4B9EA 2CJWA 4ZXFA 5CEEA 1Y5YA 1G64A 1NDUA 4TXJA 4UVEA 3BTSA 3TX2A 4FS3A 4NRDA 3I3OA 3ZWVA 1QB7A 1S0UA 1U7ZA 1ZX1A 2N3ZA 3DMPA 3DNPA 1JFRA 2XTZA 4UAGA 3O91A 4RQUA 1PKXA 5KHAA 3W9SA 1QFXA 1BA3A 3DWGA 5JMOA 1XCLA 5JPIA 1KZ9A 4GWGA 1GR0A 5EHNA 3PTZA 1JFVA 2XZPA 3KKQA 1DRWA 3V32A 2JIRA 3K71B 1CB0A 5FUYA 2AN9A 3UC9A 2I4MA 1ZH2A 3I9OA 1F8GA 3ZVRA 1GKYA 1BX3A 3SKYA 1DDOA 5ALWA 1IN1A 3CC8A 3PPWA 3Q9LA 1A7JA 1XZNA 2ZG6A 3L7NA 4WX2B 1DARA 1T4DA 2NN6F 5DYYA 3H19A 3PC2A 5AK0A 3ZVLA 4BVHA 1RZRA 4B3RB 1PV2A 2V9ZA 3KZVA 4LZPA 2HDOA 3KB8A 2A0FA 3HBMA 1CC1S 2A59A 4PYIA 3VHLB 2JIOA 2P9QA 2HW8A 5BR1A 4YPVA 3C3BA 2Q5IA 1ZMRA 4Q05A 4LX8A 5H5JA 4LFCI 1JIJA 2QAGB 3L40A 4PZPA 1CUHA 2GFQA 1L7DA 3HDJA 3N8DA 3URMA 4OPMA 4D3SA 2WINI 4F4FA 4O4IA 1H6DA 3R8XA 2WTMA 3CF0A 3GLHA 4MQ6A 2YWJA 1TRHA 2GBGA 4G84A 3CUEF 4D99A 2MMGA 2H08A 2LZ0A 2GLUA 2IJGX 3CJRA 1YJ8A 2IYUA 4G2TA 1NNSA 4KLCA 4QXAA 3UW1A 5KYYA 4JIMA 4CN9A 3RRMA 1VA5A 3D4NA 2QMQA 2LJPA 5KOYA 3U49A 1LK7A 2O2SA 1M67A 2JGKA 1RXEA 2QX6A 3UG6A 4F3TA 1L7RA 4NBUA 4WCFB 2WSYB 3DZBA 3ICPA 5JCJA 3USES 1O94C 1ZU5A 3CNOA 1CRZA 1E5VA 4FFOA 2OB1A 1DIGA 2GYWA 4USMA 2YWCA 1CRLA 1RWVA 4X3OA 4EY6A 1IK6A 2JD0A 2OILA 4TLDA 3GONA 1XA3A 4J0JA 2MINA 3AM5A 4OB7A 4Q9AA 4DMLA 4F4IA 1X6VA 3IDZA 3OKAA 3GRPA 4M9SA 1T4MA 1WXQA 2I2XB 3NG1A 1RI3A 5LP6C 2G40A 1VIMA 1T5BA 4JLSA 3OCYA 4Q37A 2JFZA 2MJLA 3VSAA 1BXZA 1ZUWA 3IIIA 4DMCA 1VBKA 4H6XA 1SXHA 5C1DA 4Z99A 5ALPA 4PS1A 3UWMA 4FHDA 1MIOA 3BE5A 3SIPA 3MBIA 4LF9I 5ILQA 5SYMA 2BHTA 5TJ9A 1VL8A 1N2BA 3RF6A 1MC8A 2ZSFA 4Q7KA 2AR9A 4JQSA 2C07A 4FDLA 4TV8B 2R44A 4KZKA 4JJ6A 4ALMA 2UZ3A 1SHKA 2HK7A 2F8TA 4FR5A 3BE4A 1T2NA 4AY4A 4B6OA 4ZZ1A 2HPZA 5I7HA 2PXAA 3FCOA 3QBTA 4HWOA 5LSAA 3RAGA 3WU6A 2C5SA 3LUFA 4U7TB 2PBFA 3MTAA 2WG2A 1CBUA 4B3SE 2XWQA 3VHQA 2JW5A 4FD3A 1G7TA 4CM4A 4R9RA 2BPOA 3R0ZA 2YOFA 3OTQA 2Z56A 3UBTA 2HRQA 1FVXA 2Q4OA 4NXNE 1DG1G 4YYZA 1HLGA 1UDBA 4DNXA 2OM6A 4MB6A 1KMNA 1ISJA 5ESRA 4ZKEA 5C4IA 4F56A 3AJRA 4NXME 3WIBA 2R66A 3COJA 2Q6OA 3DMFA 3VOBA 3WGZA 1G8GA 2FR8A 4BMZA 2HWXA 4MW9A 4UEJA 1E5QA 5JEAC 1JPUA 5G40A 1RWQA 1NE2A 1W96A 1ZUIA 3BVPA 5ALDA 2C9ZA 4I1SA 1NN5A 4GBGA 3ETNA 1AKRA 1C9JA 1X39A 2VAWA 2SECE 1NKVA 3G5UA 4IJ5A 1TC1A 3ESBA 1Y7TA 4WUVA 2ZM6E 1A5ZA 5H81A 5P8WA 1IN6A 1DLJA 1SKYE 2GPAA 3CX4A 3K92A 3O4GA 3S1AB 1V1JA 2CXSA 5DM70 4N3CA 1CERA 2FQQA 1WCV1 4IZJB 4BFZA 2HA0A 1EWRA 3VSDA 3FCAA 3GZNA 2HBZA 4ZO7A 2P4QA 1M6YA 2AE2A 1D6TA 2RBGA 3AZPA 4EW2A 1LCIA 3WU3A 1ZM3A 4LF6E 4F1KA 1CE8B 1O08A 2XDWA 3KSRA 4TMFA 2I4OA 4NCBA 4WWHA 3T5BA 4ATNA 1KYIA 2RK3A 3F5MA 1EHCA 3OZCA 3UAZA 1WUIS 3T9BA 3WKBA 1FJGE 2OP1A 3GJ6A 4Q6WA 1UXGA 2PU5A 1GQFA 3FF1A 5IAAA 1HT2E 2PKQP 2OXTA 2HIAA 3KQMA 1O94D 4JP3A 1P7VA 2XZTA 3TLJA 3WHPA 4IFTA 2ZIFA 4C07A 5I7AA 1WO8A 2XNSA 1TCAA 1H8HD 4G4SO 4OU5A 1G6OA 4EUFA 3KDPA 2D1FA 3LCUA 4DR1I 4ARAA 4HI0E 1EBFA 2QN2A 2WJWA 3QEMB 4DM7A 2PIAA 3L4EA 1G8YA 3D8TA 3FYDA 2ATVA 4J2OA 1BCRA 4ROTA 2QD2A 4B35A 4CT4B 1LFDB 3UGQA 2DBZA 5HQ3A 3G8BA 3C6QA 1NQWA 1EFVB 4LRYA 4Q5IA 3LA8A 1JQ3A 1MB0A 5MF6A 2Z0MA 4I46A 1ZL0A 2EKBA 2OCXA 3ENKA 1DKRA 1V1MB 2WW4A 2BGGA 2NUAA 5HFNA 5ARDA 2ONKA 3OPXA 5KNCH 2OGSA 5AVKA 5KHOC 2QZ9A 5AJWA 3GHYA 4NZYA 4BUJA 3F3SA 4TTSA 4KQVA 3IQZA 1YOVB 3ZWNA 2WMOB 1N3BA 1T1IA 2O2GA 2BHSA 2V2VA 1AK2A 4IHJA 1SK8A 2AMYA 4WADA 2I7XA 2PWYA 1QLHA 1TIBA 4AK9A 3O73A 2ZE8A 4F92B 2CFSA 3T7RA 4BQEA 1SCAA 1EEHA 3F8SA 1XE3A 4LF4E 1OXTA 4F2PA 4HRYA 4IH9A 1H3EA 4H59A 1I2ZA 3QGMA 5B7NA 5BUZA 1TUEA 1NHWA 4BAGA 2BHNA 5CNIA 1NMXA 4IH1A 4EL5A 3GLRA 4BASA 2AKAB 5BNFA 3CDJA 4H9GA 3T1OA 4MQYA 1CLUA 3UNXA 1XR3A 3ANSA 3GLGB 1T36B 2QL5A 5FPQA 4FWHA 1TJNA 2OOSA 4A7PA 1Y6GA 2X15A 3Q87B 2HEGA 1JLMA 1ULTA 1U3GA 1BXGB 5JEAD 1O77A 4MWSA 1ZHOA 1M2EA 4U7PB 1URPA 4LBVA 4UPVA 3SHVA 2H1WA 3BFXA 4M9XA 4YT4A 2J0UA 3TBKA 3STTA 1Y6JA 2ONJA 1ACJA 2YVKA 1WXXA 4J03A 4Z7YA 1R6TA 4PRYA 3OPVA 4EFMA 4L8YA 1U2GA 4Z4QA 1KMMA 3THOA 1J0XO 4OK3A 4XJVA 1R0SA 1R50A 2RHDA 4XOIA 4MU0A 5H3LA 2VATA 3MWEB 4ZCTA 3ABRB 2ISCA 1YZFA 3ZHOA 1L5WA 4DR2E 1CS0A 2QPTA 4K86A 5HUJA 3U0VA 4LFCE 3LQ4A 5F1PA 3BRQA 3MC1A 1KEKA 4QOSA 5TGTA 2DY1A 3L5OA 2J45A 2GN1A 3UKJA 4L08A 4HACB 1SKQA 3ITDA 3WWOA 1V4VA 5D3KA 1P4GA 4EG6A 3H7AA 3U7RA 3BRSA 1NWHA 3AZQA 2COKA 2DUNA 3NR2A 3U3ZA 3F3KA 1GGEA 2NG1A 1U3FA 4QBGB 3RS3A 2WIAA 1OE0A 3CCCA 4YCCA 1YR8A 2YL2A 4W1QA 5TF0A 1U8CB 1UBJS 1W5EA 2L2QA 1MA0A 2RGUA 3FG9A 2YJ6A 3NP9A 3RJ5A 3L8GA 1OIVA 2BGMA 3LK6A 2ENWA 2M6KA 5HR5A 1ZXNA 4RUKA 2IEIA 2I3ZA 2UUOA 3GZTB 3V1UA 5FWYB 5PNTA 5DIZA 2Z5BA 1U3TA 1SG0A 3AIOA 4HDMA 4KO2S 1DCMA 3AESB 1GL9B 3QNMA 4ETWA 4M86A 2RJNA 4PQFA 1H65A 3CU5A 4KFSA 2YRWA 3NZEA 4ISCA 3V2GA 3QHPA 2P0AA 4FYYA 3HPRA 5JH7A 1S02A 4Y1FA 2O8BB 2CE7A 2WV9A 4GOKA 5DNCA 2ZETA 3L7JA 4LF9E 4G25A 2FR8C 1NI5A 2C7GA 2AF3C 2KHZA 2WHXA 1W30A 3OF2A 2AE8A 1RZRD 1Z6ZA 3C70A 3CN7A 4H0CA 1WHTB 4HT3B 4U02A 4X7PA 1UQTA 5KEIA 3ETGA 1ZXLA 4JBXA 1QNLA 4H77A 1T2VA 4U5XA 1HMPA 4B0PA 4N5MA 4ES6A 3ICWA 4Y6LA 1QQTA 2PKRA 4Q4CA 4HBZA 3OLVA 5DI3A 4JEIA 4MWOA 3GI1A 1YT5A 2QVLA 2Y99A 4EOGA 2PNZA 3KXDA 3PJRA 4FFPA 1XAHA 3T1HI 1L5ZA 1Z5VA 2I3AA 4GRAA 3R7DA 1ZBDA 3PS1A 3EUEA 2RFLA 5JS8A 2AEMA 2EKZA 4J0CA 2OXEA 1JEQA 4HO1X 3U3JA 2VSOA 2WUGA 4FOLA 3U7IA 3X1YA 4HVCA 5K7SA 2EZTA 3V34A 5KBYA 1Q6YA 3IESA 4UU1A 2HA7A 4LKRA 2WV7A 6YASA 3DV9A 2XUAA 2OHJA 1FVFA 4YAEA 5DEIA 3JASA 4CBVA 2QN1A 4I9FA 5KNBD 2WZBA 2P3SA 5JCJD 3T1QA 2Z2IA 1TLFA 3A6KA 2QNIA 2A14A 2XBMA 5EXSA 2FXIA 3MRSA 4X64E 2ADOA 3V3TA 3EDMA 3UJDA 4B2YA 1CZKA 2ZT5A 1HTWA 2V7UA 3DZGA 1TO2E 2Z2KA 1LLCA 4HV4A 2JFWA 3BXOA 2I8LA 1AS0A 1KBOA 1JUDA 1BGVA 2VOJA 3UK7A 3GW8A 4ENPA 4UE2A 5K3AA 4CKWA 2C20A 4MVWA 5F5XA 3G2LA 1D8AA 3N07A 2DC1A 1V5FA 5IUKC 2DTDA 3FWKA 3S2EA 5JJIA 4J1TA 3GDWA 4C2BA 1I14A 5DN9A 1W4LA 3ROZA 1A5BB 4ZI7A 5EP1A 4UHHA 4J6FA 1FSFA 4ZV7A 1R0XA 5HXAA 1NZFA 3M4XA 3QIAA 3D6TB 1KU0A 1E1CA 1ETUA 1KQ3A 4TKLA 1YA8A 3K9CA 2HHHB 4YRCA 2JAOA 3CN9A 3P5SA 3E8XA 3AEKA 2ZSKA 2Y1CA 2NPFA 3W4JA 4B3MI 5EP3A 3VYSB 1Q1ZA 3SQNA 3BDAA 3MGGA 3QUCA 4G86A 4YAWA 1KYVA 4CQLB 4DBVO 3TBHA 8ATCA 3N6RA 2HCFA 3SNHA 2F1HA 4Q93A 2FPIB 5ED0A 1B0PA 1EFKA 1TF2A 2FLVA 2BONA 4TN1A 2GYVA 5EIHA 3WGQA 2VJCA 5C46F 3GB9A 2HU5A 3KOZA 3ZJVA 4MU1A 1X3SA 3KYBA 4IR7A 1O6CA 3TIXB 4QQKA 2G5PA 4DV3E 4S2EA 4PO1A 4DSUA 1KGSA 3RVKA 2C2OA 4QG3A 3GJ4A 5DHAA 4DR7I 3F7OA 1M0SA 3FYUA 4IIJA 3OEHA 3ANLA 1IHDA 3L04A 1LY1A 1A77A 3LFUA 4O1MA 1Z8DA 2VA8A 5ICCA 5IAGA 4WJKB 3OM1A 4TQ9A 3ILVA 1DTEA 3P4UA 1KQGA 1XXHB 1T26A 3WMGA 5A9SA 5IKMA 2TMYA 1GPKA 2ZAOA 4JC0A 4U8HA 2QUKA 3FNGA 3MRTA 4EKGA 5I3ZA 4H1VA 1U2GC 3ETHA 2VHYA 3QLEA 5CYOA 5KSWB 1N5LA 3K0HA 3GP8A 2WYIA 2ORED 3V1YA 4DV1B 4O2AA 1FFXA 1Z06A 3G2QA 4RS3A 5LQNA 4MUGA 4M8LA 2D2FA 4DLRA 4EK9A 1Z6YA 3CSUA 4ZQCB 2X9LA 2OCKA 3DLAA 2HQSA 5TEWA 4CM8A 4DV4B 2ZTUA 1LDEA 4C20A 3WISA 5IF3A 2XMQA 5BNZA 1C0EA 4AJNA 1LPMA 1JI3A 3HRHA 4M0EA 3DLTA 3R7AA 3DWIA 1IBSA 4S1VA 2W2LD 4XGRA 1HOXA 1ZK4A 2WNIA 3IOMA 4IUDS 4GZMA 1DKLA 1JQLB 1MNQA 5G0UA 3UA3A 4NNOA 4YTEA 4BO6A 1ODCA 1ZO8A 1AHPA 3HL0A 4KCGA 4X6UA 1I24A 5EMLA 2GXSA 1X15A 5D8DA 5CITA 2D59A 4MR9B 1ZGHA 4CF4A 4DCPA 1G4UR 5JDCA 3RE1A 4OO1A 3DBHB 1U0RA 1VE5A 3ECCA 1V47A 1RLIA 4Y7DA 3TOCA 4F3CA 4ZA2A 4MKHA 1A9RA 2BTOA 1DSSG 1QLJA 4R5MA 1X7ZA 4KKVA 3LK7A 1GCGA 1K08A 3P2KA 4B40A 5CDGA 4ZREA 1J07A 1U0LA 1OH5A 1Z0ZA 2O07A 3JVEA 3MJRA 1YR1A 1XF9A 3I8OA 5EQJB 4HWSA 2EBWA 1PJLA 1KETA 2B30A 2JIZA 3EGVA 3EVFA 5SY4A 3BSYA 3PCRB 1M1XB 1OJLA 1QOPB 3O6VA 4L9RA 4CU5A 4JXXA 3OTHA 3GT3A 1QH8B 4RZQA 5A4KA 1IIBA 1DC4A 1X1EA 1NASA 1P61B 1Q74A 1YJ5A 2L18A 4YS6A 1R10A 2P7HA 2AR0A 2DHQA 2JI7A 2DH6A 1JKIA 1TEVA 4I8DA 3RIGA 2FPGA 3KT0A 1QCCA 5E7MA 1ZGJA 4HSGA 4MGKR 3W3AA 4HQNA 1GXSB 3TAUA 1ZITA 1ZJJA 1E3IA 4MVXA 2PKWA 1Y4UA 1ETHA 3F6RA 1NOIA 5F2EA 1JDBC 3NHAA 3N2KA 4FT4A 2FPXA 3Q7IA 1ZRSA 2X8AA 1HK7A 1OZAA 2W43A 1OR8A 1AUOA 2CXPA 3TW8A 1JHYA 2H1CA 3AP1A 3K9WA 4X20A 5D3MB 5LA6F 5I9MA 4D98A 5EJGA 2CL6X 5CRIA 1ZVMA 1ABFA 4J7XA 4DLLA 2GN2A 1JEDA 2D1YA 1RM3A 1RRCA 1UJ6A 1QIJA 4P9NA 1V71A 3ETEA 2FW9A 2FZGA 5JQWA 3V1KA 5K4HA 1TFRA 4Z7JA 5HJ7A 5LUBA 1DBSA 2QTVA 4H3VA 5BN3B 1HNXB 1NOJA 2FJUA 2OCBA 1N33I 2QG6A 3HADA 3REFA 2X42A 4C3VA 1W76A 4FQ8A 4CF5A 4DIMA 4PAGA 1P1RA 3B9PA 3UV3A 1GILA 2Q46A 1USVA 5U4QA 4P58A 4GOND 3SM9A 1CZHA 1AV7A 2ZZKA 3R5XA 2NSDA 1ZD1A 3OMWA 4J0IA 4RPLA 1VCHA 1GPBA 2QROA 4GLOA 2R1VB 5IJWA 3AL2A 4HH1A 4GXRA 4QEKA 4YI3A 2VQSA 1CP2A 4Y2YA 2BFNA 3VHXB 2W98A 1XNRB 2ZIWB 1HDIA 4QODA 5HM6A 5H8WA 2ZUTA 4BNHA 2XZDA 5DM1A 4WJLA 4Q02A 1TJ3A 4M8SA 3T1HE 3FX2A 2R6FA 4HEHA 4PZCA 4W8GA 4AJIA 3WBFA 2AJCA 4MJLA 3HO8A 1GV0A 2DY0A 2IYSA 2JHFA 1YR3A 3AY3A 2R48A 3C3AA 3N86A 4J1TC 3ROFA 2DPXA 1G42A 3VVCA 3ZGOA 5EG5A 5LD2C 4KR7A 2WB4A 1RXSA 5L4NA 5K3FA 1BS9A 3JSXA 4RGQA 1B26A 4KLRA 2GZ2A 4YIKA 5JSUA 5IEBA 4DXDA 1N7GA 2Q6KA 1ZD3A 4X62I 2O19A 1FU4A 2NZ8A 4AJKA 1LPBB 1K4KA 2OC4A 4MB0A 1Y8RA 4L4RA 4CMIA 4ZJYA 4TZ6A 1PHRA 1KH3A 4LOKA 3SHTA 2IITA 4HXYA 2QIOA 3QXJA 1ID1A 1OUMA 4IZKA 2WAYA 1N9GB 2ZDHA 5KC9A 2XZOA 1BKSB 1BMFA 4L4UA 4PN3A 3CVOA 5AHXA 2JCXA 3EH2A 3H3JA 4IUCS 3CDIA 4QYTA 1R5NA 5ABPA 1DAEA 3C7TA 3OM0A 3OIWA 1PGOA 3ZDCA 4GMGA 2QRKA 2XKAA 2HWWA 3PBKA 4Z9XA 1VB3A 1DINA 1EM8B 1KEPA 1Q0HA 4E4TA 1XD8A 2HJGA 1TVEA 3HBLA 3Q1LA 1E69A 2OAGA 1L5RA 3FYUC 4DPWA 2WFZA 4OI4A 1XAIA 1SC1A 3ZHUA 4YX9A 1QIKA 1Z6PA 3MGBA 4QHTA 1LH0A 5FBKA 1E6LA 1V4BA 1SUAA 3EE6A 1OJ4A 4CIBA 5MGBA 3JW8A 4BYGA 4KI0A 4OOFA 2I6UA 3HV2A 1GVNB 5FDFA 4CEHB 5CPFA 2GPSA 3HXQA 2LDBA 1MB9A 1FUKA 2A9RA 3L9WA 3P3GA 3K09A 3KZ1E 3M9LA 4WKCA 2H1SA 2UZ0A 1HR0I 3K73O 4F46A 2OA0A 5ICSA 3PFWO 2O54A 3IPCA 4HNTA 4ZV4A 3UAYA 1YK0A 4ETMA 3PNPA 4NMWA 2PSDA 2PNJA 1N32I 1NF8A 721PA 1UWVA 4KPEC 3LG2A 5KU7A 3I76A 4G41A 3DHNA 3GLFA 4DDMA 2FFJA 3DTVA 3F0TA 5EPEA 3EG9B 1E9EA 2NO9A 3RUPA 1G16A 2H52A 5D84A 1GTRA 4RABA 2FX3A 2H65A 1V7QA 3OP4A 1EXWA 1TUIA 1JEOA 1J9ZA 1NI3A 4NBLA 2IBSA 4AO7A 3VR6H 4N7BA 4RKQA 4DRXA 4B32A 1B8NA 1VYUA 4BJ6A 4FGLA 5CLLA 3O74A 1QQ5A 1C1XB 5JDCC 1Z5OA 3NIGB 1QRAA 2J6BA 1TGYA 2GA9A 1Z4JA 1DT3A 1XZMA 4M9UA 3MJFA 4OO1C 3D6MA 4MGYR 1M6VB 1Q16A 4PC2A 4QAJA 4WXPA 3RABA 1U2ZA 4LV5B 4WOKA 1I6KA 4MLZA 2EFGA 1HY3A 2YUIA 2X1MA 2RHJA 3INGA 4DRYA 1TVKA 4ERXA 4UNPA 3EQ8A 3HFJA 3MS4A 3NH9A 1VISA 3KHKA 5EKTA 4DCTA 3L93A 1OFGA 3BGVA 5H4GA 4JK3A 1CQPA 1IULA 3GUYA 4Q47A 2NYUA 2XQJA 2MT9A 3AFOA 4ND2A 4RH0A 1KDYA 3HKBB 4HTFA 1VHTA 3ICQB 2H51A 3X1WA 2QQ5A 3F5QA 1NU8A 2YXNA 1QZZA 4IILA 3EFEA 4OHPA 2CNBA 2LIVA 2OM2A 3CZ9A 4AJ9A 5K20A 1RP1A 2Q62A 1H94A 1MV5A 4YAJA 5JANA 3FKJA 2IIVA 1YI0A 1QUEA 5H83A 4BEWA 1JSZA 3ESZA 5EHGA 1I7QB 2I6QA 4I7EA 4F04A 1DIOB 3ZD9A 5ICFA 5JROA 5EC8A 1SK9A 4DV0I 4ARBA 5AW4A 3M49A 1W35A 3PQ7A 3QOXA 1G6HA 1Z5CA 4DBLC 2F3TA 2IEBA 4X95A 5I9SA 3GFOA 4ZZ2A 3DOCA 1E1LA 2VDNB 4PG8A 4Y2RA 2C5GA 4LK3A 4ZTBA 5T4FA 1DVRA 2JI8A 4O4JB 3OEHD 1WMAA 2HK3A 2VDPB 1T0UA 1C1YA 3H5RA 5EKSA 3WB9A 3NBFA 3KJGA 4B3TB 2PZJA 5GOTA 1R4NA 2BD0A 2W9XA 2AOWA 4BJ3A 3H42B 2P9TA 3LWZA 1OXXK 3EXIA 1N5DA 1HL3A 1Q7TA 4BX2A 3OT4A 4D25A 3G7SA 3KKKA 3VR5H 3JQ7B 3RARA 3ANYB 4PAOA 4X8LA 1JAIA 1HDEA 1KZ6A 1I5EA 4BN4A 1GPUA 4YV7A 3TI7A 3S6JA 4BLUA 1TYDE 1GZ5A 4EG8A 1L5HB 2E9SA 3QVSA 3BILA 4FKZA 2JAQA 1O9GA 3ZWPA 3E05A 3MCWA 3S5JA 1KA9H 1DV1A 1V41E 2DFLA 3AGPA 1Y4AE 2IF0A 4B3FX 2FU5C 1BHQ1 4AX4A 1NJGA 5CP8A 5FUBA 3Q8KA 4HQOA 1J56A 4Q1EA 4DZRA 2ZYUX 4MAFA 1YACA 2OFXA 5FPTA 1H2ZA 3ZZTA 3IELA 1PJQA 2O0JA 4M54A 4V0QA 1SU6A 5ELWA 4KDFA 2Q8NA 5FLEX 5IPFA 1R37A 3SYNA 2HD4A 3ZW8A 2WZCA 2ZYTX 1JDVA 2YZ2A 4FZJA 4BE4A 1WB9A 2V8PA 1QGOA 4S12A 4EYKA 4OO1D 4PPNA 1B8OA 4URVR 5LN1A 1F60A 3K9BA 2ZRMA 3E8SA 3OUTA 4OFXA 3WWDA 4IDQA 3DCIA 4ZC8A 3WZLA 1FP1D 5JZVA 5KOJA 4YJGB 4LYYA 2H57A 4US1R 4FS8A 2PN1A 4I5EA 1O6FA 5FULA 4JUBA 4QT0A 1IBKB 4X8MA 2D13A 1V8BA 4OB6A 1RYZA 1Z5NA 2VJYA 2PLNA 3FMPB 1SXJB 3B3JA 3MTBA 4JC4A 1JJVA 2RGRA 4DJJA 2PGLA 3AEZA 4IMPA 2OMEA 3BPSA 1GZ3A 1R0CA 2O7NA 3PXDA 2UYYA 2ZIXA 1T24A 4WLEA 4ZHQA 3ZWDA 4CE6A 1Z5AA 3PNQA 5EIAA 2G9NA 4CRWB 5FNVB 4DPKA 5LMUB 1JVBA 2EBHX 2YHIB 1K7CA 3TUJC 4O3MA 2QG9A 1BYUA 1Z0BA 3VC3A 4WT7A 2BFFA 2BGLA 4X62E 5IYZA 3LT5A 1SQSA 3AXTA 1UEXC 2XF8A 3WLJA 4UM9B 5A1JA 3W3AD 2ZUDA 7ABPA 2VDLB 1TF7A 2I6GA 3K09C 4QELA 1YRBA 2P1ZA 3A4LA 3D8UA 4CGYA 4D8XA 2GRAA 3TG2A 1AO0A 3H8VA 1AQUA 2QAIA 2ZT7A 1KY2A 2Y93A 3A32A 3K30A 2WNRA 1MGPA 2A4MA 4RX1A 4CM5A 1EH5A 4EMBA 4WNAB 4I55F 3AUUA 3J81A 4R1UA 3RIEA 1IY8A 5AQEA 2XE8A 1OI4A 3ZZ0A 3ZN2A 1KOFA 1TRKA 3C6YA 3P0EA 4TYWA 3PTLA 1FJXA 4V1CI 5CVUA 2WVGA 4P93A 4RZ2A 1KS9A 2ZTHA 3LT2A 5H7XA 4AUEA 4DLZA 1GAXA 3WB1A 1AK1A 1I0LA 1L4KA 3OAAA 5G4KB 1UK7A 3HHPA 4WK2B 5CLJA 3W2FA 1PDWA 3NMUF 5DM2A 4EY7A 2GVDC 4CMHA 4DLKA 3I62A 2CLHB 4MRAA 4MW6A 1EFHA 3ILXA 1YI8A 1FLAA 1SKBA 3FROA 3HVJA 3NYIA 2PXXA 5E1OA 2B9VA 4M9QA 3V55A 3TQFA 3WNQA 5CB8A 1G38A 1HR0E 1Q92A 3HU3A 3JRWA 3FMVA 5ELLA 1VJTA 1XCGB 3KSZO 4HJXA 4OQPA 5FHRA 3EDYA 4IGIA 3PYDA 4OJYA 4ZQHA 4DFDA 5DHUA 4I9NA 2GAAA 3T5MA 3HU2A 1VP9A 3D4BA 4MP8A 3LPDA 4O02B 2G88A 1V11B 1R6MA 2CHVA 4KACA 4TRJA 5IVIA 4MYCA 4C6TB 5CLQA 3THYA 2HX1A 2AF4C 1L8AA 1F2DA 4AWXA 2PJRA 4HDSA 1JR4A 4B80A 2NX2A 1W49A 4F0JA 5K0NA 1XXLA 1OZ0A 3TYXA 1MMFB 3FYCA 3SCZA 1DKOA 4DPXA 1T9DA 1M7HA 1R0YA 2ARKA 3CXUA 2JFYA 4K5QA 3AY0A 4DRZA 4R69A 4AKGA 1B23P 1DTWA 2NADA 3GO4A 1WXDA 5FLYA 4AN4A 4E0BA 4S1PA 4F4JA 4QJ3A 4Z4CA 1BMFD 3WLKX 1FIUA 3PUHA 2FMIA 5HK9A 2D8AA 1RWOA 4PWZA 2YJ5A 3IT0A 2IHTA 3T3HA 5K01A 1B8UA 2WAXA 3UATA 3C5CA 2ZT8A 3EZ7A 3GNTA 2C61A 1Y9AA 3ZE1B 4NPCA 5CM8B 3HY3A 1LSJA 3NCHA 4IF6A 4ZRDA 4CEIB 2JVJA 3EIOA 1NTRA 1KJ9A 3HY6A 1D9XA 2X8JB 3QOFA 4EGCB 1I4WA 3OCUA 4UUNA 1JJ7A 1EWQA 1J1ZA 4BLSA 3HYLA 1NG1A 4X1YB 3H87A 4AP6A 3KQLA 2QMHA 2QEQA 1ENOA 3L7ZB 3IUMA 3TR6A 5CMLA 1T9GS 1YS6A 1JRLA 2ZJ1A 3F9CA 3FHLA 3BQ9A 1R3DA 2QK4A 3KFLA 1M66A 2C8VA 3D2CA 3I4LA 2REBA 1DO8A 4L07A 5H1YA 1MO3A 2GO7A 4X24A 5FL3A 4TYNA 1US8A 4KXXA 4AULA 1GPWB 2DE0X 3FLAA 1NXTA 1PNRA 4BP1A 3G5MA 1NUHA 1XMOI 3BK1A 4Q3CA 4V0KA 2O3TA 3ZKDA 1J0BA 4LHVA 2IOYA 3AXSA 5AFSA 3QFFA 1XYGA 4RDIA 3I5MA 3RVBA 4B4DA 4B3HA 4MYHA 2VG8A 4NDZA 5FR1A 5CIYA 2YXLA 4L4ZA 3KQPA 2AQHA 5CX1A 4WOJA 4UHJA 2LTAA 3IAS1 1ZKDA 4C3ZA 4RTNA 3R7LA 5JNRA 4DBZA 2P5SA 4FCCA 1VPEA 1XP8A 3FVWA 5BN4B 3GJTA 3UOAB 1M2VB 1RI1A 4EGQA 4TUYF 4YRIA 2Z6AA 1CFJA 1ZOPA 3GJSA 5ADWA 4YJHB 3IB6A 2REOA 1JE0A 4BU1A 4C0BA 5AJZA 3C4VA 2DXIA 5JAOA 2WF5A 3V9PA 4P98A 4CF7A 1EHIA 5K09A 3DE2X 4PX5A 3PC6A 4QXOA 5FTJA 3DR3A 5DHFA 1NBMA 5BSWA 2C3MA 4Q21A 4WY2A 4W5HA 3WGJA 5T8KC 2XUOA 4WEQA 4F2GA 2RI1A 2ZBVA 1N0HA 1QHEA 4ITUA 3D7NA 2NU6B 1YAJA 1WSBA 3A9WA 3PHHA 3RYFB 3IXQA 1N6PA 3CF4A 2XGGA 2HA3A 1ES9A 4WZBA 4A1OA 5KJFA 1TT5B 2HV8A 2OVBA 4K9PA 4QUDA 5BQXA 1JAHA 1ZMXA 3O2QB 2QP3A