4JI8E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8E02
4DR7E 4OX9I 1KTVA 4JI3I 4DUZE 1NHIA 1WUUA 2V2ZA 3ADIA 1FWKA 2L3CA 4DV6I 4DR6I 4LFAI 2GS8A 3WU6A 4YY3E 2VQFE 4X8WA 3C4TA 3LPSA 4NXNE 1EI1A 4LF4I 4FWHA 1HNZE 5BR8E 3HTXA 4DU7A 2NPFA 1XNQI 1H72C 2NUGA 2WW4A 2RS6A 3K1JA 1OJ4A 2L33A 3ZKDA 1QU6A 1NHJA 4DV4I 1IBLE 4DXLA 1H7SA 1H74A 1HNWE 4JG4A 3H4LA 1I94I 4JI5I 4LF7E 4LF8E 2LBSB 4X64E 4DPWA 2UUBI 1XMOI 4B3SI 2MDRA 4R1FA 1RR9A 1NHHA 4DV2I 1HR0E 4LF5E 3WU5A 3J7AG 3ZZUA 1IBKI 2A2DA 2V2VA 4GKKI 4M1KA 3CWVA 3T1HI 2ZITA 4M30A 4ED4A 4JI6E 4M2ZA 1N33E 2N3GA 3LLHA 4WUBA 4DR1I 5IWAI 2L2KB 3Q1QA 4OX9E 3GONA 1B63A 1N0UA 4DKKA 4DU8A 3LNUA 2DMYA 2NA2A 3ZZTA 2UUAI 3QT6A 4DV6E 4DR6E 4KHPI 4LFAE 4UT4A 2BM1A 3JAMQ 3P1XA 4X62I 2RS7A 2BV3A 2V8PA 4LF4E 2NUFA 4DV3E 4DV7I 4FWGA 3J7AM 1EKZA 2UXCI 1XNQE 2HFUA 2DEJA 2ZM6E 2UUCI 2LRSA 2BM0A 1DARA 1WHQA 1PVGA 1IBMI 4Z7CA 3J80Q 4DV4E 4JI7I 4LFCI 3PYEA 4B3RI 5IT9C 4LF9I 3T1YE 2EZ6A 4P7AA 3OTOE 1N32I 2LTSA 2E1RA 1I94E 4JI5E 1X47A 3ZKBA 2UUBE 1XMOE 3VYYA 4B3SE 1VISA 4DV2E 4DPTA 4GKJE 5L3JA 3PYFA 1IBKE 5LMNI 1YZ9A 1KVKA 2VQEE 4GKKE 1H73A 2LTRA 3T1HE 1Z0WA 3WU4A 3J81C 1UHZA 4HACA 4B3TI 1MU5A 4DR1E 5IWAE 1B62A 1N0VC 4JI0I 4JI8I 2DIXA 4I3HA 1S16A 4DR2I 2DEIA 4JI2I 1ZM2A 1QZRA 1N34E 3F0NA 5A2QC 4NXMI 2UUAE 1HNXI 1FNMA 4KHPE 3PYDA 4DPXA 4LF6I 4DR3I 4USMA 4X62E 3C4BA 4JI4I 3WU3A 2LJHA 4DV0I 2UXDI 1S4EA 4DV7E 2VF3A 2N3HA 2V2QA 3ZZ0A 4X66I 2UXCE 2ZBKB 2UU9I 4DPYA 2UUCE 2IHR1 4NXNI 4DV5I 3M6AA 4DUYI 2HHHI 1IBME 4JI7E 4FWDA 1Z5AA 4JI3E 4LFCE 2RSMA 1YYOA 5CFFE 4LFBI 4B3RE 3QT7A 4AQYI 4JYAI 4Z7YA 1H7UA 1N32E 1U2RA 2XEXA 2A2CA 3ZM7A 4MYUA 2DB2A 2NUEA 2Q2EB 4DR4I 1STUA 4URLA 1KKHA 3QT5A 1XNRI 2OI2A 4JI1I 2JVAA 4DPUA 4HACB 1WHNA 2RTXA 1XMQI 2L2NA 4FN5A 1X49A 5FLXC 5LMNE 2R42A 4MYTA 3ADLA 4LF7I 2CPNA 4JV5I 1UILA 1DI2A 4WUCA 4B3TE 4FW9A 4JI0E 1ZM9A 2HFSA 4WFTA 4DR2E 4B3MI 1Z0CA 1FJGI 1YYKA 4NXME 1X48A 1HNXE 2LUPB 1EA6A 2F4VI 4PU9A 2HK2A 4K0KI 4LF6E 4DR3E 1PKPA 4YHHI 1ELOA 4JI4E 1N36I 4DV0E 1T4NA 2UXDE 1XHKA 4DV1I 1T4OA 2LUQA 4DR5I 2HKEA 4X66E 4HXZA 4PRVA 1J5EI 2UU9E 5LMUI 2X7IA 3V2UC 5IT9Q 1ZXMA 2HK3A 4DV5E 4DUYE 1A6FA 2L2MA 2HHHE 1ZXNA 4DV3I 2UXBI 4KQVA 3B78A 5LL6R 2E5LI 4X65I 4PRXA 3B8HA 4LFBE 2EFGA 4AQYE 4JYAE 3PYGA 2ZM6I 3HULA 1KIJA 1ZBTA 1FKAE 5GMDA 1K47A 2V34A 2L3JA 4DR7I 4DR4E 4DUZI 3J81Q 1XNRE 1NZ0A 4JI1E 1Z0BA 3T1YI 4WYQB 1UEKA 3ADGA 5GMEA 2HKJA 1XMQE 3OTOI 1Z0TA 2R3VA 4YY3I 1O0WA 1Z0VA 5A2QQ 2VQFI 2CZ9A 1Z5CA 4OOGC 4JV5E 2X36A 4P52A 1HNZI 4EMDA 4HY1A 5BR8I 3D4JA 2J7KA 1T4LB 4GKJI 4USKA 4B3ME 1FJGE 4LF9E 3JAMC 4RPFA 2VQEI 2F4VE 3LTOA 2LJPA 3VYXA 1FI4A 2JY9A 4K0KE 2AJ4A 4XTJA 1FWLA 4UTGA 1Z59A 4YHHE 1YYWA 4HYMA 1PIEA 1Z0EA 1IBLI 1N36E 1RQ0A 1ZM4A 1GQEA 2B7VA 4DV1E 1N34I 4DR5E 3B82A 1D6TA 3ADJA 1RC7A 1HNWI 1J5EE 3J7Yp 5LMUE 2B7TA 2B3TB 4LF8I 3J80C 4X64I 1BKNA 1ZM3A 1MG7A 2UXBE 4JI8E 1J26A 4WUDA 1HR0I 4JI2E 4LF5I 2E5LE 4X65E 1MX0A 2YT4A 1RREA 3QT8A 4JI6I 1N33I 3K17A 1Z0GA 5FLXQ 4ZVIA 1Z5BA 2KHXA 3V5RA
chains in the Genus database with same CATH superfamily
4DR7E 4OX9I 2NABA 4BHCA 4IFDB 1KTVA 4JI3I 4DUZE 1UN6B 4DR4I 2EOYA 2LCEA 2YZTA 4R2EA 1JK2A 1NHIA 2PO1A 1WUUA 2M1SA 1YSAC 2V2ZA 3ADIA 1FWKA 2DSYA 2L3CA 4DV6I 1HK7A 4DR6I 4MLQA 4LFAI 2GS8A 2EPZA 3WU6A 3EPJA 4YY3E 4R2SA 2GPIA 5EKWA 2VQFE 4X8WA 2NN6C 2O1UA 3C4TA 3LPSA 2DRPA 4NXNE 5EL9A 1EI1A 2WP8B 5DNLA 3M85G 4LF4I 4FWHA 1HNZE 5K36F 5DRPA 1X6HA 5BR8E 4BMJA 3HTXA 4DU7A 2EMBA 1PDAA 2EPOA 1UDNA 2NPFA 3FIGA 4GZNC 1NCSA 1XNQI 1R6LA 1IQSA 1SR9A 4MLVA 1H72C 3M99B 2NUGA 2WW4A 3Q6NA 4F2JC 1MGTA 1N3GA 2RS6A 3JU0A 3OMLA 3K1JA 1OJ4A 5AE3A 2L33A 5AASA 3ZKDA 3M7ND 4MU0A 5K36B 1QU6A 1NHJA 4DV4I 5A69A 3HXLA 1YH8A 1YPNA 1IBLE 4DXLA 1H7SA 1H74A 1USVA 5JEAC 4OO1F 2LT7A 1VI7A 3L7ZA 3DF6A 2V86A 2D9HA 1HNWE 3ECRA 4JG4A 3H4LA 1I94I 4JI5I 2V89A 2EOHA 4N4RB 4LF7E 3HQ1A 4LF8E 2LBSB 4X64E 4DPWA 1WXRA 2UUBI 4NHRA 4R2DA 2PO2B 2DGCA 1XMOI 4AM3A 4B3SI 1ZU1A 2MDRA 4R1FA 1RR9A 2CG9A 1NHHA 1YUIA 1YHCA 1HR0E 4GQUA 2EOMA 3IWDA 4DV2I 2AE8A 4LF5E 3WU5A 2J65A 3J7AG 4NZVA 3ZZUA 2BA0D 1IBKI 2F8BA 3VK6A 4F6MA 2A2DA 2YRKA 2V2VA 4TUGA 2WBUA 2EWLA 4IFDE 4GKKI 4M1KA 3BIDA 4FK5C 3CWVA 3T1HI 2EORA 2ZITA 4M30A 4ED4A 2PO1B 4JI6E 4M2ZA 4RHBB 2N3GA 1N33E 3LLHA 2VRDA 4HTGA 1A1HA 4WUBA 5FWKA 2EN1A 4DR1I 5IWAI 2L2KB 2IOPA 2A25A 1TF6A 3Q1QA 2EM7A 4R03A 4OX9E 2YTJA 3GONA 1B63A 3IWBA 2EPPA 4DKKA 1N0UA 4DU8A 3LNUA 2DMYA 2KOUA 2YWQA 5K36C 2EPRA 2MC6A 2NA2A 2EPKX 3ZZTA 2B9DA 2UUAI 4IFDD 4BA1A 3QT6A 3K6QA 4DV6E 4DR6E 4KHPI 2YTNA 1BBOA 4LFAE 4UT4A 2EMKA 4R2AA 2FGGA 2EM9A 2JYAA 1ZR9A 4M9VC 2BM1A 3C6KA 2LO3A 3JAMQ 4BBYA 3P1XA 1L4SA 4X62I 2RS7A 2ENAA 2BV3A 3VHTB 2YTDA 3KRNA 3UK3C 1NEIA 3NZKA 2V8PA 4LF4E 4IZJA 2NUFA 4DV3E 2EM2A 4DV7I 3MHHC 4ZYDA 4FWGA 2J7JA 1EKZA 1T39A 3J7AM 2EM3A 5C0XA 2M7QA 2UXCI 1UBDC 1E3HA 1PJTA 4TUIA 5TSEA 2ODRD 1JK1A 1XNQE 2HFUA 2DEJA 1X6EA 3EPKA 4NBQA 2ZM6E 2UUCI 2LVHA 2PNMA 2LRSA 1BBGA 2VF1A 2BM0A 4OO1A 3L7ZB 2WZOA 1WHQA 1DARA 1RMDA 4F9AB 4ZYHA 2EOQA 2R76A 2YSPA 1PVGA 3CDJA 4U3DA 1IBMI 2EMCA 4Z7CA 1QNTA 1A1GA 3J80Q 4DV4E 4JI7I 5K36D 5C0XE 4LFCI 5KL3A 1A1FA 3PYEA 2JP9A 5ELWA 4B3RI 5IT9C 4LF9I 2JWOA 3T1YE 1R6MA 2EZ6A 4KZSA 2HC5A 1G2FC 2PRTA 1P42A 4P7AA 1PJQA 1WRJA 4WX9A 3OTOE 1N32I 5DRQA 2EE8A 2N8XA 2YTPA 4OO1E 2LTSA 2H36X 1LLMC 1I94E 4JI5E 2BA0G 2E1RA 4LCFA 1X47A 3ZKBA 1X6FA 2HJJA 4O43A 4MU4A 1UDSA 3PRYA 4MU1A 2UUBE 1XMOE 3VYYA 4B3SE 2EN3A 1SFEA 1UDQA 1VISA 2BA1D 4DV2E 4DPTA 4GKJE 5L3JA 3PYFA 2EL4A 4OO1D 1IBKE 5LMNI 2EM0A 1YZ9A 2EMLA 1KVKA 2VQEE 4F9BB 2BR2A 4GKKE 1H73A 2LTRA 2CGEA 3T1HE 2EMYA 2EN4A 4BA1B 1Z0WA 4FW6A 3WU4A 3J81C 1UHZA 5C0XF 2NN6A 4HACA 2EN8A 5A6BA 1MU5A 3GCMA 4DR1E 5IWAE 1B62A 3HKMA 4B3TI 2E1MA 3B4TA 4FW3A 1N0VC 4JI0I 5ADZA 4JI8I 3UHMA 2DIXA 4I3HA 5AE2A 1S16A 4DR2I 2DEIA 4JI2I 1ZM2A 2PNZA 2EOZA 4R8OA 2YTGA 1B69A 1N34E 1QZRA 5A2QC 1BB8A 3F0NA 2FV4B 4NXMI 2UUAE 1HNXI 4FW4A 2EN2A 4LOMA 4ZYEA 2EM6A 3EPHA 1FNMA 2WCC3 4KHPE 3H1CA 3PYDA 3Q6MA 4IZJB 4IFDC 4WSPA 2GHFA 5C0XB 4DPXA 4LF6I 3HPZA 4DR3I 2NN6E 4BA2A 4USMA 5KL4A 5F3WA 4X62E 3C4BA 4JI4I 3WU3A 2LJHA 3MSWA 3K85A 2C37A 1UDOA 5A6KA 4DV0I 2UXDI 2EMAA 1F2IG 1S4EA 1MEYC 1OYSA 1YFHA 4P78A 5T6JA 4DV7E 4OO1B 2L92A 2VF3A 2N3HA 2V2QA 3ZZ0A 4F6NA 2MKNA 3P3CA 2JT2A 2UXCE 2E72A 3KWRA 4X66I 2YTIA 2MDGA 2ZBKB 5JEAA 3P06A 4WXDA 3L00A 2UU9I 1OYPA 2ODRC 4BHBA 4DPYA 2UUCE 2IHR1 4FW7A 1P47A 2IERA 2ADRA 4NXNI 2EM4A 2Z5EA 3M6AA 4DV5I 4DUYI 2EMFA 3U1YA 3RMPA 4BC9A 2HHHI 3LMLA 2JOXA 1IBME 4BCAA 2Z5BA 2EOXA 1X3CA 4JI7E 4FWDA 5KL7A 1Z5AA 2EPMX 3EPLA 4JI3E 2IOQA 2EQ3A 4LFCE 4ISAA 4R2CA 2RSMA 1YYOA 5JEAE 2EP3A 5CFFE 2VESA 4LFBI 1X5WA 5AE1A 4B3RE 2NN6F 2GQ0A 4OKGA 3QT7A 4AQYI 4JYAI 4Z7YA 2F1DA 1H7UA 1N32E 1DQ3A 1U2RA 1EH8A 3KZYA 3M85D 2XEXA 4L8NA 1Y4UA 2A2CA 3AV0A 3ZM7A 2JXPA 2Z5CA 2EM8A 5AC5A 1IMUA 4MYUA 2DB2A 2NUEA 5IXMB 3CDIA 2C38A 2Q2EB 1XXEA 2EPAA 2BR2B 1STUA 3HJCA 2GLIA 1KKHA 2C39A 3QT5A 2OI2A 4URLA 5C0XC 1XNRI 2DMIA 3M7NG 4JI1I 4MQYA 1A1LA 2JVAA 4DPUA 4BS9A 2NN6B 1WHNA 4HACB 4QNKA 2WNRA 4QNJA 2RTXA 3P3GA 1XMQI 2L2NA 1A1IA 1Y6ZA 2K7IA 4FN5A 1X49A 5FLXC 2JEAA 2EOSA 5LMNE 4OO1C 2R42A 2O3ZA 4MYTA 3P76A 3ADLA 4LF7I 4L5NC 2PNZB 2JE6A 2CPNA 4RH8A 2EJ4A 1AAYA 4LTYA 2YRHA 1UILA 2FTXB 4JV5I 2Q8UA 5LLQA 1DI2A 4WUCA 4WSGA 5JEAF 4B3TE 1T38A 4FW9A 4JI0E 2VE7C 1GZ6A 4I8OA 1ZM9A 2RPCA 4LPFA 2HFSA 4WFTA 2M4IA 4J8ZA 4DR2E 4BA2B 2R1FA 2IESA 4B3MI 2V88A 2EPLX 2LMZA 1Z0CA 3GLLA 1FJGI 1YYKA 1Z1BA 3THOB 4NXME 1X48A 3HPSA 1HNXE 2C37B 4WPYA 2LUPB 2EOOA 1EA6A 2F4VI 4PU9A 2EPNA 2ENHA 3F6GA 2HK2A 2EOFA 4IS1C 2EOIA 4BC7A 4U3BA 4IZJD 4K0KI 4LF6E 4DR3E 2DLKA 2KONA 5JEAB 1A1KA 1PKPA 4YHHI 2LE2A 1ELOA 5C0XD 4JI4E 1N36I 1USUA 4DV0E 1T4NA 2JPAA 2EMXA 2UXDE 4IZKA 4O4KA 2MKDA 4DMIA 1EH7A 4KWYA 1XHKA 1T4OA 2LUQA 4DV1I 4DR5I 5A6AA 2HKEA 4X66E 4R2RA 4HXZA 4M0VA 2PO0A 4PRVA 4LU9A 5DNYA 2Z5BB 3EQ1A 3DD6A 2UU9E 1Y60A 5LMUI 2X7IA 1J5EI 2ENCA 3V2UC 2V85A 5IT9Q 2I13A 2YU5A 2EPXA 2LV2A 1ZXMA 1PJSA 3KZZA 2YU8A 2L8TA 2HK3A 4DV5E 3AUZA 4DUYE 4F54A 4IJDA 2L2MA 1A6FA 2HHHE 3THNA 2EQ1A 2V87A 1ZXNA 4DV3I 2UXBI 2CT1A 2YTFA 1OYRA 2EMZA 4KQVA 3B78A 4MU3A 5LL6R 2E5LI 3U1KA 1DGCA 2WBSA 2GO3A 4X65I 2YSOA 2JEBA 2Z5CB 4PRXA 3B8HA 5DRRA 2YPNA 4LFBE 2C38B 4O5GA 3IWCA 2C39B 3TQMA 4AQYE 4JYAE 1ZAAC 2EFGA 3PYGA 4AIMA 2ZM6I 3HULA 4MDTA 1KIJA 1A1JA 1ZBTA 2EL6A 2EOJA 1KJKA 1FKAE 2RSIA 4OZEA 2O1VA 2V83A 2WNRB 5GMDA 1K47A 2ELYA 3F6HA 2WBTA 2V34A 2EPCA 3BF2A 2L3JA 2JEAB 4ZYGA 4DR7I 1AH5A 3PS2A 4DR4E 4DUZI 2JE6B 1XNRE 3J81Q 1E3PA 1NZ0A 4JI1E 1Z0BA 2EN7A 4FW5A 2EMWA 3DJWA 3T1YI 4WYQB 1UEKA 3ADGA 5GMEA 2ELZA 1XMQE 2HKJA 4LCGA 1TN9A 3OTOI 5A6JA 1Z0TA 2NN6D 2K4VA 2R3VA 1O0WA 5A6BD 1Z0VA 5A2QQ 4YY3I 2CZ9A 2VQFI 3MHSC 4IFDA 1Z5CA 5DNXA 2EOEA 2BBGA 2EPUA 4OOGC 4JV5E 2X36A 2G7HA 1EH6A 4P52A 4IS9A 1HNZI 4EMDA 4HY1A 5BR8I 3D4JA 1KYQA 4WXCA 2J7KA 1T4LB 2I9IA 4GKJI 1RHYA 1GTKA 4USKA 4B3ME 3P3EA 3H09A 1FJGE 4LF9E 2EN6A 2YRMA 3JAMC 2BA1G 2WP8A 3BBGA 4RPFA 2VQEI 4IZKB 2F4VE 3LTOA 2LJPA 1Y4SA 2YTEA 3VYXA 2EMHA 1FI4A 2JY9A 4R2PA 4R2QA 4K0KE 2YTQA 1FWLA 2V8QB 2AJ4A 4UTGA 4XTJA 2PO0B 2YTOA 1Z59A 3JTZA 4YHHE 2O1WA 4X9JA 1YYWA 3GMEA 4HYMA 1PIEA 1Z0EA 5JEAD 1IBLI 4Q35B 1N36E 1RQ0A 1ZM4A 1GQEA 2B7VA 5AC4A 4DV1E 2CSHA 2DLQA 1N34I 2JOBA 4DR5E 3B82A 2EM5A 3ZOQB 5IV8B 3ADJA 2LJUA 1D6TA 1RC7A 1G2DC 5K36A 2HGHA 5DROA 1ZBQA 2GO4A 4O24A 2EL5A 1J5EE 5KL6A 1HNWI 3J7Yp 5LMUE 2B7TA 4P7DA 2B3TB 5KL5A 4LF8I 2L6MA 3C6MA 2JEBB 2RQLA 3J80C 4X64I 2CVEA 2EMGA 2BB8A 1BKNA 1Y5YA 4Q28A 4F9CB 1ZM3A 2PNLA 1MG7A 2UXBE 4JI8E 3PS3A 1J26A 3BGHA 2JR1A 4WUDA 1HR0I 1TF3A 4IFDF 4JI2E 4LF5I 2E5LE 4X65E 1MX0A 2EQ0A 2YT4A 1WJPA 4AIDA 5K36E 1YUJA 1RREA 3QT8A 2PO2A 4GEQB 3PS1A 4JI6I 2CTDA 1N33I 4LCHA 2O1TA 1Z0GA 3K17A 5FLXQ 2M9AA 4HEIA 4ZVIA 2EMIA 1IQOA 4N3OA 5KL2A 1Z5BA 2KHXA 3QG5C 2MC5A 4J3DA 3V5RA
chains in the Genus database with same CATH topology
4DR7E 4OX9I 1KTVA 4JI3I 4DUZE 2YZTA 1NHIA 1WUUA 2M1SA 2V2ZA 3ADIA 1FWKA 2DSYA 2L3CA 4DV6I 1HK7A 4DR6I 4LFAI 2GS8A 3WU6A 4YY3E 2VQFE 4X8WA 2O1UA 3C4TA 3LPSA 4NXNE 1EI1A 4LF4I 4FWHA 1HNZE 5BR8E 4BMJA 3HTXA 4DU7A 2NPFA 3FIGA 1XNQI 1SR9A 1H72C 2NUGA 2WW4A 3Q6NA 2RS6A 3JU0A 3OMLA 3K1JA 1OJ4A 5AE3A 2L33A 5AASA 3ZKDA 1QU6A 1NHJA 4DV4I 3HXLA 1IBLE 4DXLA 1H7SA 1H74A 1USVA 3DF6A 2V86A 1HNWE 4JG4A 3H4LA 1I94I 4JI5I 2V89A 4LF7E 3HQ1A 4LF8E 2LBSB 4X64E 4DPWA 1WXRA 2UUBI 1XMOI 4B3SI 2MDRA 4R1FA 1RR9A 2CG9A 1NHHA 4DV2I 1HR0E 3IWDA 4LF5E 3WU5A 3J7AG 3ZZUA 1IBKI 2F8BA 3VK6A 2A2DA 2V2VA 4TUGA 2EWLA 4GKKI 4M1KA 3CWVA 3T1HI 2ZITA 4M30A 4ED4A 4JI6E 4M2ZA 1N33E 2N3GA 3LLHA 4WUBA 5FWKA 4DR1I 5IWAI 2L2KB 2IOPA 3Q1QA 4R03A 4OX9E 3GONA 1B63A 3IWBA 1N0UA 4DKKA 4DU8A 3LNUA 2DMYA 2KOUA 2NA2A 2MC6A 3ZZTA 2B9DA 2UUAI 3QT6A 3K6QA 4DV6E 4DR6E 4KHPI 4LFAE 4UT4A 2FGGA 2BM1A 3JAMQ 4BBYA 3P1XA 4X62I 2RS7A 2BV3A 2V8PA 4LF4E 4IZJA 2NUFA 4DV3E 4DV7I 4FWGA 3J7AM 1EKZA 2M7QA 2UXCI 4TUIA 2ODRD 1XNQE 2HFUA 2DEJA 2ZM6E 2UUCI 2PNMA 2LRSA 2VF1A 2BM0A 2WZOA 1WHQA 1DARA 4F9AB 1PVGA 1IBMI 4Z7CA 3J80Q 4DV4E 4JI7I 4LFCI 3PYEA 4B3RI 5IT9C 4LF9I 2JWOA 3T1YE 2EZ6A 4KZSA 4P7AA 3OTOE 1N32I 2LTSA 2H36X 1I94E 4JI5E 2E1RA 1X47A 3ZKBA 3PRYA 2UUBE 1XMOE 3VYYA 4B3SE 1VISA 4DV2E 4DPTA 4GKJE 5L3JA 3PYFA 1IBKE 5LMNI 1YZ9A 1KVKA 2VQEE 4F9BB 4GKKE 1H73A 2LTRA 2CGEA 3T1HE 1Z0WA 3WU4A 3J81C 1UHZA 4HACA 4B3TI 1MU5A 4DR1E 5IWAE 1B62A 2E1MA 1N0VC 4JI0I 5ADZA 4JI8I 2DIXA 4I3HA 5AE2A 1S16A 4DR2I 2DEIA 4JI2I 1ZM2A 4R8OA 1QZRA 1N34E 3F0NA 5A2QC 2FV4B 4NXMI 2UUAE 1HNXI 1FNMA 4IZJB 4KHPE 3PYDA 3Q6MA 4WSPA 4DPXA 4LF6I 3HPZA 4DR3I 4USMA 5F3WA 4X62E 3C4BA 4JI4I 3WU3A 2LJHA 3MSWA 3K85A 4DV0I 2UXDI 1S4EA 4P78A 5T6JA 4DV7E 2L92A 2VF3A 2N3HA 2V2QA 3ZZ0A 4X66I 2UXCE 3KWRA 2ZBKB 3P06A 2UU9I 2ODRC 4DPYA 2UUCE 2IHR1 4NXNI 2Z5EA 4DV5I 3M6AA 4DUYI 3RMPA 4BC9A 2HHHI 3LMLA 2JOXA 1IBME 4BCAA 2Z5BA 4JI7E 4FWDA 1Z5AA 4JI3E 2IOQA 4LFCE 2RSMA 1YYOA 5CFFE 4LFBI 5AE1A 4B3RE 2GQ0A 3QT7A 4AQYI 4JYAI 4Z7YA 1H7UA 1N32E 1DQ3A 1U2RA 2XEXA 4L8NA 1Y4UA 2A2CA 3AV0A 3ZM7A 2Z5CA 4MYUA 2DB2A 2NUEA 2Q2EB 4DR4I 1STUA 3HJCA 1KKHA 3QT5A 4URLA 1XNRI 2OI2A 4JI1I 2JVAA 4DPUA 4BS9A 4HACB 1WHNA 2RTXA 1XMQI 2L2NA 1Y6ZA 4FN5A 1X49A 5FLXC 5LMNE 2R42A 4MYTA 3ADLA 4LF7I 4L5NC 2CPNA 4JV5I 4LTYA 1UILA 2FTXB 1DI2A 4WUCA 4B3TE 4FW9A 4JI0E 2VE7C 1GZ6A 4I8OA 1ZM9A 2HFSA 4WFTA 2M4IA 4J8ZA 4DR2E 4B3MI 2V88A 2LMZA 1Z0CA 1FJGI 1YYKA 4NXME 1X48A 3HPSA 1HNXE 4WPYA 2LUPB 1EA6A 2F4VI 4PU9A 3F6GA 2HK2A 4BC7A 4K0KI 4IZJD 4LF6E 4DR3E 2KONA 1PKPA 4YHHI 2LE2A 1ELOA 4JI4E 1N36I 1USUA 4DV0E 1T4NA 2UXDE 4IZKA 4DMIA 1XHKA 4DV1I 1T4OA 2LUQA 4DR5I 2HKEA 4X66E 4HXZA 4M0VA 4PRVA 4LU9A 5DNYA 2Z5BB 1J5EI 2UU9E 5LMUI 2X7IA 3V2UC 2V85A 5IT9Q 1ZXMA 2L8TA 2HK3A 4DV5E 3AUZA 4DUYE 4F54A 1A6FA 2L2MA 2HHHE 2V87A 1ZXNA 4DV3I 2UXBI 4KQVA 3B78A 5LL6R 2E5LI 4X65I 2Z5CB 4PRXA 3B8HA 4LFBE 3IWCA 2EFGA 4AQYE 4JYAE 3PYGA 2ZM6I 3HULA 1KIJA 1ZBTA 1FKAE 2O1VA 2V83A 5GMDA 1K47A 3F6HA 2V34A 2L3JA 4DR7I 4DR4E 4DUZI 3J81Q 1XNRE 1NZ0A 4JI1E 1Z0BA 3DJWA 3T1YI 4WYQB 1UEKA 3ADGA 5GMEA 2HKJA 1XMQE 3OTOI 1Z0TA 2K4VA 2R3VA 1O0WA 1Z0VA 4YY3I 5A2QQ 2VQFI 2CZ9A 1Z5CA 4OOGC 4JV5E 2X36A 2G7HA 4P52A 1HNZI 4EMDA 4HY1A 5BR8I 3D4JA 2J7KA 1T4LB 4GKJI 4USKA 4B3ME 3H09A 1FJGE 4LF9E 3JAMC 4RPFA 2VQEI 4IZKB 2F4VE 3LTOA 2LJPA 1Y4SA 3VYXA 1FI4A 2JY9A 4K0KE 2AJ4A 4XTJA 1FWLA 4UTGA 2V8QB 1Z59A 3JTZA 4YHHE 2O1WA 1YYWA 4HYMA 1PIEA 1Z0EA 1IBLI 1N36E 1RQ0A 1ZM4A 1GQEA 2B7VA 4DV1E 1N34I 2JOBA 4DR5E 3B82A 1D6TA 3ZOQB 3ADJA 1RC7A 1ZBQA 1HNWI 1J5EE 3J7Yp 5LMUE 2B7TA 4P7DA 2B3TB 4LF8I 2L6MA 3J80C 4X64I 1BKNA 4Q28A 4F9CB 1ZM3A 2PNLA 1MG7A 2UXBE 4JI8E 1J26A 2JR1A 4WUDA 1HR0I 4JI2E 4LF5I 2E5LE 4X65E 1MX0A 2YT4A 1RREA 3QT8A 4GEQB 4JI6I 1N33I 2O1TA 1Z0GA 3K17A 5FLXQ 4ZVIA 4N3OA 1Z5BA 2KHXA 2MC5A 3V5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 E;  4OX9 I;  1KTV A;  4JI3 I;  4DUZ E;  1NHI A;  1WUU A;  2V2Z A;  3ADI A;  1FWK A;  2L3C A;  4DV6 I;  4DR6 I;  4LFA I;  2GS8 A;  3WU6 A;  4YY3 E;  2VQF E;  4X8W A;  3C4T A;  3LPS A;  4NXN E;  1EI1 A;  4LF4 I;  4FWH A;  1HNZ E;  5BR8 E;  3HTX A;  4DU7 A;  2NPF A;  1XNQ I;  1H72 C;  2NUG A;  2WW4 A;  2RS6 A;  3K1J A;  1OJ4 A;  2L33 A;  3ZKD A;  1QU6 A;  1NHJ A;  4DV4 I;  1IBL E;  4DXL A;  1H7S A;  1H74 A;  1HNW E;  4JG4 A;  3H4L A;  1I94 I;  4JI5 I;  4LF7 E;  4LF8 E;  2LBS B;  4X64 E;  4DPW A;  2UUB I;  1XMO I;  4B3S I;  2MDR A;  4R1F A;  1RR9 A;  1NHH A;  4DV2 I;  1HR0 E;  4LF5 E;  3WU5 A;  3J7A G;  3ZZU A;  1IBK I;  2A2D A;  2V2V A;  4GKK I;  4M1K A;  3CWV A;  3T1H I;  2ZIT A;  4M30 A;  4ED4 A;  4JI6 E;  4M2Z A;  1N33 E;  2N3G A;  3LLH A;  4WUB A;  4DR1 I;  5IWA I;  2L2K B;  3Q1Q A;  4OX9 E;  3GON A;  1B63 A;  1N0U A;  4DKK A;  4DU8 A;  3LNU A;  2DMY A;  2NA2 A;  3ZZT A;  2UUA I;  3QT6 A;  4DV6 E;  4DR6 E;  4KHP I;  4LFA E;  4UT4 A;  2BM1 A;  3JAM Q;  3P1X A;  4X62 I;  2RS7 A;  2BV3 A;  2V8P A;  4LF4 E;  2NUF A;  4DV3 E;  4DV7 I;  4FWG A;  3J7A M;  1EKZ A;  2UXC I;  1XNQ E;  2HFU A;  2DEJ A;  2ZM6 E;  2UUC I;  2LRS A;  2BM0 A;  1DAR A;  1WHQ A;  1PVG A;  1IBM I;  4Z7C A;  3J80 Q;  4DV4 E;  4JI7 I;  4LFC I;  3PYE A;  4B3R I;  5IT9 C;  4LF9 I;  3T1Y E;  2EZ6 A;  4P7A A;  3OTO E;  1N32 I;  2LTS A;  2E1R A;  1I94 E;  4JI5 E;  1X47 A;  3ZKB A;  2UUB E;  1XMO E;  3VYY A;  4B3S E;  1VIS A;  4DV2 E;  4DPT A;  4GKJ E;  5L3J A;  3PYF A;  1IBK E;  5LMN I;  1YZ9 A;  1KVK A;  2VQE E;  4GKK E;  1H73 A;  2LTR A;  3T1H E;  1Z0W A;  3WU4 A;  3J81 C;  1UHZ A;  4HAC A;  4B3T I;  1MU5 A;  4DR1 E;  5IWA E;  1B62 A;  1N0V C;  4JI0 I;  4JI8 I;  2DIX A;  4I3H A;  1S16 A;  4DR2 I;  2DEI A;  4JI2 I;  1ZM2 A;  1QZR A;  1N34 E;  3F0N A;  5A2Q C;  4NXM I;  2UUA E;  1HNX I;  1FNM A;  4KHP E;  3PYD A;  4DPX A;  4LF6 I;  4DR3 I;  4USM A;  4X62 E;  3C4B A;  4JI4 I;  3WU3 A;  2LJH A;  4DV0 I;  2UXD I;  1S4E A;  4DV7 E;  2VF3 A;  2N3H A;  2V2Q A;  3ZZ0 A;  4X66 I;  2UXC E;  2ZBK B;  2UU9 I;  4DPY A;  2UUC E;  2IHR 1;  4NXN I;  4DV5 I;  3M6A A;  4DUY I;  2HHH I;  1IBM E;  4JI7 E;  4FWD A;  1Z5A A;  4JI3 E;  4LFC E;  2RSM A;  1YYO A;  5CFF E;  4LFB I;  4B3R E;  3QT7 A;  4AQY I;  4JYA I;  4Z7Y A;  1H7U A;  1N32 E;  1U2R A;  2XEX A;  2A2C A;  3ZM7 A;  4MYU A;  2DB2 A;  2NUE A;  2Q2E B;  4DR4 I;  1STU A;  4URL A;  1KKH A;  3QT5 A;  1XNR I;  2OI2 A;  4JI1 I;  2JVA A;  4DPU A;  4HAC B;  1WHN A;  2RTX A;  1XMQ I;  2L2N A;  4FN5 A;  1X49 A;  5FLX C;  5LMN E;  2R42 A;  4MYT A;  3ADL A;  4LF7 I;  2CPN A;  4JV5 I;  1UIL A;  1DI2 A;  4WUC A;  4B3T E;  4FW9 A;  4JI0 E;  1ZM9 A;  2HFS A;  4WFT A;  4DR2 E;  4B3M I;  1Z0C A;  1FJG I;  1YYK A;  4NXM E;  1X48 A;  1HNX E;  2LUP B;  1EA6 A;  2F4V I;  4PU9 A;  2HK2 A;  4K0K I;  4LF6 E;  4DR3 E;  1PKP A;  4YHH I;  1ELO A;  4JI4 E;  1N36 I;  4DV0 E;  1T4N A;  2UXD E;  1XHK A;  4DV1 I;  1T4O A;  2LUQ A;  4DR5 I;  2HKE A;  4X66 E;  4HXZ A;  4PRV A;  1J5E I;  2UU9 E;  5LMU I;  2X7I A;  3V2U C;  5IT9 Q;  1ZXM A;  2HK3 A;  4DV5 E;  4DUY E;  1A6F A;  2L2M A;  2HHH E;  1ZXN A;  4DV3 I;  2UXB I;  4KQV A;  3B78 A;  5LL6 R;  2E5L I;  4X65 I;  4PRX A;  3B8H A;  4LFB E;  2EFG A;  4AQY E;  4JYA E;  3PYG A;  2ZM6 I;  3HUL A;  1KIJ A;  1ZBT A;  1FKA E;  5GMD A;  1K47 A;  2V34 A;  2L3J A;  4DR7 I;  4DR4 E;  4DUZ I;  3J81 Q;  1XNR E;  1NZ0 A;  4JI1 E;  1Z0B A;  3T1Y I;  4WYQ B;  1UEK A;  3ADG A;  5GME A;  2HKJ A;  1XMQ E;  3OTO I;  1Z0T A;  2R3V A;  4YY3 I;  1O0W A;  1Z0V A;  5A2Q Q;  2VQF I;  2CZ9 A;  1Z5C A;  4OOG C;  4JV5 E;  2X36 A;  4P52 A;  1HNZ I;  4EMD A;  4HY1 A;  5BR8 I;  3D4J A;  2J7K A;  1T4L B;  4GKJ I;  4USK A;  4B3M E;  1FJG E;  4LF9 E;  3JAM C;  4RPF A;  2VQE I;  2F4V E;  3LTO A;  2LJP A;  3VYX A;  1FI4 A;  2JY9 A;  4K0K E;  2AJ4 A;  4XTJ A;  1FWL A;  4UTG A;  1Z59 A;  4YHH E;  1YYW A;  4HYM A;  1PIE A;  1Z0E A;  1IBL I;  1N36 E;  1RQ0 A;  1ZM4 A;  1GQE A;  2B7V A;  4DV1 E;  1N34 I;  4DR5 E;  3B82 A;  1D6T A;  3ADJ A;  1RC7 A;  1HNW I;  1J5E E;  3J7Y p;  5LMU E;  2B7T A;  2B3T B;  4LF8 I;  3J80 C;  4X64 I;  1BKN A;  1ZM3 A;  1MG7 A;  2UXB E;  4JI8 E;  1J26 A;  4WUD A;  1HR0 I;  4JI2 E;  4LF5 I;  2E5L E;  4X65 E;  1MX0 A;  2YT4 A;  1RRE A;  3QT8 A;  4JI6 I;  1N33 I;  3K17 A;  1Z0G A;  5FLX Q;  4ZVI A;  1Z5B A;  2KHX A;  3V5R A; 
#chains in the Genus database with same CATH topology
 4DR7 E;  4OX9 I;  2NAB A;  4BHC A;  4IFD B;  1KTV A;  4JI3 I;  4DUZ E;  1UN6 B;  4DR4 I;  2EOY A;  2LCE A;  2YZT A;  4R2E A;  1JK2 A;  1NHI A;  2PO1 A;  1WUU A;  2M1S A;  1YSA C;  2V2Z A;  3ADI A;  1FWK A;  2DSY A;  2L3C A;  4DV6 I;  1HK7 A;  4DR6 I;  4MLQ A;  4LFA I;  2GS8 A;  2EPZ A;  3WU6 A;  3EPJ A;  4YY3 E;  4R2S A;  2GPI A;  5EKW A;  2VQF E;  4X8W A;  2NN6 C;  2O1U A;  3C4T A;  3LPS A;  2DRP A;  4NXN E;  5EL9 A;  1EI1 A;  2WP8 B;  5DNL A;  3M85 G;  4LF4 I;  4FWH A;  1HNZ E;  5K36 F;  5DRP A;  1X6H A;  5BR8 E;  4BMJ A;  3HTX A;  4DU7 A;  2EMB A;  1PDA A;  2EPO A;  1UDN A;  2NPF A;  3FIG A;  4GZN C;  1NCS A;  1XNQ I;  1R6L A;  1IQS A;  1SR9 A;  4MLV A;  1H72 C;  3M99 B;  2NUG A;  2WW4 A;  3Q6N A;  4F2J C;  1MGT A;  1N3G A;  2RS6 A;  3JU0 A;  3OML A;  3K1J A;  1OJ4 A;  5AE3 A;  2L33 A;  5AAS A;  3ZKD A;  3M7N D;  4MU0 A;  5K36 B;  1QU6 A;  1NHJ A;  4DV4 I;  5A69 A;  3HXL A;  1YH8 A;  1YPN A;  1IBL E;  4DXL A;  1H7S A;  1H74 A;  1USV A;  5JEA C;  4OO1 F;  2LT7 A;  1VI7 A;  3L7Z A;  3DF6 A;  2V86 A;  2D9H A;  1HNW E;  3ECR A;  4JG4 A;  3H4L A;  1I94 I;  4JI5 I;  2V89 A;  2EOH A;  4N4R B;  4LF7 E;  3HQ1 A;  4LF8 E;  2LBS B;  4X64 E;  4DPW A;  1WXR A;  2UUB I;  4NHR A;  4R2D A;  2PO2 B;  2DGC A;  1XMO I;  4AM3 A;  4B3S I;  1ZU1 A;  2MDR A;  4R1F A;  1RR9 A;  2CG9 A;  1NHH A;  1YUI A;  1YHC A;  1HR0 E;  4GQU A;  2EOM A;  3IWD A;  4DV2 I;  2AE8 A;  4LF5 E;  3WU5 A;  2J65 A;  3J7A G;  4NZV A;  3ZZU A;  2BA0 D;  1IBK I;  2F8B A;  3VK6 A;  4F6M A;  2A2D A;  2YRK A;  2V2V A;  4TUG A;  2WBU A;  2EWL A;  4IFD E;  4GKK I;  4M1K A;  3BID A;  4FK5 C;  3CWV A;  3T1H I;  2EOR A;  2ZIT A;  4M30 A;  4ED4 A;  2PO1 B;  4JI6 E;  4M2Z A;  4RHB B;  2N3G A;  1N33 E;  3LLH A;  2VRD A;  4HTG A;  1A1H A;  4WUB A;  5FWK A;  2EN1 A;  4DR1 I;  5IWA I;  2L2K B;  2IOP A;  2A25 A;  1TF6 A;  3Q1Q A;  2EM7 A;  4R03 A;  4OX9 E;  2YTJ A;  3GON A;  1B63 A;  3IWB A;  2EPP A;  4DKK A;  1N0U A;  4DU8 A;  3LNU A;  2DMY A;  2KOU A;  2YWQ A;  5K36 C;  2EPR A;  2MC6 A;  2NA2 A;  2EPK X;  3ZZT A;  2B9D A;  2UUA I;  4IFD D;  4BA1 A;  3QT6 A;  3K6Q A;  4DV6 E;  4DR6 E;  4KHP I;  2YTN A;  1BBO A;  4LFA E;  4UT4 A;  2EMK A;  4R2A A;  2FGG A;  2EM9 A;  2JYA A;  1ZR9 A;  4M9V C;  2BM1 A;  3C6K A;  2LO3 A;  3JAM Q;  4BBY A;  3P1X A;  1L4S A;  4X62 I;  2RS7 A;  2ENA A;  2BV3 A;  3VHT B;  2YTD A;  3KRN A;  3UK3 C;  1NEI A;  3NZK A;  2V8P A;  4LF4 E;  4IZJ A;  2NUF A;  4DV3 E;  2EM2 A;  4DV7 I;  3MHH C;  4ZYD A;  4FWG A;  2J7J A;  1EKZ A;  1T39 A;  3J7A M;  2EM3 A;  5C0X A;  2M7Q A;  2UXC I;  1UBD C;  1E3H A;  1PJT A;  4TUI A;  5TSE A;  2ODR D;  1JK1 A;  1XNQ E;  2HFU A;  2DEJ A;  1X6E A;  3EPK A;  4NBQ A;  2ZM6 E;  2UUC I;  2LVH A;  2PNM A;  2LRS A;  1BBG A;  2VF1 A;  2BM0 A;  4OO1 A;  3L7Z B;  2WZO A;  1WHQ A;  1DAR A;  1RMD A;  4F9A B;  4ZYH A;  2EOQ A;  2R76 A;  2YSP A;  1PVG A;  3CDJ A;  4U3D A;  1IBM I;  2EMC A;  4Z7C A;  1QNT A;  1A1G A;  3J80 Q;  4DV4 E;  4JI7 I;  5K36 D;  5C0X E;  4LFC I;  5KL3 A;  1A1F A;  3PYE A;  2JP9 A;  5ELW A;  4B3R I;  5IT9 C;  4LF9 I;  2JWO A;  3T1Y E;  1R6M A;  2EZ6 A;  4KZS A;  2HC5 A;  1G2F C;  2PRT A;  1P42 A;  4P7A A;  1PJQ A;  1WRJ A;  4WX9 A;  3OTO E;  1N32 I;  5DRQ A;  2EE8 A;  2N8X A;  2YTP A;  4OO1 E;  2LTS A;  2H36 X;  1LLM C;  1I94 E;  4JI5 E;  2BA0 G;  2E1R A;  4LCF A;  1X47 A;  3ZKB A;  1X6F A;  2HJJ A;  4O43 A;  4MU4 A;  1UDS A;  3PRY A;  4MU1 A;  2UUB E;  1XMO E;  3VYY A;  4B3S E;  2EN3 A;  1SFE A;  1UDQ A;  1VIS A;  2BA1 D;  4DV2 E;  4DPT A;  4GKJ E;  5L3J A;  3PYF A;  2EL4 A;  4OO1 D;  1IBK E;  5LMN I;  2EM0 A;  1YZ9 A;  2EML A;  1KVK A;  2VQE E;  4F9B B;  2BR2 A;  4GKK E;  1H73 A;  2LTR A;  2CGE A;  3T1H E;  2EMY A;  2EN4 A;  4BA1 B;  1Z0W A;  4FW6 A;  3WU4 A;  3J81 C;  1UHZ A;  5C0X F;  2NN6 A;  4HAC A;  2EN8 A;  5A6B A;  1MU5 A;  3GCM A;  4DR1 E;  5IWA E;  1B62 A;  3HKM A;  4B3T I;  2E1M A;  3B4T A;  4FW3 A;  1N0V C;  4JI0 I;  5ADZ A;  4JI8 I;  3UHM A;  2DIX A;  4I3H A;  5AE2 A;  1S16 A;  4DR2 I;  2DEI A;  4JI2 I;  1ZM2 A;  2PNZ A;  2EOZ A;  4R8O A;  2YTG A;  1B69 A;  1N34 E;  1QZR A;  5A2Q C;  1BB8 A;  3F0N A;  2FV4 B;  4NXM I;  2UUA E;  1HNX I;  4FW4 A;  2EN2 A;  4LOM A;  4ZYE A;  2EM6 A;  3EPH A;  1FNM A;  2WCC 3;  4KHP E;  3H1C A;  3PYD A;  3Q6M A;  4IZJ B;  4IFD C;  4WSP A;  2GHF A;  5C0X B;  4DPX A;  4LF6 I;  3HPZ A;  4DR3 I;  2NN6 E;  4BA2 A;  4USM A;  5KL4 A;  5F3W A;  4X62 E;  3C4B A;  4JI4 I;  3WU3 A;  2LJH A;  3MSW A;  3K85 A;  2C37 A;  1UDO A;  5A6K A;  4DV0 I;  2UXD I;  2EMA A;  1F2I G;  1S4E A;  1MEY C;  1OYS A;  1YFH A;  4P78 A;  5T6J A;  4DV7 E;  4OO1 B;  2L92 A;  2VF3 A;  2N3H A;  2V2Q A;  3ZZ0 A;  4F6N A;  2MKN A;  3P3C A;  2JT2 A;  2UXC E;  2E72 A;  3KWR A;  4X66 I;  2YTI A;  2MDG A;  2ZBK B;  5JEA A;  3P06 A;  4WXD A;  3L00 A;  2UU9 I;  1OYP A;  2ODR C;  4BHB A;  4DPY A;  2UUC E;  2IHR 1;  4FW7 A;  1P47 A;  2IER A;  2ADR A;  4NXN I;  2EM4 A;  2Z5E A;  3M6A A;  4DV5 I;  4DUY I;  2EMF A;  3U1Y A;  3RMP A;  4BC9 A;  2HHH I;  3LML A;  2JOX A;  1IBM E;  4BCA A;  2Z5B A;  2EOX A;  1X3C A;  4JI7 E;  4FWD A;  5KL7 A;  1Z5A A;  2EPM X;  3EPL A;  4JI3 E;  2IOQ A;  2EQ3 A;  4LFC E;  4ISA A;  4R2C A;  2RSM A;  1YYO A;  5JEA E;  2EP3 A;  5CFF E;  2VES A;  4LFB I;  1X5W A;  5AE1 A;  4B3R E;  2NN6 F;  2GQ0 A;  4OKG A;  3QT7 A;  4AQY I;  4JYA I;  4Z7Y A;  2F1D A;  1H7U A;  1N32 E;  1DQ3 A;  1U2R A;  1EH8 A;  3KZY A;  3M85 D;  2XEX A;  4L8N A;  1Y4U A;  2A2C A;  3AV0 A;  3ZM7 A;  2JXP A;  2Z5C A;  2EM8 A;  5AC5 A;  1IMU A;  4MYU A;  2DB2 A;  2NUE A;  5IXM B;  3CDI A;  2C38 A;  2Q2E B;  1XXE A;  2EPA A;  2BR2 B;  1STU A;  3HJC A;  2GLI A;  1KKH A;  2C39 A;  3QT5 A;  2OI2 A;  4URL A;  5C0X C;  1XNR I;  2DMI A;  3M7N G;  4JI1 I;  4MQY A;  1A1L A;  2JVA A;  4DPU A;  4BS9 A;  2NN6 B;  1WHN A;  4HAC B;  4QNK A;  2WNR A;  4QNJ A;  2RTX A;  3P3G A;  1XMQ I;  2L2N A;  1A1I A;  1Y6Z A;  2K7I A;  4FN5 A;  1X49 A;  5FLX C;  2JEA A;  2EOS A;  5LMN E;  4OO1 C;  2R42 A;  2O3Z A;  4MYT A;  3P76 A;  3ADL A;  4LF7 I;  4L5N C;  2PNZ B;  2JE6 A;  2CPN A;  4RH8 A;  2EJ4 A;  1AAY A;  4LTY A;  2YRH A;  1UIL A;  2FTX B;  4JV5 I;  2Q8U A;  5LLQ A;  1DI2 A;  4WUC A;  4WSG A;  5JEA F;  4B3T E;  1T38 A;  4FW9 A;  4JI0 E;  2VE7 C;  1GZ6 A;  4I8O A;  1ZM9 A;  2RPC A;  4LPF A;  2HFS A;  4WFT A;  2M4I A;  4J8Z A;  4DR2 E;  4BA2 B;  2R1F A;  2IES A;  4B3M I;  2V88 A;  2EPL X;  2LMZ A;  1Z0C A;  3GLL A;  1FJG I;  1YYK A;  1Z1B A;  3THO B;  4NXM E;  1X48 A;  3HPS A;  1HNX E;  2C37 B;  4WPY A;  2LUP B;  2EOO A;  1EA6 A;  2F4V I;  4PU9 A;  2EPN A;  2ENH A;  3F6G A;  2HK2 A;  2EOF A;  4IS1 C;  2EOI A;  4BC7 A;  4U3B A;  4IZJ D;  4K0K I;  4LF6 E;  4DR3 E;  2DLK A;  2KON A;  5JEA B;  1A1K A;  1PKP A;  4YHH I;  2LE2 A;  1ELO A;  5C0X D;  4JI4 E;  1N36 I;  1USU A;  4DV0 E;  1T4N A;  2JPA A;  2EMX A;  2UXD E;  4IZK A;  4O4K A;  2MKD A;  4DMI A;  1EH7 A;  4KWY A;  1XHK A;  1T4O A;  2LUQ A;  4DV1 I;  4DR5 I;  5A6A A;  2HKE A;  4X66 E;  4R2R A;  4HXZ A;  4M0V A;  2PO0 A;  4PRV A;  4LU9 A;  5DNY A;  2Z5B B;  3EQ1 A;  3DD6 A;  2UU9 E;  1Y60 A;  5LMU I;  2X7I A;  1J5E I;  2ENC A;  3V2U C;  2V85 A;  5IT9 Q;  2I13 A;  2YU5 A;  2EPX A;  2LV2 A;  1ZXM A;  1PJS A;  3KZZ A;  2YU8 A;  2L8T A;  2HK3 A;  4DV5 E;  3AUZ A;  4DUY E;  4F54 A;  4IJD A;  2L2M A;  1A6F A;  2HHH E;  3THN A;  2EQ1 A;  2V87 A;  1ZXN A;  4DV3 I;  2UXB I;  2CT1 A;  2YTF A;  1OYR A;  2EMZ A;  4KQV A;  3B78 A;  4MU3 A;  5LL6 R;  2E5L I;  3U1K A;  1DGC A;  2WBS A;  2GO3 A;  4X65 I;  2YSO A;  2JEB A;  2Z5C B;  4PRX A;  3B8H A;  5DRR A;  2YPN A;  4LFB E;  2C38 B;  4O5G A;  3IWC A;  2C39 B;  3TQM A;  4AQY E;  4JYA E;  1ZAA C;  2EFG A;  3PYG A;  4AIM A;  2ZM6 I;  3HUL A;  4MDT A;  1KIJ A;  1A1J A;  1ZBT A;  2EL6 A;  2EOJ A;  1KJK A;  1FKA E;  2RSI A;  4OZE A;  2O1V A;  2V83 A;  2WNR B;  5GMD A;  1K47 A;  2ELY A;  3F6H A;  2WBT A;  2V34 A;  2EPC A;  3BF2 A;  2L3J A;  2JEA B;  4ZYG A;  4DR7 I;  1AH5 A;  3PS2 A;  4DR4 E;  4DUZ I;  2JE6 B;  1XNR E;  3J81 Q;  1E3P A;  1NZ0 A;  4JI1 E;  1Z0B A;  2EN7 A;  4FW5 A;  2EMW A;  3DJW A;  3T1Y I;  4WYQ B;  1UEK A;  3ADG A;  5GME A;  2ELZ A;  1XMQ E;  2HKJ A;  4LCG A;  1TN9 A;  3OTO I;  5A6J A;  1Z0T A;  2NN6 D;  2K4V A;  2R3V A;  1O0W A;  5A6B D;  1Z0V A;  5A2Q Q;  4YY3 I;  2CZ9 A;  2VQF I;  3MHS C;  4IFD A;  1Z5C A;  5DNX A;  2EOE A;  2BBG A;  2EPU A;  4OOG C;  4JV5 E;  2X36 A;  2G7H A;  1EH6 A;  4P52 A;  4IS9 A;  1HNZ I;  4EMD A;  4HY1 A;  5BR8 I;  3D4J A;  1KYQ A;  4WXC A;  2J7K A;  1T4L B;  2I9I A;  4GKJ I;  1RHY A;  1GTK A;  4USK A;  4B3M E;  3P3E A;  3H09 A;  1FJG E;  4LF9 E;  2EN6 A;  2YRM A;  3JAM C;  2BA1 G;  2WP8 A;  3BBG A;  4RPF A;  2VQE I;  4IZK B;  2F4V E;  3LTO A;  2LJP A;  1Y4S A;  2YTE A;  3VYX A;  2EMH A;  1FI4 A;  2JY9 A;  4R2P A;  4R2Q A;  4K0K E;  2YTQ A;  1FWL A;  2V8Q B;  2AJ4 A;  4UTG A;  4XTJ A;  2PO0 B;  2YTO A;  1Z59 A;  3JTZ A;  4YHH E;  2O1W A;  4X9J A;  1YYW A;  3GME A;  4HYM A;  1PIE A;  1Z0E A;  5JEA D;  1IBL I;  4Q35 B;  1N36 E;  1RQ0 A;  1ZM4 A;  1GQE A;  2B7V A;  5AC4 A;  4DV1 E;  2CSH A;  2DLQ A;  1N34 I;  2JOB A;  4DR5 E;  3B82 A;  2EM5 A;  3ZOQ B;  5IV8 B;  3ADJ A;  2LJU A;  1D6T A;  1RC7 A;  1G2D C;  5K36 A;  2HGH A;  5DRO A;  1ZBQ A;  2GO4 A;  4O24 A;  2EL5 A;  1J5E E;  5KL6 A;  1HNW I;  3J7Y p;  5LMU E;  2B7T A;  4P7D A;  2B3T B;  5KL5 A;  4LF8 I;  2L6M A;  3C6M A;  2JEB B;  2RQL A;  3J80 C;  4X64 I;  2CVE A;  2EMG A;  2BB8 A;  1BKN A;  1Y5Y A;  4Q28 A;  4F9C B;  1ZM3 A;  2PNL A;  1MG7 A;  2UXB E;  4JI8 E;  3PS3 A;  1J26 A;  3BGH A;  2JR1 A;  4WUD A;  1HR0 I;  1TF3 A;  4IFD F;  4JI2 E;  4LF5 I;  2E5L E;  4X65 E;  1MX0 A;  2EQ0 A;  2YT4 A;  1WJP A;  4AID A;  5K36 E;  1YUJ A;  1RRE A;  3QT8 A;  2PO2 A;  4GEQ B;  3PS1 A;  4JI6 I;  2CTD A;  1N33 I;  4LCH A;  2O1T A;  1Z0G A;  3K17 A;  5FLX Q;  2M9A A;  4HEI A;  4ZVI A;  2EMI A;  1IQO A;  4N3O A;  5KL2 A;  1Z5B A;  2KHX A;  3QG5 C;  2MC5 A;  4J3D A;  3V5R A; 
#chains in the Genus database with same CATH homology
 4DR7 E;  4OX9 I;  1KTV A;  4JI3 I;  4DUZ E;  2YZT A;  1NHI A;  1WUU A;  2M1S A;  2V2Z A;  3ADI A;  1FWK A;  2DSY A;  2L3C A;  4DV6 I;  1HK7 A;  4DR6 I;  4LFA I;  2GS8 A;  3WU6 A;  4YY3 E;  2VQF E;  4X8W A;  2O1U A;  3C4T A;  3LPS A;  4NXN E;  1EI1 A;  4LF4 I;  4FWH A;  1HNZ E;  5BR8 E;  4BMJ A;  3HTX A;  4DU7 A;  2NPF A;  3FIG A;  1XNQ I;  1SR9 A;  1H72 C;  2NUG A;  2WW4 A;  3Q6N A;  2RS6 A;  3JU0 A;  3OML A;  3K1J A;  1OJ4 A;  5AE3 A;  2L33 A;  5AAS A;  3ZKD A;  1QU6 A;  1NHJ A;  4DV4 I;  3HXL A;  1IBL E;  4DXL A;  1H7S A;  1H74 A;  1USV A;  3DF6 A;  2V86 A;  1HNW E;  4JG4 A;  3H4L A;  1I94 I;  4JI5 I;  2V89 A;  4LF7 E;  3HQ1 A;  4LF8 E;  2LBS B;  4X64 E;  4DPW A;  1WXR A;  2UUB I;  1XMO I;  4B3S I;  2MDR A;  4R1F A;  1RR9 A;  2CG9 A;  1NHH A;  4DV2 I;  1HR0 E;  3IWD A;  4LF5 E;  3WU5 A;  3J7A G;  3ZZU A;  1IBK I;  2F8B A;  3VK6 A;  2A2D A;  2V2V A;  4TUG A;  2EWL A;  4GKK I;  4M1K A;  3CWV A;  3T1H I;  2ZIT A;  4M30 A;  4ED4 A;  4JI6 E;  4M2Z A;  1N33 E;  2N3G A;  3LLH A;  4WUB A;  5FWK A;  4DR1 I;  5IWA I;  2L2K B;  2IOP A;  3Q1Q A;  4R03 A;  4OX9 E;  3GON A;  1B63 A;  3IWB A;  1N0U A;  4DKK A;  4DU8 A;  3LNU A;  2DMY A;  2KOU A;  2NA2 A;  2MC6 A;  3ZZT A;  2B9D A;  2UUA I;  3QT6 A;  3K6Q A;  4DV6 E;  4DR6 E;  4KHP I;  4LFA E;  4UT4 A;  2FGG A;  2BM1 A;  3JAM Q;  4BBY A;  3P1X A;  4X62 I;  2RS7 A;  2BV3 A;  2V8P A;  4LF4 E;  4IZJ A;  2NUF A;  4DV3 E;  4DV7 I;  4FWG A;  3J7A M;  1EKZ A;  2M7Q A;  2UXC I;  4TUI A;  2ODR D;  1XNQ E;  2HFU A;  2DEJ A;  2ZM6 E;  2UUC I;  2PNM A;  2LRS A;  2VF1 A;  2BM0 A;  2WZO A;  1WHQ A;  1DAR A;  4F9A B;  1PVG A;  1IBM I;  4Z7C A;  3J80 Q;  4DV4 E;  4JI7 I;  4LFC I;  3PYE A;  4B3R I;  5IT9 C;  4LF9 I;  2JWO A;  3T1Y E;  2EZ6 A;  4KZS A;  4P7A A;  3OTO E;  1N32 I;  2LTS A;  2H36 X;  1I94 E;  4JI5 E;  2E1R A;  1X47 A;  3ZKB A;  3PRY A;  2UUB E;  1XMO E;  3VYY A;  4B3S E;  1VIS A;  4DV2 E;  4DPT A;  4GKJ E;  5L3J A;  3PYF A;  1IBK E;  5LMN I;  1YZ9 A;  1KVK A;  2VQE E;  4F9B B;  4GKK E;  1H73 A;  2LTR A;  2CGE A;  3T1H E;  1Z0W A;  3WU4 A;  3J81 C;  1UHZ A;  4HAC A;  4B3T I;  1MU5 A;  4DR1 E;  5IWA E;  1B62 A;  2E1M A;  1N0V C;  4JI0 I;  5ADZ A;  4JI8 I;  2DIX A;  4I3H A;  5AE2 A;  1S16 A;  4DR2 I;  2DEI A;  4JI2 I;  1ZM2 A;  4R8O A;  1QZR A;  1N34 E;  3F0N A;  5A2Q C;  2FV4 B;  4NXM I;  2UUA E;  1HNX I;  1FNM A;  4IZJ B;  4KHP E;  3PYD A;  3Q6M A;  4WSP A;  4DPX A;  4LF6 I;  3HPZ A;  4DR3 I;  4USM A;  5F3W A;  4X62 E;  3C4B A;  4JI4 I;  3WU3 A;  2LJH A;  3MSW A;  3K85 A;  4DV0 I;  2UXD I;  1S4E A;  4P78 A;  5T6J A;  4DV7 E;  2L92 A;  2VF3 A;  2N3H A;  2V2Q A;  3ZZ0 A;  4X66 I;  2UXC E;  3KWR A;  2ZBK B;  3P06 A;  2UU9 I;  2ODR C;  4DPY A;  2UUC E;  2IHR 1;  4NXN I;  2Z5E A;  4DV5 I;  3M6A A;  4DUY I;  3RMP A;  4BC9 A;  2HHH I;  3LML A;  2JOX A;  1IBM E;  4BCA A;  2Z5B A;  4JI7 E;  4FWD A;  1Z5A A;  4JI3 E;  2IOQ A;  4LFC E;  2RSM A;  1YYO A;  5CFF E;  4LFB I;  5AE1 A;  4B3R E;  2GQ0 A;  3QT7 A;  4AQY I;  4JYA I;  4Z7Y A;  1H7U A;  1N32 E;  1DQ3 A;  1U2R A;  2XEX A;  4L8N A;  1Y4U A;  2A2C A;  3AV0 A;  3ZM7 A;  2Z5C A;  4MYU A;  2DB2 A;  2NUE A;  2Q2E B;  4DR4 I;  1STU A;  3HJC A;  1KKH A;  3QT5 A;  4URL A;  1XNR I;  2OI2 A;  4JI1 I;  2JVA A;  4DPU A;  4BS9 A;  4HAC B;  1WHN A;  2RTX A;  1XMQ I;  2L2N A;  1Y6Z A;  4FN5 A;  1X49 A;  5FLX C;  5LMN E;  2R42 A;  4MYT A;  3ADL A;  4LF7 I;  4L5N C;  2CPN A;  4JV5 I;  4LTY A;  1UIL A;  2FTX B;  1DI2 A;  4WUC A;  4B3T E;  4FW9 A;  4JI0 E;  2VE7 C;  1GZ6 A;  4I8O A;  1ZM9 A;  2HFS A;  4WFT A;  2M4I A;  4J8Z A;  4DR2 E;  4B3M I;  2V88 A;  2LMZ A;  1Z0C A;  1FJG I;  1YYK A;  4NXM E;  1X48 A;  3HPS A;  1HNX E;  4WPY A;  2LUP B;  1EA6 A;  2F4V I;  4PU9 A;  3F6G A;  2HK2 A;  4BC7 A;  4K0K I;  4IZJ D;  4LF6 E;  4DR3 E;  2KON A;  1PKP A;  4YHH I;  2LE2 A;  1ELO A;  4JI4 E;  1N36 I;  1USU A;  4DV0 E;  1T4N A;  2UXD E;  4IZK A;  4DMI A;  1XHK A;  4DV1 I;  1T4O A;  2LUQ A;  4DR5 I;  2HKE A;  4X66 E;  4HXZ A;  4M0V A;  4PRV A;  4LU9 A;  5DNY A;  2Z5B B;  1J5E I;  2UU9 E;  5LMU I;  2X7I A;  3V2U C;  2V85 A;  5IT9 Q;  1ZXM A;  2L8T A;  2HK3 A;  4DV5 E;  3AUZ A;  4DUY E;  4F54 A;  1A6F A;  2L2M A;  2HHH E;  2V87 A;  1ZXN A;  4DV3 I;  2UXB I;  4KQV A;  3B78 A;  5LL6 R;  2E5L I;  4X65 I;  2Z5C B;  4PRX A;  3B8H A;  4LFB E;  3IWC A;  2EFG A;  4AQY E;  4JYA E;  3PYG A;  2ZM6 I;  3HUL A;  1KIJ A;  1ZBT A;  1FKA E;  2O1V A;  2V83 A;  5GMD A;  1K47 A;  3F6H A;  2V34 A;  2L3J A;  4DR7 I;  4DR4 E;  4DUZ I;  3J81 Q;  1XNR E;  1NZ0 A;  4JI1 E;  1Z0B A;  3DJW A;  3T1Y I;  4WYQ B;  1UEK A;  3ADG A;  5GME A;  2HKJ A;  1XMQ E;  3OTO I;  1Z0T A;  2K4V A;  2R3V A;  1O0W A;  1Z0V A;  4YY3 I;  5A2Q Q;  2VQF I;  2CZ9 A;  1Z5C A;  4OOG C;  4JV5 E;  2X36 A;  2G7H A;  4P52 A;  1HNZ I;  4EMD A;  4HY1 A;  5BR8 I;  3D4J A;  2J7K A;  1T4L B;  4GKJ I;  4USK A;  4B3M E;  3H09 A;  1FJG E;  4LF9 E;  3JAM C;  4RPF A;  2VQE I;  4IZK B;  2F4V E;  3LTO A;  2LJP A;  1Y4S A;  3VYX A;  1FI4 A;  2JY9 A;  4K0K E;  2AJ4 A;  4XTJ A;  1FWL A;  4UTG A;  2V8Q B;  1Z59 A;  3JTZ A;  4YHH E;  2O1W A;  1YYW A;  4HYM A;  1PIE A;  1Z0E A;  1IBL I;  1N36 E;  1RQ0 A;  1ZM4 A;  1GQE A;  2B7V A;  4DV1 E;  1N34 I;  2JOB A;  4DR5 E;  3B82 A;  1D6T A;  3ZOQ B;  3ADJ A;  1RC7 A;  1ZBQ A;  1HNW I;  1J5E E;  3J7Y p;  5LMU E;  2B7T A;  4P7D A;  2B3T B;  4LF8 I;  2L6M A;  3J80 C;  4X64 I;  1BKN A;  4Q28 A;  4F9C B;  1ZM3 A;  2PNL A;  1MG7 A;  2UXB E;  4JI8 E;  1J26 A;  2JR1 A;  4WUD A;  1HR0 I;  4JI2 E;  4LF5 I;  2E5L E;  4X65 E;  1MX0 A;  2YT4 A;  1RRE A;  3QT8 A;  4GEQ B;  4JI6 I;  1N33 I;  2O1T A;  1Z0G A;  3K17 A;  5FLX Q;  4ZVI A;  4N3O A;  1Z5B A;  2KHX A;  2MC5 A;  3V5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...