4JI8E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8E02
1K47A 4DV0E 3WU3A 2UXBI 3PYEA 2F4VI 4NXMI 3VYXA 1XHKA 5LMUE 4DV3I 3WU6A 1OJ4A 4ZVIA 2HFUA 4JI3I 1N34E 4X66E 5BR8I 1XNRI 1J5EE 1XNQE 1FWLA 2CZ9A 3WU5A 4K0KE 4LFAE 4DKKA 4JV5E 3H4LA 4JI1E 4JI5E 1WHQA 1FKAE 4NXNE 2E1RA 2UXDE 1IBMI 2V8PA 4JYAI 1RQ0A 1UILA 4JI6E 1MX0A 1HNXI 2E5LI 4JI2E 2VF3A 2EFGA 4B3RI 4OX9I 4DUZI 2RTXA 2N3GA 4WUCA 1HR0I 2LTRA 2UUCE 5IWAE 4LFCI 2V2QA 1J26A 4PU9A 2UUAE 3OTOI 1HNWI 1FJGI 1N33I 3J7Yp 1WHNA 4WYQB 1VISA 4DR1I 4LFBI 2B7TA 4X62E 2EZ6A 3C4BA 3V5RA 3QT6A 3WU4A 4DR6I 4DV2I 2VQEE 4B3MI 5A2QQ 4JI8I 1KKHA 1MG7A 1A6FA 2CPNA 1X47A 4YY3E 1KIJA 2L3JA 2LUPB 2V2ZA 4B3TI 2NA2A 4LF8E 2R42A 4GKKI 1ZM4A 1N36I 4B3SE 1RC7A 3PYDA 3QT8A 4DV6E 1T4LB 4DR4E 4USKA 1U2RA 1ZXMA 4DPWA 3T1HI 4KHPE 4I3HA 1N32E 4X64E 1YYOA 1Z0WA 1EI1A 4DV7I 1T4OA 4M2ZA 3ZZTA 4LF7I 4FWDA 2UU9I 2GS8A 4DV1E 4USMA 1RREA 2NUGA 4DV5E 4HY1A 3B78A 4DUYE 4DXLA 2UXCI 4DV4I 2DMYA 2UXBE 1EKZA 5LL6R 1Z5AA 2F4VE 1Z5BA 4P7AA 1NHHA 5GMEA 4AQYE 1IBKI 1H7UA 4DV3E 4PRVA 1Z5CA 2DIXA 4JI3E 3PYGA 5BR8E 1XNRE 4DR3I 2J7KA 1XMOI 3ZKDA 2OI2A 2UUBI 2Q2EB 3T1YI 2L2KB 3V2UC 2A2DA 3J80Q 4LF4I 1IBME 1X48A 4GKJI 1PIEA 1X49A 2HKJA 2DB2A 4WFTA 4Z7YA 2E5LE 4DR7I 2L2NA 2X36A 4LF9I 1ZM9A 3JAMC 2V2VA 2LTSA 3J81C 1WUUA 4B3RE 4DUZE 3ADGA 1HR0E 1YYKA 3F0NA 4JV5I 1IBLI 3OTOE 4M30A 2JVAA 4WUBA 2VQFI 1HNZI 3J80C 3K1JA 1H72C 2BV3A 1N33E 1GQEA 3K17A 5LMNI 4DR1E 4LFBE 1BKNA 1RR9A 4DV2E 3M6AA 4FWGA 4B3ME 5IT9Q 2HHHE 4JI8E 4DPUA 4Z7CA 1Z0EA 2ZM6I 1FI4A 2DEIA 5IWAI 4WUDA 4LF5I 4FN5A 4UT4A 4DR5I 4HXZA 4B3TE 4GKKE 3PYFA 1N36E 2NPFA 1S4EA 4LF6E 3Q1QA 1O0WA 2XEXA 3ZKBA 2R3VA 1FNMA 4JI0I 3QT5A 2RSMA 2WW4A 5FLXQ 4JI7I 5IT9C 1NZ0A 2X7IA 2AJ4A 2LUQA 3CWVA 4XTJA 4DPXA 4X65I 4DV7E 4LF7E 2V34A 4FWHA 1H7SA 2LRSA 2LJHA 5CFFE 2UXCE 4UTGA 4DR4I 4JI4I 1IBKE 1UEKA 2B3TB 1XMQI 4NXME 3GONA 4DR2I 3B82A 5FLXC 2JY9A 1N32I 1T4NA 3JAMQ 4YHHI 3J81Q 2ZITA 1S16A 4ED4A 1XMOE 2ZBKB 1STUA 2UUBE 3T1YE 1NHJA 1UHZA 4DPYA 1N0VC 4LF4E 1Z0TA 1Z0BA 4DPTA 1D6TA 1KVKA 1Z0CA 4GKJE 1B62A 1B63A 4M1KA 2A2CA 4URLA 4DUYI 2LJPA 4JYAE 1I94I 4MYUA 2N3HA 3QT7A 4DV0I 4DR7E 4AQYI 3LLHA 2HFSA 1HNXE 4LF9E 1ELOA 1DARA 1DI2A 5LMUI 2RS7A 4RPFA 1MU5A 1N34I 4KQVA 4X66I 4OX9E 3ADIA 1J5EI 1XNQI 1IBLE 4HACA 2VQFE 2LBSB 1HNZE 4LFAI 4K0KI 4LFCE 1PKPA 3ADLA 4JI1I 4DU7A 4JI5I 4NXNI 3C4TA 2UXDI 1Z0VA 1HNWE 1FJGE 5LMNE 1H73A 1QU6A 2BM1A 2KHXA 4JI6I 3LPSA 2BM0A 2NUEA 4FW9A 4JI2I 4DR6E 1ZXNA 2YT4A 2ZM6E 4X8WA 4P52A 4LF5E 2L3CA 2UUCI 4MYTA 4DR5E 2HK3A 4PRXA 1Z59A 1FWKA 2L33A 5GMDA 2UUAI 3ZM7A 1ZBTA 3LTOA 4EMDA 1NHIA 5L3JA 3ADJA 4X62I 4JI0E 2RS6A 2HHHI 4JI7E 4R1FA 4HYMA 2VQEI 2HKEA 3T1HE 4X65E 2MDRA 4DU8A 2DEJA 4YY3I 1YZ9A 1N0UA 2UU9E 2IHR1 4LF6I 4OOGC 4LF8I 1H74A 4B3SI 3J7AM 4DV6I 4JI4E 3ZZUA 4DV4E 1Z0GA 2L2MA 3J7AG 1XMQE 1KTVA 4DR2E 3VYYA 2NUFA 5A2QC 3P1XA 1EA6A 4YHHE 4KHPI 4X64I 4DR3E 4JG4A 1ZM3A 1QZRA 2HK2A 1PVGA 2B7VA 3LNUA 4DV1I 1YYWA 3B8HA 3HTXA 3D4JA 1ZM2A 3ZZ0A 4DV5I 3HULA 1I94E 4HACB
chains in the Genus database with same CATH superfamily
1K47A 2EM8A 3K6QA 2RPCA 4DV0E 3WU3A 2EOMA 2UXBI 3PYEA 2EPRA 1UDSA 1OYSA 2F4VI 4NXMI 2LV2A 1Z1BA 5TSEA 2Z5CA 3VYXA 1XHKA 4M9VC 5LMUE 5AE3A 4DV3I 1A1GA 3WU6A 3THOB 1TN9A 2EMBA 5T6JA 2F8BA 1OJ4A 4BA2A 4OO1A 4ZVIA 2HFUA 4JI3I 1N34E 4KWYA 5EKWA 2YTEA 3IWDA 4X66E 5BR8I 1XNRI 2EN1A 1J5EE 2HGHA 1XNQE 1FWLA 4IFDE 2CZ9A 4FK5C 4ZYHA 2EM7A 1T39A 3JU0A 2DGCA 3OMLA 4LFAE 4K0KE 2VESA 3K85A 1PJQA 4DKKA 4JV5E 3H4LA 5DNYA 4JI1E 2JYAA 2WP8B 4JI5E 2EMFA 1UDOA 2PO0A 1WHQA 1FKAE 4NXNE 3P3CA 2YU5A 4LCHA 2E1RA 2YTDA 1ZR9A 2UXDE 3L00A 2IOQA 1IBMI 3EPHA 2V8PA 4KZSA 4JYAI 4IS9A 3M7NG 2FGGA 1RQ0A 1UILA 2PO1A 3HQ1A 2EOZA 4JI6E 1MX0A 1HNXI 1P42A 4HTGA 4FW5A 2Z5BA 2E5LI 4JI2E 2JT2A 1N3GA 4F2JC 4L8NA 2V83A 2VF3A 2O1TA 2EQ0A 2EOQA 3PS3A 4IZJA 4P7DA 2EFGA 4B3RI 2GLIA 4OX9I 4DUZI 2RTXA 2CGEA 2N3GA 5LLQA 2BR2A 4WUCA 3IWCA 2YZTA 1HR0I 2LTRA 2RQLA 4ZYDA 4GZNC 2UUCE 4OKGA 3Q6MA 2CSHA 2BB8A 2YSPA 5ADZA 5IWAE 1J26A 2V2QA 4LFCI 2O1UA 4AM3A 2EMXA 4PU9A 2UUAE 3OTOI 1UDQA 2MKNA 4U3DA 4R2CA 2EP3A 2V87A 2JEAB 1NCSA 1FJGI 4WSGA 1HNWI 5K36E 1RHYA 1N33I 2MC5A 4IFDC 4BC9A 3J7Yp 3MSWA 1OYRA 1WHNA 3DF6A 4WYQB 2EQ1A 4TUGA 1VISA 4DR1I 1Y4SA 3U1YA 4LFBI 2VRDA 4OO1D 2B7TA 4X62E 2V8QB 2EZ6A 5JEAE 5K36D 3C4BA 3V5RA 2EOIA 3QT6A 4HEIA 1L4SA 3EQ1A 2C39B 3WU4A 4DR6I 4DV2I 2F1DA 5JEAD 3KZZA 2VQEE 4B3MI 2V86A 5A2QQ 4JI8I 4LU9A 1P47A 1KKHA 1MG7A 2JE6B 2K4VA 2PO2B 1A6FA 2JWOA 2CTDA 2CPNA 1X47A 4YY3E 1KIJA 1KYQA 3BBGA 1HK7A 2R76A 2EMIA 2L3JA 2FV4B 5C0XA 2LO3A 1RMDA 2LUPB 2EPOA 2V2ZA 2EM9A 2NA2A 2EL6A 4LF8E 2R42A 4B3TI 4GKKI 5FWKA 3C6MA 1ZM4A 1N36I 4B3SE 1RC7A 3P06A 3PYDA 3QT8A 4IZJD 4DV6E 2LT7A 1T4LB 2MDGA 4NHRA 1EH6A 4DR4E 2DMIA 4USKA 3VK6A 3C6KA 4IS1C 1U2RA 2LMZA 1ZXMA 4DPWA 5K36C 2YPNA 3T1HI 5K36F 3QG5C 2EORA 4KHPE 4I3HA 4AIDA 1N32E 3M85D 4X64E 2JOXA 2EN3A 1YYOA 1R6LA 1Z0WA 5JEAC 5JEAF 2YRKA 1EI1A 2Z5CB 2NN6E 1T4OA 4M2ZA 4DV7I 3ZZTA 1E3HA 3HXLA 2C37B 2CVEA 4LF7I 4FWDA 2UU9I 5A6AA 2O3ZA 2GS8A 4DV1E 5ELWA 4USMA 2RSIA 2KOUA 2VE7C 5K36B 4P78A 1RREA 2NUGA 2G7HA 4DV5E 1JK1A 2M4IA 4O24A 3B78A 3P3EA 4HY1A 3WU5A 4BA1A 4DUYE 1A1IA 5KL7A 4DXLA 2UXCI 4LOMA 4DV4I 4FW3A 2DMYA 2K7IA 3KZYA 1A1HA 2ENAA 5LL6R 1EKZA 2UXBE 2CG9A 2GQ0A 5JEAB 1Z5AA 2F4VE 1Z5BA 2LE2A 4P7AA 2JOBA 1NHHA 5GMEA 4TUIA 1X6EA 2E72A 4AQYE 1IBKI 3ZOQB 2L6MA 1H7UA 4DV3E 4PRVA 5DRRA 2EOJA 2L8TA 1Z5CA 2JEBA 2H36X 2PO1B 2WBUA 2EOEA 2DIXA 4Q28A 4JI3E 3PYGA 5BR8E 1XNRE 4DR3I 2EPNA 2J7KA 3EPKA 1Y60A 1XMOI 3ZKDA 2OI2A 2GPIA 2UUBI 2FTXB 1AH5A 2Q2EB 3T1YI 1E3PA 2IOPA 2L2KB 2JEAA 3HKMA 3Q6NA 3V2UC 2A2DA 4IZJB 3J80Q 4LF4I 5IV8B 1IBME 1IQSA 1X48A 2BR2B 4GKJI 1PIEA 1EH7A 1X49A 2JXPA 4WX9A 2NN6C 2NN6F 2HKJA 2DB2A 4R8OA 4WFTA 4QNKA 2E5LE 1YPNA 1ZU1A 1NEIA 2DLQA 2EJ4A 2L2NA 4Z7YA 2X36A 4MQYA 4DR7I 1GTKA 4N4RB 4LF9I 2EOSA 2EN2A 1ZM9A 3JAMC 2V2VA 2LTSA 3J81C 1TF6A 3CDJA 4WPYA 1QNTA 1WUUA 4B3RE 2J7JA 2ODRD 4DUZE 1F2IG 2NN6B 3ADGA 2PNMA 1HR0E 1YYKA 1YUJA 2EOOA 3F0NA 4JV5I 1IBLI 2EPXA 3OTOE 4M30A 2JVAA 4MU4A 4WUBA 2BA0G 2VQFI 1HNZI 2I9IA 4MU1A 5AE2A 2LJUA 3J80C 2JPAA 3K1JA 5DROA 4R03A 1H72C 4QNJA 2EPAA 2BV3A 1N33E 1GQEA 3K17A 3GLLA 4OO1E 5LMNI 4DR1E 1WXRA 2EM3A 2EPUA 1MEYC 4LFBE 1G2DC 2WBTA 2EM2A 4MLVA 1BKNA 4IZKB 1RR9A 4GEQB 4DV2E 3B4TA 3M6AA 2V88A 2WP8A 4FWGA 4I8OA 4B3ME 5IT9Q 2HHHE 4JI8E 5KL4A 1ZBQA 4DPUA 5DRPA 4Z7CA 2D9HA 3L7ZB 2J65A 2IESA 2EE8A 1Z0EA 2ZM6I 1FI4A 2DEIA 1SR9A 1BBGA 5IWAI 1DQ3A 2BBGA 4WUDA 1WRJA 4LF5I 3P3GA 4FN5A 5A6KA 2EMZA 4UT4A 4DR5I 4HXZA 3F6GA 4B3TE 4GKKE 3PYFA 1N36E 2NPFA 1S4EA 4LF6E 5EL9A 3Q1QA 1O0WA 1Y6ZA 5IXMB 3M7ND 2XEXA 4AIMA 3ZKBA 2MKDA 2R3VA 1FNMA 1B69A 2MC6A 4RHBB 4IJDA 4F6MA 2YU8A 4JI0I 2DRPA 3QT5A 4GQUA 3TQMA 2WNRA 2RSMA 2WW4A 2PNZB 5FLXQ 2L92A 1UBDC 5IT9C 4JI7I 1NZ0A 4OO1C 4MLQA 4O4KA 2LUQA 2AJ4A 2X7IA 3CWVA 4XTJA 4LPFA 3HPSA 3H1CA 5F3WA 4DPXA 4LCFA 3GMEA 4X65I 2EMGA 2ELYA 4RH8A 4DV7E 1YH8A 5KL6A 4FW7A 4LF7E 2V34A 4BS9A 1YFHA 2WCC3 4ZYGA 2C39A 4FWHA 4F9BB 3LMLA 2EM0A 3EPLA 1YSAC 2EOFA 2GO3A 1H7SA 1BB8A 1XXEA 4BA2B 2LRSA 2LJHA 4OO1B 3DJWA 4LTYA 5CFFE 3CDIA 2UXCE 1Y5YA 4UTGA 3UK3C 3FIGA 1Y4UA 2GO4A 2JE6A 4DR4I 4IFDA 5KL3A 4WXDA 2EPMX 1AAYA 2PO2A 1G2FC 4JI4I 4LCGA 3P76A 5DNLA 2YTQA 3THNA 5KL2A 1IBKE 2EMCA 2PO0B 1UEKA 2B3TB 2EOYA 1XMQI 4NXME 3GONA 4OO1F 2E1MA 5C0XE 4DR2I 5FLXC 5KL5A 3B82A 2JY9A 1N32I 4O43A 1T4NA 3JAMQ 4L5NC 2WBSA 4YHHI 3J81Q 2ZITA 2EWLA 1S16A 4ED4A 5C0XD 2ELZA 2YTPA 1XMOE 1YHCA 2ZBKB 2BA1G 1STUA 2PRTA 2UUBE 3T1YE 1PJTA 2LVHA 1UHZA 2YTNA 1NHJA 2Z5BB 1UDNA 2EMWA 4DPYA 4J3DA 2GHFA 4MU3A 2A25A 1N0VC 4LF4E 2EN8A 1Z0BA 1Z0TA 4DPTA 2LCEA 1D6TA 2ENCA 1KVKA 1Z0CA 4R2EA 2ADRA 4GKJE 1B62A 1B63A 2A2CA 4M1KA 3U1KA 1X3CA 4URLA 2C38A 4DUYI 2ENHA 3MHHC 4BHBA 2LJPA 4JYAE 3MHSC 1USUA 1I94I 2DLKA 4MYUA 2N3HA 3RMPA 3QT7A 4DV0I 2EN7A 1X5WA 4DR7E 4AQYI 1EH8A 2O1VA 3LLHA 3PS2A 2EOHA 3EPJA 2C37A 1HNXE 4LF9E 2YTJA 2HFSA 2EL4A 1ELOA 1DARA 1DI2A 2YSOA 5LMUI 5AASA 1LLMC 2RS7A 4FW4A 5K36A 2HJJA 1A1JA 1UN6B 4RPFA 1A1FA 4DMIA 1MU5A 1N34I 4KQVA 4X66I 4OX9E 3ADIA 5JEAA 1J5EI 3HJCA 1XNQI 1SFEA 4IFDD 1IBLE 4HACA 2VQFE 2LBSB 1HNZE 4LFAI 4K0KI 3BIDA 4LFCE 5C0XC 1PKPA 4R2RA 3ADLA 5C0XF 4JI1I 4DU7A 4JI5I 4F9AB 4NXNI 3JTZA 4F54A 5DRQA 3C4TA 2UXDI 1Z0VA 3BF2A 2CT1A 1HNWE 1FJGE 5LMNE 1H73A 4OZEA 1QU6A 4R2PA 2NABA 2YTFA 3BGHA 2KONA 2BM1A 5AC5A 3KRNA 2B9DA 2KHXA 5A6BA 4WSPA 4JI6I 3LPSA 3F6HA 2EMKA 2BM0A 3H09A 2NUEA 4ISAA 3AV0A 5C0XB 4FW9A 4N3OA 4JI2I 2Z5EA 4DR6E 1TF3A 1ZXNA 4BHCA 2EMAA 2YT4A 3M85G 2EPKX 2I13A 2BA1D 1IMUA 4FW6A 2IERA 4M0VA 4BMJA 2Q8UA 4X8WA 2ZM6E 4P52A 1JK2A 4LF5E 2WNRB 2L3CA 2UUCI 4MYTA 4DR5E 4BCAA 2HK3A 3PRYA 1Z59A 4PRXA 2N8XA 1FWKA 2L33A 5GMDA 2YRMA 2UUAI 2ODRC 2AE8A 4X9JA 3ZM7A 4IFDF 1ZBTA 2EMHA 3LTOA 2YTOA 2O1WA 4EMDA 2EMYA 1NHIA 3GCMA 2VF1A 5L3JA 3ADJA 2NN6A 3NZKA 4R2AA 1PJSA 4J8ZA 2PNLA 4X62I 4JI0E 2EOXA 4BC7A 1GZ6A 2RS6A 2YWQA 4O5GA 2HHHI 4JI7E 4R1FA 1A1KA 4HYMA 5DNXA 2VQEI 5AC4A 1BBOA 2HKEA 4BA1B 4WXCA 3T1HE 4IFDB 1DGCA 1MGTA 4X65E 2YTGA 3M99B 2M1SA 4U3BA 2M7QA 2M9AA 2MDRA 2EL5A 1YUIA 2YTIA 4DU8A 2DEJA 5A69A 4IZKA 5A6BD 4YY3I 2WZOA 3KWRA 3AUZA 4BBYA 1YZ9A 3VHTB 2UU9E 1N0UA 2BA0D 2IHR1 2V85A 4R2QA 2JEBB 4LF6I 4OOGC 4LF8I 2V89A 1KJKA 1X6HA 2EM6A 2EPZA 1H74A 3L7ZA 4B3SI 3J7AM 2EN4A 4DV6I 4JI4E 1X6FA 2EM4A 3ZZUA 4DV4E 4F6NA 2EPPA 1Z0GA 1USVA 2L2MA 4ZYEA 3ECRA 5A6JA 3J7AG 1XMQE 3DD6A 2EM5A 4NBQA 4R2SA 4DR2E 1KTVA 3VYYA 2NUFA 1VI7A 2C38B 2EMLA 5A2QC 3P1XA 1PDAA 2R1FA 2YRHA 1EA6A 4YHHE 4F9CB 4KHPI 2EPCA 2EN6A 4X64I 4MDTA 4DR3E 2HC5A 4JG4A 3IWBA 1OYPA 2JP9A 4MU0A 1ZM3A 1QZRA 2HK2A 2NN6D 1T38A 1A1LA 2EQ3A 5AE1A 4Q35B 1PVGA 2B7VA 1R6MA 3LNUA 4DV1I 1WJPA 1YYWA 2DSYA 2PNZA 3B8HA 3HPZA 3HTXA 3D4JA 3UHMA 4R2DA 3PS1A 4NZVA 1IQOA 1ZAAC 1ZM2A 2EPLX 3ZZ0A 4DV5I 2JR1A 3HULA 1I94E 4HACB
chains in the Genus database with same CATH topology
1K47A 3K6QA 4DV0E 3WU3A 2UXBI 3PYEA 2F4VI 4NXMI 2Z5CA 3VYXA 1XHKA 5LMUE 5AE3A 4DV3I 3WU6A 5T6JA 2F8BA 1OJ4A 4ZVIA 2HFUA 4JI3I 1N34E 3IWDA 4X66E 5BR8I 1XNRI 1J5EE 1XNQE 1FWLA 2CZ9A 3JU0A 4K0KE 3OMLA 4LFAE 3K85A 3WU5A 4DKKA 4JV5E 3H4LA 5DNYA 4JI1E 4JI5E 1WHQA 1FKAE 4NXNE 2E1RA 2UXDE 2IOQA 1IBMI 2V8PA 4KZSA 4JYAI 2FGGA 1RQ0A 1UILA 3HQ1A 4JI6E 1MX0A 1HNXI 2Z5BA 2E5LI 4JI2E 4L8NA 2V83A 2VF3A 2O1TA 4IZJA 4P7DA 2EFGA 4B3RI 4OX9I 4DUZI 2RTXA 2CGEA 2N3GA 4WUCA 3IWCA 2YZTA 1HR0I 2LTRA 2UUCE 3Q6MA 5ADZA 5IWAE 2V2QA 4LFCI 1J26A 2O1UA 4PU9A 2UUAE 3OTOI 2V87A 1HNWI 1FJGI 1N33I 2MC5A 4BC9A 3J7Yp 3MSWA 1WHNA 3DF6A 4WYQB 4TUGA 1VISA 4DR1I 4LFBI 1Y4SA 2B7TA 4X62E 2V8QB 2EZ6A 3C4BA 3V5RA 3QT6A 3WU4A 4DR6I 4DV2I 2VQEE 4B3MI 2V86A 5A2QQ 4JI8I 4LU9A 1KKHA 1MG7A 2K4VA 1A6FA 2JWOA 2CPNA 1X47A 4YY3E 1KIJA 1HK7A 2L3JA 2FV4B 2LUPB 2V2ZA 4B3TI 2NA2A 4LF8E 2R42A 4GKKI 5FWKA 1ZM4A 1N36I 4B3SE 1RC7A 3P06A 3PYDA 3QT8A 4IZJD 4DV6E 1T4LB 4DR4E 4USKA 3VK6A 1U2RA 2LMZA 1ZXMA 4DPWA 3T1HI 4KHPE 4I3HA 1N32E 4X64E 2JOXA 1YYOA 1Z0WA 1EI1A 2Z5CB 4DV7I 1T4OA 4M2ZA 3ZZTA 3HXLA 4LF7I 4FWDA 2UU9I 2GS8A 4DV1E 4USMA 2KOUA 2VE7C 4P78A 1RREA 2NUGA 2G7HA 4DV5E 2M4IA 3B78A 4HY1A 4DUYE 4DXLA 2UXCI 4DV4I 2DMYA 2UXBE 2CG9A 5LL6R 1EKZA 2GQ0A 1Z5AA 2F4VE 1Z5BA 2LE2A 4P7AA 2JOBA 1NHHA 5GMEA 4TUIA 4AQYE 1IBKI 3ZOQB 2L6MA 1H7UA 4DV3E 4PRVA 2L8TA 1Z5CA 2H36X 2DIXA 4Q28A 4JI3E 3PYGA 5BR8E 1XNRE 4DR3I 2J7KA 1XMOI 3ZKDA 2OI2A 2UUBI 2FTXB 2Q2EB 3T1YI 2IOPA 2L2KB 3Q6NA 3V2UC 2A2DA 4IZJB 3J80Q 4LF4I 1IBME 1X48A 4GKJI 1PIEA 1X49A 2HKJA 2DB2A 4R8OA 4WFTA 4Z7YA 2E5LE 4DR7I 2L2NA 2X36A 4LF9I 1ZM9A 3JAMC 2V2VA 2LTSA 3J81C 4WPYA 1WUUA 4B3RE 2ODRD 4DUZE 2PNMA 3ADGA 1HR0E 1YYKA 3F0NA 4JV5I 1IBLI 3OTOE 4M30A 2JVAA 4WUBA 2VQFI 1HNZI 5AE2A 3J80C 3K1JA 4R03A 1H72C 2BV3A 1N33E 1GQEA 3K17A 5LMNI 4DR1E 1WXRA 4LFBE 1BKNA 4IZKB 1RR9A 4GEQB 4DV2E 3M6AA 2V88A 4FWGA 4I8OA 4B3ME 5IT9Q 2HHHE 4JI8E 1ZBQA 4DPUA 4Z7CA 1Z0EA 2ZM6I 1FI4A 2DEIA 1SR9A 5IWAI 1DQ3A 4WUDA 4LF5I 4FN5A 4UT4A 4DR5I 4HXZA 3F6GA 4B3TE 4GKKE 3PYFA 1N36E 2NPFA 1S4EA 4LF6E 3Q1QA 1O0WA 1Y6ZA 2XEXA 3ZKBA 2R3VA 1FNMA 2MC6A 4JI0I 3QT5A 2RSMA 2WW4A 5FLXQ 2L92A 4JI7I 5IT9C 1NZ0A 2X7IA 2AJ4A 2LUQA 3CWVA 4XTJA 3HPSA 5F3WA 4DPXA 4X65I 4DV7E 4LF7E 2V34A 4BS9A 4FWHA 4F9BB 3LMLA 1H7SA 2LRSA 2LJHA 3DJWA 4LTYA 5CFFE 2UXCE 4UTGA 3FIGA 1Y4UA 4DR4I 4JI4I 1IBKE 1UEKA 2B3TB 1XMQI 4NXME 3GONA 2E1MA 4DR2I 5FLXC 3B82A 2JY9A 1N32I 1T4NA 3JAMQ 4L5NC 4YHHI 3J81Q 2ZITA 2EWLA 1S16A 4ED4A 1XMOE 2ZBKB 1STUA 2UUBE 3T1YE 1NHJA 1UHZA 2Z5BB 4DPYA 1N0VC 4LF4E 1Z0TA 1Z0BA 4DPTA 1D6TA 1KVKA 1Z0CA 4GKJE 1B62A 1B63A 4M1KA 2A2CA 4URLA 4DUYI 2LJPA 4JYAE 1USUA 1I94I 4MYUA 2N3HA 3RMPA 3QT7A 4DV0I 4DR7E 4AQYI 2O1VA 3LLHA 2HFSA 1HNXE 4LF9E 1ELOA 1DARA 1DI2A 5LMUI 5AASA 2RS7A 4RPFA 4DMIA 1MU5A 1N34I 4KQVA 4X66I 4OX9E 3ADIA 1J5EI 1XNQI 3HJCA 1IBLE 4HACA 2VQFE 2LBSB 1HNZE 4LFAI 4K0KI 4LFCE 1PKPA 3ADLA 4JI1I 4DU7A 4JI5I 4F9AB 4NXNI 3JTZA 4F54A 3C4TA 2UXDI 1Z0VA 1HNWE 1FJGE 5LMNE 1H73A 1QU6A 2BM1A 2KONA 2B9DA 2KHXA 4WSPA 4JI6I 3LPSA 3F6HA 2BM0A 3H09A 2NUEA 3AV0A 4FW9A 4N3OA 4JI2I 2Z5EA 4DR6E 1ZXNA 2YT4A 4M0VA 4BMJA 4X8WA 2ZM6E 4P52A 4LF5E 2L3CA 2UUCI 4MYTA 4DR5E 4BCAA 2HK3A 3PRYA 1Z59A 4PRXA 1FWKA 2L33A 5GMDA 2UUAI 2ODRC 3ZM7A 1ZBTA 3LTOA 2O1WA 4EMDA 1NHIA 2VF1A 5L3JA 3ADJA 4J8ZA 2PNLA 4X62I 4JI0E 4BC7A 1GZ6A 2RS6A 2HHHI 4JI7E 4R1FA 4HYMA 2VQEI 2HKEA 3T1HE 4X65E 2M1SA 2M7QA 2MDRA 4DU8A 2DEJA 4IZKA 4YY3I 2WZOA 3KWRA 3AUZA 4BBYA 1YZ9A 2UU9E 1N0UA 2IHR1 2V85A 4LF6I 4OOGC 4LF8I 2V89A 1H74A 4B3SI 3J7AM 4DV6I 4JI4E 3ZZUA 4DV4E 1Z0GA 1USVA 2L2MA 3J7AG 1XMQE 1KTVA 4DR2E 3VYYA 2NUFA 5A2QC 3P1XA 1EA6A 4YHHE 4F9CB 4KHPI 4X64I 4DR3E 4JG4A 3IWBA 1ZM3A 1QZRA 2HK2A 5AE1A 1PVGA 2B7VA 3LNUA 4DV1I 1YYWA 2DSYA 3B8HA 3HPZA 3HTXA 3D4JA 1ZM2A 3ZZ0A 4DV5I 2JR1A 3HULA 1I94E 4HACB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K47 A;  4DV0 E;  3WU3 A;  2UXB I;  3PYE A;  2F4V I;  4NXM I;  3VYX A;  1XHK A;  5LMU E;  4DV3 I;  3WU6 A;  1OJ4 A;  4ZVI A;  2HFU A;  4JI3 I;  1N34 E;  4X66 E;  5BR8 I;  1XNR I;  1J5E E;  1XNQ E;  1FWL A;  2CZ9 A;  3WU5 A;  4K0K E;  4LFA E;  4DKK A;  4JV5 E;  3H4L A;  4JI1 E;  4JI5 E;  1WHQ A;  1FKA E;  4NXN E;  2E1R A;  2UXD E;  1IBM I;  2V8P A;  4JYA I;  1RQ0 A;  1UIL A;  4JI6 E;  1MX0 A;  1HNX I;  2E5L I;  4JI2 E;  2VF3 A;  2EFG A;  4B3R I;  4OX9 I;  4DUZ I;  2RTX A;  2N3G A;  4WUC A;  1HR0 I;  2LTR A;  2UUC E;  5IWA E;  4LFC I;  2V2Q A;  1J26 A;  4PU9 A;  2UUA E;  3OTO I;  1HNW I;  1FJG I;  1N33 I;  3J7Y p;  1WHN A;  4WYQ B;  1VIS A;  4DR1 I;  4LFB I;  2B7T A;  4X62 E;  2EZ6 A;  3C4B A;  3V5R A;  3QT6 A;  3WU4 A;  4DR6 I;  4DV2 I;  2VQE E;  4B3M I;  5A2Q Q;  4JI8 I;  1KKH A;  1MG7 A;  1A6F A;  2CPN A;  1X47 A;  4YY3 E;  1KIJ A;  2L3J A;  2LUP B;  2V2Z A;  4B3T I;  2NA2 A;  4LF8 E;  2R42 A;  4GKK I;  1ZM4 A;  1N36 I;  4B3S E;  1RC7 A;  3PYD A;  3QT8 A;  4DV6 E;  1T4L B;  4DR4 E;  4USK A;  1U2R A;  1ZXM A;  4DPW A;  3T1H I;  4KHP E;  4I3H A;  1N32 E;  4X64 E;  1YYO A;  1Z0W A;  1EI1 A;  4DV7 I;  1T4O A;  4M2Z A;  3ZZT A;  4LF7 I;  4FWD A;  2UU9 I;  2GS8 A;  4DV1 E;  4USM A;  1RRE A;  2NUG A;  4DV5 E;  4HY1 A;  3B78 A;  4DUY E;  4DXL A;  2UXC I;  4DV4 I;  2DMY A;  2UXB E;  1EKZ A;  5LL6 R;  1Z5A A;  2F4V E;  1Z5B A;  4P7A A;  1NHH A;  5GME A;  4AQY E;  1IBK I;  1H7U A;  4DV3 E;  4PRV A;  1Z5C A;  2DIX A;  4JI3 E;  3PYG A;  5BR8 E;  1XNR E;  4DR3 I;  2J7K A;  1XMO I;  3ZKD A;  2OI2 A;  2UUB I;  2Q2E B;  3T1Y I;  2L2K B;  3V2U C;  2A2D A;  3J80 Q;  4LF4 I;  1IBM E;  1X48 A;  4GKJ I;  1PIE A;  1X49 A;  2HKJ A;  2DB2 A;  4WFT A;  4Z7Y A;  2E5L E;  4DR7 I;  2L2N A;  2X36 A;  4LF9 I;  1ZM9 A;  3JAM C;  2V2V A;  2LTS A;  3J81 C;  1WUU A;  4B3R E;  4DUZ E;  3ADG A;  1HR0 E;  1YYK A;  3F0N A;  4JV5 I;  1IBL I;  3OTO E;  4M30 A;  2JVA A;  4WUB A;  2VQF I;  1HNZ I;  3J80 C;  3K1J A;  1H72 C;  2BV3 A;  1N33 E;  1GQE A;  3K17 A;  5LMN I;  4DR1 E;  4LFB E;  1BKN A;  1RR9 A;  4DV2 E;  3M6A A;  4FWG A;  4B3M E;  5IT9 Q;  2HHH E;  4JI8 E;  4DPU A;  4Z7C A;  1Z0E A;  2ZM6 I;  1FI4 A;  2DEI A;  5IWA I;  4WUD A;  4LF5 I;  4FN5 A;  4UT4 A;  4DR5 I;  4HXZ A;  4B3T E;  4GKK E;  3PYF A;  1N36 E;  2NPF A;  1S4E A;  4LF6 E;  3Q1Q A;  1O0W A;  2XEX A;  3ZKB A;  2R3V A;  1FNM A;  4JI0 I;  3QT5 A;  2RSM A;  2WW4 A;  5FLX Q;  4JI7 I;  5IT9 C;  1NZ0 A;  2X7I A;  2AJ4 A;  2LUQ A;  3CWV A;  4XTJ A;  4DPX A;  4X65 I;  4DV7 E;  4LF7 E;  2V34 A;  4FWH A;  1H7S A;  2LRS A;  2LJH A;  5CFF E;  2UXC E;  4UTG A;  4DR4 I;  4JI4 I;  1IBK E;  1UEK A;  2B3T B;  1XMQ I;  4NXM E;  3GON A;  4DR2 I;  3B82 A;  5FLX C;  2JY9 A;  1N32 I;  1T4N A;  3JAM Q;  4YHH I;  3J81 Q;  2ZIT A;  1S16 A;  4ED4 A;  1XMO E;  2ZBK B;  1STU A;  2UUB E;  3T1Y E;  1NHJ A;  1UHZ A;  4DPY A;  1N0V C;  4LF4 E;  1Z0T A;  1Z0B A;  4DPT A;  1D6T A;  1KVK A;  1Z0C A;  4GKJ E;  1B62 A;  1B63 A;  4M1K A;  2A2C A;  4URL A;  4DUY I;  2LJP A;  4JYA E;  1I94 I;  4MYU A;  2N3H A;  3QT7 A;  4DV0 I;  4DR7 E;  4AQY I;  3LLH A;  2HFS A;  1HNX E;  4LF9 E;  1ELO A;  1DAR A;  1DI2 A;  5LMU I;  2RS7 A;  4RPF A;  1MU5 A;  1N34 I;  4KQV A;  4X66 I;  4OX9 E;  3ADI A;  1J5E I;  1XNQ I;  1IBL E;  4HAC A;  2VQF E;  2LBS B;  1HNZ E;  4LFA I;  4K0K I;  4LFC E;  1PKP A;  3ADL A;  4JI1 I;  4DU7 A;  4JI5 I;  4NXN I;  3C4T A;  2UXD I;  1Z0V A;  1HNW E;  1FJG E;  5LMN E;  1H73 A;  1QU6 A;  2BM1 A;  2KHX A;  4JI6 I;  3LPS A;  2BM0 A;  2NUE A;  4FW9 A;  4JI2 I;  4DR6 E;  1ZXN A;  2YT4 A;  2ZM6 E;  4X8W A;  4P52 A;  4LF5 E;  2L3C A;  2UUC I;  4MYT A;  4DR5 E;  2HK3 A;  4PRX A;  1Z59 A;  1FWK A;  2L33 A;  5GMD A;  2UUA I;  3ZM7 A;  1ZBT A;  3LTO A;  4EMD A;  1NHI A;  5L3J A;  3ADJ A;  4X62 I;  4JI0 E;  2RS6 A;  2HHH I;  4JI7 E;  4R1F A;  4HYM A;  2VQE I;  2HKE A;  3T1H E;  4X65 E;  2MDR A;  4DU8 A;  2DEJ A;  4YY3 I;  1YZ9 A;  1N0U A;  2UU9 E;  2IHR 1;  4LF6 I;  4OOG C;  4LF8 I;  1H74 A;  4B3S I;  3J7A M;  4DV6 I;  4JI4 E;  3ZZU A;  4DV4 E;  1Z0G A;  2L2M A;  3J7A G;  1XMQ E;  1KTV A;  4DR2 E;  3VYY A;  2NUF A;  5A2Q C;  3P1X A;  1EA6 A;  4YHH E;  4KHP I;  4X64 I;  4DR3 E;  4JG4 A;  1ZM3 A;  1QZR A;  2HK2 A;  1PVG A;  2B7V A;  3LNU A;  4DV1 I;  1YYW A;  3B8H A;  3HTX A;  3D4J A;  1ZM2 A;  3ZZ0 A;  4DV5 I;  3HUL A;  1I94 E;  4HAC B; 
#chains in the Genus database with same CATH topology
 1K47 A;  2EM8 A;  3K6Q A;  2RPC A;  4DV0 E;  3WU3 A;  2EOM A;  2UXB I;  3PYE A;  2EPR A;  1UDS A;  1OYS A;  2F4V I;  4NXM I;  2LV2 A;  1Z1B A;  5TSE A;  2Z5C A;  3VYX A;  1XHK A;  4M9V C;  5LMU E;  5AE3 A;  4DV3 I;  1A1G A;  3WU6 A;  3THO B;  1TN9 A;  2EMB A;  5T6J A;  2F8B A;  1OJ4 A;  4BA2 A;  4OO1 A;  4ZVI A;  2HFU A;  4JI3 I;  1N34 E;  4KWY A;  5EKW A;  2YTE A;  3IWD A;  4X66 E;  5BR8 I;  1XNR I;  2EN1 A;  1J5E E;  2HGH A;  1XNQ E;  1FWL A;  4IFD E;  2CZ9 A;  4FK5 C;  4ZYH A;  2EM7 A;  1T39 A;  3JU0 A;  2DGC A;  3OML A;  4LFA E;  4K0K E;  2VES A;  3K85 A;  1PJQ A;  4DKK A;  4JV5 E;  3H4L A;  5DNY A;  4JI1 E;  2JYA A;  2WP8 B;  4JI5 E;  2EMF A;  1UDO A;  2PO0 A;  1WHQ A;  1FKA E;  4NXN E;  3P3C A;  2YU5 A;  4LCH A;  2E1R A;  2YTD A;  1ZR9 A;  2UXD E;  3L00 A;  2IOQ A;  1IBM I;  3EPH A;  2V8P A;  4KZS A;  4JYA I;  4IS9 A;  3M7N G;  2FGG A;  1RQ0 A;  1UIL A;  2PO1 A;  3HQ1 A;  2EOZ A;  4JI6 E;  1MX0 A;  1HNX I;  1P42 A;  4HTG A;  4FW5 A;  2Z5B A;  2E5L I;  4JI2 E;  2JT2 A;  1N3G A;  4F2J C;  4L8N A;  2V83 A;  2VF3 A;  2O1T A;  2EQ0 A;  2EOQ A;  3PS3 A;  4IZJ A;  4P7D A;  2EFG A;  4B3R I;  2GLI A;  4OX9 I;  4DUZ I;  2RTX A;  2CGE A;  2N3G A;  5LLQ A;  2BR2 A;  4WUC A;  3IWC A;  2YZT A;  1HR0 I;  2LTR A;  2RQL A;  4ZYD A;  4GZN C;  2UUC E;  4OKG A;  3Q6M A;  2CSH A;  2BB8 A;  2YSP A;  5ADZ A;  5IWA E;  1J26 A;  2V2Q A;  4LFC I;  2O1U A;  4AM3 A;  2EMX A;  4PU9 A;  2UUA E;  3OTO I;  1UDQ A;  2MKN A;  4U3D A;  4R2C A;  2EP3 A;  2V87 A;  2JEA B;  1NCS A;  1FJG I;  4WSG A;  1HNW I;  5K36 E;  1RHY A;  1N33 I;  2MC5 A;  4IFD C;  4BC9 A;  3J7Y p;  3MSW A;  1OYR A;  1WHN A;  3DF6 A;  4WYQ B;  2EQ1 A;  4TUG A;  1VIS A;  4DR1 I;  1Y4S A;  3U1Y A;  4LFB I;  2VRD A;  4OO1 D;  2B7T A;  4X62 E;  2V8Q B;  2EZ6 A;  5JEA E;  5K36 D;  3C4B A;  3V5R A;  2EOI A;  3QT6 A;  4HEI A;  1L4S A;  3EQ1 A;  2C39 B;  3WU4 A;  4DR6 I;  4DV2 I;  2F1D A;  5JEA D;  3KZZ A;  2VQE E;  4B3M I;  2V86 A;  5A2Q Q;  4JI8 I;  4LU9 A;  1P47 A;  1KKH A;  1MG7 A;  2JE6 B;  2K4V A;  2PO2 B;  1A6F A;  2JWO A;  2CTD A;  2CPN A;  1X47 A;  4YY3 E;  1KIJ A;  1KYQ A;  3BBG A;  1HK7 A;  2R76 A;  2EMI A;  2L3J A;  2FV4 B;  5C0X A;  2LO3 A;  1RMD A;  2LUP B;  2EPO A;  2V2Z A;  2EM9 A;  2NA2 A;  2EL6 A;  4LF8 E;  2R42 A;  4B3T I;  4GKK I;  5FWK A;  3C6M A;  1ZM4 A;  1N36 I;  4B3S E;  1RC7 A;  3P06 A;  3PYD A;  3QT8 A;  4IZJ D;  4DV6 E;  2LT7 A;  1T4L B;  2MDG A;  4NHR A;  1EH6 A;  4DR4 E;  2DMI A;  4USK A;  3VK6 A;  3C6K A;  4IS1 C;  1U2R A;  2LMZ A;  1ZXM A;  4DPW A;  5K36 C;  2YPN A;  3T1H I;  5K36 F;  3QG5 C;  2EOR A;  4KHP E;  4I3H A;  4AID A;  1N32 E;  3M85 D;  4X64 E;  2JOX A;  2EN3 A;  1YYO A;  1R6L A;  1Z0W A;  5JEA C;  5JEA F;  2YRK A;  1EI1 A;  2Z5C B;  2NN6 E;  1T4O A;  4M2Z A;  4DV7 I;  3ZZT A;  1E3H A;  3HXL A;  2C37 B;  2CVE A;  4LF7 I;  4FWD A;  2UU9 I;  5A6A A;  2O3Z A;  2GS8 A;  4DV1 E;  5ELW A;  4USM A;  2RSI A;  2KOU A;  2VE7 C;  5K36 B;  4P78 A;  1RRE A;  2NUG A;  2G7H A;  4DV5 E;  1JK1 A;  2M4I A;  4O24 A;  3B78 A;  3P3E A;  4HY1 A;  3WU5 A;  4BA1 A;  4DUY E;  1A1I A;  5KL7 A;  4DXL A;  2UXC I;  4LOM A;  4DV4 I;  4FW3 A;  2DMY A;  2K7I A;  3KZY A;  1A1H A;  2ENA A;  5LL6 R;  1EKZ A;  2UXB E;  2CG9 A;  2GQ0 A;  5JEA B;  1Z5A A;  2F4V E;  1Z5B A;  2LE2 A;  4P7A A;  2JOB A;  1NHH A;  5GME A;  4TUI A;  1X6E A;  2E72 A;  4AQY E;  1IBK I;  3ZOQ B;  2L6M A;  1H7U A;  4DV3 E;  4PRV A;  5DRR A;  2EOJ A;  2L8T A;  1Z5C A;  2JEB A;  2H36 X;  2PO1 B;  2WBU A;  2EOE A;  2DIX A;  4Q28 A;  4JI3 E;  3PYG A;  5BR8 E;  1XNR E;  4DR3 I;  2EPN A;  2J7K A;  3EPK A;  1Y60 A;  1XMO I;  3ZKD A;  2OI2 A;  2GPI A;  2UUB I;  2FTX B;  1AH5 A;  2Q2E B;  3T1Y I;  1E3P A;  2IOP A;  2L2K B;  2JEA A;  3HKM A;  3Q6N A;  3V2U C;  2A2D A;  4IZJ B;  3J80 Q;  4LF4 I;  5IV8 B;  1IBM E;  1IQS A;  1X48 A;  2BR2 B;  4GKJ I;  1PIE A;  1EH7 A;  1X49 A;  2JXP A;  4WX9 A;  2NN6 C;  2NN6 F;  2HKJ A;  2DB2 A;  4R8O A;  4WFT A;  4QNK A;  2E5L E;  1YPN A;  1ZU1 A;  1NEI A;  2DLQ A;  2EJ4 A;  2L2N A;  4Z7Y A;  2X36 A;  4MQY A;  4DR7 I;  1GTK A;  4N4R B;  4LF9 I;  2EOS A;  2EN2 A;  1ZM9 A;  3JAM C;  2V2V A;  2LTS A;  3J81 C;  1TF6 A;  3CDJ A;  4WPY A;  1QNT A;  1WUU A;  4B3R E;  2J7J A;  2ODR D;  4DUZ E;  1F2I G;  2NN6 B;  3ADG A;  2PNM A;  1HR0 E;  1YYK A;  1YUJ A;  2EOO A;  3F0N A;  4JV5 I;  1IBL I;  2EPX A;  3OTO E;  4M30 A;  2JVA A;  4MU4 A;  4WUB A;  2BA0 G;  2VQF I;  1HNZ I;  2I9I A;  4MU1 A;  5AE2 A;  2LJU A;  3J80 C;  2JPA A;  3K1J A;  5DRO A;  4R03 A;  1H72 C;  4QNJ A;  2EPA A;  2BV3 A;  1N33 E;  1GQE A;  3K17 A;  3GLL A;  4OO1 E;  5LMN I;  4DR1 E;  1WXR A;  2EM3 A;  2EPU A;  1MEY C;  4LFB E;  1G2D C;  2WBT A;  2EM2 A;  4MLV A;  1BKN A;  4IZK B;  1RR9 A;  4GEQ B;  4DV2 E;  3B4T A;  3M6A A;  2V88 A;  2WP8 A;  4FWG A;  4I8O A;  4B3M E;  5IT9 Q;  2HHH E;  4JI8 E;  5KL4 A;  1ZBQ A;  4DPU A;  5DRP A;  4Z7C A;  2D9H A;  3L7Z B;  2J65 A;  2IES A;  2EE8 A;  1Z0E A;  2ZM6 I;  1FI4 A;  2DEI A;  1SR9 A;  1BBG A;  5IWA I;  1DQ3 A;  2BBG A;  4WUD A;  1WRJ A;  4LF5 I;  3P3G A;  4FN5 A;  5A6K A;  2EMZ A;  4UT4 A;  4DR5 I;  4HXZ A;  3F6G A;  4B3T E;  4GKK E;  3PYF A;  1N36 E;  2NPF A;  1S4E A;  4LF6 E;  5EL9 A;  3Q1Q A;  1O0W A;  1Y6Z A;  5IXM B;  3M7N D;  2XEX A;  4AIM A;  3ZKB A;  2MKD A;  2R3V A;  1FNM A;  1B69 A;  2MC6 A;  4RHB B;  4IJD A;  4F6M A;  2YU8 A;  4JI0 I;  2DRP A;  3QT5 A;  4GQU A;  3TQM A;  2WNR A;  2RSM A;  2WW4 A;  2PNZ B;  5FLX Q;  2L92 A;  1UBD C;  5IT9 C;  4JI7 I;  1NZ0 A;  4OO1 C;  4MLQ A;  4O4K A;  2LUQ A;  2AJ4 A;  2X7I A;  3CWV A;  4XTJ A;  4LPF A;  3HPS A;  3H1C A;  5F3W A;  4DPX A;  4LCF A;  3GME A;  4X65 I;  2EMG A;  2ELY A;  4RH8 A;  4DV7 E;  1YH8 A;  5KL6 A;  4FW7 A;  4LF7 E;  2V34 A;  4BS9 A;  1YFH A;  2WCC 3;  4ZYG A;  2C39 A;  4FWH A;  4F9B B;  3LML A;  2EM0 A;  3EPL A;  1YSA C;  2EOF A;  2GO3 A;  1H7S A;  1BB8 A;  1XXE A;  4BA2 B;  2LRS A;  2LJH A;  4OO1 B;  3DJW A;  4LTY A;  5CFF E;  3CDI A;  2UXC E;  1Y5Y A;  4UTG A;  3UK3 C;  3FIG A;  1Y4U A;  2GO4 A;  2JE6 A;  4DR4 I;  4IFD A;  5KL3 A;  4WXD A;  2EPM X;  1AAY A;  2PO2 A;  1G2F C;  4JI4 I;  4LCG A;  3P76 A;  5DNL A;  2YTQ A;  3THN A;  5KL2 A;  1IBK E;  2EMC A;  2PO0 B;  1UEK A;  2B3T B;  2EOY A;  1XMQ I;  4NXM E;  3GON A;  4OO1 F;  2E1M A;  5C0X E;  4DR2 I;  5FLX C;  5KL5 A;  3B82 A;  2JY9 A;  1N32 I;  4O43 A;  1T4N A;  3JAM Q;  4L5N C;  2WBS A;  4YHH I;  3J81 Q;  2ZIT A;  2EWL A;  1S16 A;  4ED4 A;  5C0X D;  2ELZ A;  2YTP A;  1XMO E;  1YHC A;  2ZBK B;  2BA1 G;  1STU A;  2PRT A;  2UUB E;  3T1Y E;  1PJT A;  2LVH A;  1UHZ A;  2YTN A;  1NHJ A;  2Z5B B;  1UDN A;  2EMW A;  4DPY A;  4J3D A;  2GHF A;  4MU3 A;  2A25 A;  1N0V C;  4LF4 E;  2EN8 A;  1Z0B A;  1Z0T A;  4DPT A;  2LCE A;  1D6T A;  2ENC A;  1KVK A;  1Z0C A;  4R2E A;  2ADR A;  4GKJ E;  1B62 A;  1B63 A;  2A2C A;  4M1K A;  3U1K A;  1X3C A;  4URL A;  2C38 A;  4DUY I;  2ENH A;  3MHH C;  4BHB A;  2LJP A;  4JYA E;  3MHS C;  1USU A;  1I94 I;  2DLK A;  4MYU A;  2N3H A;  3RMP A;  3QT7 A;  4DV0 I;  2EN7 A;  1X5W A;  4DR7 E;  4AQY I;  1EH8 A;  2O1V A;  3LLH A;  3PS2 A;  2EOH A;  3EPJ A;  2C37 A;  1HNX E;  4LF9 E;  2YTJ A;  2HFS A;  2EL4 A;  1ELO A;  1DAR A;  1DI2 A;  2YSO A;  5LMU I;  5AAS A;  1LLM C;  2RS7 A;  4FW4 A;  5K36 A;  2HJJ A;  1A1J A;  1UN6 B;  4RPF A;  1A1F A;  4DMI A;  1MU5 A;  1N34 I;  4KQV A;  4X66 I;  4OX9 E;  3ADI A;  5JEA A;  1J5E I;  3HJC A;  1XNQ I;  1SFE A;  4IFD D;  1IBL E;  4HAC A;  2VQF E;  2LBS B;  1HNZ E;  4LFA I;  4K0K I;  3BID A;  4LFC E;  5C0X C;  1PKP A;  4R2R A;  3ADL A;  5C0X F;  4JI1 I;  4DU7 A;  4JI5 I;  4F9A B;  4NXN I;  3JTZ A;  4F54 A;  5DRQ A;  3C4T A;  2UXD I;  1Z0V A;  3BF2 A;  2CT1 A;  1HNW E;  1FJG E;  5LMN E;  1H73 A;  4OZE A;  1QU6 A;  4R2P A;  2NAB A;  2YTF A;  3BGH A;  2KON A;  2BM1 A;  5AC5 A;  3KRN A;  2B9D A;  2KHX A;  5A6B A;  4WSP A;  4JI6 I;  3LPS A;  3F6H A;  2EMK A;  2BM0 A;  3H09 A;  2NUE A;  4ISA A;  3AV0 A;  5C0X B;  4FW9 A;  4N3O A;  4JI2 I;  2Z5E A;  4DR6 E;  1TF3 A;  1ZXN A;  4BHC A;  2EMA A;  2YT4 A;  3M85 G;  2EPK X;  2I13 A;  2BA1 D;  1IMU A;  4FW6 A;  2IER A;  4M0V A;  4BMJ A;  2Q8U A;  4X8W A;  2ZM6 E;  4P52 A;  1JK2 A;  4LF5 E;  2WNR B;  2L3C A;  2UUC I;  4MYT A;  4DR5 E;  4BCA A;  2HK3 A;  3PRY A;  1Z59 A;  4PRX A;  2N8X A;  1FWK A;  2L33 A;  5GMD A;  2YRM A;  2UUA I;  2ODR C;  2AE8 A;  4X9J A;  3ZM7 A;  4IFD F;  1ZBT A;  2EMH A;  3LTO A;  2YTO A;  2O1W A;  4EMD A;  2EMY A;  1NHI A;  3GCM A;  2VF1 A;  5L3J A;  3ADJ A;  2NN6 A;  3NZK A;  4R2A A;  1PJS A;  4J8Z A;  2PNL A;  4X62 I;  4JI0 E;  2EOX A;  4BC7 A;  1GZ6 A;  2RS6 A;  2YWQ A;  4O5G A;  2HHH I;  4JI7 E;  4R1F A;  1A1K A;  4HYM A;  5DNX A;  2VQE I;  5AC4 A;  1BBO A;  2HKE A;  4BA1 B;  4WXC A;  3T1H E;  4IFD B;  1DGC A;  1MGT A;  4X65 E;  2YTG A;  3M99 B;  2M1S A;  4U3B A;  2M7Q A;  2M9A A;  2MDR A;  2EL5 A;  1YUI A;  2YTI A;  4DU8 A;  2DEJ A;  5A69 A;  4IZK A;  5A6B D;  4YY3 I;  2WZO A;  3KWR A;  3AUZ A;  4BBY A;  1YZ9 A;  3VHT B;  2UU9 E;  1N0U A;  2BA0 D;  2IHR 1;  2V85 A;  4R2Q A;  2JEB B;  4LF6 I;  4OOG C;  4LF8 I;  2V89 A;  1KJK A;  1X6H A;  2EM6 A;  2EPZ A;  1H74 A;  3L7Z A;  4B3S I;  3J7A M;  2EN4 A;  4DV6 I;  4JI4 E;  1X6F A;  2EM4 A;  3ZZU A;  4DV4 E;  4F6N A;  2EPP A;  1Z0G A;  1USV A;  2L2M A;  4ZYE A;  3ECR A;  5A6J A;  3J7A G;  1XMQ E;  3DD6 A;  2EM5 A;  4NBQ A;  4R2S A;  4DR2 E;  1KTV A;  3VYY A;  2NUF A;  1VI7 A;  2C38 B;  2EML A;  5A2Q C;  3P1X A;  1PDA A;  2R1F A;  2YRH A;  1EA6 A;  4YHH E;  4F9C B;  4KHP I;  2EPC A;  2EN6 A;  4X64 I;  4MDT A;  4DR3 E;  2HC5 A;  4JG4 A;  3IWB A;  1OYP A;  2JP9 A;  4MU0 A;  1ZM3 A;  1QZR A;  2HK2 A;  2NN6 D;  1T38 A;  1A1L A;  2EQ3 A;  5AE1 A;  4Q35 B;  1PVG A;  2B7V A;  1R6M A;  3LNU A;  4DV1 I;  1WJP A;  1YYW A;  2DSY A;  2PNZ A;  3B8H A;  3HPZ A;  3HTX A;  3D4J A;  3UHM A;  4R2D A;  3PS1 A;  4NZV A;  1IQO A;  1ZAA C;  1ZM2 A;  2EPL X;  3ZZ0 A;  4DV5 I;  2JR1 A;  3HUL A;  1I94 E;  4HAC B; 
#chains in the Genus database with same CATH homology
 1K47 A;  3K6Q A;  4DV0 E;  3WU3 A;  2UXB I;  3PYE A;  2F4V I;  4NXM I;  2Z5C A;  3VYX A;  1XHK A;  5LMU E;  5AE3 A;  4DV3 I;  3WU6 A;  5T6J A;  2F8B A;  1OJ4 A;  4ZVI A;  2HFU A;  4JI3 I;  1N34 E;  3IWD A;  4X66 E;  5BR8 I;  1XNR I;  1J5E E;  1XNQ E;  1FWL A;  2CZ9 A;  3JU0 A;  4K0K E;  3OML A;  4LFA E;  3K85 A;  3WU5 A;  4DKK A;  4JV5 E;  3H4L A;  5DNY A;  4JI1 E;  4JI5 E;  1WHQ A;  1FKA E;  4NXN E;  2E1R A;  2UXD E;  2IOQ A;  1IBM I;  2V8P A;  4KZS A;  4JYA I;  2FGG A;  1RQ0 A;  1UIL A;  3HQ1 A;  4JI6 E;  1MX0 A;  1HNX I;  2Z5B A;  2E5L I;  4JI2 E;  4L8N A;  2V83 A;  2VF3 A;  2O1T A;  4IZJ A;  4P7D A;  2EFG A;  4B3R I;  4OX9 I;  4DUZ I;  2RTX A;  2CGE A;  2N3G A;  4WUC A;  3IWC A;  2YZT A;  1HR0 I;  2LTR A;  2UUC E;  3Q6M A;  5ADZ A;  5IWA E;  2V2Q A;  4LFC I;  1J26 A;  2O1U A;  4PU9 A;  2UUA E;  3OTO I;  2V87 A;  1HNW I;  1FJG I;  1N33 I;  2MC5 A;  4BC9 A;  3J7Y p;  3MSW A;  1WHN A;  3DF6 A;  4WYQ B;  4TUG A;  1VIS A;  4DR1 I;  4LFB I;  1Y4S A;  2B7T A;  4X62 E;  2V8Q B;  2EZ6 A;  3C4B A;  3V5R A;  3QT6 A;  3WU4 A;  4DR6 I;  4DV2 I;  2VQE E;  4B3M I;  2V86 A;  5A2Q Q;  4JI8 I;  4LU9 A;  1KKH A;  1MG7 A;  2K4V A;  1A6F A;  2JWO A;  2CPN A;  1X47 A;  4YY3 E;  1KIJ A;  1HK7 A;  2L3J A;  2FV4 B;  2LUP B;  2V2Z A;  4B3T I;  2NA2 A;  4LF8 E;  2R42 A;  4GKK I;  5FWK A;  1ZM4 A;  1N36 I;  4B3S E;  1RC7 A;  3P06 A;  3PYD A;  3QT8 A;  4IZJ D;  4DV6 E;  1T4L B;  4DR4 E;  4USK A;  3VK6 A;  1U2R A;  2LMZ A;  1ZXM A;  4DPW A;  3T1H I;  4KHP E;  4I3H A;  1N32 E;  4X64 E;  2JOX A;  1YYO A;  1Z0W A;  1EI1 A;  2Z5C B;  4DV7 I;  1T4O A;  4M2Z A;  3ZZT A;  3HXL A;  4LF7 I;  4FWD A;  2UU9 I;  2GS8 A;  4DV1 E;  4USM A;  2KOU A;  2VE7 C;  4P78 A;  1RRE A;  2NUG A;  2G7H A;  4DV5 E;  2M4I A;  3B78 A;  4HY1 A;  4DUY E;  4DXL A;  2UXC I;  4DV4 I;  2DMY A;  2UXB E;  2CG9 A;  5LL6 R;  1EKZ A;  2GQ0 A;  1Z5A A;  2F4V E;  1Z5B A;  2LE2 A;  4P7A A;  2JOB A;  1NHH A;  5GME A;  4TUI A;  4AQY E;  1IBK I;  3ZOQ B;  2L6M A;  1H7U A;  4DV3 E;  4PRV A;  2L8T A;  1Z5C A;  2H36 X;  2DIX A;  4Q28 A;  4JI3 E;  3PYG A;  5BR8 E;  1XNR E;  4DR3 I;  2J7K A;  1XMO I;  3ZKD A;  2OI2 A;  2UUB I;  2FTX B;  2Q2E B;  3T1Y I;  2IOP A;  2L2K B;  3Q6N A;  3V2U C;  2A2D A;  4IZJ B;  3J80 Q;  4LF4 I;  1IBM E;  1X48 A;  4GKJ I;  1PIE A;  1X49 A;  2HKJ A;  2DB2 A;  4R8O A;  4WFT A;  4Z7Y A;  2E5L E;  4DR7 I;  2L2N A;  2X36 A;  4LF9 I;  1ZM9 A;  3JAM C;  2V2V A;  2LTS A;  3J81 C;  4WPY A;  1WUU A;  4B3R E;  2ODR D;  4DUZ E;  2PNM A;  3ADG A;  1HR0 E;  1YYK A;  3F0N A;  4JV5 I;  1IBL I;  3OTO E;  4M30 A;  2JVA A;  4WUB A;  2VQF I;  1HNZ I;  5AE2 A;  3J80 C;  3K1J A;  4R03 A;  1H72 C;  2BV3 A;  1N33 E;  1GQE A;  3K17 A;  5LMN I;  4DR1 E;  1WXR A;  4LFB E;  1BKN A;  4IZK B;  1RR9 A;  4GEQ B;  4DV2 E;  3M6A A;  2V88 A;  4FWG A;  4I8O A;  4B3M E;  5IT9 Q;  2HHH E;  4JI8 E;  1ZBQ A;  4DPU A;  4Z7C A;  1Z0E A;  2ZM6 I;  1FI4 A;  2DEI A;  1SR9 A;  5IWA I;  1DQ3 A;  4WUD A;  4LF5 I;  4FN5 A;  4UT4 A;  4DR5 I;  4HXZ A;  3F6G A;  4B3T E;  4GKK E;  3PYF A;  1N36 E;  2NPF A;  1S4E A;  4LF6 E;  3Q1Q A;  1O0W A;  1Y6Z A;  2XEX A;  3ZKB A;  2R3V A;  1FNM A;  2MC6 A;  4JI0 I;  3QT5 A;  2RSM A;  2WW4 A;  5FLX Q;  2L92 A;  4JI7 I;  5IT9 C;  1NZ0 A;  2X7I A;  2AJ4 A;  2LUQ A;  3CWV A;  4XTJ A;  3HPS A;  5F3W A;  4DPX A;  4X65 I;  4DV7 E;  4LF7 E;  2V34 A;  4BS9 A;  4FWH A;  4F9B B;  3LML A;  1H7S A;  2LRS A;  2LJH A;  3DJW A;  4LTY A;  5CFF E;  2UXC E;  4UTG A;  3FIG A;  1Y4U A;  4DR4 I;  4JI4 I;  1IBK E;  1UEK A;  2B3T B;  1XMQ I;  4NXM E;  3GON A;  2E1M A;  4DR2 I;  5FLX C;  3B82 A;  2JY9 A;  1N32 I;  1T4N A;  3JAM Q;  4L5N C;  4YHH I;  3J81 Q;  2ZIT A;  2EWL A;  1S16 A;  4ED4 A;  1XMO E;  2ZBK B;  1STU A;  2UUB E;  3T1Y E;  1NHJ A;  1UHZ A;  2Z5B B;  4DPY A;  1N0V C;  4LF4 E;  1Z0T A;  1Z0B A;  4DPT A;  1D6T A;  1KVK A;  1Z0C A;  4GKJ E;  1B62 A;  1B63 A;  4M1K A;  2A2C A;  4URL A;  4DUY I;  2LJP A;  4JYA E;  1USU A;  1I94 I;  4MYU A;  2N3H A;  3RMP A;  3QT7 A;  4DV0 I;  4DR7 E;  4AQY I;  2O1V A;  3LLH A;  2HFS A;  1HNX E;  4LF9 E;  1ELO A;  1DAR A;  1DI2 A;  5LMU I;  5AAS A;  2RS7 A;  4RPF A;  4DMI A;  1MU5 A;  1N34 I;  4KQV A;  4X66 I;  4OX9 E;  3ADI A;  1J5E I;  1XNQ I;  3HJC A;  1IBL E;  4HAC A;  2VQF E;  2LBS B;  1HNZ E;  4LFA I;  4K0K I;  4LFC E;  1PKP A;  3ADL A;  4JI1 I;  4DU7 A;  4JI5 I;  4F9A B;  4NXN I;  3JTZ A;  4F54 A;  3C4T A;  2UXD I;  1Z0V A;  1HNW E;  1FJG E;  5LMN E;  1H73 A;  1QU6 A;  2BM1 A;  2KON A;  2B9D A;  2KHX A;  4WSP A;  4JI6 I;  3LPS A;  3F6H A;  2BM0 A;  3H09 A;  2NUE A;  3AV0 A;  4FW9 A;  4N3O A;  4JI2 I;  2Z5E A;  4DR6 E;  1ZXN A;  2YT4 A;  4M0V A;  4BMJ A;  4X8W A;  2ZM6 E;  4P52 A;  4LF5 E;  2L3C A;  2UUC I;  4MYT A;  4DR5 E;  4BCA A;  2HK3 A;  3PRY A;  1Z59 A;  4PRX A;  1FWK A;  2L33 A;  5GMD A;  2UUA I;  2ODR C;  3ZM7 A;  1ZBT A;  3LTO A;  2O1W A;  4EMD A;  1NHI A;  2VF1 A;  5L3J A;  3ADJ A;  4J8Z A;  2PNL A;  4X62 I;  4JI0 E;  4BC7 A;  1GZ6 A;  2RS6 A;  2HHH I;  4JI7 E;  4R1F A;  4HYM A;  2VQE I;  2HKE A;  3T1H E;  4X65 E;  2M1S A;  2M7Q A;  2MDR A;  4DU8 A;  2DEJ A;  4IZK A;  4YY3 I;  2WZO A;  3KWR A;  3AUZ A;  4BBY A;  1YZ9 A;  2UU9 E;  1N0U A;  2IHR 1;  2V85 A;  4LF6 I;  4OOG C;  4LF8 I;  2V89 A;  1H74 A;  4B3S I;  3J7A M;  4DV6 I;  4JI4 E;  3ZZU A;  4DV4 E;  1Z0G A;  1USV A;  2L2M A;  3J7A G;  1XMQ E;  1KTV A;  4DR2 E;  3VYY A;  2NUF A;  5A2Q C;  3P1X A;  1EA6 A;  4YHH E;  4F9C B;  4KHP I;  4X64 I;  4DR3 E;  4JG4 A;  3IWB A;  1ZM3 A;  1QZR A;  2HK2 A;  5AE1 A;  1PVG A;  2B7V A;  3LNU A;  4DV1 I;  1YYW A;  2DSY A;  3B8H A;  3HPZ A;  3HTX A;  3D4J A;  1ZM2 A;  3ZZ0 A;  4DV5 I;  2JR1 A;  3HUL A;  1I94 E;  4HAC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...