4JI8E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8E02
4JYAI 4LFCE 1N36I 3LTOA 1J5EE 4X62I 3J7AM 4YY3E 3OTOI 4WUCA 4URLA 4FN5A 2V2ZA 1ZBTA 1HNZE 4HYMA 2E5LI 4JI6E 1HR0I 5IT9C 1PIEA 1KTVA 1KVKA 2L2KB 3ZZUA 4WUDA 2B3TB 2LUQA 4KHPI 4DV2I 5BR8I 2UUAI 1I94E 4M1KA 3B8HA 3LPSA 2CPNA 1IBKE 4USMA 4B3RE 2F4VE 1N32I 1H7SA 4P7AA 5L3JA 4WFTA 4JG4A 1RR9A 1WHNA 1B62A 4UT4A 3J80Q 1KIJA 4ZVIA 2WW4A 1XMOI 2LTSA 3Q1QA 4X65E 4I3HA 2IHR1 3QT6A 4DUYE 3JAMQ 1N33I 4DV7E 2N3GA 2JVAA 4LF7E 4HACB 3J80C 4NXMI 4K0KE 4RPFA 1IBKI 2JY9A 2LJHA 4JI1E 3HTXA 5FLXQ 3T1YI 1ZXNA 2DB2A 1WUUA 4XTJA 2VQEI 2L33A 4JI4E 1MG7A 3JAMC 1GQEA 1ZXMA 3M6AA 4AQYI 1XMQI 4R1FA 2LBSB 4DR7I 3PYEA 1NHJA 3ADIA 2R42A 1XNQI 1Z5AA 3T1HE 4DV5I 4DV3I 4PU9A 5FLXC 4X8WA 2V8PA 3ADJA 2ZBKB 2UXDI 1IBLE 1A6FA 1NZ0A 4LFAI 1K47A 3V2UC 5IWAI 1H74A 5LMUI 1RC7A 3LLHA 1Z0BA 1OJ4A 4K0KI 2LUPB 2J7KA 3PYDA 4JI7I 3J7AG 4DR5I 1ZM3A 2VQFI 4DR3I 2B7VA 2V2VA 4USKA 2UU9I 2AJ4A 1HNXI 2UXCI 4JI8I 3VYXA 4NXNI 4MYUA 4DV1E 5LMNE 1O0WA 4JI3E 1Z0VA 1IBME 2GS8A 4DV6E 3CWVA 3QT5A 4DPXA 1BKNA 1N34I 1QU6A 1YYWA 1T4LB 1NHIA 1Z0WA 3D4JA 4JI2E 2UUBE 4MYTA 4M30A 4X66E 4UTGA 2ZM6E 1XNRE 4DR1I 4EMDA 3J7Yp 2A2DA 2BV3A 4LF8I 4DXLA 4LF5I 4LF4I 3WU4A 4JI0I 4DR6I 3C4TA 2LRSA 1KKHA 1VISA 2UUCE 1N0VC 3B82A 1D6TA 2BM0A 2RS6A 2V34A 1FKAE 4LFCI 1J5EI 1FJGE 4FWDA 4DV6I 4YY3I 1T4OA 1X47A 1HNZI 1Z0TA 4JI6I 4LFBE 4PRXA 1DI2A 1ZM9A 1S4EA 1I94I 2UUBI 4X66I 5LL6R 2HK3A 4B3TE 4PRVA 2NA2A 4B3RI 2F4VI 1FI4A 4DPUA 2UXBE 1U2RA 2RSMA 3WU3A 2Q2EB 2MDRA 4DR2E 1Z5CA 4GKJE 2UUCI 4DUZE 1T4NA 1N0UA 3F0NA 4HACA 4YHHE 4Z7CA 1Z0CA 2NUEA 1YYOA 4X65I 1PVGA 2ZITA 1FJGI 1XHKA 4LF9E 2HK2A 1H7UA 2HFSA 2L3CA 3ZKDA 4GKKE 4DUYI 1HNWE 2LTRA 4B3ME 4LFBI 2DIXA 4DV7I 2E1RA 1UHZA 3ADGA 4LF7I 1WHQA 3K17A 1N36E 4X62E 3J81Q 2EZ6A 1YYKA 2NPFA 4JI1I 2DEJA 2E5LE 2UXBI 1HR0E 3K1JA 1RREA 4FW9A 4DR4E 4Z7YA 4KHPE 4DV2E 2UUAE 2B7TA 4JI4I 4DU7A 2L2MA 4DPYA 1STUA 4LF6E 3P1XA 2OI2A 1N32E 3J81C 3T1HI 4ED4A 2L3JA 4FWGA 1H73A 4LF9I 3HULA 4WUBA 1FNMA 1MU5A 3C4BA 2BM1A 1IBLI 2XEXA 1XMOE 2VF3A 4X64E 4KQVA 3ADLA 4DV4E 2LJPA 3ZZ0A 1N33E 4DR4I 2DEIA 1EKZA 2CZ9A 1UEKA 4NXME 2HKJA 4JV5E 3WU5A 1YZ9A 4FWHA 4LF6I 2A2CA 2L2NA 4DV1I 3VYYA 5LMNI 2EFGA 4JI3I 2KHXA 4WYQB 1Z0EA 1IBMI 3T1YE 2DMYA 4DV0E 3ZZTA 3LNUA 2RTXA 3WU6A 2VQEE 1B63A 1Z59A 4OX9E 4AQYE 1XMQE 4P52A 1UILA 4DR7E 2X36A 3V5RA 4JI2I 3QT7A 4B3SE 4X64I 2HKEA 1XNQE 2YT4A 2ZM6I 4DV4I 1XNRI 4DV5E 4DV3E 2NUFA 2HHHE 1Z0GA 4JI5E 3ZM7A 3H4LA 2UXDE 4DPTA 4LFAE 5IWAE 1EI1A 5LMUE 1QZRA 1FWKA 1PKPA 4JV5I 2V2QA 4JI7E 4DPWA 4DR5E 4OOGC 3PYFA 4DV0I 3B78A 1X49A 2VQFE 5CFFE 4DR3E 1NHHA 3GONA 5GMDA 2UU9E 3QT8A 4OX9I 4DU8A 1HNXE 5A2QQ 3PYGA 2UXCE 4JI8E 2NUGA 4JYAE 4NXNE 1J26A 4B3SI 2RS7A 4B3TI 3OTOE 1N34E 1MX0A 1RQ0A 2HHHI 1EA6A 4JI5I 2N3HA 5GMEA 1H72C 1ELOA 5BR8E 4DR2I 4GKJI 1ZM2A 4DUZI 4HXZA 5A2QC 4YHHI 4DR1E 2X7IA 4LF8E 4LF5E 4M2ZA 4LF4E 1X48A 1DARA 2HFUA 2R3VA 4JI0E 4DR6E 5IT9Q 1Z5BA 4GKKI 1HNWI 4HY1A 4B3MI 4DKKA 3ZKBA 1S16A 1ZM4A 1FWLA
chains in the Genus database with same CATH superfamily
3H1CA 2PO1B 3P3GA 2IOQA 4LCFA 4JYAI 2FTXB 4IS9A 4LFCE 1N36I 3LTOA 1SR9A 2Q8UA 1J5EE 4X62I 1IQSA 3J7AM 2BA1D 4YY3E 3THNA 3OTOI 4WUCA 4URLA 1A1HA 2VESA 4FN5A 2V2ZA 1ZBTA 2EM4A 1OYPA 1HNZE 4HYMA 2E5LI 4BA1A 1PDAA 4IS1C 4JI6E 2EQ1A 2IERA 1HR0I 5IT9C 1PIEA 1KTVA 4HTGA 4LU9A 1KVKA 2L2KB 1R6MA 3ZZUA 5AE3A 4WUDA 2B3TB 4O4KA 2LUQA 4IFDD 4KHPI 4DV2I 2YTFA 5BR8I 5C0XE 2UUAI 1I94E 4M1KA 4MU1A 3B8HA 1TF3A 2EMCA 3LPSA 2CPNA 2EOSA 2FGGA 2WBUA 2DGCA 1IBKE 4USMA 2IESA 4LCHA 2O1UA 4B3RE 5K36F 2F4VE 3DJWA 1N32I 4NZVA 1H7SA 2EN2A 4Q28A 1GTKA 4R03A 2WNRA 2EL5A 3P3CA 4P7AA 5L3JA 2ELZA 2V8QB 2LCEA 3MSWA 3QG5C 5ADZA 2M9AA 4WFTA 4OKGA 2BA0D 2JYAA 4JG4A 1RR9A 2GPIA 1WHNA 1B62A 3KZYA 4UT4A 2NN6E 3J80Q 1KIJA 3U1YA 4ZVIA 2WW4A 1X6HA 1XMOI 1KYQA 2EPAA 2EMXA 2LTSA 3Q1QA 5K36D 3Q6MA 2YTPA 4X65E 2EPXA 4I3HA 4BS9A 1Z1BA 5K36C 4OO1E 2V87A 2PRTA 2IHR1 3QT6A 3FIGA 1P42A 5K36A 3JTZA 4DUYE 2O1VA 2V88A 1UDSA 2O1TA 3PS2A 4Q35B 3JAMQ 1N33I 2WP8B 2WCC3 4DV7E 1ZR9A 2N3GA 2MKNA 2EOMA 2YRMA 5JEAF 2JVAA 4LF7E 2BR2A 4HACB 3J80C 1Y6ZA 1B69A 1UBDC 2YZTA 4NXMI 4F9CB 4K0KE 4FW5A 4MLVA 4WSGA 4O43A 4RPFA 2ENHA 4F9AB 4O5GA 1IBKI 1X6EA 2JY9A 2LE2A 5C0XB 4LTYA 1BBGA 2LJHA 4JI1E 3HTXA 5FLXQ 2EN4A 4F54A 5KL7A 2GO4A 3T1YI 1ZXNA 2DB2A 4FW3A 1WUUA 4F6NA 4BHCA 3IWDA 5EL9A 5JEAD 4XTJA 2VQEI 2BA1G 2L33A 5ELWA 4R2PA 4JI4E 3JAMC 1GQEA 1MG7A 1ZXMA 1T39A 1BB8A 3M6AA 4AQYI 1XMQI 4R1FA 4HEIA 2LBSB 2HGHA 2FV4B 4NBQA 4DR7I 3PYEA 5F3WA 1NHJA 4F9BB 4AIDA 4BA2B 3ADIA 2R42A 2WBTA 2CVEA 2NN6B 2DLQA 2EOYA 1XNQI 2BBGA 3T1HE 1Z5AA 1A1KA 2JE6B 4DV5I 4DV3I 5FLXC 4PU9A 4X8WA 5AE2A 2V8PA 3BIDA 3DF6A 5AASA 5KL2A 4OO1B 3ADJA 2ZBKB 3LMLA 2UXDI 1IBLE 2LJUA 2EMWA 2EPMX 3VHTB 1A6FA 1NZ0A 4LOMA 1K47A 1EH7A 3V2UC 4IFDE 2R1FA 4IZJA 5IWAI 2LT7A 1H74A 4R8OA 3GLLA 2NN6C 4QNJA 5LMUI 4LFAI 1RC7A 3LLHA 4WXCA 3BBGA 1Z0BA 1OJ4A 4K0KI 2LUPB 3H09A 2J7KA 2YPNA 2NN6A 3PYDA 2EQ3A 1MGTA 2JEBB 2NABA 3DD6A 4U3DA 4JI7I 1L4SA 2EOOA 3J7AG 5IV8B 2YSPA 2JE6A 5FWKA 2A25A 2ENCA 4DR5I 1NEIA 1ZM3A 2EOIA 1TF6A 2VQFI 4DR3I 2B7VA 1X3CA 4IJDA 4TUGA 2V2VA 4USKA 2UU9I 4L5NC 5AC5A 1YFHA 2AJ4A 2EPUA 2PNZB 1HNXI 3M7ND 2UXCI 3HKMA 4JI8I 3VYXA 1T38A 4OZEA 4NXNI 4MYUA 2EPPA 2JWOA 5LMNE 4DV1E 1O0WA 4JI3E 1OYSA 1IBME 1Z0VA 5A69A 4DV6E 2GS8A 3CWVA 3QT5A 4DPXA 3L7ZB 2K7IA 1BKNA 1N34I 2EOJA 3TQMA 4R2QA 1XXEA 2JEBA 2EJ4A 2V89A 1QU6A 1YYWA 1YH8A 1T4LB 2J7JA 2GO3A 3Q6NA 1NHIA 1Z0WA 1EH6A 2EMYA 1PJQA 4R2AA 3D4JA 4JI2E 2UUBE 4MYTA 2YRHA 4M30A 3K85A 4X66E 2R76A 4R2DA 1OYRA 4UTGA 5A6KA 4L8NA 1YHCA 2PO1A 1PJTA 2K4VA 2ZM6E 2I9IA 1XNRE 4DR1I 4EMDA 2ENAA 4DMIA 3J7Yp 1TN9A 1R6LA 2EMZA 2A2DA 2BV3A 4LF8I 4DXLA 2HJJA 4R2RA 4LF5I 4LF4I 5A6BD 4IZKB 3WU4A 4P78A 4JI0I 4DR6I 4I8OA 2EM2A 2Z5CB 3NZKA 2I13A 2LMZA 2LRSA 3C4TA 1KKHA 1VISA 1WRJA 2EMHA 2ELYA 2UUCE 1N0VC 2J65A 3B82A 5A6BA 2EPCA 4GZNC 1D6TA 2YRKA 2EL6A 2RS6A 2BM0A 5DNLA 2C37B 2V34A 2JPAA 3BF2A 1FKAE 2YSOA 4GQUA 4LFCI 2CT1A 2EMIA 1G2FC 3KWRA 1J5EI 5EKWA 2EMFA 1FJGE 3AUZA 2E72A 4FWDA 4DV6I 4YY3I 3CDIA 1T4OA 1X47A 3RMPA 1HNZI 1Z0TA 4JI6I 2EN1A 4LFBE 2EPLX 4PRXA 1UN6B 1DI2A 1ZM9A 1S4EA 2WZOA 3U1KA 4WXDA 1X5WA 1I94I 2UUBI 4X66I 5LL6R 2M1SA 2HK3A 4IFDF 4B3TE 4PRVA 2NA2A 4B3RI 4MQYA 5KL6A 4TUIA 4FK5C 2F4VI 1FI4A 2JEAB 4DPUA 3M7NG 2UXBE 1A1LA 1U2RA 2YTGA 2RSMA 4ZYHA 3WU3A 2Q2EB 5DNXA 3JU0A 3L00A 2MDRA 1Y4UA 4DR2E 3MHHC 1YUJA 1Z5CA 5A6JA 4GKJE 1E3HA 2WP8A 3THOB 2UUCI 3OMLA 4DUZE 4MU3A 5KL4A 2GLIA 2NN6F 1T4NA 1N0UA 3F0NA 4HACA 2WBSA 5C0XC 4YHHE 4MU4A 1Z0CA 2EM5A 4J8ZA 1YYOA 4BBYA 2NUEA 4Z7CA 4X65I 2EMKA 3EPKA 1PVGA 2LO3A 2ZITA 2PNLA 5C0XA 3EPHA 4OO1F 1FJGI 2JOBA 4LF9E 2EMBA 1XHKA 2HK2A 1H7UA 4IZJD 2HFSA 3MHSC 2L3CA 3ZKDA 4GKKE 2JEAA 3EPJA 4DUYI 2EM7A 3F6GA 1HNWE 2EM9A 2LTRA 2F8BA 4B3ME 4LFBI 2DIXA 4DV7I 4WPYA 2E1RA 2NN6D 1UHZA 3ADGA 2HC5A 2PO0B 4LF7I 2MC5A 1WHQA 2YTIA 3K17A 4RHBB 1N36E 4KZSA 2Z5EA 4X62E 3J81Q 2V86A 4BA2A 4ZYGA 1YYKA 2EZ6A 2NPFA 1DGCA 4OO1D 1UDNA 1WXRA 2EM3A 5DRPA 4JI1I 1A1GA 2DEJA 4OO1C 3M85D 2E5LE 2UXBI 2ADRA 2Z5BB 2LVHA 3EQ1A 1HR0E 1RREA 3K1JA 4FW9A 4DR4E 2PO2B 4N4RB 4U3BA 4Z7YA 4OO1A 4KHPE 2JT2A 1LLMC 2YTDA 4DV2E 4RH8A 2UUAE 2B7TA 4JI4I 2YWQA 2E1MA 4DU7A 2L2MA 4F2JC 2EP3A 4LPFA 4DPYA 1STUA 1WJPA 4AIMA 5K36E 4LF6E 3F6HA 4BMJA 2GHFA 3P1XA 3HPZA 1N32E 2OI2A 2EPZA 3PS1A 2EN8A 5LLQA 4ZYDA 3J81C 4FW6A 3EPLA 2EOEA 3T1HI 4ED4A 2L3JA 2EMAA 3C6KA 1UDOA 1A1JA 1H73A 4FWGA 4LF9I 1NCSA 3HULA 1F2IG 4WUBA 1FNMA 2Z5BA 2V85A 3IWBA 1MU5A 3C4BA 1KJKA 4MU0A 2BM1A 5DROA 2PO2A 3ECRA 1IBLI 2XEXA 3UHMA 2RSIA 2ODRC 3HJCA 1XMOE 2YTQA 2VF3A 4X64E 2EPKX 3PRYA 2PNZA 4IFDB 4KQVA 3ADLA 3KRNA 4DV4E 2EOXA 3BGHA 2N8XA 2LJPA 4LCGA 1A1FA 2WNRB 3B4TA 1P47A 2EOZA 2KONA 2EPOA 3L7ZA 3ZZ0A 5DNYA 4WSPA 1Y5YA 2YU5A 1N33E 5T6JA 5JEAE 4DR4I 2DEIA 4AM3A 1N3GA 4QNKA 2YTJA 3HPSA 3K6QA 1EKZA 4KWYA 2MKDA 2CZ9A 1UEKA 2YTNA 4NXME 1SFEA 3HXLA 2HKJA 4FW7A 2L92A 2JXPA 3M99B 4R2CA 1YSAC 4JV5E 4IFDC 3WU5A 1YZ9A 4FWHA 4R2SA 4LF6I 2H36X 1JK2A 2GQ0A 1ZU1A 2A2CA 4IFDA 2L2NA 4ZYEA 3VYYA 1HK7A 2EFGA 5LMNI 2KHXA 4WYQB 1Z0EA 4DV1I 1IBMI 4JI3I 2EPRA 3T1YE 5K36B 2DMYA 3VK6A 2L8TA 4DV0E 5KL5A 3ZZTA 3LNUA 2RTXA 4MDTA 4BC7A 3WU6A 2EE8A 2VQEE 4IZKA 1B63A 1USUA 2EOHA 1Z59A 2BR2B 4OX9E 2Z5CA 4AQYE 1XMQE 1ZAAC 4P52A 1UILA 2IOPA 2L6MA 4DR7E 1G2DC 3P76A 2EWLA 2X36A 3M85G 3V5RA 4P7DA 4JI2I 5C0XF 4M0VA 2M4IA 2EL4A 4B3SE 3CDJA 3QT7A 4X64I 2EM8A 3AV0A 2YTEA 2EM0A 2C37A 2HKEA 3HQ1A 1XNQE 1E3PA 2C38B 2YT4A 4WX9A 2G7HA 4F6MA 2ZM6I 4DV4I 4DV5E 1XNRI 4DV3E 2NUFA 2HHHE 1Z0GA 4FW4A 5KL3A 1ZBQA 1USVA 5DRQA 4JI5E 3C6MA 1EH8A 2C39B 2EPNA 3ZM7A 4X9JA 3H4LA 2AE8A 2UXDE 4DPTA 1QNTA 1UDQA 2CTDA 4LFAE 3KZZA 2LV2A 2VF1A 5IWAE 1EI1A 2DRPA 5C0XD 3IWCA 2MDGA 5LMUE 1QZRA 5JEAB 1FWKA 4BCAA 1PKPA 4JV5I 2V2QA 1RMDA 2YU8A 2EM6A 2F1DA 1PJSA 2MC6A 4JI7E 3PS3A 2C38A 4DPWA 3P3EA 2EMGA 5DRRA 1Y4SA 4DR5E 3GCMA 4OOGC 3PYFA 4DV0I 4MLQA 5AE1A 3UK3C 1X49A 2DSYA 2VQFE 5CFFE 4DR3E 1NHHA 2C39A 3B78A 3GONA 2D9HA 2VRDA 5GMDA 2O1WA 2UU9E 4IZJB 4BHBA 3QT8A 5JEAC 5A6AA 4DU8A 4OX9I 1HNXE 3P06A 5A2QQ 2O3ZA 3PYGA 2UXCE 4JI8E 5AC4A 2NUGA 2JR1A 4NXNE 4JYAE 1RHYA 4O24A 1J26A 2B9DA 5JEAA 4B3SI 2RPCA 2YTOA 2RS7A 4N3OA 2PNMA 4B3TI 3OTOE 2CG9A 1IQOA 1N34E 4BC9A 1MX0A 1RQ0A 1AAYA 1DQ3A 2JOXA 2EOQA 2V83A 4M9VC 1EA6A 2CGEA 2HHHI 4JI5I 2N3HA 1Y60A 2DLKA 5GMEA 1H72C 1ELOA 5IXMB 5BR8E 2RQLA 4DR2I 1MEYC 1GZ6A 4GKJI 2JP9A 1ZM2A 4DUZI 4HXZA 5TSEA 2PO0A 5A2QC 2EORA 2BA0G 2DMIA 2KOUA 4YHHI 4DR1E 2EN7A 2BB8A 1BBOA 2X7IA 4LF8E 2CSHA 4LF5E 4M2ZA 2VE7C 1X48A 4LF4E 1DARA 2HFUA 2R3VA 4J3DA 4BA1B 4NHRA 2EOFA 1IMUA 4JI0E 4DR6E 5IT9Q 2EQ0A 3ZOQB 4R2EA 1YUIA 1Z5BA 4GKKI 4ISAA 1HNWI 1X6FA 1VI7A 2ODRD 4HY1A 2M7QA 1YPNA 4DKKA 1JK1A 3GMEA 2EMLA 1A1IA 1S16A 3ZKBA 4B3MI 4GEQB 2EN3A 1AH5A 2EN6A 1ZM4A 1FWLA
chains in the Genus database with same CATH topology
2IOQA 4JYAI 2FTXB 4LFCE 1N36I 3LTOA 1SR9A 1J5EE 4X62I 3J7AM 4YY3E 3OTOI 4WUCA 4URLA 4FN5A 2V2ZA 1ZBTA 1HNZE 4HYMA 2E5LI 4JI6E 1HR0I 5IT9C 1PIEA 1KTVA 4LU9A 1KVKA 2L2KB 3ZZUA 5AE3A 4WUDA 2B3TB 2LUQA 4KHPI 4DV2I 5BR8I 2UUAI 1I94E 4M1KA 3B8HA 3LPSA 2CPNA 2FGGA 1IBKE 4USMA 2O1UA 4B3RE 2F4VE 3DJWA 1N32I 1H7SA 4Q28A 4R03A 4P7AA 5L3JA 2V8QB 3MSWA 5ADZA 4WFTA 4JG4A 1RR9A 1WHNA 1B62A 4UT4A 3J80Q 1KIJA 4ZVIA 2WW4A 1XMOI 2LTSA 3Q1QA 3Q6MA 4X65E 4I3HA 4BS9A 2V87A 2IHR1 3QT6A 3FIGA 3JTZA 4DUYE 2O1VA 2V88A 2O1TA 3JAMQ 1N33I 4DV7E 2N3GA 2JVAA 4LF7E 4HACB 3J80C 1Y6ZA 4NXMI 2YZTA 4F9CB 4K0KE 4RPFA 4F9AB 1IBKI 2JY9A 2LE2A 4LTYA 2LJHA 4JI1E 3HTXA 5FLXQ 4F54A 3T1YI 1ZXNA 2DB2A 1WUUA 3IWDA 4XTJA 2VQEI 2L33A 4JI4E 1MG7A 3JAMC 1GQEA 1ZXMA 3M6AA 4AQYI 1XMQI 4R1FA 2LBSB 4DR7I 2FV4B 3PYEA 5F3WA 1NHJA 4F9BB 3ADIA 2R42A 1XNQI 1Z5AA 3T1HE 4DV5I 4DV3I 5FLXC 4PU9A 4X8WA 5AE2A 2V8PA 3DF6A 5AASA 3ADJA 2ZBKB 3LMLA 2UXDI 1IBLE 1A6FA 1NZ0A 4LFAI 1K47A 3V2UC 4IZJA 5IWAI 1H74A 4R8OA 5LMUI 1RC7A 3LLHA 1Z0BA 1OJ4A 4K0KI 2LUPB 3H09A 2J7KA 3PYDA 4JI7I 3J7AG 5FWKA 4DR5I 1ZM3A 2VQFI 4DR3I 2B7VA 4TUGA 2V2VA 4USKA 2UU9I 4L5NC 2AJ4A 1HNXI 2UXCI 4JI8I 3VYXA 4NXNI 4MYUA 2JWOA 5LMNE 4DV1E 1O0WA 4JI3E 1Z0VA 1IBME 2GS8A 4DV6E 3CWVA 3QT5A 4DPXA 1BKNA 1N34I 2V89A 1QU6A 1YYWA 1T4LB 3Q6NA 1NHIA 1Z0WA 3D4JA 4JI2E 2UUBE 4MYTA 4M30A 3K85A 4X66E 4UTGA 4L8NA 2K4VA 2ZM6E 1XNRE 4DR1I 4EMDA 4DMIA 3J7Yp 2A2DA 2BV3A 4LF8I 4DXLA 4LF5I 4LF4I 4IZKB 3WU4A 4P78A 4JI0I 4DR6I 4I8OA 2Z5CB 2LMZA 2LRSA 3C4TA 1KKHA 1VISA 2UUCE 1N0VC 3B82A 1D6TA 2BM0A 2RS6A 2V34A 1FKAE 4LFCI 3KWRA 1J5EI 1FJGE 3AUZA 4FWDA 4DV6I 4YY3I 1T4OA 1X47A 3RMPA 1HNZI 1Z0TA 4JI6I 4LFBE 4PRXA 1DI2A 1ZM9A 1S4EA 2WZOA 1I94I 2UUBI 4X66I 5LL6R 2M1SA 2HK3A 4B3TE 4PRVA 2NA2A 4B3RI 4TUIA 2F4VI 1FI4A 4DPUA 2UXBE 1U2RA 2RSMA 3WU3A 2Q2EB 3JU0A 2MDRA 1Y4UA 4DR2E 1Z5CA 4GKJE 2UUCI 3OMLA 4DUZE 1T4NA 1N0UA 3F0NA 4HACA 4YHHE 4Z7CA 1Z0CA 2NUEA 4J8ZA 1YYOA 4BBYA 4X65I 1PVGA 2ZITA 2PNLA 1FJGI 2JOBA 4LF9E 1XHKA 2HK2A 1H7UA 4IZJD 2HFSA 2L3CA 3ZKDA 4GKKE 4DUYI 3F6GA 1HNWE 2LTRA 2F8BA 4B3ME 4LFBI 2DIXA 4DV7I 4WPYA 2E1RA 1UHZA 3ADGA 4LF7I 2MC5A 1WHQA 3K17A 1N36E 4KZSA 2Z5EA 4X62E 3J81Q 2V86A 2EZ6A 1YYKA 2NPFA 1WXRA 4JI1I 2DEJA 2E5LE 2UXBI 2Z5BB 1HR0E 3K1JA 1RREA 4FW9A 4DR4E 4Z7YA 4KHPE 4DV2E 2UUAE 2B7TA 4JI4I 2E1MA 4DU7A 2L2MA 4DPYA 1STUA 4LF6E 3F6HA 4BMJA 3P1XA 3HPZA 1N32E 2OI2A 3J81C 3T1HI 4ED4A 2L3JA 4FWGA 1H73A 4LF9I 3HULA 4WUBA 1FNMA 2Z5BA 2V85A 3IWBA 1MU5A 3C4BA 2BM1A 1IBLI 2XEXA 3HJCA 2ODRC 1XMOE 2VF3A 4X64E 3PRYA 4KQVA 3ADLA 4DV4E 2LJPA 2KONA 3ZZ0A 5DNYA 4WSPA 1N33E 5T6JA 4DR4I 2DEIA 3HPSA 3K6QA 1EKZA 2CZ9A 1UEKA 4NXME 3HXLA 2HKJA 2L92A 4JV5E 3WU5A 1YZ9A 4FWHA 4LF6I 2H36X 2GQ0A 2A2CA 2L2NA 1HK7A 3VYYA 5LMNI 2EFGA 4DV1I 2KHXA 4WYQB 1Z0EA 1IBMI 4JI3I 3T1YE 2DMYA 3VK6A 2L8TA 4DV0E 3ZZTA 3LNUA 2RTXA 3WU6A 4BC7A 2VQEE 4IZKA 1B63A 1USUA 1Z59A 4OX9E 2Z5CA 4AQYE 1XMQE 4P52A 1UILA 2IOPA 2L6MA 4DR7E 2EWLA 2X36A 3V5RA 4P7DA 4JI2I 4M0VA 2M4IA 3QT7A 4B3SE 4X64I 3AV0A 2HKEA 3HQ1A 1XNQE 2YT4A 2ZM6I 2G7HA 4DV4I 1XNRI 4DV5E 4DV3E 2NUFA 2HHHE 1Z0GA 1ZBQA 1USVA 4JI5E 3ZM7A 3H4LA 2UXDE 4DPTA 4LFAE 2VF1A 5IWAE 1EI1A 3IWCA 5LMUE 1QZRA 1FWKA 4BCAA 1PKPA 4JV5I 2V2QA 2MC6A 4JI7E 4DPWA 1Y4SA 4DR5E 4OOGC 3PYFA 4DV0I 5AE1A 3B78A 1X49A 2DSYA 2VQFE 5CFFE 4DR3E 1NHHA 3GONA 5GMDA 2O1WA 2UU9E 4IZJB 3QT8A 4OX9I 4DU8A 1HNXE 3P06A 5A2QQ 3PYGA 2UXCE 4JI8E 2NUGA 2JR1A 4NXNE 4JYAE 1J26A 2B9DA 4B3SI 2RS7A 4N3OA 2PNMA 4B3TI 3OTOE 2CG9A 1N34E 4BC9A 1MX0A 1RQ0A 1DQ3A 2JOXA 2V83A 1EA6A 2CGEA 2HHHI 4JI5I 2N3HA 5GMEA 1H72C 1ELOA 5BR8E 4DR2I 1GZ6A 4GKJI 1ZM2A 4DUZI 4HXZA 5A2QC 2KOUA 4YHHI 4DR1E 2X7IA 4LF8E 4LF5E 4M2ZA 2VE7C 1X48A 4LF4E 1DARA 2HFUA 2R3VA 4JI0E 4DR6E 5IT9Q 3ZOQB 1Z5BA 4GKKI 1HNWI 2ODRD 4HY1A 2M7QA 4DKKA 3ZKBA 4B3MI 1S16A 4GEQB 1ZM4A 1FWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA I;  4LFC E;  1N36 I;  3LTO A;  1J5E E;  4X62 I;  3J7A M;  4YY3 E;  3OTO I;  4WUC A;  4URL A;  4FN5 A;  2V2Z A;  1ZBT A;  1HNZ E;  4HYM A;  2E5L I;  4JI6 E;  1HR0 I;  5IT9 C;  1PIE A;  1KTV A;  1KVK A;  2L2K B;  3ZZU A;  4WUD A;  2B3T B;  2LUQ A;  4KHP I;  4DV2 I;  5BR8 I;  2UUA I;  1I94 E;  4M1K A;  3B8H A;  3LPS A;  2CPN A;  1IBK E;  4USM A;  4B3R E;  2F4V E;  1N32 I;  1H7S A;  4P7A A;  5L3J A;  4WFT A;  4JG4 A;  1RR9 A;  1WHN A;  1B62 A;  4UT4 A;  3J80 Q;  1KIJ A;  4ZVI A;  2WW4 A;  1XMO I;  2LTS A;  3Q1Q A;  4X65 E;  4I3H A;  2IHR 1;  3QT6 A;  4DUY E;  3JAM Q;  1N33 I;  4DV7 E;  2N3G A;  2JVA A;  4LF7 E;  4HAC B;  3J80 C;  4NXM I;  4K0K E;  4RPF A;  1IBK I;  2JY9 A;  2LJH A;  4JI1 E;  3HTX A;  5FLX Q;  3T1Y I;  1ZXN A;  2DB2 A;  1WUU A;  4XTJ A;  2VQE I;  2L33 A;  4JI4 E;  1MG7 A;  3JAM C;  1GQE A;  1ZXM A;  3M6A A;  4AQY I;  1XMQ I;  4R1F A;  2LBS B;  4DR7 I;  3PYE A;  1NHJ A;  3ADI A;  2R42 A;  1XNQ I;  1Z5A A;  3T1H E;  4DV5 I;  4DV3 I;  4PU9 A;  5FLX C;  4X8W A;  2V8P A;  3ADJ A;  2ZBK B;  2UXD I;  1IBL E;  1A6F A;  1NZ0 A;  4LFA I;  1K47 A;  3V2U C;  5IWA I;  1H74 A;  5LMU I;  1RC7 A;  3LLH A;  1Z0B A;  1OJ4 A;  4K0K I;  2LUP B;  2J7K A;  3PYD A;  4JI7 I;  3J7A G;  4DR5 I;  1ZM3 A;  2VQF I;  4DR3 I;  2B7V A;  2V2V A;  4USK A;  2UU9 I;  2AJ4 A;  1HNX I;  2UXC I;  4JI8 I;  3VYX A;  4NXN I;  4MYU A;  4DV1 E;  5LMN E;  1O0W A;  4JI3 E;  1Z0V A;  1IBM E;  2GS8 A;  4DV6 E;  3CWV A;  3QT5 A;  4DPX A;  1BKN A;  1N34 I;  1QU6 A;  1YYW A;  1T4L B;  1NHI A;  1Z0W A;  3D4J A;  4JI2 E;  2UUB E;  4MYT A;  4M30 A;  4X66 E;  4UTG A;  2ZM6 E;  1XNR E;  4DR1 I;  4EMD A;  3J7Y p;  2A2D A;  2BV3 A;  4LF8 I;  4DXL A;  4LF5 I;  4LF4 I;  3WU4 A;  4JI0 I;  4DR6 I;  3C4T A;  2LRS A;  1KKH A;  1VIS A;  2UUC E;  1N0V C;  3B82 A;  1D6T A;  2BM0 A;  2RS6 A;  2V34 A;  1FKA E;  4LFC I;  1J5E I;  1FJG E;  4FWD A;  4DV6 I;  4YY3 I;  1T4O A;  1X47 A;  1HNZ I;  1Z0T A;  4JI6 I;  4LFB E;  4PRX A;  1DI2 A;  1ZM9 A;  1S4E A;  1I94 I;  2UUB I;  4X66 I;  5LL6 R;  2HK3 A;  4B3T E;  4PRV A;  2NA2 A;  4B3R I;  2F4V I;  1FI4 A;  4DPU A;  2UXB E;  1U2R A;  2RSM A;  3WU3 A;  2Q2E B;  2MDR A;  4DR2 E;  1Z5C A;  4GKJ E;  2UUC I;  4DUZ E;  1T4N A;  1N0U A;  3F0N A;  4HAC A;  4YHH E;  4Z7C A;  1Z0C A;  2NUE A;  1YYO A;  4X65 I;  1PVG A;  2ZIT A;  1FJG I;  1XHK A;  4LF9 E;  2HK2 A;  1H7U A;  2HFS A;  2L3C A;  3ZKD A;  4GKK E;  4DUY I;  1HNW E;  2LTR A;  4B3M E;  4LFB I;  2DIX A;  4DV7 I;  2E1R A;  1UHZ A;  3ADG A;  4LF7 I;  1WHQ A;  3K17 A;  1N36 E;  4X62 E;  3J81 Q;  2EZ6 A;  1YYK A;  2NPF A;  4JI1 I;  2DEJ A;  2E5L E;  2UXB I;  1HR0 E;  3K1J A;  1RRE A;  4FW9 A;  4DR4 E;  4Z7Y A;  4KHP E;  4DV2 E;  2UUA E;  2B7T A;  4JI4 I;  4DU7 A;  2L2M A;  4DPY A;  1STU A;  4LF6 E;  3P1X A;  2OI2 A;  1N32 E;  3J81 C;  3T1H I;  4ED4 A;  2L3J A;  4FWG A;  1H73 A;  4LF9 I;  3HUL A;  4WUB A;  1FNM A;  1MU5 A;  3C4B A;  2BM1 A;  1IBL I;  2XEX A;  1XMO E;  2VF3 A;  4X64 E;  4KQV A;  3ADL A;  4DV4 E;  2LJP A;  3ZZ0 A;  1N33 E;  4DR4 I;  2DEI A;  1EKZ A;  2CZ9 A;  1UEK A;  4NXM E;  2HKJ A;  4JV5 E;  3WU5 A;  1YZ9 A;  4FWH A;  4LF6 I;  2A2C A;  2L2N A;  4DV1 I;  3VYY A;  5LMN I;  2EFG A;  4JI3 I;  2KHX A;  4WYQ B;  1Z0E A;  1IBM I;  3T1Y E;  2DMY A;  4DV0 E;  3ZZT A;  3LNU A;  2RTX A;  3WU6 A;  2VQE E;  1B63 A;  1Z59 A;  4OX9 E;  4AQY E;  1XMQ E;  4P52 A;  1UIL A;  4DR7 E;  2X36 A;  3V5R A;  4JI2 I;  3QT7 A;  4B3S E;  4X64 I;  2HKE A;  1XNQ E;  2YT4 A;  2ZM6 I;  4DV4 I;  1XNR I;  4DV5 E;  4DV3 E;  2NUF A;  2HHH E;  1Z0G A;  4JI5 E;  3ZM7 A;  3H4L A;  2UXD E;  4DPT A;  4LFA E;  5IWA E;  1EI1 A;  5LMU E;  1QZR A;  1FWK A;  1PKP A;  4JV5 I;  2V2Q A;  4JI7 E;  4DPW A;  4DR5 E;  4OOG C;  3PYF A;  4DV0 I;  3B78 A;  1X49 A;  2VQF E;  5CFF E;  4DR3 E;  1NHH A;  3GON A;  5GMD A;  2UU9 E;  3QT8 A;  4OX9 I;  4DU8 A;  1HNX E;  5A2Q Q;  3PYG A;  2UXC E;  4JI8 E;  2NUG A;  4JYA E;  4NXN E;  1J26 A;  4B3S I;  2RS7 A;  4B3T I;  3OTO E;  1N34 E;  1MX0 A;  1RQ0 A;  2HHH I;  1EA6 A;  4JI5 I;  2N3H A;  5GME A;  1H72 C;  1ELO A;  5BR8 E;  4DR2 I;  4GKJ I;  1ZM2 A;  4DUZ I;  4HXZ A;  5A2Q C;  4YHH I;  4DR1 E;  2X7I A;  4LF8 E;  4LF5 E;  4M2Z A;  4LF4 E;  1X48 A;  1DAR A;  2HFU A;  2R3V A;  4JI0 E;  4DR6 E;  5IT9 Q;  1Z5B A;  4GKK I;  1HNW I;  4HY1 A;  4B3M I;  4DKK A;  3ZKB A;  1S16 A;  1ZM4 A;  1FWL A; 
#chains in the Genus database with same CATH topology
 3H1C A;  2PO1 B;  3P3G A;  2IOQ A;  4LCF A;  4JYA I;  2FTX B;  4IS9 A;  4LFC E;  1N36 I;  3LTO A;  1SR9 A;  2Q8U A;  1J5E E;  4X62 I;  1IQS A;  3J7A M;  2BA1 D;  4YY3 E;  3THN A;  3OTO I;  4WUC A;  4URL A;  1A1H A;  2VES A;  4FN5 A;  2V2Z A;  1ZBT A;  2EM4 A;  1OYP A;  1HNZ E;  4HYM A;  2E5L I;  4BA1 A;  1PDA A;  4IS1 C;  4JI6 E;  2EQ1 A;  2IER A;  1HR0 I;  5IT9 C;  1PIE A;  1KTV A;  4HTG A;  4LU9 A;  1KVK A;  2L2K B;  1R6M A;  3ZZU A;  5AE3 A;  4WUD A;  2B3T B;  4O4K A;  2LUQ A;  4IFD D;  4KHP I;  4DV2 I;  2YTF A;  5BR8 I;  5C0X E;  2UUA I;  1I94 E;  4M1K A;  4MU1 A;  3B8H A;  1TF3 A;  2EMC A;  3LPS A;  2CPN A;  2EOS A;  2FGG A;  2WBU A;  2DGC A;  1IBK E;  4USM A;  2IES A;  4LCH A;  2O1U A;  4B3R E;  5K36 F;  2F4V E;  3DJW A;  1N32 I;  4NZV A;  1H7S A;  2EN2 A;  4Q28 A;  1GTK A;  4R03 A;  2WNR A;  2EL5 A;  3P3C A;  4P7A A;  5L3J A;  2ELZ A;  2V8Q B;  2LCE A;  3MSW A;  3QG5 C;  5ADZ A;  2M9A A;  4WFT A;  4OKG A;  2BA0 D;  2JYA A;  4JG4 A;  1RR9 A;  2GPI A;  1WHN A;  1B62 A;  3KZY A;  4UT4 A;  2NN6 E;  3J80 Q;  1KIJ A;  3U1Y A;  4ZVI A;  2WW4 A;  1X6H A;  1XMO I;  1KYQ A;  2EPA A;  2EMX A;  2LTS A;  3Q1Q A;  5K36 D;  3Q6M A;  2YTP A;  4X65 E;  2EPX A;  4I3H A;  4BS9 A;  1Z1B A;  5K36 C;  4OO1 E;  2V87 A;  2PRT A;  2IHR 1;  3QT6 A;  3FIG A;  1P42 A;  5K36 A;  3JTZ A;  4DUY E;  2O1V A;  2V88 A;  1UDS A;  2O1T A;  3PS2 A;  4Q35 B;  3JAM Q;  1N33 I;  2WP8 B;  2WCC 3;  4DV7 E;  1ZR9 A;  2N3G A;  2MKN A;  2EOM A;  2YRM A;  5JEA F;  2JVA A;  4LF7 E;  2BR2 A;  4HAC B;  3J80 C;  1Y6Z A;  1B69 A;  1UBD C;  2YZT A;  4NXM I;  4F9C B;  4K0K E;  4FW5 A;  4MLV A;  4WSG A;  4O43 A;  4RPF A;  2ENH A;  4F9A B;  4O5G A;  1IBK I;  1X6E A;  2JY9 A;  2LE2 A;  5C0X B;  4LTY A;  1BBG A;  2LJH A;  4JI1 E;  3HTX A;  5FLX Q;  2EN4 A;  4F54 A;  5KL7 A;  2GO4 A;  3T1Y I;  1ZXN A;  2DB2 A;  4FW3 A;  1WUU A;  4F6N A;  4BHC A;  3IWD A;  5EL9 A;  5JEA D;  4XTJ A;  2VQE I;  2BA1 G;  2L33 A;  5ELW A;  4R2P A;  4JI4 E;  3JAM C;  1GQE A;  1MG7 A;  1ZXM A;  1T39 A;  1BB8 A;  3M6A A;  4AQY I;  1XMQ I;  4R1F A;  4HEI A;  2LBS B;  2HGH A;  2FV4 B;  4NBQ A;  4DR7 I;  3PYE A;  5F3W A;  1NHJ A;  4F9B B;  4AID A;  4BA2 B;  3ADI A;  2R42 A;  2WBT A;  2CVE A;  2NN6 B;  2DLQ A;  2EOY A;  1XNQ I;  2BBG A;  3T1H E;  1Z5A A;  1A1K A;  2JE6 B;  4DV5 I;  4DV3 I;  5FLX C;  4PU9 A;  4X8W A;  5AE2 A;  2V8P A;  3BID A;  3DF6 A;  5AAS A;  5KL2 A;  4OO1 B;  3ADJ A;  2ZBK B;  3LML A;  2UXD I;  1IBL E;  2LJU A;  2EMW A;  2EPM X;  3VHT B;  1A6F A;  1NZ0 A;  4LOM A;  1K47 A;  1EH7 A;  3V2U C;  4IFD E;  2R1F A;  4IZJ A;  5IWA I;  2LT7 A;  1H74 A;  4R8O A;  3GLL A;  2NN6 C;  4QNJ A;  5LMU I;  4LFA I;  1RC7 A;  3LLH A;  4WXC A;  3BBG A;  1Z0B A;  1OJ4 A;  4K0K I;  2LUP B;  3H09 A;  2J7K A;  2YPN A;  2NN6 A;  3PYD A;  2EQ3 A;  1MGT A;  2JEB B;  2NAB A;  3DD6 A;  4U3D A;  4JI7 I;  1L4S A;  2EOO A;  3J7A G;  5IV8 B;  2YSP A;  2JE6 A;  5FWK A;  2A25 A;  2ENC A;  4DR5 I;  1NEI A;  1ZM3 A;  2EOI A;  1TF6 A;  2VQF I;  4DR3 I;  2B7V A;  1X3C A;  4IJD A;  4TUG A;  2V2V A;  4USK A;  2UU9 I;  4L5N C;  5AC5 A;  1YFH A;  2AJ4 A;  2EPU A;  2PNZ B;  1HNX I;  3M7N D;  2UXC I;  3HKM A;  4JI8 I;  3VYX A;  1T38 A;  4OZE A;  4NXN I;  4MYU A;  2EPP A;  2JWO A;  5LMN E;  4DV1 E;  1O0W A;  4JI3 E;  1OYS A;  1IBM E;  1Z0V A;  5A69 A;  4DV6 E;  2GS8 A;  3CWV A;  3QT5 A;  4DPX A;  3L7Z B;  2K7I A;  1BKN A;  1N34 I;  2EOJ A;  3TQM A;  4R2Q A;  1XXE A;  2JEB A;  2EJ4 A;  2V89 A;  1QU6 A;  1YYW A;  1YH8 A;  1T4L B;  2J7J A;  2GO3 A;  3Q6N A;  1NHI A;  1Z0W A;  1EH6 A;  2EMY A;  1PJQ A;  4R2A A;  3D4J A;  4JI2 E;  2UUB E;  4MYT A;  2YRH A;  4M30 A;  3K85 A;  4X66 E;  2R76 A;  4R2D A;  1OYR A;  4UTG A;  5A6K A;  4L8N A;  1YHC A;  2PO1 A;  1PJT A;  2K4V A;  2ZM6 E;  2I9I A;  1XNR E;  4DR1 I;  4EMD A;  2ENA A;  4DMI A;  3J7Y p;  1TN9 A;  1R6L A;  2EMZ A;  2A2D A;  2BV3 A;  4LF8 I;  4DXL A;  2HJJ A;  4R2R A;  4LF5 I;  4LF4 I;  5A6B D;  4IZK B;  3WU4 A;  4P78 A;  4JI0 I;  4DR6 I;  4I8O A;  2EM2 A;  2Z5C B;  3NZK A;  2I13 A;  2LMZ A;  2LRS A;  3C4T A;  1KKH A;  1VIS A;  1WRJ A;  2EMH A;  2ELY A;  2UUC E;  1N0V C;  2J65 A;  3B82 A;  5A6B A;  2EPC A;  4GZN C;  1D6T A;  2YRK A;  2EL6 A;  2RS6 A;  2BM0 A;  5DNL A;  2C37 B;  2V34 A;  2JPA A;  3BF2 A;  1FKA E;  2YSO A;  4GQU A;  4LFC I;  2CT1 A;  2EMI A;  1G2F C;  3KWR A;  1J5E I;  5EKW A;  2EMF A;  1FJG E;  3AUZ A;  2E72 A;  4FWD A;  4DV6 I;  4YY3 I;  3CDI A;  1T4O A;  1X47 A;  3RMP A;  1HNZ I;  1Z0T A;  4JI6 I;  2EN1 A;  4LFB E;  2EPL X;  4PRX A;  1UN6 B;  1DI2 A;  1ZM9 A;  1S4E A;  2WZO A;  3U1K A;  4WXD A;  1X5W A;  1I94 I;  2UUB I;  4X66 I;  5LL6 R;  2M1S A;  2HK3 A;  4IFD F;  4B3T E;  4PRV A;  2NA2 A;  4B3R I;  4MQY A;  5KL6 A;  4TUI A;  4FK5 C;  2F4V I;  1FI4 A;  2JEA B;  4DPU A;  3M7N G;  2UXB E;  1A1L A;  1U2R A;  2YTG A;  2RSM A;  4ZYH A;  3WU3 A;  2Q2E B;  5DNX A;  3JU0 A;  3L00 A;  2MDR A;  1Y4U A;  4DR2 E;  3MHH C;  1YUJ A;  1Z5C A;  5A6J A;  4GKJ E;  1E3H A;  2WP8 A;  3THO B;  2UUC I;  3OML A;  4DUZ E;  4MU3 A;  5KL4 A;  2GLI A;  2NN6 F;  1T4N A;  1N0U A;  3F0N A;  4HAC A;  2WBS A;  5C0X C;  4YHH E;  4MU4 A;  1Z0C A;  2EM5 A;  4J8Z A;  1YYO A;  4BBY A;  2NUE A;  4Z7C A;  4X65 I;  2EMK A;  3EPK A;  1PVG A;  2LO3 A;  2ZIT A;  2PNL A;  5C0X A;  3EPH A;  4OO1 F;  1FJG I;  2JOB A;  4LF9 E;  2EMB A;  1XHK A;  2HK2 A;  1H7U A;  4IZJ D;  2HFS A;  3MHS C;  2L3C A;  3ZKD A;  4GKK E;  2JEA A;  3EPJ A;  4DUY I;  2EM7 A;  3F6G A;  1HNW E;  2EM9 A;  2LTR A;  2F8B A;  4B3M E;  4LFB I;  2DIX A;  4DV7 I;  4WPY A;  2E1R A;  2NN6 D;  1UHZ A;  3ADG A;  2HC5 A;  2PO0 B;  4LF7 I;  2MC5 A;  1WHQ A;  2YTI A;  3K17 A;  4RHB B;  1N36 E;  4KZS A;  2Z5E A;  4X62 E;  3J81 Q;  2V86 A;  4BA2 A;  4ZYG A;  1YYK A;  2EZ6 A;  2NPF A;  1DGC A;  4OO1 D;  1UDN A;  1WXR A;  2EM3 A;  5DRP A;  4JI1 I;  1A1G A;  2DEJ A;  4OO1 C;  3M85 D;  2E5L E;  2UXB I;  2ADR A;  2Z5B B;  2LVH A;  3EQ1 A;  1HR0 E;  1RRE A;  3K1J A;  4FW9 A;  4DR4 E;  2PO2 B;  4N4R B;  4U3B A;  4Z7Y A;  4OO1 A;  4KHP E;  2JT2 A;  1LLM C;  2YTD A;  4DV2 E;  4RH8 A;  2UUA E;  2B7T A;  4JI4 I;  2YWQ A;  2E1M A;  4DU7 A;  2L2M A;  4F2J C;  2EP3 A;  4LPF A;  4DPY A;  1STU A;  1WJP A;  4AIM A;  5K36 E;  4LF6 E;  3F6H A;  4BMJ A;  2GHF A;  3P1X A;  3HPZ A;  1N32 E;  2OI2 A;  2EPZ A;  3PS1 A;  2EN8 A;  5LLQ A;  4ZYD A;  3J81 C;  4FW6 A;  3EPL A;  2EOE A;  3T1H I;  4ED4 A;  2L3J A;  2EMA A;  3C6K A;  1UDO A;  1A1J A;  1H73 A;  4FWG A;  4LF9 I;  1NCS A;  3HUL A;  1F2I G;  4WUB A;  1FNM A;  2Z5B A;  2V85 A;  3IWB A;  1MU5 A;  3C4B A;  1KJK A;  4MU0 A;  2BM1 A;  5DRO A;  2PO2 A;  3ECR A;  1IBL I;  2XEX A;  3UHM A;  2RSI A;  2ODR C;  3HJC A;  1XMO E;  2YTQ A;  2VF3 A;  4X64 E;  2EPK X;  3PRY A;  2PNZ A;  4IFD B;  4KQV A;  3ADL A;  3KRN A;  4DV4 E;  2EOX A;  3BGH A;  2N8X A;  2LJP A;  4LCG A;  1A1F A;  2WNR B;  3B4T A;  1P47 A;  2EOZ A;  2KON A;  2EPO A;  3L7Z A;  3ZZ0 A;  5DNY A;  4WSP A;  1Y5Y A;  2YU5 A;  1N33 E;  5T6J A;  5JEA E;  4DR4 I;  2DEI A;  4AM3 A;  1N3G A;  4QNK A;  2YTJ A;  3HPS A;  3K6Q A;  1EKZ A;  4KWY A;  2MKD A;  2CZ9 A;  1UEK A;  2YTN A;  4NXM E;  1SFE A;  3HXL A;  2HKJ A;  4FW7 A;  2L92 A;  2JXP A;  3M99 B;  4R2C A;  1YSA C;  4JV5 E;  4IFD C;  3WU5 A;  1YZ9 A;  4FWH A;  4R2S A;  4LF6 I;  2H36 X;  1JK2 A;  2GQ0 A;  1ZU1 A;  2A2C A;  4IFD A;  2L2N A;  4ZYE A;  3VYY A;  1HK7 A;  2EFG A;  5LMN I;  2KHX A;  4WYQ B;  1Z0E A;  4DV1 I;  1IBM I;  4JI3 I;  2EPR A;  3T1Y E;  5K36 B;  2DMY A;  3VK6 A;  2L8T A;  4DV0 E;  5KL5 A;  3ZZT A;  3LNU A;  2RTX A;  4MDT A;  4BC7 A;  3WU6 A;  2EE8 A;  2VQE E;  4IZK A;  1B63 A;  1USU A;  2EOH A;  1Z59 A;  2BR2 B;  4OX9 E;  2Z5C A;  4AQY E;  1XMQ E;  1ZAA C;  4P52 A;  1UIL A;  2IOP A;  2L6M A;  4DR7 E;  1G2D C;  3P76 A;  2EWL A;  2X36 A;  3M85 G;  3V5R A;  4P7D A;  4JI2 I;  5C0X F;  4M0V A;  2M4I A;  2EL4 A;  4B3S E;  3CDJ A;  3QT7 A;  4X64 I;  2EM8 A;  3AV0 A;  2YTE A;  2EM0 A;  2C37 A;  2HKE A;  3HQ1 A;  1XNQ E;  1E3P A;  2C38 B;  2YT4 A;  4WX9 A;  2G7H A;  4F6M A;  2ZM6 I;  4DV4 I;  4DV5 E;  1XNR I;  4DV3 E;  2NUF A;  2HHH E;  1Z0G A;  4FW4 A;  5KL3 A;  1ZBQ A;  1USV A;  5DRQ A;  4JI5 E;  3C6M A;  1EH8 A;  2C39 B;  2EPN A;  3ZM7 A;  4X9J A;  3H4L A;  2AE8 A;  2UXD E;  4DPT A;  1QNT A;  1UDQ A;  2CTD A;  4LFA E;  3KZZ A;  2LV2 A;  2VF1 A;  5IWA E;  1EI1 A;  2DRP A;  5C0X D;  3IWC A;  2MDG A;  5LMU E;  1QZR A;  5JEA B;  1FWK A;  4BCA A;  1PKP A;  4JV5 I;  2V2Q A;  1RMD A;  2YU8 A;  2EM6 A;  2F1D A;  1PJS A;  2MC6 A;  4JI7 E;  3PS3 A;  2C38 A;  4DPW A;  3P3E A;  2EMG A;  5DRR A;  1Y4S A;  4DR5 E;  3GCM A;  4OOG C;  3PYF A;  4DV0 I;  4MLQ A;  5AE1 A;  3UK3 C;  1X49 A;  2DSY A;  2VQF E;  5CFF E;  4DR3 E;  1NHH A;  2C39 A;  3B78 A;  3GON A;  2D9H A;  2VRD A;  5GMD A;  2O1W A;  2UU9 E;  4IZJ B;  4BHB A;  3QT8 A;  5JEA C;  5A6A A;  4DU8 A;  4OX9 I;  1HNX E;  3P06 A;  5A2Q Q;  2O3Z A;  3PYG A;  2UXC E;  4JI8 E;  5AC4 A;  2NUG A;  2JR1 A;  4NXN E;  4JYA E;  1RHY A;  4O24 A;  1J26 A;  2B9D A;  5JEA A;  4B3S I;  2RPC A;  2YTO A;  2RS7 A;  4N3O A;  2PNM A;  4B3T I;  3OTO E;  2CG9 A;  1IQO A;  1N34 E;  4BC9 A;  1MX0 A;  1RQ0 A;  1AAY A;  1DQ3 A;  2JOX A;  2EOQ A;  2V83 A;  4M9V C;  1EA6 A;  2CGE A;  2HHH I;  4JI5 I;  2N3H A;  1Y60 A;  2DLK A;  5GME A;  1H72 C;  1ELO A;  5IXM B;  5BR8 E;  2RQL A;  4DR2 I;  1MEY C;  1GZ6 A;  4GKJ I;  2JP9 A;  1ZM2 A;  4DUZ I;  4HXZ A;  5TSE A;  2PO0 A;  5A2Q C;  2EOR A;  2BA0 G;  2DMI A;  2KOU A;  4YHH I;  4DR1 E;  2EN7 A;  2BB8 A;  1BBO A;  2X7I A;  4LF8 E;  2CSH A;  4LF5 E;  4M2Z A;  2VE7 C;  1X48 A;  4LF4 E;  1DAR A;  2HFU A;  2R3V A;  4J3D A;  4BA1 B;  4NHR A;  2EOF A;  1IMU A;  4JI0 E;  4DR6 E;  5IT9 Q;  2EQ0 A;  3ZOQ B;  4R2E A;  1YUI A;  1Z5B A;  4GKK I;  4ISA A;  1HNW I;  1X6F A;  1VI7 A;  2ODR D;  4HY1 A;  2M7Q A;  1YPN A;  4DKK A;  1JK1 A;  3GME A;  2EML A;  1A1I A;  1S16 A;  3ZKB A;  4B3M I;  4GEQ B;  2EN3 A;  1AH5 A;  2EN6 A;  1ZM4 A;  1FWL A; 
#chains in the Genus database with same CATH homology
 2IOQ A;  4JYA I;  2FTX B;  4LFC E;  1N36 I;  3LTO A;  1SR9 A;  1J5E E;  4X62 I;  3J7A M;  4YY3 E;  3OTO I;  4WUC A;  4URL A;  4FN5 A;  2V2Z A;  1ZBT A;  1HNZ E;  4HYM A;  2E5L I;  4JI6 E;  1HR0 I;  5IT9 C;  1PIE A;  1KTV A;  4LU9 A;  1KVK A;  2L2K B;  3ZZU A;  5AE3 A;  4WUD A;  2B3T B;  2LUQ A;  4KHP I;  4DV2 I;  5BR8 I;  2UUA I;  1I94 E;  4M1K A;  3B8H A;  3LPS A;  2CPN A;  2FGG A;  1IBK E;  4USM A;  2O1U A;  4B3R E;  2F4V E;  3DJW A;  1N32 I;  1H7S A;  4Q28 A;  4R03 A;  4P7A A;  5L3J A;  2V8Q B;  3MSW A;  5ADZ A;  4WFT A;  4JG4 A;  1RR9 A;  1WHN A;  1B62 A;  4UT4 A;  3J80 Q;  1KIJ A;  4ZVI A;  2WW4 A;  1XMO I;  2LTS A;  3Q1Q A;  3Q6M A;  4X65 E;  4I3H A;  4BS9 A;  2V87 A;  2IHR 1;  3QT6 A;  3FIG A;  3JTZ A;  4DUY E;  2O1V A;  2V88 A;  2O1T A;  3JAM Q;  1N33 I;  4DV7 E;  2N3G A;  2JVA A;  4LF7 E;  4HAC B;  3J80 C;  1Y6Z A;  4NXM I;  2YZT A;  4F9C B;  4K0K E;  4RPF A;  4F9A B;  1IBK I;  2JY9 A;  2LE2 A;  4LTY A;  2LJH A;  4JI1 E;  3HTX A;  5FLX Q;  4F54 A;  3T1Y I;  1ZXN A;  2DB2 A;  1WUU A;  3IWD A;  4XTJ A;  2VQE I;  2L33 A;  4JI4 E;  1MG7 A;  3JAM C;  1GQE A;  1ZXM A;  3M6A A;  4AQY I;  1XMQ I;  4R1F A;  2LBS B;  4DR7 I;  2FV4 B;  3PYE A;  5F3W A;  1NHJ A;  4F9B B;  3ADI A;  2R42 A;  1XNQ I;  1Z5A A;  3T1H E;  4DV5 I;  4DV3 I;  5FLX C;  4PU9 A;  4X8W A;  5AE2 A;  2V8P A;  3DF6 A;  5AAS A;  3ADJ A;  2ZBK B;  3LML A;  2UXD I;  1IBL E;  1A6F A;  1NZ0 A;  4LFA I;  1K47 A;  3V2U C;  4IZJ A;  5IWA I;  1H74 A;  4R8O A;  5LMU I;  1RC7 A;  3LLH A;  1Z0B A;  1OJ4 A;  4K0K I;  2LUP B;  3H09 A;  2J7K A;  3PYD A;  4JI7 I;  3J7A G;  5FWK A;  4DR5 I;  1ZM3 A;  2VQF I;  4DR3 I;  2B7V A;  4TUG A;  2V2V A;  4USK A;  2UU9 I;  4L5N C;  2AJ4 A;  1HNX I;  2UXC I;  4JI8 I;  3VYX A;  4NXN I;  4MYU A;  2JWO A;  5LMN E;  4DV1 E;  1O0W A;  4JI3 E;  1Z0V A;  1IBM E;  2GS8 A;  4DV6 E;  3CWV A;  3QT5 A;  4DPX A;  1BKN A;  1N34 I;  2V89 A;  1QU6 A;  1YYW A;  1T4L B;  3Q6N A;  1NHI A;  1Z0W A;  3D4J A;  4JI2 E;  2UUB E;  4MYT A;  4M30 A;  3K85 A;  4X66 E;  4UTG A;  4L8N A;  2K4V A;  2ZM6 E;  1XNR E;  4DR1 I;  4EMD A;  4DMI A;  3J7Y p;  2A2D A;  2BV3 A;  4LF8 I;  4DXL A;  4LF5 I;  4LF4 I;  4IZK B;  3WU4 A;  4P78 A;  4JI0 I;  4DR6 I;  4I8O A;  2Z5C B;  2LMZ A;  2LRS A;  3C4T A;  1KKH A;  1VIS A;  2UUC E;  1N0V C;  3B82 A;  1D6T A;  2BM0 A;  2RS6 A;  2V34 A;  1FKA E;  4LFC I;  3KWR A;  1J5E I;  1FJG E;  3AUZ A;  4FWD A;  4DV6 I;  4YY3 I;  1T4O A;  1X47 A;  3RMP A;  1HNZ I;  1Z0T A;  4JI6 I;  4LFB E;  4PRX A;  1DI2 A;  1ZM9 A;  1S4E A;  2WZO A;  1I94 I;  2UUB I;  4X66 I;  5LL6 R;  2M1S A;  2HK3 A;  4B3T E;  4PRV A;  2NA2 A;  4B3R I;  4TUI A;  2F4V I;  1FI4 A;  4DPU A;  2UXB E;  1U2R A;  2RSM A;  3WU3 A;  2Q2E B;  3JU0 A;  2MDR A;  1Y4U A;  4DR2 E;  1Z5C A;  4GKJ E;  2UUC I;  3OML A;  4DUZ E;  1T4N A;  1N0U A;  3F0N A;  4HAC A;  4YHH E;  4Z7C A;  1Z0C A;  2NUE A;  4J8Z A;  1YYO A;  4BBY A;  4X65 I;  1PVG A;  2ZIT A;  2PNL A;  1FJG I;  2JOB A;  4LF9 E;  1XHK A;  2HK2 A;  1H7U A;  4IZJ D;  2HFS A;  2L3C A;  3ZKD A;  4GKK E;  4DUY I;  3F6G A;  1HNW E;  2LTR A;  2F8B A;  4B3M E;  4LFB I;  2DIX A;  4DV7 I;  4WPY A;  2E1R A;  1UHZ A;  3ADG A;  4LF7 I;  2MC5 A;  1WHQ A;  3K17 A;  1N36 E;  4KZS A;  2Z5E A;  4X62 E;  3J81 Q;  2V86 A;  2EZ6 A;  1YYK A;  2NPF A;  1WXR A;  4JI1 I;  2DEJ A;  2E5L E;  2UXB I;  2Z5B B;  1HR0 E;  3K1J A;  1RRE A;  4FW9 A;  4DR4 E;  4Z7Y A;  4KHP E;  4DV2 E;  2UUA E;  2B7T A;  4JI4 I;  2E1M A;  4DU7 A;  2L2M A;  4DPY A;  1STU A;  4LF6 E;  3F6H A;  4BMJ A;  3P1X A;  3HPZ A;  1N32 E;  2OI2 A;  3J81 C;  3T1H I;  4ED4 A;  2L3J A;  4FWG A;  1H73 A;  4LF9 I;  3HUL A;  4WUB A;  1FNM A;  2Z5B A;  2V85 A;  3IWB A;  1MU5 A;  3C4B A;  2BM1 A;  1IBL I;  2XEX A;  3HJC A;  2ODR C;  1XMO E;  2VF3 A;  4X64 E;  3PRY A;  4KQV A;  3ADL A;  4DV4 E;  2LJP A;  2KON A;  3ZZ0 A;  5DNY A;  4WSP A;  1N33 E;  5T6J A;  4DR4 I;  2DEI A;  3HPS A;  3K6Q A;  1EKZ A;  2CZ9 A;  1UEK A;  4NXM E;  3HXL A;  2HKJ A;  2L92 A;  4JV5 E;  3WU5 A;  1YZ9 A;  4FWH A;  4LF6 I;  2H36 X;  2GQ0 A;  2A2C A;  2L2N A;  1HK7 A;  3VYY A;  5LMN I;  2EFG A;  4DV1 I;  2KHX A;  4WYQ B;  1Z0E A;  1IBM I;  4JI3 I;  3T1Y E;  2DMY A;  3VK6 A;  2L8T A;  4DV0 E;  3ZZT A;  3LNU A;  2RTX A;  3WU6 A;  4BC7 A;  2VQE E;  4IZK A;  1B63 A;  1USU A;  1Z59 A;  4OX9 E;  2Z5C A;  4AQY E;  1XMQ E;  4P52 A;  1UIL A;  2IOP A;  2L6M A;  4DR7 E;  2EWL A;  2X36 A;  3V5R A;  4P7D A;  4JI2 I;  4M0V A;  2M4I A;  3QT7 A;  4B3S E;  4X64 I;  3AV0 A;  2HKE A;  3HQ1 A;  1XNQ E;  2YT4 A;  2ZM6 I;  2G7H A;  4DV4 I;  1XNR I;  4DV5 E;  4DV3 E;  2NUF A;  2HHH E;  1Z0G A;  1ZBQ A;  1USV A;  4JI5 E;  3ZM7 A;  3H4L A;  2UXD E;  4DPT A;  4LFA E;  2VF1 A;  5IWA E;  1EI1 A;  3IWC A;  5LMU E;  1QZR A;  1FWK A;  4BCA A;  1PKP A;  4JV5 I;  2V2Q A;  2MC6 A;  4JI7 E;  4DPW A;  1Y4S A;  4DR5 E;  4OOG C;  3PYF A;  4DV0 I;  5AE1 A;  3B78 A;  1X49 A;  2DSY A;  2VQF E;  5CFF E;  4DR3 E;  1NHH A;  3GON A;  5GMD A;  2O1W A;  2UU9 E;  4IZJ B;  3QT8 A;  4OX9 I;  4DU8 A;  1HNX E;  3P06 A;  5A2Q Q;  3PYG A;  2UXC E;  4JI8 E;  2NUG A;  2JR1 A;  4NXN E;  4JYA E;  1J26 A;  2B9D A;  4B3S I;  2RS7 A;  4N3O A;  2PNM A;  4B3T I;  3OTO E;  2CG9 A;  1N34 E;  4BC9 A;  1MX0 A;  1RQ0 A;  1DQ3 A;  2JOX A;  2V83 A;  1EA6 A;  2CGE A;  2HHH I;  4JI5 I;  2N3H A;  5GME A;  1H72 C;  1ELO A;  5BR8 E;  4DR2 I;  1GZ6 A;  4GKJ I;  1ZM2 A;  4DUZ I;  4HXZ A;  5A2Q C;  2KOU A;  4YHH I;  4DR1 E;  2X7I A;  4LF8 E;  4LF5 E;  4M2Z A;  2VE7 C;  1X48 A;  4LF4 E;  1DAR A;  2HFU A;  2R3V A;  4JI0 E;  4DR6 E;  5IT9 Q;  3ZOQ B;  1Z5B A;  4GKK I;  1HNW I;  2ODR D;  4HY1 A;  2M7Q A;  4DKK A;  3ZKB A;  4B3M I;  1S16 A;  4GEQ B;  1ZM4 A;  1FWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...