4JI8E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8E02
2NUFA 1H7UA 5IT9C 3OTOE 1IBKI 2F4VE 4GKKE 4KHPI 4YHHE 4DV7I 3J7Yp 1RREA 4X65E 4JI7I 4MYTA 4FW9A 4JI0I 2GS8A 4DPXA 1H74A 2A2DA 3B82A 2UUAE 3WU5A 3J7AG 2V2QA 4DUZE 1B62A 4ED4A 4DR5E 2V2VA 4JI2E 4LF8I 2HKEA 3QT8A 2NPFA 4JI8E 2ZM6E 2R42A 4PRVA 1HNZE 3LTOA 4GKJI 3V5RA 3J81C 4LFBE 2YT4A 1FI4A 4R1FA 4HACA 2NUEA 1XNRE 3P1XA 1RC7A 2ZBKB 1Z0EA 4DV1I 4B3TI 4AQYE 2N3GA 4DUYE 3J80Q 2UXCI 4JYAI 1S16A 1FJGE 1FKAE 1Z0TA 3JAMQ 4GKJE 4DV5E 4DPUA 1U2RA 2DIXA 1N34E 4JI3I 3ZKDA 2UUBE 1XHKA 2LBSB 1HNXE 4JI4E 2N3HA 4P7AA 4X64E 2BV3A 1XNQI 3QT6A 2L2NA 4DXLA 1XMQE 3C4BA 4FWDA 2BM1A 4DR6I 4DV4I 2E5LE 4JI5I 2VQEI 4DR2I 3PYEA 1KIJA 5LMUI 2UUCI 4B3SI 4PRXA 4DPYA 4LF7E 2LTSA 3ADIA 1YZ9A 2L2MA 2NA2A 1O0WA 3LPSA 5FLXQ 2HFUA 4X62E 4MYUA 4ZVIA 1X47A 5A2QC 1J5EI 2RSMA 1UEKA 3HTXA 2B7TA 4USKA 1I94E 4DR3I 1N0UA 4XTJA 3ADLA 2MDRA 2LJPA 1BKNA 3Q1QA 4B3MI 2UXDI 3M6AA 4P52A 2V34A 5IWAI 3OTOI 4DV2E 2JVAA 1KVKA 2F4VI 4GKKI 4PU9A 4YHHI 2UU9E 4X65I 2L33A 3PYGA 2NUGA 1KTVA 4DR3E 2UUAI 4NXME 4DUZI 4DR5I 3VYYA 4JI2I 3T1HE 2HK2A 4LF6E 4JI8I 2ZM6I 1Z0CA 1HNZI 1NHJA 4JI1E 5LL6R 4LFBI 4DR4E 4JI6E 2BM0A 1XNRI 1HNWE 2B7VA 5GMEA 2V8PA 4B3RE 1FNMA 1Z5BA 1YYOA 1ZM3A 1N36E 1RR9A 4DUYI 4DPTA 4AQYI 1MU5A 5GMDA 1FJGI 4DV5I 1N34I 1X48A 4LFAE 2UUBI 1T4LB 3D4JA 3B78A 3GONA 1HNXI 4DV3E 4JI4I 2ZITA 4HXZA 4X64I 1WUUA 1PIEA 1XMQI 2DMYA 2E5LI 3C4TA 4LFCE 3T1YE 4USMA 1N33E 2L3JA 2HKJA 4LF7I 4DR7E 3V2UC 3LNUA 5BR8E 2R3VA 3K1JA 2OI2A 4X62I 2LUQA 4I3HA 3ZZUA 1I94I 1Z0VA 1FWKA 1KKHA 4K0KI 1S4EA 3JAMC 2RS7A 5LMNE 1MG7A 4DKKA 1HR0E 1NHHA 4DV6E 3QT7A 2LJHA 2IHR1 4WUBA 2XEXA 4DV2I 2LUPB 3QT5A 2UU9I 3HULA 4WUCA 1RQ0A 1IBME 1J26A 1N32E 1IBLE 4K0KE 1T4NA 4NXMI 3LLHA 4OOGC 1EKZA 4FWHA 2EZ6A 4NXNE 1YYWA 4LF9E 4KQVA 3T1HI 4LF4E 4LF6I 1PKPA 2VQFE 5FLXC 1UILA 4DR1E 1ZM2A 1DI2A 4YY3E 2CZ9A 4DU7A 4DU8A 5IT9Q 4M30A 4JI1I 5L3JA 3B8HA 4DR4I 3ZM7A 4JI6I 4JV5E 2E1RA 2HHHE 4WFTA 1HNWI 1Z5AA 2DB2A 2RS6A 4B3RI 2DEIA 1H7SA 1N36I 4LF5E 2X36A 2X7IA 1B63A 1DARA 4X66E 1ZM4A 4UTGA 4UT4A 1VISA 3PYFA 1YYKA 1UHZA 4LFAI 2HFSA 3ZKBA 1Z59A 4DV3I 1Z5CA 1XMOE 3J81Q 4OX9E 3PYDA 4URLA 1K47A 4M2ZA 1PVGA 3CWVA 1QZRA 2UXBE 2L3CA 2HK3A 4DV0E 1H72C 3K17A 4LFCI 3T1YI 1OJ4A 4EMDA 1N33I 2A2CA 1IBKE 4WUDA 2RTXA 4KHPE 2LTRA 1FWLA 4DR7I 4DV7E 5BR8I 4JI7E 4FN5A 4JI0E 4WYQB 3WU3A 1D6TA 2JY9A 1T4OA 4LF8E 1ELOA 5LMNI 2VF3A 1HR0I 4DV6I 2AJ4A 1EA6A 2LRSA 1EI1A 2CPNA 3ZZTA 1IBMI 4HY1A 4X8WA 3J80C 1N32I 1IBLI 5A2QQ 3ADJA 4DV1E 4NXNI 4B3TE 4LF9I 4FWGA 1X49A 2UXCE 4JYAE 3J7AM 3F0NA 1NHIA 4LF4I 2Q2EB 4JI3E 1H73A 2VQFI 4HYMA 4HACB 4DR1I 4YY3I 2DEJA 4JV5I 2HHHI 1XNQE 4Z7YA 1STUA 1Z0BA 1Z0GA 4DR6E 4DV4E 4JI5E 2VQEE 2V2ZA 1ZXMA 1QU6A 4LF5I 5CFFE 4DR2E 1WHQA 5LMUE 2J7KA 2UUCE 4B3SE 4X66I 1ZBTA 2B3TB 3ADGA 3ZZ0A 3WU6A 4JG4A 3H4LA 1WHNA 4M1KA 1NZ0A 1ZXNA 2KHXA 1J5EE 2L2KB 1A6FA 1N0VC 2WW4A 3WU4A 1Z0WA 1XMOI 4OX9I 2UXBI 1GQEA 2EFGA 3VYXA 4DV0I 4Z7CA 4DPWA 1MX0A 4B3ME 4RPFA 2UXDE 1ZM9A 5IWAE
chains in the Genus database with same CATH superfamily
2NUFA 1H7UA 1EH7A 2ELYA 3OTOE 5IT9C 2M1SA 2YTGA 1IBKI 2F4VE 2EOZA 4GKKE 4KHPI 2V87A 4YHHE 1YFHA 5K36E 4DV7I 3J7Yp 1RREA 3K85A 3THNA 4X65E 4FW4A 4JI7I 4MYTA 3OMLA 4FW9A 4JI0I 1YUJA 2GS8A 4DPXA 2YTIA 1G2FC 5AC5A 1H74A 2UUAE 2A2DA 2M4IA 1YUIA 2Z5BA 3B82A 3J7AG 2CT1A 3WU5A 2V2QA 4DUZE 3HPZA 3MHSC 1JK2A 1B62A 4DR5E 4ED4A 3JTZA 2HGHA 2NN6F 2V2VA 2C37B 4JI2E 3H1CA 2EPPA 4X9JA 4LF8I 1KYQA 2EQ1A 5C0XD 2EQ0A 2MKNA 2HKEA 3QT8A 5JEAD 2WNRA 2NPFA 2EQ3A 2C38A 2JXPA 2EPCA 2M9AA 2ENAA 1PDAA 4JI8E 1Y6ZA 2BA0G 2H36X 4F9AB 2ZM6E 2R42A 4PRVA 4BA2B 1HNZE 3LTOA 2IOPA 4GKJI 1TF6A 3IWBA 2C39B 4WSGA 2G7HA 4BHCA 3V5RA 3J81C 1TN9A 4LFBE 2YT4A 5DRRA 1Y60A 1FI4A 2EOIA 2PO2B 4R1FA 4HACA 2NUEA 2EM9A 1BBOA 2NN6C 1XNRE 2EJ4A 3P1XA 1RC7A 5ELWA 2ZBKB 2EWLA 2E1MA 1R6MA 1Z0EA 1UDNA 1AAYA 1HK7A 4DV1I 5TSEA 4B3TI 2WCC3 3M99B 4AQYE 2N3GA 4RH8A 2EMIA 2EMHA 4DUYE 2BA1D 1S16A 3J80Q 2JEAB 1FJGE 1FKAE 4JYAI 2UXCI 1Z0TA 3JAMQ 4GKJE 2EN2A 4DV5E 4DPUA 1U2RA 2EN3A 2YSOA 2DIXA 1L4SA 2WP8B 1N34E 4JI3I 5K36A 4ZYDA 3ZKDA 4OO1A 4GEQB 4NHRA 5A6KA 2LBSB 2HJJA 2UUBE 5KL5A 1XHKA 3L7ZA 2PO1A 1TF3A 1B69A 1HNXE 4JI4E 2N3HA 4P7AA 4R2SA 4X64E 2LVHA 2EORA 2BV3A 1XNQI 3QT6A 1UDQA 4BC9A 2EOJA 2JWOA 2L2NA 4O43A 4DXLA 2YRHA 1XMQE 4IZJB 4ZVIA 3C4BA 4FWDA 2BM1A 4DR6I 4DV4I 3KZZA 3KZYA 2E5LE 5ADZA 2VQEI 3M85D 4TUGA 4QNJA 4JI5I 2JP9A 1A1FA 2JEBB 5KL3A 4DR2I 3PYEA 1KIJA 4LCFA 5LMUI 3EPLA 4BBYA 2UUCI 4B3SI 1DQ3A 4PRXA 4DPYA 4LF7E 2LTSA 3ADIA 2BR2B 1YZ9A 2L2MA 2EOMA 2NA2A 4O5GA 1O0WA 3LPSA 4MQYA 3P06A 5IXMB 4ZYGA 5FLXQ 1ZU1A 3BBGA 4X62E 2HFUA 5A2QC 1X47A 4MDTA 4FW6A 4MYUA 2EM0A 2PRTA 2EPOA 2RSMA 1UEKA 2EP3A 3HTXA 1J5EI 2B7TA 4USKA 2O1VA 1I94E 1ZBQA 2YPNA 4FW7A 2F1DA 2EN7A 4NZVA 4DR3I 1UDSA 1RMDA 2GQ0A 1N0UA 4XTJA 2MDRA 4M9VC 3ADLA 1Z1BA 2LJPA 1BKNA 2EMLA 2M7QA 2VE7C 3HPSA 3F6GA 4HTGA 3Q1QA 4B3MI 2C37A 5KL4A 2UXDI 3PS3A 3M6AA 1X6FA 4P52A 2V34A 5IWAI 4GQUA 4NXMI 3OTOI 4WPYA 4DV2E 2JVAA 3ECRA 1KVKA 2IOQA 2F4VI 4GKKI 2ENCA 4PU9A 4YHHI 2UU9E 2LCEA 2YSPA 5DRPA 4X65I 2L33A 5KL7A 3PYGA 2NUGA 1KTVA 4DR3E 5K36D 4BCAA 2YTOA 4OO1D 2UUAI 4NXME 4MLQA 1KJKA 4LPFA 4AIDA 4P7DA 4DUZI 3GLLA 4DR5I 3VYYA 5KL6A 4KWYA 4I8OA 2JOXA 4JI2I 3P76A 3P3CA 3T1HE 2YU5A 1PJQA 1YH8A 2HK2A 4M0VA 1WRJA 4LF6E 2NN6A 2KOUA 2MKDA 4JI8I 1ZAAC 2BBGA 2FTXB 2EN4A 2VRDA 1JK1A 2B9DA 3U1KA 2EM8A 1Z0CA 2ZM6I 1HNZI 1UDOA 1NHJA 2GLIA 4JI1E 2WP8A 5LL6R 4LFBI 4DR4E 1RHYA 4FW3A 2YTEA 4JI6E 4IS9A 2V8QB 2BM0A 2DLQA 2EOEA 2RQLA 1HNWE 1XNRI 2B7VA 5GMEA 2V8PA 5C0XB 3IWCA 5JEAB 1N3GA 4B3RE 1X3CA 1FNMA 3GCMA 1Z5BA 1YYOA 3FIGA 1N36E 1RR9A 1ZM3A 4DPTA 4DUYI 1MU5A 2DSYA 5GMDA 4F2JC 4AQYI 1FJGI 3EPJA 2BA0D 1A1JA 4DV5I 1N34I 3DF6A 1X48A 3P3GA 2JEBA 4LFAE 3AUZA 2EOYA 2UUBI 1T4LB 3D4JA 3B78A 1X6EA 3U1YA 2CTDA 2GHFA 2ADRA 1A1HA 2VESA 3GONA 5A6AA 1HNXI 4DV3E 2O1TA 2BR2A 4JI4I 2ZITA 4HXZA 2MC5A 3THOB 2L92A 4X64I 5F3WA 4MU0A 2PNLA 2CGEA 1WUUA 2PNZB 1PIEA 5AE1A 1XMQI 2DMYA 3HXLA 2V88A 4IZKB 2R1FA 1UN6B 1VI7A 2E5LI 2RSIA 2ELZA 3C4TA 2EM2A 4LFCE 5JEAE 3T1YE 2CSHA 2CG9A 4DMIA 2EOFA 1N33E 4USMA 4LCGA 2L3JA 2HKJA 3EQ1A 4LF7I 2JE6A 3QG5C 4DR7E 1WXRA 4F6NA 3PRYA 3V2UC 2NN6D 3LNUA 5BR8E 2I13A 2R3VA 5A69A 3K1JA 2V83A 2OI2A 4X62I 2JPAA 1MEYC 2LUQA 2Z5BB 4I3HA 1P42A 2HC5A 5IWAE 3EPKA 1IQOA 1GZ6A 5EKWA 3ZZUA 1I94I 4BA1A 1Z0VA 1FWKA 2VF1A 2EN6A 4MLVA 4Q35B 4P78A 4R8OA 1BBGA 1KKHA 3CDIA 4K0KI 1S4EA 3JAMC 2RS7A 5LMNE 1P47A 1MG7A 2NABA 4DKKA 4FW5A 2RPCA 4N3OA 2Z5CB 2EMAA 1HR0E 4IJDA 4DV6E 1NHHA 3QT7A 2LJHA 2FGGA 1QNTA 2EPNA 2IHR1 2YZTA 4R2CA 4WUBA 5DROA 2ODRC 2XEXA 1ZR9A 2YTQA 5FWKA 4DV2I 2EM3A 2LUPB 3QT5A 3M85G 2UU9I 3HULA 4LU9A 4WUCA 2EL5A 1RQ0A 1IBME 1J26A 2YRMA 1EH6A 4O4KA 1N32E 1IBLE 2ENHA 1T4NA 2A25A 2LE2A 4K0KE 2GPIA 3LLHA 4OOGC 1EKZA 4LCHA 4ISAA 3IWDA 4FWHA 2DGCA 4BC7A 2EMKA 2EZ6A 2O1UA 3DD6A 2EM7A 4NXNE 1YYWA 5T6JA 4LF9E 2L6MA 4IFDC 5DRQA 2EM6A 1OYPA 2EPLX 4KQVA 3T1HI 2EE8A 2EMZA 2EPXA 3HKMA 4LF4E 4LF6I 4IFDB 2WBTA 1USVA 2EPUA 1OYSA 1AH5A 1GTKA 1PKPA 4L5NC 2VQFE 2JT2A 3GMEA 1LLMC 5FLXC 1UILA 4R2RA 3M7ND 4DR1E 4OO1B 5K36B 1ZM2A 1DI2A 4YY3E 2CZ9A 4DU7A 4DU8A 4BA2A 1T38A 4WX9A 4HEIA 5C0XF 5JEAF 3HQ1A 1DGCA 2C39A 2PO1B 4M30A 5LLQA 4JI1I 5L3JA 3B8HA 2LO3A 3JU0A 4DR4I 3ZM7A 4QNKA 2GO4A 2PO2A 5AE3A 4JV5E 4JI6I 2E1RA 4R2EA 2EMYA 4WFTA 2HHHE 1HNWI 1IQSA 1YSAC 1Z5AA 2DB2A 1E3HA 2RS6A 2LT7A 4GZNC 4B3RI 3BGHA 1A1GA 4LOMA 2DEIA 1H7SA 1EH8A 1A1LA 1N36I 2PNZA 3B4TA 2JEAA 4LF5E 2X36A 2L8TA 2X7IA 2EM5A 4MU1A 1B63A 5A6BA 1DARA 3MHHC 4X66E 4IZKA 1ZM4A 4UTGA 4UT4A 5C0XC 1IMUA 5JEAC 1VISA 4F6MA 2YTPA 3PYFA 1WJPA 3L00A 1YYKA 3KRNA 1UHZA 4LFAI 2DLKA 4IFDE 3DJWA 3C6MA 4O24A 2HFSA 3ZKBA 4F54A 1Z59A 4DV3I 3C6KA 4OO1E 1Z5CA 4N4RB 1XMOE 3J81Q 4OX9E 5DNLA 3PYDA 4MU4A 4URLA 1K47A 2V85A 4M2ZA 1PVGA 3CWVA 1QZRA 2UXBE 2Q8UA 2L3CA 2HK3A 4IZJA 4DV0E 1H72C 2LV2A 3K17A 2FV4B 4J8ZA 4LFCI 1Y4SA 3T1YI 4BS9A 1OJ4A 4AM3A 1PJTA 5A6JA 3P3EA 4EMDA 1N33I 4R03A 2A2CA 3F6HA 1IBKE 4WUDA 2RTXA 2WBSA 4KHPE 4OZEA 2Z5CA 2LTRA 1FWLA 4DR7I 4DV7E 1OYRA 5BR8I 4JI7E 5DNXA 1X6HA 4JI0E 4FN5A 2EN8A 5DNYA 4R2PA 2PO0B 2YTJA 4WYQB 3WU3A 1YPNA 4MU3A 4IS1C 1D6TA 2JY9A 1Y5YA 5C0XE 2IESA 5AC4A 2DMIA 1T4OA 2EN1A 4LF8E 1ELOA 2J65A 2EL4A 1Y4UA 2D9HA 1R6LA 5LMNI 4ZYEA 2BB8A 2VF3A 2EOQA 1HR0I 4DV6I 4WXDA 4ZYHA 2AJ4A 1EA6A 2BA1G 2NN6B 2YTDA 2EPKX 4FK5C 3BF2A 2WZOA 3RMPA 2V86A 1G2DC 2LRSA 1EI1A 3ZOQB 5A6BD 2EM4A 2CPNA 3ZZTA 2JYAA 4IFDA 2EL6A 1IBMI 3MSWA 4HY1A 2EMXA 4X8WA 2EMBA 3J80C 4BMJA 1N32I 2EOXA 2V89A 1T39A 1IBLI 3TQMA 5A2QQ 3ADJA 4R2AA 2O1WA 2WNRB 2EOSA 3KWRA 4Q28A 4IFDF 4DV1E 2GO3A 1USUA 2C38B 5IV8B 2F8BA 4J3DA 4OKGA 4B3TE 4NXNI 4LF9I 4R2DA 4FWGA 1X49A 2YTNA 3AV0A 3HJCA 2JR1A 5K36F 2CVEA 2EMCA 1BB8A 2UXCE 4OO1F 4JYAE 2EMGA 3J7AM 1F2IG 3F0NA 2J7JA 4IZJD 4F9BB 2YWQA 5EL9A 1NHIA 4LF4I 3EPHA 1SFEA 2EMFA 1A1IA 4JI3E 2Q2EB 1X5WA 2YRKA 1H73A 2VQFI 5AE2A 4LTYA 2EOHA 4KZSA 4HACB 4HYMA 4DR1I 3Q6MA 4YY3I 3H09A 2NN6E 2DEJA 4U3DA 4TUIA 1UBDC 2LJUA 2EMWA 3BIDA 1NEIA 4F9CB 4JV5I 2E72A 2HHHI 1XNQE 4Z7YA 1STUA 1Z0BA 2MC6A 2K4VA 5C0XA 5K36C 2AE8A 3UK3C 1Z0GA 5JEAA 4WSPA 4DR6E 4OO1C 4DV4E 1SR9A 2EPZA 2ODRD 3VK6A 2VQEE 4JI5E 3VHTB 3NZKA 2V2ZA 1ZXMA 2EPRA 2Z5EA 1QU6A 4AIMA 4BHBA 5CFFE 1WHQA 4DR2E 4LF5I 4RHBB 3K6QA 2KONA 5LMUE 2J7KA 2UUCE 4B3SE 3L7ZB 3PS1A 4R2QA 4X66I 1MGTA 1ZBTA 2EOOA 2JE6B 2B3TB 3ADGA 2JOBA 4U3BA 5AASA 2EPMX 3ZZ0A 3WU6A 2N8XA 4JG4A 1PJSA 4L8NA 2O3ZA 3H4LA 1WHNA 4M1KA 2KHXA 1J5EE 1NZ0A 1N0VC 2L2KB 1A6FA 1YHCA 1ZXNA 2YTFA 2WW4A 1Z0WA 3Q6NA 3UHMA 3WU4A 4IFDD 4BA1B 1XMOI 4OX9I 2WBUA 3M7NG 2EPAA 2PNMA 4WXCA 3LMLA 2UXBI 1E3PA 2MDGA 1GQEA 4NBQA 2PO0A 2IERA 2DRPA 1NCSA 1A1KA 3VYXA 2EFGA 4DV0I 4Z7CA 4DPWA 1MX0A 1XXEA 2I9IA 3CDJA 5IT9Q 4B3ME 5KL2A 2LMZA 4RPFA 2R76A 2UXDE 1ZM9A 2K7IA 3PS2A 2YU8A
chains in the Genus database with same CATH topology
2NUFA 1H7UA 5IT9C 3OTOE 2M1SA 1IBKI 2F4VE 4GKKE 4KHPI 2V87A 4YHHE 4DV7I 3J7Yp 1RREA 3K85A 4X65E 4JI7I 4MYTA 3OMLA 4FW9A 4JI0I 2GS8A 4DPXA 1H74A 2A2DA 2Z5BA 3B82A 2UUAE 3WU5A 2M4IA 3J7AG 2V2QA 4DUZE 3HPZA 1B62A 4ED4A 4DR5E 3JTZA 2V2VA 4JI2E 4LF8I 2HKEA 3QT8A 2NPFA 4JI8E 1Y6ZA 2H36X 4F9AB 2ZM6E 2R42A 4PRVA 1HNZE 3LTOA 2IOPA 4GKJI 3IWBA 2G7HA 3V5RA 3J81C 4LFBE 2YT4A 1FI4A 4R1FA 4HACA 2NUEA 1XNRE 3P1XA 1RC7A 2ZBKB 2EWLA 2E1MA 1Z0EA 4DV1I 1HK7A 4B3TI 4AQYE 2N3GA 4DUYE 3J80Q 2UXCI 4JYAI 1S16A 1FJGE 1FKAE 1Z0TA 3JAMQ 4GKJE 4DV5E 4DPUA 1U2RA 2DIXA 1N34E 4JI3I 3ZKDA 4GEQB 2UUBE 1XHKA 2LBSB 1HNXE 4JI4E 2N3HA 4P7AA 4X64E 2BV3A 1XNQI 3QT6A 4BC9A 2L2NA 2JWOA 4DXLA 1XMQE 4IZJB 3C4BA 4FWDA 2BM1A 4DR6I 4DV4I 2E5LE 5ADZA 2VQEI 4JI5I 4TUGA 4DR2I 3PYEA 1KIJA 5LMUI 4BBYA 2UUCI 4B3SI 1DQ3A 4PRXA 4DPYA 4LF7E 2LTSA 3ADIA 1YZ9A 2L2MA 2NA2A 1O0WA 3LPSA 3P06A 5FLXQ 2HFUA 4X62E 4MYUA 5A2QC 1X47A 4ZVIA 1J5EI 2RSMA 1UEKA 3HTXA 2B7TA 4USKA 2O1VA 1I94E 1ZBQA 4DR3I 2GQ0A 1N0UA 4XTJA 3ADLA 2MDRA 2LJPA 1BKNA 2M7QA 2VE7C 3HPSA 3F6GA 3Q1QA 4B3MI 2UXDI 3M6AA 4P52A 2V34A 5IWAI 3OTOI 4WPYA 4DV2E 2JVAA 1KVKA 2IOQA 2F4VI 4GKKI 4PU9A 4YHHI 2UU9E 4X65I 2L33A 3PYGA 2NUGA 1KTVA 4DR3E 4BCAA 2UUAI 4NXME 4P7DA 4DUZI 4DR5I 3VYYA 4I8OA 2JOXA 4JI2I 3T1HE 2HK2A 4M0VA 4LF6E 2KOUA 4JI8I 2FTXB 2ZM6I 2B9DA 1Z0CA 1HNZI 1NHJA 4JI1E 5LL6R 4LFBI 4DR4E 4JI6E 2V8QB 2BM0A 1XNRI 1HNWE 2B7VA 5GMEA 2V8PA 3IWCA 4B3RE 1FNMA 1Z5BA 1YYOA 3FIGA 1N36E 1RR9A 1ZM3A 4DPTA 4DUYI 1MU5A 2DSYA 5GMDA 4AQYI 1FJGI 4DV5I 1N34I 3DF6A 1X48A 4LFAE 3AUZA 2UUBI 1T4LB 3D4JA 3B78A 3GONA 1HNXI 4DV3E 2O1TA 4JI4I 2ZITA 4HXZA 2MC5A 4X64I 2L92A 5F3WA 2PNLA 2CGEA 1WUUA 1PIEA 5AE1A 1XMQI 2DMYA 3HXLA 2V88A 4IZKB 2E5LI 3C4TA 4LFCE 3T1YE 2CG9A 4DMIA 4USMA 1N33E 2L3JA 2HKJA 4LF7I 4DR7E 1WXRA 3PRYA 3V2UC 3LNUA 5BR8E 2R3VA 3K1JA 2V83A 2OI2A 4X62I 2Z5BB 2LUQA 4I3HA 3ZZUA 1GZ6A 1I94I 1Z0VA 1FWKA 2VF1A 1KKHA 4P78A 4R8OA 4K0KI 1S4EA 3JAMC 2RS7A 5LMNE 1MG7A 4DKKA 4N3OA 2Z5CB 1HR0E 1NHHA 4DV6E 3QT7A 2LJHA 2FGGA 2YZTA 2IHR1 4WUBA 2ODRC 2XEXA 5FWKA 4DV2I 2LUPB 3QT5A 2UU9I 3HULA 4LU9A 4WUCA 1RQ0A 1IBME 1J26A 1N32E 1IBLE 4K0KE 1T4NA 2LE2A 4NXMI 3LLHA 4OOGC 1EKZA 3IWDA 4FWHA 4BC7A 2EZ6A 2O1UA 4NXNE 1YYWA 5T6JA 4LF9E 2L6MA 4KQVA 3T1HI 4LF4E 4LF6I 1USVA 1PKPA 4L5NC 2VQFE 5FLXC 1UILA 4DR1E 1ZM2A 1DI2A 4YY3E 2CZ9A 4DU7A 4DU8A 5IT9Q 3HQ1A 4M30A 4JI1I 5L3JA 3B8HA 4DR4I 3JU0A 3ZM7A 4JI6I 5AE3A 4JV5E 2E1RA 2HHHE 4WFTA 1HNWI 1Z5AA 2DB2A 2RS6A 4B3RI 2DEIA 1H7SA 1N36I 4LF5E 2X36A 2L8TA 2X7IA 1B63A 1DARA 4X66E 4IZKA 1ZM4A 4UTGA 4UT4A 1VISA 3PYFA 1YYKA 1UHZA 4LFAI 3DJWA 2HFSA 3ZKBA 4F54A 1Z59A 4DV3I 1Z5CA 1XMOE 3J81Q 4OX9E 3PYDA 4URLA 1K47A 2V85A 4M2ZA 1PVGA 3CWVA 1QZRA 2UXBE 2L3CA 2HK3A 4IZJA 4DV0E 1H72C 3K17A 2FV4B 4J8ZA 4LFCI 1Y4SA 3T1YI 4BS9A 1OJ4A 4EMDA 1N33I 4R03A 2A2CA 3F6HA 1IBKE 4WUDA 2RTXA 4KHPE 2Z5CA 2LTRA 1FWLA 4DR7I 4DV7E 5BR8I 4JI7E 4FN5A 4JI0E 5DNYA 4WYQB 3WU3A 1D6TA 2JY9A 1T4OA 4LF8E 1ELOA 1Y4UA 5LMNI 2VF3A 1HR0I 4DV6I 2AJ4A 1EA6A 2WZOA 3RMPA 2V86A 2LRSA 1EI1A 3ZOQB 2CPNA 3ZZTA 1IBMI 3MSWA 4HY1A 4X8WA 3J80C 4BMJA 1N32I 2V89A 1IBLI 5A2QQ 3ADJA 2O1WA 3KWRA 4Q28A 4DV1E 1USUA 2F8BA 4NXNI 4B3TE 4LF9I 4FWGA 1X49A 3HJCA 3AV0A 2JR1A 2UXCE 4JYAE 3J7AM 3F0NA 4IZJD 4F9BB 1NHIA 4LF4I 2Q2EB 4JI3E 1H73A 2VQFI 5AE2A 4LTYA 4HYMA 4KZSA 4HACB 4DR1I 3Q6MA 4YY3I 3H09A 2DEJA 4TUIA 4F9CB 4JV5I 2HHHI 1XNQE 4Z7YA 1STUA 1Z0BA 2MC6A 2K4VA 1Z0GA 4WSPA 4DR6E 4DV4E 1SR9A 2ODRD 2VQEE 3VK6A 4JI5E 2V2ZA 1ZXMA 2Z5EA 1QU6A 4LF5I 5CFFE 4DR2E 1WHQA 3K6QA 2KONA 5LMUE 2J7KA 2UUCE 4B3SE 4X66I 1ZBTA 2B3TB 3ADGA 2JOBA 5AASA 3ZZ0A 3WU6A 4JG4A 4L8NA 3H4LA 1WHNA 4M1KA 2KHXA 1J5EE 1NZ0A 1N0VC 2L2KB 1A6FA 1ZXNA 2WW4A 3Q6NA 3WU4A 1Z0WA 1XMOI 4OX9I 2PNMA 3LMLA 2UXBI 1GQEA 2EFGA 3VYXA 4DV0I 4Z7CA 4DPWA 1MX0A 4B3ME 4RPFA 2LMZA 2UXDE 1ZM9A 5IWAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUF A;  1H7U A;  5IT9 C;  3OTO E;  1IBK I;  2F4V E;  4GKK E;  4KHP I;  4YHH E;  4DV7 I;  3J7Y p;  1RRE A;  4X65 E;  4JI7 I;  4MYT A;  4FW9 A;  4JI0 I;  2GS8 A;  4DPX A;  1H74 A;  2A2D A;  3B82 A;  2UUA E;  3WU5 A;  3J7A G;  2V2Q A;  4DUZ E;  1B62 A;  4ED4 A;  4DR5 E;  2V2V A;  4JI2 E;  4LF8 I;  2HKE A;  3QT8 A;  2NPF A;  4JI8 E;  2ZM6 E;  2R42 A;  4PRV A;  1HNZ E;  3LTO A;  4GKJ I;  3V5R A;  3J81 C;  4LFB E;  2YT4 A;  1FI4 A;  4R1F A;  4HAC A;  2NUE A;  1XNR E;  3P1X A;  1RC7 A;  2ZBK B;  1Z0E A;  4DV1 I;  4B3T I;  4AQY E;  2N3G A;  4DUY E;  3J80 Q;  2UXC I;  4JYA I;  1S16 A;  1FJG E;  1FKA E;  1Z0T A;  3JAM Q;  4GKJ E;  4DV5 E;  4DPU A;  1U2R A;  2DIX A;  1N34 E;  4JI3 I;  3ZKD A;  2UUB E;  1XHK A;  2LBS B;  1HNX E;  4JI4 E;  2N3H A;  4P7A A;  4X64 E;  2BV3 A;  1XNQ I;  3QT6 A;  2L2N A;  4DXL A;  1XMQ E;  3C4B A;  4FWD A;  2BM1 A;  4DR6 I;  4DV4 I;  2E5L E;  4JI5 I;  2VQE I;  4DR2 I;  3PYE A;  1KIJ A;  5LMU I;  2UUC I;  4B3S I;  4PRX A;  4DPY A;  4LF7 E;  2LTS A;  3ADI A;  1YZ9 A;  2L2M A;  2NA2 A;  1O0W A;  3LPS A;  5FLX Q;  2HFU A;  4X62 E;  4MYU A;  4ZVI A;  1X47 A;  5A2Q C;  1J5E I;  2RSM A;  1UEK A;  3HTX A;  2B7T A;  4USK A;  1I94 E;  4DR3 I;  1N0U A;  4XTJ A;  3ADL A;  2MDR A;  2LJP A;  1BKN A;  3Q1Q A;  4B3M I;  2UXD I;  3M6A A;  4P52 A;  2V34 A;  5IWA I;  3OTO I;  4DV2 E;  2JVA A;  1KVK A;  2F4V I;  4GKK I;  4PU9 A;  4YHH I;  2UU9 E;  4X65 I;  2L33 A;  3PYG A;  2NUG A;  1KTV A;  4DR3 E;  2UUA I;  4NXM E;  4DUZ I;  4DR5 I;  3VYY A;  4JI2 I;  3T1H E;  2HK2 A;  4LF6 E;  4JI8 I;  2ZM6 I;  1Z0C A;  1HNZ I;  1NHJ A;  4JI1 E;  5LL6 R;  4LFB I;  4DR4 E;  4JI6 E;  2BM0 A;  1XNR I;  1HNW E;  2B7V A;  5GME A;  2V8P A;  4B3R E;  1FNM A;  1Z5B A;  1YYO A;  1ZM3 A;  1N36 E;  1RR9 A;  4DUY I;  4DPT A;  4AQY I;  1MU5 A;  5GMD A;  1FJG I;  4DV5 I;  1N34 I;  1X48 A;  4LFA E;  2UUB I;  1T4L B;  3D4J A;  3B78 A;  3GON A;  1HNX I;  4DV3 E;  4JI4 I;  2ZIT A;  4HXZ A;  4X64 I;  1WUU A;  1PIE A;  1XMQ I;  2DMY A;  2E5L I;  3C4T A;  4LFC E;  3T1Y E;  4USM A;  1N33 E;  2L3J A;  2HKJ A;  4LF7 I;  4DR7 E;  3V2U C;  3LNU A;  5BR8 E;  2R3V A;  3K1J A;  2OI2 A;  4X62 I;  2LUQ A;  4I3H A;  3ZZU A;  1I94 I;  1Z0V A;  1FWK A;  1KKH A;  4K0K I;  1S4E A;  3JAM C;  2RS7 A;  5LMN E;  1MG7 A;  4DKK A;  1HR0 E;  1NHH A;  4DV6 E;  3QT7 A;  2LJH A;  2IHR 1;  4WUB A;  2XEX A;  4DV2 I;  2LUP B;  3QT5 A;  2UU9 I;  3HUL A;  4WUC A;  1RQ0 A;  1IBM E;  1J26 A;  1N32 E;  1IBL E;  4K0K E;  1T4N A;  4NXM I;  3LLH A;  4OOG C;  1EKZ A;  4FWH A;  2EZ6 A;  4NXN E;  1YYW A;  4LF9 E;  4KQV A;  3T1H I;  4LF4 E;  4LF6 I;  1PKP A;  2VQF E;  5FLX C;  1UIL A;  4DR1 E;  1ZM2 A;  1DI2 A;  4YY3 E;  2CZ9 A;  4DU7 A;  4DU8 A;  5IT9 Q;  4M30 A;  4JI1 I;  5L3J A;  3B8H A;  4DR4 I;  3ZM7 A;  4JI6 I;  4JV5 E;  2E1R A;  2HHH E;  4WFT A;  1HNW I;  1Z5A A;  2DB2 A;  2RS6 A;  4B3R I;  2DEI A;  1H7S A;  1N36 I;  4LF5 E;  2X36 A;  2X7I A;  1B63 A;  1DAR A;  4X66 E;  1ZM4 A;  4UTG A;  4UT4 A;  1VIS A;  3PYF A;  1YYK A;  1UHZ A;  4LFA I;  2HFS A;  3ZKB A;  1Z59 A;  4DV3 I;  1Z5C A;  1XMO E;  3J81 Q;  4OX9 E;  3PYD A;  4URL A;  1K47 A;  4M2Z A;  1PVG A;  3CWV A;  1QZR A;  2UXB E;  2L3C A;  2HK3 A;  4DV0 E;  1H72 C;  3K17 A;  4LFC I;  3T1Y I;  1OJ4 A;  4EMD A;  1N33 I;  2A2C A;  1IBK E;  4WUD A;  2RTX A;  4KHP E;  2LTR A;  1FWL A;  4DR7 I;  4DV7 E;  5BR8 I;  4JI7 E;  4FN5 A;  4JI0 E;  4WYQ B;  3WU3 A;  1D6T A;  2JY9 A;  1T4O A;  4LF8 E;  1ELO A;  5LMN I;  2VF3 A;  1HR0 I;  4DV6 I;  2AJ4 A;  1EA6 A;  2LRS A;  1EI1 A;  2CPN A;  3ZZT A;  1IBM I;  4HY1 A;  4X8W A;  3J80 C;  1N32 I;  1IBL I;  5A2Q Q;  3ADJ A;  4DV1 E;  4NXN I;  4B3T E;  4LF9 I;  4FWG A;  1X49 A;  2UXC E;  4JYA E;  3J7A M;  3F0N A;  1NHI A;  4LF4 I;  2Q2E B;  4JI3 E;  1H73 A;  2VQF I;  4HYM A;  4HAC B;  4DR1 I;  4YY3 I;  2DEJ A;  4JV5 I;  2HHH I;  1XNQ E;  4Z7Y A;  1STU A;  1Z0B A;  1Z0G A;  4DR6 E;  4DV4 E;  4JI5 E;  2VQE E;  2V2Z A;  1ZXM A;  1QU6 A;  4LF5 I;  5CFF E;  4DR2 E;  1WHQ A;  5LMU E;  2J7K A;  2UUC E;  4B3S E;  4X66 I;  1ZBT A;  2B3T B;  3ADG A;  3ZZ0 A;  3WU6 A;  4JG4 A;  3H4L A;  1WHN A;  4M1K A;  1NZ0 A;  1ZXN A;  2KHX A;  1J5E E;  2L2K B;  1A6F A;  1N0V C;  2WW4 A;  3WU4 A;  1Z0W A;  1XMO I;  4OX9 I;  2UXB I;  1GQE A;  2EFG A;  3VYX A;  4DV0 I;  4Z7C A;  4DPW A;  1MX0 A;  4B3M E;  4RPF A;  2UXD E;  1ZM9 A;  5IWA E; 
#chains in the Genus database with same CATH topology
 2NUF A;  1H7U A;  1EH7 A;  2ELY A;  3OTO E;  5IT9 C;  2M1S A;  2YTG A;  1IBK I;  2F4V E;  2EOZ A;  4GKK E;  4KHP I;  2V87 A;  4YHH E;  1YFH A;  5K36 E;  4DV7 I;  3J7Y p;  1RRE A;  3K85 A;  3THN A;  4X65 E;  4FW4 A;  4JI7 I;  4MYT A;  3OML A;  4FW9 A;  4JI0 I;  1YUJ A;  2GS8 A;  4DPX A;  2YTI A;  1G2F C;  5AC5 A;  1H74 A;  2UUA E;  2A2D A;  2M4I A;  1YUI A;  2Z5B A;  3B82 A;  3J7A G;  2CT1 A;  3WU5 A;  2V2Q A;  4DUZ E;  3HPZ A;  3MHS C;  1JK2 A;  1B62 A;  4DR5 E;  4ED4 A;  3JTZ A;  2HGH A;  2NN6 F;  2V2V A;  2C37 B;  4JI2 E;  3H1C A;  2EPP A;  4X9J A;  4LF8 I;  1KYQ A;  2EQ1 A;  5C0X D;  2EQ0 A;  2MKN A;  2HKE A;  3QT8 A;  5JEA D;  2WNR A;  2NPF A;  2EQ3 A;  2C38 A;  2JXP A;  2EPC A;  2M9A A;  2ENA A;  1PDA A;  4JI8 E;  1Y6Z A;  2BA0 G;  2H36 X;  4F9A B;  2ZM6 E;  2R42 A;  4PRV A;  4BA2 B;  1HNZ E;  3LTO A;  2IOP A;  4GKJ I;  1TF6 A;  3IWB A;  2C39 B;  4WSG A;  2G7H A;  4BHC A;  3V5R A;  3J81 C;  1TN9 A;  4LFB E;  2YT4 A;  5DRR A;  1Y60 A;  1FI4 A;  2EOI A;  2PO2 B;  4R1F A;  4HAC A;  2NUE A;  2EM9 A;  1BBO A;  2NN6 C;  1XNR E;  2EJ4 A;  3P1X A;  1RC7 A;  5ELW A;  2ZBK B;  2EWL A;  2E1M A;  1R6M A;  1Z0E A;  1UDN A;  1AAY A;  1HK7 A;  4DV1 I;  5TSE A;  4B3T I;  2WCC 3;  3M99 B;  4AQY E;  2N3G A;  4RH8 A;  2EMI A;  2EMH A;  4DUY E;  2BA1 D;  1S16 A;  3J80 Q;  2JEA B;  1FJG E;  1FKA E;  4JYA I;  2UXC I;  1Z0T A;  3JAM Q;  4GKJ E;  2EN2 A;  4DV5 E;  4DPU A;  1U2R A;  2EN3 A;  2YSO A;  2DIX A;  1L4S A;  2WP8 B;  1N34 E;  4JI3 I;  5K36 A;  4ZYD A;  3ZKD A;  4OO1 A;  4GEQ B;  4NHR A;  5A6K A;  2LBS B;  2HJJ A;  2UUB E;  5KL5 A;  1XHK A;  3L7Z A;  2PO1 A;  1TF3 A;  1B69 A;  1HNX E;  4JI4 E;  2N3H A;  4P7A A;  4R2S A;  4X64 E;  2LVH A;  2EOR A;  2BV3 A;  1XNQ I;  3QT6 A;  1UDQ A;  4BC9 A;  2EOJ A;  2JWO A;  2L2N A;  4O43 A;  4DXL A;  2YRH A;  1XMQ E;  4IZJ B;  4ZVI A;  3C4B A;  4FWD A;  2BM1 A;  4DR6 I;  4DV4 I;  3KZZ A;  3KZY A;  2E5L E;  5ADZ A;  2VQE I;  3M85 D;  4TUG A;  4QNJ A;  4JI5 I;  2JP9 A;  1A1F A;  2JEB B;  5KL3 A;  4DR2 I;  3PYE A;  1KIJ A;  4LCF A;  5LMU I;  3EPL A;  4BBY A;  2UUC I;  4B3S I;  1DQ3 A;  4PRX A;  4DPY A;  4LF7 E;  2LTS A;  3ADI A;  2BR2 B;  1YZ9 A;  2L2M A;  2EOM A;  2NA2 A;  4O5G A;  1O0W A;  3LPS A;  4MQY A;  3P06 A;  5IXM B;  4ZYG A;  5FLX Q;  1ZU1 A;  3BBG A;  4X62 E;  2HFU A;  5A2Q C;  1X47 A;  4MDT A;  4FW6 A;  4MYU A;  2EM0 A;  2PRT A;  2EPO A;  2RSM A;  1UEK A;  2EP3 A;  3HTX A;  1J5E I;  2B7T A;  4USK A;  2O1V A;  1I94 E;  1ZBQ A;  2YPN A;  4FW7 A;  2F1D A;  2EN7 A;  4NZV A;  4DR3 I;  1UDS A;  1RMD A;  2GQ0 A;  1N0U A;  4XTJ A;  2MDR A;  4M9V C;  3ADL A;  1Z1B A;  2LJP A;  1BKN A;  2EML A;  2M7Q A;  2VE7 C;  3HPS A;  3F6G A;  4HTG A;  3Q1Q A;  4B3M I;  2C37 A;  5KL4 A;  2UXD I;  3PS3 A;  3M6A A;  1X6F A;  4P52 A;  2V34 A;  5IWA I;  4GQU A;  4NXM I;  3OTO I;  4WPY A;  4DV2 E;  2JVA A;  3ECR A;  1KVK A;  2IOQ A;  2F4V I;  4GKK I;  2ENC A;  4PU9 A;  4YHH I;  2UU9 E;  2LCE A;  2YSP A;  5DRP A;  4X65 I;  2L33 A;  5KL7 A;  3PYG A;  2NUG A;  1KTV A;  4DR3 E;  5K36 D;  4BCA A;  2YTO A;  4OO1 D;  2UUA I;  4NXM E;  4MLQ A;  1KJK A;  4LPF A;  4AID A;  4P7D A;  4DUZ I;  3GLL A;  4DR5 I;  3VYY A;  5KL6 A;  4KWY A;  4I8O A;  2JOX A;  4JI2 I;  3P76 A;  3P3C A;  3T1H E;  2YU5 A;  1PJQ A;  1YH8 A;  2HK2 A;  4M0V A;  1WRJ A;  4LF6 E;  2NN6 A;  2KOU A;  2MKD A;  4JI8 I;  1ZAA C;  2BBG A;  2FTX B;  2EN4 A;  2VRD A;  1JK1 A;  2B9D A;  3U1K A;  2EM8 A;  1Z0C A;  2ZM6 I;  1HNZ I;  1UDO A;  1NHJ A;  2GLI A;  4JI1 E;  2WP8 A;  5LL6 R;  4LFB I;  4DR4 E;  1RHY A;  4FW3 A;  2YTE A;  4JI6 E;  4IS9 A;  2V8Q B;  2BM0 A;  2DLQ A;  2EOE A;  2RQL A;  1HNW E;  1XNR I;  2B7V A;  5GME A;  2V8P A;  5C0X B;  3IWC A;  5JEA B;  1N3G A;  4B3R E;  1X3C A;  1FNM A;  3GCM A;  1Z5B A;  1YYO A;  3FIG A;  1N36 E;  1RR9 A;  1ZM3 A;  4DPT A;  4DUY I;  1MU5 A;  2DSY A;  5GMD A;  4F2J C;  4AQY I;  1FJG I;  3EPJ A;  2BA0 D;  1A1J A;  4DV5 I;  1N34 I;  3DF6 A;  1X48 A;  3P3G A;  2JEB A;  4LFA E;  3AUZ A;  2EOY A;  2UUB I;  1T4L B;  3D4J A;  3B78 A;  1X6E A;  3U1Y A;  2CTD A;  2GHF A;  2ADR A;  1A1H A;  2VES A;  3GON A;  5A6A A;  1HNX I;  4DV3 E;  2O1T A;  2BR2 A;  4JI4 I;  2ZIT A;  4HXZ A;  2MC5 A;  3THO B;  2L92 A;  4X64 I;  5F3W A;  4MU0 A;  2PNL A;  2CGE A;  1WUU A;  2PNZ B;  1PIE A;  5AE1 A;  1XMQ I;  2DMY A;  3HXL A;  2V88 A;  4IZK B;  2R1F A;  1UN6 B;  1VI7 A;  2E5L I;  2RSI A;  2ELZ A;  3C4T A;  2EM2 A;  4LFC E;  5JEA E;  3T1Y E;  2CSH A;  2CG9 A;  4DMI A;  2EOF A;  1N33 E;  4USM A;  4LCG A;  2L3J A;  2HKJ A;  3EQ1 A;  4LF7 I;  2JE6 A;  3QG5 C;  4DR7 E;  1WXR A;  4F6N A;  3PRY A;  3V2U C;  2NN6 D;  3LNU A;  5BR8 E;  2I13 A;  2R3V A;  5A69 A;  3K1J A;  2V83 A;  2OI2 A;  4X62 I;  2JPA A;  1MEY C;  2LUQ A;  2Z5B B;  4I3H A;  1P42 A;  2HC5 A;  5IWA E;  3EPK A;  1IQO A;  1GZ6 A;  5EKW A;  3ZZU A;  1I94 I;  4BA1 A;  1Z0V A;  1FWK A;  2VF1 A;  2EN6 A;  4MLV A;  4Q35 B;  4P78 A;  4R8O A;  1BBG A;  1KKH A;  3CDI A;  4K0K I;  1S4E A;  3JAM C;  2RS7 A;  5LMN E;  1P47 A;  1MG7 A;  2NAB A;  4DKK A;  4FW5 A;  2RPC A;  4N3O A;  2Z5C B;  2EMA A;  1HR0 E;  4IJD A;  4DV6 E;  1NHH A;  3QT7 A;  2LJH A;  2FGG A;  1QNT A;  2EPN A;  2IHR 1;  2YZT A;  4R2C A;  4WUB A;  5DRO A;  2ODR C;  2XEX A;  1ZR9 A;  2YTQ A;  5FWK A;  4DV2 I;  2EM3 A;  2LUP B;  3QT5 A;  3M85 G;  2UU9 I;  3HUL A;  4LU9 A;  4WUC A;  2EL5 A;  1RQ0 A;  1IBM E;  1J26 A;  2YRM A;  1EH6 A;  4O4K A;  1N32 E;  1IBL E;  2ENH A;  1T4N A;  2A25 A;  2LE2 A;  4K0K E;  2GPI A;  3LLH A;  4OOG C;  1EKZ A;  4LCH A;  4ISA A;  3IWD A;  4FWH A;  2DGC A;  4BC7 A;  2EMK A;  2EZ6 A;  2O1U A;  3DD6 A;  2EM7 A;  4NXN E;  1YYW A;  5T6J A;  4LF9 E;  2L6M A;  4IFD C;  5DRQ A;  2EM6 A;  1OYP A;  2EPL X;  4KQV A;  3T1H I;  2EE8 A;  2EMZ A;  2EPX A;  3HKM A;  4LF4 E;  4LF6 I;  4IFD B;  2WBT A;  1USV A;  2EPU A;  1OYS A;  1AH5 A;  1GTK A;  1PKP A;  4L5N C;  2VQF E;  2JT2 A;  3GME A;  1LLM C;  5FLX C;  1UIL A;  4R2R A;  3M7N D;  4DR1 E;  4OO1 B;  5K36 B;  1ZM2 A;  1DI2 A;  4YY3 E;  2CZ9 A;  4DU7 A;  4DU8 A;  4BA2 A;  1T38 A;  4WX9 A;  4HEI A;  5C0X F;  5JEA F;  3HQ1 A;  1DGC A;  2C39 A;  2PO1 B;  4M30 A;  5LLQ A;  4JI1 I;  5L3J A;  3B8H A;  2LO3 A;  3JU0 A;  4DR4 I;  3ZM7 A;  4QNK A;  2GO4 A;  2PO2 A;  5AE3 A;  4JV5 E;  4JI6 I;  2E1R A;  4R2E A;  2EMY A;  4WFT A;  2HHH E;  1HNW I;  1IQS A;  1YSA C;  1Z5A A;  2DB2 A;  1E3H A;  2RS6 A;  2LT7 A;  4GZN C;  4B3R I;  3BGH A;  1A1G A;  4LOM A;  2DEI A;  1H7S A;  1EH8 A;  1A1L A;  1N36 I;  2PNZ A;  3B4T A;  2JEA A;  4LF5 E;  2X36 A;  2L8T A;  2X7I A;  2EM5 A;  4MU1 A;  1B63 A;  5A6B A;  1DAR A;  3MHH C;  4X66 E;  4IZK A;  1ZM4 A;  4UTG A;  4UT4 A;  5C0X C;  1IMU A;  5JEA C;  1VIS A;  4F6M A;  2YTP A;  3PYF A;  1WJP A;  3L00 A;  1YYK A;  3KRN A;  1UHZ A;  4LFA I;  2DLK A;  4IFD E;  3DJW A;  3C6M A;  4O24 A;  2HFS A;  3ZKB A;  4F54 A;  1Z59 A;  4DV3 I;  3C6K A;  4OO1 E;  1Z5C A;  4N4R B;  1XMO E;  3J81 Q;  4OX9 E;  5DNL A;  3PYD A;  4MU4 A;  4URL A;  1K47 A;  2V85 A;  4M2Z A;  1PVG A;  3CWV A;  1QZR A;  2UXB E;  2Q8U A;  2L3C A;  2HK3 A;  4IZJ A;  4DV0 E;  1H72 C;  2LV2 A;  3K17 A;  2FV4 B;  4J8Z A;  4LFC I;  1Y4S A;  3T1Y I;  4BS9 A;  1OJ4 A;  4AM3 A;  1PJT A;  5A6J A;  3P3E A;  4EMD A;  1N33 I;  4R03 A;  2A2C A;  3F6H A;  1IBK E;  4WUD A;  2RTX A;  2WBS A;  4KHP E;  4OZE A;  2Z5C A;  2LTR A;  1FWL A;  4DR7 I;  4DV7 E;  1OYR A;  5BR8 I;  4JI7 E;  5DNX A;  1X6H A;  4JI0 E;  4FN5 A;  2EN8 A;  5DNY A;  4R2P A;  2PO0 B;  2YTJ A;  4WYQ B;  3WU3 A;  1YPN A;  4MU3 A;  4IS1 C;  1D6T A;  2JY9 A;  1Y5Y A;  5C0X E;  2IES A;  5AC4 A;  2DMI A;  1T4O A;  2EN1 A;  4LF8 E;  1ELO A;  2J65 A;  2EL4 A;  1Y4U A;  2D9H A;  1R6L A;  5LMN I;  4ZYE A;  2BB8 A;  2VF3 A;  2EOQ A;  1HR0 I;  4DV6 I;  4WXD A;  4ZYH A;  2AJ4 A;  1EA6 A;  2BA1 G;  2NN6 B;  2YTD A;  2EPK X;  4FK5 C;  3BF2 A;  2WZO A;  3RMP A;  2V86 A;  1G2D C;  2LRS A;  1EI1 A;  3ZOQ B;  5A6B D;  2EM4 A;  2CPN A;  3ZZT A;  2JYA A;  4IFD A;  2EL6 A;  1IBM I;  3MSW A;  4HY1 A;  2EMX A;  4X8W A;  2EMB A;  3J80 C;  4BMJ A;  1N32 I;  2EOX A;  2V89 A;  1T39 A;  1IBL I;  3TQM A;  5A2Q Q;  3ADJ A;  4R2A A;  2O1W A;  2WNR B;  2EOS A;  3KWR A;  4Q28 A;  4IFD F;  4DV1 E;  2GO3 A;  1USU A;  2C38 B;  5IV8 B;  2F8B A;  4J3D A;  4OKG A;  4B3T E;  4NXN I;  4LF9 I;  4R2D A;  4FWG A;  1X49 A;  2YTN A;  3AV0 A;  3HJC A;  2JR1 A;  5K36 F;  2CVE A;  2EMC A;  1BB8 A;  2UXC E;  4OO1 F;  4JYA E;  2EMG A;  3J7A M;  1F2I G;  3F0N A;  2J7J A;  4IZJ D;  4F9B B;  2YWQ A;  5EL9 A;  1NHI A;  4LF4 I;  3EPH A;  1SFE A;  2EMF A;  1A1I A;  4JI3 E;  2Q2E B;  1X5W A;  2YRK A;  1H73 A;  2VQF I;  5AE2 A;  4LTY A;  2EOH A;  4KZS A;  4HAC B;  4HYM A;  4DR1 I;  3Q6M A;  4YY3 I;  3H09 A;  2NN6 E;  2DEJ A;  4U3D A;  4TUI A;  1UBD C;  2LJU A;  2EMW A;  3BID A;  1NEI A;  4F9C B;  4JV5 I;  2E72 A;  2HHH I;  1XNQ E;  4Z7Y A;  1STU A;  1Z0B A;  2MC6 A;  2K4V A;  5C0X A;  5K36 C;  2AE8 A;  3UK3 C;  1Z0G A;  5JEA A;  4WSP A;  4DR6 E;  4OO1 C;  4DV4 E;  1SR9 A;  2EPZ A;  2ODR D;  3VK6 A;  2VQE E;  4JI5 E;  3VHT B;  3NZK A;  2V2Z A;  1ZXM A;  2EPR A;  2Z5E A;  1QU6 A;  4AIM A;  4BHB A;  5CFF E;  1WHQ A;  4DR2 E;  4LF5 I;  4RHB B;  3K6Q A;  2KON A;  5LMU E;  2J7K A;  2UUC E;  4B3S E;  3L7Z B;  3PS1 A;  4R2Q A;  4X66 I;  1MGT A;  1ZBT A;  2EOO A;  2JE6 B;  2B3T B;  3ADG A;  2JOB A;  4U3B A;  5AAS A;  2EPM X;  3ZZ0 A;  3WU6 A;  2N8X A;  4JG4 A;  1PJS A;  4L8N A;  2O3Z A;  3H4L A;  1WHN A;  4M1K A;  2KHX A;  1J5E E;  1NZ0 A;  1N0V C;  2L2K B;  1A6F A;  1YHC A;  1ZXN A;  2YTF A;  2WW4 A;  1Z0W A;  3Q6N A;  3UHM A;  3WU4 A;  4IFD D;  4BA1 B;  1XMO I;  4OX9 I;  2WBU A;  3M7N G;  2EPA A;  2PNM A;  4WXC A;  3LML A;  2UXB I;  1E3P A;  2MDG A;  1GQE A;  4NBQ A;  2PO0 A;  2IER A;  2DRP A;  1NCS A;  1A1K A;  3VYX A;  2EFG A;  4DV0 I;  4Z7C A;  4DPW A;  1MX0 A;  1XXE A;  2I9I A;  3CDJ A;  5IT9 Q;  4B3M E;  5KL2 A;  2LMZ A;  4RPF A;  2R76 A;  2UXD E;  1ZM9 A;  2K7I A;  3PS2 A;  2YU8 A; 
#chains in the Genus database with same CATH homology
 2NUF A;  1H7U A;  5IT9 C;  3OTO E;  2M1S A;  1IBK I;  2F4V E;  4GKK E;  4KHP I;  2V87 A;  4YHH E;  4DV7 I;  3J7Y p;  1RRE A;  3K85 A;  4X65 E;  4JI7 I;  4MYT A;  3OML A;  4FW9 A;  4JI0 I;  2GS8 A;  4DPX A;  1H74 A;  2A2D A;  2Z5B A;  3B82 A;  2UUA E;  3WU5 A;  2M4I A;  3J7A G;  2V2Q A;  4DUZ E;  3HPZ A;  1B62 A;  4ED4 A;  4DR5 E;  3JTZ A;  2V2V A;  4JI2 E;  4LF8 I;  2HKE A;  3QT8 A;  2NPF A;  4JI8 E;  1Y6Z A;  2H36 X;  4F9A B;  2ZM6 E;  2R42 A;  4PRV A;  1HNZ E;  3LTO A;  2IOP A;  4GKJ I;  3IWB A;  2G7H A;  3V5R A;  3J81 C;  4LFB E;  2YT4 A;  1FI4 A;  4R1F A;  4HAC A;  2NUE A;  1XNR E;  3P1X A;  1RC7 A;  2ZBK B;  2EWL A;  2E1M A;  1Z0E A;  4DV1 I;  1HK7 A;  4B3T I;  4AQY E;  2N3G A;  4DUY E;  3J80 Q;  2UXC I;  4JYA I;  1S16 A;  1FJG E;  1FKA E;  1Z0T A;  3JAM Q;  4GKJ E;  4DV5 E;  4DPU A;  1U2R A;  2DIX A;  1N34 E;  4JI3 I;  3ZKD A;  4GEQ B;  2UUB E;  1XHK A;  2LBS B;  1HNX E;  4JI4 E;  2N3H A;  4P7A A;  4X64 E;  2BV3 A;  1XNQ I;  3QT6 A;  4BC9 A;  2L2N A;  2JWO A;  4DXL A;  1XMQ E;  4IZJ B;  3C4B A;  4FWD A;  2BM1 A;  4DR6 I;  4DV4 I;  2E5L E;  5ADZ A;  2VQE I;  4JI5 I;  4TUG A;  4DR2 I;  3PYE A;  1KIJ A;  5LMU I;  4BBY A;  2UUC I;  4B3S I;  1DQ3 A;  4PRX A;  4DPY A;  4LF7 E;  2LTS A;  3ADI A;  1YZ9 A;  2L2M A;  2NA2 A;  1O0W A;  3LPS A;  3P06 A;  5FLX Q;  2HFU A;  4X62 E;  4MYU A;  5A2Q C;  1X47 A;  4ZVI A;  1J5E I;  2RSM A;  1UEK A;  3HTX A;  2B7T A;  4USK A;  2O1V A;  1I94 E;  1ZBQ A;  4DR3 I;  2GQ0 A;  1N0U A;  4XTJ A;  3ADL A;  2MDR A;  2LJP A;  1BKN A;  2M7Q A;  2VE7 C;  3HPS A;  3F6G A;  3Q1Q A;  4B3M I;  2UXD I;  3M6A A;  4P52 A;  2V34 A;  5IWA I;  3OTO I;  4WPY A;  4DV2 E;  2JVA A;  1KVK A;  2IOQ A;  2F4V I;  4GKK I;  4PU9 A;  4YHH I;  2UU9 E;  4X65 I;  2L33 A;  3PYG A;  2NUG A;  1KTV A;  4DR3 E;  4BCA A;  2UUA I;  4NXM E;  4P7D A;  4DUZ I;  4DR5 I;  3VYY A;  4I8O A;  2JOX A;  4JI2 I;  3T1H E;  2HK2 A;  4M0V A;  4LF6 E;  2KOU A;  4JI8 I;  2FTX B;  2ZM6 I;  2B9D A;  1Z0C A;  1HNZ I;  1NHJ A;  4JI1 E;  5LL6 R;  4LFB I;  4DR4 E;  4JI6 E;  2V8Q B;  2BM0 A;  1XNR I;  1HNW E;  2B7V A;  5GME A;  2V8P A;  3IWC A;  4B3R E;  1FNM A;  1Z5B A;  1YYO A;  3FIG A;  1N36 E;  1RR9 A;  1ZM3 A;  4DPT A;  4DUY I;  1MU5 A;  2DSY A;  5GMD A;  4AQY I;  1FJG I;  4DV5 I;  1N34 I;  3DF6 A;  1X48 A;  4LFA E;  3AUZ A;  2UUB I;  1T4L B;  3D4J A;  3B78 A;  3GON A;  1HNX I;  4DV3 E;  2O1T A;  4JI4 I;  2ZIT A;  4HXZ A;  2MC5 A;  4X64 I;  2L92 A;  5F3W A;  2PNL A;  2CGE A;  1WUU A;  1PIE A;  5AE1 A;  1XMQ I;  2DMY A;  3HXL A;  2V88 A;  4IZK B;  2E5L I;  3C4T A;  4LFC E;  3T1Y E;  2CG9 A;  4DMI A;  4USM A;  1N33 E;  2L3J A;  2HKJ A;  4LF7 I;  4DR7 E;  1WXR A;  3PRY A;  3V2U C;  3LNU A;  5BR8 E;  2R3V A;  3K1J A;  2V83 A;  2OI2 A;  4X62 I;  2Z5B B;  2LUQ A;  4I3H A;  3ZZU A;  1GZ6 A;  1I94 I;  1Z0V A;  1FWK A;  2VF1 A;  1KKH A;  4P78 A;  4R8O A;  4K0K I;  1S4E A;  3JAM C;  2RS7 A;  5LMN E;  1MG7 A;  4DKK A;  4N3O A;  2Z5C B;  1HR0 E;  1NHH A;  4DV6 E;  3QT7 A;  2LJH A;  2FGG A;  2YZT A;  2IHR 1;  4WUB A;  2ODR C;  2XEX A;  5FWK A;  4DV2 I;  2LUP B;  3QT5 A;  2UU9 I;  3HUL A;  4LU9 A;  4WUC A;  1RQ0 A;  1IBM E;  1J26 A;  1N32 E;  1IBL E;  4K0K E;  1T4N A;  2LE2 A;  4NXM I;  3LLH A;  4OOG C;  1EKZ A;  3IWD A;  4FWH A;  4BC7 A;  2EZ6 A;  2O1U A;  4NXN E;  1YYW A;  5T6J A;  4LF9 E;  2L6M A;  4KQV A;  3T1H I;  4LF4 E;  4LF6 I;  1USV A;  1PKP A;  4L5N C;  2VQF E;  5FLX C;  1UIL A;  4DR1 E;  1ZM2 A;  1DI2 A;  4YY3 E;  2CZ9 A;  4DU7 A;  4DU8 A;  5IT9 Q;  3HQ1 A;  4M30 A;  4JI1 I;  5L3J A;  3B8H A;  4DR4 I;  3JU0 A;  3ZM7 A;  4JI6 I;  5AE3 A;  4JV5 E;  2E1R A;  2HHH E;  4WFT A;  1HNW I;  1Z5A A;  2DB2 A;  2RS6 A;  4B3R I;  2DEI A;  1H7S A;  1N36 I;  4LF5 E;  2X36 A;  2L8T A;  2X7I A;  1B63 A;  1DAR A;  4X66 E;  4IZK A;  1ZM4 A;  4UTG A;  4UT4 A;  1VIS A;  3PYF A;  1YYK A;  1UHZ A;  4LFA I;  3DJW A;  2HFS A;  3ZKB A;  4F54 A;  1Z59 A;  4DV3 I;  1Z5C A;  1XMO E;  3J81 Q;  4OX9 E;  3PYD A;  4URL A;  1K47 A;  2V85 A;  4M2Z A;  1PVG A;  3CWV A;  1QZR A;  2UXB E;  2L3C A;  2HK3 A;  4IZJ A;  4DV0 E;  1H72 C;  3K17 A;  2FV4 B;  4J8Z A;  4LFC I;  1Y4S A;  3T1Y I;  4BS9 A;  1OJ4 A;  4EMD A;  1N33 I;  4R03 A;  2A2C A;  3F6H A;  1IBK E;  4WUD A;  2RTX A;  4KHP E;  2Z5C A;  2LTR A;  1FWL A;  4DR7 I;  4DV7 E;  5BR8 I;  4JI7 E;  4FN5 A;  4JI0 E;  5DNY A;  4WYQ B;  3WU3 A;  1D6T A;  2JY9 A;  1T4O A;  4LF8 E;  1ELO A;  1Y4U A;  5LMN I;  2VF3 A;  1HR0 I;  4DV6 I;  2AJ4 A;  1EA6 A;  2WZO A;  3RMP A;  2V86 A;  2LRS A;  1EI1 A;  3ZOQ B;  2CPN A;  3ZZT A;  1IBM I;  3MSW A;  4HY1 A;  4X8W A;  3J80 C;  4BMJ A;  1N32 I;  2V89 A;  1IBL I;  5A2Q Q;  3ADJ A;  2O1W A;  3KWR A;  4Q28 A;  4DV1 E;  1USU A;  2F8B A;  4NXN I;  4B3T E;  4LF9 I;  4FWG A;  1X49 A;  3HJC A;  3AV0 A;  2JR1 A;  2UXC E;  4JYA E;  3J7A M;  3F0N A;  4IZJ D;  4F9B B;  1NHI A;  4LF4 I;  2Q2E B;  4JI3 E;  1H73 A;  2VQF I;  5AE2 A;  4LTY A;  4HYM A;  4KZS A;  4HAC B;  4DR1 I;  3Q6M A;  4YY3 I;  3H09 A;  2DEJ A;  4TUI A;  4F9C B;  4JV5 I;  2HHH I;  1XNQ E;  4Z7Y A;  1STU A;  1Z0B A;  2MC6 A;  2K4V A;  1Z0G A;  4WSP A;  4DR6 E;  4DV4 E;  1SR9 A;  2ODR D;  2VQE E;  3VK6 A;  4JI5 E;  2V2Z A;  1ZXM A;  2Z5E A;  1QU6 A;  4LF5 I;  5CFF E;  4DR2 E;  1WHQ A;  3K6Q A;  2KON A;  5LMU E;  2J7K A;  2UUC E;  4B3S E;  4X66 I;  1ZBT A;  2B3T B;  3ADG A;  2JOB A;  5AAS A;  3ZZ0 A;  3WU6 A;  4JG4 A;  4L8N A;  3H4L A;  1WHN A;  4M1K A;  2KHX A;  1J5E E;  1NZ0 A;  1N0V C;  2L2K B;  1A6F A;  1ZXN A;  2WW4 A;  3Q6N A;  3WU4 A;  1Z0W A;  1XMO I;  4OX9 I;  2PNM A;  3LML A;  2UXB I;  1GQE A;  2EFG A;  3VYX A;  4DV0 I;  4Z7C A;  4DPW A;  1MX0 A;  4B3M E;  4RPF A;  2LMZ A;  2UXD E;  1ZM9 A;  5IWA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...