4JI8E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji8E02
4OX9E 4KHPI 1FWKA 1H73A 4LF6I 2L2KB 4DXLA 2XEXA 4NXNE 5BR8E 4DR7I 4WUDA 1PVGA 2V2QA 1N36E 5L3JA 5GMDA 2R42A 3J80Q 1I94I 1XMOI 1RREA 1S4EA 2IHR1 3T1HI 4LF6E 4FWDA 3C4BA 2UUBE 2GS8A 3V2UC 4JI7E 4LF8E 4P52A 4M2ZA 2MDRA 4YY3E 1FWLA 2V2ZA 5FLXC 1HNZE 1FJGE 3QT6A 4GKJE 1HR0I 3J81C 4LF8I 4DV4I 2LUQA 4JYAE 1H7UA 3PYDA 2N3GA 4X62E 3LNUA 1DI2A 4DPTA 1XNRE 4DV7I 4EMDA 5CFFE 1NZ0A 1Z5AA 3ZM7A 1YZ9A 4DV2I 4DKKA 1IBLI 3T1HE 1N32I 2L3JA 1FJGI 5BR8I 2DEIA 1N34I 4JI2I 4X65E 2B7VA 1ZM9A 1NHJA 1WUUA 4B3RE 2HK3A 4LF5E 1X48A 2DEJA 2V2VA 4DR2E 3B82A 1HR0E 4Z7CA 2B3TB 3PYEA 1YYWA 1YYKA 4DV2E 4JI6I 1D6TA 2BM1A 1OJ4A 1MU5A 4NXNI 1ELOA 1HNWE 1UEKA 1N0VC 2RSMA 4X64E 4JI1E 2ZM6E 3ZZUA 4DPWA 2LJPA 4B3ME 1FI4A 4JI6E 4YHHE 4B3TI 3J81Q 1WHQA 3LPSA 4DPYA 2YT4A 1IBKE 4JG4A 2E5LI 4FWHA 1IBMI 3GONA 2L2NA 4HACA 4FN5A 1HNZI 4Z7YA 1Z0GA 2HHHI 4DR6I 2NA2A 4LF9E 2B7TA 4I3HA 1FKAE 4DV1I 3F0NA 3VYXA 1MX0A 1XNQI 4B3TE 2HHHE 4DR6E 4DR2I 1XHKA 2KHXA 2HFSA 1N36I 1STUA 4JYAI 1N32E 4YHHI 3H4LA 2UUCI 2L3CA 4GKKI 2HK2A 1XNRI 1N34E 4JI2E 3ADLA 4DU7A 1J5EI 4WFTA 2HFUA 2UUAE 4DUZE 4JI3I 5GMEA 4JI1I 4K0KI 4DV0E 2VQEI 2L33A 4DR1E 3ZZTA 1EA6A 3QT7A 4M1KA 1PIEA 4LF9I 2E1RA 4XTJA 2UXBE 4ZVIA 2UUAI 2R3VA 4HYMA 2HKJA 4FWGA 4USKA 4HXZA 1PKPA 1GQEA 4PU9A 1HNWI 1QZRA 2UXCE 1IBLE 4URLA 2RTXA 1KIJA 1Z0WA 2LRSA 2NUFA 1VISA 2EZ6A 1H7SA 5IT9C 1H74A 2NUGA 4B3RI 2UXBI 4K0KE 3LLHA 2E5LE 1Z5BA 3J7AG 4UT4A 3T1YI 4JI0I 2LJHA 2UUCE 4GKKE 4HY1A 4OOGC 1KKHA 2DB2A 4JI8E 5LMNE 1A6FA 2AJ4A 4LF7I 1BKNA 4RPFA 1NHHA 4DR1I 1K47A 3WU3A 3J80C 4DPUA 1Z0VA 4DR3I 3D4JA 2CPNA 3M6AA 5LMUI 3T1YE 4MYTA 1KVKA 3VYYA 3QT8A 1XMQE 2UXCI 1IBKI 1IBME 3K1JA 1UHZA 1ZXMA 2DMYA 2A2DA 3ADJA 1X47A 1Z0TA 1ZXNA 4WUCA 4LF7E 2VF3A 4JI3E 2LTRA 3ZZ0A 1Z0BA 2UU9I 3HULA 5A2QQ 1U2RA 2Q2EB 1YYOA 1EKZA 4LFBE 3C4TA 4DR5I 2X7IA 1KTVA 4DV3I 2RS6A 1FNMA 4R1FA 1J5EE 1RR9A 2BM0A 4JI4I 1XMQI 4DR4I 4PRVA 4DUZI 2F4VE 2VQEE 1J26A 4USMA 2VQFI 4NXMI 4B3SE 4WYQB 3Q1QA 5LL6R 1S16A 4JI8I 2UXDE 3ZKDA 1Z0EA 3J7AM 4DPXA 3J7Yp 3WU5A 4JV5I 3JAMC 2UU9E 1WHNA 4LFCE 1N0UA 4DV1E 4B3SI 1XNQE 4LFAE 1ZM3A 2LUPB 2L2MA 2NPFA 5LMUE 3WU4A 4ED4A 1HNXE 4DV5I 4WUBA 2LTSA 2J7KA 2UXDI 1UILA 4X8WA 2F4VI 4DR5E 3PYGA 4JI0E 1T4OA 4DV4E 4JI4E 3HTXA 2NUEA 1I94E 4NXME 2N3HA 1ZBTA 2JY9A 2HKEA 2ZBKB 2UUBI 4X66I 4LF4I 4JI7I 4LFCI 4DV5E 1RC7A 1RQ0A 4KHPE 4AQYI 4DR4E 3JAMQ 4JI5I 2BV3A 4LFBI 4DUYI 2A2CA 1X49A 4DR7E 5IWAI 2VQFE 3P1XA 4X62I 2DIXA 2X36A 3K17A 3B8HA 5LMNI 2OI2A 3WU6A 1H72C 4DV6I 3ADGA 1Z0CA 3OTOE 4LFAI 2ZM6I 1XMOE 3PYFA 1MG7A 1NHIA 4DR3E 4FW9A 1O0WA 3ADIA 4X65I 4KQVA 4DV6E 2V8PA 4HACB 1ZM4A 1HNXI 5IT9Q 4DV3E 5IWAE 3OTOI 1ZM2A 1B63A 4OX9I 1DARA 4MYUA 4JI5E 1Z59A 4DUYE 2CZ9A 2V34A 2ZITA 4DU8A 3V5RA 2WW4A 5A2QC 4JV5E 5FLXQ 3B78A 2LBSB 4X64I 3QT5A 1Z5CA 3CWVA 1B62A 4B3MI 4P7AA 1N33I 1QU6A 1T4LB 4PRXA 4UTGA 1T4NA 2JVAA 4DV0I 4LF5I 2RS7A 4M30A 4AQYE 3LTOA 1EI1A 4YY3I 4DV7E 1N33E 4X66E 4LF4E 4GKJI 3ZKBA 2EFGA
chains in the Genus database with same CATH superfamily
4OX9E 2AE8A 4KHPI 1FWKA 1X6FA 1H73A 5K36D 4LF6I 2L2KB 4Q35B 4DXLA 2J65A 2XEXA 4NXNE 5BR8E 4R03A 1B69A 2HGHA 2EMLA 5C0XF 2PO1A 3M85D 4DR7I 4WUDA 3IWCA 4LU9A 1PVGA 1N36E 1Y5YA 2V2QA 4BBYA 3L7ZA 5L3JA 5GMDA 2R42A 3J80Q 4ZYGA 1I94I 1XMOI 1A1KA 1RREA 1S4EA 2IHR1 3K6QA 2JT2A 3T1HI 5AC5A 5C0XB 4LF6E 2L92A 4FWDA 3C4BA 2C39B 1UDOA 2UUBE 2GS8A 2JEAB 4GEQB 3V2UC 1GTKA 1YHCA 4JI7E 2EOFA 5AE2A 1XXEA 2YU5A 4LF8E 4P52A 4I8OA 4M2ZA 2MDRA 2EL4A 4YY3E 1FWLA 1TF6A 5K36E 2V2ZA 5FLXC 1Y6ZA 1HNZE 4MU0A 4X9JA 1FJGE 2FTXB 3QT6A 4GKJE 2EOJA 2Z5BA 2ENCA 1HR0I 2EPOA 3J81C 4LF8I 4DV4I 4R2SA 2L6MA 2H36X 2VF1A 2LUQA 1EH6A 2O1WA 4JYAE 1H7UA 2RPCA 3PYDA 2N3GA 4X62E 1WJPA 5ADZA 1DI2A 3LNUA 2EPRA 2Z5EA 4DPTA 1XNRE 4DV7I 1VI7A 2EOIA 2NN6C 1NEIA 4EMDA 5CFFE 4R2AA 1NZ0A 1Z5AA 3ZM7A 1YZ9A 2EPAA 4ZYHA 2J7JA 1YPNA 2ODRC 3DD6A 4DKKA 4GQUA 4DV2I 1IBLI 3T1HE 1N32I 4MLQA 2RSIA 1ZBQA 3MSWA 5KL4A 2L3JA 2EOSA 2BR2A 4JI2I 1FJGI 5JEAB 5BR8I 2V83A 1EH7A 1BB8A 2R76A 4X65E 2B7VA 2EOEA 2V89A 2EN6A 2EM3A 2YTOA 1NHJA 1ZM9A 1WUUA 4IZKB 4B3RE 1USVA 2EMHA 2MC6A 3IWDA 2V86A 4BHBA 4LF5E 1UDNA 4O24A 1X48A 1G2DC 2HK3A 2DEJA 4MU3A 2YZTA 4BS9A 2V2VA 2WBUA 4DR2E 2Q8UA 3B82A 2K7IA 5A69A 1HR0E 3HPSA 4Z7CA 2B3TB 1R6LA 3UK3C 4F2JC 3EPHA 2I13A 1RHYA 1UDSA 2WP8A 3PYEA 4FW6A 1YYWA 2EPPA 2LV2A 1YYKA 3OMLA 5T6JA 4DV2E 5A6JA 4BA1A 3THNA 4JI6I 2BM1A 1D6TA 1OJ4A 1MU5A 4NXNI 1ELOA 2M7QA 3ECRA 1HNWE 1UEKA 1EH8A 2PO0B 3U1YA 3AUZA 3KZYA 1N0VC 2RSMA 4X64E 1Y4UA 4ISAA 1SR9A 1P47A 3HJCA 4JI1E 4MLVA 2ZM6E 2F1DA 3ZZUA 4DPWA 4ZYEA 2LJPA 4B3ME 1FI4A 4IFDE 4JI6E 2EM8A 4O4KA 3Q6MA 4YHHE 4B3TI 5A6KA 1IMUA 2EPNA 3J81Q 2MDGA 3BIDA 1WHQA 2GHFA 2JR1A 2E72A 3LPSA 4DPYA 4P78A 3M7ND 1A1HA 5DNYA 1JK1A 5FWKA 4AM3A 1IQSA 2YT4A 1IBKE 4JG4A 1KJKA 4FWHA 2E5LI 1PJTA 2YTEA 2NN6E 1IBMI 3GONA 2IERA 2L2NA 2BA0D 4FN5A 4HACA 1HNZI 4Z7YA 1Z0GA 3L7ZB 2HHHI 4DR6I 4R2QA 4U3BA 2NA2A 4LF9E 3FIGA 2B7TA 2D9HA 4L5NC 4F6MA 4BA2B 2EOHA 4IZJA 4I3HA 1FKAE 4QNJA 3F0NA 4DV1I 4FW3A 3GCMA 3MHSC 3VYXA 1MX0A 1XNQI 4J8ZA 2HHHE 4B3TE 4DR6E 4OO1A 4DR2I 1NCSA 1XHKA 2JOBA 2EM6A 2KHXA 2HFSA 4FW5A 1N36I 2M1SA 5TSEA 2RQLA 4KWYA 3P76A 1STUA 4JYAI 1N32E 2ENAA 3HXLA 2EQ3A 1AH5A 4LCFA 2YWQA 4YHHI 3H4LA 2UUCI 2L3CA 4GKKI 4GZNC 2EM2A 2HK2A 1XNRI 1N34E 4JI2E 3ADLA 2NN6D 4DU7A 1J5EI 4WFTA 2BA1G 2DLQA 1WXRA 1UN6B 1OYRA 2HFUA 2UUAE 5DNXA 4DUZE 4LCHA 1E3HA 3K85A 5GMEA 2WNRB 4JI1I 4JI3I 4K0KI 2EMCA 2EPUA 4DV0E 2GPIA 5EKWA 2VQEI 1KYQA 2L33A 4DR1E 5ELWA 2EE8A 1EA6A 3ZZTA 4WPYA 4IFDB 3QT7A 2BA0G 5AE3A 1F2IG 4M1KA 2EQ0A 1PIEA 4MDTA 2EMBA 2EMKA 4LF9I 2E1RA 3H1CA 2YTFA 4XTJA 2UXBE 4ZVIA 2UUAI 2R3VA 2JE6A 2EMZA 5A6AA 5AC4A 4HYMA 4IFDF 2HKJA 3DF6A 4OKGA 4FWGA 4OO1F 4LPFA 4USKA 3U1KA 3P3CA 2Z5CA 1GQEA 1PKPA 4HXZA 4PU9A 4AIMA 1DQ3A 1HNWI 2EMWA 2JP9A 5F3WA 2EN4A 3EQ1A 2PRTA 1QZRA 3P3EA 2UXCE 1YSAC 5IV8B 5DNLA 4FW7A 3M85G 3AV0A 2BB8A 1IBLE 2YRMA 4URLA 2PO1B 2RTXA 2DGCA 1KIJA 1Z0WA 2GQ0A 2LRSA 2NUFA 1VISA 2O1VA 1Z1BA 3CDIA 4NBQA 5C0XE 4TUGA 5IT9C 2EZ6A 5AASA 1H7SA 1H74A 2NUGA 4MQYA 2WBTA 4B3RI 2PNZB 1AAYA 2G7HA 4K0KE 2UXBI 5C0XA 3LLHA 4N4RB 4ZYDA 2E5LE 4TUIA 1Z5BA 2V87A 2PO2B 3MHHC 3J7AG 1X6EA 4UT4A 3T1YI 2LJHA 4JI0I 2UUCE 4GKKE 2PO0A 4HY1A 1PJQA 5K36B 2JWOA 2YTIA 4OOGC 4F54A 1KKHA 1N34I 1UDQA 2DB2A 4JI8E 5LMNE 1A6FA 2EOXA 1HK7A 2EM0A 2AJ4A 2E1MA 5KL3A 4LF7I 2CT1A 1G2FC 1BKNA 1NHHA 4RPFA 2EOQA 2HC5A 2O1TA 4DR1I 4IFDD 1K47A 1A1IA 2Z5BB 3L00A 3WU3A 3J80C 2EMXA 2BA1D 2C37B 4DPUA 2ODRD 2B9DA 1Z0VA 3PS2A 1IQOA 1RMDA 2JXPA 3D4JA 2CPNA 2GO4A 4DR3I 2EL5A 1OYPA 2GO3A 2JEBA 3M6AA 5LMUI 2ELZA 4MU4A 3H09A 4O43A 2CTDA 1P42A 5DRPA 5A6BA 3NZKA 2EM5A 3T1YE 4OZEA 2EPCA 4MYTA 2N8XA 3KZZA 2O3ZA 3EPJA 4O5GA 5JEAE 2BBGA 2EJ4A 1KVKA 4IZJB 3VYYA 3QT8A 1XMQE 4WXDA 2UXCI 5IXMB 2F8BA 1L4SA 1IBKI 3M7NG 4NHRA 1IBME 5JEAA 1JK2A 1Y60A 3K1JA 3CDJA 1UBDC 1UHZA 3ZOQB 2DMYA 4KZSA 1ZXMA 2A2DA 3ADJA 1X47A 1MEYC 1Z0TA 4LCGA 3PS3A 2LJUA 5C0XD 2MC5A 1PJSA 1ZXNA 4WUCA 2NABA 4LF7E 2VF3A 4JI3E 2LTRA 4QNKA 1YUIA 3ZZ0A 1Z0BA 2UU9I 3HULA 3GMEA 5A2QQ 1U2RA 3B4TA 2Q2EB 5K36C 2EPMX 1YYOA 4F9CB 3P06A 1EKZA 2DSYA 4WX9A 4LFBE 3C4TA 3PS1A 3C6MA 2DLKA 1GZ6A 4U3DA 5DROA 4DR5I 1USUA 2C38B 2YSOA 1KTVA 1PDAA 2X7IA 4DV3I 2RS6A 1FNMA 3P3GA 4R1FA 2YRHA 3RMPA 2YRKA 1J5EE 1YUJA 1E3PA 1RR9A 2JE6B 3QG5C 2BM0A 4JI4I 4WSPA 2CVEA 2EWLA 1XMQI 4DR4I 4PRVA 4DUZI 2F4VE 2Z5CB 2VQEE 2EN8A 1J26A 2LCEA 4USMA 1YFHA 2VQFI 4NXMI 4IJDA 3THOB 4B3SE 4WYQB 3Q1QA 2EMGA 1T39A 5LL6R 1S16A 4JI8I 2UXDE 3ZKDA 5LLQA 2YPNA 1Z0EA 2WZOA 3J7AM 4Q28A 1LLMC 1BBGA 4R2EA 3EPLA 2IESA 2NN6A 4DPXA 3J7Yp 4BC7A 3WU5A 2YSPA 4BMJA 2FV4B 3JAMC 2UU9E 1WHNA 4LFCE 1N0UA 4JV5I 4DV1E 2C39A 2JEAA 2ELYA 4B3SI 1XNQE 4LFAE 2K4VA 1ZM3A 2LUPB 5JEAF 2WBSA 2L2MA 2NPFA 5LMUE 4BCAA 5K36A 3Q6NA 1ZAAC 2IOQA 3WU4A 4ED4A 1HNXE 5KL5A 2GLIA 4DV5I 2EM7A 4WUBA 2LTSA 2M4IA 1MGTA 2J7KA 2EPKX 5KL6A 2MKNA 4IZJD 4R2DA 4WSGA 2V88A 2UXDI 1UILA 4X8WA 4MU1A 2EMYA 2YTDA 2F4VI 3TQMA 4DR5E 1R6MA 4IS1C 2LT7A 4JI0E 1T4OA 4DV4E 1BBOA 2C37A 3PYGA 2EN1A 2O1UA 4JI4E 2LMZA 1X6HA 3HTXA 4R2CA 4IFDA 1T38A 2NUEA 2DMIA 2BR2B 4N3OA 2ENHA 3JTZA 1I94E 2EQ1A 4NXME 2N3HA 1ZBTA 2JY9A 5JEAC 4IZKA 2HKEA 4M9VC 5JEAD 2ZBKB 4HEIA 3BBGA 2UUBI 4X66I 4LF4I 4OO1C 5A6BD 2A25A 2I9IA 4JI7I 1N3GA 4DV5E 1RC7A 2YTPA 4LFCI 4OO1E 2EOZA 2EL6A 2JYAA 2CSHA 4HTGA 1YH8A 2CGEA 1RQ0A 4KHPE 1A1JA 2DEIA 2JPAA 2WP8B 4AQYI 4DR4E 3JAMQ 4JI5I 2YTGA 2BV3A 5KL7A 4LFBI 4DUYI 2YU8A 2A2CA 2KONA 1X49A 4DR7E 3HKMA 4IS9A 3JU0A 5IWAI 2VQFE 2VE7C 1OYSA 2PNZA 4AIDA 5AE1A 3LMLA 3P1XA 4X62I 2DIXA 2X36A 4F9BB 3K17A 2MKDA 2PO2A 4F6NA 3B8HA 5LMNI 2EP3A 2C38A 3F6GA 2OI2A 4FK5C 4BHCA 3WU6A 3M99B 1H72C 2WCC3 2EPZA 1ZU1A 2CG9A 4J3DA 3ADGA 4DV6I 4RHBB 2VESA 3OTOE 3KWRA 1Z0CA 3VK6A 2YTNA 1SFEA 4LFAI 2ZM6I 4R2RA 4R8OA 1XMOE 2PNMA 3PYFA 1MG7A 1NHIA 4DR3E 2NN6F 4FW9A 1O0WA 2EMIA 4NZVA 3ADIA 4X65I 4F9AB 4DV6E 2V8PA 4HACB 4KQVA 5DRQA 1ZM4A 2EN3A 2IOPA 2LE2A 4DV3E 1HNXI 5IWAE 3OTOI 5IT9Q 4P7DA 1QNTA 1ZM2A 1B63A 2NN6B 3PRYA 4OX9I 2JEBB 1X5WA 1DARA 4MYUA 3BGHA 4JI5E 1Z59A 4DUYE 2EN7A 3DJWA 3GLLA 4BA2A 2CZ9A 4M0VA 2V34A 5EL9A 2ZITA 4DU8A 3V5RA 2EN2A 4OO1B 5C0XC 2LO3A 3HPZA 2VRDA 2DRPA 2WW4A 4OO1D 1TN9A 3VHTB 5K36F 2V8QB 2EPXA 2YTJA 3BF2A 4LOMA 2EMAA 2EMFA 5A2QC 4JV5E 2EOMA 5FLXQ 3B78A 2LBSB 1DGCA 2L8TA 2KOUA 4X64I 3QT5A 3UHMA 2EORA 1Z5CA 1TF3A 4FW4A 3CWVA 1B62A 4B3MI 2EM9A 2M9AA 2JOXA 1WRJA 2EOYA 1Y4SA 4DMIA 2WNRA 4P7AA 2FGGA 1N33I 4BA1B 4WXCA 1QU6A 4RH8A 2ADRA 4R2PA 1X3CA 1T4LB 4PRXA 4UTGA 5DRRA 2EPLX 1A1FA 1A1LA 3KRNA 4IFDC 2EOOA 4BC9A 2PNLA 2EM4A 3F6HA 1T4NA 2JVAA 4DV0I 4L8NA 4LF5I 2RS7A 4M30A 2YTQA 3EPKA 4AQYE 1EI1A 3LTOA 2V85A 4YY3I 3IWBA 4LTYA 2HJJA 4DV7E 3HQ1A 1N33E 3C6KA 4X66E 5KL2A 4LF4E 4GKJI 3ZKBA 2EFGA 2LVHA 2R1FA 1ZR9A 1A1GA
chains in the Genus database with same CATH topology
4OX9E 4KHPI 1FWKA 1H73A 4LF6I 2L2KB 4DXLA 2XEXA 4NXNE 5BR8E 4R03A 4DR7I 4WUDA 3IWCA 4LU9A 1PVGA 1N36E 2V2QA 4BBYA 5L3JA 5GMDA 2R42A 3J80Q 1I94I 1XMOI 1RREA 1S4EA 2IHR1 3K6QA 3T1HI 4LF6E 2L92A 4FWDA 3C4BA 2UUBE 2GS8A 4GEQB 3V2UC 4JI7E 5AE2A 4LF8E 4P52A 4I8OA 4M2ZA 2MDRA 4YY3E 1FWLA 2V2ZA 5FLXC 1Y6ZA 1HNZE 1FJGE 2FTXB 3QT6A 4GKJE 2Z5BA 1HR0I 3J81C 4LF8I 4DV4I 2L6MA 2H36X 2VF1A 2LUQA 2O1WA 4JYAE 1H7UA 3PYDA 2N3GA 4X62E 5ADZA 3LNUA 1DI2A 2Z5EA 4DPTA 1XNRE 4DV7I 4EMDA 5CFFE 1NZ0A 1Z5AA 3ZM7A 1YZ9A 2ODRC 4DV2I 4DKKA 1IBLI 3T1HE 1N32I 3MSWA 1ZBQA 2L3JA 1FJGI 5BR8I 2V83A 2DEIA 1N34I 4X65E 4JI2I 2B7VA 1ZM9A 2V89A 1NHJA 4IZKB 1WUUA 4B3RE 1USVA 2MC6A 3IWDA 2V86A 4LF5E 2HK3A 1X48A 2DEJA 2YZTA 4BS9A 2V2VA 4DR2E 3B82A 1HR0E 3HPSA 4Z7CA 2B3TB 3PYEA 1YYWA 1YYKA 3OMLA 5T6JA 4DV2E 4JI6I 1D6TA 2BM1A 1OJ4A 1MU5A 4NXNI 1ELOA 2M7QA 1HNWE 1UEKA 3AUZA 1N0VC 2RSMA 4X64E 1Y4UA 1SR9A 3HJCA 4JI1E 2ZM6E 3ZZUA 4DPWA 2LJPA 4B3ME 1FI4A 4JI6E 3Q6MA 4YHHE 4B3TI 3J81Q 1WHQA 2JR1A 3LPSA 4DPYA 4P78A 5DNYA 5FWKA 2YT4A 1IBKE 4JG4A 2E5LI 4FWHA 1IBMI 3GONA 2L2NA 4HACA 4FN5A 1HNZI 4Z7YA 1Z0GA 2HHHI 4DR6I 2NA2A 4LF9E 3FIGA 2B7TA 4L5NC 4IZJA 4I3HA 1FKAE 4DV1I 3F0NA 3VYXA 1MX0A 1XNQI 4J8ZA 2HHHE 4B3TE 4DR6E 4DR2I 1XHKA 2JOBA 2KHXA 2HFSA 1N36I 2M1SA 1STUA 4JYAI 1N32E 3HXLA 4YHHI 3H4LA 2UUCI 2L3CA 4GKKI 2HK2A 1XNRI 1N34E 4JI2E 3ADLA 4DU7A 1J5EI 4WFTA 1WXRA 2HFUA 2UUAE 4DUZE 4JI3I 3K85A 5GMEA 4JI1I 4K0KI 4DV0E 2VQEI 2L33A 4DR1E 3ZZTA 1EA6A 4WPYA 3QT7A 5AE3A 4M1KA 1PIEA 4LF9I 2E1RA 4XTJA 2UXBE 4ZVIA 2UUAI 2R3VA 4HYMA 2HKJA 3DF6A 4FWGA 4USKA 2Z5CA 1PKPA 1GQEA 4HXZA 4PU9A 1HNWI 1DQ3A 5F3WA 1QZRA 2UXCE 3AV0A 1IBLE 4URLA 2RTXA 1KIJA 2O1VA 1Z0WA 2GQ0A 2LRSA 2NUFA 1VISA 4TUGA 5IT9C 2EZ6A 5AASA 1H7SA 1H74A 2NUGA 4B3RI 2UXBI 2G7HA 4K0KE 3LLHA 2E5LE 4TUIA 1Z5BA 2V87A 3J7AG 4UT4A 3T1YI 2LJHA 4JI0I 2UUCE 4GKKE 4HY1A 2JWOA 4OOGC 4F54A 1KKHA 2DB2A 4JI8E 5LMNE 1A6FA 1HK7A 2AJ4A 2E1MA 4LF7I 1BKNA 4RPFA 1NHHA 2O1TA 4DR1I 1K47A 2Z5BB 3WU3A 3J80C 4DPUA 2ODRD 2B9DA 1Z0VA 4DR3I 3D4JA 2CPNA 3M6AA 5LMUI 3H09A 3T1YE 4MYTA 1KVKA 4IZJB 3VYYA 3QT8A 1XMQE 2UXCI 1IBKI 2F8BA 1IBME 3K1JA 1UHZA 3ZOQB 2DMYA 4KZSA 1ZXMA 2A2DA 3ADJA 1X47A 1Z0TA 2MC5A 1ZXNA 4WUCA 4LF7E 2VF3A 4JI3E 2LTRA 3ZZ0A 1Z0BA 2UU9I 3HULA 5A2QQ 1U2RA 2Q2EB 1YYOA 4F9CB 3P06A 1EKZA 2DSYA 4LFBE 3C4TA 1GZ6A 4DR5I 1USUA 1KTVA 2X7IA 4DV3I 2RS6A 1FNMA 4R1FA 3RMPA 1J5EE 1RR9A 2BM0A 4JI4I 4WSPA 2EWLA 1XMQI 4DR4I 4PRVA 4DUZI 2F4VE 2Z5CB 2VQEE 1J26A 4USMA 2VQFI 4NXMI 4B3SE 4WYQB 3Q1QA 5LL6R 1S16A 4JI8I 2UXDE 3ZKDA 1Z0EA 2WZOA 3J7AM 4Q28A 4DPXA 3J7Yp 4BC7A 3WU5A 4BMJA 2FV4B 3JAMC 2UU9E 1WHNA 4LFCE 1N0UA 4JV5I 4DV1E 4B3SI 1XNQE 4LFAE 2K4VA 1ZM3A 2LUPB 2L2MA 2NPFA 5LMUE 4BCAA 3Q6NA 2IOQA 3WU4A 4ED4A 1HNXE 4DV5I 4WUBA 2LTSA 2M4IA 2J7KA 4IZJD 2V88A 2UXDI 1UILA 4X8WA 2F4VI 4DR5E 3PYGA 4JI0E 1T4OA 4DV4E 2O1UA 4JI4E 2LMZA 3HTXA 2NUEA 4N3OA 3JTZA 1I94E 4NXME 2N3HA 1ZBTA 2JY9A 4IZKA 2HKEA 2ZBKB 2UUBI 4X66I 4LF4I 4JI7I 4LFCI 4DV5E 1RC7A 2CGEA 1RQ0A 4KHPE 4AQYI 4DR4E 3JAMQ 4JI5I 2BV3A 4LFBI 4DUYI 2A2CA 2KONA 1X49A 4DR7E 3JU0A 5IWAI 2VQFE 2VE7C 5AE1A 3LMLA 3P1XA 4X62I 2DIXA 2X36A 4F9BB 3K17A 3B8HA 5LMNI 3F6GA 2OI2A 3WU6A 1H72C 2CG9A 4DV6I 3ADGA 3OTOE 3KWRA 1Z0CA 3VK6A 4LFAI 2ZM6I 4R8OA 1XMOE 2PNMA 3PYFA 1MG7A 1NHIA 4DR3E 4FW9A 1O0WA 3ADIA 4X65I 4F9AB 4DV6E 2V8PA 4HACB 4KQVA 1ZM4A 2IOPA 1HNXI 2LE2A 4DV3E 5IT9Q 5IWAE 3OTOI 4P7DA 1ZM2A 1B63A 3PRYA 4OX9I 1DARA 4MYUA 4JI5E 1Z59A 4DUYE 3DJWA 2CZ9A 4M0VA 2V34A 2ZITA 4DU8A 3V5RA 3HPZA 2WW4A 2V8QB 5A2QC 4JV5E 5FLXQ 3B78A 2LBSB 2L8TA 2KOUA 4X64I 3QT5A 1Z5CA 3CWVA 1B62A 4B3MI 2JOXA 1Y4SA 4DMIA 4P7AA 2FGGA 1N33I 1QU6A 1T4LB 4PRXA 4UTGA 4BC9A 2PNLA 3F6HA 1T4NA 2JVAA 4DV0I 4L8NA 4LF5I 2RS7A 4M30A 4AQYE 3LTOA 1EI1A 4YY3I 2V85A 3IWBA 4LTYA 4DV7E 3HQ1A 1N33E 4X66E 4LF4E 4GKJI 3ZKBA 2EFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 E;  4KHP I;  1FWK A;  1H73 A;  4LF6 I;  2L2K B;  4DXL A;  2XEX A;  4NXN E;  5BR8 E;  4DR7 I;  4WUD A;  1PVG A;  2V2Q A;  1N36 E;  5L3J A;  5GMD A;  2R42 A;  3J80 Q;  1I94 I;  1XMO I;  1RRE A;  1S4E A;  2IHR 1;  3T1H I;  4LF6 E;  4FWD A;  3C4B A;  2UUB E;  2GS8 A;  3V2U C;  4JI7 E;  4LF8 E;  4P52 A;  4M2Z A;  2MDR A;  4YY3 E;  1FWL A;  2V2Z A;  5FLX C;  1HNZ E;  1FJG E;  3QT6 A;  4GKJ E;  1HR0 I;  3J81 C;  4LF8 I;  4DV4 I;  2LUQ A;  4JYA E;  1H7U A;  3PYD A;  2N3G A;  4X62 E;  3LNU A;  1DI2 A;  4DPT A;  1XNR E;  4DV7 I;  4EMD A;  5CFF E;  1NZ0 A;  1Z5A A;  3ZM7 A;  1YZ9 A;  4DV2 I;  4DKK A;  1IBL I;  3T1H E;  1N32 I;  2L3J A;  1FJG I;  5BR8 I;  2DEI A;  1N34 I;  4JI2 I;  4X65 E;  2B7V A;  1ZM9 A;  1NHJ A;  1WUU A;  4B3R E;  2HK3 A;  4LF5 E;  1X48 A;  2DEJ A;  2V2V A;  4DR2 E;  3B82 A;  1HR0 E;  4Z7C A;  2B3T B;  3PYE A;  1YYW A;  1YYK A;  4DV2 E;  4JI6 I;  1D6T A;  2BM1 A;  1OJ4 A;  1MU5 A;  4NXN I;  1ELO A;  1HNW E;  1UEK A;  1N0V C;  2RSM A;  4X64 E;  4JI1 E;  2ZM6 E;  3ZZU A;  4DPW A;  2LJP A;  4B3M E;  1FI4 A;  4JI6 E;  4YHH E;  4B3T I;  3J81 Q;  1WHQ A;  3LPS A;  4DPY A;  2YT4 A;  1IBK E;  4JG4 A;  2E5L I;  4FWH A;  1IBM I;  3GON A;  2L2N A;  4HAC A;  4FN5 A;  1HNZ I;  4Z7Y A;  1Z0G A;  2HHH I;  4DR6 I;  2NA2 A;  4LF9 E;  2B7T A;  4I3H A;  1FKA E;  4DV1 I;  3F0N A;  3VYX A;  1MX0 A;  1XNQ I;  4B3T E;  2HHH E;  4DR6 E;  4DR2 I;  1XHK A;  2KHX A;  2HFS A;  1N36 I;  1STU A;  4JYA I;  1N32 E;  4YHH I;  3H4L A;  2UUC I;  2L3C A;  4GKK I;  2HK2 A;  1XNR I;  1N34 E;  4JI2 E;  3ADL A;  4DU7 A;  1J5E I;  4WFT A;  2HFU A;  2UUA E;  4DUZ E;  4JI3 I;  5GME A;  4JI1 I;  4K0K I;  4DV0 E;  2VQE I;  2L33 A;  4DR1 E;  3ZZT A;  1EA6 A;  3QT7 A;  4M1K A;  1PIE A;  4LF9 I;  2E1R A;  4XTJ A;  2UXB E;  4ZVI A;  2UUA I;  2R3V A;  4HYM A;  2HKJ A;  4FWG A;  4USK A;  4HXZ A;  1PKP A;  1GQE A;  4PU9 A;  1HNW I;  1QZR A;  2UXC E;  1IBL E;  4URL A;  2RTX A;  1KIJ A;  1Z0W A;  2LRS A;  2NUF A;  1VIS A;  2EZ6 A;  1H7S A;  5IT9 C;  1H74 A;  2NUG A;  4B3R I;  2UXB I;  4K0K E;  3LLH A;  2E5L E;  1Z5B A;  3J7A G;  4UT4 A;  3T1Y I;  4JI0 I;  2LJH A;  2UUC E;  4GKK E;  4HY1 A;  4OOG C;  1KKH A;  2DB2 A;  4JI8 E;  5LMN E;  1A6F A;  2AJ4 A;  4LF7 I;  1BKN A;  4RPF A;  1NHH A;  4DR1 I;  1K47 A;  3WU3 A;  3J80 C;  4DPU A;  1Z0V A;  4DR3 I;  3D4J A;  2CPN A;  3M6A A;  5LMU I;  3T1Y E;  4MYT A;  1KVK A;  3VYY A;  3QT8 A;  1XMQ E;  2UXC I;  1IBK I;  1IBM E;  3K1J A;  1UHZ A;  1ZXM A;  2DMY A;  2A2D A;  3ADJ A;  1X47 A;  1Z0T A;  1ZXN A;  4WUC A;  4LF7 E;  2VF3 A;  4JI3 E;  2LTR A;  3ZZ0 A;  1Z0B A;  2UU9 I;  3HUL A;  5A2Q Q;  1U2R A;  2Q2E B;  1YYO A;  1EKZ A;  4LFB E;  3C4T A;  4DR5 I;  2X7I A;  1KTV A;  4DV3 I;  2RS6 A;  1FNM A;  4R1F A;  1J5E E;  1RR9 A;  2BM0 A;  4JI4 I;  1XMQ I;  4DR4 I;  4PRV A;  4DUZ I;  2F4V E;  2VQE E;  1J26 A;  4USM A;  2VQF I;  4NXM I;  4B3S E;  4WYQ B;  3Q1Q A;  5LL6 R;  1S16 A;  4JI8 I;  2UXD E;  3ZKD A;  1Z0E A;  3J7A M;  4DPX A;  3J7Y p;  3WU5 A;  4JV5 I;  3JAM C;  2UU9 E;  1WHN A;  4LFC E;  1N0U A;  4DV1 E;  4B3S I;  1XNQ E;  4LFA E;  1ZM3 A;  2LUP B;  2L2M A;  2NPF A;  5LMU E;  3WU4 A;  4ED4 A;  1HNX E;  4DV5 I;  4WUB A;  2LTS A;  2J7K A;  2UXD I;  1UIL A;  4X8W A;  2F4V I;  4DR5 E;  3PYG A;  4JI0 E;  1T4O A;  4DV4 E;  4JI4 E;  3HTX A;  2NUE A;  1I94 E;  4NXM E;  2N3H A;  1ZBT A;  2JY9 A;  2HKE A;  2ZBK B;  2UUB I;  4X66 I;  4LF4 I;  4JI7 I;  4LFC I;  4DV5 E;  1RC7 A;  1RQ0 A;  4KHP E;  4AQY I;  4DR4 E;  3JAM Q;  4JI5 I;  2BV3 A;  4LFB I;  4DUY I;  2A2C A;  1X49 A;  4DR7 E;  5IWA I;  2VQF E;  3P1X A;  4X62 I;  2DIX A;  2X36 A;  3K17 A;  3B8H A;  5LMN I;  2OI2 A;  3WU6 A;  1H72 C;  4DV6 I;  3ADG A;  1Z0C A;  3OTO E;  4LFA I;  2ZM6 I;  1XMO E;  3PYF A;  1MG7 A;  1NHI A;  4DR3 E;  4FW9 A;  1O0W A;  3ADI A;  4X65 I;  4KQV A;  4DV6 E;  2V8P A;  4HAC B;  1ZM4 A;  1HNX I;  5IT9 Q;  4DV3 E;  5IWA E;  3OTO I;  1ZM2 A;  1B63 A;  4OX9 I;  1DAR A;  4MYU A;  4JI5 E;  1Z59 A;  4DUY E;  2CZ9 A;  2V34 A;  2ZIT A;  4DU8 A;  3V5R A;  2WW4 A;  5A2Q C;  4JV5 E;  5FLX Q;  3B78 A;  2LBS B;  4X64 I;  3QT5 A;  1Z5C A;  3CWV A;  1B62 A;  4B3M I;  4P7A A;  1N33 I;  1QU6 A;  1T4L B;  4PRX A;  4UTG A;  1T4N A;  2JVA A;  4DV0 I;  4LF5 I;  2RS7 A;  4M30 A;  4AQY E;  3LTO A;  1EI1 A;  4YY3 I;  4DV7 E;  1N33 E;  4X66 E;  4LF4 E;  4GKJ I;  3ZKB A;  2EFG A; 
#chains in the Genus database with same CATH topology
 4OX9 E;  2AE8 A;  4KHP I;  1FWK A;  1X6F A;  1H73 A;  5K36 D;  4LF6 I;  2L2K B;  4Q35 B;  4DXL A;  2J65 A;  2XEX A;  4NXN E;  5BR8 E;  4R03 A;  1B69 A;  2HGH A;  2EML A;  5C0X F;  2PO1 A;  3M85 D;  4DR7 I;  4WUD A;  3IWC A;  4LU9 A;  1PVG A;  1N36 E;  1Y5Y A;  2V2Q A;  4BBY A;  3L7Z A;  5L3J A;  5GMD A;  2R42 A;  3J80 Q;  4ZYG A;  1I94 I;  1XMO I;  1A1K A;  1RRE A;  1S4E A;  2IHR 1;  3K6Q A;  2JT2 A;  3T1H I;  5AC5 A;  5C0X B;  4LF6 E;  2L92 A;  4FWD A;  3C4B A;  2C39 B;  1UDO A;  2UUB E;  2GS8 A;  2JEA B;  4GEQ B;  3V2U C;  1GTK A;  1YHC A;  4JI7 E;  2EOF A;  5AE2 A;  1XXE A;  2YU5 A;  4LF8 E;  4P52 A;  4I8O A;  4M2Z A;  2MDR A;  2EL4 A;  4YY3 E;  1FWL A;  1TF6 A;  5K36 E;  2V2Z A;  5FLX C;  1Y6Z A;  1HNZ E;  4MU0 A;  4X9J A;  1FJG E;  2FTX B;  3QT6 A;  4GKJ E;  2EOJ A;  2Z5B A;  2ENC A;  1HR0 I;  2EPO A;  3J81 C;  4LF8 I;  4DV4 I;  4R2S A;  2L6M A;  2H36 X;  2VF1 A;  2LUQ A;  1EH6 A;  2O1W A;  4JYA E;  1H7U A;  2RPC A;  3PYD A;  2N3G A;  4X62 E;  1WJP A;  5ADZ A;  1DI2 A;  3LNU A;  2EPR A;  2Z5E A;  4DPT A;  1XNR E;  4DV7 I;  1VI7 A;  2EOI A;  2NN6 C;  1NEI A;  4EMD A;  5CFF E;  4R2A A;  1NZ0 A;  1Z5A A;  3ZM7 A;  1YZ9 A;  2EPA A;  4ZYH A;  2J7J A;  1YPN A;  2ODR C;  3DD6 A;  4DKK A;  4GQU A;  4DV2 I;  1IBL I;  3T1H E;  1N32 I;  4MLQ A;  2RSI A;  1ZBQ A;  3MSW A;  5KL4 A;  2L3J A;  2EOS A;  2BR2 A;  4JI2 I;  1FJG I;  5JEA B;  5BR8 I;  2V83 A;  1EH7 A;  1BB8 A;  2R76 A;  4X65 E;  2B7V A;  2EOE A;  2V89 A;  2EN6 A;  2EM3 A;  2YTO A;  1NHJ A;  1ZM9 A;  1WUU A;  4IZK B;  4B3R E;  1USV A;  2EMH A;  2MC6 A;  3IWD A;  2V86 A;  4BHB A;  4LF5 E;  1UDN A;  4O24 A;  1X48 A;  1G2D C;  2HK3 A;  2DEJ A;  4MU3 A;  2YZT A;  4BS9 A;  2V2V A;  2WBU A;  4DR2 E;  2Q8U A;  3B82 A;  2K7I A;  5A69 A;  1HR0 E;  3HPS A;  4Z7C A;  2B3T B;  1R6L A;  3UK3 C;  4F2J C;  3EPH A;  2I13 A;  1RHY A;  1UDS A;  2WP8 A;  3PYE A;  4FW6 A;  1YYW A;  2EPP A;  2LV2 A;  1YYK A;  3OML A;  5T6J A;  4DV2 E;  5A6J A;  4BA1 A;  3THN A;  4JI6 I;  2BM1 A;  1D6T A;  1OJ4 A;  1MU5 A;  4NXN I;  1ELO A;  2M7Q A;  3ECR A;  1HNW E;  1UEK A;  1EH8 A;  2PO0 B;  3U1Y A;  3AUZ A;  3KZY A;  1N0V C;  2RSM A;  4X64 E;  1Y4U A;  4ISA A;  1SR9 A;  1P47 A;  3HJC A;  4JI1 E;  4MLV A;  2ZM6 E;  2F1D A;  3ZZU A;  4DPW A;  4ZYE A;  2LJP A;  4B3M E;  1FI4 A;  4IFD E;  4JI6 E;  2EM8 A;  4O4K A;  3Q6M A;  4YHH E;  4B3T I;  5A6K A;  1IMU A;  2EPN A;  3J81 Q;  2MDG A;  3BID A;  1WHQ A;  2GHF A;  2JR1 A;  2E72 A;  3LPS A;  4DPY A;  4P78 A;  3M7N D;  1A1H A;  5DNY A;  1JK1 A;  5FWK A;  4AM3 A;  1IQS A;  2YT4 A;  1IBK E;  4JG4 A;  1KJK A;  4FWH A;  2E5L I;  1PJT A;  2YTE A;  2NN6 E;  1IBM I;  3GON A;  2IER A;  2L2N A;  2BA0 D;  4FN5 A;  4HAC A;  1HNZ I;  4Z7Y A;  1Z0G A;  3L7Z B;  2HHH I;  4DR6 I;  4R2Q A;  4U3B A;  2NA2 A;  4LF9 E;  3FIG A;  2B7T A;  2D9H A;  4L5N C;  4F6M A;  4BA2 B;  2EOH A;  4IZJ A;  4I3H A;  1FKA E;  4QNJ A;  3F0N A;  4DV1 I;  4FW3 A;  3GCM A;  3MHS C;  3VYX A;  1MX0 A;  1XNQ I;  4J8Z A;  2HHH E;  4B3T E;  4DR6 E;  4OO1 A;  4DR2 I;  1NCS A;  1XHK A;  2JOB A;  2EM6 A;  2KHX A;  2HFS A;  4FW5 A;  1N36 I;  2M1S A;  5TSE A;  2RQL A;  4KWY A;  3P76 A;  1STU A;  4JYA I;  1N32 E;  2ENA A;  3HXL A;  2EQ3 A;  1AH5 A;  4LCF A;  2YWQ A;  4YHH I;  3H4L A;  2UUC I;  2L3C A;  4GKK I;  4GZN C;  2EM2 A;  2HK2 A;  1XNR I;  1N34 E;  4JI2 E;  3ADL A;  2NN6 D;  4DU7 A;  1J5E I;  4WFT A;  2BA1 G;  2DLQ A;  1WXR A;  1UN6 B;  1OYR A;  2HFU A;  2UUA E;  5DNX A;  4DUZ E;  4LCH A;  1E3H A;  3K85 A;  5GME A;  2WNR B;  4JI1 I;  4JI3 I;  4K0K I;  2EMC A;  2EPU A;  4DV0 E;  2GPI A;  5EKW A;  2VQE I;  1KYQ A;  2L33 A;  4DR1 E;  5ELW A;  2EE8 A;  1EA6 A;  3ZZT A;  4WPY A;  4IFD B;  3QT7 A;  2BA0 G;  5AE3 A;  1F2I G;  4M1K A;  2EQ0 A;  1PIE A;  4MDT A;  2EMB A;  2EMK A;  4LF9 I;  2E1R A;  3H1C A;  2YTF A;  4XTJ A;  2UXB E;  4ZVI A;  2UUA I;  2R3V A;  2JE6 A;  2EMZ A;  5A6A A;  5AC4 A;  4HYM A;  4IFD F;  2HKJ A;  3DF6 A;  4OKG A;  4FWG A;  4OO1 F;  4LPF A;  4USK A;  3U1K A;  3P3C A;  2Z5C A;  1GQE A;  1PKP A;  4HXZ A;  4PU9 A;  4AIM A;  1DQ3 A;  1HNW I;  2EMW A;  2JP9 A;  5F3W A;  2EN4 A;  3EQ1 A;  2PRT A;  1QZR A;  3P3E A;  2UXC E;  1YSA C;  5IV8 B;  5DNL A;  4FW7 A;  3M85 G;  3AV0 A;  2BB8 A;  1IBL E;  2YRM A;  4URL A;  2PO1 B;  2RTX A;  2DGC A;  1KIJ A;  1Z0W A;  2GQ0 A;  2LRS A;  2NUF A;  1VIS A;  2O1V A;  1Z1B A;  3CDI A;  4NBQ A;  5C0X E;  4TUG A;  5IT9 C;  2EZ6 A;  5AAS A;  1H7S A;  1H74 A;  2NUG A;  4MQY A;  2WBT A;  4B3R I;  2PNZ B;  1AAY A;  2G7H A;  4K0K E;  2UXB I;  5C0X A;  3LLH A;  4N4R B;  4ZYD A;  2E5L E;  4TUI A;  1Z5B A;  2V87 A;  2PO2 B;  3MHH C;  3J7A G;  1X6E A;  4UT4 A;  3T1Y I;  2LJH A;  4JI0 I;  2UUC E;  4GKK E;  2PO0 A;  4HY1 A;  1PJQ A;  5K36 B;  2JWO A;  2YTI A;  4OOG C;  4F54 A;  1KKH A;  1N34 I;  1UDQ A;  2DB2 A;  4JI8 E;  5LMN E;  1A6F A;  2EOX A;  1HK7 A;  2EM0 A;  2AJ4 A;  2E1M A;  5KL3 A;  4LF7 I;  2CT1 A;  1G2F C;  1BKN A;  1NHH A;  4RPF A;  2EOQ A;  2HC5 A;  2O1T A;  4DR1 I;  4IFD D;  1K47 A;  1A1I A;  2Z5B B;  3L00 A;  3WU3 A;  3J80 C;  2EMX A;  2BA1 D;  2C37 B;  4DPU A;  2ODR D;  2B9D A;  1Z0V A;  3PS2 A;  1IQO A;  1RMD A;  2JXP A;  3D4J A;  2CPN A;  2GO4 A;  4DR3 I;  2EL5 A;  1OYP A;  2GO3 A;  2JEB A;  3M6A A;  5LMU I;  2ELZ A;  4MU4 A;  3H09 A;  4O43 A;  2CTD A;  1P42 A;  5DRP A;  5A6B A;  3NZK A;  2EM5 A;  3T1Y E;  4OZE A;  2EPC A;  4MYT A;  2N8X A;  3KZZ A;  2O3Z A;  3EPJ A;  4O5G A;  5JEA E;  2BBG A;  2EJ4 A;  1KVK A;  4IZJ B;  3VYY A;  3QT8 A;  1XMQ E;  4WXD A;  2UXC I;  5IXM B;  2F8B A;  1L4S A;  1IBK I;  3M7N G;  4NHR A;  1IBM E;  5JEA A;  1JK2 A;  1Y60 A;  3K1J A;  3CDJ A;  1UBD C;  1UHZ A;  3ZOQ B;  2DMY A;  4KZS A;  1ZXM A;  2A2D A;  3ADJ A;  1X47 A;  1MEY C;  1Z0T A;  4LCG A;  3PS3 A;  2LJU A;  5C0X D;  2MC5 A;  1PJS A;  1ZXN A;  4WUC A;  2NAB A;  4LF7 E;  2VF3 A;  4JI3 E;  2LTR A;  4QNK A;  1YUI A;  3ZZ0 A;  1Z0B A;  2UU9 I;  3HUL A;  3GME A;  5A2Q Q;  1U2R A;  3B4T A;  2Q2E B;  5K36 C;  2EPM X;  1YYO A;  4F9C B;  3P06 A;  1EKZ A;  2DSY A;  4WX9 A;  4LFB E;  3C4T A;  3PS1 A;  3C6M A;  2DLK A;  1GZ6 A;  4U3D A;  5DRO A;  4DR5 I;  1USU A;  2C38 B;  2YSO A;  1KTV A;  1PDA A;  2X7I A;  4DV3 I;  2RS6 A;  1FNM A;  3P3G A;  4R1F A;  2YRH A;  3RMP A;  2YRK A;  1J5E E;  1YUJ A;  1E3P A;  1RR9 A;  2JE6 B;  3QG5 C;  2BM0 A;  4JI4 I;  4WSP A;  2CVE A;  2EWL A;  1XMQ I;  4DR4 I;  4PRV A;  4DUZ I;  2F4V E;  2Z5C B;  2VQE E;  2EN8 A;  1J26 A;  2LCE A;  4USM A;  1YFH A;  2VQF I;  4NXM I;  4IJD A;  3THO B;  4B3S E;  4WYQ B;  3Q1Q A;  2EMG A;  1T39 A;  5LL6 R;  1S16 A;  4JI8 I;  2UXD E;  3ZKD A;  5LLQ A;  2YPN A;  1Z0E A;  2WZO A;  3J7A M;  4Q28 A;  1LLM C;  1BBG A;  4R2E A;  3EPL A;  2IES A;  2NN6 A;  4DPX A;  3J7Y p;  4BC7 A;  3WU5 A;  2YSP A;  4BMJ A;  2FV4 B;  3JAM C;  2UU9 E;  1WHN A;  4LFC E;  1N0U A;  4JV5 I;  4DV1 E;  2C39 A;  2JEA A;  2ELY A;  4B3S I;  1XNQ E;  4LFA E;  2K4V A;  1ZM3 A;  2LUP B;  5JEA F;  2WBS A;  2L2M A;  2NPF A;  5LMU E;  4BCA A;  5K36 A;  3Q6N A;  1ZAA C;  2IOQ A;  3WU4 A;  4ED4 A;  1HNX E;  5KL5 A;  2GLI A;  4DV5 I;  2EM7 A;  4WUB A;  2LTS A;  2M4I A;  1MGT A;  2J7K A;  2EPK X;  5KL6 A;  2MKN A;  4IZJ D;  4R2D A;  4WSG A;  2V88 A;  2UXD I;  1UIL A;  4X8W A;  4MU1 A;  2EMY A;  2YTD A;  2F4V I;  3TQM A;  4DR5 E;  1R6M A;  4IS1 C;  2LT7 A;  4JI0 E;  1T4O A;  4DV4 E;  1BBO A;  2C37 A;  3PYG A;  2EN1 A;  2O1U A;  4JI4 E;  2LMZ A;  1X6H A;  3HTX A;  4R2C A;  4IFD A;  1T38 A;  2NUE A;  2DMI A;  2BR2 B;  4N3O A;  2ENH A;  3JTZ A;  1I94 E;  2EQ1 A;  4NXM E;  2N3H A;  1ZBT A;  2JY9 A;  5JEA C;  4IZK A;  2HKE A;  4M9V C;  5JEA D;  2ZBK B;  4HEI A;  3BBG A;  2UUB I;  4X66 I;  4LF4 I;  4OO1 C;  5A6B D;  2A25 A;  2I9I A;  4JI7 I;  1N3G A;  4DV5 E;  1RC7 A;  2YTP A;  4LFC I;  4OO1 E;  2EOZ A;  2EL6 A;  2JYA A;  2CSH A;  4HTG A;  1YH8 A;  2CGE A;  1RQ0 A;  4KHP E;  1A1J A;  2DEI A;  2JPA A;  2WP8 B;  4AQY I;  4DR4 E;  3JAM Q;  4JI5 I;  2YTG A;  2BV3 A;  5KL7 A;  4LFB I;  4DUY I;  2YU8 A;  2A2C A;  2KON A;  1X49 A;  4DR7 E;  3HKM A;  4IS9 A;  3JU0 A;  5IWA I;  2VQF E;  2VE7 C;  1OYS A;  2PNZ A;  4AID A;  5AE1 A;  3LML A;  3P1X A;  4X62 I;  2DIX A;  2X36 A;  4F9B B;  3K17 A;  2MKD A;  2PO2 A;  4F6N A;  3B8H A;  5LMN I;  2EP3 A;  2C38 A;  3F6G A;  2OI2 A;  4FK5 C;  4BHC A;  3WU6 A;  3M99 B;  1H72 C;  2WCC 3;  2EPZ A;  1ZU1 A;  2CG9 A;  4J3D A;  3ADG A;  4DV6 I;  4RHB B;  2VES A;  3OTO E;  3KWR A;  1Z0C A;  3VK6 A;  2YTN A;  1SFE A;  4LFA I;  2ZM6 I;  4R2R A;  4R8O A;  1XMO E;  2PNM A;  3PYF A;  1MG7 A;  1NHI A;  4DR3 E;  2NN6 F;  4FW9 A;  1O0W A;  2EMI A;  4NZV A;  3ADI A;  4X65 I;  4F9A B;  4DV6 E;  2V8P A;  4HAC B;  4KQV A;  5DRQ A;  1ZM4 A;  2EN3 A;  2IOP A;  2LE2 A;  4DV3 E;  1HNX I;  5IWA E;  3OTO I;  5IT9 Q;  4P7D A;  1QNT A;  1ZM2 A;  1B63 A;  2NN6 B;  3PRY A;  4OX9 I;  2JEB B;  1X5W A;  1DAR A;  4MYU A;  3BGH A;  4JI5 E;  1Z59 A;  4DUY E;  2EN7 A;  3DJW A;  3GLL A;  4BA2 A;  2CZ9 A;  4M0V A;  2V34 A;  5EL9 A;  2ZIT A;  4DU8 A;  3V5R A;  2EN2 A;  4OO1 B;  5C0X C;  2LO3 A;  3HPZ A;  2VRD A;  2DRP A;  2WW4 A;  4OO1 D;  1TN9 A;  3VHT B;  5K36 F;  2V8Q B;  2EPX A;  2YTJ A;  3BF2 A;  4LOM A;  2EMA A;  2EMF A;  5A2Q C;  4JV5 E;  2EOM A;  5FLX Q;  3B78 A;  2LBS B;  1DGC A;  2L8T A;  2KOU A;  4X64 I;  3QT5 A;  3UHM A;  2EOR A;  1Z5C A;  1TF3 A;  4FW4 A;  3CWV A;  1B62 A;  4B3M I;  2EM9 A;  2M9A A;  2JOX A;  1WRJ A;  2EOY A;  1Y4S A;  4DMI A;  2WNR A;  4P7A A;  2FGG A;  1N33 I;  4BA1 B;  4WXC A;  1QU6 A;  4RH8 A;  2ADR A;  4R2P A;  1X3C A;  1T4L B;  4PRX A;  4UTG A;  5DRR A;  2EPL X;  1A1F A;  1A1L A;  3KRN A;  4IFD C;  2EOO A;  4BC9 A;  2PNL A;  2EM4 A;  3F6H A;  1T4N A;  2JVA A;  4DV0 I;  4L8N A;  4LF5 I;  2RS7 A;  4M30 A;  2YTQ A;  3EPK A;  4AQY E;  1EI1 A;  3LTO A;  2V85 A;  4YY3 I;  3IWB A;  4LTY A;  2HJJ A;  4DV7 E;  3HQ1 A;  1N33 E;  3C6K A;  4X66 E;  5KL2 A;  4LF4 E;  4GKJ I;  3ZKB A;  2EFG A;  2LVH A;  2R1F A;  1ZR9 A;  1A1G A; 
#chains in the Genus database with same CATH homology
 4OX9 E;  4KHP I;  1FWK A;  1H73 A;  4LF6 I;  2L2K B;  4DXL A;  2XEX A;  4NXN E;  5BR8 E;  4R03 A;  4DR7 I;  4WUD A;  3IWC A;  4LU9 A;  1PVG A;  1N36 E;  2V2Q A;  4BBY A;  5L3J A;  5GMD A;  2R42 A;  3J80 Q;  1I94 I;  1XMO I;  1RRE A;  1S4E A;  2IHR 1;  3K6Q A;  3T1H I;  4LF6 E;  2L92 A;  4FWD A;  3C4B A;  2UUB E;  2GS8 A;  4GEQ B;  3V2U C;  4JI7 E;  5AE2 A;  4LF8 E;  4P52 A;  4I8O A;  4M2Z A;  2MDR A;  4YY3 E;  1FWL A;  2V2Z A;  5FLX C;  1Y6Z A;  1HNZ E;  1FJG E;  2FTX B;  3QT6 A;  4GKJ E;  2Z5B A;  1HR0 I;  3J81 C;  4LF8 I;  4DV4 I;  2L6M A;  2H36 X;  2VF1 A;  2LUQ A;  2O1W A;  4JYA E;  1H7U A;  3PYD A;  2N3G A;  4X62 E;  5ADZ A;  3LNU A;  1DI2 A;  2Z5E A;  4DPT A;  1XNR E;  4DV7 I;  4EMD A;  5CFF E;  1NZ0 A;  1Z5A A;  3ZM7 A;  1YZ9 A;  2ODR C;  4DV2 I;  4DKK A;  1IBL I;  3T1H E;  1N32 I;  3MSW A;  1ZBQ A;  2L3J A;  1FJG I;  5BR8 I;  2V83 A;  2DEI A;  1N34 I;  4X65 E;  4JI2 I;  2B7V A;  1ZM9 A;  2V89 A;  1NHJ A;  4IZK B;  1WUU A;  4B3R E;  1USV A;  2MC6 A;  3IWD A;  2V86 A;  4LF5 E;  2HK3 A;  1X48 A;  2DEJ A;  2YZT A;  4BS9 A;  2V2V A;  4DR2 E;  3B82 A;  1HR0 E;  3HPS A;  4Z7C A;  2B3T B;  3PYE A;  1YYW A;  1YYK A;  3OML A;  5T6J A;  4DV2 E;  4JI6 I;  1D6T A;  2BM1 A;  1OJ4 A;  1MU5 A;  4NXN I;  1ELO A;  2M7Q A;  1HNW E;  1UEK A;  3AUZ A;  1N0V C;  2RSM A;  4X64 E;  1Y4U A;  1SR9 A;  3HJC A;  4JI1 E;  2ZM6 E;  3ZZU A;  4DPW A;  2LJP A;  4B3M E;  1FI4 A;  4JI6 E;  3Q6M A;  4YHH E;  4B3T I;  3J81 Q;  1WHQ A;  2JR1 A;  3LPS A;  4DPY A;  4P78 A;  5DNY A;  5FWK A;  2YT4 A;  1IBK E;  4JG4 A;  2E5L I;  4FWH A;  1IBM I;  3GON A;  2L2N A;  4HAC A;  4FN5 A;  1HNZ I;  4Z7Y A;  1Z0G A;  2HHH I;  4DR6 I;  2NA2 A;  4LF9 E;  3FIG A;  2B7T A;  4L5N C;  4IZJ A;  4I3H A;  1FKA E;  4DV1 I;  3F0N A;  3VYX A;  1MX0 A;  1XNQ I;  4J8Z A;  2HHH E;  4B3T E;  4DR6 E;  4DR2 I;  1XHK A;  2JOB A;  2KHX A;  2HFS A;  1N36 I;  2M1S A;  1STU A;  4JYA I;  1N32 E;  3HXL A;  4YHH I;  3H4L A;  2UUC I;  2L3C A;  4GKK I;  2HK2 A;  1XNR I;  1N34 E;  4JI2 E;  3ADL A;  4DU7 A;  1J5E I;  4WFT A;  1WXR A;  2HFU A;  2UUA E;  4DUZ E;  4JI3 I;  3K85 A;  5GME A;  4JI1 I;  4K0K I;  4DV0 E;  2VQE I;  2L33 A;  4DR1 E;  3ZZT A;  1EA6 A;  4WPY A;  3QT7 A;  5AE3 A;  4M1K A;  1PIE A;  4LF9 I;  2E1R A;  4XTJ A;  2UXB E;  4ZVI A;  2UUA I;  2R3V A;  4HYM A;  2HKJ A;  3DF6 A;  4FWG A;  4USK A;  2Z5C A;  1PKP A;  1GQE A;  4HXZ A;  4PU9 A;  1HNW I;  1DQ3 A;  5F3W A;  1QZR A;  2UXC E;  3AV0 A;  1IBL E;  4URL A;  2RTX A;  1KIJ A;  2O1V A;  1Z0W A;  2GQ0 A;  2LRS A;  2NUF A;  1VIS A;  4TUG A;  5IT9 C;  2EZ6 A;  5AAS A;  1H7S A;  1H74 A;  2NUG A;  4B3R I;  2UXB I;  2G7H A;  4K0K E;  3LLH A;  2E5L E;  4TUI A;  1Z5B A;  2V87 A;  3J7A G;  4UT4 A;  3T1Y I;  2LJH A;  4JI0 I;  2UUC E;  4GKK E;  4HY1 A;  2JWO A;  4OOG C;  4F54 A;  1KKH A;  2DB2 A;  4JI8 E;  5LMN E;  1A6F A;  1HK7 A;  2AJ4 A;  2E1M A;  4LF7 I;  1BKN A;  4RPF A;  1NHH A;  2O1T A;  4DR1 I;  1K47 A;  2Z5B B;  3WU3 A;  3J80 C;  4DPU A;  2ODR D;  2B9D A;  1Z0V A;  4DR3 I;  3D4J A;  2CPN A;  3M6A A;  5LMU I;  3H09 A;  3T1Y E;  4MYT A;  1KVK A;  4IZJ B;  3VYY A;  3QT8 A;  1XMQ E;  2UXC I;  1IBK I;  2F8B A;  1IBM E;  3K1J A;  1UHZ A;  3ZOQ B;  2DMY A;  4KZS A;  1ZXM A;  2A2D A;  3ADJ A;  1X47 A;  1Z0T A;  2MC5 A;  1ZXN A;  4WUC A;  4LF7 E;  2VF3 A;  4JI3 E;  2LTR A;  3ZZ0 A;  1Z0B A;  2UU9 I;  3HUL A;  5A2Q Q;  1U2R A;  2Q2E B;  1YYO A;  4F9C B;  3P06 A;  1EKZ A;  2DSY A;  4LFB E;  3C4T A;  1GZ6 A;  4DR5 I;  1USU A;  1KTV A;  2X7I A;  4DV3 I;  2RS6 A;  1FNM A;  4R1F A;  3RMP A;  1J5E E;  1RR9 A;  2BM0 A;  4JI4 I;  4WSP A;  2EWL A;  1XMQ I;  4DR4 I;  4PRV A;  4DUZ I;  2F4V E;  2Z5C B;  2VQE E;  1J26 A;  4USM A;  2VQF I;  4NXM I;  4B3S E;  4WYQ B;  3Q1Q A;  5LL6 R;  1S16 A;  4JI8 I;  2UXD E;  3ZKD A;  1Z0E A;  2WZO A;  3J7A M;  4Q28 A;  4DPX A;  3J7Y p;  4BC7 A;  3WU5 A;  4BMJ A;  2FV4 B;  3JAM C;  2UU9 E;  1WHN A;  4LFC E;  1N0U A;  4JV5 I;  4DV1 E;  4B3S I;  1XNQ E;  4LFA E;  2K4V A;  1ZM3 A;  2LUP B;  2L2M A;  2NPF A;  5LMU E;  4BCA A;  3Q6N A;  2IOQ A;  3WU4 A;  4ED4 A;  1HNX E;  4DV5 I;  4WUB A;  2LTS A;  2M4I A;  2J7K A;  4IZJ D;  2V88 A;  2UXD I;  1UIL A;  4X8W A;  2F4V I;  4DR5 E;  3PYG A;  4JI0 E;  1T4O A;  4DV4 E;  2O1U A;  4JI4 E;  2LMZ A;  3HTX A;  2NUE A;  4N3O A;  3JTZ A;  1I94 E;  4NXM E;  2N3H A;  1ZBT A;  2JY9 A;  4IZK A;  2HKE A;  2ZBK B;  2UUB I;  4X66 I;  4LF4 I;  4JI7 I;  4LFC I;  4DV5 E;  1RC7 A;  2CGE A;  1RQ0 A;  4KHP E;  4AQY I;  4DR4 E;  3JAM Q;  4JI5 I;  2BV3 A;  4LFB I;  4DUY I;  2A2C A;  2KON A;  1X49 A;  4DR7 E;  3JU0 A;  5IWA I;  2VQF E;  2VE7 C;  5AE1 A;  3LML A;  3P1X A;  4X62 I;  2DIX A;  2X36 A;  4F9B B;  3K17 A;  3B8H A;  5LMN I;  3F6G A;  2OI2 A;  3WU6 A;  1H72 C;  2CG9 A;  4DV6 I;  3ADG A;  3OTO E;  3KWR A;  1Z0C A;  3VK6 A;  4LFA I;  2ZM6 I;  4R8O A;  1XMO E;  2PNM A;  3PYF A;  1MG7 A;  1NHI A;  4DR3 E;  4FW9 A;  1O0W A;  3ADI A;  4X65 I;  4F9A B;  4DV6 E;  2V8P A;  4HAC B;  4KQV A;  1ZM4 A;  2IOP A;  1HNX I;  2LE2 A;  4DV3 E;  5IT9 Q;  5IWA E;  3OTO I;  4P7D A;  1ZM2 A;  1B63 A;  3PRY A;  4OX9 I;  1DAR A;  4MYU A;  4JI5 E;  1Z59 A;  4DUY E;  3DJW A;  2CZ9 A;  4M0V A;  2V34 A;  2ZIT A;  4DU8 A;  3V5R A;  3HPZ A;  2WW4 A;  2V8Q B;  5A2Q C;  4JV5 E;  5FLX Q;  3B78 A;  2LBS B;  2L8T A;  2KOU A;  4X64 I;  3QT5 A;  1Z5C A;  3CWV A;  1B62 A;  4B3M I;  2JOX A;  1Y4S A;  4DMI A;  4P7A A;  2FGG A;  1N33 I;  1QU6 A;  1T4L B;  4PRX A;  4UTG A;  4BC9 A;  2PNL A;  3F6H A;  1T4N A;  2JVA A;  4DV0 I;  4L8N A;  4LF5 I;  2RS7 A;  4M30 A;  4AQY E;  3LTO A;  1EI1 A;  4YY3 I;  2V85 A;  3IWB A;  4LTY A;  4DV7 E;  3HQ1 A;  1N33 E;  4X66 E;  4LF4 E;  4GKJ I;  3ZKB A;  2EFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...