1I94I

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94I00
4UT4A 2BM0A 4DV4E 3GONA 1ZM2A 4K0KE 3T1YE 4LF4E 1HNZI 4KHPE 1XNQE 4P7AA 2HK3A 4DR2E 2HKEA 4JI3I 4DR3E 4DV4I 1N0VC 3ZKDA 4LFBE 1ZXNA 2XEXA 4ED4A 4LF4I 1XNQI 4DR2I 4WUDA 2VQFE 3HULA 1I94E 5GMDA 4JI0I 4DU7A 4LF7I 1H7UA 1HNWE 1N0UA 4DV1E 1N32I 3J7AG 4LF5E 1HNXI 4GKKE 4DV0E 1N33E 1FI4A 2UUAE 2E5LI 3T1HI 2AJ4A 4DV6E 1PVGA 4URLA 1S16A 1HR0E 2UXBE 1IBKI 1J5EE 1KIJA 1WUUA 4GKKI 4YHHE 4LF8E 2VQEE 4JV5E 4WUCA 1Z59A 2HFUA 5GMEA 2V8PA 1ZXMA 4DPUA 3QT5A 4NXMI 1NZ0A 1MU5A 1H74A 2V2ZA 4LF8I 4FWDA 4P52A 3B78A 3LNUA 2HHHE 3ZM7A 1XNRI 1Z0BA 4JYAE 1Z0GA 1Z0VA 3V5RA 4UTGA 2F4VE 1B63A 4DUZE 2UUCE 4JI4E 2HHHI 1H7SA 2VF3A 4JI6I 4LF6E 4HXZA 4JI7E 4PU9A 1N34E 4MYUA 4DR6I 5BR8E 2F4VI 4EMDA 4DUZI 4MYTA 5LMNI 2HFSA 4DV7I 4WUBA 2R3VA 3J7AM 4DR7I 3WU4A 3ZKBA 3WU6A 4X66I 2X7IA 1A6FA 1FNMA 4M1KA 4LF6I 1OJ4A 4DPWA 2UXDI 4JI7I 4DV3I 4B3SI 4FWHA 4JI3E 3WU5A 3B8HA 4KQVA 1RR9A 3PYEA 4B3TI 1NHHA 1S4EA 1FJGI 1H72C 4FW9A 4JI2E 5IWAI 1QZRA 4JI0E 3PYGA 1IBMI 4LF7E 4LF9I 1N32E 5L3JA 3J81Q 4JI2I 4DR5E 4GKJE 2V2VA 1HNXE 3B82A 1Z5AA 3QT6A 3WU3A 2E5LE 3T1HE 4JI5I 1IBKE 2UU9I 4DR5I 4GKJI 2HKJA 1NHJA 1D6TA 3QT7A 3M6AA 4LFCI 3OTOE 1NHIA 1N36I 1Z0TA 4Z7YA 4JI8I 1Z5CA 4NXME 4RPFA 3ZZ0A 4XTJA 5A2QQ 3LTOA 2CZ9A 4X64I 3OTOI 1FWLA 2UUBI 2WW4A 1Z5BA 1ZM3A 1FWKA 1XNRE 2E1RA 3K17A 1Z0CA 4I3HA 4PRXA 4R1FA 3Q1QA 4X65I 5FLXQ 2X36A 4HYMA 5LMUE 4AQYI 4JI6E 4DPYA 2A2DA 3JAMQ 4DR6E 4B3MI 4B3RI 3J81C 5LMNE 2Q2EB 4DV7E 4DV5E 4DR7E 4Z7CA 4X66E 5LMUI 1VISA 4USMA 2UXDE 4HACB 4DV3E 4B3SE 3D4JA 1XHKA 2LJPA 4HACA 1PIEA 4B3TE 4DV5I 4LFAI 4X62I 1FJGE 2ZM6I 2J7KA 5IWAE 1UEKA 1BKNA 1MX0A 3J80Q 4DR1I 4ZVIA 1IBME 5A2QC 2V2QA 4LF9E 2EFGA 4OX9I 1KKHA 2DEIA 3K1JA 1MG7A 4DR4I 5IT9Q 5FLXC 4JI5E 3QT8A 3ZZUA 2UU9E 5LL6R 2GS8A 1XMQE 1Z0EA 2V34A 3PYFA 4LFCE 4DV2I 1RREA 1ELOA 3JAMC 2DEJA 1Z0WA 1N36E 3H4LA 1DARA 4K0KI 3T1YI 4JI8E 3PYDA 4JG4A 4KHPI 1XMQI 4FWGA 4X64E 3CWVA 4DR3I 1B62A 2UUBE 4LFBI 1U2RA 2OI2A 2BM1A 2UXCE 4DU8A 1XMOE 2BV3A 4X65E 2VQFI 1I94I 3J80C 4AQYE 1HNWI 2NPFA 2R42A 4DV1I 4B3ME 2UXCI 4B3RE 1XMOI 4LF5I 2ZITA 4DV0I 4JI1E 3F0NA 1ZM9A 1N33I 1ZM4A 2UUAI 4DV6I 1IBLE 2A2CA 1HR0I 2UXBI 4DPTA 1J5EI 1FKAE 5IT9C 4YHHI 2VQEI 4JI1I 4LFAE 1KVKA 4JV5I 4X62E 4DPXA 2ZM6E 1KTVA 3ZZTA 4NXNE 1EI1A 1IBLI 4DR1E 4DUYE 1PKPA 1K47A 3LPSA 1EA6A 4YY3E 4NXNI 4DXLA 4PRVA 4FN5A 4JYAI 4OX9E 4DUYI 3V2UC 4DR4E 2UUCI 2HK2A 4HY1A 4YY3I 4JI4I 1H73A 1HNZE 2ZBKB 4USKA 1N34I 4DV2E 5BR8I
chains in the Genus database with same CATH superfamily
4UT4A 2BM0A 4DV4E 3GONA 1ZM2A 2NN6B 4NBQA 4K0KE 3T1YE 1UDQA 4LF4E 5C0XE 4FW3A 4J3DA 2IESA 1HNZI 4KHPE 4U3BA 1XNQE 3DD6A 4P7AA 2HK3A 4DR2E 4IZJD 2HKEA 4JI3I 4DR3E 4LCGA 4DV4I 1N0VC 3ZKDA 4LFBE 1ZXNA 4FW5A 2XEXA 4ED4A 4LF4I 5K36C 1XNQI 4DR2I 4WUDA 2VQFE 3HULA 1I94E 5GMDA 2C37A 4JI0I 2GO3A 4MU0A 5FWKA 1E3HA 4DU7A 4LF7I 1H7UA 1HNWE 2PO1B 3P3GA 1N0UA 4DV1E 1N32I 3J7AG 4LF5E 1HNXI 3PRYA 2JEAB 4GKKE 4DV0E 5JEAD 4IFDD 4AIMA 1N33E 1FI4A 2UUAE 2E5LI 3T1HI 2AJ4A 4DV6E 1PVGA 2GO4A 1S16A 4URLA 1HR0E 2UXBE 1IBKI 1J5EE 5K36B 1KIJA 1WUUA 1OYSA 4GKKI 4YHHE 4LF8E 5C0XD 2VQEE 2O1TA 4JV5E 4WUCA 1Z59A 2HFUA 5GMEA 3H1CA 2V8PA 2C39A 3HJCA 4MU1A 1ZXMA 4DPUA 3P3CA 3QT5A 4NXMI 1NZ0A 1MU5A 2BR2B 2O1WA 1H74A 2V2ZA 4LF8I 4OKGA 3M7NG 4FWDA 4P52A 3B78A 3LNUA 3P3EA 3P76A 2C38A 2HHHE 3ZM7A 1XNRI 1Z0BA 4JYAE 1Z0GA 1Z0VA 3V5RA 4UTGA 4OO1E 2F4VE 1B63A 2J65A 2NN6C 4DUZE 2UUCE 2Z5BA 4JI4E 5DROA 2HHHI 1H7SA 2VF3A 4JI6I 4LF6E 2O1UA 2JEBB 4HXZA 4JI7E 4PU9A 1N34E 4MYUA 4DR6I 5BR8E 4AIDA 4EMDA 2F4VI 4DUZI 2GQ0A 4MYTA 5LMNI 2HFSA 4DV7I 4WUBA 2R3VA 3J7AM 4DR7I 3WU4A 3ZKBA 3WU6A 4X66I 1Y4UA 4LPFA 4QNKA 2X7IA 1A6FA 1UDSA 1FNMA 4LOMA 4M1KA 3M85G 4LF6I 1OJ4A 4DPWA 2UXDI 4JI7I 4DV3I 2CGEA 4FWHA 4B3SI 2WP8A 1Y5YA 3WU5A 4JI3E 2NN6F 1R6LA 3B8HA 3PS1A 2JT2A 4KQVA 1RR9A 3PYEA 3M7ND 4B3TI 1NHHA 3U1YA 2WNRB 1S4EA 1FJGI 1H72C 2NN6A 4FW9A 4JI2E 2PNMA 4N3OA 5IWAI 1QZRA 2CG9A 5C0XB 1YHCA 4JI0E 3NZKA 3PYGA 2JE6B 1IBMI 4LF7E 5DRQA 4OO1D 3U1KA 4LF9I 1N32E 5L3JA 3J81Q 4JI2I 4DR5E 4GKJE 2V2VA 1USVA 1HNXE 3B82A 1Z5AA 4LCFA 3QT6A 4GQUA 3WU3A 2E5LE 2Z5EA 3T1HE 4JI5I 1IBKE 2UU9I 4DR5I 4GKJI 2HKJA 2F1DA 3M85D 2PO1A 1NHJA 1D6TA 3CDIA 3HKMA 5DNLA 4OZEA 3QT7A 3M6AA 4LFCI 4BA2B 3OTOE 2JEAA 1NHIA 1N36I 1Z0TA 2O1VA 4Z7YA 5K36F 4JI8I 5DRPA 5ELWA 1Z5CA 4NXME 4RPFA 1OYRA 3ZZ0A 4BA1B 4XTJA 5A2QQ 1YH8A 3LTOA 5K36A 2CZ9A 4X64I 3OTOI 1FWLA 4MDTA 2UUBI 2WW4A 1Z5BA 1ZM3A 1FWKA 5K36E 2NN6D 1XNRE 2E1RA 5DRRA 3K17A 4IZKB 1Z0CA 4I3HA 4PRXA 4R1FA 3Q1QA 4X65I 2BR2A 5FLXQ 3GCMA 2X36A 2PO0B 4HYMA 5LMUE 4AQYI 4JI6E 4DPYA 5JEAC 4IFDC 4IS9A 4IZJB 2A2DA 3JAMQ 3L7ZB 4DR6E 4B3MI 4B3RI 1Y4SA 3J81C 5LMNE 4FW4A 2IOPA 2Q2EB 2BA1D 4DV7E 4DV5E 4DR7E 4Z7CA 4X66E 5LMUI 4OO1B 1VISA 3CDJA 4USMA 2UXDE 5C0XC 4HACB 4DV3E 4B3SE 3D4JA 1XHKA 2JEBA 2LJPA 4HACA 4LCHA 1PIEA 4B3TE 4DV5I 4LFAI 4X62I 2PNLA 5EKWA 1FJGE 2ZM6I 2J7KA 3P06A 4AM3A 5JEAF 5IWAE 4FW6A 1UEKA 1BKNA 2IERA 5JEAB 1MX0A 4IFDB 3J80Q 5K36D 4DR1I 3Q6NA 4ZVIA 1IBME 3Q6MA 5A2QC 2V2QA 2BA0D 4LF9E 2Z5CB 2PNZB 2WNRA 5C0XF 2NN6E 2EFGA 4OX9I 1KKHA 2DEIA 3K1JA 1MG7A 2CVEA 5C0XA 4FW7A 4DR4I 5IT9Q 5FLXC 4JI5E 2JE6A 3QT8A 3ZZUA 2UU9E 5LL6R 2GS8A 4MQYA 1XMQE 1Z0EA 2V34A 3PYFA 4LFCE 4DV2I 4U3DA 1RREA 1ELOA 3JAMC 2DEJA 1Z0WA 1N36E 3H4LA 1DARA 4K0KI 3T1YI 4JI8E 3PYDA 4JG4A 4KHPI 1XMQI 2BA1G 2C37B 4FWGA 4X64E 3CWVA 4DR3I 1B62A 2UUBE 3B4TA 4BA2A 4LFBI 1U2RA 2OI2A 2BM1A 2AE8A 4MU3A 2UXCE 4DU8A 1XMOE 2BV3A 4MU4A 4X65E 3UHMA 2VQFI 4OO1C 1I94I 4BA1A 1Y6ZA 3J80C 4AQYE 1HNWI 1UDNA 2NPFA 1UDOA 2R42A 4DV1I 4B3ME 2UXCI 4B3RE 1XMOI 4LF5I 4IZKA 1RHYA 1XXEA 2ZITA 2BA0G 5EL9A 4DV0I 1USUA 4JI1E 1OYPA 3F0NA 1ZM9A 2C39B 2PO2B 1N33I 1ZM4A 2UUAI 3KRNA 2PO0A 3PS2A 2PO2A 4DV6I 1IBLE 2A2CA 2VESA 1HR0I 4DPTA 4ISAA 2UXBI 1J5EI 1FKAE 5IT9C 4IZJA 4OO1F 3L7ZA 4YHHI 2VQEI 3GLLA 4JI1I 1KVKA 4LFAE 3PS3A 4X62E 4JV5I 2C38B 4DPXA 2ZM6E 1KTVA 3ZZTA 4NXNE 1EI1A 4OO1A 1IBLI 3GMEA 4DR1E 4DUYE 1PKPA 1K47A 2Z5BB 1HK7A 3LPSA 1Y60A 1EA6A 3K85A 4YY3E 4NXNI 4DXLA 2O3ZA 4IFDF 4PRVA 1E3PA 4FN5A 4JYAI 4OX9E 4DUYI 3V2UC 5DNXA 5JEAA 1P42A 4IFDA 4DR4E 1VI7A 2HK2A 2UUCI 2IOQA 4HY1A 4YY3I 4JI4I 1H73A 4QNJA 5JEAE 4IFDE 1HNZE 2ZBKB 2WP8B 2Z5CA 1R6MA 2PNZA 4USKA 1N34I 4DV2E 5BR8I
chains in the Genus database with same CATH topology
4UT4A 2BM0A 4DV4E 3GONA 1ZM2A 4K0KE 3T1YE 4LF4E 1HNZI 4KHPE 1XNQE 4P7AA 2HK3A 4DR2E 4IZJD 2HKEA 4JI3I 4DR3E 4DV4I 1N0VC 3ZKDA 4LFBE 1ZXNA 2XEXA 4ED4A 4LF4I 1XNQI 4DR2I 4WUDA 2VQFE 3HULA 1I94E 5GMDA 4JI0I 5FWKA 4DU7A 4LF7I 1H7UA 1HNWE 1N0UA 4DV1E 1N32I 3J7AG 4LF5E 1HNXI 3PRYA 4GKKE 4DV0E 1N33E 1FI4A 2UUAE 2E5LI 3T1HI 2AJ4A 4DV6E 1PVGA 4URLA 1S16A 1HR0E 2UXBE 1IBKI 1J5EE 1KIJA 1WUUA 4GKKI 4YHHE 4LF8E 2VQEE 2O1TA 4JV5E 4WUCA 1Z59A 2HFUA 5GMEA 2V8PA 3HJCA 1ZXMA 4DPUA 3QT5A 4NXMI 1NZ0A 1MU5A 2O1WA 1H74A 2V2ZA 4LF8I 4FWDA 4P52A 3B78A 3LNUA 2HHHE 3ZM7A 1XNRI 1Z0BA 4JYAE 1Z0GA 1Z0VA 3V5RA 4UTGA 2F4VE 1B63A 4DUZE 2UUCE 2Z5BA 4JI4E 2HHHI 1H7SA 2VF3A 4JI6I 4LF6E 2O1UA 4HXZA 4JI7E 4PU9A 1N34E 4MYUA 4DR6I 5BR8E 2F4VI 4EMDA 4DUZI 2GQ0A 4MYTA 5LMNI 2HFSA 4DV7I 4WUBA 2R3VA 3J7AM 4DR7I 3WU4A 3ZKBA 3WU6A 4X66I 1Y4UA 2X7IA 1A6FA 1FNMA 4M1KA 4LF6I 1OJ4A 4DPWA 2UXDI 4JI7I 4DV3I 2CGEA 4FWHA 4B3SI 4JI3E 3WU5A 3B8HA 4KQVA 1RR9A 3PYEA 4B3TI 1NHHA 1S4EA 1FJGI 1H72C 4FW9A 4JI2E 2PNMA 4N3OA 5IWAI 1QZRA 2CG9A 4JI0E 3PYGA 1IBMI 4LF7E 4LF9I 1N32E 5L3JA 3J81Q 4JI2I 4DR5E 4GKJE 2V2VA 1USVA 1HNXE 3B82A 1Z5AA 3QT6A 3WU3A 2E5LE 2Z5EA 3T1HE 4JI5I 1IBKE 2UU9I 4DR5I 4GKJI 2HKJA 1NHJA 1D6TA 3QT7A 3M6AA 4LFCI 3OTOE 1NHIA 1N36I 1Z0TA 2O1VA 4Z7YA 4JI8I 1Z5CA 4NXME 4RPFA 3ZZ0A 4XTJA 5A2QQ 3LTOA 2CZ9A 4X64I 3OTOI 1FWLA 2UUBI 2WW4A 1Z5BA 1ZM3A 1FWKA 1XNRE 2E1RA 3K17A 4IZKB 1Z0CA 4I3HA 4PRXA 4R1FA 3Q1QA 4X65I 5FLXQ 2X36A 4HYMA 5LMUE 4AQYI 4JI6E 4DPYA 4IZJB 2A2DA 3JAMQ 4DR6E 4B3MI 4B3RI 1Y4SA 3J81C 5LMNE 2IOPA 2Q2EB 4DV7E 4DV5E 4DR7E 4Z7CA 4X66E 5LMUI 1VISA 4USMA 2UXDE 4HACB 4DV3E 4B3SE 3D4JA 1XHKA 2LJPA 4HACA 1PIEA 4B3TE 4DV5I 4LFAI 4X62I 2PNLA 1FJGE 2ZM6I 2J7KA 3P06A 5IWAE 1UEKA 1BKNA 1MX0A 3J80Q 4DR1I 3Q6NA 4ZVIA 1IBME 3Q6MA 5A2QC 2V2QA 4LF9E 2Z5CB 2EFGA 4OX9I 1KKHA 2DEIA 3K1JA 1MG7A 4DR4I 5IT9Q 5FLXC 4JI5E 3QT8A 3ZZUA 2UU9E 5LL6R 2GS8A 1XMQE 1Z0EA 2V34A 3PYFA 4LFCE 4DV2I 1RREA 1ELOA 3JAMC 2DEJA 1Z0WA 1N36E 3H4LA 1DARA 4K0KI 3T1YI 4JI8E 3PYDA 4JG4A 4KHPI 1XMQI 4FWGA 4X64E 3CWVA 4DR3I 1B62A 2UUBE 4LFBI 1U2RA 2OI2A 2BM1A 2UXCE 4DU8A 1XMOE 2BV3A 4X65E 2VQFI 1I94I 1Y6ZA 3J80C 4AQYE 1HNWI 2NPFA 2R42A 4DV1I 4B3ME 2UXCI 4B3RE 1XMOI 4LF5I 4IZKA 2ZITA 4DV0I 1USUA 4JI1E 3F0NA 1ZM9A 1N33I 1ZM4A 2UUAI 4DV6I 1IBLE 2A2CA 1HR0I 2UXBI 4DPTA 1J5EI 1FKAE 5IT9C 4IZJA 4YHHI 2VQEI 4JI1I 4LFAE 1KVKA 4JV5I 4X62E 4DPXA 2ZM6E 1KTVA 3ZZTA 4NXNE 1EI1A 1IBLI 4DR1E 4DUYE 1PKPA 1K47A 2Z5BB 1HK7A 3LPSA 1EA6A 3K85A 4YY3E 4NXNI 4DXLA 4PRVA 4FN5A 4JYAI 4OX9E 4DUYI 3V2UC 4DR4E 2UUCI 2HK2A 2IOQA 4HY1A 4YY3I 4JI4I 1H73A 1HNZE 2ZBKB 2Z5CA 4USKA 1N34I 4DV2E 5BR8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UT4 A;  2BM0 A;  4DV4 E;  3GON A;  1ZM2 A;  4K0K E;  3T1Y E;  4LF4 E;  1HNZ I;  4KHP E;  1XNQ E;  4P7A A;  2HK3 A;  4DR2 E;  2HKE A;  4JI3 I;  4DR3 E;  4DV4 I;  1N0V C;  3ZKD A;  4LFB E;  1ZXN A;  2XEX A;  4ED4 A;  4LF4 I;  1XNQ I;  4DR2 I;  4WUD A;  2VQF E;  3HUL A;  1I94 E;  5GMD A;  4JI0 I;  4DU7 A;  4LF7 I;  1H7U A;  1HNW E;  1N0U A;  4DV1 E;  1N32 I;  3J7A G;  4LF5 E;  1HNX I;  4GKK E;  4DV0 E;  1N33 E;  1FI4 A;  2UUA E;  2E5L I;  3T1H I;  2AJ4 A;  4DV6 E;  1PVG A;  4URL A;  1S16 A;  1HR0 E;  2UXB E;  1IBK I;  1J5E E;  1KIJ A;  1WUU A;  4GKK I;  4YHH E;  4LF8 E;  2VQE E;  4JV5 E;  4WUC A;  1Z59 A;  2HFU A;  5GME A;  2V8P A;  1ZXM A;  4DPU A;  3QT5 A;  4NXM I;  1NZ0 A;  1MU5 A;  1H74 A;  2V2Z A;  4LF8 I;  4FWD A;  4P52 A;  3B78 A;  3LNU A;  2HHH E;  3ZM7 A;  1XNR I;  1Z0B A;  4JYA E;  1Z0G A;  1Z0V A;  3V5R A;  4UTG A;  2F4V E;  1B63 A;  4DUZ E;  2UUC E;  4JI4 E;  2HHH I;  1H7S A;  2VF3 A;  4JI6 I;  4LF6 E;  4HXZ A;  4JI7 E;  4PU9 A;  1N34 E;  4MYU A;  4DR6 I;  5BR8 E;  2F4V I;  4EMD A;  4DUZ I;  4MYT A;  5LMN I;  2HFS A;  4DV7 I;  4WUB A;  2R3V A;  3J7A M;  4DR7 I;  3WU4 A;  3ZKB A;  3WU6 A;  4X66 I;  2X7I A;  1A6F A;  1FNM A;  4M1K A;  4LF6 I;  1OJ4 A;  4DPW A;  2UXD I;  4JI7 I;  4DV3 I;  4B3S I;  4FWH A;  4JI3 E;  3WU5 A;  3B8H A;  4KQV A;  1RR9 A;  3PYE A;  4B3T I;  1NHH A;  1S4E A;  1FJG I;  1H72 C;  4FW9 A;  4JI2 E;  5IWA I;  1QZR A;  4JI0 E;  3PYG A;  1IBM I;  4LF7 E;  4LF9 I;  1N32 E;  5L3J A;  3J81 Q;  4JI2 I;  4DR5 E;  4GKJ E;  2V2V A;  1HNX E;  3B82 A;  1Z5A A;  3QT6 A;  3WU3 A;  2E5L E;  3T1H E;  4JI5 I;  1IBK E;  2UU9 I;  4DR5 I;  4GKJ I;  2HKJ A;  1NHJ A;  1D6T A;  3QT7 A;  3M6A A;  4LFC I;  3OTO E;  1NHI A;  1N36 I;  1Z0T A;  4Z7Y A;  4JI8 I;  1Z5C A;  4NXM E;  4RPF A;  3ZZ0 A;  4XTJ A;  5A2Q Q;  3LTO A;  2CZ9 A;  4X64 I;  3OTO I;  1FWL A;  2UUB I;  2WW4 A;  1Z5B A;  1ZM3 A;  1FWK A;  1XNR E;  2E1R A;  3K17 A;  1Z0C A;  4I3H A;  4PRX A;  4R1F A;  3Q1Q A;  4X65 I;  5FLX Q;  2X36 A;  4HYM A;  5LMU E;  4AQY I;  4JI6 E;  4DPY A;  2A2D A;  3JAM Q;  4DR6 E;  4B3M I;  4B3R I;  3J81 C;  5LMN E;  2Q2E B;  4DV7 E;  4DV5 E;  4DR7 E;  4Z7C A;  4X66 E;  5LMU I;  1VIS A;  4USM A;  2UXD E;  4HAC B;  4DV3 E;  4B3S E;  3D4J A;  1XHK A;  2LJP A;  4HAC A;  1PIE A;  4B3T E;  4DV5 I;  4LFA I;  4X62 I;  1FJG E;  2ZM6 I;  2J7K A;  5IWA E;  1UEK A;  1BKN A;  1MX0 A;  3J80 Q;  4DR1 I;  4ZVI A;  1IBM E;  5A2Q C;  2V2Q A;  4LF9 E;  2EFG A;  4OX9 I;  1KKH A;  2DEI A;  3K1J A;  1MG7 A;  4DR4 I;  5IT9 Q;  5FLX C;  4JI5 E;  3QT8 A;  3ZZU A;  2UU9 E;  5LL6 R;  2GS8 A;  1XMQ E;  1Z0E A;  2V34 A;  3PYF A;  4LFC E;  4DV2 I;  1RRE A;  1ELO A;  3JAM C;  2DEJ A;  1Z0W A;  1N36 E;  3H4L A;  1DAR A;  4K0K I;  3T1Y I;  4JI8 E;  3PYD A;  4JG4 A;  4KHP I;  1XMQ I;  4FWG A;  4X64 E;  3CWV A;  4DR3 I;  1B62 A;  2UUB E;  4LFB I;  1U2R A;  2OI2 A;  2BM1 A;  2UXC E;  4DU8 A;  1XMO E;  2BV3 A;  4X65 E;  2VQF I;  1I94 I;  3J80 C;  4AQY E;  1HNW I;  2NPF A;  2R42 A;  4DV1 I;  4B3M E;  2UXC I;  4B3R E;  1XMO I;  4LF5 I;  2ZIT A;  4DV0 I;  4JI1 E;  3F0N A;  1ZM9 A;  1N33 I;  1ZM4 A;  2UUA I;  4DV6 I;  1IBL E;  2A2C A;  1HR0 I;  2UXB I;  4DPT A;  1J5E I;  1FKA E;  5IT9 C;  4YHH I;  2VQE I;  4JI1 I;  4LFA E;  1KVK A;  4JV5 I;  4X62 E;  4DPX A;  2ZM6 E;  1KTV A;  3ZZT A;  4NXN E;  1EI1 A;  1IBL I;  4DR1 E;  4DUY E;  1PKP A;  1K47 A;  3LPS A;  1EA6 A;  4YY3 E;  4NXN I;  4DXL A;  4PRV A;  4FN5 A;  4JYA I;  4OX9 E;  4DUY I;  3V2U C;  4DR4 E;  2UUC I;  2HK2 A;  4HY1 A;  4YY3 I;  4JI4 I;  1H73 A;  1HNZ E;  2ZBK B;  4USK A;  1N34 I;  4DV2 E;  5BR8 I; 
#chains in the Genus database with same CATH topology
 4UT4 A;  2BM0 A;  4DV4 E;  3GON A;  1ZM2 A;  2NN6 B;  4NBQ A;  4K0K E;  3T1Y E;  1UDQ A;  4LF4 E;  5C0X E;  4FW3 A;  4J3D A;  2IES A;  1HNZ I;  4KHP E;  4U3B A;  1XNQ E;  3DD6 A;  4P7A A;  2HK3 A;  4DR2 E;  4IZJ D;  2HKE A;  4JI3 I;  4DR3 E;  4LCG A;  4DV4 I;  1N0V C;  3ZKD A;  4LFB E;  1ZXN A;  4FW5 A;  2XEX A;  4ED4 A;  4LF4 I;  5K36 C;  1XNQ I;  4DR2 I;  4WUD A;  2VQF E;  3HUL A;  1I94 E;  5GMD A;  2C37 A;  4JI0 I;  2GO3 A;  4MU0 A;  5FWK A;  1E3H A;  4DU7 A;  4LF7 I;  1H7U A;  1HNW E;  2PO1 B;  3P3G A;  1N0U A;  4DV1 E;  1N32 I;  3J7A G;  4LF5 E;  1HNX I;  3PRY A;  2JEA B;  4GKK E;  4DV0 E;  5JEA D;  4IFD D;  4AIM A;  1N33 E;  1FI4 A;  2UUA E;  2E5L I;  3T1H I;  2AJ4 A;  4DV6 E;  1PVG A;  2GO4 A;  1S16 A;  4URL A;  1HR0 E;  2UXB E;  1IBK I;  1J5E E;  5K36 B;  1KIJ A;  1WUU A;  1OYS A;  4GKK I;  4YHH E;  4LF8 E;  5C0X D;  2VQE E;  2O1T A;  4JV5 E;  4WUC A;  1Z59 A;  2HFU A;  5GME A;  3H1C A;  2V8P A;  2C39 A;  3HJC A;  4MU1 A;  1ZXM A;  4DPU A;  3P3C A;  3QT5 A;  4NXM I;  1NZ0 A;  1MU5 A;  2BR2 B;  2O1W A;  1H74 A;  2V2Z A;  4LF8 I;  4OKG A;  3M7N G;  4FWD A;  4P52 A;  3B78 A;  3LNU A;  3P3E A;  3P76 A;  2C38 A;  2HHH E;  3ZM7 A;  1XNR I;  1Z0B A;  4JYA E;  1Z0G A;  1Z0V A;  3V5R A;  4UTG A;  4OO1 E;  2F4V E;  1B63 A;  2J65 A;  2NN6 C;  4DUZ E;  2UUC E;  2Z5B A;  4JI4 E;  5DRO A;  2HHH I;  1H7S A;  2VF3 A;  4JI6 I;  4LF6 E;  2O1U A;  2JEB B;  4HXZ A;  4JI7 E;  4PU9 A;  1N34 E;  4MYU A;  4DR6 I;  5BR8 E;  4AID A;  4EMD A;  2F4V I;  4DUZ I;  2GQ0 A;  4MYT A;  5LMN I;  2HFS A;  4DV7 I;  4WUB A;  2R3V A;  3J7A M;  4DR7 I;  3WU4 A;  3ZKB A;  3WU6 A;  4X66 I;  1Y4U A;  4LPF A;  4QNK A;  2X7I A;  1A6F A;  1UDS A;  1FNM A;  4LOM A;  4M1K A;  3M85 G;  4LF6 I;  1OJ4 A;  4DPW A;  2UXD I;  4JI7 I;  4DV3 I;  2CGE A;  4FWH A;  4B3S I;  2WP8 A;  1Y5Y A;  3WU5 A;  4JI3 E;  2NN6 F;  1R6L A;  3B8H A;  3PS1 A;  2JT2 A;  4KQV A;  1RR9 A;  3PYE A;  3M7N D;  4B3T I;  1NHH A;  3U1Y A;  2WNR B;  1S4E A;  1FJG I;  1H72 C;  2NN6 A;  4FW9 A;  4JI2 E;  2PNM A;  4N3O A;  5IWA I;  1QZR A;  2CG9 A;  5C0X B;  1YHC A;  4JI0 E;  3NZK A;  3PYG A;  2JE6 B;  1IBM I;  4LF7 E;  5DRQ A;  4OO1 D;  3U1K A;  4LF9 I;  1N32 E;  5L3J A;  3J81 Q;  4JI2 I;  4DR5 E;  4GKJ E;  2V2V A;  1USV A;  1HNX E;  3B82 A;  1Z5A A;  4LCF A;  3QT6 A;  4GQU A;  3WU3 A;  2E5L E;  2Z5E A;  3T1H E;  4JI5 I;  1IBK E;  2UU9 I;  4DR5 I;  4GKJ I;  2HKJ A;  2F1D A;  3M85 D;  2PO1 A;  1NHJ A;  1D6T A;  3CDI A;  3HKM A;  5DNL A;  4OZE A;  3QT7 A;  3M6A A;  4LFC I;  4BA2 B;  3OTO E;  2JEA A;  1NHI A;  1N36 I;  1Z0T A;  2O1V A;  4Z7Y A;  5K36 F;  4JI8 I;  5DRP A;  5ELW A;  1Z5C A;  4NXM E;  4RPF A;  1OYR A;  3ZZ0 A;  4BA1 B;  4XTJ A;  5A2Q Q;  1YH8 A;  3LTO A;  5K36 A;  2CZ9 A;  4X64 I;  3OTO I;  1FWL A;  4MDT A;  2UUB I;  2WW4 A;  1Z5B A;  1ZM3 A;  1FWK A;  5K36 E;  2NN6 D;  1XNR E;  2E1R A;  5DRR A;  3K17 A;  4IZK B;  1Z0C A;  4I3H A;  4PRX A;  4R1F A;  3Q1Q A;  4X65 I;  2BR2 A;  5FLX Q;  3GCM A;  2X36 A;  2PO0 B;  4HYM A;  5LMU E;  4AQY I;  4JI6 E;  4DPY A;  5JEA C;  4IFD C;  4IS9 A;  4IZJ B;  2A2D A;  3JAM Q;  3L7Z B;  4DR6 E;  4B3M I;  4B3R I;  1Y4S A;  3J81 C;  5LMN E;  4FW4 A;  2IOP A;  2Q2E B;  2BA1 D;  4DV7 E;  4DV5 E;  4DR7 E;  4Z7C A;  4X66 E;  5LMU I;  4OO1 B;  1VIS A;  3CDJ A;  4USM A;  2UXD E;  5C0X C;  4HAC B;  4DV3 E;  4B3S E;  3D4J A;  1XHK A;  2JEB A;  2LJP A;  4HAC A;  4LCH A;  1PIE A;  4B3T E;  4DV5 I;  4LFA I;  4X62 I;  2PNL A;  5EKW A;  1FJG E;  2ZM6 I;  2J7K A;  3P06 A;  4AM3 A;  5JEA F;  5IWA E;  4FW6 A;  1UEK A;  1BKN A;  2IER A;  5JEA B;  1MX0 A;  4IFD B;  3J80 Q;  5K36 D;  4DR1 I;  3Q6N A;  4ZVI A;  1IBM E;  3Q6M A;  5A2Q C;  2V2Q A;  2BA0 D;  4LF9 E;  2Z5C B;  2PNZ B;  2WNR A;  5C0X F;  2NN6 E;  2EFG A;  4OX9 I;  1KKH A;  2DEI A;  3K1J A;  1MG7 A;  2CVE A;  5C0X A;  4FW7 A;  4DR4 I;  5IT9 Q;  5FLX C;  4JI5 E;  2JE6 A;  3QT8 A;  3ZZU A;  2UU9 E;  5LL6 R;  2GS8 A;  4MQY A;  1XMQ E;  1Z0E A;  2V34 A;  3PYF A;  4LFC E;  4DV2 I;  4U3D A;  1RRE A;  1ELO A;  3JAM C;  2DEJ A;  1Z0W A;  1N36 E;  3H4L A;  1DAR A;  4K0K I;  3T1Y I;  4JI8 E;  3PYD A;  4JG4 A;  4KHP I;  1XMQ I;  2BA1 G;  2C37 B;  4FWG A;  4X64 E;  3CWV A;  4DR3 I;  1B62 A;  2UUB E;  3B4T A;  4BA2 A;  4LFB I;  1U2R A;  2OI2 A;  2BM1 A;  2AE8 A;  4MU3 A;  2UXC E;  4DU8 A;  1XMO E;  2BV3 A;  4MU4 A;  4X65 E;  3UHM A;  2VQF I;  4OO1 C;  1I94 I;  4BA1 A;  1Y6Z A;  3J80 C;  4AQY E;  1HNW I;  1UDN A;  2NPF A;  1UDO A;  2R42 A;  4DV1 I;  4B3M E;  2UXC I;  4B3R E;  1XMO I;  4LF5 I;  4IZK A;  1RHY A;  1XXE A;  2ZIT A;  2BA0 G;  5EL9 A;  4DV0 I;  1USU A;  4JI1 E;  1OYP A;  3F0N A;  1ZM9 A;  2C39 B;  2PO2 B;  1N33 I;  1ZM4 A;  2UUA I;  3KRN A;  2PO0 A;  3PS2 A;  2PO2 A;  4DV6 I;  1IBL E;  2A2C A;  2VES A;  1HR0 I;  4DPT A;  4ISA A;  2UXB I;  1J5E I;  1FKA E;  5IT9 C;  4IZJ A;  4OO1 F;  3L7Z A;  4YHH I;  2VQE I;  3GLL A;  4JI1 I;  1KVK A;  4LFA E;  3PS3 A;  4X62 E;  4JV5 I;  2C38 B;  4DPX A;  2ZM6 E;  1KTV A;  3ZZT A;  4NXN E;  1EI1 A;  4OO1 A;  1IBL I;  3GME A;  4DR1 E;  4DUY E;  1PKP A;  1K47 A;  2Z5B B;  1HK7 A;  3LPS A;  1Y60 A;  1EA6 A;  3K85 A;  4YY3 E;  4NXN I;  4DXL A;  2O3Z A;  4IFD F;  4PRV A;  1E3P A;  4FN5 A;  4JYA I;  4OX9 E;  4DUY I;  3V2U C;  5DNX A;  5JEA A;  1P42 A;  4IFD A;  4DR4 E;  1VI7 A;  2HK2 A;  2UUC I;  2IOQ A;  4HY1 A;  4YY3 I;  4JI4 I;  1H73 A;  4QNJ A;  5JEA E;  4IFD E;  1HNZ E;  2ZBK B;  2WP8 B;  2Z5C A;  1R6M A;  2PNZ A;  4USK A;  1N34 I;  4DV2 E;  5BR8 I; 
#chains in the Genus database with same CATH homology
 4UT4 A;  2BM0 A;  4DV4 E;  3GON A;  1ZM2 A;  4K0K E;  3T1Y E;  4LF4 E;  1HNZ I;  4KHP E;  1XNQ E;  4P7A A;  2HK3 A;  4DR2 E;  4IZJ D;  2HKE A;  4JI3 I;  4DR3 E;  4DV4 I;  1N0V C;  3ZKD A;  4LFB E;  1ZXN A;  2XEX A;  4ED4 A;  4LF4 I;  1XNQ I;  4DR2 I;  4WUD A;  2VQF E;  3HUL A;  1I94 E;  5GMD A;  4JI0 I;  5FWK A;  4DU7 A;  4LF7 I;  1H7U A;  1HNW E;  1N0U A;  4DV1 E;  1N32 I;  3J7A G;  4LF5 E;  1HNX I;  3PRY A;  4GKK E;  4DV0 E;  1N33 E;  1FI4 A;  2UUA E;  2E5L I;  3T1H I;  2AJ4 A;  4DV6 E;  1PVG A;  4URL A;  1S16 A;  1HR0 E;  2UXB E;  1IBK I;  1J5E E;  1KIJ A;  1WUU A;  4GKK I;  4YHH E;  4LF8 E;  2VQE E;  2O1T A;  4JV5 E;  4WUC A;  1Z59 A;  2HFU A;  5GME A;  2V8P A;  3HJC A;  1ZXM A;  4DPU A;  3QT5 A;  4NXM I;  1NZ0 A;  1MU5 A;  2O1W A;  1H74 A;  2V2Z A;  4LF8 I;  4FWD A;  4P52 A;  3B78 A;  3LNU A;  2HHH E;  3ZM7 A;  1XNR I;  1Z0B A;  4JYA E;  1Z0G A;  1Z0V A;  3V5R A;  4UTG A;  2F4V E;  1B63 A;  4DUZ E;  2UUC E;  2Z5B A;  4JI4 E;  2HHH I;  1H7S A;  2VF3 A;  4JI6 I;  4LF6 E;  2O1U A;  4HXZ A;  4JI7 E;  4PU9 A;  1N34 E;  4MYU A;  4DR6 I;  5BR8 E;  2F4V I;  4EMD A;  4DUZ I;  2GQ0 A;  4MYT A;  5LMN I;  2HFS A;  4DV7 I;  4WUB A;  2R3V A;  3J7A M;  4DR7 I;  3WU4 A;  3ZKB A;  3WU6 A;  4X66 I;  1Y4U A;  2X7I A;  1A6F A;  1FNM A;  4M1K A;  4LF6 I;  1OJ4 A;  4DPW A;  2UXD I;  4JI7 I;  4DV3 I;  2CGE A;  4FWH A;  4B3S I;  4JI3 E;  3WU5 A;  3B8H A;  4KQV A;  1RR9 A;  3PYE A;  4B3T I;  1NHH A;  1S4E A;  1FJG I;  1H72 C;  4FW9 A;  4JI2 E;  2PNM A;  4N3O A;  5IWA I;  1QZR A;  2CG9 A;  4JI0 E;  3PYG A;  1IBM I;  4LF7 E;  4LF9 I;  1N32 E;  5L3J A;  3J81 Q;  4JI2 I;  4DR5 E;  4GKJ E;  2V2V A;  1USV A;  1HNX E;  3B82 A;  1Z5A A;  3QT6 A;  3WU3 A;  2E5L E;  2Z5E A;  3T1H E;  4JI5 I;  1IBK E;  2UU9 I;  4DR5 I;  4GKJ I;  2HKJ A;  1NHJ A;  1D6T A;  3QT7 A;  3M6A A;  4LFC I;  3OTO E;  1NHI A;  1N36 I;  1Z0T A;  2O1V A;  4Z7Y A;  4JI8 I;  1Z5C A;  4NXM E;  4RPF A;  3ZZ0 A;  4XTJ A;  5A2Q Q;  3LTO A;  2CZ9 A;  4X64 I;  3OTO I;  1FWL A;  2UUB I;  2WW4 A;  1Z5B A;  1ZM3 A;  1FWK A;  1XNR E;  2E1R A;  3K17 A;  4IZK B;  1Z0C A;  4I3H A;  4PRX A;  4R1F A;  3Q1Q A;  4X65 I;  5FLX Q;  2X36 A;  4HYM A;  5LMU E;  4AQY I;  4JI6 E;  4DPY A;  4IZJ B;  2A2D A;  3JAM Q;  4DR6 E;  4B3M I;  4B3R I;  1Y4S A;  3J81 C;  5LMN E;  2IOP A;  2Q2E B;  4DV7 E;  4DV5 E;  4DR7 E;  4Z7C A;  4X66 E;  5LMU I;  1VIS A;  4USM A;  2UXD E;  4HAC B;  4DV3 E;  4B3S E;  3D4J A;  1XHK A;  2LJP A;  4HAC A;  1PIE A;  4B3T E;  4DV5 I;  4LFA I;  4X62 I;  2PNL A;  1FJG E;  2ZM6 I;  2J7K A;  3P06 A;  5IWA E;  1UEK A;  1BKN A;  1MX0 A;  3J80 Q;  4DR1 I;  3Q6N A;  4ZVI A;  1IBM E;  3Q6M A;  5A2Q C;  2V2Q A;  4LF9 E;  2Z5C B;  2EFG A;  4OX9 I;  1KKH A;  2DEI A;  3K1J A;  1MG7 A;  4DR4 I;  5IT9 Q;  5FLX C;  4JI5 E;  3QT8 A;  3ZZU A;  2UU9 E;  5LL6 R;  2GS8 A;  1XMQ E;  1Z0E A;  2V34 A;  3PYF A;  4LFC E;  4DV2 I;  1RRE A;  1ELO A;  3JAM C;  2DEJ A;  1Z0W A;  1N36 E;  3H4L A;  1DAR A;  4K0K I;  3T1Y I;  4JI8 E;  3PYD A;  4JG4 A;  4KHP I;  1XMQ I;  4FWG A;  4X64 E;  3CWV A;  4DR3 I;  1B62 A;  2UUB E;  4LFB I;  1U2R A;  2OI2 A;  2BM1 A;  2UXC E;  4DU8 A;  1XMO E;  2BV3 A;  4X65 E;  2VQF I;  1I94 I;  1Y6Z A;  3J80 C;  4AQY E;  1HNW I;  2NPF A;  2R42 A;  4DV1 I;  4B3M E;  2UXC I;  4B3R E;  1XMO I;  4LF5 I;  4IZK A;  2ZIT A;  4DV0 I;  1USU A;  4JI1 E;  3F0N A;  1ZM9 A;  1N33 I;  1ZM4 A;  2UUA I;  4DV6 I;  1IBL E;  2A2C A;  1HR0 I;  2UXB I;  4DPT A;  1J5E I;  1FKA E;  5IT9 C;  4IZJ A;  4YHH I;  2VQE I;  4JI1 I;  4LFA E;  1KVK A;  4JV5 I;  4X62 E;  4DPX A;  2ZM6 E;  1KTV A;  3ZZT A;  4NXN E;  1EI1 A;  1IBL I;  4DR1 E;  4DUY E;  1PKP A;  1K47 A;  2Z5B B;  1HK7 A;  3LPS A;  1EA6 A;  3K85 A;  4YY3 E;  4NXN I;  4DXL A;  4PRV A;  4FN5 A;  4JYA I;  4OX9 E;  4DUY I;  3V2U C;  4DR4 E;  2UUC I;  2HK2 A;  2IOQ A;  4HY1 A;  4YY3 I;  4JI4 I;  1H73 A;  1HNZ E;  2ZBK B;  2Z5C A;  4USK A;  1N34 I;  4DV2 E;  5BR8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...