1I94I

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94I00
2HK2A 2X36A 2UXCE 2HK3A 3J80Q 4OX9E 1XHKA 4JV5E 3JAMC 1J5EI 2HFUA 2R42A 4X65E 1S16A 5A2QC 3ZZTA 3HULA 4JI7I 4DPWA 4FWDA 2VQFE 4DR4I 1NZ0A 4EMDA 5LMUE 4DV6I 3ZZ0A 4LF4E 2NPFA 2V8PA 4GKJI 1N34E 3PYDA 1Z0GA 1N36E 4WUBA 4YY3I 4USMA 4DV5E 4Z7YA 4Z7CA 2VQFI 3B78A 4GKKI 4HY1A 4LFCI 2HKJA 2V2ZA 1EA6A 1H72C 4JI4E 2V2QA 4LF8E 4X62I 2ZM6I 1XNQI 1Z0BA 1IBKE 5GMEA 1U2RA 1WUUA 1H73A 1KVKA 2LJPA 2R3VA 4DPXA 2BM0A 1IBME 1Z0EA 4JI3I 3ZM7A 4HACA 3T1YE 4B3TI 1H74A 1B62A 3PYEA 3ZZUA 4LFAI 4DV0E 4JI5E 4LF9E 1N0VC 1XNRI 1N33I 1PVGA 5FLXQ 4JI6E 2F4VE 3D4JA 3B82A 2UXBE 1XMQE 1DARA 4DXLA 1I94I 3LPSA 2ZBKB 4P52A 1XMOE 4HACB 4UTGA 1B63A 4B3MI 1J5EE 1BKNA 4DU8A 2VQEE 4JI7E 4MYTA 4DV7I 2HHHI 4DR4E 4HYMA 4DV6E 3K17A 4FWGA 2BM1A 4GKJE 1KIJA 1XMOI 4DUYI 4B3SI 2VF3A 1H7SA 4JI8I 4WUDA 4YY3E 4PRVA 4DR2I 1RREA 2VQEI 1FJGE 3V2UC 4GKKE 1FNMA 4LFCE 4I3HA 1HNZI 4DPYA 4K0KI 3QT7A 2HKEA 4B3RI 5IT9C 1NHHA 1OJ4A 4KHPI 4FW9A 1FJGI 3V5RA 4X62E 1H7UA 1ZXNA 2ZM6E 2UUAI 3J7AG 4ED4A 3J81Q 1XNQE 4M1KA 1ZM2A 1ELOA 1QZRA 1ZM3A 4DR6I 1Z0WA 1EI1A 2OI2A 4FWHA 2UUCI 3WU6A 2J7KA 1ZM4A 2E5LI 4LFBI 4URLA 2UU9I 4FN5A 4DUZI 4JI3E 1IBLE 4DU7A 4B3TE 4PU9A 3J80C 3M6AA 5LMNI 4DV1I 4LFAE 2A2CA 4DPUA 4DR5I 1XNRE 1N33E 2Q2EB 4DR3I 1IBLI 4AQYE 4JI1I 2WW4A 3K1JA 1I94E 1Z5CA 4DV4I 2CZ9A 4R1FA 4B3ME 1HR0I 1D6TA 2UUBI 3JAMQ 4UT4A 3B8HA 4LF6I 5L3JA 4DV7E 2HHHE 4AQYI 1UEKA 5A2QQ 2GS8A 1MX0A 2DEIA 2X7IA 4JI2I 4DV2I 3PYFA 1ZM9A 4MYUA 4DUYE 4B3SE 4JI8E 4DPTA 1FWKA 1PIEA 3OTOE 4DR2E 1KKHA 1VISA 4KQVA 5LL6R 1HNZE 4K0KE 3WU3A 4USKA 2ZITA 2DEJA 4X66I 1Z0VA 4B3RE 5IWAI 3J7AM 2A2DA 4KHPE 3CWVA 3OTOI 1N0UA 2UXDI 2AJ4A 1HNXI 2UUAE 4NXNE 3H4LA 4RPFA 4DR6E 2XEXA 1MU5A 4DR1I 5FLXC 2UUCE 1HNWI 4JYAI 1A6FA 4NXMI 2E5LE 4LFBE 4X64I 2UU9E 4DUZE 3QT5A 5GMDA 4LF5I 4LF7I 4DR7I 4NXNI 3LTOA 2UXCI 5LMNE 4DV1E 2BV3A 4ZVIA 4OX9I 4JV5I 1NHIA 4WUCA 1S4EA 4DR5E 1Z5AA 3QT6A 4X65I 1KTVA 1FWLA 1NHJA 4DR3E 3T1HE 4JI1E 5LMUI 4LF4I 4DV4E 3ZKBA 1N34I 4XTJA 1N36I 4YHHE 3WU4A 1HR0E 1N32E 3Q1QA 2UUBE 2V2VA 4DV5I 3T1HI 4LF6E 1RR9A 4JI2E 4DV2E 1K47A 1Z0TA 2HFSA 1FI4A 4JI4I 4YHHI 3LNUA 1N32I 4PRXA 4LF8I 3PYGA 4DV3E 3J81C 3F0NA 4JI0E 3WU5A 1IBKI 4X66E 1MG7A 5BR8E 1IBMI 5IWAE 5IT9Q 2UXDE 4DV3I 1HNXE 4P7AA 1PKPA 3T1YI 2E1RA 4JI0I 2V34A 1Z59A 2EFGA 4DV0I 4HXZA 3GONA 5BR8I 4JI5I 1Z0CA 4DR1E 4LF9I 1FKAE 1HNWE 4JYAE 4NXME 4X64E 4JG4A 4JI6I 4LF5E 2F4VI 1ZXMA 1Z5BA 3QT8A 4LF7E 3ZKDA 2UXBI 1XMQI 4DR7E
chains in the Genus database with same CATH superfamily
2HK2A 2X36A 2UXCE 2HK3A 4FW6A 1E3PA 3J80Q 4OX9E 1XHKA 4JV5E 3JAMC 1YH8A 1J5EI 2HFUA 2IOQA 2R42A 4X65E 5JEAC 1S16A 5A2QC 3ZZTA 3HULA 4JI7I 4DPWA 4FWDA 2VQFE 4DR4I 1NZ0A 4EMDA 5LMUE 4DV6I 4OZEA 3ZZ0A 4LF4E 5K36A 2NN6E 2NPFA 2V8PA 4GKJI 4IZJD 1N34E 3PYDA 1Z0GA 1N36E 1OYRA 1Y5YA 2O1UA 4WUBA 4YY3I 4USMA 5C0XC 4DV5E 5K36F 4Z7YA 4Z7CA 4OO1A 2PO0A 4LCHA 4IFDC 2VQFI 1UDNA 5DNXA 3B78A 4IZJB 4GKKI 4HY1A 4LPFA 4LFCI 4IZKA 5K36D 4OKGA 2HKJA 2V2ZA 1EA6A 1H72C 2CGEA 2F1DA 4JI4E 4U3BA 2WP8A 3CDIA 2V2QA 4LF8E 5K36B 2JE6A 4X62I 1YHCA 2ZM6I 1XNQI 1UDSA 1Z0BA 2WNRA 1IBKE 5GMEA 4FW5A 1U2RA 1WUUA 1H73A 1KVKA 2LJPA 4BA1A 2R3VA 2PO0B 2C39B 2BM0A 4DPXA 1IBME 1Z0EA 2JEAB 4JI3I 5DROA 3ZM7A 4HACA 3T1YE 4B3TI 4MU0A 5DRPA 3HJCA 1H74A 1B62A 2IOPA 3PYEA 2WP8B 5EL9A 3ZZUA 4DV0E 5JEAE 4LFAI 4JI5E 3Q6NA 2JE6B 1N0VC 4LF9E 2IERA 3P3CA 1XNRI 2O3ZA 2PO2A 1N33I 1PVGA 5FLXQ 2WNRB 2Z5BA 4JI6E 2F4VE 3P3GA 3D4JA 1VI7A 3B82A 2NN6A 1R6LA 2UXBE 4BA1B 1XMQE 4MU1A 1DARA 4DXLA 5C0XE 1I94I 3LPSA 2ZBKB 4P52A 4IFDE 1XMOE 4HACB 2NN6F 4UTGA 1B63A 4FW3A 1J5EE 4B3MI 1BKNA 4DU8A 1UDQA 2BA0D 2VQEE 4JI7E 4MYTA 2NN6D 4LCGA 4DV7I 2HHHI 4DR4E 3B4TA 1Y4SA 4HYMA 3UHMA 4DV6E 2BA1G 3K17A 4FWGA 2BM1A 2PO2B 3M85G 4QNKA 2Z5BB 4GKJE 1KIJA 1XMOI 4IZJA 4DUYI 4B3SI 2VF3A 1H7SA 2NN6B 4JI8I 4WUDA 4YY3E 4PRVA 4DR2I 2O1WA 3DD6A 4QNJA 1RREA 2VQEI 1FJGE 3V2UC 4GKKE 1FNMA 2PNZB 4LFCE 1HK7A 4I3HA 1HNZI 4DPYA 4K0KI 3QT7A 2HKEA 4B3RI 2GO4A 5IT9C 1NHHA 3NZKA 1OJ4A 4KHPI 4OO1C 4FW9A 1FJGI 3V5RA 2C39A 5JEAA 4X62E 1H7UA 1ZXNA 2ZM6E 2UUAI 3J7AG 4ED4A 3J81Q 2JEAA 1XNQE 4M1KA 1ZM2A 1ELOA 1QZRA 1ZM3A 4DR6I 2GO3A 5JEAF 1Z0WA 1EI1A 2OI2A 4FWHA 2UUCI 3WU6A 2J7KA 1ZM4A 2GQ0A 2O1TA 2E5LI 4URLA 4LFBI 1USVA 2UU9I 4FN5A 4DUZI 4JI3E 2Z5CA 3M7NG 5JEAD 2J65A 1IBLE 4LOMA 4DU7A 5C0XA 4B3TE 4PU9A 3J80C 4IFDA 3U1YA 3M6AA 5LMNI 4DV1I 2JT2A 4LFAE 2PNMA 2A2CA 4J3DA 5C0XF 5JEAB 4DPUA 2BR2A 3PS3A 4DR5I 4IFDF 3PS2A 1XNRE 1N33E 2Q2EB 4DR3I 1IBLI 5C0XD 4AQYE 4IFDD 4JI1I 2WW4A 4NBQA 3K1JA 3P3EA 1E3HA 1I94E 1Z5CA 4DV4I 1Y60A 2Z5CB 2CZ9A 4R1FA 4B3ME 5C0XB 1HR0I 1D6TA 2UUBI 3JAMQ 4IFDB 3K85A 4UT4A 3B8HA 3P76A 2JEBB 4LF6I 5L3JA 4DV7E 2HHHE 4AQYI 1UEKA 5A2QQ 2GS8A 2PNLA 1MX0A 2BR2B 2DEIA 4OO1E 2X7IA 4JI2I 4DV2I 3PYFA 2CG9A 1ZM9A 2PNZA 4MYUA 4DUYE 4B3SE 4JI8E 4MDTA 4DPTA 1FWKA 4LCFA 1PIEA 3OTOE 4DR2E 2C38A 1KKHA 2IESA 4MU4A 1VISA 4AIMA 3L7ZA 4KQVA 5LL6R 1HNZE 4K0KE 5DRQA 3WU3A 4USKA 2ZITA 2DEJA 4X66I 1Z0VA 4B3RE 3GLLA 5IWAI 3J7AM 2A2DA 2C37B 4KHPE 3M7ND 3CWVA 3OTOI 1N0UA 2UXDI 2AJ4A 1HNXI 4MQYA 2Z5EA 3PS1A 2UUAE 4NXNE 5K36C 1Y6ZA 3H4LA 4RPFA 4DR6E 2XEXA 2C38B 1MU5A 4DR1I 5FLXC 2UUCE 1HNWI 4JYAI 1A6FA 3L7ZB 2E5LE 4NXMI 4LFBE 4X64I 2UU9E 4DUZE 3QT5A 5GMDA 4LF5I 3Q6MA 4U3DA 4LF7I 2AE8A 4ISAA 4DR7I 4MU3A 3LTOA 4NXNI 2UXCI 5LMNE 4DV1E 1USUA 1Y4UA 2BV3A 4ZVIA 4OX9I 4JV5I 3U1KA 4BA2B 4N3OA 1NHIA 4WUCA 3GMEA 1OYSA 1S4EA 4DR5E 1Z5AA 3QT6A 4X65I 5ELWA 1KTVA 1UDOA 1FWLA 1NHJA 4DR3E 3T1HE 2BA0G 1RHYA 2O1VA 3GCMA 5LMUI 4JI1E 4LF4I 2JEBA 4DV4E 4OO1F 3ZKBA 1N34I 4XTJA 1N36I 3HKMA 4YHHE 3WU4A 1HR0E 1N32E 3Q1QA 4IS9A 2UUBE 2V2VA 4DV5I 4OO1D 3T1HI 4LF6E 4FW7A 3PRYA 1RR9A 4GQUA 2BA1D 4AIDA 3M85D 4JI2E 4DV2E 5DRRA 1K47A 1Z0TA 2HFSA 1FI4A 4JI4I 4OO1B 4YHHI 3LNUA 1N32I 5K36E 4PRXA 4IZKB 4LF8I 2NN6C 3PYGA 4DV3E 5EKWA 3J81C 2C37A 3F0NA 4JI0E 3P06A 3WU5A 1P42A 1IBKI 2PO1A 4X66E 1MG7A 1R6MA 5BR8E 1IBMI 5IWAE 2CVEA 5IT9Q 2UXDE 4DV3I 1HNXE 4P7AA 1PKPA 3T1YI 4FW4A 2E1RA 5DNLA 4JI0I 2V34A 1Z59A 2EFGA 4DV0I 2VESA 3KRNA 4HXZA 3GONA 5BR8I 4JI5I 1Z0CA 4DR1E 4LF9I 3H1CA 3CDJA 1FKAE 1HNWE 4AM3A 4JYAE 4NXME 4X64E 4JG4A 4BA2A 5FWKA 4JI6I 1XXEA 4LF5E 2F4VI 2PO1B 1ZXMA 1Z5BA 3QT8A 4LF7E 3ZKDA 2UXBI 1XMQI 1OYPA 4DR7E
chains in the Genus database with same CATH topology
2HK2A 2X36A 2UXCE 2HK3A 3J80Q 4OX9E 1XHKA 4JV5E 3JAMC 1J5EI 2HFUA 2IOQA 2R42A 4X65E 1S16A 5A2QC 3ZZTA 3HULA 4JI7I 4DPWA 4FWDA 2VQFE 4DR4I 1NZ0A 4EMDA 5LMUE 4DV6I 3ZZ0A 4LF4E 2NPFA 2V8PA 4GKJI 4IZJD 1N34E 3PYDA 1Z0GA 1N36E 2O1UA 4WUBA 4YY3I 4USMA 4DV5E 4Z7YA 4Z7CA 2VQFI 3B78A 4IZJB 4GKKI 4HY1A 4LFCI 4IZKA 2HKJA 2V2ZA 1EA6A 1H72C 2CGEA 4JI4E 2V2QA 4LF8E 4X62I 2ZM6I 1XNQI 1Z0BA 1IBKE 5GMEA 1U2RA 1WUUA 1H73A 1KVKA 2LJPA 2R3VA 4DPXA 2BM0A 1IBME 1Z0EA 4JI3I 3ZM7A 4HACA 3T1YE 4B3TI 3HJCA 1H74A 1B62A 2IOPA 3PYEA 3ZZUA 4LFAI 4DV0E 4JI5E 3Q6NA 4LF9E 1N0VC 1XNRI 1N33I 1PVGA 5FLXQ 2Z5BA 4JI6E 2F4VE 3D4JA 3B82A 2UXBE 1XMQE 1DARA 4DXLA 1I94I 3LPSA 2ZBKB 4P52A 1XMOE 4HACB 4UTGA 1B63A 4B3MI 1J5EE 1BKNA 4DU8A 2VQEE 4JI7E 4MYTA 4DV7I 2HHHI 4DR4E 1Y4SA 4HYMA 4DV6E 3K17A 4FWGA 2BM1A 2Z5BB 4GKJE 1KIJA 1XMOI 4IZJA 4DUYI 4B3SI 2VF3A 1H7SA 4JI8I 4WUDA 4YY3E 4PRVA 4DR2I 2O1WA 1RREA 2VQEI 1FJGE 3V2UC 4GKKE 1FNMA 4LFCE 1HK7A 4I3HA 1HNZI 4DPYA 4K0KI 3QT7A 2HKEA 4B3RI 5IT9C 1NHHA 1OJ4A 4KHPI 4FW9A 1FJGI 3V5RA 4X62E 1H7UA 1ZXNA 2ZM6E 2UUAI 3J7AG 4ED4A 3J81Q 1XNQE 4M1KA 1ZM2A 1ELOA 1QZRA 1ZM3A 4DR6I 1Z0WA 1EI1A 2OI2A 4FWHA 2UUCI 3WU6A 2J7KA 1ZM4A 2GQ0A 2O1TA 2E5LI 4URLA 4LFBI 1USVA 2UU9I 4FN5A 4DUZI 4JI3E 2Z5CA 1IBLE 4DU7A 4B3TE 4PU9A 3J80C 3M6AA 5LMNI 4DV1I 4LFAE 2PNMA 2A2CA 4DPUA 4DR5I 1XNRE 1N33E 2Q2EB 4DR3I 1IBLI 4AQYE 4JI1I 2WW4A 3K1JA 1I94E 1Z5CA 4DV4I 2Z5CB 2CZ9A 4R1FA 4B3ME 1HR0I 1D6TA 2UUBI 3JAMQ 3K85A 4UT4A 3B8HA 4LF6I 5L3JA 4DV7E 2HHHE 4AQYI 1UEKA 5A2QQ 2GS8A 2PNLA 1MX0A 2DEIA 2X7IA 4JI2I 4DV2I 3PYFA 2CG9A 1ZM9A 4MYUA 4DUYE 4B3SE 4JI8E 4DPTA 1FWKA 1PIEA 3OTOE 4DR2E 1KKHA 1VISA 4KQVA 5LL6R 1HNZE 4K0KE 3WU3A 4USKA 2ZITA 2DEJA 4X66I 1Z0VA 4B3RE 5IWAI 3J7AM 2A2DA 4KHPE 3CWVA 3OTOI 1N0UA 2UXDI 2AJ4A 1HNXI 2Z5EA 2UUAE 4NXNE 1Y6ZA 3H4LA 4RPFA 4DR6E 2XEXA 1MU5A 4DR1I 5FLXC 2UUCE 1HNWI 4JYAI 1A6FA 4NXMI 2E5LE 4LFBE 4X64I 2UU9E 4DUZE 3QT5A 5GMDA 4LF5I 3Q6MA 4LF7I 4DR7I 4NXNI 3LTOA 2UXCI 5LMNE 4DV1E 1USUA 1Y4UA 2BV3A 4ZVIA 4OX9I 4JV5I 4N3OA 1NHIA 4WUCA 1S4EA 4DR5E 1Z5AA 3QT6A 4X65I 1KTVA 1FWLA 1NHJA 4DR3E 3T1HE 2O1VA 4JI1E 5LMUI 4LF4I 4DV4E 3ZKBA 1N34I 4XTJA 1N36I 4YHHE 3WU4A 1HR0E 1N32E 3Q1QA 2UUBE 2V2VA 4DV5I 3T1HI 4LF6E 3PRYA 1RR9A 4JI2E 4DV2E 1K47A 1Z0TA 2HFSA 1FI4A 4JI4I 4YHHI 3LNUA 1N32I 4PRXA 4IZKB 4LF8I 3PYGA 4DV3E 3J81C 3F0NA 4JI0E 3P06A 3WU5A 1IBKI 4X66E 1MG7A 5BR8E 1IBMI 5IWAE 5IT9Q 2UXDE 4DV3I 1HNXE 4P7AA 1PKPA 3T1YI 2E1RA 4JI0I 2V34A 1Z59A 2EFGA 4DV0I 4HXZA 3GONA 5BR8I 4JI5I 1Z0CA 4DR1E 4LF9I 1FKAE 1HNWE 4JYAE 4NXME 4X64E 4JG4A 5FWKA 4JI6I 4LF5E 2F4VI 1ZXMA 1Z5BA 3QT8A 4LF7E 3ZKDA 2UXBI 1XMQI 4DR7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK2 A;  2X36 A;  2UXC E;  2HK3 A;  3J80 Q;  4OX9 E;  1XHK A;  4JV5 E;  3JAM C;  1J5E I;  2HFU A;  2R42 A;  4X65 E;  1S16 A;  5A2Q C;  3ZZT A;  3HUL A;  4JI7 I;  4DPW A;  4FWD A;  2VQF E;  4DR4 I;  1NZ0 A;  4EMD A;  5LMU E;  4DV6 I;  3ZZ0 A;  4LF4 E;  2NPF A;  2V8P A;  4GKJ I;  1N34 E;  3PYD A;  1Z0G A;  1N36 E;  4WUB A;  4YY3 I;  4USM A;  4DV5 E;  4Z7Y A;  4Z7C A;  2VQF I;  3B78 A;  4GKK I;  4HY1 A;  4LFC I;  2HKJ A;  2V2Z A;  1EA6 A;  1H72 C;  4JI4 E;  2V2Q A;  4LF8 E;  4X62 I;  2ZM6 I;  1XNQ I;  1Z0B A;  1IBK E;  5GME A;  1U2R A;  1WUU A;  1H73 A;  1KVK A;  2LJP A;  2R3V A;  4DPX A;  2BM0 A;  1IBM E;  1Z0E A;  4JI3 I;  3ZM7 A;  4HAC A;  3T1Y E;  4B3T I;  1H74 A;  1B62 A;  3PYE A;  3ZZU A;  4LFA I;  4DV0 E;  4JI5 E;  4LF9 E;  1N0V C;  1XNR I;  1N33 I;  1PVG A;  5FLX Q;  4JI6 E;  2F4V E;  3D4J A;  3B82 A;  2UXB E;  1XMQ E;  1DAR A;  4DXL A;  1I94 I;  3LPS A;  2ZBK B;  4P52 A;  1XMO E;  4HAC B;  4UTG A;  1B63 A;  4B3M I;  1J5E E;  1BKN A;  4DU8 A;  2VQE E;  4JI7 E;  4MYT A;  4DV7 I;  2HHH I;  4DR4 E;  4HYM A;  4DV6 E;  3K17 A;  4FWG A;  2BM1 A;  4GKJ E;  1KIJ A;  1XMO I;  4DUY I;  4B3S I;  2VF3 A;  1H7S A;  4JI8 I;  4WUD A;  4YY3 E;  4PRV A;  4DR2 I;  1RRE A;  2VQE I;  1FJG E;  3V2U C;  4GKK E;  1FNM A;  4LFC E;  4I3H A;  1HNZ I;  4DPY A;  4K0K I;  3QT7 A;  2HKE A;  4B3R I;  5IT9 C;  1NHH A;  1OJ4 A;  4KHP I;  4FW9 A;  1FJG I;  3V5R A;  4X62 E;  1H7U A;  1ZXN A;  2ZM6 E;  2UUA I;  3J7A G;  4ED4 A;  3J81 Q;  1XNQ E;  4M1K A;  1ZM2 A;  1ELO A;  1QZR A;  1ZM3 A;  4DR6 I;  1Z0W A;  1EI1 A;  2OI2 A;  4FWH A;  2UUC I;  3WU6 A;  2J7K A;  1ZM4 A;  2E5L I;  4LFB I;  4URL A;  2UU9 I;  4FN5 A;  4DUZ I;  4JI3 E;  1IBL E;  4DU7 A;  4B3T E;  4PU9 A;  3J80 C;  3M6A A;  5LMN I;  4DV1 I;  4LFA E;  2A2C A;  4DPU A;  4DR5 I;  1XNR E;  1N33 E;  2Q2E B;  4DR3 I;  1IBL I;  4AQY E;  4JI1 I;  2WW4 A;  3K1J A;  1I94 E;  1Z5C A;  4DV4 I;  2CZ9 A;  4R1F A;  4B3M E;  1HR0 I;  1D6T A;  2UUB I;  3JAM Q;  4UT4 A;  3B8H A;  4LF6 I;  5L3J A;  4DV7 E;  2HHH E;  4AQY I;  1UEK A;  5A2Q Q;  2GS8 A;  1MX0 A;  2DEI A;  2X7I A;  4JI2 I;  4DV2 I;  3PYF A;  1ZM9 A;  4MYU A;  4DUY E;  4B3S E;  4JI8 E;  4DPT A;  1FWK A;  1PIE A;  3OTO E;  4DR2 E;  1KKH A;  1VIS A;  4KQV A;  5LL6 R;  1HNZ E;  4K0K E;  3WU3 A;  4USK A;  2ZIT A;  2DEJ A;  4X66 I;  1Z0V A;  4B3R E;  5IWA I;  3J7A M;  2A2D A;  4KHP E;  3CWV A;  3OTO I;  1N0U A;  2UXD I;  2AJ4 A;  1HNX I;  2UUA E;  4NXN E;  3H4L A;  4RPF A;  4DR6 E;  2XEX A;  1MU5 A;  4DR1 I;  5FLX C;  2UUC E;  1HNW I;  4JYA I;  1A6F A;  4NXM I;  2E5L E;  4LFB E;  4X64 I;  2UU9 E;  4DUZ E;  3QT5 A;  5GMD A;  4LF5 I;  4LF7 I;  4DR7 I;  4NXN I;  3LTO A;  2UXC I;  5LMN E;  4DV1 E;  2BV3 A;  4ZVI A;  4OX9 I;  4JV5 I;  1NHI A;  4WUC A;  1S4E A;  4DR5 E;  1Z5A A;  3QT6 A;  4X65 I;  1KTV A;  1FWL A;  1NHJ A;  4DR3 E;  3T1H E;  4JI1 E;  5LMU I;  4LF4 I;  4DV4 E;  3ZKB A;  1N34 I;  4XTJ A;  1N36 I;  4YHH E;  3WU4 A;  1HR0 E;  1N32 E;  3Q1Q A;  2UUB E;  2V2V A;  4DV5 I;  3T1H I;  4LF6 E;  1RR9 A;  4JI2 E;  4DV2 E;  1K47 A;  1Z0T A;  2HFS A;  1FI4 A;  4JI4 I;  4YHH I;  3LNU A;  1N32 I;  4PRX A;  4LF8 I;  3PYG A;  4DV3 E;  3J81 C;  3F0N A;  4JI0 E;  3WU5 A;  1IBK I;  4X66 E;  1MG7 A;  5BR8 E;  1IBM I;  5IWA E;  5IT9 Q;  2UXD E;  4DV3 I;  1HNX E;  4P7A A;  1PKP A;  3T1Y I;  2E1R A;  4JI0 I;  2V34 A;  1Z59 A;  2EFG A;  4DV0 I;  4HXZ A;  3GON A;  5BR8 I;  4JI5 I;  1Z0C A;  4DR1 E;  4LF9 I;  1FKA E;  1HNW E;  4JYA E;  4NXM E;  4X64 E;  4JG4 A;  4JI6 I;  4LF5 E;  2F4V I;  1ZXM A;  1Z5B A;  3QT8 A;  4LF7 E;  3ZKD A;  2UXB I;  1XMQ I;  4DR7 E; 
#chains in the Genus database with same CATH topology
 2HK2 A;  2X36 A;  2UXC E;  2HK3 A;  4FW6 A;  1E3P A;  3J80 Q;  4OX9 E;  1XHK A;  4JV5 E;  3JAM C;  1YH8 A;  1J5E I;  2HFU A;  2IOQ A;  2R42 A;  4X65 E;  5JEA C;  1S16 A;  5A2Q C;  3ZZT A;  3HUL A;  4JI7 I;  4DPW A;  4FWD A;  2VQF E;  4DR4 I;  1NZ0 A;  4EMD A;  5LMU E;  4DV6 I;  4OZE A;  3ZZ0 A;  4LF4 E;  5K36 A;  2NN6 E;  2NPF A;  2V8P A;  4GKJ I;  4IZJ D;  1N34 E;  3PYD A;  1Z0G A;  1N36 E;  1OYR A;  1Y5Y A;  2O1U A;  4WUB A;  4YY3 I;  4USM A;  5C0X C;  4DV5 E;  5K36 F;  4Z7Y A;  4Z7C A;  4OO1 A;  2PO0 A;  4LCH A;  4IFD C;  2VQF I;  1UDN A;  5DNX A;  3B78 A;  4IZJ B;  4GKK I;  4HY1 A;  4LPF A;  4LFC I;  4IZK A;  5K36 D;  4OKG A;  2HKJ A;  2V2Z A;  1EA6 A;  1H72 C;  2CGE A;  2F1D A;  4JI4 E;  4U3B A;  2WP8 A;  3CDI A;  2V2Q A;  4LF8 E;  5K36 B;  2JE6 A;  4X62 I;  1YHC A;  2ZM6 I;  1XNQ I;  1UDS A;  1Z0B A;  2WNR A;  1IBK E;  5GME A;  4FW5 A;  1U2R A;  1WUU A;  1H73 A;  1KVK A;  2LJP A;  4BA1 A;  2R3V A;  2PO0 B;  2C39 B;  2BM0 A;  4DPX A;  1IBM E;  1Z0E A;  2JEA B;  4JI3 I;  5DRO A;  3ZM7 A;  4HAC A;  3T1Y E;  4B3T I;  4MU0 A;  5DRP A;  3HJC A;  1H74 A;  1B62 A;  2IOP A;  3PYE A;  2WP8 B;  5EL9 A;  3ZZU A;  4DV0 E;  5JEA E;  4LFA I;  4JI5 E;  3Q6N A;  2JE6 B;  1N0V C;  4LF9 E;  2IER A;  3P3C A;  1XNR I;  2O3Z A;  2PO2 A;  1N33 I;  1PVG A;  5FLX Q;  2WNR B;  2Z5B A;  4JI6 E;  2F4V E;  3P3G A;  3D4J A;  1VI7 A;  3B82 A;  2NN6 A;  1R6L A;  2UXB E;  4BA1 B;  1XMQ E;  4MU1 A;  1DAR A;  4DXL A;  5C0X E;  1I94 I;  3LPS A;  2ZBK B;  4P52 A;  4IFD E;  1XMO E;  4HAC B;  2NN6 F;  4UTG A;  1B63 A;  4FW3 A;  1J5E E;  4B3M I;  1BKN A;  4DU8 A;  1UDQ A;  2BA0 D;  2VQE E;  4JI7 E;  4MYT A;  2NN6 D;  4LCG A;  4DV7 I;  2HHH I;  4DR4 E;  3B4T A;  1Y4S A;  4HYM A;  3UHM A;  4DV6 E;  2BA1 G;  3K17 A;  4FWG A;  2BM1 A;  2PO2 B;  3M85 G;  4QNK A;  2Z5B B;  4GKJ E;  1KIJ A;  1XMO I;  4IZJ A;  4DUY I;  4B3S I;  2VF3 A;  1H7S A;  2NN6 B;  4JI8 I;  4WUD A;  4YY3 E;  4PRV A;  4DR2 I;  2O1W A;  3DD6 A;  4QNJ A;  1RRE A;  2VQE I;  1FJG E;  3V2U C;  4GKK E;  1FNM A;  2PNZ B;  4LFC E;  1HK7 A;  4I3H A;  1HNZ I;  4DPY A;  4K0K I;  3QT7 A;  2HKE A;  4B3R I;  2GO4 A;  5IT9 C;  1NHH A;  3NZK A;  1OJ4 A;  4KHP I;  4OO1 C;  4FW9 A;  1FJG I;  3V5R A;  2C39 A;  5JEA A;  4X62 E;  1H7U A;  1ZXN A;  2ZM6 E;  2UUA I;  3J7A G;  4ED4 A;  3J81 Q;  2JEA A;  1XNQ E;  4M1K A;  1ZM2 A;  1ELO A;  1QZR A;  1ZM3 A;  4DR6 I;  2GO3 A;  5JEA F;  1Z0W A;  1EI1 A;  2OI2 A;  4FWH A;  2UUC I;  3WU6 A;  2J7K A;  1ZM4 A;  2GQ0 A;  2O1T A;  2E5L I;  4URL A;  4LFB I;  1USV A;  2UU9 I;  4FN5 A;  4DUZ I;  4JI3 E;  2Z5C A;  3M7N G;  5JEA D;  2J65 A;  1IBL E;  4LOM A;  4DU7 A;  5C0X A;  4B3T E;  4PU9 A;  3J80 C;  4IFD A;  3U1Y A;  3M6A A;  5LMN I;  4DV1 I;  2JT2 A;  4LFA E;  2PNM A;  2A2C A;  4J3D A;  5C0X F;  5JEA B;  4DPU A;  2BR2 A;  3PS3 A;  4DR5 I;  4IFD F;  3PS2 A;  1XNR E;  1N33 E;  2Q2E B;  4DR3 I;  1IBL I;  5C0X D;  4AQY E;  4IFD D;  4JI1 I;  2WW4 A;  4NBQ A;  3K1J A;  3P3E A;  1E3H A;  1I94 E;  1Z5C A;  4DV4 I;  1Y60 A;  2Z5C B;  2CZ9 A;  4R1F A;  4B3M E;  5C0X B;  1HR0 I;  1D6T A;  2UUB I;  3JAM Q;  4IFD B;  3K85 A;  4UT4 A;  3B8H A;  3P76 A;  2JEB B;  4LF6 I;  5L3J A;  4DV7 E;  2HHH E;  4AQY I;  1UEK A;  5A2Q Q;  2GS8 A;  2PNL A;  1MX0 A;  2BR2 B;  2DEI A;  4OO1 E;  2X7I A;  4JI2 I;  4DV2 I;  3PYF A;  2CG9 A;  1ZM9 A;  2PNZ A;  4MYU A;  4DUY E;  4B3S E;  4JI8 E;  4MDT A;  4DPT A;  1FWK A;  4LCF A;  1PIE A;  3OTO E;  4DR2 E;  2C38 A;  1KKH A;  2IES A;  4MU4 A;  1VIS A;  4AIM A;  3L7Z A;  4KQV A;  5LL6 R;  1HNZ E;  4K0K E;  5DRQ A;  3WU3 A;  4USK A;  2ZIT A;  2DEJ A;  4X66 I;  1Z0V A;  4B3R E;  3GLL A;  5IWA I;  3J7A M;  2A2D A;  2C37 B;  4KHP E;  3M7N D;  3CWV A;  3OTO I;  1N0U A;  2UXD I;  2AJ4 A;  1HNX I;  4MQY A;  2Z5E A;  3PS1 A;  2UUA E;  4NXN E;  5K36 C;  1Y6Z A;  3H4L A;  4RPF A;  4DR6 E;  2XEX A;  2C38 B;  1MU5 A;  4DR1 I;  5FLX C;  2UUC E;  1HNW I;  4JYA I;  1A6F A;  3L7Z B;  2E5L E;  4NXM I;  4LFB E;  4X64 I;  2UU9 E;  4DUZ E;  3QT5 A;  5GMD A;  4LF5 I;  3Q6M A;  4U3D A;  4LF7 I;  2AE8 A;  4ISA A;  4DR7 I;  4MU3 A;  3LTO A;  4NXN I;  2UXC I;  5LMN E;  4DV1 E;  1USU A;  1Y4U A;  2BV3 A;  4ZVI A;  4OX9 I;  4JV5 I;  3U1K A;  4BA2 B;  4N3O A;  1NHI A;  4WUC A;  3GME A;  1OYS A;  1S4E A;  4DR5 E;  1Z5A A;  3QT6 A;  4X65 I;  5ELW A;  1KTV A;  1UDO A;  1FWL A;  1NHJ A;  4DR3 E;  3T1H E;  2BA0 G;  1RHY A;  2O1V A;  3GCM A;  5LMU I;  4JI1 E;  4LF4 I;  2JEB A;  4DV4 E;  4OO1 F;  3ZKB A;  1N34 I;  4XTJ A;  1N36 I;  3HKM A;  4YHH E;  3WU4 A;  1HR0 E;  1N32 E;  3Q1Q A;  4IS9 A;  2UUB E;  2V2V A;  4DV5 I;  4OO1 D;  3T1H I;  4LF6 E;  4FW7 A;  3PRY A;  1RR9 A;  4GQU A;  2BA1 D;  4AID A;  3M85 D;  4JI2 E;  4DV2 E;  5DRR A;  1K47 A;  1Z0T A;  2HFS A;  1FI4 A;  4JI4 I;  4OO1 B;  4YHH I;  3LNU A;  1N32 I;  5K36 E;  4PRX A;  4IZK B;  4LF8 I;  2NN6 C;  3PYG A;  4DV3 E;  5EKW A;  3J81 C;  2C37 A;  3F0N A;  4JI0 E;  3P06 A;  3WU5 A;  1P42 A;  1IBK I;  2PO1 A;  4X66 E;  1MG7 A;  1R6M A;  5BR8 E;  1IBM I;  5IWA E;  2CVE A;  5IT9 Q;  2UXD E;  4DV3 I;  1HNX E;  4P7A A;  1PKP A;  3T1Y I;  4FW4 A;  2E1R A;  5DNL A;  4JI0 I;  2V34 A;  1Z59 A;  2EFG A;  4DV0 I;  2VES A;  3KRN A;  4HXZ A;  3GON A;  5BR8 I;  4JI5 I;  1Z0C A;  4DR1 E;  4LF9 I;  3H1C A;  3CDJ A;  1FKA E;  1HNW E;  4AM3 A;  4JYA E;  4NXM E;  4X64 E;  4JG4 A;  4BA2 A;  5FWK A;  4JI6 I;  1XXE A;  4LF5 E;  2F4V I;  2PO1 B;  1ZXM A;  1Z5B A;  3QT8 A;  4LF7 E;  3ZKD A;  2UXB I;  1XMQ I;  1OYP A;  4DR7 E; 
#chains in the Genus database with same CATH homology
 2HK2 A;  2X36 A;  2UXC E;  2HK3 A;  3J80 Q;  4OX9 E;  1XHK A;  4JV5 E;  3JAM C;  1J5E I;  2HFU A;  2IOQ A;  2R42 A;  4X65 E;  1S16 A;  5A2Q C;  3ZZT A;  3HUL A;  4JI7 I;  4DPW A;  4FWD A;  2VQF E;  4DR4 I;  1NZ0 A;  4EMD A;  5LMU E;  4DV6 I;  3ZZ0 A;  4LF4 E;  2NPF A;  2V8P A;  4GKJ I;  4IZJ D;  1N34 E;  3PYD A;  1Z0G A;  1N36 E;  2O1U A;  4WUB A;  4YY3 I;  4USM A;  4DV5 E;  4Z7Y A;  4Z7C A;  2VQF I;  3B78 A;  4IZJ B;  4GKK I;  4HY1 A;  4LFC I;  4IZK A;  2HKJ A;  2V2Z A;  1EA6 A;  1H72 C;  2CGE A;  4JI4 E;  2V2Q A;  4LF8 E;  4X62 I;  2ZM6 I;  1XNQ I;  1Z0B A;  1IBK E;  5GME A;  1U2R A;  1WUU A;  1H73 A;  1KVK A;  2LJP A;  2R3V A;  4DPX A;  2BM0 A;  1IBM E;  1Z0E A;  4JI3 I;  3ZM7 A;  4HAC A;  3T1Y E;  4B3T I;  3HJC A;  1H74 A;  1B62 A;  2IOP A;  3PYE A;  3ZZU A;  4LFA I;  4DV0 E;  4JI5 E;  3Q6N A;  4LF9 E;  1N0V C;  1XNR I;  1N33 I;  1PVG A;  5FLX Q;  2Z5B A;  4JI6 E;  2F4V E;  3D4J A;  3B82 A;  2UXB E;  1XMQ E;  1DAR A;  4DXL A;  1I94 I;  3LPS A;  2ZBK B;  4P52 A;  1XMO E;  4HAC B;  4UTG A;  1B63 A;  4B3M I;  1J5E E;  1BKN A;  4DU8 A;  2VQE E;  4JI7 E;  4MYT A;  4DV7 I;  2HHH I;  4DR4 E;  1Y4S A;  4HYM A;  4DV6 E;  3K17 A;  4FWG A;  2BM1 A;  2Z5B B;  4GKJ E;  1KIJ A;  1XMO I;  4IZJ A;  4DUY I;  4B3S I;  2VF3 A;  1H7S A;  4JI8 I;  4WUD A;  4YY3 E;  4PRV A;  4DR2 I;  2O1W A;  1RRE A;  2VQE I;  1FJG E;  3V2U C;  4GKK E;  1FNM A;  4LFC E;  1HK7 A;  4I3H A;  1HNZ I;  4DPY A;  4K0K I;  3QT7 A;  2HKE A;  4B3R I;  5IT9 C;  1NHH A;  1OJ4 A;  4KHP I;  4FW9 A;  1FJG I;  3V5R A;  4X62 E;  1H7U A;  1ZXN A;  2ZM6 E;  2UUA I;  3J7A G;  4ED4 A;  3J81 Q;  1XNQ E;  4M1K A;  1ZM2 A;  1ELO A;  1QZR A;  1ZM3 A;  4DR6 I;  1Z0W A;  1EI1 A;  2OI2 A;  4FWH A;  2UUC I;  3WU6 A;  2J7K A;  1ZM4 A;  2GQ0 A;  2O1T A;  2E5L I;  4URL A;  4LFB I;  1USV A;  2UU9 I;  4FN5 A;  4DUZ I;  4JI3 E;  2Z5C A;  1IBL E;  4DU7 A;  4B3T E;  4PU9 A;  3J80 C;  3M6A A;  5LMN I;  4DV1 I;  4LFA E;  2PNM A;  2A2C A;  4DPU A;  4DR5 I;  1XNR E;  1N33 E;  2Q2E B;  4DR3 I;  1IBL I;  4AQY E;  4JI1 I;  2WW4 A;  3K1J A;  1I94 E;  1Z5C A;  4DV4 I;  2Z5C B;  2CZ9 A;  4R1F A;  4B3M E;  1HR0 I;  1D6T A;  2UUB I;  3JAM Q;  3K85 A;  4UT4 A;  3B8H A;  4LF6 I;  5L3J A;  4DV7 E;  2HHH E;  4AQY I;  1UEK A;  5A2Q Q;  2GS8 A;  2PNL A;  1MX0 A;  2DEI A;  2X7I A;  4JI2 I;  4DV2 I;  3PYF A;  2CG9 A;  1ZM9 A;  4MYU A;  4DUY E;  4B3S E;  4JI8 E;  4DPT A;  1FWK A;  1PIE A;  3OTO E;  4DR2 E;  1KKH A;  1VIS A;  4KQV A;  5LL6 R;  1HNZ E;  4K0K E;  3WU3 A;  4USK A;  2ZIT A;  2DEJ A;  4X66 I;  1Z0V A;  4B3R E;  5IWA I;  3J7A M;  2A2D A;  4KHP E;  3CWV A;  3OTO I;  1N0U A;  2UXD I;  2AJ4 A;  1HNX I;  2Z5E A;  2UUA E;  4NXN E;  1Y6Z A;  3H4L A;  4RPF A;  4DR6 E;  2XEX A;  1MU5 A;  4DR1 I;  5FLX C;  2UUC E;  1HNW I;  4JYA I;  1A6F A;  4NXM I;  2E5L E;  4LFB E;  4X64 I;  2UU9 E;  4DUZ E;  3QT5 A;  5GMD A;  4LF5 I;  3Q6M A;  4LF7 I;  4DR7 I;  4NXN I;  3LTO A;  2UXC I;  5LMN E;  4DV1 E;  1USU A;  1Y4U A;  2BV3 A;  4ZVI A;  4OX9 I;  4JV5 I;  4N3O A;  1NHI A;  4WUC A;  1S4E A;  4DR5 E;  1Z5A A;  3QT6 A;  4X65 I;  1KTV A;  1FWL A;  1NHJ A;  4DR3 E;  3T1H E;  2O1V A;  4JI1 E;  5LMU I;  4LF4 I;  4DV4 E;  3ZKB A;  1N34 I;  4XTJ A;  1N36 I;  4YHH E;  3WU4 A;  1HR0 E;  1N32 E;  3Q1Q A;  2UUB E;  2V2V A;  4DV5 I;  3T1H I;  4LF6 E;  3PRY A;  1RR9 A;  4JI2 E;  4DV2 E;  1K47 A;  1Z0T A;  2HFS A;  1FI4 A;  4JI4 I;  4YHH I;  3LNU A;  1N32 I;  4PRX A;  4IZK B;  4LF8 I;  3PYG A;  4DV3 E;  3J81 C;  3F0N A;  4JI0 E;  3P06 A;  3WU5 A;  1IBK I;  4X66 E;  1MG7 A;  5BR8 E;  1IBM I;  5IWA E;  5IT9 Q;  2UXD E;  4DV3 I;  1HNX E;  4P7A A;  1PKP A;  3T1Y I;  2E1R A;  4JI0 I;  2V34 A;  1Z59 A;  2EFG A;  4DV0 I;  4HXZ A;  3GON A;  5BR8 I;  4JI5 I;  1Z0C A;  4DR1 E;  4LF9 I;  1FKA E;  1HNW E;  4JYA E;  4NXM E;  4X64 E;  4JG4 A;  5FWK A;  4JI6 I;  4LF5 E;  2F4V I;  1ZXM A;  1Z5B A;  3QT8 A;  4LF7 E;  3ZKD A;  2UXB I;  1XMQ I;  4DR7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...