1I94I

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94I00
1OJ4A 1Z59A 4DR6E 4K0KI 4OX9E 4R1FA 4AQYI 3T1YI 4YHHI 4DV6E 1NHHA 4NXNE 4DPUA 2J7KA 4KQVA 5LL6R 3WU6A 3V5RA 2DEJA 1HNZE 4UT4A 2VF3A 1D6TA 2UUAI 4JI5E 2R42A 4JV5E 1PKPA 4X65E 4RPFA 1RREA 3QT6A 4DR5E 1H7SA 4LF6I 1VISA 3T1HI 4B3RE 4JG4A 1XNRE 1ZM3A 3HULA 2F4VI 3M6AA 4OX9I 4NXME 4GKKE 2NPFA 4DV6I 1BKNA 3ZZUA 1DARA 4ZVIA 4DPYA 1IBKE 1B63A 2WW4A 4B3SE 1IBLE 3QT8A 1FJGE 2HK2A 4JI5I 4B3TE 2OI2A 4FN5A 4X65I 1MG7A 3Q1QA 4DR5I 2A2CA 4B3RI 1XNRI 4USMA 3B78A 4LF5I 3LNUA 4JI2E 1H74A 2VQEE 4NXMI 4GKKI 4I3HA 2V34A 1ELOA 4XTJA 3J81Q 1IBKI 2AJ4A 4B3SI 4JI3E 1IBLI 1FJGI 3QT7A 4MYUA 4B3TI 1XHKA 4JI4E 1A6FA 2HKEA 1KTVA 4DUZE 4LF4I 2X7IA 3H4LA 4DV2E 1MU5A 1N0VC 2V2ZA 1XMQE 4JI2I 2VQEI 1Z0GA 1Z0TA 3J80C 1QZRA 4FWDA 1KIJA 2VQFE 1HNWE 3WU4A 3LPSA 4PRVA 3ZM7A 4LFBE 1EA6A 1FI4A 3K1JA 2BM1A 4PU9A 1J5EE 5GMDA 3F0NA 4JI4I 2X36A 1EI1A 4X66I 4DUZI 4JI0I 1H73A 2HFSA 4DV2I 2UU9E 4JI7E 1XMQI 2LJPA 2XEXA 5IT9C 3WU3A 2VQFI 1ZXMA 4KHPE 1NHJA 4HY1A 1HNWI 4LFBI 4DU8A 1J5EI 1H72C 4DR6I 4LFAE 1N34E 1Z5CA 4MYTA 4NXNI 3JAMC 1HNZI 1UEKA 1XNQE 1S16A 4JI7I 4LF8E 5L3JA 4Z7YA 5BR8E 4JV5I 4LF7E 4WUBA 4KHPI 3ZKBA 4HYMA 3CWVA 2V2QA 1Z0WA 3PYGA 2A2DA 1U2RA 4LFAI 1K47A 1FWKA 1N34I 2E5LE 4JI8E 1KVKA 4JYAE 1MX0A 4P7AA 1N36E 3J80Q 4ED4A 1XNQI 4WUCA 4LF8I 1Z0CA 2UUCE 3GONA 3WU5A 5BR8I 1HNXE 4X64E 2HKJA 4M1KA 4LF7I 4Z7CA 4FW9A 4DU7A 1Z5AA 4DXLA 4HACB 1I94E 4LFCE 4HACA 2GS8A 4DV0E 1XMOE 2BM0A 2E5LI 4JI8I 2V2VA 1IBME 4DR7E 4DR2E 4USKA 4JYAI 2UXDE 1FNMA 1N36I 1B62A 1PVGA 4JI3I 4DV3E 1HR0E 5LMUE 2UUCI 1Z5BA 5IT9Q 4P52A 3LTOA 3PYEA 4DV7E 1HNXI 4LF9E 4X64I 1FKAE 3K17A 2UUAE 4DPTA 2BV3A 4HXZA 1N0UA 1ZXNA 5A2QC 4DV4E 1ZM9A 4LFCI 1XMOI 4DV0I 4DV1E 4GKJE 2HK3A 4WUDA 3QT5A 3JAMQ 4DR4E 1IBMI 3V2UC 1ZM2A 4DR7I 1S4EA 4DR2I 2UXDI 4DR1E 4DV3I 1HR0I 5LMUI 4DV7I 5FLXC 4LF9I 4DUYE 1Z0EA 2UUBE 4FWHA 4JI6E 4DV4I 4DV5E 2HHHE 4DPWA 1PIEA 1WUUA 2UU9I 1ZM4A 2R3VA 5LMNE 4DV1I 4GKJI 5GMEA 4DR4I 4DR3E 4LF5E 1NHIA 4DPXA 1N32E 2ZM6E 4DR1I 1KKHA 1Z0VA 4FWGA 4DUYI 4URLA 2UUBI 4JI6I 2EFGA 3PYFA 2Q2EB 4X62E 4DV5I 3PYDA 2HHHI 3J7AM 4EMDA 4JI1E 4LF4E 4B3ME 5IWAE 1N33E 1FWLA 5LMNI 4UTGA 3ZKDA 1NZ0A 2UXBE 2UXCE 2E1RA 4DR3I 1N32I 2ZM6I 4YY3E 3OTOE 2DEIA 5A2QQ 4PRXA 3B8HA 4K0KE 2HFUA 2ZITA 3B82A 4X62I 4AQYE 3T1YE 2V8PA 4YHHE 4JI1I 4X66E 4B3MI 4JI0E 1RR9A 5IWAI 1N33I 3ZZTA 2CZ9A 1Z0BA 2UXBI 2UXCI 3J81C 3ZZ0A 4YY3I 5FLXQ 3OTOI 1I94I 3T1HE 4LF6E 2F4VE 3J7AG 1H7UA 3D4JA 2ZBKB
chains in the Genus database with same CATH superfamily
1OJ4A 1Z59A 4DR6E 1Y4SA 4K0KI 4OX9E 4R1FA 4AQYI 3T1YI 4YHHI 4DV6E 3PS1A 1NHHA 4NXNE 4DPUA 2BA1G 2JT2A 2J7KA 4KQVA 5LL6R 3WU6A 3V5RA 2DEJA 1HNZE 4UT4A 2VF3A 1D6TA 2UUAI 4JI5E 2R42A 4JV5E 2PO2A 1PKPA 4X65E 4RPFA 3M7ND 1RREA 2NN6B 3KRNA 3QT6A 4LCGA 4DR5E 1USVA 2C37A 1H7SA 2BR2B 1VISA 3T1HI 4LF6I 4JG4A 1XNRE 4B3RE 2NN6F 2WNRB 2BR2A 1ZM3A 1Y5YA 2PNMA 3HULA 2F4VI 2JEBB 5K36C 3M6AA 2Z5BA 4FW3A 1RHYA 1XXEA 4AIMA 5JEAD 4NXME 3H1CA 4OX9I 4GKKE 2NPFA 4DV6I 1BKNA 2BA0G 3ZZUA 1DARA 4ZVIA 4DPYA 1IBKE 1B63A 2WW4A 4B3SE 1IBLE 3QT8A 1R6LA 4U3BA 1FJGE 4MU3A 2HK2A 4JI5I 4B3TE 2OI2A 4FN5A 4X65I 1MG7A 3Q1QA 2CGEA 5K36B 1Y6ZA 3DD6A 4DR5I 1UDSA 5FWKA 2A2CA 4B3RI 1XNRI 4IFDB 5K36F 2AE8A 4ISAA 4BA2B 2BA0D 5C0XC 4USMA 3B78A 4LF5I 3LNUA 4JI2E 1H74A 2VQEE 4NXMI 4GKKI 4I3HA 3P3EA 2V34A 2IERA 4IZJD 1ELOA 2GO4A 4XTJA 3J81Q 1IBKI 2AJ4A 4B3SI 4JI3E 1IBLI 1FJGI 3QT7A 4MYUA 4B3TI 2C39A 1XHKA 4JI4E 3PS3A 5C0XB 4FW7A 3UHMA 4OKGA 1A6FA 2C38A 4OO1C 2Z5EA 2HKEA 1KTVA 5C0XF 2WP8A 4DUZE 4LF4I 2X7IA 3H4LA 1UDNA 4DV2E 1MU5A 1N0VC 2V2ZA 1XMQE 3P76A 2VESA 2PO1B 4JI2I 2VQEI 1Z0GA 1Z0TA 1OYPA 3J80C 2GO3A 1QZRA 4FWDA 1KIJA 1Y60A 4J3DA 2VQFE 1HNWE 4FW4A 3WU4A 3LPSA 4PRVA 3ZM7A 4LFBE 1EA6A 3HKMA 1FI4A 3K1JA 2BM1A 4PU9A 1J5EE 4IFDE 2J65A 5GMDA 4OO1F 3F0NA 4JI4I 4AIDA 2O1WA 2X36A 4BA1B 5DROA 1EI1A 4X66I 4DUZI 4JI0I 4BA1A 3PS2A 1H73A 2HFSA 4DV2I 2UU9E 4JI7E 2F1DA 1XMQI 4U3DA 1UDOA 2LJPA 2XEXA 5IT9C 3WU3A 2VQFI 1ZXMA 4KHPE 1NHJA 3U1YA 4HY1A 2NN6A 1HNWI 5EKWA 4LFBI 2WNRA 5JEAC 4DU8A 1J5EI 1UDQA 2IOQA 1H72C 2JEBA 4DR6I 4LFAE 1N34E 4IZKB 1Z5CA 2JE6B 4MYTA 4NXNI 4MU4A 3CDIA 3JAMC 1HNZI 1UEKA 1XNQE 1S16A 4JI7I 4LF8E 5L3JA 2O1TA 4Z7YA 5BR8E 4JV5I 2JEAB 1VI7A 5JEAB 2JEAA 4LF7E 3GLLA 4WUBA 4KHPI 3ZKBA 3Q6NA 2IESA 5JEAF 5K36A 1R6MA 4HYMA 3CWVA 2V2QA 4IFDD 4IFDA 2Z5CB 1Z0WA 3PYGA 4BA2A 2A2DA 4LCFA 1U2RA 4LFAI 1K47A 1FWKA 1N34I 2E5LE 4JI8E 2IOPA 2O1VA 3L7ZB 4GQUA 4NBQA 1KVKA 4JYAE 1MX0A 4P7AA 3K85A 1N36E 1HK7A 3J80Q 2NN6E 4ED4A 1XNQI 4WUCA 4LF8I 1OYSA 1Z0CA 2UUCE 3GONA 3WU5A 5BR8I 1HNXE 4X64E 2HKJA 4M1KA 4LF7I 4Z7CA 4FW9A 4DU7A 5C0XA 1Z5AA 4DXLA 4HACB 1I94E 4LFCE 4HACA 2O3ZA 2GS8A 4LPFA 2PNZB 4DV0E 1XMOE 2BM0A 1YHCA 3GCMA 2PO1A 2E5LI 4JI8I 2V2VA 1IBME 1E3PA 2PO0B 4DR7E 4DR2E 4USKA 4JYAI 2UXDE 1FNMA 2PO0A 1N36I 1B62A 1PVGA 4JI3I 5DRRA 4OZEA 4OO1B 5K36E 4DV3E 1HR0E 5LMUE 2UUCI 1Z5BA 5IT9Q 4P52A 4OO1A 3LTOA 3PYEA 4DV7E 1HNXI 4LF9E 4X64I 1FKAE 3K17A 3M85G 2UUAE 3NZKA 4DPTA 4MQYA 2BV3A 4HXZA 3HJCA 1N0UA 1ZXNA 5A2QC 4DV4E 1ZM9A 4LFCI 4AM3A 2GQ0A 4MU1A 4DV0I 1XMOI 4MU0A 4DV1E 4GKJE 2HK3A 4WUDA 3QT5A 3JAMQ 4DR4E 1IBMI 3V2UC 1ZM2A 4DR7I 2NN6D 1S4EA 4DR2I 2UXDI 3U1KA 3M85D 4DR1E 5DNXA 5DNLA 5C0XE 4DV3I 1HR0I 5LMUI 3P3GA 4DV7I 5FLXC 4LF9I 4DUYE 3PRYA 2CG9A 2PO2B 1Z0EA 2UUBE 2PNLA 4FWHA 4FW5A 4JI6E 2C37B 4IZKA 3B4TA 2JE6A 4DV4I 4DV5E 2HHHE 4DPWA 1PIEA 1WUUA 2UU9I 1ZM4A 3P06A 3P3CA 2R3VA 5LMNE 4DV1I 2Z5BB 4GKJI 2BA1D 5GMEA 4DR4I 4OO1E 5EL9A 4DR3E 4LF5E 1NHIA 4DPXA 4IFDC 5JEAA 1N32E 5K36D 1YH8A 2ZM6E 4DR1I 1KKHA 1Z0VA 4FWGA 2Z5CA 4DUYI 4URLA 5DRQA 4QNKA 2UUBI 3Q6MA 4FW6A 4JI6I 4QNJA 2EFGA 3PYFA 2Q2EB 4LOMA 4X62E 4N3OA 1E3HA 3GMEA 1Y4UA 4DV5I 3L7ZA 3PYDA 2HHHI 3J7AM 4EMDA 4JI1E 4LF4E 4B3ME 5IWAE 1N33E 1FWLA 4IFDF 5LMNI 4UTGA 3ZKDA 1NZ0A 2UXBE 2UXCE 3CDJA 2E1RA 1USUA 4DR3I 1OYRA 1N32I 2CVEA 5C0XD 4IZJB 2ZM6I 4YY3E 4IZJA 5ELWA 3OTOE 2DEIA 4LCHA 2PNZA 2C39B 5A2QQ 4PRXA 3B8HA 2O1UA 2C38B 4K0KE 2HFUA 2ZITA 3B82A 4X62I 4AQYE 3T1YE 2V8PA 4YHHE 2WP8B 5JEAE 4JI1I 4X66E 4B3MI 4JI0E 1RR9A 5IWAI 1N33I 4OO1D 1P42A 3ZZTA 2CZ9A 1Z0BA 2UXBI 2UXCI 4IS9A 3J81C 4MDTA 3ZZ0A 4YY3I 5FLXQ 3OTOI 1I94I 3T1HE 4LF6E 2F4VE 3J7AG 1H7UA 5DRPA 3D4JA 2ZBKB 2NN6C 3M7NG
chains in the Genus database with same CATH topology
1OJ4A 1Z59A 4DR6E 1Y4SA 4K0KI 4OX9E 4R1FA 4AQYI 3T1YI 4YHHI 4DV6E 1NHHA 4NXNE 4DPUA 2J7KA 4KQVA 5LL6R 3WU6A 3V5RA 2DEJA 1HNZE 4UT4A 2VF3A 1D6TA 2UUAI 4JI5E 2R42A 4JV5E 1PKPA 4X65E 4RPFA 1RREA 3QT6A 4DR5E 1USVA 1H7SA 4LF6I 1VISA 3T1HI 4B3RE 4JG4A 1XNRE 1ZM3A 2PNMA 3HULA 2F4VI 3M6AA 2Z5BA 4OX9I 4NXME 4GKKE 2NPFA 4DV6I 1BKNA 3ZZUA 1DARA 4ZVIA 4DPYA 1IBKE 1B63A 2WW4A 4B3SE 1IBLE 3QT8A 1FJGE 2HK2A 4JI5I 4B3TE 2OI2A 4FN5A 4X65I 1MG7A 3Q1QA 2CGEA 1Y6ZA 4DR5I 5FWKA 2A2CA 4B3RI 1XNRI 4USMA 3B78A 4LF5I 3LNUA 4JI2E 1H74A 2VQEE 4NXMI 4GKKI 4I3HA 2V34A 4IZJD 1ELOA 4XTJA 3J81Q 1IBKI 2AJ4A 4B3SI 4JI3E 1IBLI 1FJGI 3QT7A 4MYUA 4B3TI 1XHKA 4JI4E 1A6FA 2Z5EA 2HKEA 1KTVA 4DUZE 4LF4I 2X7IA 3H4LA 4DV2E 1MU5A 1N0VC 2V2ZA 1XMQE 4JI2I 2VQEI 1Z0GA 1Z0TA 3J80C 1QZRA 4FWDA 1KIJA 2VQFE 1HNWE 3WU4A 3LPSA 4PRVA 3ZM7A 4LFBE 1EA6A 1FI4A 3K1JA 2BM1A 4PU9A 1J5EE 5GMDA 3F0NA 4JI4I 2O1WA 2X36A 1EI1A 4X66I 4DUZI 4JI0I 1H73A 2HFSA 4DV2I 2UU9E 4JI7E 1XMQI 2LJPA 2XEXA 5IT9C 3WU3A 2VQFI 1ZXMA 4KHPE 1NHJA 4HY1A 1HNWI 4LFBI 4DU8A 1J5EI 2IOQA 1H72C 4DR6I 4LFAE 1N34E 4IZKB 1Z5CA 4MYTA 4NXNI 3JAMC 1HNZI 1UEKA 1XNQE 1S16A 4JI7I 4LF8E 5L3JA 2O1TA 4Z7YA 5BR8E 4JV5I 4LF7E 4WUBA 4KHPI 3ZKBA 3Q6NA 4HYMA 3CWVA 2V2QA 2Z5CB 1Z0WA 3PYGA 2A2DA 1U2RA 4LFAI 1K47A 1FWKA 1N34I 2E5LE 4JI8E 2IOPA 2O1VA 1KVKA 4JYAE 1MX0A 4P7AA 3K85A 1N36E 1HK7A 3J80Q 4ED4A 1XNQI 4WUCA 4LF8I 1Z0CA 2UUCE 3GONA 3WU5A 5BR8I 1HNXE 4X64E 2HKJA 4M1KA 4LF7I 4Z7CA 4FW9A 4DU7A 1Z5AA 4DXLA 4HACB 1I94E 4LFCE 4HACA 2GS8A 4DV0E 1XMOE 2BM0A 2E5LI 4JI8I 2V2VA 1IBME 4DR7E 4DR2E 4USKA 4JYAI 2UXDE 1FNMA 1N36I 1B62A 1PVGA 4JI3I 4DV3E 1HR0E 5LMUE 2UUCI 1Z5BA 5IT9Q 4P52A 3LTOA 3PYEA 4DV7E 1HNXI 4LF9E 4X64I 1FKAE 3K17A 2UUAE 4DPTA 2BV3A 4HXZA 3HJCA 1N0UA 1ZXNA 5A2QC 4DV4E 1ZM9A 4LFCI 2GQ0A 1XMOI 4DV0I 4DV1E 4GKJE 2HK3A 4WUDA 3QT5A 3JAMQ 4DR4E 1IBMI 3V2UC 1ZM2A 4DR7I 1S4EA 4DR2I 2UXDI 4DR1E 4DV3I 1HR0I 5LMUI 4DV7I 5FLXC 4LF9I 4DUYE 3PRYA 2CG9A 1Z0EA 2UUBE 2PNLA 4FWHA 4JI6E 4IZKA 4DV4I 4DV5E 2HHHE 4DPWA 1PIEA 1WUUA 2UU9I 1ZM4A 3P06A 2R3VA 5LMNE 4DV1I 2Z5BB 4GKJI 5GMEA 4DR4I 4DR3E 4LF5E 1NHIA 4DPXA 1N32E 2ZM6E 4DR1I 1KKHA 1Z0VA 4FWGA 2Z5CA 4DUYI 4URLA 2UUBI 3Q6MA 4JI6I 2EFGA 3PYFA 2Q2EB 4X62E 4N3OA 1Y4UA 4DV5I 3PYDA 2HHHI 3J7AM 4EMDA 4JI1E 4LF4E 4B3ME 5IWAE 1N33E 1FWLA 5LMNI 4UTGA 3ZKDA 1NZ0A 2UXBE 2UXCE 2E1RA 1USUA 4DR3I 1N32I 4IZJB 2ZM6I 4YY3E 4IZJA 3OTOE 2DEIA 5A2QQ 4PRXA 3B8HA 2O1UA 4K0KE 2HFUA 2ZITA 3B82A 4X62I 4AQYE 3T1YE 2V8PA 4YHHE 4JI1I 4X66E 4B3MI 4JI0E 1RR9A 5IWAI 1N33I 3ZZTA 2CZ9A 1Z0BA 2UXBI 2UXCI 3J81C 3ZZ0A 4YY3I 5FLXQ 3OTOI 1I94I 3T1HE 4LF6E 2F4VE 3J7AG 1H7UA 3D4JA 2ZBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ4 A;  1Z59 A;  4DR6 E;  4K0K I;  4OX9 E;  4R1F A;  4AQY I;  3T1Y I;  4YHH I;  4DV6 E;  1NHH A;  4NXN E;  4DPU A;  2J7K A;  4KQV A;  5LL6 R;  3WU6 A;  3V5R A;  2DEJ A;  1HNZ E;  4UT4 A;  2VF3 A;  1D6T A;  2UUA I;  4JI5 E;  2R42 A;  4JV5 E;  1PKP A;  4X65 E;  4RPF A;  1RRE A;  3QT6 A;  4DR5 E;  1H7S A;  4LF6 I;  1VIS A;  3T1H I;  4B3R E;  4JG4 A;  1XNR E;  1ZM3 A;  3HUL A;  2F4V I;  3M6A A;  4OX9 I;  4NXM E;  4GKK E;  2NPF A;  4DV6 I;  1BKN A;  3ZZU A;  1DAR A;  4ZVI A;  4DPY A;  1IBK E;  1B63 A;  2WW4 A;  4B3S E;  1IBL E;  3QT8 A;  1FJG E;  2HK2 A;  4JI5 I;  4B3T E;  2OI2 A;  4FN5 A;  4X65 I;  1MG7 A;  3Q1Q A;  4DR5 I;  2A2C A;  4B3R I;  1XNR I;  4USM A;  3B78 A;  4LF5 I;  3LNU A;  4JI2 E;  1H74 A;  2VQE E;  4NXM I;  4GKK I;  4I3H A;  2V34 A;  1ELO A;  4XTJ A;  3J81 Q;  1IBK I;  2AJ4 A;  4B3S I;  4JI3 E;  1IBL I;  1FJG I;  3QT7 A;  4MYU A;  4B3T I;  1XHK A;  4JI4 E;  1A6F A;  2HKE A;  1KTV A;  4DUZ E;  4LF4 I;  2X7I A;  3H4L A;  4DV2 E;  1MU5 A;  1N0V C;  2V2Z A;  1XMQ E;  4JI2 I;  2VQE I;  1Z0G A;  1Z0T A;  3J80 C;  1QZR A;  4FWD A;  1KIJ A;  2VQF E;  1HNW E;  3WU4 A;  3LPS A;  4PRV A;  3ZM7 A;  4LFB E;  1EA6 A;  1FI4 A;  3K1J A;  2BM1 A;  4PU9 A;  1J5E E;  5GMD A;  3F0N A;  4JI4 I;  2X36 A;  1EI1 A;  4X66 I;  4DUZ I;  4JI0 I;  1H73 A;  2HFS A;  4DV2 I;  2UU9 E;  4JI7 E;  1XMQ I;  2LJP A;  2XEX A;  5IT9 C;  3WU3 A;  2VQF I;  1ZXM A;  4KHP E;  1NHJ A;  4HY1 A;  1HNW I;  4LFB I;  4DU8 A;  1J5E I;  1H72 C;  4DR6 I;  4LFA E;  1N34 E;  1Z5C A;  4MYT A;  4NXN I;  3JAM C;  1HNZ I;  1UEK A;  1XNQ E;  1S16 A;  4JI7 I;  4LF8 E;  5L3J A;  4Z7Y A;  5BR8 E;  4JV5 I;  4LF7 E;  4WUB A;  4KHP I;  3ZKB A;  4HYM A;  3CWV A;  2V2Q A;  1Z0W A;  3PYG A;  2A2D A;  1U2R A;  4LFA I;  1K47 A;  1FWK A;  1N34 I;  2E5L E;  4JI8 E;  1KVK A;  4JYA E;  1MX0 A;  4P7A A;  1N36 E;  3J80 Q;  4ED4 A;  1XNQ I;  4WUC A;  4LF8 I;  1Z0C A;  2UUC E;  3GON A;  3WU5 A;  5BR8 I;  1HNX E;  4X64 E;  2HKJ A;  4M1K A;  4LF7 I;  4Z7C A;  4FW9 A;  4DU7 A;  1Z5A A;  4DXL A;  4HAC B;  1I94 E;  4LFC E;  4HAC A;  2GS8 A;  4DV0 E;  1XMO E;  2BM0 A;  2E5L I;  4JI8 I;  2V2V A;  1IBM E;  4DR7 E;  4DR2 E;  4USK A;  4JYA I;  2UXD E;  1FNM A;  1N36 I;  1B62 A;  1PVG A;  4JI3 I;  4DV3 E;  1HR0 E;  5LMU E;  2UUC I;  1Z5B A;  5IT9 Q;  4P52 A;  3LTO A;  3PYE A;  4DV7 E;  1HNX I;  4LF9 E;  4X64 I;  1FKA E;  3K17 A;  2UUA E;  4DPT A;  2BV3 A;  4HXZ A;  1N0U A;  1ZXN A;  5A2Q C;  4DV4 E;  1ZM9 A;  4LFC I;  1XMO I;  4DV0 I;  4DV1 E;  4GKJ E;  2HK3 A;  4WUD A;  3QT5 A;  3JAM Q;  4DR4 E;  1IBM I;  3V2U C;  1ZM2 A;  4DR7 I;  1S4E A;  4DR2 I;  2UXD I;  4DR1 E;  4DV3 I;  1HR0 I;  5LMU I;  4DV7 I;  5FLX C;  4LF9 I;  4DUY E;  1Z0E A;  2UUB E;  4FWH A;  4JI6 E;  4DV4 I;  4DV5 E;  2HHH E;  4DPW A;  1PIE A;  1WUU A;  2UU9 I;  1ZM4 A;  2R3V A;  5LMN E;  4DV1 I;  4GKJ I;  5GME A;  4DR4 I;  4DR3 E;  4LF5 E;  1NHI A;  4DPX A;  1N32 E;  2ZM6 E;  4DR1 I;  1KKH A;  1Z0V A;  4FWG A;  4DUY I;  4URL A;  2UUB I;  4JI6 I;  2EFG A;  3PYF A;  2Q2E B;  4X62 E;  4DV5 I;  3PYD A;  2HHH I;  3J7A M;  4EMD A;  4JI1 E;  4LF4 E;  4B3M E;  5IWA E;  1N33 E;  1FWL A;  5LMN I;  4UTG A;  3ZKD A;  1NZ0 A;  2UXB E;  2UXC E;  2E1R A;  4DR3 I;  1N32 I;  2ZM6 I;  4YY3 E;  3OTO E;  2DEI A;  5A2Q Q;  4PRX A;  3B8H A;  4K0K E;  2HFU A;  2ZIT A;  3B82 A;  4X62 I;  4AQY E;  3T1Y E;  2V8P A;  4YHH E;  4JI1 I;  4X66 E;  4B3M I;  4JI0 E;  1RR9 A;  5IWA I;  1N33 I;  3ZZT A;  2CZ9 A;  1Z0B A;  2UXB I;  2UXC I;  3J81 C;  3ZZ0 A;  4YY3 I;  5FLX Q;  3OTO I;  1I94 I;  3T1H E;  4LF6 E;  2F4V E;  3J7A G;  1H7U A;  3D4J A;  2ZBK B; 
#chains in the Genus database with same CATH topology
 1OJ4 A;  1Z59 A;  4DR6 E;  1Y4S A;  4K0K I;  4OX9 E;  4R1F A;  4AQY I;  3T1Y I;  4YHH I;  4DV6 E;  3PS1 A;  1NHH A;  4NXN E;  4DPU A;  2BA1 G;  2JT2 A;  2J7K A;  4KQV A;  5LL6 R;  3WU6 A;  3V5R A;  2DEJ A;  1HNZ E;  4UT4 A;  2VF3 A;  1D6T A;  2UUA I;  4JI5 E;  2R42 A;  4JV5 E;  2PO2 A;  1PKP A;  4X65 E;  4RPF A;  3M7N D;  1RRE A;  2NN6 B;  3KRN A;  3QT6 A;  4LCG A;  4DR5 E;  1USV A;  2C37 A;  1H7S A;  2BR2 B;  1VIS A;  3T1H I;  4LF6 I;  4JG4 A;  1XNR E;  4B3R E;  2NN6 F;  2WNR B;  2BR2 A;  1ZM3 A;  1Y5Y A;  2PNM A;  3HUL A;  2F4V I;  2JEB B;  5K36 C;  3M6A A;  2Z5B A;  4FW3 A;  1RHY A;  1XXE A;  4AIM A;  5JEA D;  4NXM E;  3H1C A;  4OX9 I;  4GKK E;  2NPF A;  4DV6 I;  1BKN A;  2BA0 G;  3ZZU A;  1DAR A;  4ZVI A;  4DPY A;  1IBK E;  1B63 A;  2WW4 A;  4B3S E;  1IBL E;  3QT8 A;  1R6L A;  4U3B A;  1FJG E;  4MU3 A;  2HK2 A;  4JI5 I;  4B3T E;  2OI2 A;  4FN5 A;  4X65 I;  1MG7 A;  3Q1Q A;  2CGE A;  5K36 B;  1Y6Z A;  3DD6 A;  4DR5 I;  1UDS A;  5FWK A;  2A2C A;  4B3R I;  1XNR I;  4IFD B;  5K36 F;  2AE8 A;  4ISA A;  4BA2 B;  2BA0 D;  5C0X C;  4USM A;  3B78 A;  4LF5 I;  3LNU A;  4JI2 E;  1H74 A;  2VQE E;  4NXM I;  4GKK I;  4I3H A;  3P3E A;  2V34 A;  2IER A;  4IZJ D;  1ELO A;  2GO4 A;  4XTJ A;  3J81 Q;  1IBK I;  2AJ4 A;  4B3S I;  4JI3 E;  1IBL I;  1FJG I;  3QT7 A;  4MYU A;  4B3T I;  2C39 A;  1XHK A;  4JI4 E;  3PS3 A;  5C0X B;  4FW7 A;  3UHM A;  4OKG A;  1A6F A;  2C38 A;  4OO1 C;  2Z5E A;  2HKE A;  1KTV A;  5C0X F;  2WP8 A;  4DUZ E;  4LF4 I;  2X7I A;  3H4L A;  1UDN A;  4DV2 E;  1MU5 A;  1N0V C;  2V2Z A;  1XMQ E;  3P76 A;  2VES A;  2PO1 B;  4JI2 I;  2VQE I;  1Z0G A;  1Z0T A;  1OYP A;  3J80 C;  2GO3 A;  1QZR A;  4FWD A;  1KIJ A;  1Y60 A;  4J3D A;  2VQF E;  1HNW E;  4FW4 A;  3WU4 A;  3LPS A;  4PRV A;  3ZM7 A;  4LFB E;  1EA6 A;  3HKM A;  1FI4 A;  3K1J A;  2BM1 A;  4PU9 A;  1J5E E;  4IFD E;  2J65 A;  5GMD A;  4OO1 F;  3F0N A;  4JI4 I;  4AID A;  2O1W A;  2X36 A;  4BA1 B;  5DRO A;  1EI1 A;  4X66 I;  4DUZ I;  4JI0 I;  4BA1 A;  3PS2 A;  1H73 A;  2HFS A;  4DV2 I;  2UU9 E;  4JI7 E;  2F1D A;  1XMQ I;  4U3D A;  1UDO A;  2LJP A;  2XEX A;  5IT9 C;  3WU3 A;  2VQF I;  1ZXM A;  4KHP E;  1NHJ A;  3U1Y A;  4HY1 A;  2NN6 A;  1HNW I;  5EKW A;  4LFB I;  2WNR A;  5JEA C;  4DU8 A;  1J5E I;  1UDQ A;  2IOQ A;  1H72 C;  2JEB A;  4DR6 I;  4LFA E;  1N34 E;  4IZK B;  1Z5C A;  2JE6 B;  4MYT A;  4NXN I;  4MU4 A;  3CDI A;  3JAM C;  1HNZ I;  1UEK A;  1XNQ E;  1S16 A;  4JI7 I;  4LF8 E;  5L3J A;  2O1T A;  4Z7Y A;  5BR8 E;  4JV5 I;  2JEA B;  1VI7 A;  5JEA B;  2JEA A;  4LF7 E;  3GLL A;  4WUB A;  4KHP I;  3ZKB A;  3Q6N A;  2IES A;  5JEA F;  5K36 A;  1R6M A;  4HYM A;  3CWV A;  2V2Q A;  4IFD D;  4IFD A;  2Z5C B;  1Z0W A;  3PYG A;  4BA2 A;  2A2D A;  4LCF A;  1U2R A;  4LFA I;  1K47 A;  1FWK A;  1N34 I;  2E5L E;  4JI8 E;  2IOP A;  2O1V A;  3L7Z B;  4GQU A;  4NBQ A;  1KVK A;  4JYA E;  1MX0 A;  4P7A A;  3K85 A;  1N36 E;  1HK7 A;  3J80 Q;  2NN6 E;  4ED4 A;  1XNQ I;  4WUC A;  4LF8 I;  1OYS A;  1Z0C A;  2UUC E;  3GON A;  3WU5 A;  5BR8 I;  1HNX E;  4X64 E;  2HKJ A;  4M1K A;  4LF7 I;  4Z7C A;  4FW9 A;  4DU7 A;  5C0X A;  1Z5A A;  4DXL A;  4HAC B;  1I94 E;  4LFC E;  4HAC A;  2O3Z A;  2GS8 A;  4LPF A;  2PNZ B;  4DV0 E;  1XMO E;  2BM0 A;  1YHC A;  3GCM A;  2PO1 A;  2E5L I;  4JI8 I;  2V2V A;  1IBM E;  1E3P A;  2PO0 B;  4DR7 E;  4DR2 E;  4USK A;  4JYA I;  2UXD E;  1FNM A;  2PO0 A;  1N36 I;  1B62 A;  1PVG A;  4JI3 I;  5DRR A;  4OZE A;  4OO1 B;  5K36 E;  4DV3 E;  1HR0 E;  5LMU E;  2UUC I;  1Z5B A;  5IT9 Q;  4P52 A;  4OO1 A;  3LTO A;  3PYE A;  4DV7 E;  1HNX I;  4LF9 E;  4X64 I;  1FKA E;  3K17 A;  3M85 G;  2UUA E;  3NZK A;  4DPT A;  4MQY A;  2BV3 A;  4HXZ A;  3HJC A;  1N0U A;  1ZXN A;  5A2Q C;  4DV4 E;  1ZM9 A;  4LFC I;  4AM3 A;  2GQ0 A;  4MU1 A;  4DV0 I;  1XMO I;  4MU0 A;  4DV1 E;  4GKJ E;  2HK3 A;  4WUD A;  3QT5 A;  3JAM Q;  4DR4 E;  1IBM I;  3V2U C;  1ZM2 A;  4DR7 I;  2NN6 D;  1S4E A;  4DR2 I;  2UXD I;  3U1K A;  3M85 D;  4DR1 E;  5DNX A;  5DNL A;  5C0X E;  4DV3 I;  1HR0 I;  5LMU I;  3P3G A;  4DV7 I;  5FLX C;  4LF9 I;  4DUY E;  3PRY A;  2CG9 A;  2PO2 B;  1Z0E A;  2UUB E;  2PNL A;  4FWH A;  4FW5 A;  4JI6 E;  2C37 B;  4IZK A;  3B4T A;  2JE6 A;  4DV4 I;  4DV5 E;  2HHH E;  4DPW A;  1PIE A;  1WUU A;  2UU9 I;  1ZM4 A;  3P06 A;  3P3C A;  2R3V A;  5LMN E;  4DV1 I;  2Z5B B;  4GKJ I;  2BA1 D;  5GME A;  4DR4 I;  4OO1 E;  5EL9 A;  4DR3 E;  4LF5 E;  1NHI A;  4DPX A;  4IFD C;  5JEA A;  1N32 E;  5K36 D;  1YH8 A;  2ZM6 E;  4DR1 I;  1KKH A;  1Z0V A;  4FWG A;  2Z5C A;  4DUY I;  4URL A;  5DRQ A;  4QNK A;  2UUB I;  3Q6M A;  4FW6 A;  4JI6 I;  4QNJ A;  2EFG A;  3PYF A;  2Q2E B;  4LOM A;  4X62 E;  4N3O A;  1E3H A;  3GME A;  1Y4U A;  4DV5 I;  3L7Z A;  3PYD A;  2HHH I;  3J7A M;  4EMD A;  4JI1 E;  4LF4 E;  4B3M E;  5IWA E;  1N33 E;  1FWL A;  4IFD F;  5LMN I;  4UTG A;  3ZKD A;  1NZ0 A;  2UXB E;  2UXC E;  3CDJ A;  2E1R A;  1USU A;  4DR3 I;  1OYR A;  1N32 I;  2CVE A;  5C0X D;  4IZJ B;  2ZM6 I;  4YY3 E;  4IZJ A;  5ELW A;  3OTO E;  2DEI A;  4LCH A;  2PNZ A;  2C39 B;  5A2Q Q;  4PRX A;  3B8H A;  2O1U A;  2C38 B;  4K0K E;  2HFU A;  2ZIT A;  3B82 A;  4X62 I;  4AQY E;  3T1Y E;  2V8P A;  4YHH E;  2WP8 B;  5JEA E;  4JI1 I;  4X66 E;  4B3M I;  4JI0 E;  1RR9 A;  5IWA I;  1N33 I;  4OO1 D;  1P42 A;  3ZZT A;  2CZ9 A;  1Z0B A;  2UXB I;  2UXC I;  4IS9 A;  3J81 C;  4MDT A;  3ZZ0 A;  4YY3 I;  5FLX Q;  3OTO I;  1I94 I;  3T1H E;  4LF6 E;  2F4V E;  3J7A G;  1H7U A;  5DRP A;  3D4J A;  2ZBK B;  2NN6 C;  3M7N G; 
#chains in the Genus database with same CATH homology
 1OJ4 A;  1Z59 A;  4DR6 E;  1Y4S A;  4K0K I;  4OX9 E;  4R1F A;  4AQY I;  3T1Y I;  4YHH I;  4DV6 E;  1NHH A;  4NXN E;  4DPU A;  2J7K A;  4KQV A;  5LL6 R;  3WU6 A;  3V5R A;  2DEJ A;  1HNZ E;  4UT4 A;  2VF3 A;  1D6T A;  2UUA I;  4JI5 E;  2R42 A;  4JV5 E;  1PKP A;  4X65 E;  4RPF A;  1RRE A;  3QT6 A;  4DR5 E;  1USV A;  1H7S A;  4LF6 I;  1VIS A;  3T1H I;  4B3R E;  4JG4 A;  1XNR E;  1ZM3 A;  2PNM A;  3HUL A;  2F4V I;  3M6A A;  2Z5B A;  4OX9 I;  4NXM E;  4GKK E;  2NPF A;  4DV6 I;  1BKN A;  3ZZU A;  1DAR A;  4ZVI A;  4DPY A;  1IBK E;  1B63 A;  2WW4 A;  4B3S E;  1IBL E;  3QT8 A;  1FJG E;  2HK2 A;  4JI5 I;  4B3T E;  2OI2 A;  4FN5 A;  4X65 I;  1MG7 A;  3Q1Q A;  2CGE A;  1Y6Z A;  4DR5 I;  5FWK A;  2A2C A;  4B3R I;  1XNR I;  4USM A;  3B78 A;  4LF5 I;  3LNU A;  4JI2 E;  1H74 A;  2VQE E;  4NXM I;  4GKK I;  4I3H A;  2V34 A;  4IZJ D;  1ELO A;  4XTJ A;  3J81 Q;  1IBK I;  2AJ4 A;  4B3S I;  4JI3 E;  1IBL I;  1FJG I;  3QT7 A;  4MYU A;  4B3T I;  1XHK A;  4JI4 E;  1A6F A;  2Z5E A;  2HKE A;  1KTV A;  4DUZ E;  4LF4 I;  2X7I A;  3H4L A;  4DV2 E;  1MU5 A;  1N0V C;  2V2Z A;  1XMQ E;  4JI2 I;  2VQE I;  1Z0G A;  1Z0T A;  3J80 C;  1QZR A;  4FWD A;  1KIJ A;  2VQF E;  1HNW E;  3WU4 A;  3LPS A;  4PRV A;  3ZM7 A;  4LFB E;  1EA6 A;  1FI4 A;  3K1J A;  2BM1 A;  4PU9 A;  1J5E E;  5GMD A;  3F0N A;  4JI4 I;  2O1W A;  2X36 A;  1EI1 A;  4X66 I;  4DUZ I;  4JI0 I;  1H73 A;  2HFS A;  4DV2 I;  2UU9 E;  4JI7 E;  1XMQ I;  2LJP A;  2XEX A;  5IT9 C;  3WU3 A;  2VQF I;  1ZXM A;  4KHP E;  1NHJ A;  4HY1 A;  1HNW I;  4LFB I;  4DU8 A;  1J5E I;  2IOQ A;  1H72 C;  4DR6 I;  4LFA E;  1N34 E;  4IZK B;  1Z5C A;  4MYT A;  4NXN I;  3JAM C;  1HNZ I;  1UEK A;  1XNQ E;  1S16 A;  4JI7 I;  4LF8 E;  5L3J A;  2O1T A;  4Z7Y A;  5BR8 E;  4JV5 I;  4LF7 E;  4WUB A;  4KHP I;  3ZKB A;  3Q6N A;  4HYM A;  3CWV A;  2V2Q A;  2Z5C B;  1Z0W A;  3PYG A;  2A2D A;  1U2R A;  4LFA I;  1K47 A;  1FWK A;  1N34 I;  2E5L E;  4JI8 E;  2IOP A;  2O1V A;  1KVK A;  4JYA E;  1MX0 A;  4P7A A;  3K85 A;  1N36 E;  1HK7 A;  3J80 Q;  4ED4 A;  1XNQ I;  4WUC A;  4LF8 I;  1Z0C A;  2UUC E;  3GON A;  3WU5 A;  5BR8 I;  1HNX E;  4X64 E;  2HKJ A;  4M1K A;  4LF7 I;  4Z7C A;  4FW9 A;  4DU7 A;  1Z5A A;  4DXL A;  4HAC B;  1I94 E;  4LFC E;  4HAC A;  2GS8 A;  4DV0 E;  1XMO E;  2BM0 A;  2E5L I;  4JI8 I;  2V2V A;  1IBM E;  4DR7 E;  4DR2 E;  4USK A;  4JYA I;  2UXD E;  1FNM A;  1N36 I;  1B62 A;  1PVG A;  4JI3 I;  4DV3 E;  1HR0 E;  5LMU E;  2UUC I;  1Z5B A;  5IT9 Q;  4P52 A;  3LTO A;  3PYE A;  4DV7 E;  1HNX I;  4LF9 E;  4X64 I;  1FKA E;  3K17 A;  2UUA E;  4DPT A;  2BV3 A;  4HXZ A;  3HJC A;  1N0U A;  1ZXN A;  5A2Q C;  4DV4 E;  1ZM9 A;  4LFC I;  2GQ0 A;  1XMO I;  4DV0 I;  4DV1 E;  4GKJ E;  2HK3 A;  4WUD A;  3QT5 A;  3JAM Q;  4DR4 E;  1IBM I;  3V2U C;  1ZM2 A;  4DR7 I;  1S4E A;  4DR2 I;  2UXD I;  4DR1 E;  4DV3 I;  1HR0 I;  5LMU I;  4DV7 I;  5FLX C;  4LF9 I;  4DUY E;  3PRY A;  2CG9 A;  1Z0E A;  2UUB E;  2PNL A;  4FWH A;  4JI6 E;  4IZK A;  4DV4 I;  4DV5 E;  2HHH E;  4DPW A;  1PIE A;  1WUU A;  2UU9 I;  1ZM4 A;  3P06 A;  2R3V A;  5LMN E;  4DV1 I;  2Z5B B;  4GKJ I;  5GME A;  4DR4 I;  4DR3 E;  4LF5 E;  1NHI A;  4DPX A;  1N32 E;  2ZM6 E;  4DR1 I;  1KKH A;  1Z0V A;  4FWG A;  2Z5C A;  4DUY I;  4URL A;  2UUB I;  3Q6M A;  4JI6 I;  2EFG A;  3PYF A;  2Q2E B;  4X62 E;  4N3O A;  1Y4U A;  4DV5 I;  3PYD A;  2HHH I;  3J7A M;  4EMD A;  4JI1 E;  4LF4 E;  4B3M E;  5IWA E;  1N33 E;  1FWL A;  5LMN I;  4UTG A;  3ZKD A;  1NZ0 A;  2UXB E;  2UXC E;  2E1R A;  1USU A;  4DR3 I;  1N32 I;  4IZJ B;  2ZM6 I;  4YY3 E;  4IZJ A;  3OTO E;  2DEI A;  5A2Q Q;  4PRX A;  3B8H A;  2O1U A;  4K0K E;  2HFU A;  2ZIT A;  3B82 A;  4X62 I;  4AQY E;  3T1Y E;  2V8P A;  4YHH E;  4JI1 I;  4X66 E;  4B3M I;  4JI0 E;  1RR9 A;  5IWA I;  1N33 I;  3ZZT A;  2CZ9 A;  1Z0B A;  2UXB I;  2UXC I;  3J81 C;  3ZZ0 A;  4YY3 I;  5FLX Q;  3OTO I;  1I94 I;  3T1H E;  4LF6 E;  2F4V E;  3J7A G;  1H7U A;  3D4J A;  2ZBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...