1I94I

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94I00
4JI1E 3PYDA 1HNWE 3T1YE 2GS8A 2VQEE 3J81C 4KQVA 4DR5I 1MU5A 3F0NA 2HFSA 1N33E 5LMUE 4LF7I 4DR3I 1Z0WA 2UU9I 2E5LI 4GKKI 4NXNI 4HACA 2LJPA 4MYUA 1XNQE 4B3SE 1ZXMA 4LF8E 1Z0VA 4YY3E 2VQFI 4LFAE 4LF9E 4B3RE 1HNWI 4NXME 2HKJA 4UTGA 2F4VE 4OX9E 3V5RA 2UUCI 1H72C 5FLXQ 4DPXA 1D6TA 1N33I 5LMUI 1A6FA 1Z5BA 3PYFA 4DUYE 3QT5A 2XEXA 4DR4E 3ZKBA 4P52A 3D4JA 4LF8I 4DUZE 1S16A 4K0KI 1Z5AA 1FJGI 4LF9I 1BKNA 5FLXC 4HXZA 3GONA 1Z5CA 4DV6I 1NHJA 4DV7I 4LFCI 4WUDA 4X64I 1ZM4A 2HK2A 2HK3A 1I94E 4JI4E 4DU7A 2UXCE 1H7UA 3QT8A 2WW4A 2A2DA 1IBLE 4JI7E 4DR6E 2UXBE 4DPTA 2HFUA 2OI2A 5GMEA 3PYEA 4DR2E 1NZ0A 1KIJA 4DR5E 1QZRA 4URLA 2UUAE 1VISA 1I94I 4JI4I 2E5LE 1KVKA 2ZITA 4JI7I 4GKKE 4NXNE 4DR6I 4FW9A 4Z7CA 4JI8E 3QT7A 4DV2I 4GKJI 4LF5E 3T1HI 4B3TE 2DEIA 2VQFE 5IT9Q 2AJ4A 3V2UC 2UUCE 3HULA 2V2ZA 1FWKA 2UUAI 4DV1I 4X65I 1N32I 4DV3E 4DPYA 3QT6A 4P7AA 4JI8I 3ZM7A 4JV5E 2ZM6I 4LF5I 1WUUA 1HNXE 4B3TI 4K0KE 1FJGE 5IT9C 4DV5I 3ZZUA 3B8HA 4DR7I 1HR0I 5LMNE 4JYAI 4DV6E 4DV7E 4LFCE 4LFBI 4DV3I 4X64E 3WU4A 1N0VC 3LNUA 4JV5I 4YHHI 4FWDA 1HNXI 2R42A 2NPFA 4UT4A 1PIEA 4USKA 4DR1I 1KTVA 1ELOA 5LMNI 1N34I 4MYTA 1ZM2A 2UUBI 3K1JA 3J80Q 2E1RA 4WUBA 5IWAI 1Z0TA 1PVGA 1S4EA 2HHHE 1B62A 1DARA 2HKEA 2X7IA 4DV4E 2V2QA 1XNRI 4LF6E 4DV2E 4GKJE 1J5EI 3T1HE 4PRVA 5L3JA 4X66I 4ZVIA 2CZ9A 3OTOI 1FWLA 3H4LA 2X36A 4FN5A 1PKPA 1FI4A 3J80C 1N36I 5BR8E 1FNMA 4I3HA 4DV1E 4JI2I 4X65E 1N0UA 4HACB 1MG7A 1N32E 1ZXNA 1XMOE 1EI1A 2HHHI 4Z7YA 1ZM3A 1IBME 2BM1A 4DV4I 2J7KA 2ZM6E 1XMQI 4LF6I 4AQYI 1XHKA 4DV5E 4EMDA 4DV0E 1KKHA 1H7SA 1Z0GA 3LPSA 1HNZI 4DU8A 3CWVA 4DR7E 4JI3E 1FKAE 5BR8I 1HR0E 4JYAE 4LF4I 4LFBE 2BV3A 1XMOI 1UEKA 3PYGA 1IBMI 4JI5I 2Q2EB 2EFGA 3K17A 3J7AM 1IBKI 4YHHE 4XTJA 1RR9A 2V34A 1NHIA 4DV0I 4JI3I 2ZBKB 3ZKDA 4JI6I 2VF3A 3LTOA 4DR1E 1N34E 3B78A 3ZZTA 1Z0CA 1ZM9A 2UUBE 3B82A 4JI0I 4USMA 4R1FA 1RREA 4KHPI 3J7AG 5IWAE 4JI1I 3JAMQ 4WUCA 3T1YI 2VQEI 2DEJA 2V2VA 2BM0A 1XNRE 4PRXA 5A2QQ 1J5EE 4X66E 4X62E 3OTOE 4FWHA 5GMDA 1Z59A 1Z0EA 1EA6A 3WU3A 4DPWA 1XNQI 1N36E 1H73A 4B3SI 2UXDE 4JI2E 3JAMC 4YY3I 4DPUA 4LFAI 4FWGA 4B3RI 3M6AA 5LL6R 4NXMI 4RPFA 2F4VI 4HYMA 4OX9I 5A2QC 2V8PA 1XMQE 1MX0A 4AQYE 4ED4A 4X62I 3Q1QA 4DUYI 1HNZE 1NHHA 4DR4I 2UXDI 4DUZI 3WU6A 3WU5A 4LF4E 1U2RA 4HY1A 4DXLA 4B3ME 4JI5E 1IBKE 4JG4A 4PU9A 3J81Q 3ZZ0A 4LF7E 1K47A 4DR3E 2UXCI 2UU9E 4JI6E 2R3VA 1IBLI 4M1KA 1Z0BA 2UXBI 1OJ4A 1B63A 1H74A 2A2CA 4JI0E 4KHPE 4B3MI 4DR2I
chains in the Genus database with same CATH superfamily
4JI1E 3PYDA 1HNWE 4BA2B 3T1YE 2GS8A 2VQEE 3J81C 4KQVA 4DR5I 1MU5A 3F0NA 2HFSA 2F1DA 1N33E 5LMUE 4LF7I 3CDIA 4LPFA 4DR3I 5K36C 2PNZB 1Z0WA 2UU9I 2E5LI 2WP8A 5FWKA 4IFDA 2Z5EA 4GKKI 3L7ZA 4NXNI 4HACA 2LJPA 3M85G 2WNRB 4MYUA 2C39B 4MU3A 1XNQE 1UDQA 4B3SE 1ZXMA 4AIDA 2GO3A 4LF8E 1Z0VA 4FW5A 3H1CA 2JE6B 4YY3E 2VQFI 4LFAE 4OO1A 4LF9E 1Y4UA 4B3RE 1HNWI 4NXME 2HKJA 2PO1B 4UTGA 2F4VE 4OX9E 3V5RA 2UUCI 1H72C 5FLXQ 4DPXA 1D6TA 1N33I 5LMUI 1A6FA 2PO0B 4GQUA 1Z5BA 3PYFA 3HJCA 4N3OA 4DUYE 3QT5A 2XEXA 4DR4E 4FW6A 3ZKBA 4P52A 3K85A 3D4JA 4LF8I 4DUZE 1S16A 4K0KI 1Z5AA 2O1VA 1FJGI 4LF9I 2NN6B 1BKNA 3P3GA 4FW4A 5FLXC 2BR2A 5DNLA 2IOPA 4HXZA 3GONA 2GQ0A 2JEBA 1USVA 1Z5CA 4DV6I 1HK7A 1NHJA 4DV7I 4LFCI 4WUDA 5K36D 4X64I 1ZM4A 3NZKA 2HK2A 2BA1G 2HK3A 1I94E 4JI4E 4DU7A 2UXCE 1H7UA 3QT8A 4BA1B 2WW4A 2A2DA 1IBLE 4JI7E 5DROA 4DR6E 2UXBE 2NN6F 5C0XD 4DPTA 2HFUA 5JEAD 2OI2A 5GMEA 4FW3A 3PYEA 4DR2E 1NZ0A 4LOMA 1KIJA 4DR5E 4MQYA 1QZRA 2WP8B 4URLA 2UUAE 4IFDB 1VISA 3L7ZB 3M7ND 1I94I 4JI4I 1OYRA 1E3HA 2E5LE 1KVKA 2ZITA 4JI7I 3Q6NA 4GKKE 4NXNE 4DR6I 4FW9A 4Z7CA 4JI8E 4OO1B 3QT7A 4NBQA 4DV2I 4IZKA 3GMEA 4GKJI 4LF5E 3T1HI 4B3TE 2DEIA 2VQFE 5IT9Q 2NN6C 2AJ4A 3PS3A 3V2UC 4IFDF 3PS1A 2UUCE 3HULA 2V2ZA 4LCHA 1FWKA 2UUAI 4DV1I 4X65I 2GO4A 5DRQA 1N32I 5C0XA 5JEAA 4DV3E 2PNLA 4OO1F 4DPYA 3QT6A 4P7AA 4JI8I 3ZM7A 4JV5E 2ZM6I 4ISAA 4LF5I 1WUUA 1HNXE 4B3TI 4K0KE 1FJGE 2BR2B 5IT9C 4DV5I 3ZZUA 3B8HA 3P3CA 4DR7I 2BA0D 2J65A 1UDNA 1HR0I 5LMNE 4JYAI 4AIMA 4DV6E 4DV7E 4LFCE 3M7NG 4LFBI 4DV3I 4X64E 4IFDC 3WU4A 1N0VC 3U1YA 3LNUA 4JV5I 4IZJD 3P3EA 5DNXA 4YHHI 1XXEA 1R6LA 4FWDA 1HNXI 2R42A 2JEAA 5K36E 4OO1C 2NPFA 1YHCA 4UT4A 4QNKA 1PIEA 4USKA 2NN6D 4DR1I 1R6MA 1KTVA 1ELOA 5LMNI 1N34I 5DRPA 2O1UA 5C0XE 4MYTA 5JEAE 1ZM2A 2UUBI 3K1JA 3UHMA 3J80Q 3PS2A 2E1RA 4WUBA 5IWAI 4AM3A 1Z0TA 1PVGA 1S4EA 2HHHE 3PRYA 1B62A 4MDTA 1DARA 4IZKB 2HKEA 2X7IA 5DRRA 3B4TA 4DV4E 3HKMA 2V2QA 1XNRI 2VESA 5EKWA 4LF6E 4DV2E 4GKJE 1J5EI 1VI7A 3T1HE 4PRVA 5L3JA 4X66I 4ZVIA 2CG9A 2CZ9A 2BA0G 2AE8A 2PO2A 3OTOI 1FWLA 4OZEA 3H4LA 2X36A 4FN5A 1PKPA 2Z5BA 5C0XB 1FI4A 3J80C 1N36I 5BR8E 1FNMA 3M85D 4IZJA 4I3HA 4DV1E 4JI2I 4X65E 1N0UA 4HACB 1MG7A 1N32E 3CDJA 1ZXNA 4IFDD 1XMOE 1EI1A 2HHHI 4Z7YA 1ZM3A 2Z5CA 1IBME 2BM1A 4DV4I 2J7KA 2ZM6E 1RHYA 4U3DA 2CGEA 1XMQI 4LF6I 4OO1D 4AQYI 1XHKA 4DV5E 4EMDA 4DV0E 1KKHA 1H7SA 1Z0GA 3LPSA 1HNZI 2PNMA 4U3BA 5C0XF 4DU8A 5K36A 3CWVA 4DR7E 4JI3E 1FKAE 4LCFA 5BR8I 1HR0E 4JYAE 2IERA 2C37A 4LF4I 1Y6ZA 4LFBE 2BV3A 1XMOI 1UEKA 3PYGA 1IBMI 2JEAB 4JI5I 2Q2EB 2EFGA 3K17A 3J7AM 4MU0A 1IBKI 4YHHE 1P42A 4XTJA 1RR9A 2V34A 1NHIA 2O1TA 4DV0I 4OKGA 2JEBB 1OYPA 4JI3I 2ZBKB 3ZKDA 4JI6I 2VF3A 3LTOA 4DR1E 2BA1D 1N34E 3B78A 3ZZTA 4J3DA 1Z0CA 1ZM9A 2UUBE 3B82A 3KRNA 4JI0I 5C0XC 5JEAC 4USMA 4R1FA 3GCMA 1RREA 4KHPI 3J7AG 2NN6E 5IWAE 2C38A 4JI1I 3JAMQ 4WUCA 3T1YI 2VQEI 2DEJA 2V2VA 2BM0A 4BA2A 1XNRE 4PRXA 5A2QQ 2PO2B 1J5EE 4X66E 1YH8A 4X62E 3Q6MA 2Z5BB 4MU4A 2O3ZA 1Y5YA 4IZJB 3OTOE 4FWHA 2PNZA 5GMDA 1Z0EA 1OYSA 1EA6A 1Z59A 3WU3A 4DPWA 1XNQI 1N36E 1H73A 4B3SI 2UXDE 4JI2E 1USUA 3JAMC 2Z5CB 2WNRA 3P06A 4DPUA 4YY3I 4LFAI 4FWGA 2C39A 1UDSA 4B3RI 3M6AA 2IOQA 5LL6R 4NXMI 4RPFA 2JE6A 2F4VI 4HYMA 4OX9I 5A2QC 4MU1A 1Y4SA 2V8PA 1XMQE 2PO1A 3GLLA 5K36B 1MX0A 4AQYE 4ED4A 4IFDE 4X62I 3Q1QA 4DUYI 1HNZE 1NHHA 2PO0A 1UDOA 4DR4I 4IS9A 2C37B 5JEAB 3U1KA 4OO1E 2CVEA 4DUZI 2UXDI 2O1WA 3WU6A 3WU5A 4LF4E 2JT2A 4LCGA 1U2RA 4HY1A 4DXLA 4B3ME 4JI5E 5K36F 3P76A 2NN6A 5ELWA 1IBKE 2IESA 4JG4A 4PU9A 3J81Q 4FW7A 3ZZ0A 1E3PA 4LF7E 5EL9A 1K47A 4DR3E 5JEAF 2UXCI 2UU9E 4JI6E 2R3VA 1IBLI 4M1KA 4QNJA 1Z0BA 2UXBI 1OJ4A 1B63A 4BA1A 1H74A 2A2CA 2C38B 4JI0E 3DD6A 1Y60A 4KHPE 4B3MI 4DR2I
chains in the Genus database with same CATH topology
4JI1E 3PYDA 1HNWE 3T1YE 2GS8A 2VQEE 3J81C 4KQVA 4DR5I 1MU5A 3F0NA 2HFSA 1N33E 5LMUE 4LF7I 4DR3I 1Z0WA 2UU9I 2E5LI 5FWKA 2Z5EA 4GKKI 4NXNI 4HACA 2LJPA 4MYUA 1XNQE 4B3SE 1ZXMA 4LF8E 1Z0VA 4YY3E 2VQFI 4LFAE 4LF9E 1Y4UA 4B3RE 1HNWI 4NXME 2HKJA 4UTGA 2F4VE 4OX9E 3V5RA 2UUCI 1H72C 5FLXQ 4DPXA 1D6TA 1N33I 5LMUI 1A6FA 1Z5BA 3PYFA 3HJCA 4N3OA 4DUYE 3QT5A 2XEXA 4DR4E 3ZKBA 4P52A 3K85A 3D4JA 4LF8I 4DUZE 1S16A 4K0KI 1Z5AA 2O1VA 1FJGI 4LF9I 1BKNA 5FLXC 2IOPA 4HXZA 3GONA 2GQ0A 1USVA 1Z5CA 4DV6I 1HK7A 1NHJA 4DV7I 4LFCI 4WUDA 4X64I 1ZM4A 2HK2A 2HK3A 1I94E 4JI4E 4DU7A 2UXCE 1H7UA 3QT8A 2WW4A 2A2DA 1IBLE 4JI7E 4DR6E 2UXBE 4DPTA 2HFUA 2OI2A 5GMEA 3PYEA 4DR2E 1NZ0A 1KIJA 4DR5E 1QZRA 4URLA 2UUAE 1VISA 1I94I 4JI4I 2E5LE 1KVKA 2ZITA 4JI7I 3Q6NA 4GKKE 4NXNE 4DR6I 4FW9A 4Z7CA 4JI8E 3QT7A 4DV2I 4IZKA 4GKJI 4LF5E 3T1HI 4B3TE 2DEIA 2VQFE 5IT9Q 2AJ4A 3V2UC 2UUCE 3HULA 2V2ZA 1FWKA 2UUAI 4DV1I 4X65I 1N32I 4DV3E 2PNLA 4DPYA 3QT6A 4P7AA 4JI8I 3ZM7A 4JV5E 2ZM6I 4LF5I 1WUUA 1HNXE 4B3TI 4K0KE 1FJGE 5IT9C 4DV5I 3ZZUA 3B8HA 4DR7I 1HR0I 5LMNE 4JYAI 4DV6E 4DV7E 4LFCE 4LFBI 4DV3I 4X64E 3WU4A 1N0VC 3LNUA 4JV5I 4IZJD 4YHHI 4FWDA 1HNXI 2R42A 2NPFA 4UT4A 1PIEA 4USKA 4DR1I 1KTVA 1ELOA 5LMNI 1N34I 2O1UA 4MYTA 1ZM2A 2UUBI 3K1JA 3J80Q 2E1RA 4WUBA 5IWAI 1Z0TA 1PVGA 1S4EA 2HHHE 3PRYA 1B62A 1DARA 4IZKB 2HKEA 2X7IA 4DV4E 2V2QA 1XNRI 4LF6E 4DV2E 4GKJE 1J5EI 3T1HE 4PRVA 5L3JA 4X66I 4ZVIA 2CG9A 2CZ9A 3OTOI 1FWLA 3H4LA 2X36A 4FN5A 1PKPA 2Z5BA 1FI4A 3J80C 1N36I 5BR8E 1FNMA 4IZJA 4I3HA 4DV1E 4JI2I 4X65E 1N0UA 4HACB 1MG7A 1N32E 1ZXNA 1XMOE 1EI1A 2HHHI 4Z7YA 1ZM3A 2Z5CA 1IBME 2BM1A 4DV4I 2J7KA 2ZM6E 2CGEA 1XMQI 4LF6I 4AQYI 1XHKA 4DV5E 4EMDA 4DV0E 1KKHA 1H7SA 1Z0GA 3LPSA 1HNZI 2PNMA 4DU8A 3CWVA 4DR7E 4JI3E 1FKAE 5BR8I 1HR0E 4JYAE 4LF4I 1Y6ZA 4LFBE 2BV3A 1XMOI 1UEKA 3PYGA 1IBMI 4JI5I 2Q2EB 2EFGA 3K17A 3J7AM 1IBKI 4YHHE 4XTJA 1RR9A 2V34A 1NHIA 2O1TA 4DV0I 4JI3I 2ZBKB 3ZKDA 4JI6I 2VF3A 3LTOA 4DR1E 1N34E 3B78A 3ZZTA 1Z0CA 1ZM9A 2UUBE 3B82A 4JI0I 4USMA 4R1FA 1RREA 4KHPI 3J7AG 5IWAE 4JI1I 3JAMQ 4WUCA 3T1YI 2VQEI 2DEJA 2V2VA 2BM0A 1XNRE 4PRXA 5A2QQ 1J5EE 4X66E 4X62E 3Q6MA 2Z5BB 4IZJB 3OTOE 4FWHA 5GMDA 1Z59A 1Z0EA 1EA6A 3WU3A 4DPWA 1XNQI 1N36E 1H73A 4B3SI 2UXDE 4JI2E 1USUA 3JAMC 2Z5CB 3P06A 4DPUA 4YY3I 4LFAI 4FWGA 4B3RI 3M6AA 2IOQA 5LL6R 4NXMI 4RPFA 2F4VI 4HYMA 4OX9I 5A2QC 1Y4SA 2V8PA 1XMQE 1MX0A 4AQYE 4ED4A 4X62I 3Q1QA 4DUYI 1HNZE 1NHHA 4DR4I 2UXDI 4DUZI 2O1WA 3WU6A 3WU5A 4LF4E 1U2RA 4HY1A 4DXLA 4B3ME 4JI5E 1IBKE 4JG4A 4PU9A 3J81Q 3ZZ0A 4LF7E 1K47A 4DR3E 2UXCI 2UU9E 4JI6E 2R3VA 1IBLI 4M1KA 1Z0BA 2UXBI 1OJ4A 1B63A 1H74A 2A2CA 4JI0E 4KHPE 4B3MI 4DR2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 E;  3PYD A;  1HNW E;  3T1Y E;  2GS8 A;  2VQE E;  3J81 C;  4KQV A;  4DR5 I;  1MU5 A;  3F0N A;  2HFS A;  1N33 E;  5LMU E;  4LF7 I;  4DR3 I;  1Z0W A;  2UU9 I;  2E5L I;  4GKK I;  4NXN I;  4HAC A;  2LJP A;  4MYU A;  1XNQ E;  4B3S E;  1ZXM A;  4LF8 E;  1Z0V A;  4YY3 E;  2VQF I;  4LFA E;  4LF9 E;  4B3R E;  1HNW I;  4NXM E;  2HKJ A;  4UTG A;  2F4V E;  4OX9 E;  3V5R A;  2UUC I;  1H72 C;  5FLX Q;  4DPX A;  1D6T A;  1N33 I;  5LMU I;  1A6F A;  1Z5B A;  3PYF A;  4DUY E;  3QT5 A;  2XEX A;  4DR4 E;  3ZKB A;  4P52 A;  3D4J A;  4LF8 I;  4DUZ E;  1S16 A;  4K0K I;  1Z5A A;  1FJG I;  4LF9 I;  1BKN A;  5FLX C;  4HXZ A;  3GON A;  1Z5C A;  4DV6 I;  1NHJ A;  4DV7 I;  4LFC I;  4WUD A;  4X64 I;  1ZM4 A;  2HK2 A;  2HK3 A;  1I94 E;  4JI4 E;  4DU7 A;  2UXC E;  1H7U A;  3QT8 A;  2WW4 A;  2A2D A;  1IBL E;  4JI7 E;  4DR6 E;  2UXB E;  4DPT A;  2HFU A;  2OI2 A;  5GME A;  3PYE A;  4DR2 E;  1NZ0 A;  1KIJ A;  4DR5 E;  1QZR A;  4URL A;  2UUA E;  1VIS A;  1I94 I;  4JI4 I;  2E5L E;  1KVK A;  2ZIT A;  4JI7 I;  4GKK E;  4NXN E;  4DR6 I;  4FW9 A;  4Z7C A;  4JI8 E;  3QT7 A;  4DV2 I;  4GKJ I;  4LF5 E;  3T1H I;  4B3T E;  2DEI A;  2VQF E;  5IT9 Q;  2AJ4 A;  3V2U C;  2UUC E;  3HUL A;  2V2Z A;  1FWK A;  2UUA I;  4DV1 I;  4X65 I;  1N32 I;  4DV3 E;  4DPY A;  3QT6 A;  4P7A A;  4JI8 I;  3ZM7 A;  4JV5 E;  2ZM6 I;  4LF5 I;  1WUU A;  1HNX E;  4B3T I;  4K0K E;  1FJG E;  5IT9 C;  4DV5 I;  3ZZU A;  3B8H A;  4DR7 I;  1HR0 I;  5LMN E;  4JYA I;  4DV6 E;  4DV7 E;  4LFC E;  4LFB I;  4DV3 I;  4X64 E;  3WU4 A;  1N0V C;  3LNU A;  4JV5 I;  4YHH I;  4FWD A;  1HNX I;  2R42 A;  2NPF A;  4UT4 A;  1PIE A;  4USK A;  4DR1 I;  1KTV A;  1ELO A;  5LMN I;  1N34 I;  4MYT A;  1ZM2 A;  2UUB I;  3K1J A;  3J80 Q;  2E1R A;  4WUB A;  5IWA I;  1Z0T A;  1PVG A;  1S4E A;  2HHH E;  1B62 A;  1DAR A;  2HKE A;  2X7I A;  4DV4 E;  2V2Q A;  1XNR I;  4LF6 E;  4DV2 E;  4GKJ E;  1J5E I;  3T1H E;  4PRV A;  5L3J A;  4X66 I;  4ZVI A;  2CZ9 A;  3OTO I;  1FWL A;  3H4L A;  2X36 A;  4FN5 A;  1PKP A;  1FI4 A;  3J80 C;  1N36 I;  5BR8 E;  1FNM A;  4I3H A;  4DV1 E;  4JI2 I;  4X65 E;  1N0U A;  4HAC B;  1MG7 A;  1N32 E;  1ZXN A;  1XMO E;  1EI1 A;  2HHH I;  4Z7Y A;  1ZM3 A;  1IBM E;  2BM1 A;  4DV4 I;  2J7K A;  2ZM6 E;  1XMQ I;  4LF6 I;  4AQY I;  1XHK A;  4DV5 E;  4EMD A;  4DV0 E;  1KKH A;  1H7S A;  1Z0G A;  3LPS A;  1HNZ I;  4DU8 A;  3CWV A;  4DR7 E;  4JI3 E;  1FKA E;  5BR8 I;  1HR0 E;  4JYA E;  4LF4 I;  4LFB E;  2BV3 A;  1XMO I;  1UEK A;  3PYG A;  1IBM I;  4JI5 I;  2Q2E B;  2EFG A;  3K17 A;  3J7A M;  1IBK I;  4YHH E;  4XTJ A;  1RR9 A;  2V34 A;  1NHI A;  4DV0 I;  4JI3 I;  2ZBK B;  3ZKD A;  4JI6 I;  2VF3 A;  3LTO A;  4DR1 E;  1N34 E;  3B78 A;  3ZZT A;  1Z0C A;  1ZM9 A;  2UUB E;  3B82 A;  4JI0 I;  4USM A;  4R1F A;  1RRE A;  4KHP I;  3J7A G;  5IWA E;  4JI1 I;  3JAM Q;  4WUC A;  3T1Y I;  2VQE I;  2DEJ A;  2V2V A;  2BM0 A;  1XNR E;  4PRX A;  5A2Q Q;  1J5E E;  4X66 E;  4X62 E;  3OTO E;  4FWH A;  5GMD A;  1Z59 A;  1Z0E A;  1EA6 A;  3WU3 A;  4DPW A;  1XNQ I;  1N36 E;  1H73 A;  4B3S I;  2UXD E;  4JI2 E;  3JAM C;  4YY3 I;  4DPU A;  4LFA I;  4FWG A;  4B3R I;  3M6A A;  5LL6 R;  4NXM I;  4RPF A;  2F4V I;  4HYM A;  4OX9 I;  5A2Q C;  2V8P A;  1XMQ E;  1MX0 A;  4AQY E;  4ED4 A;  4X62 I;  3Q1Q A;  4DUY I;  1HNZ E;  1NHH A;  4DR4 I;  2UXD I;  4DUZ I;  3WU6 A;  3WU5 A;  4LF4 E;  1U2R A;  4HY1 A;  4DXL A;  4B3M E;  4JI5 E;  1IBK E;  4JG4 A;  4PU9 A;  3J81 Q;  3ZZ0 A;  4LF7 E;  1K47 A;  4DR3 E;  2UXC I;  2UU9 E;  4JI6 E;  2R3V A;  1IBL I;  4M1K A;  1Z0B A;  2UXB I;  1OJ4 A;  1B63 A;  1H74 A;  2A2C A;  4JI0 E;  4KHP E;  4B3M I;  4DR2 I; 
#chains in the Genus database with same CATH topology
 4JI1 E;  3PYD A;  1HNW E;  4BA2 B;  3T1Y E;  2GS8 A;  2VQE E;  3J81 C;  4KQV A;  4DR5 I;  1MU5 A;  3F0N A;  2HFS A;  2F1D A;  1N33 E;  5LMU E;  4LF7 I;  3CDI A;  4LPF A;  4DR3 I;  5K36 C;  2PNZ B;  1Z0W A;  2UU9 I;  2E5L I;  2WP8 A;  5FWK A;  4IFD A;  2Z5E A;  4GKK I;  3L7Z A;  4NXN I;  4HAC A;  2LJP A;  3M85 G;  2WNR B;  4MYU A;  2C39 B;  4MU3 A;  1XNQ E;  1UDQ A;  4B3S E;  1ZXM A;  4AID A;  2GO3 A;  4LF8 E;  1Z0V A;  4FW5 A;  3H1C A;  2JE6 B;  4YY3 E;  2VQF I;  4LFA E;  4OO1 A;  4LF9 E;  1Y4U A;  4B3R E;  1HNW I;  4NXM E;  2HKJ A;  2PO1 B;  4UTG A;  2F4V E;  4OX9 E;  3V5R A;  2UUC I;  1H72 C;  5FLX Q;  4DPX A;  1D6T A;  1N33 I;  5LMU I;  1A6F A;  2PO0 B;  4GQU A;  1Z5B A;  3PYF A;  3HJC A;  4N3O A;  4DUY E;  3QT5 A;  2XEX A;  4DR4 E;  4FW6 A;  3ZKB A;  4P52 A;  3K85 A;  3D4J A;  4LF8 I;  4DUZ E;  1S16 A;  4K0K I;  1Z5A A;  2O1V A;  1FJG I;  4LF9 I;  2NN6 B;  1BKN A;  3P3G A;  4FW4 A;  5FLX C;  2BR2 A;  5DNL A;  2IOP A;  4HXZ A;  3GON A;  2GQ0 A;  2JEB A;  1USV A;  1Z5C A;  4DV6 I;  1HK7 A;  1NHJ A;  4DV7 I;  4LFC I;  4WUD A;  5K36 D;  4X64 I;  1ZM4 A;  3NZK A;  2HK2 A;  2BA1 G;  2HK3 A;  1I94 E;  4JI4 E;  4DU7 A;  2UXC E;  1H7U A;  3QT8 A;  4BA1 B;  2WW4 A;  2A2D A;  1IBL E;  4JI7 E;  5DRO A;  4DR6 E;  2UXB E;  2NN6 F;  5C0X D;  4DPT A;  2HFU A;  5JEA D;  2OI2 A;  5GME A;  4FW3 A;  3PYE A;  4DR2 E;  1NZ0 A;  4LOM A;  1KIJ A;  4DR5 E;  4MQY A;  1QZR A;  2WP8 B;  4URL A;  2UUA E;  4IFD B;  1VIS A;  3L7Z B;  3M7N D;  1I94 I;  4JI4 I;  1OYR A;  1E3H A;  2E5L E;  1KVK A;  2ZIT A;  4JI7 I;  3Q6N A;  4GKK E;  4NXN E;  4DR6 I;  4FW9 A;  4Z7C A;  4JI8 E;  4OO1 B;  3QT7 A;  4NBQ A;  4DV2 I;  4IZK A;  3GME A;  4GKJ I;  4LF5 E;  3T1H I;  4B3T E;  2DEI A;  2VQF E;  5IT9 Q;  2NN6 C;  2AJ4 A;  3PS3 A;  3V2U C;  4IFD F;  3PS1 A;  2UUC E;  3HUL A;  2V2Z A;  4LCH A;  1FWK A;  2UUA I;  4DV1 I;  4X65 I;  2GO4 A;  5DRQ A;  1N32 I;  5C0X A;  5JEA A;  4DV3 E;  2PNL A;  4OO1 F;  4DPY A;  3QT6 A;  4P7A A;  4JI8 I;  3ZM7 A;  4JV5 E;  2ZM6 I;  4ISA A;  4LF5 I;  1WUU A;  1HNX E;  4B3T I;  4K0K E;  1FJG E;  2BR2 B;  5IT9 C;  4DV5 I;  3ZZU A;  3B8H A;  3P3C A;  4DR7 I;  2BA0 D;  2J65 A;  1UDN A;  1HR0 I;  5LMN E;  4JYA I;  4AIM A;  4DV6 E;  4DV7 E;  4LFC E;  3M7N G;  4LFB I;  4DV3 I;  4X64 E;  4IFD C;  3WU4 A;  1N0V C;  3U1Y A;  3LNU A;  4JV5 I;  4IZJ D;  3P3E A;  5DNX A;  4YHH I;  1XXE A;  1R6L A;  4FWD A;  1HNX I;  2R42 A;  2JEA A;  5K36 E;  4OO1 C;  2NPF A;  1YHC A;  4UT4 A;  4QNK A;  1PIE A;  4USK A;  2NN6 D;  4DR1 I;  1R6M A;  1KTV A;  1ELO A;  5LMN I;  1N34 I;  5DRP A;  2O1U A;  5C0X E;  4MYT A;  5JEA E;  1ZM2 A;  2UUB I;  3K1J A;  3UHM A;  3J80 Q;  3PS2 A;  2E1R A;  4WUB A;  5IWA I;  4AM3 A;  1Z0T A;  1PVG A;  1S4E A;  2HHH E;  3PRY A;  1B62 A;  4MDT A;  1DAR A;  4IZK B;  2HKE A;  2X7I A;  5DRR A;  3B4T A;  4DV4 E;  3HKM A;  2V2Q A;  1XNR I;  2VES A;  5EKW A;  4LF6 E;  4DV2 E;  4GKJ E;  1J5E I;  1VI7 A;  3T1H E;  4PRV A;  5L3J A;  4X66 I;  4ZVI A;  2CG9 A;  2CZ9 A;  2BA0 G;  2AE8 A;  2PO2 A;  3OTO I;  1FWL A;  4OZE A;  3H4L A;  2X36 A;  4FN5 A;  1PKP A;  2Z5B A;  5C0X B;  1FI4 A;  3J80 C;  1N36 I;  5BR8 E;  1FNM A;  3M85 D;  4IZJ A;  4I3H A;  4DV1 E;  4JI2 I;  4X65 E;  1N0U A;  4HAC B;  1MG7 A;  1N32 E;  3CDJ A;  1ZXN A;  4IFD D;  1XMO E;  1EI1 A;  2HHH I;  4Z7Y A;  1ZM3 A;  2Z5C A;  1IBM E;  2BM1 A;  4DV4 I;  2J7K A;  2ZM6 E;  1RHY A;  4U3D A;  2CGE A;  1XMQ I;  4LF6 I;  4OO1 D;  4AQY I;  1XHK A;  4DV5 E;  4EMD A;  4DV0 E;  1KKH A;  1H7S A;  1Z0G A;  3LPS A;  1HNZ I;  2PNM A;  4U3B A;  5C0X F;  4DU8 A;  5K36 A;  3CWV A;  4DR7 E;  4JI3 E;  1FKA E;  4LCF A;  5BR8 I;  1HR0 E;  4JYA E;  2IER A;  2C37 A;  4LF4 I;  1Y6Z A;  4LFB E;  2BV3 A;  1XMO I;  1UEK A;  3PYG A;  1IBM I;  2JEA B;  4JI5 I;  2Q2E B;  2EFG A;  3K17 A;  3J7A M;  4MU0 A;  1IBK I;  4YHH E;  1P42 A;  4XTJ A;  1RR9 A;  2V34 A;  1NHI A;  2O1T A;  4DV0 I;  4OKG A;  2JEB B;  1OYP A;  4JI3 I;  2ZBK B;  3ZKD A;  4JI6 I;  2VF3 A;  3LTO A;  4DR1 E;  2BA1 D;  1N34 E;  3B78 A;  3ZZT A;  4J3D A;  1Z0C A;  1ZM9 A;  2UUB E;  3B82 A;  3KRN A;  4JI0 I;  5C0X C;  5JEA C;  4USM A;  4R1F A;  3GCM A;  1RRE A;  4KHP I;  3J7A G;  2NN6 E;  5IWA E;  2C38 A;  4JI1 I;  3JAM Q;  4WUC A;  3T1Y I;  2VQE I;  2DEJ A;  2V2V A;  2BM0 A;  4BA2 A;  1XNR E;  4PRX A;  5A2Q Q;  2PO2 B;  1J5E E;  4X66 E;  1YH8 A;  4X62 E;  3Q6M A;  2Z5B B;  4MU4 A;  2O3Z A;  1Y5Y A;  4IZJ B;  3OTO E;  4FWH A;  2PNZ A;  5GMD A;  1Z0E A;  1OYS A;  1EA6 A;  1Z59 A;  3WU3 A;  4DPW A;  1XNQ I;  1N36 E;  1H73 A;  4B3S I;  2UXD E;  4JI2 E;  1USU A;  3JAM C;  2Z5C B;  2WNR A;  3P06 A;  4DPU A;  4YY3 I;  4LFA I;  4FWG A;  2C39 A;  1UDS A;  4B3R I;  3M6A A;  2IOQ A;  5LL6 R;  4NXM I;  4RPF A;  2JE6 A;  2F4V I;  4HYM A;  4OX9 I;  5A2Q C;  4MU1 A;  1Y4S A;  2V8P A;  1XMQ E;  2PO1 A;  3GLL A;  5K36 B;  1MX0 A;  4AQY E;  4ED4 A;  4IFD E;  4X62 I;  3Q1Q A;  4DUY I;  1HNZ E;  1NHH A;  2PO0 A;  1UDO A;  4DR4 I;  4IS9 A;  2C37 B;  5JEA B;  3U1K A;  4OO1 E;  2CVE A;  4DUZ I;  2UXD I;  2O1W A;  3WU6 A;  3WU5 A;  4LF4 E;  2JT2 A;  4LCG A;  1U2R A;  4HY1 A;  4DXL A;  4B3M E;  4JI5 E;  5K36 F;  3P76 A;  2NN6 A;  5ELW A;  1IBK E;  2IES A;  4JG4 A;  4PU9 A;  3J81 Q;  4FW7 A;  3ZZ0 A;  1E3P A;  4LF7 E;  5EL9 A;  1K47 A;  4DR3 E;  5JEA F;  2UXC I;  2UU9 E;  4JI6 E;  2R3V A;  1IBL I;  4M1K A;  4QNJ A;  1Z0B A;  2UXB I;  1OJ4 A;  1B63 A;  4BA1 A;  1H74 A;  2A2C A;  2C38 B;  4JI0 E;  3DD6 A;  1Y60 A;  4KHP E;  4B3M I;  4DR2 I; 
#chains in the Genus database with same CATH homology
 4JI1 E;  3PYD A;  1HNW E;  3T1Y E;  2GS8 A;  2VQE E;  3J81 C;  4KQV A;  4DR5 I;  1MU5 A;  3F0N A;  2HFS A;  1N33 E;  5LMU E;  4LF7 I;  4DR3 I;  1Z0W A;  2UU9 I;  2E5L I;  5FWK A;  2Z5E A;  4GKK I;  4NXN I;  4HAC A;  2LJP A;  4MYU A;  1XNQ E;  4B3S E;  1ZXM A;  4LF8 E;  1Z0V A;  4YY3 E;  2VQF I;  4LFA E;  4LF9 E;  1Y4U A;  4B3R E;  1HNW I;  4NXM E;  2HKJ A;  4UTG A;  2F4V E;  4OX9 E;  3V5R A;  2UUC I;  1H72 C;  5FLX Q;  4DPX A;  1D6T A;  1N33 I;  5LMU I;  1A6F A;  1Z5B A;  3PYF A;  3HJC A;  4N3O A;  4DUY E;  3QT5 A;  2XEX A;  4DR4 E;  3ZKB A;  4P52 A;  3K85 A;  3D4J A;  4LF8 I;  4DUZ E;  1S16 A;  4K0K I;  1Z5A A;  2O1V A;  1FJG I;  4LF9 I;  1BKN A;  5FLX C;  2IOP A;  4HXZ A;  3GON A;  2GQ0 A;  1USV A;  1Z5C A;  4DV6 I;  1HK7 A;  1NHJ A;  4DV7 I;  4LFC I;  4WUD A;  4X64 I;  1ZM4 A;  2HK2 A;  2HK3 A;  1I94 E;  4JI4 E;  4DU7 A;  2UXC E;  1H7U A;  3QT8 A;  2WW4 A;  2A2D A;  1IBL E;  4JI7 E;  4DR6 E;  2UXB E;  4DPT A;  2HFU A;  2OI2 A;  5GME A;  3PYE A;  4DR2 E;  1NZ0 A;  1KIJ A;  4DR5 E;  1QZR A;  4URL A;  2UUA E;  1VIS A;  1I94 I;  4JI4 I;  2E5L E;  1KVK A;  2ZIT A;  4JI7 I;  3Q6N A;  4GKK E;  4NXN E;  4DR6 I;  4FW9 A;  4Z7C A;  4JI8 E;  3QT7 A;  4DV2 I;  4IZK A;  4GKJ I;  4LF5 E;  3T1H I;  4B3T E;  2DEI A;  2VQF E;  5IT9 Q;  2AJ4 A;  3V2U C;  2UUC E;  3HUL A;  2V2Z A;  1FWK A;  2UUA I;  4DV1 I;  4X65 I;  1N32 I;  4DV3 E;  2PNL A;  4DPY A;  3QT6 A;  4P7A A;  4JI8 I;  3ZM7 A;  4JV5 E;  2ZM6 I;  4LF5 I;  1WUU A;  1HNX E;  4B3T I;  4K0K E;  1FJG E;  5IT9 C;  4DV5 I;  3ZZU A;  3B8H A;  4DR7 I;  1HR0 I;  5LMN E;  4JYA I;  4DV6 E;  4DV7 E;  4LFC E;  4LFB I;  4DV3 I;  4X64 E;  3WU4 A;  1N0V C;  3LNU A;  4JV5 I;  4IZJ D;  4YHH I;  4FWD A;  1HNX I;  2R42 A;  2NPF A;  4UT4 A;  1PIE A;  4USK A;  4DR1 I;  1KTV A;  1ELO A;  5LMN I;  1N34 I;  2O1U A;  4MYT A;  1ZM2 A;  2UUB I;  3K1J A;  3J80 Q;  2E1R A;  4WUB A;  5IWA I;  1Z0T A;  1PVG A;  1S4E A;  2HHH E;  3PRY A;  1B62 A;  1DAR A;  4IZK B;  2HKE A;  2X7I A;  4DV4 E;  2V2Q A;  1XNR I;  4LF6 E;  4DV2 E;  4GKJ E;  1J5E I;  3T1H E;  4PRV A;  5L3J A;  4X66 I;  4ZVI A;  2CG9 A;  2CZ9 A;  3OTO I;  1FWL A;  3H4L A;  2X36 A;  4FN5 A;  1PKP A;  2Z5B A;  1FI4 A;  3J80 C;  1N36 I;  5BR8 E;  1FNM A;  4IZJ A;  4I3H A;  4DV1 E;  4JI2 I;  4X65 E;  1N0U A;  4HAC B;  1MG7 A;  1N32 E;  1ZXN A;  1XMO E;  1EI1 A;  2HHH I;  4Z7Y A;  1ZM3 A;  2Z5C A;  1IBM E;  2BM1 A;  4DV4 I;  2J7K A;  2ZM6 E;  2CGE A;  1XMQ I;  4LF6 I;  4AQY I;  1XHK A;  4DV5 E;  4EMD A;  4DV0 E;  1KKH A;  1H7S A;  1Z0G A;  3LPS A;  1HNZ I;  2PNM A;  4DU8 A;  3CWV A;  4DR7 E;  4JI3 E;  1FKA E;  5BR8 I;  1HR0 E;  4JYA E;  4LF4 I;  1Y6Z A;  4LFB E;  2BV3 A;  1XMO I;  1UEK A;  3PYG A;  1IBM I;  4JI5 I;  2Q2E B;  2EFG A;  3K17 A;  3J7A M;  1IBK I;  4YHH E;  4XTJ A;  1RR9 A;  2V34 A;  1NHI A;  2O1T A;  4DV0 I;  4JI3 I;  2ZBK B;  3ZKD A;  4JI6 I;  2VF3 A;  3LTO A;  4DR1 E;  1N34 E;  3B78 A;  3ZZT A;  1Z0C A;  1ZM9 A;  2UUB E;  3B82 A;  4JI0 I;  4USM A;  4R1F A;  1RRE A;  4KHP I;  3J7A G;  5IWA E;  4JI1 I;  3JAM Q;  4WUC A;  3T1Y I;  2VQE I;  2DEJ A;  2V2V A;  2BM0 A;  1XNR E;  4PRX A;  5A2Q Q;  1J5E E;  4X66 E;  4X62 E;  3Q6M A;  2Z5B B;  4IZJ B;  3OTO E;  4FWH A;  5GMD A;  1Z59 A;  1Z0E A;  1EA6 A;  3WU3 A;  4DPW A;  1XNQ I;  1N36 E;  1H73 A;  4B3S I;  2UXD E;  4JI2 E;  1USU A;  3JAM C;  2Z5C B;  3P06 A;  4DPU A;  4YY3 I;  4LFA I;  4FWG A;  4B3R I;  3M6A A;  2IOQ A;  5LL6 R;  4NXM I;  4RPF A;  2F4V I;  4HYM A;  4OX9 I;  5A2Q C;  1Y4S A;  2V8P A;  1XMQ E;  1MX0 A;  4AQY E;  4ED4 A;  4X62 I;  3Q1Q A;  4DUY I;  1HNZ E;  1NHH A;  4DR4 I;  2UXD I;  4DUZ I;  2O1W A;  3WU6 A;  3WU5 A;  4LF4 E;  1U2R A;  4HY1 A;  4DXL A;  4B3M E;  4JI5 E;  1IBK E;  4JG4 A;  4PU9 A;  3J81 Q;  3ZZ0 A;  4LF7 E;  1K47 A;  4DR3 E;  2UXC I;  2UU9 E;  4JI6 E;  2R3V A;  1IBL I;  4M1K A;  1Z0B A;  2UXB I;  1OJ4 A;  1B63 A;  1H74 A;  2A2C A;  4JI0 E;  4KHP E;  4B3M I;  4DR2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...