1I94I

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94I00
2ZITA 3PYEA 1WUUA 1PVGA 3PYFA 4K0KI 2HK2A 4JI2E 4OX9E 2A2DA 4K0KE 1KVKA 3V5RA 5IWAI 4MYUA 4UTGA 2R42A 3LTOA 2UXCE 1PKPA 2GS8A 1K47A 4DUYE 1EA6A 1XNQI 2UXDE 4B3RE 4JI6E 2ZM6I 4LF5E 4RPFA 1N0VC 5GMEA 1IBME 1KKHA 5LL6R 3F0NA 4LF6I 2J7KA 3J7AG 2E5LE 1FJGI 1Z5BA 3J81C 2HKJA 4NXME 2DEJA 2BV3A 1S4EA 4HACA 4DUZE 1B63A 4GKJI 4DR4I 4DV1I 1ELOA 4X65E 4DXLA 1H7UA 4ED4A 4FWGA 2OI2A 1I94E 4DR2I 4P7AA 2BM1A 3T1YE 4DR2E 2ZBKB 3WU4A 4JV5I 3ZKBA 1HNWE 2X36A 3T1YI 1FWLA 1N33I 1RREA 1FKAE 4JI1E 2NPFA 1IBKE 4KQVA 4DV5I 4DR3E 4DV6I 1H73A 3PYGA 4OX9I 1N36I 1D6TA 1Z0EA 1HNZE 4LFCI 5A2QC 2UXCI 1NZ0A 5LMNE 4DU8A 1N34E 4DV7I 3B82A 4X64E 4I3HA 1Z0GA 4DV0I 1U2RA 2LJPA 4GKKI 2Q2EB 5BR8E 4LFAE 4AQYI 3QT6A 4USKA 2VQEE 4MYTA 1BKNA 2UUBI 4DPYA 1N32E 4Z7CA 4AQYE 4DR1E 3D4JA 2E1RA 4PRVA 3K17A 1IBKI 3OTOE 4HY1A 1NHJA 2UU9E 1XNRE 4WUDA 1KIJA 4DPTA 3T1HI 5FLXQ 1HNXI 4DV2E 4X66E 3ZM7A 3Q1QA 4JI0I 4JI8E 2VQFE 1HR0I 1XMOE 2VQFI 4JI0E 3HULA 1EI1A 1Z5CA 5LMNI 1N0UA 3J80C 2UXBI 4DV0E 2V8PA 4KHPE 4JYAE 1N34I 4YHHI 4UT4A 4KHPI 2HHHE 3CWVA 4LFAI 2E5LI 3ZKDA 3ZZUA 4B3RI 5IT9Q 2A2CA 4WUBA 4WUCA 4JI3I 2HFSA 2UUCE 1N32I 1HNWI 1S16A 4YY3I 4LFBE 1MX0A 4ZVIA 4DV5E 3JAMQ 2UUCI 4NXMI 2UU9I 1XMOI 4GKJE 1Z0CA 4DV1E 2R3VA 2DEIA 3J80Q 4NXNE 4LF7I 3WU3A 3QT7A 1N36E 4FW9A 4B3TE 4NXNI 1XNQE 2UXDI 4DR6I 2HHHI 4R1FA 2WW4A 3H4LA 4DV7E 4DR7I 2ZM6E 4JYAI 1ZM9A 2UUAE 1ZXMA 4LF9I 4LF8I 1ZXNA 4JV5E 5FLXC 4LF5I 4LF9E 4XTJA 1MU5A 1ZM3A 2VF3A 3LNUA 4JI5I 3OTOI 3ZZ0A 1HR0E 1FJGE 4HXZA 4DR4E 2EFGA 4DV2I 4X66I 4X65I 1HNZI 4P52A 1DARA 1FNMA 2BM0A 4X64I 3GONA 1I94I 4DR7E 4DUYI 3J7AM 3JAMC 4X62I 3WU6A 4LFCE 2VQEI 4B3TI 5LMUE 4DPXA 1H72C 4JI7E 1J5EE 1N33E 4YY3E 4B3ME 1H74A 1ZM4A 4PU9A 1Z59A 4DR5I 3T1HE 1ZM2A 1H7SA 4LF8E 4DV4E 5L3JA 4JI4E 1Z0VA 1A6FA 3PYDA 1XHKA 2AJ4A 4LF4E 2F4VE 3QT5A 1OJ4A 4DUZI 4Z7YA 1IBLI 4FWDA 4HACB 1Z0WA 2HFUA 2HKEA 4DPWA 1Z0TA 1KTVA 1Z0BA 1FWKA 4EMDA 4JG4A 1J5EI 4JI7I 4FN5A 4DV3E 1QZRA 3M6AA 3QT8A 3K1JA 4DR5E 4LF6E 4LFBI 4JI4I 4JI1I 5IT9C 2UUAI 3WU5A 4JI6I 4JI5E 4HYMA 2V2QA 4DR3I 4URLA 2CZ9A 1MG7A 4FWHA 1VISA 1Z5AA 1HNXE 4LF4I 1NHIA 2XEXA 4JI8I 4JI2I 1IBLE 1RR9A 4PRXA 2HK3A 3V2UC 2UXBE 5IWAE 3B78A 2V2ZA 4B3SE 4DR6E 4DV3I 3J81Q 5BR8I 5LMUI 4LF7E 2V2VA 4B3SI 1NHHA 2UUBE 1FI4A 4X62E 1UEKA 1PIEA 4GKKE 4YHHE 4JI3E 2V34A 5GMDA 4M1KA 3LPSA 4DR1I 2X7IA 4DPUA 5A2QQ 4DU7A 4B3MI 4USMA 2F4VI 1IBMI 3ZZTA 1B62A 1XMQE 4DV4I 1XNRI 3B8HA 1XMQI 4DV6E
chains in the Genus database with same CATH superfamily
2ZITA 3PYEA 1WUUA 2J65A 1PVGA 5K36C 4U3BA 3PYFA 4K0KI 2HK2A 2JT2A 1Y6ZA 4JI2E 4OX9E 3PS3A 2A2DA 3CDJA 5C0XF 4K0KE 1KVKA 3V5RA 5IWAI 4MYUA 4UTGA 5DRRA 2R42A 3LTOA 2UXCE 1PKPA 2GS8A 1K47A 2Z5CB 4MU4A 4DUYE 1EA6A 3Q6MA 3M7NG 1P42A 1XNQI 2UXDE 1Y5YA 4B3RE 4OO1B 1OYPA 1Y4UA 2IESA 4JI6E 2ZM6I 4LF5E 4RPFA 1N0VC 5GMEA 1IBME 1KKHA 5LL6R 3F0NA 2PO2B 4LF6I 2J7KA 3J7AG 2E5LE 1E3HA 1E3PA 4IFDB 4FW4A 1FJGI 1Z5BA 3J81C 2BA0G 2JEAB 2HKJA 4NXME 2PO0B 2DEJA 1YHCA 1S4EA 2BV3A 4HACA 4DUZE 2WP8B 1B63A 4GKJI 4DR4I 4DV1I 3L7ZA 4IZJA 1ELOA 4LCFA 2JEAA 4X65E 4IFDD 2NN6C 4DXLA 1H7UA 4LCHA 4ED4A 4NBQA 4FWGA 2OI2A 1I94E 4DR2I 4P7AA 2BM1A 5K36A 3T1YE 4DR2E 2ZBKB 3WU4A 4JV5I 3ZKBA 1HNWE 2X36A 3T1YI 1FWLA 1N33I 1RREA 5JEAB 1FKAE 4MDTA 4JI1E 3K85A 2NPFA 2NN6A 4KQVA 1IBKE 2O1TA 4DV5I 5DROA 4DR3E 4DV6I 1H73A 3GCMA 3PYGA 2JEBB 4OX9I 1N36I 1D6TA 2CGEA 1Z0EA 4BA1A 1HNZE 4LFCI 5A2QC 2UXCI 1NZ0A 3P3GA 5LMNE 4DU8A 1N34E 4DV7I 3B82A 4MU3A 4X64E 4I3HA 2C38B 1Z0GA 4DV0I 1U2RA 2LJPA 4GKKI 2Q2EB 5BR8E 4LFAE 4AQYI 3QT6A 4USKA 2VQEE 4MYTA 2C39A 1BKNA 2UUBI 4DPYA 1N32E 4Z7CA 4AQYE 4DR1E 1UDNA 3D4JA 2E1RA 4PRVA 3K17A 1IBKI 4FW7A 4LOMA 2PO2A 1NHJA 2BR2A 4HY1A 3OTOE 2UU9E 1XNRE 4WUDA 1KIJA 4DPTA 3T1HI 5FLXQ 1HNXI 4QNJA 4DV2E 3GMEA 4X66E 3ZM7A 3Q1QA 1USVA 4JI0I 4JI8E 2VQFE 1HR0I 1XMOE 2GO4A 2VQFI 4JI0E 3HULA 1EI1A 4ISAA 4LCGA 1Y60A 1Z5CA 5LMNI 1N0UA 3J80C 4OZEA 2UXBI 4DV0E 2V8PA 4OO1F 4KHPE 2NN6D 4JYAE 1N34I 5EKWA 4YHHI 4UT4A 4KHPI 2HHHE 2O1VA 4OO1A 2C39B 3CWVA 4IFDE 4LFAI 3PRYA 2E5LI 3ZKDA 3ZZUA 5DNXA 4B3RI 5JEAF 5IT9Q 2A2CA 4WUBA 4WUCA 4JI3I 2HFSA 2UUCE 1XXEA 1N32I 2GO3A 1S16A 3B4TA 4YY3I 4LFBE 1HNWI 1MX0A 4ZVIA 4DV5E 3JAMQ 2UUCI 4NXMI 2UU9I 1XMOI 2JE6B 4IZJD 4GKJE 1Z0CA 4DV1E 4IFDA 2IOPA 2Z5EA 2R3VA 2DEIA 2WNRB 5EL9A 3J80Q 4NXNE 1UDOA 5ELWA 4LF7I 3WU3A 3QT7A 3NZKA 1N36E 1USUA 4FW9A 4B3TE 5JEAD 4NXNI 2O1WA 1XNQE 2UXDI 4DR6I 2HHHI 4R1FA 1YH8A 2WW4A 3H4LA 4DV7E 4DR7I 1Y4SA 2VESA 2ZM6E 2CVEA 5K36D 4JYAI 1ZM9A 1UDQA 2UUAE 1ZXMA 2Z5CA 4LF9I 4LF8I 1ZXNA 3H1CA 2F1DA 4JV5E 2BA0D 5FLXC 5DRPA 2BR2B 3GLLA 4XTJA 4LF5I 4LF9E 1MU5A 2PO0A 1ZM3A 2VF3A 4BA2A 3LNUA 4JI5I 3OTOI 4IFDF 3P3CA 3ZZ0A 1HR0E 1FJGE 4HXZA 4DR4E 2EFGA 2NN6E 3U1YA 4DV2I 2PO1B 4OKGA 4X66I 2WP8A 4FW3A 4X65I 1HNZI 4P52A 1DARA 4IZJB 2C37B 1R6LA 1FNMA 2BM0A 2O1UA 4X64I 3HKMA 3KRNA 2BA1D 3GONA 1I94I 4IS9A 4DR7E 4AIDA 4DUYI 3JAMC 3J7AM 4X62I 3WU6A 4LFCE 5K36F 4QNKA 2VQEI 4B3TI 5LMUE 4OO1D 4DPXA 5C0XA 1H72C 2CG9A 4JI7E 1J5EE 1RHYA 2Z5BA 1N33E 2IOQA 4YY3E 2PNZB 4B3ME 1H74A 1ZM4A 4PU9A 1Z59A 4DR5I 3T1HE 1ZM2A 1H7SA 5DNLA 4LF8E 4DV4E 5L3JA 4JI4E 1Z0VA 4IZKB 1A6FA 3PYDA 1XHKA 2AJ4A 4LF4E 2WNRA 2F4VE 1HK7A 5JEAC 5FWKA 3QT5A 1OJ4A 4DUZI 2BA1G 4Z7YA 1IBLI 3U1KA 4FWDA 4HACB 4IZKA 3M85D 1Z0WA 2HFUA 5DRQA 2HKEA 4DPWA 1Z0TA 3UHMA 1KTVA 3L7ZB 2C37A 2PNLA 2GQ0A 1Z0BA 2O3ZA 3M7ND 5C0XE 1OYRA 1FWKA 4EMDA 4JG4A 4MU0A 1J5EI 1OYSA 3P06A 4JI7I 4FN5A 4DV3E 5C0XD 1QZRA 2PNZA 3M6AA 3QT8A 3K1JA 4DR5E 2Z5BB 4OO1C 4LF6E 2NN6B 4LFBI 4JI4I 4JI1I 5IT9C 2PNMA 4LPFA 5C0XB 3WU5A 2UUAI 4JI6I 4U3DA 4JI5E 3M85G 4HYMA 4GQUA 2V2QA 4DR3I 4BA2B 4J3DA 5K36E 5JEAE 2JEBA 2AE8A 3HJCA 4URLA 3PS1A 2CZ9A 1MG7A 4FWHA 1VISA 1Z5AA 1HNXE 4MU1A 4LF4I 1UDSA 1NHIA 2XEXA 2NN6F 4JI8I 4OO1E 4JI2I 1IBLE 1RR9A 4PRXA 4AM3A 2HK3A 4FW5A 3V2UC 2UXBE 4MQYA 3DD6A 4BA1B 5IWAE 3B78A 2V2ZA 3Q6NA 4B3SE 4DR6E 4DV3I 3J81Q 5BR8I 5LMUI 4LF7E 2V2VA 4B3SI 2C38A 1NHHA 2UUBE 1FI4A 4X62E 1UEKA 3CDIA 2IERA 1PIEA 4GKKE 4YHHE 4JI3E 1VI7A 2V34A 5GMDA 3P3EA 4M1KA 5JEAA 5K36B 3LPSA 3PS2A 2X7IA 4DPUA 4AIMA 4DU7A 4USMA 5A2QQ 4DR1I 4B3MI 2F4VI 1IBMI 4IFDC 3ZZTA 1B62A 4FW6A 3P76A 1XMQE 4DV4I 1XNRI 4N3OA 2JE6A 3B8HA 1R6MA 1XMQI 2PO1A 5C0XC 4DV6E
chains in the Genus database with same CATH topology
2ZITA 3PYEA 1WUUA 1PVGA 3PYFA 4K0KI 2HK2A 1Y6ZA 4JI2E 4OX9E 2A2DA 4K0KE 1KVKA 3V5RA 5IWAI 4MYUA 4UTGA 2R42A 3LTOA 2UXCE 1PKPA 2GS8A 1K47A 2Z5CB 4DUYE 1EA6A 3Q6MA 1XNQI 2UXDE 4B3RE 1Y4UA 4JI6E 2ZM6I 4LF5E 4RPFA 1N0VC 5GMEA 1IBME 1KKHA 5LL6R 3F0NA 4LF6I 2J7KA 3J7AG 2E5LE 1FJGI 1Z5BA 3J81C 2HKJA 4NXME 2DEJA 2BV3A 1S4EA 4HACA 4DUZE 1B63A 4GKJI 4DR4I 4DV1I 4IZJA 1ELOA 4X65E 4DXLA 1H7UA 4ED4A 4FWGA 2OI2A 1I94E 4DR2I 4P7AA 2BM1A 3T1YE 4DR2E 2ZBKB 3WU4A 4JV5I 3ZKBA 1HNWE 2X36A 3T1YI 1FWLA 1N33I 1RREA 1FKAE 4JI1E 3K85A 2NPFA 1IBKE 4KQVA 2O1TA 4DV5I 4DR3E 4DV6I 1H73A 3PYGA 4OX9I 1N36I 1D6TA 2CGEA 1Z0EA 1HNZE 4LFCI 5A2QC 2UXCI 1NZ0A 5LMNE 4DU8A 1N34E 4DV7I 3B82A 4X64E 4I3HA 1Z0GA 4DV0I 1U2RA 2LJPA 4GKKI 2Q2EB 5BR8E 4LFAE 4AQYI 3QT6A 4USKA 2VQEE 4MYTA 1BKNA 2UUBI 4DPYA 1N32E 4Z7CA 4AQYE 4DR1E 3D4JA 2E1RA 4PRVA 3K17A 1IBKI 3OTOE 4HY1A 1NHJA 2UU9E 1XNRE 4WUDA 1KIJA 4DPTA 3T1HI 5FLXQ 1HNXI 4DV2E 4X66E 3ZM7A 3Q1QA 1USVA 4JI0I 4JI8E 2VQFE 1HR0I 1XMOE 2VQFI 4JI0E 3HULA 1EI1A 1Z5CA 5LMNI 1N0UA 3J80C 2UXBI 4DV0E 2V8PA 4KHPE 4JYAE 1N34I 4YHHI 4UT4A 4KHPI 2HHHE 2O1VA 3CWVA 4LFAI 3PRYA 2E5LI 3ZKDA 3ZZUA 4B3RI 5IT9Q 2A2CA 4WUBA 4WUCA 4JI3I 2HFSA 2UUCE 1N32I 1HNWI 1S16A 4YY3I 4LFBE 1MX0A 4ZVIA 4DV5E 3JAMQ 2UUCI 4NXMI 2UU9I 1XMOI 4IZJD 4GKJE 1Z0CA 4DV1E 2IOPA 2Z5EA 2R3VA 2DEIA 3J80Q 4NXNE 4LF7I 3WU3A 3QT7A 1N36E 1USUA 4FW9A 4B3TE 4NXNI 2O1WA 1XNQE 2UXDI 4DR6I 2HHHI 4R1FA 2WW4A 3H4LA 4DV7E 4DR7I 1Y4SA 2ZM6E 4JYAI 1ZM9A 2UUAE 1ZXMA 2Z5CA 4LF9I 4LF8I 1ZXNA 4JV5E 5FLXC 4LF5I 4LF9E 4XTJA 1MU5A 1ZM3A 2VF3A 3LNUA 4JI5I 3OTOI 3ZZ0A 1HR0E 1FJGE 4HXZA 4DR4E 2EFGA 4DV2I 4X66I 4X65I 1HNZI 4P52A 1DARA 4IZJB 1FNMA 2BM0A 2O1UA 4X64I 3GONA 1I94I 4DR7E 4DUYI 3J7AM 3JAMC 4X62I 3WU6A 4LFCE 2VQEI 4B3TI 5LMUE 4DPXA 1H72C 2CG9A 4JI7E 1J5EE 2Z5BA 1N33E 2IOQA 4YY3E 4B3ME 1H74A 1ZM4A 4PU9A 1Z59A 4DR5I 3T1HE 1ZM2A 1H7SA 4LF8E 4DV4E 5L3JA 4JI4E 1Z0VA 4IZKB 1A6FA 3PYDA 1XHKA 2AJ4A 4LF4E 2F4VE 1HK7A 5FWKA 3QT5A 1OJ4A 4DUZI 4Z7YA 1IBLI 4FWDA 4HACB 4IZKA 1Z0WA 2HFUA 2HKEA 4DPWA 1Z0TA 1KTVA 2PNLA 2GQ0A 1Z0BA 1FWKA 4EMDA 4JG4A 1J5EI 3P06A 4JI7I 4FN5A 4DV3E 1QZRA 3M6AA 3QT8A 3K1JA 4DR5E 2Z5BB 4LF6E 4LFBI 4JI4I 4JI1I 5IT9C 2PNMA 2UUAI 3WU5A 4JI6I 4JI5E 4HYMA 2V2QA 4DR3I 3HJCA 4URLA 2CZ9A 1MG7A 4FWHA 1VISA 1Z5AA 1HNXE 4LF4I 1NHIA 2XEXA 4JI8I 4JI2I 1IBLE 1RR9A 4PRXA 2HK3A 3V2UC 2UXBE 5IWAE 3B78A 2V2ZA 3Q6NA 4B3SE 4DR6E 4DV3I 3J81Q 5BR8I 5LMUI 4LF7E 2V2VA 4B3SI 1NHHA 2UUBE 1FI4A 4X62E 1UEKA 1PIEA 4GKKE 4YHHE 4JI3E 2V34A 5GMDA 4M1KA 3LPSA 4DR1I 2X7IA 4DPUA 5A2QQ 4DU7A 4B3MI 4USMA 2F4VI 1IBMI 3ZZTA 1B62A 1XMQE 4DV4I 1XNRI 4N3OA 3B8HA 1XMQI 4DV6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  3PYE A;  1WUU A;  1PVG A;  3PYF A;  4K0K I;  2HK2 A;  4JI2 E;  4OX9 E;  2A2D A;  4K0K E;  1KVK A;  3V5R A;  5IWA I;  4MYU A;  4UTG A;  2R42 A;  3LTO A;  2UXC E;  1PKP A;  2GS8 A;  1K47 A;  4DUY E;  1EA6 A;  1XNQ I;  2UXD E;  4B3R E;  4JI6 E;  2ZM6 I;  4LF5 E;  4RPF A;  1N0V C;  5GME A;  1IBM E;  1KKH A;  5LL6 R;  3F0N A;  4LF6 I;  2J7K A;  3J7A G;  2E5L E;  1FJG I;  1Z5B A;  3J81 C;  2HKJ A;  4NXM E;  2DEJ A;  2BV3 A;  1S4E A;  4HAC A;  4DUZ E;  1B63 A;  4GKJ I;  4DR4 I;  4DV1 I;  1ELO A;  4X65 E;  4DXL A;  1H7U A;  4ED4 A;  4FWG A;  2OI2 A;  1I94 E;  4DR2 I;  4P7A A;  2BM1 A;  3T1Y E;  4DR2 E;  2ZBK B;  3WU4 A;  4JV5 I;  3ZKB A;  1HNW E;  2X36 A;  3T1Y I;  1FWL A;  1N33 I;  1RRE A;  1FKA E;  4JI1 E;  2NPF A;  1IBK E;  4KQV A;  4DV5 I;  4DR3 E;  4DV6 I;  1H73 A;  3PYG A;  4OX9 I;  1N36 I;  1D6T A;  1Z0E A;  1HNZ E;  4LFC I;  5A2Q C;  2UXC I;  1NZ0 A;  5LMN E;  4DU8 A;  1N34 E;  4DV7 I;  3B82 A;  4X64 E;  4I3H A;  1Z0G A;  4DV0 I;  1U2R A;  2LJP A;  4GKK I;  2Q2E B;  5BR8 E;  4LFA E;  4AQY I;  3QT6 A;  4USK A;  2VQE E;  4MYT A;  1BKN A;  2UUB I;  4DPY A;  1N32 E;  4Z7C A;  4AQY E;  4DR1 E;  3D4J A;  2E1R A;  4PRV A;  3K17 A;  1IBK I;  3OTO E;  4HY1 A;  1NHJ A;  2UU9 E;  1XNR E;  4WUD A;  1KIJ A;  4DPT A;  3T1H I;  5FLX Q;  1HNX I;  4DV2 E;  4X66 E;  3ZM7 A;  3Q1Q A;  4JI0 I;  4JI8 E;  2VQF E;  1HR0 I;  1XMO E;  2VQF I;  4JI0 E;  3HUL A;  1EI1 A;  1Z5C A;  5LMN I;  1N0U A;  3J80 C;  2UXB I;  4DV0 E;  2V8P A;  4KHP E;  4JYA E;  1N34 I;  4YHH I;  4UT4 A;  4KHP I;  2HHH E;  3CWV A;  4LFA I;  2E5L I;  3ZKD A;  3ZZU A;  4B3R I;  5IT9 Q;  2A2C A;  4WUB A;  4WUC A;  4JI3 I;  2HFS A;  2UUC E;  1N32 I;  1HNW I;  1S16 A;  4YY3 I;  4LFB E;  1MX0 A;  4ZVI A;  4DV5 E;  3JAM Q;  2UUC I;  4NXM I;  2UU9 I;  1XMO I;  4GKJ E;  1Z0C A;  4DV1 E;  2R3V A;  2DEI A;  3J80 Q;  4NXN E;  4LF7 I;  3WU3 A;  3QT7 A;  1N36 E;  4FW9 A;  4B3T E;  4NXN I;  1XNQ E;  2UXD I;  4DR6 I;  2HHH I;  4R1F A;  2WW4 A;  3H4L A;  4DV7 E;  4DR7 I;  2ZM6 E;  4JYA I;  1ZM9 A;  2UUA E;  1ZXM A;  4LF9 I;  4LF8 I;  1ZXN A;  4JV5 E;  5FLX C;  4LF5 I;  4LF9 E;  4XTJ A;  1MU5 A;  1ZM3 A;  2VF3 A;  3LNU A;  4JI5 I;  3OTO I;  3ZZ0 A;  1HR0 E;  1FJG E;  4HXZ A;  4DR4 E;  2EFG A;  4DV2 I;  4X66 I;  4X65 I;  1HNZ I;  4P52 A;  1DAR A;  1FNM A;  2BM0 A;  4X64 I;  3GON A;  1I94 I;  4DR7 E;  4DUY I;  3J7A M;  3JAM C;  4X62 I;  3WU6 A;  4LFC E;  2VQE I;  4B3T I;  5LMU E;  4DPX A;  1H72 C;  4JI7 E;  1J5E E;  1N33 E;  4YY3 E;  4B3M E;  1H74 A;  1ZM4 A;  4PU9 A;  1Z59 A;  4DR5 I;  3T1H E;  1ZM2 A;  1H7S A;  4LF8 E;  4DV4 E;  5L3J A;  4JI4 E;  1Z0V A;  1A6F A;  3PYD A;  1XHK A;  2AJ4 A;  4LF4 E;  2F4V E;  3QT5 A;  1OJ4 A;  4DUZ I;  4Z7Y A;  1IBL I;  4FWD A;  4HAC B;  1Z0W A;  2HFU A;  2HKE A;  4DPW A;  1Z0T A;  1KTV A;  1Z0B A;  1FWK A;  4EMD A;  4JG4 A;  1J5E I;  4JI7 I;  4FN5 A;  4DV3 E;  1QZR A;  3M6A A;  3QT8 A;  3K1J A;  4DR5 E;  4LF6 E;  4LFB I;  4JI4 I;  4JI1 I;  5IT9 C;  2UUA I;  3WU5 A;  4JI6 I;  4JI5 E;  4HYM A;  2V2Q A;  4DR3 I;  4URL A;  2CZ9 A;  1MG7 A;  4FWH A;  1VIS A;  1Z5A A;  1HNX E;  4LF4 I;  1NHI A;  2XEX A;  4JI8 I;  4JI2 I;  1IBL E;  1RR9 A;  4PRX A;  2HK3 A;  3V2U C;  2UXB E;  5IWA E;  3B78 A;  2V2Z A;  4B3S E;  4DR6 E;  4DV3 I;  3J81 Q;  5BR8 I;  5LMU I;  4LF7 E;  2V2V A;  4B3S I;  1NHH A;  2UUB E;  1FI4 A;  4X62 E;  1UEK A;  1PIE A;  4GKK E;  4YHH E;  4JI3 E;  2V34 A;  5GMD A;  4M1K A;  3LPS A;  4DR1 I;  2X7I A;  4DPU A;  5A2Q Q;  4DU7 A;  4B3M I;  4USM A;  2F4V I;  1IBM I;  3ZZT A;  1B62 A;  1XMQ E;  4DV4 I;  1XNR I;  3B8H A;  1XMQ I;  4DV6 E; 
#chains in the Genus database with same CATH topology
 2ZIT A;  3PYE A;  1WUU A;  2J65 A;  1PVG A;  5K36 C;  4U3B A;  3PYF A;  4K0K I;  2HK2 A;  2JT2 A;  1Y6Z A;  4JI2 E;  4OX9 E;  3PS3 A;  2A2D A;  3CDJ A;  5C0X F;  4K0K E;  1KVK A;  3V5R A;  5IWA I;  4MYU A;  4UTG A;  5DRR A;  2R42 A;  3LTO A;  2UXC E;  1PKP A;  2GS8 A;  1K47 A;  2Z5C B;  4MU4 A;  4DUY E;  1EA6 A;  3Q6M A;  3M7N G;  1P42 A;  1XNQ I;  2UXD E;  1Y5Y A;  4B3R E;  4OO1 B;  1OYP A;  1Y4U A;  2IES A;  4JI6 E;  2ZM6 I;  4LF5 E;  4RPF A;  1N0V C;  5GME A;  1IBM E;  1KKH A;  5LL6 R;  3F0N A;  2PO2 B;  4LF6 I;  2J7K A;  3J7A G;  2E5L E;  1E3H A;  1E3P A;  4IFD B;  4FW4 A;  1FJG I;  1Z5B A;  3J81 C;  2BA0 G;  2JEA B;  2HKJ A;  4NXM E;  2PO0 B;  2DEJ A;  1YHC A;  1S4E A;  2BV3 A;  4HAC A;  4DUZ E;  2WP8 B;  1B63 A;  4GKJ I;  4DR4 I;  4DV1 I;  3L7Z A;  4IZJ A;  1ELO A;  4LCF A;  2JEA A;  4X65 E;  4IFD D;  2NN6 C;  4DXL A;  1H7U A;  4LCH A;  4ED4 A;  4NBQ A;  4FWG A;  2OI2 A;  1I94 E;  4DR2 I;  4P7A A;  2BM1 A;  5K36 A;  3T1Y E;  4DR2 E;  2ZBK B;  3WU4 A;  4JV5 I;  3ZKB A;  1HNW E;  2X36 A;  3T1Y I;  1FWL A;  1N33 I;  1RRE A;  5JEA B;  1FKA E;  4MDT A;  4JI1 E;  3K85 A;  2NPF A;  2NN6 A;  4KQV A;  1IBK E;  2O1T A;  4DV5 I;  5DRO A;  4DR3 E;  4DV6 I;  1H73 A;  3GCM A;  3PYG A;  2JEB B;  4OX9 I;  1N36 I;  1D6T A;  2CGE A;  1Z0E A;  4BA1 A;  1HNZ E;  4LFC I;  5A2Q C;  2UXC I;  1NZ0 A;  3P3G A;  5LMN E;  4DU8 A;  1N34 E;  4DV7 I;  3B82 A;  4MU3 A;  4X64 E;  4I3H A;  2C38 B;  1Z0G A;  4DV0 I;  1U2R A;  2LJP A;  4GKK I;  2Q2E B;  5BR8 E;  4LFA E;  4AQY I;  3QT6 A;  4USK A;  2VQE E;  4MYT A;  2C39 A;  1BKN A;  2UUB I;  4DPY A;  1N32 E;  4Z7C A;  4AQY E;  4DR1 E;  1UDN A;  3D4J A;  2E1R A;  4PRV A;  3K17 A;  1IBK I;  4FW7 A;  4LOM A;  2PO2 A;  1NHJ A;  2BR2 A;  4HY1 A;  3OTO E;  2UU9 E;  1XNR E;  4WUD A;  1KIJ A;  4DPT A;  3T1H I;  5FLX Q;  1HNX I;  4QNJ A;  4DV2 E;  3GME A;  4X66 E;  3ZM7 A;  3Q1Q A;  1USV A;  4JI0 I;  4JI8 E;  2VQF E;  1HR0 I;  1XMO E;  2GO4 A;  2VQF I;  4JI0 E;  3HUL A;  1EI1 A;  4ISA A;  4LCG A;  1Y60 A;  1Z5C A;  5LMN I;  1N0U A;  3J80 C;  4OZE A;  2UXB I;  4DV0 E;  2V8P A;  4OO1 F;  4KHP E;  2NN6 D;  4JYA E;  1N34 I;  5EKW A;  4YHH I;  4UT4 A;  4KHP I;  2HHH E;  2O1V A;  4OO1 A;  2C39 B;  3CWV A;  4IFD E;  4LFA I;  3PRY A;  2E5L I;  3ZKD A;  3ZZU A;  5DNX A;  4B3R I;  5JEA F;  5IT9 Q;  2A2C A;  4WUB A;  4WUC A;  4JI3 I;  2HFS A;  2UUC E;  1XXE A;  1N32 I;  2GO3 A;  1S16 A;  3B4T A;  4YY3 I;  4LFB E;  1HNW I;  1MX0 A;  4ZVI A;  4DV5 E;  3JAM Q;  2UUC I;  4NXM I;  2UU9 I;  1XMO I;  2JE6 B;  4IZJ D;  4GKJ E;  1Z0C A;  4DV1 E;  4IFD A;  2IOP A;  2Z5E A;  2R3V A;  2DEI A;  2WNR B;  5EL9 A;  3J80 Q;  4NXN E;  1UDO A;  5ELW A;  4LF7 I;  3WU3 A;  3QT7 A;  3NZK A;  1N36 E;  1USU A;  4FW9 A;  4B3T E;  5JEA D;  4NXN I;  2O1W A;  1XNQ E;  2UXD I;  4DR6 I;  2HHH I;  4R1F A;  1YH8 A;  2WW4 A;  3H4L A;  4DV7 E;  4DR7 I;  1Y4S A;  2VES A;  2ZM6 E;  2CVE A;  5K36 D;  4JYA I;  1ZM9 A;  1UDQ A;  2UUA E;  1ZXM A;  2Z5C A;  4LF9 I;  4LF8 I;  1ZXN A;  3H1C A;  2F1D A;  4JV5 E;  2BA0 D;  5FLX C;  5DRP A;  2BR2 B;  3GLL A;  4XTJ A;  4LF5 I;  4LF9 E;  1MU5 A;  2PO0 A;  1ZM3 A;  2VF3 A;  4BA2 A;  3LNU A;  4JI5 I;  3OTO I;  4IFD F;  3P3C A;  3ZZ0 A;  1HR0 E;  1FJG E;  4HXZ A;  4DR4 E;  2EFG A;  2NN6 E;  3U1Y A;  4DV2 I;  2PO1 B;  4OKG A;  4X66 I;  2WP8 A;  4FW3 A;  4X65 I;  1HNZ I;  4P52 A;  1DAR A;  4IZJ B;  2C37 B;  1R6L A;  1FNM A;  2BM0 A;  2O1U A;  4X64 I;  3HKM A;  3KRN A;  2BA1 D;  3GON A;  1I94 I;  4IS9 A;  4DR7 E;  4AID A;  4DUY I;  3JAM C;  3J7A M;  4X62 I;  3WU6 A;  4LFC E;  5K36 F;  4QNK A;  2VQE I;  4B3T I;  5LMU E;  4OO1 D;  4DPX A;  5C0X A;  1H72 C;  2CG9 A;  4JI7 E;  1J5E E;  1RHY A;  2Z5B A;  1N33 E;  2IOQ A;  4YY3 E;  2PNZ B;  4B3M E;  1H74 A;  1ZM4 A;  4PU9 A;  1Z59 A;  4DR5 I;  3T1H E;  1ZM2 A;  1H7S A;  5DNL A;  4LF8 E;  4DV4 E;  5L3J A;  4JI4 E;  1Z0V A;  4IZK B;  1A6F A;  3PYD A;  1XHK A;  2AJ4 A;  4LF4 E;  2WNR A;  2F4V E;  1HK7 A;  5JEA C;  5FWK A;  3QT5 A;  1OJ4 A;  4DUZ I;  2BA1 G;  4Z7Y A;  1IBL I;  3U1K A;  4FWD A;  4HAC B;  4IZK A;  3M85 D;  1Z0W A;  2HFU A;  5DRQ A;  2HKE A;  4DPW A;  1Z0T A;  3UHM A;  1KTV A;  3L7Z B;  2C37 A;  2PNL A;  2GQ0 A;  1Z0B A;  2O3Z A;  3M7N D;  5C0X E;  1OYR A;  1FWK A;  4EMD A;  4JG4 A;  4MU0 A;  1J5E I;  1OYS A;  3P06 A;  4JI7 I;  4FN5 A;  4DV3 E;  5C0X D;  1QZR A;  2PNZ A;  3M6A A;  3QT8 A;  3K1J A;  4DR5 E;  2Z5B B;  4OO1 C;  4LF6 E;  2NN6 B;  4LFB I;  4JI4 I;  4JI1 I;  5IT9 C;  2PNM A;  4LPF A;  5C0X B;  3WU5 A;  2UUA I;  4JI6 I;  4U3D A;  4JI5 E;  3M85 G;  4HYM A;  4GQU A;  2V2Q A;  4DR3 I;  4BA2 B;  4J3D A;  5K36 E;  5JEA E;  2JEB A;  2AE8 A;  3HJC A;  4URL A;  3PS1 A;  2CZ9 A;  1MG7 A;  4FWH A;  1VIS A;  1Z5A A;  1HNX E;  4MU1 A;  4LF4 I;  1UDS A;  1NHI A;  2XEX A;  2NN6 F;  4JI8 I;  4OO1 E;  4JI2 I;  1IBL E;  1RR9 A;  4PRX A;  4AM3 A;  2HK3 A;  4FW5 A;  3V2U C;  2UXB E;  4MQY A;  3DD6 A;  4BA1 B;  5IWA E;  3B78 A;  2V2Z A;  3Q6N A;  4B3S E;  4DR6 E;  4DV3 I;  3J81 Q;  5BR8 I;  5LMU I;  4LF7 E;  2V2V A;  4B3S I;  2C38 A;  1NHH A;  2UUB E;  1FI4 A;  4X62 E;  1UEK A;  3CDI A;  2IER A;  1PIE A;  4GKK E;  4YHH E;  4JI3 E;  1VI7 A;  2V34 A;  5GMD A;  3P3E A;  4M1K A;  5JEA A;  5K36 B;  3LPS A;  3PS2 A;  2X7I A;  4DPU A;  4AIM A;  4DU7 A;  4USM A;  5A2Q Q;  4DR1 I;  4B3M I;  2F4V I;  1IBM I;  4IFD C;  3ZZT A;  1B62 A;  4FW6 A;  3P76 A;  1XMQ E;  4DV4 I;  1XNR I;  4N3O A;  2JE6 A;  3B8H A;  1R6M A;  1XMQ I;  2PO1 A;  5C0X C;  4DV6 E; 
#chains in the Genus database with same CATH homology
 2ZIT A;  3PYE A;  1WUU A;  1PVG A;  3PYF A;  4K0K I;  2HK2 A;  1Y6Z A;  4JI2 E;  4OX9 E;  2A2D A;  4K0K E;  1KVK A;  3V5R A;  5IWA I;  4MYU A;  4UTG A;  2R42 A;  3LTO A;  2UXC E;  1PKP A;  2GS8 A;  1K47 A;  2Z5C B;  4DUY E;  1EA6 A;  3Q6M A;  1XNQ I;  2UXD E;  4B3R E;  1Y4U A;  4JI6 E;  2ZM6 I;  4LF5 E;  4RPF A;  1N0V C;  5GME A;  1IBM E;  1KKH A;  5LL6 R;  3F0N A;  4LF6 I;  2J7K A;  3J7A G;  2E5L E;  1FJG I;  1Z5B A;  3J81 C;  2HKJ A;  4NXM E;  2DEJ A;  2BV3 A;  1S4E A;  4HAC A;  4DUZ E;  1B63 A;  4GKJ I;  4DR4 I;  4DV1 I;  4IZJ A;  1ELO A;  4X65 E;  4DXL A;  1H7U A;  4ED4 A;  4FWG A;  2OI2 A;  1I94 E;  4DR2 I;  4P7A A;  2BM1 A;  3T1Y E;  4DR2 E;  2ZBK B;  3WU4 A;  4JV5 I;  3ZKB A;  1HNW E;  2X36 A;  3T1Y I;  1FWL A;  1N33 I;  1RRE A;  1FKA E;  4JI1 E;  3K85 A;  2NPF A;  1IBK E;  4KQV A;  2O1T A;  4DV5 I;  4DR3 E;  4DV6 I;  1H73 A;  3PYG A;  4OX9 I;  1N36 I;  1D6T A;  2CGE A;  1Z0E A;  1HNZ E;  4LFC I;  5A2Q C;  2UXC I;  1NZ0 A;  5LMN E;  4DU8 A;  1N34 E;  4DV7 I;  3B82 A;  4X64 E;  4I3H A;  1Z0G A;  4DV0 I;  1U2R A;  2LJP A;  4GKK I;  2Q2E B;  5BR8 E;  4LFA E;  4AQY I;  3QT6 A;  4USK A;  2VQE E;  4MYT A;  1BKN A;  2UUB I;  4DPY A;  1N32 E;  4Z7C A;  4AQY E;  4DR1 E;  3D4J A;  2E1R A;  4PRV A;  3K17 A;  1IBK I;  3OTO E;  4HY1 A;  1NHJ A;  2UU9 E;  1XNR E;  4WUD A;  1KIJ A;  4DPT A;  3T1H I;  5FLX Q;  1HNX I;  4DV2 E;  4X66 E;  3ZM7 A;  3Q1Q A;  1USV A;  4JI0 I;  4JI8 E;  2VQF E;  1HR0 I;  1XMO E;  2VQF I;  4JI0 E;  3HUL A;  1EI1 A;  1Z5C A;  5LMN I;  1N0U A;  3J80 C;  2UXB I;  4DV0 E;  2V8P A;  4KHP E;  4JYA E;  1N34 I;  4YHH I;  4UT4 A;  4KHP I;  2HHH E;  2O1V A;  3CWV A;  4LFA I;  3PRY A;  2E5L I;  3ZKD A;  3ZZU A;  4B3R I;  5IT9 Q;  2A2C A;  4WUB A;  4WUC A;  4JI3 I;  2HFS A;  2UUC E;  1N32 I;  1HNW I;  1S16 A;  4YY3 I;  4LFB E;  1MX0 A;  4ZVI A;  4DV5 E;  3JAM Q;  2UUC I;  4NXM I;  2UU9 I;  1XMO I;  4IZJ D;  4GKJ E;  1Z0C A;  4DV1 E;  2IOP A;  2Z5E A;  2R3V A;  2DEI A;  3J80 Q;  4NXN E;  4LF7 I;  3WU3 A;  3QT7 A;  1N36 E;  1USU A;  4FW9 A;  4B3T E;  4NXN I;  2O1W A;  1XNQ E;  2UXD I;  4DR6 I;  2HHH I;  4R1F A;  2WW4 A;  3H4L A;  4DV7 E;  4DR7 I;  1Y4S A;  2ZM6 E;  4JYA I;  1ZM9 A;  2UUA E;  1ZXM A;  2Z5C A;  4LF9 I;  4LF8 I;  1ZXN A;  4JV5 E;  5FLX C;  4LF5 I;  4LF9 E;  4XTJ A;  1MU5 A;  1ZM3 A;  2VF3 A;  3LNU A;  4JI5 I;  3OTO I;  3ZZ0 A;  1HR0 E;  1FJG E;  4HXZ A;  4DR4 E;  2EFG A;  4DV2 I;  4X66 I;  4X65 I;  1HNZ I;  4P52 A;  1DAR A;  4IZJ B;  1FNM A;  2BM0 A;  2O1U A;  4X64 I;  3GON A;  1I94 I;  4DR7 E;  4DUY I;  3J7A M;  3JAM C;  4X62 I;  3WU6 A;  4LFC E;  2VQE I;  4B3T I;  5LMU E;  4DPX A;  1H72 C;  2CG9 A;  4JI7 E;  1J5E E;  2Z5B A;  1N33 E;  2IOQ A;  4YY3 E;  4B3M E;  1H74 A;  1ZM4 A;  4PU9 A;  1Z59 A;  4DR5 I;  3T1H E;  1ZM2 A;  1H7S A;  4LF8 E;  4DV4 E;  5L3J A;  4JI4 E;  1Z0V A;  4IZK B;  1A6F A;  3PYD A;  1XHK A;  2AJ4 A;  4LF4 E;  2F4V E;  1HK7 A;  5FWK A;  3QT5 A;  1OJ4 A;  4DUZ I;  4Z7Y A;  1IBL I;  4FWD A;  4HAC B;  4IZK A;  1Z0W A;  2HFU A;  2HKE A;  4DPW A;  1Z0T A;  1KTV A;  2PNL A;  2GQ0 A;  1Z0B A;  1FWK A;  4EMD A;  4JG4 A;  1J5E I;  3P06 A;  4JI7 I;  4FN5 A;  4DV3 E;  1QZR A;  3M6A A;  3QT8 A;  3K1J A;  4DR5 E;  2Z5B B;  4LF6 E;  4LFB I;  4JI4 I;  4JI1 I;  5IT9 C;  2PNM A;  2UUA I;  3WU5 A;  4JI6 I;  4JI5 E;  4HYM A;  2V2Q A;  4DR3 I;  3HJC A;  4URL A;  2CZ9 A;  1MG7 A;  4FWH A;  1VIS A;  1Z5A A;  1HNX E;  4LF4 I;  1NHI A;  2XEX A;  4JI8 I;  4JI2 I;  1IBL E;  1RR9 A;  4PRX A;  2HK3 A;  3V2U C;  2UXB E;  5IWA E;  3B78 A;  2V2Z A;  3Q6N A;  4B3S E;  4DR6 E;  4DV3 I;  3J81 Q;  5BR8 I;  5LMU I;  4LF7 E;  2V2V A;  4B3S I;  1NHH A;  2UUB E;  1FI4 A;  4X62 E;  1UEK A;  1PIE A;  4GKK E;  4YHH E;  4JI3 E;  2V34 A;  5GMD A;  4M1K A;  3LPS A;  4DR1 I;  2X7I A;  4DPU A;  5A2Q Q;  4DU7 A;  4B3M I;  4USM A;  2F4V I;  1IBM I;  3ZZT A;  1B62 A;  1XMQ E;  4DV4 I;  1XNR I;  4N3O A;  3B8H A;  1XMQ I;  4DV6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...