1I94I

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94I00
4DXLA 4DV2E 4DUYI 2UXDI 4DV5E 4KHPI 4DPYA 4LF9E 4LF8I 1XMQE 4JI7E 4DR6E 2ZM6E 1VISA 4GKKI 4DUZE 2UU9I 4NXMI 4PU9A 4JI8E 4URLA 4UT4A 1EI1A 4DU8A 1XNRE 4DV0E 1FI4A 3GONA 4LFBI 4B3SE 5GMEA 1N33I 3PYGA 4Z7CA 4WUCA 4DV7E 2UUBE 2UXCI 4DUZI 3ZKDA 1ZM2A 1RREA 1UEKA 2HFUA 2ZM6I 2UUCI 4JI2E 1HNXE 1D6TA 4LFAI 1KKHA 4JV5E 4JI2I 2HFSA 4Z7YA 1H7SA 3LTOA 1N36I 2VQEE 1FKAE 1N36E 1NHHA 4KQVA 4X62I 4JI1I 4JI6I 4B3TE 2HK2A 1N34I 2UXBI 4JV5I 4DPXA 3B8HA 4AQYI 4X65I 1Z0VA 4JI8I 4R1FA 4NXME 3OTOI 4JI4I 4B3RE 4ED4A 3LPSA 4DPUA 4YHHE 5IWAE 3ZZUA 2R42A 4LF8E 4DR1E 4B3SI 2HKEA 3Q1QA 4DV5I 4GKJE 4DUYE 2UXDE 4DV2I 2ZBKB 3PYFA 2XEXA 2J7KA 4X66E 1WUUA 4XTJA 4X66I 4DV1E 1RR9A 4HYMA 4B3ME 4FWDA 4WUDA 3J80Q 4HACB 1ZM3A 1S4EA 1HNWE 2A2CA 1NHIA 3QT6A 4LF4E 4LF9I 4DPWA 4LF6E 1Z5AA 1OJ4A 1FWLA 1ELOA 2F4VI 3CWVA 2F4VE 2V2QA 3WU4A 4DV1I 5IT9C 1N34E 4DV6E 4DR3I 4JI1E 1HR0E 5LMNI 1DARA 4P52A 4WUBA 4UTGA 5IWAI 1ZM9A 1KVKA 3WU3A 4FN5A 3PYEA 2HKJA 1N0VC 4I3HA 3JAMC 1IBKE 1Z0CA 4DR2I 2V2VA 3HULA 4JI4E 1Z5CA 1Z5BA 2LJPA 4DR4I 4FW9A 5LMUE 4JI5I 5L3JA 4JI3I 2VQFI 1MG7A 2R3VA 4AQYE 2WW4A 1IBKI 1ZXMA 4OX9E 4OX9I 2UUAE 4JI0E 1J5EE 4X64I 4PRXA 4JI0I 4DV3E 4DR1I 1Z59A 1H73A 5GMDA 2HHHI 1H74A 5FLXC 4DR4E 4B3RI 4JI3E 4LF5I 4LFCI 4JYAE 2HK3A 1PVGA 4JI5E 4LFAE 5IT9Q 5BR8E 4B3TI 1HNWI 4YHHI 3OTOE 1Z0EA 2V8PA 2CZ9A 4DR2E 3M6AA 3B82A 2UU9E 1B63A 2AJ4A 1H7UA 4X64E 4DV0I 4DR7I 4USMA 1XNQI 1Z0TA 4JI7I 1HR0I 4DR7E 3ZZTA 4HXZA 1A6FA 4LFCE 4LF5E 1IBLI 4RPFA 1HNXI 1HNZE 2VF3A 4ZVIA 1MU5A 1HNZI 2UXCE 4LF7E 1XMQI 3T1YE 4LFBE 1IBME 4DR5I 1J5EI 2BM1A 2UXBE 1EA6A 2UUCE 2BV3A 3PYDA 3B78A 4MYUA 3QT5A 1NHJA 1S16A 1B62A 1PIEA 4DPTA 3T1HI 4GKKE 1KTVA 2EFGA 1Z0WA 1XNRI 2NPFA 1BKNA 4JG4A 4DR5E 4P7AA 4KHPE 2V34A 3T1YI 4EMDA 2BM0A 4LF6I 4PRVA 3ZM7A 2OI2A 4DV7I 2UUBI 1FJGE 4B3MI 4X65E 1XMOE 1U2RA 1QZRA 5LMNE 2GS8A 3J81C 1K47A 1N32I 1FNMA 4K0KI 4FWHA 4NXNI 3JAMQ 4GKJI 1IBMI 1Z0GA 4DV4E 4DR6I 1ZXNA 2E1RA 2E5LE 3D4JA 3F0NA 2E5LI 1H72C 5BR8I 1KIJA 4JYAI 2Q2EB 4MYTA 2V2ZA 4NXNE 3K1JA 3WU6A 2ZITA 1ZM4A 1Z0BA 1N32E 3QT8A 4DU7A 1MX0A 3T1HE 3ZKBA 5LL6R 2UUAI 2DEJA 1I94I 4DV6I 3QT7A 4HY1A 4DR3E 1PKPA 2A2DA 1I94E 3WU5A 3J7AG 3V2UC 3J81Q 5LMUI 4LF4I 4M1KA 4DV4I 1IBLE 2VQEI 1N33E 4HACA 3ZZ0A 4YY3E 1FJGI 3LNUA 5FLXQ 4JI6E 2HHHE 1FWKA 1XNQE 3J80C 3K17A 1NZ0A 2X7IA 4X62E 4DV3I 3J7AM 5A2QC 1N0UA 2DEIA 1XMOI 5A2QQ 2VQFE 3H4LA 4LF7I 4K0KE 1XHKA 3V5RA 2X36A 4YY3I 4USKA 4FWGA
chains in the Genus database with same CATH superfamily
2Z5EA 4DXLA 4DV2E 4DUYI 2UXDI 4DV5E 4KHPI 4DPYA 4MQYA 4LF9E 4LF8I 1XMQE 2IOQA 3PS2A 2O1TA 4JI7E 3CDIA 4DR6E 2ZM6E 3HKMA 1VISA 4GKKI 4DUZE 2UU9I 4NXMI 4PU9A 4JI8E 4URLA 4OO1A 2JEAB 4UT4A 1EI1A 4IZJD 4BA1A 5EL9A 4DU8A 3UHMA 1XNRE 5K36F 5JEAB 4DV0E 2BA0G 4GQUA 1FI4A 3GONA 4LFBI 4B3SE 5GMEA 3H1CA 1N33I 3PYGA 4Z7CA 1R6LA 4WUCA 2Z5CA 1UDNA 4DV7E 2UUBE 2UXCI 4DUZI 3ZKDA 1ZM2A 1RREA 1UEKA 2HFUA 4U3BA 2ZM6I 2UUCI 2WNRB 2PNLA 4JI2E 2PO2B 1HNXE 3P3GA 1D6TA 4LFAI 3Q6NA 5JEAA 1KKHA 5EKWA 4JV5E 2NN6B 1USUA 4BA1B 2C38A 4JI2I 4OO1F 2HFSA 2IESA 4Z7YA 1H7SA 2VESA 3LTOA 4IZJB 1N36I 4IFDD 5C0XE 2VQEE 1FKAE 1N36E 1NHHA 2IERA 4KQVA 4X62I 4OO1B 1E3PA 4OO1C 2PO0A 2NN6E 4JI1I 4JI6I 4B3TE 2HK2A 1N34I 2UXBI 4JV5I 4DPXA 2C39B 3B8HA 4IZKA 4AQYI 4X65I 1XXEA 1Z0VA 5DRPA 4LOMA 4R1FA 2PO0B 4JI8I 4NXME 3OTOI 5ELWA 4JI4I 4B3RE 4ED4A 3LPSA 4DPUA 4YHHE 5JEAF 5IWAE 3ZZUA 2R42A 4LF8E 3GCMA 4U3DA 4MU3A 2IOPA 4NBQA 4DR1E 4B3SI 2HKEA 3Q1QA 4DV5I 4GKJE 2Z5BA 4DUYE 2UXDE 4DV2I 5K36C 2ZBKB 3PYFA 2XEXA 2J7KA 2PNMA 4X66E 1WUUA 4N3OA 4XTJA 4X66I 4DV1E 5K36A 1RR9A 4HYMA 4B3ME 2PNZA 4FWDA 4WUDA 3J80Q 4HACB 1ZM3A 1UDQA 4OZEA 4FW3A 1S4EA 1HNWE 2O1WA 2A2CA 1NHIA 3QT6A 2JT2A 4DPWA 4LF4E 4LF9I 4J3DA 4LF6E 1Z5AA 1OJ4A 1FWLA 1ELOA 2BR2B 2F4VI 2GQ0A 3CWVA 5DRQA 3Q6MA 2F4VE 2V2QA 3WU4A 4DV1I 2C37B 5IT9C 1N34E 4DV6E 4DR3I 4JI1E 1HR0E 4AIMA 5LMNI 5C0XA 1DARA 4P52A 4WUBA 4OKGA 3L7ZB 4UTGA 2PNZB 2C38B 3B4TA 5IWAI 1ZM9A 1KVKA 3WU3A 4FN5A 3PYEA 1N0VC 2HKJA 4I3HA 3JAMC 1IBKE 1Y4UA 1Z0CA 4DR2I 2V2VA 3HULA 4JI4E 1Z5CA 1Z5BA 4OO1E 1YH8A 2NN6C 2LJPA 4FW5A 4DR4I 4FW9A 1Y5YA 5LMUE 5DRRA 2JE6A 4JI5I 5L3JA 4QNKA 3M85G 4JI3I 2VQFI 1MG7A 2J65A 2R3VA 4AQYE 2WW4A 1IBKI 2Z5CB 1UDSA 1HK7A 1ZXMA 4IFDB 4OX9E 4OX9I 2UUAE 4JI0E 1J5EE 4X64I 4PRXA 4AM3A 4JI0I 4DV3E 4DR1I 1Z59A 1H73A 4LPFA 5JEAE 5GMDA 2HHHI 1H74A 3GLLA 5FLXC 4DR4E 4B3RI 4JI3E 1YHCA 4LF5I 4LFCI 2PO1B 1R6MA 4JYAE 2HK3A 1PVGA 4JI5E 4LFAE 5IT9Q 5BR8E 3P3CA 4MU0A 4QNJA 4B3TI 1HNWI 4YHHI 2BA0D 4IZJA 2PO1A 5C0XC 3OTOE 1Z0EA 4IFDC 2V8PA 2CZ9A 4DR2E 3M6AA 3B82A 2UU9E 1B63A 2AJ4A 1H7UA 4X64E 2GO3A 4DV0I 4DR7I 4USMA 1XNQI 1Z0TA 4JI7I 1HR0I 2GO4A 4DR7E 3ZZTA 2WNRA 4HXZA 1A6FA 2WP8B 4LFCE 4LF5E 4IFDA 1IBLI 4RPFA 1HNXI 2F1DA 4BA2B 4IFDF 1HNZE 2VF3A 4ZVIA 1MU5A 2BA1G 1HNZI 2UXCE 4LF7E 1XMQI 3T1YE 4LFBE 1IBME 4DR5I 1J5EI 5K36D 2BM1A 4FW6A 2UXBE 3L7ZA 1EA6A 2UUCE 2BV3A 3PYDA 3B78A 5C0XF 4FW4A 4MYUA 3QT5A 1NHJA 1S16A 1B62A 5DNLA 1PIEA 4DPTA 2NN6F 3T1HI 2JEBA 4GKKE 1KTVA 1OYPA 2JEBB 5DNXA 2EFGA 1Z0WA 1XNRI 2NPFA 1BKNA 4JG4A 4DR5E 4P7AA 4KHPE 2V34A 3M7NG 3T1YI 4EMDA 3GMEA 1OYRA 2BM0A 4LF6I 4PRVA 3ZM7A 2OI2A 3U1KA 3P3EA 2JE6B 3KRNA 4LCFA 4DV7I 2UUBI 1FJGE 4B3MI 1RHYA 1P42A 3CDJA 4X65E 1XMOE 1U2RA 3P76A 3M85D 1QZRA 5LMNE 4BA2A 2GS8A 3J81C 1K47A 4LCGA 1N32I 1FNMA 4K0KI 4IS9A 4FWHA 4MDTA 4NXNI 3JAMQ 4GKJI 1IBMI 3DD6A 5JEAD 1VI7A 1Z0GA 4DV4E 2JEAA 3PS3A 4DR6I 1ZXNA 2E1RA 2E5LE 3D4JA 3F0NA 2C39A 2E5LI 1USVA 1H72C 5BR8I 3K85A 5K36E 1KIJA 2AE8A 4JYAI 2Q2EB 4MYTA 1E3HA 2V2ZA 4NXNE 1OYSA 3K1JA 3WU6A 2ZITA 3PRYA 1ZM4A 1Z0BA 1N32E 1Y60A 3QT8A 4DU7A 5FWKA 1MX0A 3T1HE 3ZKBA 3HJCA 5LL6R 4IFDE 1Y6ZA 2CVEA 2UUAI 2DEJA 1I94I 2Z5BB 4DV6I 3QT7A 4HY1A 4DR3E 1PKPA 2BA1D 2A2DA 1I94E 4ISAA 2PO2A 4OO1D 3WU5A 2O1VA 3J7AG 3V2UC 4FW7A 3J81Q 5LMUI 4LF4I 5C0XD 3NZKA 2BR2A 4IZKB 4LCHA 4M1KA 5JEAC 5DROA 5K36B 4DV4I 2NN6D 3PS1A 1IBLE 2VQEI 1N33E 3M7ND 4HACA 3ZZ0A 4YY3E 1FJGI 2O3ZA 3LNUA 2CGEA 5FLXQ 2WP8A 4MU4A 4JI6E 2HHHE 1FWKA 1XNQE 4MU1A 3J80C 3K17A 1NZ0A 1UDOA 3P06A 2X7IA 4X62E 4DV3I 3J7AM 5A2QC 1N0UA 2DEIA 1XMOI 5A2QQ 2C37A 2VQFE 2O1UA 3H4LA 4AIDA 4LF7I 2NN6A 1Y4SA 3U1YA 4K0KE 1XHKA 2CG9A 3V5RA 2X36A 4YY3I 4USKA 4FWGA 5C0XB
chains in the Genus database with same CATH topology
2Z5EA 4DXLA 4DV2E 4DUYI 2UXDI 4DV5E 4KHPI 4DPYA 4LF9E 4LF8I 1XMQE 2IOQA 2O1TA 4JI7E 4DR6E 2ZM6E 1VISA 4GKKI 4DUZE 2UU9I 4NXMI 4PU9A 4JI8E 4URLA 4UT4A 1EI1A 4IZJD 4DU8A 1XNRE 4DV0E 1FI4A 3GONA 4LFBI 4B3SE 5GMEA 1N33I 3PYGA 4Z7CA 4WUCA 2Z5CA 4DV7E 2UUBE 2UXCI 4DUZI 3ZKDA 1ZM2A 1RREA 1UEKA 2HFUA 2ZM6I 2UUCI 2PNLA 4JI2E 1HNXE 1D6TA 4LFAI 3Q6NA 1KKHA 4JV5E 1USUA 4JI2I 2HFSA 4Z7YA 1H7SA 3LTOA 4IZJB 1N36I 2VQEE 1FKAE 1N36E 1NHHA 4KQVA 4X62I 4JI1I 4JI6I 4B3TE 2HK2A 1N34I 2UXBI 4JV5I 4DPXA 3B8HA 4IZKA 4AQYI 4X65I 1Z0VA 4JI8I 4R1FA 4NXME 3OTOI 4JI4I 4B3RE 4ED4A 3LPSA 4DPUA 4YHHE 5IWAE 3ZZUA 2R42A 4LF8E 2IOPA 4DR1E 4B3SI 2HKEA 3Q1QA 4DV5I 4GKJE 2Z5BA 4DUYE 2UXDE 4DV2I 2ZBKB 3PYFA 2XEXA 2J7KA 2PNMA 4X66E 1WUUA 4N3OA 4XTJA 4X66I 4DV1E 1RR9A 4HYMA 4B3ME 4FWDA 4WUDA 3J80Q 4HACB 1ZM3A 1S4EA 1HNWE 2O1WA 2A2CA 1NHIA 3QT6A 4LF4E 4DPWA 4LF9I 4LF6E 1Z5AA 1OJ4A 1FWLA 1ELOA 2F4VI 2GQ0A 3CWVA 3Q6MA 2F4VE 2V2QA 3WU4A 4DV1I 5IT9C 1N34E 4DV6E 4DR3I 4JI1E 1HR0E 5LMNI 1DARA 4P52A 4WUBA 4UTGA 5IWAI 1ZM9A 1KVKA 3WU3A 4FN5A 3PYEA 1N0VC 2HKJA 4I3HA 3JAMC 1IBKE 1Y4UA 1Z0CA 4DR2I 2V2VA 3HULA 4JI4E 1Z5CA 1Z5BA 2LJPA 4DR4I 4FW9A 5LMUE 4JI5I 5L3JA 4JI3I 2VQFI 1MG7A 2R3VA 4AQYE 2WW4A 1IBKI 2Z5CB 1HK7A 1ZXMA 4OX9E 4OX9I 2UUAE 4JI0E 1J5EE 4X64I 4PRXA 4JI0I 4DV3E 4DR1I 1Z59A 1H73A 5GMDA 2HHHI 1H74A 5FLXC 4DR4E 4B3RI 4JI3E 4LF5I 4LFCI 4JYAE 2HK3A 1PVGA 4JI5E 4LFAE 5IT9Q 5BR8E 4B3TI 1HNWI 4YHHI 4IZJA 3OTOE 1Z0EA 2V8PA 2CZ9A 4DR2E 3M6AA 3B82A 2UU9E 1B63A 2AJ4A 1H7UA 4X64E 4DV0I 4DR7I 4USMA 1XNQI 1Z0TA 4JI7I 1HR0I 4DR7E 3ZZTA 4HXZA 1A6FA 4LFCE 4LF5E 1IBLI 4RPFA 1HNXI 1HNZE 2VF3A 4ZVIA 1MU5A 1HNZI 2UXCE 4LF7E 1XMQI 3T1YE 4LFBE 1IBME 4DR5I 1J5EI 2BM1A 2UXBE 1EA6A 2UUCE 2BV3A 3PYDA 3B78A 4MYUA 3QT5A 1NHJA 1S16A 1B62A 1PIEA 4DPTA 3T1HI 4GKKE 1KTVA 2EFGA 1Z0WA 1XNRI 2NPFA 1BKNA 4JG4A 4DR5E 4P7AA 4KHPE 2V34A 3T1YI 4EMDA 2BM0A 4LF6I 4PRVA 3ZM7A 2OI2A 4DV7I 2UUBI 1FJGE 4B3MI 4X65E 1XMOE 1U2RA 1QZRA 5LMNE 2GS8A 3J81C 1K47A 1N32I 1FNMA 4K0KI 4FWHA 4NXNI 3JAMQ 4GKJI 1IBMI 1Z0GA 4DV4E 4DR6I 1ZXNA 2E1RA 2E5LE 3D4JA 3F0NA 2E5LI 1USVA 1H72C 5BR8I 3K85A 1KIJA 4JYAI 2Q2EB 4MYTA 2V2ZA 4NXNE 3K1JA 3WU6A 2ZITA 3PRYA 1ZM4A 1Z0BA 1N32E 3QT8A 4DU7A 5FWKA 1MX0A 3T1HE 3ZKBA 3HJCA 5LL6R 1Y6ZA 2UUAI 2DEJA 1I94I 2Z5BB 4DV6I 3QT7A 4HY1A 4DR3E 1PKPA 2A2DA 1I94E 3WU5A 2O1VA 3J7AG 3V2UC 3J81Q 5LMUI 4LF4I 4IZKB 4M1KA 4DV4I 1IBLE 2VQEI 1N33E 4HACA 3ZZ0A 4YY3E 1FJGI 3LNUA 2CGEA 5FLXQ 4JI6E 2HHHE 1FWKA 1XNQE 3J80C 3K17A 1NZ0A 3P06A 2X7IA 4X62E 4DV3I 3J7AM 5A2QC 1N0UA 2DEIA 1XMOI 5A2QQ 2VQFE 2O1UA 3H4LA 4LF7I 1Y4SA 4K0KE 1XHKA 2CG9A 3V5RA 2X36A 4YY3I 4USKA 4FWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXL A;  4DV2 E;  4DUY I;  2UXD I;  4DV5 E;  4KHP I;  4DPY A;  4LF9 E;  4LF8 I;  1XMQ E;  4JI7 E;  4DR6 E;  2ZM6 E;  1VIS A;  4GKK I;  4DUZ E;  2UU9 I;  4NXM I;  4PU9 A;  4JI8 E;  4URL A;  4UT4 A;  1EI1 A;  4DU8 A;  1XNR E;  4DV0 E;  1FI4 A;  3GON A;  4LFB I;  4B3S E;  5GME A;  1N33 I;  3PYG A;  4Z7C A;  4WUC A;  4DV7 E;  2UUB E;  2UXC I;  4DUZ I;  3ZKD A;  1ZM2 A;  1RRE A;  1UEK A;  2HFU A;  2ZM6 I;  2UUC I;  4JI2 E;  1HNX E;  1D6T A;  4LFA I;  1KKH A;  4JV5 E;  4JI2 I;  2HFS A;  4Z7Y A;  1H7S A;  3LTO A;  1N36 I;  2VQE E;  1FKA E;  1N36 E;  1NHH A;  4KQV A;  4X62 I;  4JI1 I;  4JI6 I;  4B3T E;  2HK2 A;  1N34 I;  2UXB I;  4JV5 I;  4DPX A;  3B8H A;  4AQY I;  4X65 I;  1Z0V A;  4JI8 I;  4R1F A;  4NXM E;  3OTO I;  4JI4 I;  4B3R E;  4ED4 A;  3LPS A;  4DPU A;  4YHH E;  5IWA E;  3ZZU A;  2R42 A;  4LF8 E;  4DR1 E;  4B3S I;  2HKE A;  3Q1Q A;  4DV5 I;  4GKJ E;  4DUY E;  2UXD E;  4DV2 I;  2ZBK B;  3PYF A;  2XEX A;  2J7K A;  4X66 E;  1WUU A;  4XTJ A;  4X66 I;  4DV1 E;  1RR9 A;  4HYM A;  4B3M E;  4FWD A;  4WUD A;  3J80 Q;  4HAC B;  1ZM3 A;  1S4E A;  1HNW E;  2A2C A;  1NHI A;  3QT6 A;  4LF4 E;  4LF9 I;  4DPW A;  4LF6 E;  1Z5A A;  1OJ4 A;  1FWL A;  1ELO A;  2F4V I;  3CWV A;  2F4V E;  2V2Q A;  3WU4 A;  4DV1 I;  5IT9 C;  1N34 E;  4DV6 E;  4DR3 I;  4JI1 E;  1HR0 E;  5LMN I;  1DAR A;  4P52 A;  4WUB A;  4UTG A;  5IWA I;  1ZM9 A;  1KVK A;  3WU3 A;  4FN5 A;  3PYE A;  2HKJ A;  1N0V C;  4I3H A;  3JAM C;  1IBK E;  1Z0C A;  4DR2 I;  2V2V A;  3HUL A;  4JI4 E;  1Z5C A;  1Z5B A;  2LJP A;  4DR4 I;  4FW9 A;  5LMU E;  4JI5 I;  5L3J A;  4JI3 I;  2VQF I;  1MG7 A;  2R3V A;  4AQY E;  2WW4 A;  1IBK I;  1ZXM A;  4OX9 E;  4OX9 I;  2UUA E;  4JI0 E;  1J5E E;  4X64 I;  4PRX A;  4JI0 I;  4DV3 E;  4DR1 I;  1Z59 A;  1H73 A;  5GMD A;  2HHH I;  1H74 A;  5FLX C;  4DR4 E;  4B3R I;  4JI3 E;  4LF5 I;  4LFC I;  4JYA E;  2HK3 A;  1PVG A;  4JI5 E;  4LFA E;  5IT9 Q;  5BR8 E;  4B3T I;  1HNW I;  4YHH I;  3OTO E;  1Z0E A;  2V8P A;  2CZ9 A;  4DR2 E;  3M6A A;  3B82 A;  2UU9 E;  1B63 A;  2AJ4 A;  1H7U A;  4X64 E;  4DV0 I;  4DR7 I;  4USM A;  1XNQ I;  1Z0T A;  4JI7 I;  1HR0 I;  4DR7 E;  3ZZT A;  4HXZ A;  1A6F A;  4LFC E;  4LF5 E;  1IBL I;  4RPF A;  1HNX I;  1HNZ E;  2VF3 A;  4ZVI A;  1MU5 A;  1HNZ I;  2UXC E;  4LF7 E;  1XMQ I;  3T1Y E;  4LFB E;  1IBM E;  4DR5 I;  1J5E I;  2BM1 A;  2UXB E;  1EA6 A;  2UUC E;  2BV3 A;  3PYD A;  3B78 A;  4MYU A;  3QT5 A;  1NHJ A;  1S16 A;  1B62 A;  1PIE A;  4DPT A;  3T1H I;  4GKK E;  1KTV A;  2EFG A;  1Z0W A;  1XNR I;  2NPF A;  1BKN A;  4JG4 A;  4DR5 E;  4P7A A;  4KHP E;  2V34 A;  3T1Y I;  4EMD A;  2BM0 A;  4LF6 I;  4PRV A;  3ZM7 A;  2OI2 A;  4DV7 I;  2UUB I;  1FJG E;  4B3M I;  4X65 E;  1XMO E;  1U2R A;  1QZR A;  5LMN E;  2GS8 A;  3J81 C;  1K47 A;  1N32 I;  1FNM A;  4K0K I;  4FWH A;  4NXN I;  3JAM Q;  4GKJ I;  1IBM I;  1Z0G A;  4DV4 E;  4DR6 I;  1ZXN A;  2E1R A;  2E5L E;  3D4J A;  3F0N A;  2E5L I;  1H72 C;  5BR8 I;  1KIJ A;  4JYA I;  2Q2E B;  4MYT A;  2V2Z A;  4NXN E;  3K1J A;  3WU6 A;  2ZIT A;  1ZM4 A;  1Z0B A;  1N32 E;  3QT8 A;  4DU7 A;  1MX0 A;  3T1H E;  3ZKB A;  5LL6 R;  2UUA I;  2DEJ A;  1I94 I;  4DV6 I;  3QT7 A;  4HY1 A;  4DR3 E;  1PKP A;  2A2D A;  1I94 E;  3WU5 A;  3J7A G;  3V2U C;  3J81 Q;  5LMU I;  4LF4 I;  4M1K A;  4DV4 I;  1IBL E;  2VQE I;  1N33 E;  4HAC A;  3ZZ0 A;  4YY3 E;  1FJG I;  3LNU A;  5FLX Q;  4JI6 E;  2HHH E;  1FWK A;  1XNQ E;  3J80 C;  3K17 A;  1NZ0 A;  2X7I A;  4X62 E;  4DV3 I;  3J7A M;  5A2Q C;  1N0U A;  2DEI A;  1XMO I;  5A2Q Q;  2VQF E;  3H4L A;  4LF7 I;  4K0K E;  1XHK A;  3V5R A;  2X36 A;  4YY3 I;  4USK A;  4FWG A; 
#chains in the Genus database with same CATH topology
 2Z5E A;  4DXL A;  4DV2 E;  4DUY I;  2UXD I;  4DV5 E;  4KHP I;  4DPY A;  4MQY A;  4LF9 E;  4LF8 I;  1XMQ E;  2IOQ A;  3PS2 A;  2O1T A;  4JI7 E;  3CDI A;  4DR6 E;  2ZM6 E;  3HKM A;  1VIS A;  4GKK I;  4DUZ E;  2UU9 I;  4NXM I;  4PU9 A;  4JI8 E;  4URL A;  4OO1 A;  2JEA B;  4UT4 A;  1EI1 A;  4IZJ D;  4BA1 A;  5EL9 A;  4DU8 A;  3UHM A;  1XNR E;  5K36 F;  5JEA B;  4DV0 E;  2BA0 G;  4GQU A;  1FI4 A;  3GON A;  4LFB I;  4B3S E;  5GME A;  3H1C A;  1N33 I;  3PYG A;  4Z7C A;  1R6L A;  4WUC A;  2Z5C A;  1UDN A;  4DV7 E;  2UUB E;  2UXC I;  4DUZ I;  3ZKD A;  1ZM2 A;  1RRE A;  1UEK A;  2HFU A;  4U3B A;  2ZM6 I;  2UUC I;  2WNR B;  2PNL A;  4JI2 E;  2PO2 B;  1HNX E;  3P3G A;  1D6T A;  4LFA I;  3Q6N A;  5JEA A;  1KKH A;  5EKW A;  4JV5 E;  2NN6 B;  1USU A;  4BA1 B;  2C38 A;  4JI2 I;  4OO1 F;  2HFS A;  2IES A;  4Z7Y A;  1H7S A;  2VES A;  3LTO A;  4IZJ B;  1N36 I;  4IFD D;  5C0X E;  2VQE E;  1FKA E;  1N36 E;  1NHH A;  2IER A;  4KQV A;  4X62 I;  4OO1 B;  1E3P A;  4OO1 C;  2PO0 A;  2NN6 E;  4JI1 I;  4JI6 I;  4B3T E;  2HK2 A;  1N34 I;  2UXB I;  4JV5 I;  4DPX A;  2C39 B;  3B8H A;  4IZK A;  4AQY I;  4X65 I;  1XXE A;  1Z0V A;  5DRP A;  4LOM A;  4R1F A;  2PO0 B;  4JI8 I;  4NXM E;  3OTO I;  5ELW A;  4JI4 I;  4B3R E;  4ED4 A;  3LPS A;  4DPU A;  4YHH E;  5JEA F;  5IWA E;  3ZZU A;  2R42 A;  4LF8 E;  3GCM A;  4U3D A;  4MU3 A;  2IOP A;  4NBQ A;  4DR1 E;  4B3S I;  2HKE A;  3Q1Q A;  4DV5 I;  4GKJ E;  2Z5B A;  4DUY E;  2UXD E;  4DV2 I;  5K36 C;  2ZBK B;  3PYF A;  2XEX A;  2J7K A;  2PNM A;  4X66 E;  1WUU A;  4N3O A;  4XTJ A;  4X66 I;  4DV1 E;  5K36 A;  1RR9 A;  4HYM A;  4B3M E;  2PNZ A;  4FWD A;  4WUD A;  3J80 Q;  4HAC B;  1ZM3 A;  1UDQ A;  4OZE A;  4FW3 A;  1S4E A;  1HNW E;  2O1W A;  2A2C A;  1NHI A;  3QT6 A;  2JT2 A;  4DPW A;  4LF4 E;  4LF9 I;  4J3D A;  4LF6 E;  1Z5A A;  1OJ4 A;  1FWL A;  1ELO A;  2BR2 B;  2F4V I;  2GQ0 A;  3CWV A;  5DRQ A;  3Q6M A;  2F4V E;  2V2Q A;  3WU4 A;  4DV1 I;  2C37 B;  5IT9 C;  1N34 E;  4DV6 E;  4DR3 I;  4JI1 E;  1HR0 E;  4AIM A;  5LMN I;  5C0X A;  1DAR A;  4P52 A;  4WUB A;  4OKG A;  3L7Z B;  4UTG A;  2PNZ B;  2C38 B;  3B4T A;  5IWA I;  1ZM9 A;  1KVK A;  3WU3 A;  4FN5 A;  3PYE A;  1N0V C;  2HKJ A;  4I3H A;  3JAM C;  1IBK E;  1Y4U A;  1Z0C A;  4DR2 I;  2V2V A;  3HUL A;  4JI4 E;  1Z5C A;  1Z5B A;  4OO1 E;  1YH8 A;  2NN6 C;  2LJP A;  4FW5 A;  4DR4 I;  4FW9 A;  1Y5Y A;  5LMU E;  5DRR A;  2JE6 A;  4JI5 I;  5L3J A;  4QNK A;  3M85 G;  4JI3 I;  2VQF I;  1MG7 A;  2J65 A;  2R3V A;  4AQY E;  2WW4 A;  1IBK I;  2Z5C B;  1UDS A;  1HK7 A;  1ZXM A;  4IFD B;  4OX9 E;  4OX9 I;  2UUA E;  4JI0 E;  1J5E E;  4X64 I;  4PRX A;  4AM3 A;  4JI0 I;  4DV3 E;  4DR1 I;  1Z59 A;  1H73 A;  4LPF A;  5JEA E;  5GMD A;  2HHH I;  1H74 A;  3GLL A;  5FLX C;  4DR4 E;  4B3R I;  4JI3 E;  1YHC A;  4LF5 I;  4LFC I;  2PO1 B;  1R6M A;  4JYA E;  2HK3 A;  1PVG A;  4JI5 E;  4LFA E;  5IT9 Q;  5BR8 E;  3P3C A;  4MU0 A;  4QNJ A;  4B3T I;  1HNW I;  4YHH I;  2BA0 D;  4IZJ A;  2PO1 A;  5C0X C;  3OTO E;  1Z0E A;  4IFD C;  2V8P A;  2CZ9 A;  4DR2 E;  3M6A A;  3B82 A;  2UU9 E;  1B63 A;  2AJ4 A;  1H7U A;  4X64 E;  2GO3 A;  4DV0 I;  4DR7 I;  4USM A;  1XNQ I;  1Z0T A;  4JI7 I;  1HR0 I;  2GO4 A;  4DR7 E;  3ZZT A;  2WNR A;  4HXZ A;  1A6F A;  2WP8 B;  4LFC E;  4LF5 E;  4IFD A;  1IBL I;  4RPF A;  1HNX I;  2F1D A;  4BA2 B;  4IFD F;  1HNZ E;  2VF3 A;  4ZVI A;  1MU5 A;  2BA1 G;  1HNZ I;  2UXC E;  4LF7 E;  1XMQ I;  3T1Y E;  4LFB E;  1IBM E;  4DR5 I;  1J5E I;  5K36 D;  2BM1 A;  4FW6 A;  2UXB E;  3L7Z A;  1EA6 A;  2UUC E;  2BV3 A;  3PYD A;  3B78 A;  5C0X F;  4FW4 A;  4MYU A;  3QT5 A;  1NHJ A;  1S16 A;  1B62 A;  5DNL A;  1PIE A;  4DPT A;  2NN6 F;  3T1H I;  2JEB A;  4GKK E;  1KTV A;  1OYP A;  2JEB B;  5DNX A;  2EFG A;  1Z0W A;  1XNR I;  2NPF A;  1BKN A;  4JG4 A;  4DR5 E;  4P7A A;  4KHP E;  2V34 A;  3M7N G;  3T1Y I;  4EMD A;  3GME A;  1OYR A;  2BM0 A;  4LF6 I;  4PRV A;  3ZM7 A;  2OI2 A;  3U1K A;  3P3E A;  2JE6 B;  3KRN A;  4LCF A;  4DV7 I;  2UUB I;  1FJG E;  4B3M I;  1RHY A;  1P42 A;  3CDJ A;  4X65 E;  1XMO E;  1U2R A;  3P76 A;  3M85 D;  1QZR A;  5LMN E;  4BA2 A;  2GS8 A;  3J81 C;  1K47 A;  4LCG A;  1N32 I;  1FNM A;  4K0K I;  4IS9 A;  4FWH A;  4MDT A;  4NXN I;  3JAM Q;  4GKJ I;  1IBM I;  3DD6 A;  5JEA D;  1VI7 A;  1Z0G A;  4DV4 E;  2JEA A;  3PS3 A;  4DR6 I;  1ZXN A;  2E1R A;  2E5L E;  3D4J A;  3F0N A;  2C39 A;  2E5L I;  1USV A;  1H72 C;  5BR8 I;  3K85 A;  5K36 E;  1KIJ A;  2AE8 A;  4JYA I;  2Q2E B;  4MYT A;  1E3H A;  2V2Z A;  4NXN E;  1OYS A;  3K1J A;  3WU6 A;  2ZIT A;  3PRY A;  1ZM4 A;  1Z0B A;  1N32 E;  1Y60 A;  3QT8 A;  4DU7 A;  5FWK A;  1MX0 A;  3T1H E;  3ZKB A;  3HJC A;  5LL6 R;  4IFD E;  1Y6Z A;  2CVE A;  2UUA I;  2DEJ A;  1I94 I;  2Z5B B;  4DV6 I;  3QT7 A;  4HY1 A;  4DR3 E;  1PKP A;  2BA1 D;  2A2D A;  1I94 E;  4ISA A;  2PO2 A;  4OO1 D;  3WU5 A;  2O1V A;  3J7A G;  3V2U C;  4FW7 A;  3J81 Q;  5LMU I;  4LF4 I;  5C0X D;  3NZK A;  2BR2 A;  4IZK B;  4LCH A;  4M1K A;  5JEA C;  5DRO A;  5K36 B;  4DV4 I;  2NN6 D;  3PS1 A;  1IBL E;  2VQE I;  1N33 E;  3M7N D;  4HAC A;  3ZZ0 A;  4YY3 E;  1FJG I;  2O3Z A;  3LNU A;  2CGE A;  5FLX Q;  2WP8 A;  4MU4 A;  4JI6 E;  2HHH E;  1FWK A;  1XNQ E;  4MU1 A;  3J80 C;  3K17 A;  1NZ0 A;  1UDO A;  3P06 A;  2X7I A;  4X62 E;  4DV3 I;  3J7A M;  5A2Q C;  1N0U A;  2DEI A;  1XMO I;  5A2Q Q;  2C37 A;  2VQF E;  2O1U A;  3H4L A;  4AID A;  4LF7 I;  2NN6 A;  1Y4S A;  3U1Y A;  4K0K E;  1XHK A;  2CG9 A;  3V5R A;  2X36 A;  4YY3 I;  4USK A;  4FWG A;  5C0X B; 
#chains in the Genus database with same CATH homology
 2Z5E A;  4DXL A;  4DV2 E;  4DUY I;  2UXD I;  4DV5 E;  4KHP I;  4DPY A;  4LF9 E;  4LF8 I;  1XMQ E;  2IOQ A;  2O1T A;  4JI7 E;  4DR6 E;  2ZM6 E;  1VIS A;  4GKK I;  4DUZ E;  2UU9 I;  4NXM I;  4PU9 A;  4JI8 E;  4URL A;  4UT4 A;  1EI1 A;  4IZJ D;  4DU8 A;  1XNR E;  4DV0 E;  1FI4 A;  3GON A;  4LFB I;  4B3S E;  5GME A;  1N33 I;  3PYG A;  4Z7C A;  4WUC A;  2Z5C A;  4DV7 E;  2UUB E;  2UXC I;  4DUZ I;  3ZKD A;  1ZM2 A;  1RRE A;  1UEK A;  2HFU A;  2ZM6 I;  2UUC I;  2PNL A;  4JI2 E;  1HNX E;  1D6T A;  4LFA I;  3Q6N A;  1KKH A;  4JV5 E;  1USU A;  4JI2 I;  2HFS A;  4Z7Y A;  1H7S A;  3LTO A;  4IZJ B;  1N36 I;  2VQE E;  1FKA E;  1N36 E;  1NHH A;  4KQV A;  4X62 I;  4JI1 I;  4JI6 I;  4B3T E;  2HK2 A;  1N34 I;  2UXB I;  4JV5 I;  4DPX A;  3B8H A;  4IZK A;  4AQY I;  4X65 I;  1Z0V A;  4JI8 I;  4R1F A;  4NXM E;  3OTO I;  4JI4 I;  4B3R E;  4ED4 A;  3LPS A;  4DPU A;  4YHH E;  5IWA E;  3ZZU A;  2R42 A;  4LF8 E;  2IOP A;  4DR1 E;  4B3S I;  2HKE A;  3Q1Q A;  4DV5 I;  4GKJ E;  2Z5B A;  4DUY E;  2UXD E;  4DV2 I;  2ZBK B;  3PYF A;  2XEX A;  2J7K A;  2PNM A;  4X66 E;  1WUU A;  4N3O A;  4XTJ A;  4X66 I;  4DV1 E;  1RR9 A;  4HYM A;  4B3M E;  4FWD A;  4WUD A;  3J80 Q;  4HAC B;  1ZM3 A;  1S4E A;  1HNW E;  2O1W A;  2A2C A;  1NHI A;  3QT6 A;  4LF4 E;  4DPW A;  4LF9 I;  4LF6 E;  1Z5A A;  1OJ4 A;  1FWL A;  1ELO A;  2F4V I;  2GQ0 A;  3CWV A;  3Q6M A;  2F4V E;  2V2Q A;  3WU4 A;  4DV1 I;  5IT9 C;  1N34 E;  4DV6 E;  4DR3 I;  4JI1 E;  1HR0 E;  5LMN I;  1DAR A;  4P52 A;  4WUB A;  4UTG A;  5IWA I;  1ZM9 A;  1KVK A;  3WU3 A;  4FN5 A;  3PYE A;  1N0V C;  2HKJ A;  4I3H A;  3JAM C;  1IBK E;  1Y4U A;  1Z0C A;  4DR2 I;  2V2V A;  3HUL A;  4JI4 E;  1Z5C A;  1Z5B A;  2LJP A;  4DR4 I;  4FW9 A;  5LMU E;  4JI5 I;  5L3J A;  4JI3 I;  2VQF I;  1MG7 A;  2R3V A;  4AQY E;  2WW4 A;  1IBK I;  2Z5C B;  1HK7 A;  1ZXM A;  4OX9 E;  4OX9 I;  2UUA E;  4JI0 E;  1J5E E;  4X64 I;  4PRX A;  4JI0 I;  4DV3 E;  4DR1 I;  1Z59 A;  1H73 A;  5GMD A;  2HHH I;  1H74 A;  5FLX C;  4DR4 E;  4B3R I;  4JI3 E;  4LF5 I;  4LFC I;  4JYA E;  2HK3 A;  1PVG A;  4JI5 E;  4LFA E;  5IT9 Q;  5BR8 E;  4B3T I;  1HNW I;  4YHH I;  4IZJ A;  3OTO E;  1Z0E A;  2V8P A;  2CZ9 A;  4DR2 E;  3M6A A;  3B82 A;  2UU9 E;  1B63 A;  2AJ4 A;  1H7U A;  4X64 E;  4DV0 I;  4DR7 I;  4USM A;  1XNQ I;  1Z0T A;  4JI7 I;  1HR0 I;  4DR7 E;  3ZZT A;  4HXZ A;  1A6F A;  4LFC E;  4LF5 E;  1IBL I;  4RPF A;  1HNX I;  1HNZ E;  2VF3 A;  4ZVI A;  1MU5 A;  1HNZ I;  2UXC E;  4LF7 E;  1XMQ I;  3T1Y E;  4LFB E;  1IBM E;  4DR5 I;  1J5E I;  2BM1 A;  2UXB E;  1EA6 A;  2UUC E;  2BV3 A;  3PYD A;  3B78 A;  4MYU A;  3QT5 A;  1NHJ A;  1S16 A;  1B62 A;  1PIE A;  4DPT A;  3T1H I;  4GKK E;  1KTV A;  2EFG A;  1Z0W A;  1XNR I;  2NPF A;  1BKN A;  4JG4 A;  4DR5 E;  4P7A A;  4KHP E;  2V34 A;  3T1Y I;  4EMD A;  2BM0 A;  4LF6 I;  4PRV A;  3ZM7 A;  2OI2 A;  4DV7 I;  2UUB I;  1FJG E;  4B3M I;  4X65 E;  1XMO E;  1U2R A;  1QZR A;  5LMN E;  2GS8 A;  3J81 C;  1K47 A;  1N32 I;  1FNM A;  4K0K I;  4FWH A;  4NXN I;  3JAM Q;  4GKJ I;  1IBM I;  1Z0G A;  4DV4 E;  4DR6 I;  1ZXN A;  2E1R A;  2E5L E;  3D4J A;  3F0N A;  2E5L I;  1USV A;  1H72 C;  5BR8 I;  3K85 A;  1KIJ A;  4JYA I;  2Q2E B;  4MYT A;  2V2Z A;  4NXN E;  3K1J A;  3WU6 A;  2ZIT A;  3PRY A;  1ZM4 A;  1Z0B A;  1N32 E;  3QT8 A;  4DU7 A;  5FWK A;  1MX0 A;  3T1H E;  3ZKB A;  3HJC A;  5LL6 R;  1Y6Z A;  2UUA I;  2DEJ A;  1I94 I;  2Z5B B;  4DV6 I;  3QT7 A;  4HY1 A;  4DR3 E;  1PKP A;  2A2D A;  1I94 E;  3WU5 A;  2O1V A;  3J7A G;  3V2U C;  3J81 Q;  5LMU I;  4LF4 I;  4IZK B;  4M1K A;  4DV4 I;  1IBL E;  2VQE I;  1N33 E;  4HAC A;  3ZZ0 A;  4YY3 E;  1FJG I;  3LNU A;  2CGE A;  5FLX Q;  4JI6 E;  2HHH E;  1FWK A;  1XNQ E;  3J80 C;  3K17 A;  1NZ0 A;  3P06 A;  2X7I A;  4X62 E;  4DV3 I;  3J7A M;  5A2Q C;  1N0U A;  2DEI A;  1XMO I;  5A2Q Q;  2VQF E;  2O1U A;  3H4L A;  4LF7 I;  1Y4S A;  4K0K E;  1XHK A;  2CG9 A;  3V5R A;  2X36 A;  4YY3 I;  4USK A;  4FWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...