1USUA

The structure of the complex between aha1 and hsp90
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
256
structure length
246
Chain Sequence
b'PTKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKSVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 74
structure length 246
sequence length 256
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1usuA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usuA02
2O1TA 1Y4UA 2IOPA 3HJCA 3Q6MA 1HK7A 5FWKA 1USUA 2IOQA 2O1UA 2O1VA 1Y4SA 3Q6NA 3PRYA 1USVA 1Y6ZA 2CG9A 2CGEA 2O1WA 2GQ0A
chains in the Genus database with same CATH superfamily
1HNWB 4CKBA 2ODBA 2WOJA 1OLSA 3HA2A 3OQVA 5HILA 1YBAA 3RO7A 3BTUA 1KXZA 2WU8A 5AVZA 5LFAA 1DINA 2HLDA 3GRCA 3CNHA 1TZCA 3ZGVA 4LCJA 3K9WA 5TQVA 3WJ7A 4BE7B 1N0WA 2SCUB 1PSZA 2W2KB 1RQ7A 2WUGA 1ZI9A 4JIMA 4QREA 5FPHA 3R8XA 6CHYA 3T7RA 3HXQA 3OVMA 3J7TA 1PJQA 1NM5A 1OU0A 4KV9A 4QBFA 1GU0A 3TJMA 1YMVA 4D9KA 5KEIA 3NBFA 2NPFA 1TO2E 5F7ZA 4C7MA 5CVTA 4HYMA 2P65A 3V8QA 1ZD9A 4REOA 4BQOA 4C01A 5D5HA 2VR1A 4OBBA 4JVMA 3O1HB 1EX7A 1DOHA 2IEIA 1I33A 1QQ5A 1W2HA 5B3JC 4BC1A 1V8ZA 3AHIA 3G6WA 2CVQA 3BD9A 5CIQA 2P90A 1FDUA 1A04A 3C8DA 2ORWA 4US1R 1ZN9A 5BV7A 2J6HA 4YJDA 3RFTA 1EA5A 3AHDA 3VR5A 5I7VA 1XD2A 3K31A 2ZJ0A 4RFSB 4MNTA 2VJNA 3IH5A 2ORIA 5TEVA 3M9XA 1UBUS 2GK4A 1SB8A 3OCYA 3PWKA 1QB7A 2JFYA 2IV7A 2AJDA 5KNBH 1J9GA 2VF3A 2SBTA 5DHAA 4UQOA 5CDHA 1C1DB 2PRIA 2D1QA 1SGWA 3FYUB 5DYIA 4AIRA 2E5LE 1UMDB 4OGWA 4MQMA 3NTXA 3LO5A 1NQVA 3L7BA 3JZDA 5FD8A 3S6JA 1I01A 1U2PA 1E3WA 1P4RA 1RSZA 4IM7A 4ND7A 2JJ2D 3U19A 1GPYA 4PZCA 4WCVA 1LLQA 4ZC1A 2QVCA 2XTNA 4AT1A 3GG2A 5HIJA 4O59O 1H6AA 4XWAA 3ZG6A 2ZAGA 1JKXA 1A8UA 2DQSA 4JX9A 2ZWVA 1Z74A 2FZVA 1R6LA 4DDKA 2GAFA 1PR4A 2P35A 3BTSA 4O8ZA 1RM0A 1KJQA 3OPNA 5FOVA 4E13A 1N8SA 4LHEA 1WPQA 1GUAA 4LTNA 1P19A 1B8VA 2OAGA 5FI3A 4AS2A 4BKQA 5HBRA 5T6MA 3OZBA 1ODCA 4URZR 4RD0A 3KSZO 2D5BA 3I0ZA 2UYQA 1HDIA 3O8OB 4MVJP 4O4HF 1KEEB 3LIPA 3FFAA 2R96A 1N1GA 5CW1A 4DV7B 1U0BB 3D5TA 3FDZB 2WVAA 4MRMA 5SYNA 3RVBA 5GMDA 2PYIA 3COVA 4UEWA 5IVHA 1KY3A 3ORSA 3B51X 1IPEA 2C5HA 4RLHA 1EEXB 2I3AA 5FOWA 2OT3B 2RBKA 5C1BA 1T9HA 4IX9A 3S2ZA 4C4RA 5F73A 2ZRMA 4XE5A 2CL0X 3WYEA 4HAIA 4C43A 1TM3E 2J3HA 3RSOA 2Q1XA 1W93A 2BFOA 3D8RA 3EAFA 2R6CA 4WSOA 5I8PA 1ISFA 1EM8B 3LQ4A 2BGMA 4G5QA 1U2GC 2JF0A 3JQAA 3N0XA 5KTRA 4X97A 5JMPA 1TQ8A 1YJXA 3IQEA 2QUZA 4FMPA 1SVSA 3P8ZA 1IDN1 1YZUA 4H7JA 1T8SA 1LX6A 3G2PA 4OXYA 2F3UA 2P6MA 4EHJA 4I6JA 1I94I 2RAPA 1U2SA 2NUBA 5THXA 1N8KA 5HK9A 2ILTA 4HQ6A 1Q0PA 1SVNA 3E4DA 2HF9A 1WKVA 1A9ZA 5D87A 2I4LA 5C8YB 4EA9A 1DQPA 1MT3A 3Q88A 5CURA 5E9WA 1D6NA 8GPBA 2IS1A 4N01A 4KPUB 2ZBPA 3O95A 3LUFA 1USUA 1QPBA 1GCGA 1SBNE 3NUGA 3QUAA 4M0EA 4BB9A 4N7BA 4M89A 2AMLA 5AJXA 3ZGYA 3EVGA 4W5NA 2NO6A 1JEAA 1R18A 2PIDA 2XV1A 3NWPA 4OL9A 4X64B 3ZD9A 4D4MA 4F2PA 5ADVA 1SEVA 4CKXA 4ZQGA 1YRAA 4FFBB 4EYSA 1GXSA 3PPIA 3NC0C 2X5KO 4RQUA 3IA2A 3WKBA 1EINA 2JANA 3ZHQA 1JHVA 4YMGA 3D9QX 4DIEA 1XTQA 4R7TA 4AN4A 3L7DA 1RM5A 3PNPA 4X91A 2JGDA 3N2KB 2QZ4A 1ZIOA 4OXRA 4FYJA 3T3MB 1GGHA 2VBCA 3NYWA 4GFDA 1Z16A 3TMKA 3I5YA 2A30A 2ID9A 2PNFA 1T2DA 4L5JA 2XAAA 2IOQA 1FQJA 1EWVA 1IBRA 2YY6A 4IMRA 4X3CA 1IEXA 2Q5OA 2W2LD 4X7BA 4IQ4A 4JBXA 1XR3A 3HDVA 3TSOA 3FUXA 2H4JA 2GD2A 1B1AA 2ZRJA 2NP7A 3HULA 3K1AA 3PXCX 4P53A 1DAOA 1X0VA 4S2UA 3BIXA 4MXDA 2YVUA 5GTDA 3DLTA 2P9TA 3WP0A 3DEKA 2OCXA 4ERXA 2IXAA 5KC8A 2G1KA 1X92A 3P2IA 1EM6A 1REQA 4WEQA 5CJJA 4RTQA 1OV4A 4C78A 1ZPDA 4FW5A 3U1YA 1PDVA 2WKPA 2XE8A 4B7XA 5KMGA 4RHEA 3EVEA 3ZBQA 3NT4A 5F4ZA 1M6EX 3OZAA 4MRPA 2BFDA 4KHPE 2GLXA 2H2AA 2EKQA 1S2DA 1TFRA 2YX1A 2CHEA 3ZXSA 3CO5A 3ZQUA 1LW7A 5JLJA 2YXNA 3QX7A 4E1AA 1QTNA 3MGAA 4RF3A 5DASA 4PIVA 2BR2B 4X6YA 1PQYA 3IIMA 5J4LA 2FPOA 3BZUA 4F3CA 2Q7XA 3WHKA 1VYTA 4RETA 1TUGA 2JLWA 1DC6A 2YINC 1KVQA 1OBOA 1M5TA 5EMNA 1WXXA 4G1UC 3DVAA 4K8OA 3MM4A 5IK2A 3E18A 2P9FA 5C34B 5JXIA 3GLLA 1IL0A 1F2VA 3JWJA 1WS6A 1PX0A 2CNDA 5TF0A 3LHFA 2FUKA 1VL8A 1JXMA 2B7BA 4RELA 4Y0VA 3GP5A 4ID3A 3ZGOA 5CBPB 4RX1A 5IT9A 5K36C 2BA0D 1NP6A 4URLA 2PD6A 1I3CA 3MUOA 3THWA 1VIMA 4X6LA 1QF9A 4RY0A 4ZI7B 1KQGA 3FMVA 3L8GA 1LLDA 1JI3A 1FPQA 4HS4A 4Y1EA 3EXIB 3FGPA 4CI0B 4DV0B 5IASA 1H1DA 4BATA 3ME5A 3ROMA 1Y5LA 4B3HA 4DIUA 2GM9A 3TDNA 5HA5A 2ECQA 1W4ZA 3DBIA 4OU5A 3DLHA 3FPSA 4WLFA 5DTRA 3QVXA 3OQIA 2VSXA 4JSYA 3UC9A 2BN4A 2Q3EA 2XUGA 3ED5A 4RTSA 1QOZA 2WTNA 3HDQA 2QSJA 1UZAA 3A6FA 5A4FS 1NC1A 3IA7A 3GRRA 4NHOA 4NU5A 4RSHA 3V7YA 3O2SB 3GJSA 3W34A 1K92A 3ZTTA 1Z5AA 2R5WA 4R5HA 1G18A 1UBOS 4E46A 1L7XA 5GGXA 4UNRA 1JQLB 2V0NA 1P31A 1JMVA 4NNOA 3EFOA 1C7QA 1H0RA 3L6BA 5HSGA 4MVWA 1DEHA 3DTVB 5H59A 1L5NA 4QLOA 3NAZA 4HWGA 1CZOA 5FHQA 1AD2A 3VOAA 4QU8A 4FE4A 1HE1C 3HHEA 1YZGA 4ZQHA 4MIKA 3A6JA 3MTQA 4TKMA 4MKXA 3UUWA 3UW3A 1G7RA 1QX3A 1RYEA 2COKA 2VHQA 2UYGA 1W1UA 2DTDA 3EE6A 4M8IA 5J59A 5JWHA 2WYVA 4QSHA 1I1QB 4HMQA 4PZZA 3VJLA 5DNCA 3DEAA 4R84A 2EIHA 3GL9A 3W5DA 4L4XA 2JZOA 5EJ2A 4EJSB 5KX5B 3C7KA 4LF4E 3L0CA 1UR5A 2HRBA 1PZXA 4LBWA 4RPIA 3RGWS 4L4SA 1ECGA 2I7CA 3MJFA 4LV5B 2Q3HA 2GZRA 1JLLB 2FW0A 1OGJA 1M1ZA 2XVZA 3K2BA 3LVQE 3O3OB 4IFDB 2XE6A 4QU0A 1XMXA 4US0R 5AWFC 3ZNOA 4CN8A 1TXGA 5AVRA 2Z83A 1CHNA 3HA7A 4XM1A 4WFKA 5AD1A 4R2XA 2Q27A 5KTYA 3JS5A 2FSVA 5FUMA 1T3HA 1MF7A 2X2PA 4JI5I 1KEWA 2FB9A 4GS5A 1NJGA 4UREA 3G8DA 1SR8A 3UT0A 1IQRA 4WDRA 2FG7C 1OVGA 4J3NA 2OLKA 2IY7A 2J6CA 2BKVA 1ORDA 5IU6A 4K81B 4MVYA 1E8MA 1YBFA 4PZLA 3AMVA 4TLBA 3SC2A 2VKTA 4H60A 3H1TA 1UK9A 3OAAD 5FOXA 1H0HA 4NKRA 2ZRLA 3WDMA 2WF8A 3SN6A 1N3BA 1YB6A 4I4TB 4B5LA 2FN9A 4JUBA 2P3SA 4PTLA 3EWIA 5AVYA 2RJ3A 2R4TA 1W87A 4DMKA 5JYDA 4Z4FA 5E7MA 1DC4A 3JQFC 2Q4DA 3IMFA 3KYBA 3U1VA 2XNDD 2FOIA 2GM3A 3QBTA 3TLZA 2IPAB 4BA2A 1I7PA 3I0NA 2F3RA 4JOSA 1P5FA 2GF9A 1PFQA 1MJGA 3ETNA 4TVOA 2WMYA 2O20A 4DIDA 4BQIA 3SQDA 4QXMA 2IODA 3UJCA 1L8OA 1XMIA 1XMOB 2WAMA 2IXGA 3ZU2A 3CTPA 4FW3A 5JAPA 1ZNZA 4DJFC 1Q0QA 1U02A 2CXQA 2HZ7A 2OCPA 3T95A 3ZVLA 4U02A 2A9JA 3MIIA 1Y1PA 3NHYA 1MU5A 5EKXA 4FNMA 1FIUA 4X64I 1GVHA 1R6DA 2G88A 4M22A 3CB4A 4L72A 4AMBA 3JX9A 3ZD6A 3WMFA 1WF6A 1HE4A 1P0MA 3CX8A 3NTUA 4XKJA 3LY5A 5FTMA 1PF7E 5JD3A 1HMPA 3B7WA 2FRDC 4QATA 3GFVA 1M72A 2HU2A 4X5OA 2DLNA 4YMTA 1ZK0A 1QPZA 3KWFA 1ZN7A 5F5XA 1RKUA 1XJ5A 4K9OA 3O8RA 1LVGA 2JA1A 4GMXA 5ALIA 3I5UA 5H3CA 1CUZA 4K6FA 2J3KA 2FMKA 1JLHA 2H7VA 4F4CA 2YZ7A 3AR3A 1TC2A 4QVIA 3FW1A 4TM8A 3PEEA 3SHTA 1QMGA 1X38A 1R4ZA 2GCGA 3EXG2 5FWKA 4YUWA 2ZI9A 5JISA 3KU4A 4OKNA 3IPXA 2LZ0A 3M89A 4FNAA 4CMJA 2RB4A 4IS9A 2NUAB 1DBQA 3FZQA 4YO7A 3BWEA 3MXOA 3AUKA 4KG7A 4HZUB 4U7FA 1LNSA 2ORED 3WLLA 4UBMA 1FW6A 5J2TB 4B0PA 1NQOA 1CUFA 1PDOA 5CCDA 5TNXA 4FMDB 3HYCA 2EFDB 4B7UA 4O4LA 4LOAA 4UHBA 1U7ZA 5BVGB 1Y34E 5AXBA 3HBFA 1IXKA 4DLLA 1XTJA 4GXTA 1KHTA 1BD3A 4AMGA 3E7PA 2VRWA 1QZXA 4ZVOA 1AF4A 4J75A 4NS4A 4OJKA 3QHPA 3HHPA 4OHMA 4KBGA 1GQOA 2J41A 5K99A 3WZ2A 3AY0A 1K8YB 3SZRA 1QV9A 2C42A 4LJ5A 3SI7A 3CPJB 1CE8B 1SKQA 1TUBA 2A0YA 4BNXA 3SKXA 1L5ZA 1UXKA 4MS3B 3EVTA 3TNYA 5K05A 3P2OA 4Y6QA 2ZP1A 5TMEA 4NXNB 3CDJA 4I6GA 3R5FA 4F96A 1GSOA 1V16A 3JU3A 2Q6OA 1UKAA 3AIKA 4TROA 3BGOS 3TQCA 1DFIA 3V4FA 2IKQA 4BLQA 4WTOA 4FZRA 4YX9A 5L4LA 1NVBA 2W90A 2ANCA 3WLQA 1XPUA 5IN5A 4B3FX 3AFNA 5IC5A 5TPZD 1RT9A 2EZTA 2FGJA 3O7WA 5IABA 2O6HA 1E9VA 1FUIA 2ZSBA 3ZR4B 1I3OA 1M7GA 1Q3KA 3HR7A 4NAUA 4PV7A 1R10A 3CLHA 1NY5A 1T2VA 3JVVA 3X1JA 1ATZA 2B21A 2MMGA 3BWDD 5DNEA 3ZDEA 4DQXA 1HXHA 1I51A 2L42A 1ODKA 3LWZA 2IYTA 5KOJB 3PCXA 1E77A 1YDHA 1SC4A 3INTA 3V4PB 4XTCS 1NUPA 4DQUA 1H2HA 3D7MA 3R6DA 4JLSA 4UOZA 2JLXA 2F1HA 1ZXNA 3JPWA 3HXMA 3NEAA 3FB4A 3PICA 5JUWA 4ZOQI 3D3WB 4YIKA 2JGJA 3TPZA 3U0VA 5BVHA 1VG9B 3DKVA 1YRYE 3MTAA 4HQ0A 1WZEA 4HLUA 3PLAE 3F0NA 1NNLA 2VIIA 1N92A 4ZVMA 2VPZA 5CK4A 4YAEA 1YS6A 4EPTA 1L6RA 2RARA 2R47A 3ADPA 3TN7A 1KU0A 1NRWA 3DKRA 1VGQA 2HLNA 1KOFA 4JLNA 5A9SB 3FYTA 1XNQE 1BQ3A 2BKAA 4MW4A 4D5GA 5LPNA 2WZBA 5DLQC 3A1DA 1SD2A 3H97A 4B74A 5DEOA 3KTOA 4DV4B 3V55A 1RHRA 5ILQA 2IHYA 3CCFA 1K0FA 1CX9B 1P9WA 3RC1A 3B1JA 4FUQA 1GFZA 4TM7A 4BKMA 2B3DA 1LPOA 5FULA 3TWOA 5IZ4A 2EZ9A 1U8UA 2XE4A 1ORVA 2G9RA 1PWEA 3IPYA 5EYPA 2TRSB 5HJ2A 3A27A 3ST7A 5BW6B 3I72A 3PEVA 3QFHA 4X45A 2XOKA 3A4YA 4X9XA 4COOA 3RS9A 4JHXA 1SBHA 2NVUA 4BMNA 3SYLA 1NC3A 4ZJYA 3V3TA 4AICA 3H1PA 4TRMA 3RTEA 2OTCA 4D3FA 4C0QC 3BHMA 1DGQA 2NTJA 2ZB3A 1QGAA 3COYA 1HFJA 3GYBA 1T3SA 4JEHA 5KPDA 3IL2A 2ZVPX 1CUWA 2WIBA 3G2MA 4W1QA 4PAMA 3UV3A 1OYPA 2JH8A 4OA8A 3PNYA 1EJ6A 3FY4A 4XX0A 4P3YA 3GIDA 5FYDA 4DVGA 4DLUA 5FPQA 2H1VA 1E6UA 1ISHA 1E2EA 1UJ4A 3FNIA 1RYNA 3ZWAA 2V7VA 3GDHA 2O5CA 5IC4A 5IZCA 2MINA 3WQHA 1DO0A 4PSVA 2DE0X 4UM9B 4MUJA 3RC7A 2WA1A 2HYIC 4Y8VA 3TECE 1BMDA 3M6MD 4L50A 5DP2A 3VBCA 3ZWYA 4BRSA 2CK3A 2CL5A 2GS9A 3CLUC 3IURA 1OT5A 3C7TA 2GGSA 2QS9A 4ZI3A 4J03A 1H23A 2YXDA 2BF4A 4RK1A 4Z1MD 3OO0A 5LQUA 1D0IA 4L76A 5EL9A 1J70A 1JQBA 1THMA 3MZ0A 4RIGA 3RS3A 4BDTA 3L8HA 4BN4A 3LHIA 4DR1E 1LWOA 3H9CA 1B73A 4JCOA 4FGKA 1DG9A 1XMOI 3I9FA 1H72C 4NNJA 4BO6A 4EY6A 1LPBB 5I7WA 4N49A 4EHLA 5I7UA 2VPIA 1UL1X 2GB4A 4PFJA 4JLAA 5K3EA 2V8OA 3WRWA 2G7ZA 2FSPA 1R8XA 2UYYA 4DTCA 3BFKA 3OMXA 2V7EA 2DM6A 4UMEA 4YXWA 5BR8B 5IWCA 2QX8A 2YFHA 2E37A 3GUCA 4L08A 3VC1A 5LQNA 2QX6A 3DHEA 2O52A 1O95A 3LVFO 4RPLA 4IV0A 3I6ZA 3SXPA 4U9IS 3A4VA 3ORQA 4BO7A 2FWIA 2DT8A 1OYRA 3JR7A 1OD6A 3KOWA 3NHRA 4KMOA 3LP6A 3RAFC 4DGSA 3ZV4A 2B2XA 4OLAA 5HFJA 3BGVA 4BLOA 5TE9A 5SYMA 4NBWA 4EYQA 4RTRA 5EPEA 4I19A 1SUBA 3HBNA 3I42A 4PGAA 2DHDA 3EQZA 3AU8A 3X1ZA 2DSTA 4QNMA 3P9NA 1CJSA 3L6DA 4R1SA 4BEBA 5AVWA 1SXQA 2DR2A 4GECA 1UKZA 1EGHA 4E3WA 1WW2A 3FWNA 4KXUA 3FFBA 4PU9A 4V38A 4ZWNA 4PFQA 2QRVB 3LUHA 4P2BA 1UXOA 2JI4A 1KDYA 3FRJA 4ND3A 4E15A 4BGUA 1SCUA 3VR6H 4A0HA 1XNHA 4EMTA 2XUFA 4D0RA 2P69A 2QXYA 3A31A 2CXRA 1YJQA 2QTLA 3IJEB 2JIOA 2Z9BA 2E1PA 2QNIA 1P7ZA 3SSNA 1PJ8A 5BYJA 4FZ5A 2GUWA 3B20A 5A3VA 3KR2A 2H29A 3TQFA 2ZSDA 1OLUA 1ONOA 3H7IA 4H1UA 2WK1A 2FLVA 1I13A 2VOEA 1WUJS 4JKOA 4GX2A 1BHQ1 5FL7D 1XVLA 5DLEA 4FOTA 5AFSA 1U9ZA 1JR3D 4BLRA 4DPTA 4O4IB 1O6CA 4CG0A 4L27A 4G01B 4IFDD 5A2QC 3M7IA 1OIVA 4FFLA 1U9IA 2BAGA 4HFJA 5HUJA 2VKQA 3CLSD 2PJUA 2FUG6 4J43A 1L7AA 3W0LB 1ZBDA 4LZOA 1NKSA 4NAHA 3HJFA 1JPUA 4QGHA 4CBVA 5CR9A 3EZGA 2FRXA 3E7DA 4NXNI 2ODTX 1PL0A 4R8MA 1KDPA 3TRJA 4V1CA 3O83A 3QU4A 5CT5A 4HGRA 5E6RA 3SBXA 1ZSYA 5F98A 3PUHA 1B2RA 3G0GA 1U2DC 4EHIA 4O4LF 2AG8A 3D4JA 1OWLA 3GCZA 1ZNWA 4PC3A 3TLGA 4D1YA 4O2AB 4O3MA 1BKYA 3HS3A 4DPKA 4FB4A 4DPYA 1U4OA 4B40A 4XA8A 1UBCA 1JSRA 3AJ8A 3EVZA 4GBJA 1ZJ4A 2FQWA 1GGEA 3AM3A 3LLMA 3TOCA 4PFSA 5JXWA 5KTSA 1ID1A 1DPFA 1XLTC 3PP8A 4PGMA 2PO2B 4WW0A 3CLTD 5IWAE 1Y89A 3CR8A 2V74B 1Z12A 5LMUE 3OZCA 2ZQYA 4F3TA 2OO7A 4W8GA 4E51A 3FETA 3ZNPA 5HOQA 2PBFA 1UDQA 5ADHA 1AKWA 1DIHA 1T6ZA 1ZUWA 2YKGA 3U7IA 1P0FA 2BP7B 4TWAA 2QD4A 5JC8A 1Z7GA 2D13A 4R4JA 5I9TA 4AYWA 1EGMB 5HMMA 4PGHA 5KI6A 1NMZA 1OGYA 1AG9A 1WMSA 3KO8A 1X94A 1ZGCA 2BE7A 1MABA 1SA0A 1U94A 2QP3A 3DZIA 4CL2A 4DWJA 3QKIA 1K5DA 3TEFA 2B1RA 3C4VA 5CCBA 2GM5A 3AG5A 4JLVA 1ILEA 2QSUA 3ILSA 1XXHA 2CE7A 3D2LA 3QE0A 4LOJA 4LZZA 3W7AA 4F1JA 4YRAA 2XNCA 1WUHS 3PUWA 3QELB 5LZ5A 5DHUA 4LMRA 5K0EA 1N2HA 3KALA 2REQB 3IDSA 1CQXA 3PTZA 3LXXA 1CRPA 1O8CA 1ZP6A 2FQYA 5ITZB 1E98A 1AKQA 1HL3A 1KMIY 1TADA 1VHTA 3KM0A 3OZ7A 1V5FA 4LQCA 3KETA 5JSZA 4E1BA 1UMBA 1YQGA 2E0IA 1EDBA 2FNAA 2HCTA 4Q1EA 1GUYA 3R6LA 4LMBA 1XV5A 2VDVE 1Y7PA 3ER6A 4HRXA 3RLIA 1XKXA 3PRJA 1U5CA 1EMDA 2NO7A 4PCLA 1Q1AA 1OXMA 1HKHA 1K2VN 4XPIB 3UZUA 3ISTA 2QIOA 4WRRA 4MQFB 3TLXA 3LUAA 1GT91 3D5QA 2VNSA 4K6OA 2OZLA 4YBZA 1I7NA 1G1MA 3MXTA 4LWQA 2OESA 2YR0A 3R3SA 2JHFA 1W9MA 5A2QQ 3NEPX 4OQDA 3FZYA 4GF5A 4Q03A 1NXOA 1RAIA 1LNQA 3DZJA 2Q4RA 4HH1A 4EO4A 4Q00A 1G3RA 4LKOA 3GJ7A 4OUDA 5EG5A 3RSFA 4F5YA 1SG0A 4E30A 3EG9A 1FWKA 4OQEA 4ATNA 4D56A 4DCOA 4K5QA 4KGVA 3QWIA 2ALJA 3M1YA 4FOSA 3WL6A 4BPBA 3HEMA 3CG4A 4RF4A 1X8LA 4E12A 1OZGA 2A9QA 2RJOA 1EQ2A 1IZ7A 1RMQA 2KSQA 5CT4A 2XSZD 4G5OA 2A3RA 4NU0A 2ZBEA 5T6BA 1DIRA 3LA6A 5D6OA 2YOFA 3T7TA 5JW6A 3ICQB 1U1CA 4PC1A 5BNZA 4ON9A 4Q47A 1Z68A 3PQEA 5IM5A 2ZKLA 3ABQB 4DCMA 2GHQA 5IS2A 1K88A 1MG0A 3UYLA 1CJCA 1JEEA 3VM6A 3ZV5A 1LPMA 4NAVA 2JFUA 4E3ZA 8OHMA 2ZVQX 1R0WA 2PX4A 4ENRA 3OX1A 1FLNA 4E5MA 2HF8A 3DD5A 1KPGA 3OPVA 3P0IA 4TTAA 3WK6A 3KIPA 3K0CC 3MD0A 1PJTA 5C5CA 1E6EA 2AOWA 2PLFA 2HBYA 2VCEA 4OVKA 3GFQA 2UUPA 2GPYA 3D31A 3UQZA 1Q0HA 1V37A 4TTJA 5C31A 3V2IA 1S0UA 3T1OA 1YH8A 5BR8I 1TTPB 2RI6A 1VRWA 2XGOA 5K6AA 1IJKA 2QTMA 2WU3A 2UXCB 3MK31 3PFBA 3P7MA 4GKKI 4OUKX 5A4KA 4CKZA 3FWZA 4AKSA 1QG4A 2AZXA 4BQPA 1VJDA 5A9TA 1BRMA 5I7SA 3LPSA 4J6FA 3H3JA 4QDJA 3CS3A 3KWJA 4XJSA 1BVRA 5D2CA 1JALA 5EZSA 2E82A 1LXCA 1XP8A 4FBMA 4HL6A 2HPAA 1KYZA 1D4FA 3LF2A 1V7CA 4J0JA 4LRUA 2AG0A 4U9UA 5AHWA 5BMVB 1N2OA 1NBAA 3E8SA 4MUAA 4UHKA 3WWZA 4A91A 1LK5A 1XN1A 4PRYA 3F73A 4MV0A 3QVTA 5FTWA 3N5KA 3DVQX 3DD6A 2BH2A 1NSTA 1U7PA 4B82A 2EIXA 2I4TA 5KQPA 4NWIA 5EIAA 3PGLA 1YRHA 3Q3VA 3QYJA 3AT1A 3GXOA 1RS0A 4FKZA 2WZQA 1VE6A 3P9SA 4LXQA 1NP3A 3D8HA 2A1TR 3QP9A 4QULA 4UVGA 1POWA 3A7DA 4YV1A 4Z8XA 3ORFA 1XCJA 5JE8A 2B83A 2VPQA 1TT5A 4RXUA 1IQUA 1AXEA 1JKFA 1MPTA 2JLBA 5CLFA 2C83A 4ZT3A 3TEJA 1OX4A 1XMVA 5T3UA 2AN4A 5HKAA 1K9SA 3ELBA 1L4EA 2BWJA 3HFSA 4KO2S 5KVVA 3U4AA 1QHFA 1RP7A 2B61A 5JEAA 1XYYA 5MGNA 4JT8A 3UMSA 2PBRA 3G23A 2KPOA 3K09A 4Y3UA 3T3IA 4DCGA 1A9YA 4PYIA 1PV1A 3GPDG 3K1ZA 3UK2A 1N7JA 1S2NA 3G9XA 1RZRD 4BRUA 2HBRA 3DQZA 2CEKA 2ZWMA 3AY3A 2G4VA 5TV2A 5JS8A 3PRYA 1XRSB 1GYQA 2ZROA 3ZD8A 2NT3A 1C0IA 1PD1A 2R6DA 4MRRA 5IFKA 1UBFA 1JSXA 2GRJA 4W7SA 4LC9A 4P0QB 5A2GA 3ONEA 4L9SA 4EJ6A 1NMQA 1A5SB 3DCYA 1SRRA 1U11A 3HFGA 3KX2A 4R8RA 4AIDA 1U2EA 3FUVA 3T5TA 2FR1A 4F85A 4LNAA 3HY6A 4RK5A 3ZE7A 3F1LA 1VSTA 2VAWA 5F52A 4ZCPA 1IB6A 3DTTA 4C4YA 3BGDA 2Q4EA 1DZ3A 1GZ5A 1MFPA 5A6VA 3DEIA 3H6HA 2XBUA 3ONDA 2NP6A 3R7BA 4UM9D 1ZFNA 3G89A 6GPBA 2QT0A 3P4UA 2PUEA 4XGIA 4B3TE 2UV8A 3RBZA 4C0JA 4LK2A 4Q21A 2ABWA 2R6FA 1LRKA 1K6XA 1Z5OA 1XDDA 3ES9A 3C1AA 4R0MA 3N07A 3BMQB 4EX7A 3A1WA 2FR0A 1E3JA 4YAGA 4GDMA 1OBHA 2IDZA 4L5YA 1E0JA 2NN6A 1SBQA 2RK6A 1ZIXA 2YJ5A 2YZGA 3AUYA 3GJYA 5FWDA 5I8WA 1XIVA 4LSZA 5ARCA 2A7XA 1U2ZA 2QV7A 4G0YA 1CY6A 3ELDA 3KSUA 2X7HA 4NMXB 4TYMA 2WJIA 3HXKA 1J39A 4R2IA 2OG2A 5C1DA 2PXHA 2QD5A 3PPYA 4EF4A 1EX6A 4BWVA 5I4KA 2RGCA 4PAQA 5FADA 5JS2A 3KR9A 3ANTA 1M1YE 3KKKA 4OO1A 1DXHA 1KQ3A 1L4FA 3PQ7A 3PHJA 5D7BA 4ENSA 4AU1A 2AMJA 1TLLA 4DA8A 2Y1OA 5KYWB 4YUYA 3DMFA 3NH6A 1KARA 3DZKA 3HFRA 1JPJA 1VLQA 1BA2A 3R1IA 4Q3KA 2NU9B 4OU4A 4AMVA 3IKVA 3X1YA 2JGRA 2JS7A 4DV2B 1LK0A 1OQAA 2VWGA 5ILGA 4JB2A 2I2FA 1IQ0A 3L9XA 2JEAB 2NZ8A 4PQEA 3X1DA 3GJ0A 5B37A 4CM9A 2VXOA 3SHVA 5AICA 4D6YA 1CQPA 5DI9A 4GIBA 4DV5E 1E5VA 1VJTA 1DTWA 2CYAA 3DSRA 3TBFA 4ANFA 2I1LA 3INNA 3WMEA 2IL1A 1RRPA 3JQGA 2UXBB 2WM9B 4CI9A 5CFMA 1QP0A 4EUEA 4XWKA 2JARA 3GG9A 4UEOA 3GA7A 1ZW1A 4UTOA 1CVLA 3BIJA 4HVLA 2Z08A 3HWSA 4H59A 1GCUA 1HORA 3ZZ0A 1HYQA 1JQKA 3OCUA 4PZPA 3EBLA 2VK4A 1BE6A 3IDZA 3QFFA 4Q1FA 5T41A 4AJNA 4KQCA 5ER6A 1I4DD 4L4UA 1KAQA 3X1XA 3X1WA 1T3LA 2HM7A 1YDGA 4R9RA 4B2PA 3GDFA 3ZHRA 4BNFA 1KZ1A 4URXR 3P9PA 3OKPA 5EESA 3NU1A 3IAS1 3N2YA 1RJGA 2HU8A 3QF7A 3VR1A 2W00A 4WBNA 2D1YA 1VP9A 3C3EA 5ECWA 1T2FA 3TZLA 3HADA 1FDRA 5AKJA 3TL2A 4NATA 4NJMA 3QY9A 1ESCA 4ETMA 2YWEA 1RKQA 4DV3I 1N2JA 1GGJA 1Y6JA 1H5UA 1NUSA 2JH3A 1F2TB 1OMOA 1P1KA 3CN7A 4YY3E 2F48A 3PNLA 4P98A 5I8ZA 4P3PA 3NM4A 3U1TA 2JFZA 3U48A 3WB0A 2DLCX 3RYFA 2QRUA 5ELMA 3R7LA 2ZCVA 4EGSA 3BN3A 1A9OA 1Q50A 4FOOA 1C29B 1IAVA 1Z4QA 3DG9A 1RI5A 1S96A 2HFSA 4C06A 5JNUA 3GT7A 2LCIA 3M3DA 3RS4A 2NSYA 2PS9A 5TR9A 2J33A 3EYAA 4FT4A 2AL7A 2I6FA 4QWWA 3OJWA 3QEJA 1TZMA 5K4GA 4MQLA 1OWMA 3R75A 4XQ9A 2FEMA 1OLOA 4I81A 4J9VA 5C3UA 4ZFNA 2DYKA 5AESA 2GJ9A 1SXJB 5CA0B 2PV0A 3PLNA 2GFIA 2UXCI 2CDRA 3HUTA 3IAAA 1N2EA 3Q6NA 2VDUE 4G0VA 1YE8A 4Z9XA 3ER9A 1U0NA 3RQSA 4A5OA 1OAKA 2X36A 1N2ZA 3IAM6 2H9IA 5TRTA 2EBHX 1WDLA 3VNRA 5A4IS 3WTBA 1II0A 3W2IA 2FP4B 3G2QA 1GG8A 5DX1A 4PWZA 5LMNI 4OJYA 1Y80A 4WKOA 1JIXA 2C99A 2VCYA 4QELA 3RODA 3Q72A 3OH8A 4MA5A 5T57A 1SCDA 3RRMA 1SOMA 2WU1A 4OSEA 3V8RA 4GKBA 1N32I 3H2SA 3BGSA 3RIHA 4NZYA 4HEJA 5L3RA 4Z7OB 4JVLA 4ZTUB 2C2XA 1V71A 1XMJA 1BU5A 5IN4A 1EQAA 4OM8A 3AVQA 4TV8F 2C3MA 2MSKA 4N7MA 1J49A 1GV1A 2BBWA 2XRYA 4CT5A 1YDMA 2ZR7A 3BMCA 4P4SA 1L5KA 3MERA 3WA6A 1EVJA 4AM3A 1LJLA 5IBQA 5KAMA 3PGMA 3NEYA 3UGJA 2Q6IA 2PNMA 4LQLA 3CSDA 1Z6TA 5FFFA 1T4DA 1WQ3A 3VYWA 4UBLA 1M0SA 4BMPB 2JHAA 4IG9A 2NSHA 4RWEA 4HNVA 1T5SA 5KNDH 5DPMA 1N0HA 1Y8RB 3UUGA 5CM9C 3FZGA 4Q82A 1A7AA 1BVUA 5D3MB 1S1MA 3L1IA 3CFYA 1KI7A 4AJ2A 1FJ2A 2O14A 3I1FA 2NU8A 3F9IA 2UU9I 3FCAA 2HX1A 3OFVA 1V3VA 4F86A 2R8XA 3GMTA 1JW9B 2IS4A 4NH4A 1N5KA 1NZFA 2JBAB 2XCRB 3S8EA 4ZAYA 4RTJA 2Q2OA 1CIVA 4QTXA 5DT2A 1BRTA 1CV2A 2IA5A 3OMLA 2FSIA 3DAPA 4P0TA 4UUPA 2EG9A 1VKJA 4JJGA 5LBTA 4QTUB 3TLJA 5KYYB 1NQUA 2JFXA 1L4NA 1FX0B 3QKRB 3TINA 1H1LB 2C8LA 1FTNA 2QXUA 2PH5A 2PRZA 2YFQA 3UXMA 1IBSA 1TA9A 3SS8A 2RH9B 5I7RA 3V34A 5KYUA 1T2EA 1QP4A 1JWBB 4OV6B 3M2PA 3GLHB 2YBEA 5BN3A 1G5RA 1ZCJA 2GBFA 1DWUA 2FFJA 3PTLA 1ILWA 4ZYTA 5DBIA 5JEAF 1B15A 4B79A 4BLTA 2CN1A 4OXKA 2OXRA 1AZSC 3H5WA 3ENZA 4H7PA 4ZZ1A 4DQ0A 4DN6A 2BA0G 1JU3A 1QHHA 1VL5A 1EHCA 1KSHA 2OBFA 2RG7A 3DL4A 4WLOA 2C84A 1Y4AE 4ZVKA 4E6EA 2C3UA 3ANMA 4XSHA 3GLFB 2PSEA 2Q1YA 3CLRC 2E4UA 2VTDA 1C8LA 3RT7A 1LF0A 3SC3A 1LSOA 2AE2A 2QTTA 2HHHE 1OFUA 4DNPA 3NPAA 4RADA 3RC8A 1GUFA 2HA2A 3B1YA 4MV4A 4FFPA 1A2KC 2OHFA 2RKOA 2RFLA 4QTTB 4DF3A 1FVOA 2A84A 1XTTA 4FIDA 5BO5A 4B2LA 1WD7A 3M4XA 4KDCA 5DTEA 1ZNQO 4AN0A 3KFXA 2GCPA 1UDAA 3WSTA 4HNSA 3O8LA 1DKPA 3WC4A 4TUYB 5JNLA 3QPDA 4DLTA 3RIEA 3SX4A 1XMQB 1Z0TA 2E4ZA 4X66B 2YWFA 1TO1E 3IESA 2XMCA 4P5EA 4DR7E 3REOA 5JQGB 4AROA 4POAA 1RI2A 3VNVA 3KB6A 1WU7A 2DHEA 2QLFA 3O8CA 1NXPA 5EAIA 1ZHOA 3QEBZ 5FAXA 3EDMA 4YRDA 5AQ1A 4D4KA 2AFIA 2Z30A 3E4CA 4IFIA 1IUPA 2YXBA 1OX5A 4YA6A 1BTOA 4I4CA 4YRNA 5G40A 3K0HA 4UVIA 1SUEA 2PKXA 4A16A 1ES9A 4N3AA 1VLVA 3JYLA 1P61B 3U3XA 4DJDC 1FU7A 2VLBA 1HNWE 3RC9A 1H4QA 1JDUA 3PUKA 2NN6F 1S3SA 5D5PA 3T7SA 1GKUB 2UXBI 4DUGA 5EIXA 4EIWA 4H08A 3OG9A 3NHAA 5T8KA 2IHBA 3F1KA 5EFZA 4FD2A 3FVVA 5BN5A 4AZ3A 5FWYB 1VLZA 2D59A 3D4NA 2E1RA 2DFKB 2A57A 2AEMA 2JIRA 4HAVA 4L2IA 1E6CA 1UAGA 2Y67A 5CNMA 4OO1F 4KE8A 4BBZA 3CUVA 1IUOA 4MKZA 1G3MA 1MRSA 5HKLA 2GETA 3UAWA 1D1QA 4AUNA 1PZEA 4J1TC 5ANRB 1SHLA 2YJ6A 1TFUA 2O3UA 4JXXA 4HQOA 2H65A 4PGGA 5IAJA 3JD4A 3QTBA 3MLEA 3CNEA 1P7YA 3I2IA 3ILHA 3NONA 2JIZA 2MT9A 5C4MA 1DEKA 4JI3B 2DCMA 3GJ3A 2Z6QA 5FOSA 4JI1B 3V42A 2CV0A 2EJCA 4N9QA 3DO8A 2J5QA 2BL4A 2X8JA 2Z4SA 3HKCB 5K45A 4MVJA 2BSXA 5CGQB 3CNQS 2XWBF 1O9BA 1FJHA 1G8KA 5FNVA 5JYBA 4OYLA 4XX1A 2R8YA 1V3QE 5AUQA 1OI7A 3H1FA 2YNMA 2WUDA 1A7UA 3KDAA 4BZXA 4PIPA 2WY2D 1TQ4A 2ID4A 4Y6LA 2GJ4A 2Q21A 1BYIA 2IP1A 2VWHA 3F7MA 4O29A 1Z22A 3BIFA 5BWMA 2G82A 6YASA 1YO6A 2IXFA 4LF9I 1W4AA 3WU4A 4A0FA 3LTEA 1YQTA 2VH5R 5INTA 1KL7A 3P9ZA 5C7LO 2PCJA 3ELYA 4CU2A 1NN3A 1T6NA 2H0RA 3T38A 1EX1A 2JEOA 1SM4A 1V5GA 1I5EA 3IVXA 2FE4A 2IE8A 4G0OA 4MW7A 4V0NA 5HBGA 4TZTA 4UBIA 4WBNF 1X7ZA 2B2NA 4FEGA 5CH8A 4RD2A 5C1PA 5D1NA 4F72A 1IZ0A 4RE6A 4CM4B 3X1MA 5CLJA 1HNXB 2YCLA 5FA5A 4E5SA 2ZUSA 4OJMX 1IJFA 4M8SA 4WESB 2ZIXA 3HB0A 4AXXA 3PDUA 1NJ2A 4FR2A 4I1SA 3S44A 4B0OA 3AR9A 4Z4QA 1FSSA 1PN3A 3JW8A 2HFKA 1R12A 3S28A 2F4VE 3V7NA 4DV7E 3ZWQA 1KIAA 3DZDA 4N5HX 4LYJA 4B8WA 4A8JB 2OC4A 1Z4PX 2Y68A 4E03A 1ZNXA 3H4TA 1B0ZA 3A2LA 3LQKA 1KC3A 3RTCA 4J0QA 2QYSA 2ZTSA 3O0DA 1Z0VA 2C2GA 2QVXX 1RADA 1QGDA 2ZCUA 3ZYZA 4EABA 4CKWA 5IJ9B 1EDZA 4N5IX 2OCGA 2ZIWB 3I23A 4BO2A 1VJRA 5ALOA 3GNSA 2QI9F 2QM7A 4B81A 4BO1A 2DBVO 2CFSA 2QLLA 3O4GA 1P6XA 1XWIA 1NRJB 1MX5A 2I03A 2LP4Y 1AK1A 2WIKA 1NLZA 1NXQA 4JUDX 4D0NA 1NRIA 1PZMA 2O3QA 2H31A 4DRXA 3Q7TA 4ENVA 1UMCA 1JU9A 1IBLE 2XKAA 1H8HA 4YMLA 2V58A 4BNMA 3IERA 4BV8A 4FHGA 4UTGA 3O4FA 4LF6I 1FTSA 3CF6R 4L57A 2EL9A 5CLHA 4CTOA 2VOJA 2LV8A 1V3UA 1OV6A 1S4EA 1D5WA 2C00A 4UXHA 5D1HA 5ICSA 5KWEA 4L73A 4LRTB 1QGED 3NIFB 4PBRA 3BEOA 2GDJA 4Y6OA 1I0LA 3EQ2A 3RC2A 1UIRA 4DV6I 4F4UA 4I3HA 2PY6A 3BRQA 1SIBE 3WAJA 1FFYA 1RXWA 5DXAA 4E5UA 3UF0A 4MDEA 1KI8A 5TS2A 1J6UA 4TQUS 4AS1A 4YPFA 2JASA 2ODPA 2VPPA 2YS6A 3E22A 3OEED 2WTBA 3OLQA 3OMWA 4BV9A 3SQXA 1QC5A 4EEZA 1SZPA 2C92A 3P26A 4WOKA 4ZIRA 5FQNA 2HRRA 2O8VA 1YHCA 3I76A 3E2IA 2G04A 4L3OA 5FTKA 4Y6GB 5AUPB 2PMEA 1DRJA 1L4GA 2GN2A 3V2UC 4UNIA 4IHKA 5BWNA 4RDHA 1U63A 4ND2A 1MVLA 4MV9A 4OO3A 4PQRA 5HCNA 3PQ6A 4BN0A 1I3LA 5CFZA 5JJ5A 4FGSA 3QHQA 5JIBA 3U1KA 1SUDA 1VB5A 2YYSA 1WIWA 3B3GA 4LSWA 3D3JA 4XIJA 4K6KA 3MHTA 4ARIA 2HWWA 1HRKA 1T15A 3HUEA 3QPUA 1KAHA 4OMUA 1HE2A 1CQIB 1ZY2A 3LG2A 4X8MA 1P8AA 4IVQA 1TQHA 5KWJA 1IOWA 2OHXA 4R8LA 4ZAXA 1BWQA 1RU3A 1YK0A 3W3ZB 5IPFA 4DA4A 3ZY3A 4BVAA 3BF7A 2VQEB 1QRRA 1RQRA 1JFTA 1PQPA 1TRHA 1F60A 4RYDA 2IYSA 1UZLA 2QPLA 4BE4A 1HDGO 2V9ZA 1GFIA 3AESB 2F59A 3KOOA 3ZGZA 2WT8A 4J3DA 4QA9A 3ABSB 1KJWA 5EJEA 1L4MA 4XCVA 3GHHA 4LV6A 4Q05A 2XPCA 3PYLA 4PG4A 3AETB 3QUTA 2WYUA 3EULA 5CG2A 2FU5C 5DROA 3H9UA 3QSGA 1RXIA 1VSBA 3OE7A 3MN1A 4MYCA 3CE6A 3KLBA 2WG2A 2G6TA 3GLIA 1QKIA 1HE5A 2VDMB 2XE7A 3DA8A 1QHGA 1KKMA 2QYOA 4MS4B 1NJFA 3SU8A 3T12A 4BAGA 5C5EA 3L02A 2H18A 1QRDA 4X66I 3PRHA 1IXYA 1QTRA 1QHEA 2ZVJA 1ZQ1A 2JC3A 4ND8A 2YIJA 3TZHA 3P45A 3ND9A 2YWBA 1MOPA 1YS4A 2PWZA 2YQ4A 4MR9A 4UDNA 5GQSA 4OXNA 2P1RA 3JQ7A 1BDJA 4K9QA 2GN6A 2NYVA 2P0AA 3A1UA 2Q6VA 1K86A 1CRWG 3KL4A 4LKRA 2O2DA 4Q3LA 4RTMA 4X7MA 3ILVA 1CS0B 1U0TA 3EGIA 4B43A 4CM8B 1X8KA 2IU3A 5K6TA 1IH8A 1J0AA 1SUSA 3FMOB 3N7AA 1Y60A 3FYHA 5HQ3A 1OLXB 3H8VA 2C8VA 5C0XA 1EWRA 4QXAA 3UKOA 2ODQA 4MP8A 1IONA 1E4EA 2ZUVA 2VQ3A 4IMIB 2RHOA 4UHHA 3ONFA 3DPUA 4DCVA 1AJEA 2X14A 1KO5A 2FPIA 2GRAA 6AT1A 2OV4A 2X5XA 2I6GA 3OZXA 2Z5BA 2IY9A 1DSSG 4JNKA 1ADBA 3NBMA 4H3KB 2R8ZA 4IYJA 2JBHA 5AW6A 3D1LA 3G88A 2VJOA 5JT1A 4M1OA 1ZG3A 4NARA 1V1MB 3PFFA 4DV0E 1SG6A 4DDUA 4O25A 1F4LA 2VVTA 5IXSA 4UNSA 3WLHA 2EFCB 2ERYA 4F2HA 1R5NA 3FROA 1C1HA 3K8QA 3P0EA 4JI1I 2J1LA 1NVVQ 1GG9A 5HS6A 2W6PA 3A3OA 1URPA 2PFSA 3DB2A 4Q12A 2ZZMA 1H93A 2W2TA 1GO2A 4EQ6A 1NVGA 4MKFA 2VDWB 5AUNB 2PNZB 2QUKA 5ARBA 2ONCA 3B6KA 3KPVA 3ZZMA 1L4BA 1XC7A 1ZS9A 4DR4B 1E2JA 1EVLA 3DFKA 4DMUB 2E4XA 1P5ZB 5JAQA 1JHYA 1O03A 1DKNA 2QY6A 3TTVA 3UH1A 5C53B 3IODA 3NCHA 2O23A 5L3ZA 1XXLA 4XWYA 1KTIA 4GKKB 2CUKA 3ETLA 3WDKA 2PX3A 2WD7A 3K73O 4URYR 1LBIA 2PL9A 4NR0A 4EYEA 1I2AA 4KRXA 4CIWA 2BJWA 1GN8A 1VG1A 3WL4A 3WWYA 1QHIA 4LVNA 4ZD6A 4IJKA 1AUOA 4P5DA 4GE3A 521PA 4U2GA 1ZJYA 3F5DA 5EJIA 1A3CA 4TOIA 5KSZA 1FSPA 1KJIA 1JR3E 1E7YA 2X23A 1TYAE 1G4AE 2YQZA 1A5TA 5J47A 4DNFA 4ENTA 1GGNA 4IFDE 3GVPA 3M6FA 3OIFA 1Z17A 4IDAA 1TF7A 2GVNA 4MVJF 1ZR4A 4W5JA 1J5XA 5FNVF 1KS9A 1RIFA 3KTAB 1ULTA 1Z3CA 1E2QA 1JEDA 3QU5A 4PNHA 5F5NA 4Q18A 4DBVO 4CIAA 1EGVB 3FNFA 3B60A 2C0CA 2J5RA 4BVEA 5LZ4A 2YS7A 3GW8A 2O2YA 5B2FA 1WXWA 1Z9BA 2FW1A 3BH6A 3FCEA 1A5ZA 5EOVA 3BICA 1UF9A 2BR4A 3GN2A 3PJGA 4M83A 5EQDA 4YYZA 1JXOA 2CHQA 2QV0A 5CDUA 2WAXA 4HLUC 1DQNA 1T8TA 5E2BA 1OAAA 3Q0EA 4RC9A 1BGXT 2VJQA 1D09A 4NV3A 2J0VA 1K0UA 2PMCA 3VTAA 1KO8A 1VKZA 1JL3A 3H1BA 2W42A 1WA5A 1Z4LA 1RYMA 3CCBA 2WJPA 3EXEB 1U8FO 3MQ4A 3CR7A 3AX6A 1HO3A 4NDNE 1K5GA 5TY0A 1V25A 1BVYF 3F2IA 1FLAA 3LY8A 4U0KA 1H65A 2M1ZA 3AHCA 2ZM6E 2J9GA 2PUAA 5DM2A 4L5IA 1UJNA 3NCTA 5ALPA 3HVIA 2ZRAA 3URKA 3PQDA 3LQQA 2HV8A 4MB2A 5M2QA 3M85D 4DV1B 5FT9A 2HQOA 4WNYA 3PF8A 3HXOA 1XQ9A 4H7IA 4EO9A 3GRKA 3FPGA 1Y3FE 4LGVA 3OESA 4C5CA 4D97A 2XUZA 5IULC 4KPYA 1E3PA 2OLEA 2WBLC 4D0LB 2O8DB 1CB7A 2B5OA 4MYTA 3MJCA 3RU7A 1W2WB 2JAWA 1M0EA 4UOEA 5EMHA 4DPLA 3FLBA 3H16A 1DX4A 2PO1A 4QXRA 3U81A 4NBQA 1CUYA 1D4AA 1BSVA 2PKQO 1L4YA 4JB0A 3EZXA 4KYTA 3CVJA 4N5MA 3SMQA 3UENA 4BB0A 1IBKB 4K8RB 5HP4A 1ZVVA 1XZMA 1ACJA 5AQEA 1PGOA 4NENA 3AERB 3OFND 5A3RA 3EHDA 4HDMA 5K9ZA 1PCXA 2AHOA 3A26A 5K3FA 5H16A 4K9NA 3QWBA 2JCBA 4CJXA 3K2EA 1DUIA 3VYSB 5JSFA 1DC7A 2DAPA 4B4WA 4E2WA 4ER0A 3EIHA 3M7NG 2NQ8A 3UGTA 4N1AA 1CSEE 1EK5A 1X2EA 4MTLA 4P83A 4BFTA 5LMZA 4KQKA 2ASVA 4DJEC 3E3MA 4NE9A 3CJTA 1JJBA 4HB0A 1G8PA 5HZGA 4WY2A 3LW7A 1BCRA 1E1DA 1NI4A 2VN8A 4DPWA 4A2CA 3PNQA 3TZQA 3SIRA 2H5JA 3HA3A 1EDDA 3AI1A 3EWSA 3BFVA 4D2IA 4EGCB 1NVVR 3P3GA 3LC1O 4XUCA 1AVTA 3UV7A 3TTUA 2CLOB 1HRDA 1CRQA 2P5UA 1VZ2A 1SBYA 2R7LA 1C8KA 3GB9A 2DECA 2Z04A 4ZYUA 1U0OC 2KX7A 3OOYA 4RLQA 1GAXA 4XD7A 3UC5A 2PUTA 5THKA 5C7OO 5EJGA 1IN8A 4ZZIA 4OP1A 3CQ9A 4DBZA 1K7YA 421PA 1I2MA 1W5SA 4CMKA 1BKSB 3GPCA 2I2CA 2DERA 2P2LA 2W71A 1Q3HA 3PRKE 4I55A 3GQBA 3F6BX 3WHPA 2CD7A 4DA0A 1V6CA 3K4QA 3DOJA 1NQWA 4LJRA 1GPKA 2QNRA 4U7GA 2FK7A 4J7UA 3WFJA 4IQ8A 2V1XA 1QFYA 4KP7A 1S8AA 5KJEA 1O95C 2CCJA 1OJ4A 2H54A 4HRYA 4IDEA 4L3WA 5JG7A 3RUCA 1U0HC 2H08A 2FDCA 1GQRA 3LL7A 3VHLB 5L3QA 4KXWA 4XR4A 2RE8A 1RWPA 2FJPA 1RQXA 2HA4A 5DIFA 1MO4A 1E0SA 2QMZA 4Q02A 4BO8A 4GZ3A 4CDMA 1QH8B 1ZL0A 3R7WB 3BX1A 3NOVA 4R9VA 1Z25A 5HK8A 3OKAA 3D4BA 1N4DA 3H9JA 2C4NA 2P2SA 2GSWA 4E2YA 3Q87B 2GVDC 1X1AA 4CKBB 2VF7A 2ARKA 4PG8A 5JROA 3KQNA 1OLSB 4QDZA 3JR3A 5AI9A 4EUNA 1ECJA 2COEA 1MC4A 4I8XA 3W6OA 3VSDA 2HKJA 3ZV3A 2R0QC 3PJEA 1E79A 1MT0A 2ZYDA 3TTXA 1WUIS 4LJLA 4OQFA 4BQQA 2YJ3A 4II3A 1X7WB 3L7YA 3OZFA 1E3MA 3K4HA 4TZKA 2GK7A 2I7VA 1FFEA 2H92A 3JRNA 1WMAA 4HYQA 3VPDA 2WRZA 1PE0A 3G0DA 4DBLC 3U16A 4N48A 4PNEA 4ZU3A 2X42A 1YR8A 2WNHA 1P39A 1G6HA 2ZEJA 4P35A 1PO7A 4R68A 1XK7A 3SNKA 2XITA 3VHXA 1Q74A 4BVHA 1C3EA 3AJAA 1CJUC 3I04A 5JVDF 1MORA 2J48A 4HMPA 4IFEA 4JI4I 1ZM4A 2HK9A 1XD2B 4UZSA 4MMZB 3AB7A 3HP1A 2NO0A 3F71A 1A1VA 2BKXA 4PPGA 1ZN2A 2BGJA 3EGVA 4IIUA 1N9ZA 2OXCA 3EEFA 3V5RA 2D7CA 2OL4A 3KEFA 4DR4I 1PZFA 3HU3A 4KLAA 4PVCA 1FBTA 1RNLA 2VF2A 3PG5A 5PGMA 4ARSA 4JLPA 1YFKA 3IILA 1MPXA 2HI0A 1E3WB 4B45A 1RHMA 1RYYA 3VV3A 5K1ZA 3VU9A 5I9BA 5HS4A 3FTCA 1BE8A 1VM6A 1OIXA 3FAKA 4JODA 3SZMA 3ICEA 5CJ2A 3SSOA 4CMEA 3NTVA 4XIFA 3NEJA 4FS3A 4MLPA 3BXOA 3O6VA 1P75A 1G60A 2R7MA 3IO3A 4WGGA 1TF5A 1M1NB 3VVBA 4CKEA 2XB2A 1YFZA 2WT4A 1YAHA 3FZEA 4MWDA 4A9AA 1W88A 2MDTA 3WL3A 3AVVA 1SAYA 3UXEA 1QFXA 2QBYB 5H82A 3OJXA 4AQYB 4JXZA 2QPOA 4EG3A 3K5WA 3W5HA 4GW3A 1SKAA 2CF6A 3R9KA 2Q28A 3MJDA 4ICIA 1QZRA 1YZHA 2QN3A 4YK7A 3U60B 3VJRA 2X0EA 1MAVA 2Q1UA 2YHIA 1WUUA 1L4KA 3MVEA 4FZVA 2FG6C 3HGTA 3T1TA 1SD1A 1DKLA 4IEFB 3J81k 2V7PA 5DM0A 3A0UA 5FI0B 5C2JB 4A0GA 1SPXA 2JLYA 1H7SA 2OXFA 2NAFA 3OCVA 2Q6LA 1F8UA 1RQ2A 2F1KA 3HDGA 4RA9B 2F9FA 4MCIA 3K70B 1RZVA 3IV6A 1SOVA 1KETA 2R1ZA 621PA 3H3FA 5HWSA 3WGYA 1VPLA 2Y99A 3LCMA 3PC8A 4UD2A 3JQAB 3JQDA 1IVNA 3RUFA 2DHQA 1VDZA 1ZD2P 1YRLA 2DR0A 2HPZA 2VBIA 3FNRA 1JDZA 1X1RA 3AQ4A 1S2OA 3K1TA 1GRRA 4M6WA 2WP8A 4DVJA 5LSAA 3NETA 4QXPA 5IANA 4M76B 3NFYA 4EY3A 1A88A 1H9AA 2PS1A 3BD6A 3NRCA 3P0HA 4ZOEA 4INOA 3N6XA 4H0NA 3G49A 4NP6A 2O1WA 4QU9A 3V6LA 2VJPA 3ETJA 1LBQA 3UWSA 3TRHA 4TX1A 2EOAA 3KKMA 2QG6A 1EWYA 3UOAB 5JMWA 4E22A 5HM8A 2V6IA 3F8TA 1Y82A 2XQFA 3UB4A 5ITSA 3QPCA 1G16A 5AP9A 1IHXA 1SU4A 2CVPA 4JMPA 1EBBA 3WWEA 4F3RA 4F2DA 4WK6A 2UUCB 4FKMA 4GX1A 4RVSA 1MGOA 1BD4A 4KFRA 3Q5DA 2BGGA 4NTZA 3KUXA 3FR8A 3FLEA 1IBKI 3ZX4A 4ALNA 1DRUA 2P2NA 4TQ9A 3RUEA 1BQ4A 1K3TA 3TZEA 4A4DA 4N8SA 1GXSB 4KGXA 5AOVA 5KUTA 3N75A 4ASUD 1MAAA 3KOXA 1TCVA 3TW8A 1YV9A 4YMHA 1UEXC 5DH9A 4JYBA 2KM1A 2PSJA 1R6VA 2VJMB 3GR6A 4RU1A 1QRUA 4ZQIA 1G8MA 4Z6KA 3QENA 1WXQA 1L7OA 2BMEA 2R8RA 4TRRA 3WFZA 4GR9A 1RJDA 3STXA 2VH1A 3REFA 3KKZA 5DNLA 3GX1A 1Y6FA 1VIVA 1Y7HA 2YWGA 3R7AA 5LLDA 1TTQB 4E5NA 3L8FA 4ACBA 3O90A 3LPMA 2OMKA 3KPWA 2Q62A 3WK5A 4JL5A 4HDKA 3DP9A 5CDFA 2VYNA 2QA5A 3AJRA 4DYDA 1CJVC 2IOYA 1V95A 2E55A 5AK6A 2PTHA 1SEPA 3UK6A 2OQRA 4NU8X 16PKA 1XRRA 3CW8X 3BKXA 1UBLS 1W5FA 5KMGB 1XWWA 1SBZA 3O2QB 4XFKA 4DOMA 3D6UA 3PZRA 5A5EA 2XB4A 4L5CA 1QP8A 4JP3A 2BFDB 3COSA 4IR7A 1DMRA 2HDOA 1E7QA 3CEJA 5K6AC 1N6PA 3AR8A 4L0MA 4BZQA 5EHZA 3KV1A 3FUWA 3N0WA 3M6UA 3CIOA 4EF6A 3RUHA 4F4IA 3KSBC 4GP7A 4MITA 4IIJF 1Y37A 1MXFA 3FZNA 2CDAA 4GQIA 3U4DA 3P5BA 4CIDA 3C98A 2ZETA 2JFQA 2GNPA 2ZRNA 2RONA 2PPVA 3N39C 5FH9A 1EFRD 2NACA 4RVNA 1H9CA 4P3XA 4G1MB 1O5TA 4Z3DA 3G5AA 3LZDA 1R0CA 3DVAB 1ETHA 3NNSA 2FWBA 4TVBA 3DE5X 3GJXC 1VE1A 2Q9CA 1IOZA 2YTZA 5CDGA 3A1CA 4WUBA 5BSVA 1CETA 2FMHA 8ADHA 2NZUG 3T06B 3L1UA 1JLKA 1V5EA 4Y2GA 2HC9A 3VKVA 3VZDA 3AHFA 2HWKA 1BMQA 2ZW9A 4W7IA 5DHRA 3THWB 4J91A 3I6QA 1H22A 4AULA 1Y7TA 1XDUA 4BXOB 1T13A 4JB3A 3H4VA 2J9RA 3G9ZA 4LW8A 3V1NA 2V4UA 2XTJA 3PXEA 1IY9A 2LDBA 3PI6A 1V48A 3BMNB 5G0UA 2VT2A 3AIMA 3TLYA 3VXKA 2H63A 2VLIA 4MQEA 3DULA 1FU4A 4Z7JA 3SFVA 1UOEA 5L6MB 2JKVA 5JEAC 3ENVA 3A3PA 4GLOA 3OQIB 5HJ7A 1Y42X 4I5GA 2D2FA 3BSYA 4GI2A 4D98A 4HACB 1XAHA 2YV4A 4YAUA 2PZJA 2PR7A 5JOQA 1ZKMA 3K09C 4DL9A 1DAMA 5D5QA 3D6FA 4HNQA 4RVCA 3WLFA 3WGUA 3RAJA 3KQUA 4RENA 2ZBQA 4PONA 3R9IA 3OFSA 2NMVA 3MWLA 3FRHA 1XD8A 1SC9A 3LFUA 2QORA 3IKJA 4IQ0A 4HNUA 3QH4A 4FYVA 1DX6A 4BZWA 4HXYA 4LRXA 2MR6A 2B4YA 2ICAA 2OO5A 4XD2A 1CUDA 3WYNA 3PHHA 5ETJA 2WPNA 5TJ9A 5A5FA 1B3RA 5KCZA 1EVIA 3D8TA 1DNPA 5IH7A 1BNCA 2FFBA 3CURA 2B69A 1DV1A 4I14A 1P9LA 3ZU4A 1X1QA 2W9XA 3B8EA 3PT9A 4O2LA 4MO2A 4RJTA 1OFIA 1OXKB 2XEDA 3PXUA 1UPFA 2C38A 4L1KA 4YJHA 3DKPA 3NORA 1C9YA 1VL2A 4S1OA 3RG2A 3GD5A 1NTOA 1PDWA 2B9EA 4PGFA 2X9LA 4Q1VA 1C9DB 3HKBB 1XTSA 1D2RA 2IKSA 5A4MS 4G09A 2L69A 3KRTA 3UJ8A 3F4BA 4A5SA 1PK9A 2WYOA 3ZDXB 3ZCXA 3LY9A 1UWVA 1SPBS 4KSCA 4GKAA 4X1KB 2AI1A 2IZOA 1N4AA 1DPGA 4CR8A 3O1IC 1M34A 4RVFA 3CUUA 1K4MA 3BIOA 1CT9A 1GQYA 4D43A 4G9EA 3L7OA 4HATA 4IZ6A 3ELUA 1P2FA 4MAMA 5AK3A 5ECGC 4C0HA 3W5CA 4G3XA 1MZPA 1D2HA 4KE7A 4QUHA 3RIYA 4X1YA 1N5MA 1QIGA 5KNCA 2BTOA 2VTVA 4RL4A 4C88A 3HA5A 3LH5A 3VUFA 1WPRA 2BFBA 2COUA 1T36A 4BFUA 5B5SA 4KIFA 5F78A 3A9CA 1I4WA 1Q11A 4GQUA 1E1QA 5CFOA 1JFFA 3RYIB 4OO1C 3G13A 1TC1A 2GN8A 2NZXA 4B9AA 4XWWA 4UDOA 2WTUA 2G1PA 1KRXA 3LF1A 4HWKA 2AJLI 3LU1A 3W3AH 4ARCA 1JDNA 5K0ZA 4DQKA 5H8WA 3E03A 2Q4BA 1I4EB 3EVBA 1KKUA 3HCOA 4BGVA 3EZ6A 3MF4A 3A58B 4BA2B 1X13A 2CYBA 2ZPUA 3H2ZA 3IT2A 4IUYA 1MNAA 3E3NA 1UP7A 4NNPA 3U3OA 1RRFA 1CF9A 1UBTS 3JQBA 3MWYW 4EPVA 3BJRA 1QGYA 2XVAA 1EKXA 3I01M 4PYJA 4H1WA 1HG1A 4LFCI 4KTVE 3LPDA 4DW8A 2EW8A 4F1WA 2WJ3A 1UJCA 3HO1A 4TZ0A 2C7BA 2QTVA 4N82A 4L8WB 3CONA 2GEUA 4P3KA 5T4BA 5BXQC 2K87A 5SZHB 3EX7C 1FPMA 1FMCA 3L7MA 1E3LA 3A1EA 3HUFA 4EM6A 2YRWA 2FZEA 3T5DA 4BIMA 1YZLA 2XJ9A 1KAGA 2HLDD 4ZYZA 5MN5A 3LTOA 4IXWA 4R2KA 5EHIA 4DLZA 2HQ1A 4QPCA 3BKWA 4D46A 2HWXA 1H94A 3H17A 1SVUA 3PDCA 1AMUA 1FFAA 3T9AA 2VQEE 3QMWA 1GARA 4LDRA 3E7WA 2KE5A 4WNAB 2LKCA 5BSMA 4TWRA 1A1SA 4QOEA 3AOEC 1WEHA 1O58A 1O97D 3LWNA 3IQFA 4L51A 1YOBA 3BDVA 5CPBA 5G41A 1CZHA 2ZUEA 1C0LA 1Y63A 4JR2A 1RR9A 1D5CA 5DW3A 5F76A 3FVTA 3U40A 1ORTA 4BNHA 5JMOA 1IBMB 2WTXA 3GBPA 1QVWA 2C9MA 2VP6A 4H7KA 4MR7A 2WNRB 2PZEA 5M04A 2EX1A 2ZRBA 4WV3A 1XK6A 3N87A 1KC1A 3FMIA 1M1UA 2JKYA 3EF3A 4Z7YA 3Q3HA 2GXQA 1KVTA 1I24A 1WXGA 4YNBA 2FEKA 3VR5D 1OXSC 2BT4A 3VPGA 1RLIA 1SZDA 2II6A 1DBVO 1VJ0A 3QTTA 1NOKA 4IIXA 2X0FA 4DDHA 4QRDA 4RHYA 1OFGA 4QNRA 5COBA 1GRCA 4XYLA 1D8AA 1X19A 2NW6A 4B3SB 3RFVA 1M2KA 5FJIA 5HXAA 2CNBA 5G0VA 3OTOB 3FE2A 4IILA 3ZHCA 5BUCA 4BLVA 2QI9C 4Q37A 1OH8A 4C4SA 4BE9A 3C7CB 4NG4A 3ITDA 2CNNA 3PUIA 3OM9A 1YMQA 2Q99A 4O4LB 1PW7A 3VUEA 3UIEA 2ZI6A 3CZPA 3HZZA 4YCBA 3AFMA 3ROQA 3VKWA 2HJGA 2IPLA 3I01A 5G02A 1R4NA 4LYDA 4PO3X 4Y9DA 4F5WA 2JVKA 1TW2A 2YY7A 2R6HA 1T8WA 3AP2A 3FPJA 1AX9A 3CZ5A 4IGKA 1ZXLA 4CEIA 5GWXA 2OGSA 4I50B 4EPXA 1PJLA 2W98A 4M54A 3DGEC 1DRVA 3H87A 3TTYA 1MW9X 1QG0A 4JYZA 4HH4A 1P81A 2D8MA 2YDXA 5CXQA 5LA6B 3IOMA 3Q2KA 4YRBA 1UANA 3OX2A 3W7BA 1XU7A 4ADSG 3KLOA 1DC3A 2VNHA 4URVR 4B4KA 1ZVKA 4LE2A 3UXYA 3KUDA 1VI7A 2BFNA 4HWTA 2I62A 4IP0A 2QNBA 3EUWA 1EEHA 3MWEA 3WX0A 1K4YA 2GXAA 4IGEA 4WACA 3I2GA 4LF5I 5TB5A 4FZ3A 5ES4B 1CJBA 2GTIA 1Z0ZA 3PE3A 1OXUA 3U7QA 5AI5A 4XWOA 2JFNA 3LM8A 1JFSA 4JP8A 4ND5A 3K70D 4ZDIA 4CQLA 3ICWA 2KLHA 1NTRA 1YS9A 1JR4A 4NBUA 4BV3A 2QAIA 1Q15A 3TUZC 2JGNA 1NFQA 4PBSA 4F56A 2O57A 2HMUA 3JQAD 3ZW7A 5D3KA 3ANXA 1DIBA 2WWHA 1J8FA 3HU5A 4DLBA 4DNQA 3ZK9A 2JD1A 2O2IA 5H81A 3SC4A 5BR1A 5BWBA 2XAUA 2ZE5A 3OIYA 4NCNA 3PDWA 5GONB 4GBMA 5KJFA 4E4YA 2IXBA 2NTEA 5B6IA 4HNAA 5CVJA 2H1RA 1YHNA 2O3ZA 1ZA1A 1LI4A 2WPDA 1T1JA 4FFWA 4EY5A 3ZNQA 4CEHB 3ESQA 5AW4A 3CLRD 3VPCA 4F46A 1D6JA 1NYTA 4K05A 5JFGA 2V1UA 2XXJA 3ZC3A 2D2VA 3AVUA 4C2UA 1QFZA 5GZ1A 4YHHB 1LU9A 2P8SA 4ZRDA 1EJ2A 3T0IA 3E5NA 2L2QA 2HMAA 4HVAA 4JBWA 4BNYA 4M1SA 2Y9MB 3KQPA 3PD1A 1JKMA 2R9VA 5L7TA 5LZ2A 5L6LB 5JZBA 1ECPA 1K6JA 4DCNA 4TTQA 4YCDA 1UQRA 3H99A 4CNQA 1Z6AA 3CZ9A 4ARBA 5G4LA 3OETA 1YQXA 2RG1A 5EXPA 3WHIA 4AJJA 1RYHA 3NI2A 2RKBA 3MJTA 4ZA2A 2JAHA 4NBRA 4DV2E 2MYTA 5GZ3A 1SB9A 2Y93A 3RS0A 3S2UA 3WBKA 1CDZA 1WW8A 1FU8A 2Z1MA 4QFDA 5EYPB 3QPBA 1A9XA 5GAJA 2HLPA 2LTAA 2X19A 3C5EA 2NVUB 1QGOA 3DAHA 3UPUA 4H18A 4IOLA 4W6ZA 2CJWA 3TR5A 4HWPA 4R51A 5J5CA 3FFTA 4GX0A 1Q91A 3Q4GA 4U2FA 1W52X 2A1IA 4L8FA 4G0PA 4L6AA 1ULUA 3C3MA 4RANA 3WR5A 1IPFA 3H6GA 3R0VA 4XX0B 5TGDA 3TK1A 3LLVA 3UB3A 3LYHA 1U7WA 2IUUA 1MR3F 4EMUA 3C3DA 3HXLA 4GYYA 3JRWA 1YZ3A 2W6QA 2PUBA 1U0SY 3JWEA 4E1VA 2Q2VA 3H5AA 1KO4A 2XTMA 2O8EA 2MINB 3OFJA 3NHPA 3EEOA 2BUAA 1QCYA 2XDAA 3DZHA 4D82A 4EDHA 1Z18A 2G17A 5G0WA 1I3KA 3VSEA 2GFHA 1JB9A 3FI9A 3V1MA 5LYJB 3FF4A 2J0EA 4JVSB 4BB5A 1FSZA 1MX0A 1HYHA 5E38A 1GA6A 3TQTA 3UMVA 4A6PA 3BBLA 3KQWA 1MB4A 1GSAA 2W6MA 3QT7A 3BOSA 2WWYA 1UP4A 1FP1D 3VI4B 5G1NA 5JO0A 1L5QA 2WINI 1F9EA 3DUWA 3O3MB 3TAXA 5LKRA 4LPSA 3TD2A 3IAHA 1KYYA 4P1ZA 1ZEMA 4P84A 1AKEA 3VPFA 4OGFA 5L4SA 1NW9B 4P08A 4ZVTA 2FGKA 3LP8A 2F8SA 1ODJA 5EMJA 4DMLA 2D8AA 3I39X 3WB2A 3PGJA 4OYHA 2GARA 1JBKA 4GUDA 1NJSA 2CUZA 1MLDA 2VYVA 4PXAA 2VA9A 1YE5A 4ALMA 3VMMA 4X62B 1CXZA 3R3UA 3P9RA 4BZPA 1Z0KA 5IK2D 3RFFA 4DLSA 4B7ZA 2WKQA 4DEYA 3NFRA 3RTAA 5I7EA 1RDFA 2A86A 2XADA 2FPKA 4LBZA 4ZAZA 1GTVA 1U6KA 4BB6A 4DTIA 2VSNA 2J59A 4Z4CA 3ZY5A 2R6R1 3TQOA 3H3XA 4MKGA 5C51B 1OI2A 4RWZA 9ATCA 5KINB 1LEHA 2Y0BA 4E5YA 4A03A 4ZODA 3SLKA 4JFAA 2WTAA 4CM5A 1YSCA 3GD7A 2GO4A 2OORC 5AH0A 4W8OA 4FKBA 2J3LA 3FIJA 4YRKA 2GHRA 2CCKA 2O3TA 3IBGA 1MO5A 3Q0IA 1K98A 4QYSA 1CUUA 1N9GB 2HF2A 2UXDE 2REXB 1PR5A 2HHAA 3AV3A 4WD3A 3G2NA 3ZY6A 2HREA 4ZRNA 3ZKAA 4DPUA 1UZNA 4CLDA 1ZOLA 5FLXC 1BDMA 1IAQA 2I4OA 1NHGA 3N2ZB 5EZ5A 4GR4A 2IHKA 1L8XA 3K15A 3ERCA 1SRQA 1U0EA 4H4DA 2AE8A 2YNMC 4BHTA 5K4HA 4NL4H 2ECOA 3IR7A 4PIMA 3O7MA 3O94A 1NNEA 2VEDA 5TX7A 4D9EA 4KN6A 4J76A 5CNKA 1KDOA 3NLLA 2KBEA 1CR0A 5K51A 1CB0A 3UUFA 3KJXA 3AFHA 3I30X 3W2TA 4CV3A 3OQOA 5EJMA 4GOXA 3D64A 3NP7A 3P9QA 3OTOI 1PTJC 3DD1A 4JEUA 2AC4A 2JD0A 1QYVA 3EK2A 1SJ9A 2BBTA 1QYWA 2YMMA 4OP3A 4QYIA 3LTNC 3ZDFA 5A62A 3UAVA 1JG6A 2UDPA 4AYXA 5LQDA 4W5RA 1A9QA 2EF0A 1TTHA 4JGGA 4URUR 1OU4A 3C43A 1Z29A 2FYTA 2F55A 1T5IA 1OLUB 2C3OA 3K5IA 1ZCAA 3HXTA 4MI1A 2VDNB 1EP1B 3HU2A 4CUZA 5M34A 1AUVA 3N1UA 4TYQA 2XDQA 3U3MA 1F3LA 1WV0A 3D54D 3HB1A 1C1YA 5EVJA 5THQA 7YASA 1RPTA 2P9CA 4Z3OA 4RSRA 5ICGA 1M6VA 2V0CA 2G28A 3QMMA 4C76A 1D1TA 5FBZA 4I9UA 2D1SA 2FETA 1IYZA 4HADA 4CM6A 1J56A 2QXTA 1ITZA 3CNBA 3TZBA 1MHTA 1ZK2A 1JHOA 1NU6A 2KS6A 3NOQA 4ITUA 4R1LA 3L1JA 3O4VA 3T35A 3VI3B 1RJEA 3EC1A 4PX5A 1YQUA 5JNVA 1U8EA 4ABTA 1U7XA 4V1CB 4W9RA 3A1NA 2ONKA 1E5LA 1NOIA 1XTBA 5JYCA 1AXGA 1R6MA 2AC2A 3QF4A 1MX1A 4KE6A 2RIRA 1N25A 3U44A 1DJQA 1WY7A 1Q14A 3GLHE 1D2NA 2IWHA 5BQPA 1NGSA 3OTWA 3VRHA 1A27A 4JV5B 1YGYA 4WL0A 4BWFB 4ZQBA 2QJRA 5J43A 3V32A 2WQ6A 2MTBA 4J0DA 3EPJA 1VCIA 1IPHA 1JQ3A 1F4VA 3EGXA 4GLLA 4M38A 4YI5A 4QLBA 3EZ9A 2OM6A 4OATA 1IM8A 3EXHB 3E48A 3GLFE 1PR6A 4KC0A 3W5IA 1Y3DE 2FFQA 2LCFA 1KIFA 1ZH0A 3WV5A 5EHNA 2AFHA 2O1XA 2N1BA 1MJ5A 2CL7X 2J0QA 1ZYUA 4NCXA 2J30A 5CVEA 2X76A 3VX3A 4BCBA 3CB2A 2JKZA 3G8BA 4BMOB 4ISBA 3RBXA 2WF7A 4FEYA 2RGGA 5FLXQ 2GS8A 2BC9A 1QYCA 2EGHA 2PZFA 3KYJB 3UK0A 1ZD4A 2PG3A 4RIEA 1MABB 1FQKA 1SA0B 1Z0GA 3O31A 4M0DA 2VTEA 3RVNA 5BNWA 5FFMA 1XMQE 3HV0A 3OO1A 3CVVA 4MHTA 2Y92A 1GGVA 2F90A 1OI3A 3PHBE 4BP8A 1GD1O 1HDOA 2FLWA 2GJAA 5KTOA 2CFOA 3W4KA 1UMKA 1VI2A 3PKJA 1A2QA 2UKDA 3JV7A 3MLAA 1EXWA 1FI4A 1FNCA 1ZR2A 2ZLBA 1BXGA 4QIHA 3GFGA 4YLEA 1GTSA 1EVKA 4WBXC 3ELWA 5FPYA 2W4QA 3UMJA 4YHBA 1WB9A 1TE2A 2YWXA 3HBLA 4FSXA 3HDTA 4EW1A 5K0NA 4LZJA 2XQVA 2EV9A 2P2ZA 3DGFC 2RI0A 4NESA 2XEXA 2BM9A 2HA7A 3A70A 3EVCA 3K94A 1UWKA 4DSTA 2C7PA 1SY7A 4R1UA 3RF7A 4R7ZA 1M67A 1KNQA 2QRGA 2G07A 1B0PA 2CMKA 2XODA 3L4EA 4FJ0A 3PUXA 3QBVA 2X5OA 5H1YA 5A1JA 2ZOSA 4NY1A 1FUKA 2YHBA 5FWAA 1J5EE 1AK9A 3ASVA 3EWAA 4XIGS 3F6PA 1GOTA 3HZHA 1QZZA 3QVVA 1MH9A 2H4WA 1L8AA 4QT0A 1R2QA 2BV3A 3EQ9A 3NTRA 1R64A 4XB6B 4IIVA 2JHCA 5K0BA 1D9ZA 4JBYA 1QVVA 4KYVA 1LTKA 4N5LA 4IJVA 4N7JA 4DAEA 1H6CA 4E94A 1OFVA 3N58A 5JZ9A 2PT5A 5DSTA 4D8TA 1L1RA 1IHOA 4EYOA 2VUIB 3WIDA 3QI2A 1WDTA 5JAZA 4C29A 1PI3A 5KVAA 3D8UA 2YYYA 4I08A 4XPZA 3W6ZA 3PUZA 4UHDA 5E1OA 1XHKA 1CFJA 4KAJA 4U7JA 4QG7A 1C30B 3MJVA 4JI3E 2IYAA 2D06A 4HXZA 2OSVA 4XIIA 4RVUA 1T35A 4MDFA 4R8KA 2JIQA 1JJFA 1VYVA 2PRYA 2W0MA 3PQ3A 4I5EA 3FWHA 5ECDA 1QE5A 3MS7A 3OCWA 1MN6A 2R48A 4HOYA 4NZMA 4QPNA 4WN9B 1L3IA 1FUYB 5CRIA 1V35A 2WEKA 4IDPA 1NUQA 4I2NA 1GL7A 3UYKA 3C15C 4CQJA 1G8HA 3BAFA 3H2GA 2WWXA 3F47A 5EGSA 3UKJA 2ZDGA 1ZAKA 3IQGX 2OAP1 4HDSB 4K6MA 2YV3A 4WUDA 4C14A 5BORA 4Y1GA 4PLZA 1AQ6A 2P11A 2AHRA 2ZYUX 3PF9A 3M85G 1V96A 1IOLA 4B3RE 3VDNB 4GC9A 3U13A 1JBEA 5ENZA 2QMHA 5ALTA 3HCEA 1T5OA 3G82C 1VRVA 4F97A 5H0IA 5HIIA 3OD5A 4DXDA 3OZEA 3EVAA 3UJNA 3A2NA 4TSRA 3SBOA 4UFOA 3BMXA 1VG8A 4I4NA 4GWGA 1FP4B 2VK8A 2OO3A 5DRQA 4JENA 1ABEA 3WLTA 5I9MA 3MJEA 5EJAA 5G4KA 1NF8A 4HZIA 1Z38A 3W3AA 1KAMA 1HNXE 1QR6A 2C5SA 4GPEA 5KYKA 2CB9A 3ASUA 4ZOCA 4IUBS 1GHTA 1ZZEA 4Z9AA 1NPTO 1TM4E 4IDOA 2IDKA 3QHAA 1NQ5A 4JLBA 3OLYA 3IFSA 4V3BA 1CYDA 2NT4A 1I10A 2VDLB 2BEWB 3ETGA 2WD8A 3KZKA 2V7QD 3ONVA 3I8SA 5AK0A 3RHTA 1R8YA 5C5DA 2QPTA 2QU7A 3AFOA 5DYTA 5KDOA 3PYGA 2XRFA 3IUMA 2C3PA 3LDUA 4OEHA 1W48A 2Z8XA 1VLJA 4N3NA 4F4HA 1I6KA 3F4LA 5C35A 4EW6A 2Z6UA 1BEZA 2VZ8A 1U8YA 2VUSA 1SFRA 3GONA 1R6TA 2CKDA 1ORHA 2SNIE 3NYQA 4IH4A 4RZSA 3STUA 3T1YE 5JZMA 1PYGA 4JU8A 1WTAA 4PSAA 4PZYA 5DRYA 4Z0TA 4BNDB 3WNBA 3L6RA 4C7OB 5CT9A 1XD9A 2A0UA 2WDZA 4QRHA 5DE3A 4ZKEA 1DWPA 3FCUB 4AJ1A 1OX4B 1T5BA 2WU4A 3SF8A 4E7PA 3AF5A 1E6WA 4DMMA 1E3HA 1DT3A 3ETCA 4N5DA 4RSGA 5AM4A 3SGLA 2E5LI 1ZH2A 2O0HA 2Q45A 2XDYA 3Q11A 2ASEA 5EKDA 1Y9JA 2PX5A 3ZI0A 3ZWOA 4AQDA 4E0BA 4F6RA 4Z7QB 1OUMA 1PKXA 1GP2A 4ZDKA 5DBEX 5IKMA 4OB7A 3R3WA 4AFNA 2M6SA 2YXLA 5J2UB 1KDVA 4PSCA 2Q2NA 3U0BA 2EU8A 2G4CA 3HSYA 1U2GA 1MG7A 4F45A 3F2VA 3HSSA 1T9DA 5AYVA 3I9JA 4YUXA 4JC4A 4MYDA 5F5LA 1UBNA 4LF4B 1C4WA 1YR7A 1XFDA 2HO4A 3PSAA 4U7TB 3BWVA 4MPRA 5DB4A 3UAYA 5CVCA 4EFNA 3A25A 3O9VA 3FOEC 1KYVA 1AF7A 3LDAA 3DR5A 2R00A 1HK7A 5JCZA 3HV2A 4OOEA 4Q7EA 4MVCA 4BFVA 1Q21A 1MXHA 2GYYA 4Q6BA 3L49A 1C9EA 4U3JB 1VB3A 1E6KA 1UBGA 2AJ4A 1CUIA 4GLFA 4UHJA 1YU9A 4NMWA 5IHPA 2IOHA 1O6BA 3DDZX 3IAXA 2D3TA 4FINA 4MV8A 4OQPA 4KSBA 4INPA 3KB8A 4B4VA 5BV1A 2OK7A 1ZGZA 1DQZA 4ZZ2A 4F1KA 4NZZA 1W8IA 3G79A 2IERA 1OYYA 1S2IA 1FK8A 1Z37A 2BFPA 2CKMA 3H5NA 3UOWA 4EELA 3M3HA 2C4WA 3DXXA 4WKNA 1WMEA 1KPIA 3CEHA 2ETXA 2DT5A 3QLVA 5J40A 3NBQA 2MCFA 3RK1A 5K0CA 1IK6A 2J46A 4ZGGA 2P30A 5B64A 2XJ4A 3ADDA 5TMBA 1FFXA 1Z45A 2NN6B 3IQDB 4P4UA 4YB8A 1LWNA 2BEUA 2TYSB 3FGOA 1PVOA 1QCCA 5DBGA 4X1IA 3L18A 1H3EA 2EKZA 2JGAA 1Q7BA 2G9ZA 4J07A 5KYXB 3L2OB 1WQ1R 3AM5A 4HY3A 1KYQA 4LFAE 4AJ9A 1V9CA 4MS1A 5EMKA 1ZUIA 4Q5IA 1SC3A 3R6WA 3GDWA 5JS7A 5GINE 1WNTA 2BELA 1Q0ZA 5AI6A 3ZHBA 1CP3A 3AFGA 1SUIA 5TQ2A 2QL5A 4YXWD 2CJFA 1WSAA 1PQWA 1P6QA 3L8CA 5AJZA 2IHUA 1EBUA 5HFNA 1ND6A 1O95D 2E6KA 2PO7A 3NYIA 4MJXA 1BDBA 5DK6A 1J9ZA 4EECA 2XYQA 3OTHA 4DRZA 5BSKA 4RD3A 1PGJA 2Q6KA 4J4BA 2X1VA 4WN3A 4EVQA 1T9KA 3K71B 4BBJA 4NYIQ 1TLTA 1FWLA 5GJWC 4AO6A 4YS6A 1DTWB 1U2TA 2DTEA 3RRZA 2DWOA 2R97A 5HKKA 3JQGB 1OKKA 1U9JA 3WU5A 4OA5A 2I2WA 2I67A 5ALVA 3B85A 1Q92A 1W75A 4YJ3A 4Y67A 4PZEA 4KE9A 5KYVA 3SFTA 5F3RA 4B09A 2XCQA 1EQUA 2JIMA 4B44A 4B4OA 3DEZA 3OC0A 5JBQA 4JI0B 2CL6X 4JJKA 4S24A 1U5AA 1DCKA 1JEQA 3L6UA 4A6XA 4EHNA 2FUEA 1DIOB 2A4MA 2PA3A 4AX8A 5JCJD 4BIIA 2PUCA 5HUHA 4N47A 3AXTA 4X24A 5CW2A 1M76A 4KZPA 1SCBA 4JSTA 1RW4A 3EPPA 1M2VA 2ZJ8A 1K47A 3SHQA 1KEUA 2ATXA 2WHPA 3CXRA 4WXEA 4CQMB 1J1IA 4IF6A 4JYPA 4P9NA 2Z58A 2NU7A 1Q7TA 4AJKA 4CWAA 1N5JA 4EBBA 2G08A 5K36A 3D4OA 4BRZA 1XCOA 4HDNB 1XA4A 2EFYA 4N5NA 3W9SA 2PGDA 3B9QA 1ZKDA 2IVZA 4M1QA 3F78A 2O8BA 1PP4A 4HXGA 2QN6A 3C41J 5KSOA 4Q9IA 4YAWA 3EPLA 4KHPI 2AOVA 4R1PA 4Z0HO 5EIOA 2AK3A 4LECA 5F1OA 1UK6A 3EIEA 2AZTA 4TL7A 3D4LA 2P5TB 3T4PA 4AZ0B 2C7OA 2X9GA 1IUNA 3JYQA 3QI7A 2Q5QA 2KQUA 5CUQA 4ZTBA 2ZAYA 3TCNA 1K8XB 2GVZC 2GKOA 4XLTA 4EG0A 1J25A 2OV3A 3V8NA 4RVDA 3CPEA 1RYFA 3DZBA 4R1TA 3R7SA 4BMCA 3OSUA 4UPEA 1ZLXA 2HSWA 3ICCA 1GZHB 2BOVA 2VXBA 10MHA 3KLPX 1UC9A 2I29A 3C45A 3IQIX 5B7NA 1FX1A 5LDHA 5LZ8A 4F06A 2HA3A 2HLHA 2R42A 1YONA 1BX3A 4MUFA 1PVDA 2VUTA 5BSWA