1Z0VA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Pathological crystallography: case studies of several unusual macromolecular crystals.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 53
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0vA00
4KHPI 4Z7YA 2R3VA 4DV1I 2VQEI 3LNUA 4LFAE 4DV7E 1HNXI 3K1JA 1B63A 4HYMA 4OX9E 2UXCI 1NZ0A 4AQYE 1XMOE 2HHHE 3K17A 1OJ4A 3GONA 1IBME 2DEIA 1N34I 5L3JA 1IBKI 2Q2EB 4DR2I 4P52A 3HULA 1HR0I 1S16A 3QT6A 1MX0A 4KQVA 4UT4A 1U2RA 4USMA 4DUYE 5IT9C 3WU6A 2VQFI 4DV2I 4B3ME 3ZZ0A 4URLA 1XNRE 4DR5I 4X64E 2UUBE 1S4EA 4DUZI 4P7AA 4JI5I 4HXZA 4HY1A 5BR8I 3J7AG 1PVGA 4X65E 1Z5AA 4HACB 3PYDA 4FWDA 3OTOI 4DR7E 1D6TA 4JV5I 1H72C 2V2VA 3J7AM 4DR1E 1FWLA 2V34A 3WU5A 3ZZTA 1HNZI 5IWAI 4DR6E 1BKNA 4X66I 4JYAI 1RR9A 4DPUA 1PIEA 1H7SA 4DR3E 5LMNI 1A6FA 2R42A 4LFBE 1FNMA 2ZBKB 3M6AA 4LF5E 2DEJA 4XTJA 2HK3A 1XNQE 3PYFA 4JI4E 2ZITA 4RPFA 4LFAI 4DV7I 4MYUA 4JI6E 4OX9I 4AQYI 2F4VE 1XMOI 2HHHI 2V8PA 4LF4E 5GMEA 1IBMI 1KTVA 1H73A 4M1KA 4LF9E 1HNWE 2HFSA 4JI3E 4LFCE 4ZVIA 1NHIA 4PU9A 1ZXNA 4B3MI 3LPSA 4NXMI 1FJGE 4JI8E 1XNRI 1Z5CA 4X64I 2UUBI 3LTOA 4DV0I 4LF6E 1Z0EA 4GKJI 4X65I 4B3TI 4USKA 4NXNE 1MU5A 1KVKA 2A2CA 1DARA 3JAMQ 1N32E 2UXBE 2HFUA 1UEKA 4DR1I 1ZM4A 1EA6A 1ZM3A 2V2ZA 3WU3A 4YY3E 1MG7A 4EMDA 4X62I 4DR6I 4JI1I 1N36E 3H4LA 4DR3I 4GKKE 1FI4A 1IBLE 4LFBI 4DV5E 2UU9E 3T1YE 3ZZUA 3T1HE 1I94E 3WU4A 1QZRA 3ZKBA 1ELOA 4JI4I 4FN5A 3QT5A 2BM0A 4JI0I 1N33E 4JG4A 2VQEE 2UUCI 4DV3E 2ZM6E 4JI6I 3D4JA 1Z0CA 2F4VI 4B3SE 4LF4I 1ZXMA 1Z0GA 3ZKDA 3J80Q 4LF9I 1HNWI 4WUBA 3F0NA 4JI3I 4LFCI 4MYTA 4DV4E 3V5RA 1NHHA 2VQFE 4DPYA 4B3RE 4DU7A 4JI8I 4DR5E 4DV6E 2UXDE 5FLXQ 4LF6I 3Q1QA 4FWHA 3JAMC 2E5LE 4WUCA 1H7UA 1XMQE 4NXNI 3B82A 4LF8E 1N32I 4PRVA 4FW9A 4YY3I 4DUYI 5A2QC 4YHHE 1N36I 1FKAE 1N0VC 2BV3A 4UTGA 1ZM2A 4WUDA 2CZ9A 4GKKI 1B62A 1NHJA 2X36A 1IBLI 4DR4E 5LMUE 1H74A 4DV5I 3T1YI 2HK2A 4LF7E 1I94I 4K0KE 4DU8A 3PYGA 2UUAE 4DR7I 4DPXA 3B78A 2J7KA 2XEXA 1N33I 4R1FA 4DV3I 3QT7A 2ZM6I 1Z0TA 3J80C 4B3SI 1FWKA 5A2QQ 4JI7E 1KKHA 4FWGA 3J81C 1J5EE 4JI2E 1Z5BA 4Z7CA 1Z0WA 1XHKA 4LF5I 2WW4A 2HKEA 4DPWA 5LL6R 4DV4I 3CWVA 1XNQI 4KHPE 4NXME 4B3RI 5FLXC 4DV1E 2NPFA 4DV6I 2UXDI 1HNXE 4DV0E 4DXLA 4GKJE 2UXCE 2E5LI 4B3TE 1XMQI 3ZM7A 2OI2A 2VF3A 1EI1A 1IBKE 1PKPA 1N34E 4LF8I 3QT8A 4DR2E 1WUUA 1HR0E 4I3HA 5GMDA 3J81Q 1VISA 4X62E 4DV2E 1Z0BA 4YHHI 4JI1E 1FJGI 2GS8A 5IT9Q 3PYEA 4HACA 2EFGA 4DPTA 4DUZE 1RREA 4JI5E 4DR4I 5LMUI 5BR8E 3V2UC 4LF7I 1N0UA 4K0KI 4PRXA 2E1RA 1KIJA 2UUAI 2HKJA 3OTOE 2UXBI 4JV5E 1ZM9A 2X7IA 4JI0E 2A2DA 1Z59A 2V2QA 1Z0VA 2UUCE 1HNZE 5IWAE 4X66E 2BM1A 4JYAE 1K47A 4ED4A 4JI7I 1J5EI 2LJPA 5LMNE 4JI2I 2UU9I 3T1HI 2AJ4A 3B8HA
chains in the Genus database with same CATH superfamily
4KHPI 4Z7YA 4IZJA 5K36B 2R3VA 4OO1F 4DV1I 2VQEI 2WNRB 3LNUA 2PO0B 4LFAE 2PO1A 4AM3A 4DV7E 4IFDE 1HNXI 3K1JA 1B63A 4HYMA 4OX9E 2UXCI 1NZ0A 2NN6A 4AQYE 2C37A 1XMOE 2HHHE 3K17A 2PNLA 1OJ4A 1OYSA 3GONA 2O1UA 3GMEA 2IESA 1OYPA 1IBME 2DEIA 1N34I 5L3JA 1IBKI 2Q2EB 1USUA 4DR2I 4P52A 4MU0A 2JE6A 3HULA 1HR0I 1S16A 3QT6A 4GQUA 1MX0A 4BA2B 4KQVA 4LCHA 4UT4A 1U2RA 4USMA 4DUYE 5IT9C 5C0XD 4MU4A 3P3CA 3WU6A 4IZKA 2VQFI 4DV2I 2BR2B 4B3ME 3ZZ0A 4BA1A 4NBQA 4URLA 1XNRE 4DR5I 4FW5A 4IZJD 4X64E 1S4EA 2IOQA 4LCGA 4DUZI 4P7AA 2UUBE 4JI5I 4HXZA 4HY1A 2CGEA 5BR8I 3J7AG 1PVGA 5K36E 4X65E 1Z5AA 2BA1G 4FW6A 3CDJA 4HACB 2NN6D 3PYDA 4FWDA 3OTOI 4DR7E 1D6TA 4JV5I 1H72C 2V2VA 3J7AM 4DR1E 1FWLA 2V34A 2PNMA 4FW4A 5EL9A 3U1KA 3WU5A 2GO4A 5EKWA 3NZKA 3ZZTA 1HNZI 4OO1D 5IWAI 4DR6E 1BKNA 4X66I 1UDOA 4JYAI 2Z5BA 1RR9A 2C39B 2O1VA 4DPUA 1PIEA 1H7SA 4DR3E 5LMNI 1A6FA 2BA0D 4U3DA 2R42A 4LFBE 1FNMA 2ZBKB 3M6AA 4LF5E 2DEJA 4XTJA 2HK3A 4AIMA 1XNQE 3PYFA 4JI4E 2VESA 1VI7A 3P3GA 2ZITA 3P06A 2C39A 2J65A 5C0XB 4RPFA 1USVA 4LFAI 4DV7I 4MYUA 4JI6E 4OX9I 4IFDF 4AQYI 2F4VE 1UDNA 1XMOI 2HHHI 4IZJB 2V8PA 3CDIA 4LF4E 2Z5CB 5GMEA 1IBMI 1KTVA 1H73A 4M1KA 2PO1B 4LOMA 4LF9E 1HNWE 2HFSA 1YHCA 2NN6B 4JI3E 2C37B 4LFCE 4ZVIA 2JEBA 1NHIA 4PU9A 5ELWA 1ZXNA 4B3MI 3LPSA 4NXMI 1FJGE 2Z5CA 3UHMA 4OO1C 4JI8E 2JE6B 1XNRI 4FW3A 4OO1B 1Z5CA 4X64I 2UUBI 3LTOA 2IERA 4DV0I 4LF6E 1Z0EA 4GKJI 4IZKB 1HK7A 4X65I 4B3TI 4USKA 2F1DA 4NXNE 1MU5A 4BA1B 5C0XE 5FWKA 1KVKA 5K36F 5JEAA 2BA0G 2A2CA 4OKGA 1DARA 3JAMQ 1N32E 2UXBE 2HFUA 4ISAA 1UEKA 4MU1A 4OO1A 4DR1I 1ZM4A 1EA6A 1ZM3A 2V2ZA 3WU3A 1R6MA 2GO3A 4YY3E 1MG7A 1UDQA 4EMDA 4X62I 4DR6I 5DNLA 4MQYA 4JI1I 1N36E 3H4LA 2IOPA 4DR3I 4GKKE 1FI4A 2NN6E 1IBLE 3PS3A 3P3EA 4LFBI 4DV5E 2UU9E 3T1YE 3ZZUA 3T1HE 3HKMA 1I94E 1Y6ZA 2Z5BB 3WU4A 1QZRA 3ZKBA 3M7NG 1ELOA 4OZEA 3PRYA 1Y4SA 4FN5A 4JI4I 3QT5A 2BM0A 4JI0I 5JEAD 1N33E 4JG4A 2VQEE 2UUCI 4DV3E 2JEAA 3GCMA 2PO2A 2ZM6E 4JI6I 3D4JA 1Z0CA 2F4VI 4B3SE 4LF4I 1ZXMA 4U3BA 1Z0GA 3ZKDA 3J80Q 1YH8A 2O3ZA 4LCFA 4LF9I 3KRNA 1HNWI 4WUBA 3F0NA 4JI3I 4LFCI 4N3OA 4MYTA 4DV4E 3V5RA 1NHHA 2VQFE 4DPYA 2O1TA 4B3RE 4DU7A 2C38A 4JI8I 4DR5E 4IS9A 4DV6E 2UXDE 3PS1A 5FLXQ 4J3DA 4LF6I 3Q1QA 2WP8A 3PS2A 4FWHA 2JEBB 2O1WA 4MU3A 3JAMC 2E5LE 4WUCA 1H7UA 1XMQE 4MDTA 4NXNI 3B82A 4LF8E 1N32I 3M7ND 5C0XF 4PRVA 4FW9A 4YY3I 4DUYI 5A2QC 5JEAC 4FW7A 5JEAB 4YHHE 1N36I 1FKAE 4IFDA 4QNKA 1N0VC 2BV3A 4UTGA 1ZM2A 4WUDA 2CZ9A 3Q6MA 3DD6A 4GKKI 1B62A 1NHJA 2X36A 1IBLI 4DR4E 5LMUE 1H74A 3GLLA 4DV5I 3T1YI 2NN6F 3L7ZA 2HK2A 4LF7E 1I94I 1P42A 4K0KE 4DU8A 3PYGA 2UUAE 5K36C 4DR7I 4DPXA 3B78A 2J7KA 1Y4UA 3M85G 2XEXA 1N33I 4R1FA 1RHYA 1XXEA 4DV3I 3QT7A 3HJCA 3K85A 2ZM6I 1Z0TA 2CG9A 3J80C 2CVEA 4B3SI 1Y5YA 1FWKA 5A2QQ 4JI7E 1KKHA 5K36A 4FWGA 3J81C 4IFDD 1J5EE 4JI2E 1Z5BA 2JEAB 4Z7CA 1Z0WA 2PO2B 1E3HA 2WNRA 1E3PA 2PO0A 1XHKA 5JEAE 4LF5I 2WW4A 2HKEA 5DROA 4DPWA 5LL6R 4DV4I 3CWVA 4OO1E 1XNQI 4KHPE 4NXME 4B3RI 5FLXC 5DRRA 4DV1E 2NPFA 4DV6I 2UXDI 1HNXE 4DV0E 4DXLA 4GKJE 4BA2A 1R6LA 2UXCE 2E5LI 4B3TE 5DRPA 3H1CA 1XMQI 3ZM7A 2C38B 2OI2A 2VF3A 1EI1A 2BR2A 1PKPA 1N34E 1IBKE 4LF8I 3Q6NA 3QT8A 4DR2E 1WUUA 1HR0E 3M85D 2WP8B 2AE8A 5K36D 4I3HA 4LPFA 5GMDA 3J81Q 1VISA 4X62E 4DV2E 1Z0BA 4YHHI 4JI1E 1FJGI 2GS8A 5IT9Q 3PYEA 4HACA 2EFGA 2GQ0A 3B4TA 4DPTA 4DUZE 1OYRA 1RREA 2PNZB 4JI5E 4DR4I 5LMUI 5BR8E 2JT2A 3V2UC 4LF7I 5DRQA 4IFDC 1N0UA 4K0KI 4IFDB 4PRXA 2E1RA 1KIJA 3P76A 2UUAI 4QNJA 2HKJA 3OTOE 2UXBI 4JV5E 5C0XC 1ZM9A 2X7IA 4JI0E 4AIDA 2A2DA 1Z59A 2V2QA 3L7ZB 1Z0VA 2PNZA 2UUCE 1HNZE 5IWAE 4X66E 2BM1A 4JYAE 1K47A 4ED4A 4JI7I 2BA1D 1J5EI 2LJPA 3U1YA 5LMNE 4JI2I 5C0XA 2UU9I 2NN6C 3T1HI 2AJ4A 1Y60A 5DNXA 1UDSA 2Z5EA 5JEAF 3B8HA
chains in the Genus database with same CATH topology
4KHPI 4Z7YA 4IZJA 2R3VA 4DV1I 2VQEI 3LNUA 4LFAE 4DV7E 1HNXI 3K1JA 1B63A 4HYMA 4OX9E 2UXCI 1NZ0A 4AQYE 1XMOE 2HHHE 3K17A 2PNLA 1OJ4A 3GONA 2O1UA 1IBME 2DEIA 1N34I 5L3JA 1IBKI 2Q2EB 1USUA 4DR2I 4P52A 3HULA 1HR0I 1S16A 3QT6A 1MX0A 4KQVA 4UT4A 1U2RA 4USMA 4DUYE 5IT9C 3WU6A 4IZKA 2VQFI 4DV2I 4B3ME 3ZZ0A 4URLA 1XNRE 4DR5I 4IZJD 4X64E 1S4EA 2IOQA 4DUZI 2UUBE 4P7AA 4JI5I 4HXZA 4HY1A 2CGEA 5BR8I 3J7AG 1PVGA 4X65E 1Z5AA 4HACB 3PYDA 4FWDA 3OTOI 4DR7E 1D6TA 4JV5I 1H72C 2V2VA 3J7AM 4DR1E 1FWLA 2V34A 2PNMA 3WU5A 3ZZTA 1HNZI 5IWAI 4DR6E 1BKNA 4X66I 4JYAI 2Z5BA 1RR9A 2O1VA 4DPUA 1PIEA 1H7SA 4DR3E 5LMNI 1A6FA 2R42A 4LFBE 1FNMA 2ZBKB 3M6AA 4LF5E 2DEJA 4XTJA 2HK3A 1XNQE 3PYFA 4JI4E 2ZITA 3P06A 4RPFA 1USVA 4LFAI 4DV7I 4MYUA 4JI6E 4OX9I 4AQYI 2F4VE 1XMOI 2HHHI 4IZJB 2V8PA 4LF4E 2Z5CB 5GMEA 1IBMI 1KTVA 1H73A 4M1KA 4LF9E 1HNWE 2HFSA 4JI3E 4LFCE 4ZVIA 1NHIA 4PU9A 1ZXNA 4B3MI 3LPSA 4NXMI 1FJGE 2Z5CA 4JI8E 1XNRI 1Z5CA 4X64I 2UUBI 3LTOA 4DV0I 4LF6E 1Z0EA 4GKJI 4IZKB 1HK7A 4X65I 4B3TI 4USKA 4NXNE 1MU5A 5FWKA 1KVKA 2A2CA 1DARA 3JAMQ 1N32E 2UXBE 2HFUA 1UEKA 4DR1I 1ZM4A 1EA6A 1ZM3A 2V2ZA 3WU3A 4YY3E 1MG7A 4EMDA 4X62I 4DR6I 4JI1I 1N36E 3H4LA 2IOPA 4DR3I 4GKKE 1FI4A 1IBLE 4LFBI 4DV5E 2UU9E 3T1YE 3ZZUA 3T1HE 1I94E 1Y6ZA 2Z5BB 3WU4A 1QZRA 3ZKBA 1ELOA 3PRYA 1Y4SA 4FN5A 4JI4I 3QT5A 2BM0A 4JI0I 1N33E 4JG4A 2VQEE 2UUCI 4DV3E 2ZM6E 4JI6I 3D4JA 1Z0CA 2F4VI 4B3SE 4LF4I 1ZXMA 1Z0GA 3ZKDA 3J80Q 4LF9I 1HNWI 4WUBA 3F0NA 4JI3I 4LFCI 4N3OA 4MYTA 4DV4E 3V5RA 1NHHA 2VQFE 4DPYA 2O1TA 4B3RE 4DU7A 4JI8I 4DR5E 4DV6E 2UXDE 5FLXQ 4LF6I 3Q1QA 4FWHA 2O1WA 3JAMC 2E5LE 4WUCA 1H7UA 1XMQE 4NXNI 3B82A 4LF8E 1N32I 4PRVA 4FW9A 4YY3I 4DUYI 5A2QC 4YHHE 1N36I 1FKAE 1N0VC 2BV3A 4UTGA 1ZM2A 4WUDA 2CZ9A 3Q6MA 4GKKI 1B62A 1NHJA 2X36A 1IBLI 4DR4E 5LMUE 1H74A 4DV5I 3T1YI 2HK2A 4LF7E 1I94I 4K0KE 4DU8A 3PYGA 2UUAE 4DR7I 4DPXA 3B78A 2J7KA 1Y4UA 2XEXA 1N33I 4R1FA 4DV3I 3QT7A 3HJCA 3K85A 2ZM6I 1Z0TA 2CG9A 3J80C 4B3SI 1FWKA 5A2QQ 4JI7E 1KKHA 4FWGA 3J81C 1J5EE 4JI2E 1Z5BA 4Z7CA 1Z0WA 1XHKA 4LF5I 2WW4A 2HKEA 4DPWA 5LL6R 4DV4I 3CWVA 1XNQI 4KHPE 4NXME 4B3RI 5FLXC 4DV1E 2NPFA 4DV6I 2UXDI 1HNXE 4DV0E 4DXLA 4GKJE 2UXCE 2E5LI 4B3TE 1XMQI 3ZM7A 2OI2A 2VF3A 1EI1A 1PKPA 1N34E 1IBKE 4LF8I 3Q6NA 3QT8A 4DR2E 1WUUA 1HR0E 4I3HA 5GMDA 3J81Q 1VISA 4X62E 4DV2E 1Z0BA 4YHHI 4JI1E 1FJGI 2GS8A 5IT9Q 3PYEA 4HACA 2EFGA 2GQ0A 4DPTA 4DUZE 1RREA 4JI5E 4DR4I 5LMUI 5BR8E 3V2UC 4LF7I 1N0UA 4K0KI 4PRXA 2E1RA 1KIJA 2UUAI 2HKJA 3OTOE 2UXBI 4JV5E 1ZM9A 2X7IA 4JI0E 2A2DA 1Z59A 2V2QA 1Z0VA 2UUCE 1HNZE 5IWAE 4X66E 2BM1A 4JYAE 1K47A 4ED4A 4JI7I 1J5EI 2LJPA 5LMNE 4JI2I 2UU9I 3T1HI 2AJ4A 2Z5EA 3B8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP I;  4Z7Y A;  2R3V A;  4DV1 I;  2VQE I;  3LNU A;  4LFA E;  4DV7 E;  1HNX I;  3K1J A;  1B63 A;  4HYM A;  4OX9 E;  2UXC I;  1NZ0 A;  4AQY E;  1XMO E;  2HHH E;  3K17 A;  1OJ4 A;  3GON A;  1IBM E;  2DEI A;  1N34 I;  5L3J A;  1IBK I;  2Q2E B;  4DR2 I;  4P52 A;  3HUL A;  1HR0 I;  1S16 A;  3QT6 A;  1MX0 A;  4KQV A;  4UT4 A;  1U2R A;  4USM A;  4DUY E;  5IT9 C;  3WU6 A;  2VQF I;  4DV2 I;  4B3M E;  3ZZ0 A;  4URL A;  1XNR E;  4DR5 I;  4X64 E;  2UUB E;  1S4E A;  4DUZ I;  4P7A A;  4JI5 I;  4HXZ A;  4HY1 A;  5BR8 I;  3J7A G;  1PVG A;  4X65 E;  1Z5A A;  4HAC B;  3PYD A;  4FWD A;  3OTO I;  4DR7 E;  1D6T A;  4JV5 I;  1H72 C;  2V2V A;  3J7A M;  4DR1 E;  1FWL A;  2V34 A;  3WU5 A;  3ZZT A;  1HNZ I;  5IWA I;  4DR6 E;  1BKN A;  4X66 I;  4JYA I;  1RR9 A;  4DPU A;  1PIE A;  1H7S A;  4DR3 E;  5LMN I;  1A6F A;  2R42 A;  4LFB E;  1FNM A;  2ZBK B;  3M6A A;  4LF5 E;  2DEJ A;  4XTJ A;  2HK3 A;  1XNQ E;  3PYF A;  4JI4 E;  2ZIT A;  4RPF A;  4LFA I;  4DV7 I;  4MYU A;  4JI6 E;  4OX9 I;  4AQY I;  2F4V E;  1XMO I;  2HHH I;  2V8P A;  4LF4 E;  5GME A;  1IBM I;  1KTV A;  1H73 A;  4M1K A;  4LF9 E;  1HNW E;  2HFS A;  4JI3 E;  4LFC E;  4ZVI A;  1NHI A;  4PU9 A;  1ZXN A;  4B3M I;  3LPS A;  4NXM I;  1FJG E;  4JI8 E;  1XNR I;  1Z5C A;  4X64 I;  2UUB I;  3LTO A;  4DV0 I;  4LF6 E;  1Z0E A;  4GKJ I;  4X65 I;  4B3T I;  4USK A;  4NXN E;  1MU5 A;  1KVK A;  2A2C A;  1DAR A;  3JAM Q;  1N32 E;  2UXB E;  2HFU A;  1UEK A;  4DR1 I;  1ZM4 A;  1EA6 A;  1ZM3 A;  2V2Z A;  3WU3 A;  4YY3 E;  1MG7 A;  4EMD A;  4X62 I;  4DR6 I;  4JI1 I;  1N36 E;  3H4L A;  4DR3 I;  4GKK E;  1FI4 A;  1IBL E;  4LFB I;  4DV5 E;  2UU9 E;  3T1Y E;  3ZZU A;  3T1H E;  1I94 E;  3WU4 A;  1QZR A;  3ZKB A;  1ELO A;  4JI4 I;  4FN5 A;  3QT5 A;  2BM0 A;  4JI0 I;  1N33 E;  4JG4 A;  2VQE E;  2UUC I;  4DV3 E;  2ZM6 E;  4JI6 I;  3D4J A;  1Z0C A;  2F4V I;  4B3S E;  4LF4 I;  1ZXM A;  1Z0G A;  3ZKD A;  3J80 Q;  4LF9 I;  1HNW I;  4WUB A;  3F0N A;  4JI3 I;  4LFC I;  4MYT A;  4DV4 E;  3V5R A;  1NHH A;  2VQF E;  4DPY A;  4B3R E;  4DU7 A;  4JI8 I;  4DR5 E;  4DV6 E;  2UXD E;  5FLX Q;  4LF6 I;  3Q1Q A;  4FWH A;  3JAM C;  2E5L E;  4WUC A;  1H7U A;  1XMQ E;  4NXN I;  3B82 A;  4LF8 E;  1N32 I;  4PRV A;  4FW9 A;  4YY3 I;  4DUY I;  5A2Q C;  4YHH E;  1N36 I;  1FKA E;  1N0V C;  2BV3 A;  4UTG A;  1ZM2 A;  4WUD A;  2CZ9 A;  4GKK I;  1B62 A;  1NHJ A;  2X36 A;  1IBL I;  4DR4 E;  5LMU E;  1H74 A;  4DV5 I;  3T1Y I;  2HK2 A;  4LF7 E;  1I94 I;  4K0K E;  4DU8 A;  3PYG A;  2UUA E;  4DR7 I;  4DPX A;  3B78 A;  2J7K A;  2XEX A;  1N33 I;  4R1F A;  4DV3 I;  3QT7 A;  2ZM6 I;  1Z0T A;  3J80 C;  4B3S I;  1FWK A;  5A2Q Q;  4JI7 E;  1KKH A;  4FWG A;  3J81 C;  1J5E E;  4JI2 E;  1Z5B A;  4Z7C A;  1Z0W A;  1XHK A;  4LF5 I;  2WW4 A;  2HKE A;  4DPW A;  5LL6 R;  4DV4 I;  3CWV A;  1XNQ I;  4KHP E;  4NXM E;  4B3R I;  5FLX C;  4DV1 E;  2NPF A;  4DV6 I;  2UXD I;  1HNX E;  4DV0 E;  4DXL A;  4GKJ E;  2UXC E;  2E5L I;  4B3T E;  1XMQ I;  3ZM7 A;  2OI2 A;  2VF3 A;  1EI1 A;  1IBK E;  1PKP A;  1N34 E;  4LF8 I;  3QT8 A;  4DR2 E;  1WUU A;  1HR0 E;  4I3H A;  5GMD A;  3J81 Q;  1VIS A;  4X62 E;  4DV2 E;  1Z0B A;  4YHH I;  4JI1 E;  1FJG I;  2GS8 A;  5IT9 Q;  3PYE A;  4HAC A;  2EFG A;  4DPT A;  4DUZ E;  1RRE A;  4JI5 E;  4DR4 I;  5LMU I;  5BR8 E;  3V2U C;  4LF7 I;  1N0U A;  4K0K I;  4PRX A;  2E1R A;  1KIJ A;  2UUA I;  2HKJ A;  3OTO E;  2UXB I;  4JV5 E;  1ZM9 A;  2X7I A;  4JI0 E;  2A2D A;  1Z59 A;  2V2Q A;  1Z0V A;  2UUC E;  1HNZ E;  5IWA E;  4X66 E;  2BM1 A;  4JYA E;  1K47 A;  4ED4 A;  4JI7 I;  1J5E I;  2LJP A;  5LMN E;  4JI2 I;  2UU9 I;  3T1H I;  2AJ4 A;  3B8H A; 
#chains in the Genus database with same CATH topology
 4KHP I;  4Z7Y A;  4IZJ A;  5K36 B;  2R3V A;  4OO1 F;  4DV1 I;  2VQE I;  2WNR B;  3LNU A;  2PO0 B;  4LFA E;  2PO1 A;  4AM3 A;  4DV7 E;  4IFD E;  1HNX I;  3K1J A;  1B63 A;  4HYM A;  4OX9 E;  2UXC I;  1NZ0 A;  2NN6 A;  4AQY E;  2C37 A;  1XMO E;  2HHH E;  3K17 A;  2PNL A;  1OJ4 A;  1OYS A;  3GON A;  2O1U A;  3GME A;  2IES A;  1OYP A;  1IBM E;  2DEI A;  1N34 I;  5L3J A;  1IBK I;  2Q2E B;  1USU A;  4DR2 I;  4P52 A;  4MU0 A;  2JE6 A;  3HUL A;  1HR0 I;  1S16 A;  3QT6 A;  4GQU A;  1MX0 A;  4BA2 B;  4KQV A;  4LCH A;  4UT4 A;  1U2R A;  4USM A;  4DUY E;  5IT9 C;  5C0X D;  4MU4 A;  3P3C A;  3WU6 A;  4IZK A;  2VQF I;  4DV2 I;  2BR2 B;  4B3M E;  3ZZ0 A;  4BA1 A;  4NBQ A;  4URL A;  1XNR E;  4DR5 I;  4FW5 A;  4IZJ D;  4X64 E;  1S4E A;  2IOQ A;  4LCG A;  4DUZ I;  4P7A A;  2UUB E;  4JI5 I;  4HXZ A;  4HY1 A;  2CGE A;  5BR8 I;  3J7A G;  1PVG A;  5K36 E;  4X65 E;  1Z5A A;  2BA1 G;  4FW6 A;  3CDJ A;  4HAC B;  2NN6 D;  3PYD A;  4FWD A;  3OTO I;  4DR7 E;  1D6T A;  4JV5 I;  1H72 C;  2V2V A;  3J7A M;  4DR1 E;  1FWL A;  2V34 A;  2PNM A;  4FW4 A;  5EL9 A;  3U1K A;  3WU5 A;  2GO4 A;  5EKW A;  3NZK A;  3ZZT A;  1HNZ I;  4OO1 D;  5IWA I;  4DR6 E;  1BKN A;  4X66 I;  1UDO A;  4JYA I;  2Z5B A;  1RR9 A;  2C39 B;  2O1V A;  4DPU A;  1PIE A;  1H7S A;  4DR3 E;  5LMN I;  1A6F A;  2BA0 D;  4U3D A;  2R42 A;  4LFB E;  1FNM A;  2ZBK B;  3M6A A;  4LF5 E;  2DEJ A;  4XTJ A;  2HK3 A;  4AIM A;  1XNQ E;  3PYF A;  4JI4 E;  2VES A;  1VI7 A;  3P3G A;  2ZIT A;  3P06 A;  2C39 A;  2J65 A;  5C0X B;  4RPF A;  1USV A;  4LFA I;  4DV7 I;  4MYU A;  4JI6 E;  4OX9 I;  4IFD F;  4AQY I;  2F4V E;  1UDN A;  1XMO I;  2HHH I;  4IZJ B;  2V8P A;  3CDI A;  4LF4 E;  2Z5C B;  5GME A;  1IBM I;  1KTV A;  1H73 A;  4M1K A;  2PO1 B;  4LOM A;  4LF9 E;  1HNW E;  2HFS A;  1YHC A;  2NN6 B;  4JI3 E;  2C37 B;  4LFC E;  4ZVI A;  2JEB A;  1NHI A;  4PU9 A;  5ELW A;  1ZXN A;  4B3M I;  3LPS A;  4NXM I;  1FJG E;  2Z5C A;  3UHM A;  4OO1 C;  4JI8 E;  2JE6 B;  1XNR I;  4FW3 A;  4OO1 B;  1Z5C A;  4X64 I;  2UUB I;  3LTO A;  2IER A;  4DV0 I;  4LF6 E;  1Z0E A;  4GKJ I;  4IZK B;  1HK7 A;  4X65 I;  4B3T I;  4USK A;  2F1D A;  4NXN E;  1MU5 A;  4BA1 B;  5C0X E;  5FWK A;  1KVK A;  5K36 F;  5JEA A;  2BA0 G;  2A2C A;  4OKG A;  1DAR A;  3JAM Q;  1N32 E;  2UXB E;  2HFU A;  4ISA A;  1UEK A;  4MU1 A;  4OO1 A;  4DR1 I;  1ZM4 A;  1EA6 A;  1ZM3 A;  2V2Z A;  3WU3 A;  1R6M A;  2GO3 A;  4YY3 E;  1MG7 A;  1UDQ A;  4EMD A;  4X62 I;  4DR6 I;  5DNL A;  4MQY A;  4JI1 I;  1N36 E;  3H4L A;  2IOP A;  4DR3 I;  4GKK E;  1FI4 A;  2NN6 E;  1IBL E;  3PS3 A;  3P3E A;  4LFB I;  4DV5 E;  2UU9 E;  3T1Y E;  3ZZU A;  3T1H E;  3HKM A;  1I94 E;  1Y6Z A;  2Z5B B;  3WU4 A;  1QZR A;  3ZKB A;  3M7N G;  1ELO A;  4OZE A;  3PRY A;  1Y4S A;  4FN5 A;  4JI4 I;  3QT5 A;  2BM0 A;  4JI0 I;  5JEA D;  1N33 E;  4JG4 A;  2VQE E;  2UUC I;  4DV3 E;  2JEA A;  3GCM A;  2PO2 A;  2ZM6 E;  4JI6 I;  3D4J A;  1Z0C A;  2F4V I;  4B3S E;  4LF4 I;  1ZXM A;  4U3B A;  1Z0G A;  3ZKD A;  3J80 Q;  1YH8 A;  2O3Z A;  4LCF A;  4LF9 I;  3KRN A;  1HNW I;  4WUB A;  3F0N A;  4JI3 I;  4LFC I;  4N3O A;  4MYT A;  4DV4 E;  3V5R A;  1NHH A;  2VQF E;  4DPY A;  2O1T A;  4B3R E;  4DU7 A;  2C38 A;  4JI8 I;  4DR5 E;  4IS9 A;  4DV6 E;  2UXD E;  3PS1 A;  5FLX Q;  4J3D A;  4LF6 I;  3Q1Q A;  2WP8 A;  3PS2 A;  4FWH A;  2JEB B;  2O1W A;  4MU3 A;  3JAM C;  2E5L E;  4WUC A;  1H7U A;  1XMQ E;  4MDT A;  4NXN I;  3B82 A;  4LF8 E;  1N32 I;  3M7N D;  5C0X F;  4PRV A;  4FW9 A;  4YY3 I;  4DUY I;  5A2Q C;  5JEA C;  4FW7 A;  5JEA B;  4YHH E;  1N36 I;  1FKA E;  4IFD A;  4QNK A;  1N0V C;  2BV3 A;  4UTG A;  1ZM2 A;  4WUD A;  2CZ9 A;  3Q6M A;  3DD6 A;  4GKK I;  1B62 A;  1NHJ A;  2X36 A;  1IBL I;  4DR4 E;  5LMU E;  1H74 A;  3GLL A;  4DV5 I;  3T1Y I;  2NN6 F;  3L7Z A;  2HK2 A;  4LF7 E;  1I94 I;  1P42 A;  4K0K E;  4DU8 A;  3PYG A;  2UUA E;  5K36 C;  4DR7 I;  4DPX A;  3B78 A;  2J7K A;  1Y4U A;  3M85 G;  2XEX A;  1N33 I;  4R1F A;  1RHY A;  1XXE A;  4DV3 I;  3QT7 A;  3HJC A;  3K85 A;  2ZM6 I;  1Z0T A;  2CG9 A;  3J80 C;  2CVE A;  4B3S I;  1Y5Y A;  1FWK A;  5A2Q Q;  4JI7 E;  1KKH A;  5K36 A;  4FWG A;  3J81 C;  4IFD D;  1J5E E;  4JI2 E;  1Z5B A;  2JEA B;  4Z7C A;  1Z0W A;  2PO2 B;  1E3H A;  2WNR A;  1E3P A;  2PO0 A;  1XHK A;  5JEA E;  4LF5 I;  2WW4 A;  2HKE A;  5DRO A;  4DPW A;  5LL6 R;  4DV4 I;  3CWV A;  4OO1 E;  1XNQ I;  4KHP E;  4NXM E;  4B3R I;  5FLX C;  5DRR A;  4DV1 E;  2NPF A;  4DV6 I;  2UXD I;  1HNX E;  4DV0 E;  4DXL A;  4GKJ E;  4BA2 A;  1R6L A;  2UXC E;  2E5L I;  4B3T E;  5DRP A;  3H1C A;  1XMQ I;  3ZM7 A;  2C38 B;  2OI2 A;  2VF3 A;  1EI1 A;  2BR2 A;  1PKP A;  1N34 E;  1IBK E;  4LF8 I;  3Q6N A;  3QT8 A;  4DR2 E;  1WUU A;  1HR0 E;  3M85 D;  2WP8 B;  2AE8 A;  5K36 D;  4I3H A;  4LPF A;  5GMD A;  3J81 Q;  1VIS A;  4X62 E;  4DV2 E;  1Z0B A;  4YHH I;  4JI1 E;  1FJG I;  2GS8 A;  5IT9 Q;  3PYE A;  4HAC A;  2EFG A;  2GQ0 A;  3B4T A;  4DPT A;  4DUZ E;  1OYR A;  1RRE A;  2PNZ B;  4JI5 E;  4DR4 I;  5LMU I;  5BR8 E;  2JT2 A;  3V2U C;  4LF7 I;  5DRQ A;  4IFD C;  1N0U A;  4K0K I;  4IFD B;  4PRX A;  2E1R A;  1KIJ A;  3P76 A;  2UUA I;  4QNJ A;  2HKJ A;  3OTO E;  2UXB I;  4JV5 E;  5C0X C;  1ZM9 A;  2X7I A;  4JI0 E;  4AID A;  2A2D A;  1Z59 A;  2V2Q A;  3L7Z B;  1Z0V A;  2PNZ A;  2UUC E;  1HNZ E;  5IWA E;  4X66 E;  2BM1 A;  4JYA E;  1K47 A;  4ED4 A;  4JI7 I;  2BA1 D;  1J5E I;  2LJP A;  3U1Y A;  5LMN E;  4JI2 I;  5C0X A;  2UU9 I;  2NN6 C;  3T1H I;  2AJ4 A;  1Y60 A;  5DNX A;  1UDS A;  2Z5E A;  5JEA F;  3B8H A; 
#chains in the Genus database with same CATH homology
 4KHP I;  4Z7Y A;  4IZJ A;  2R3V A;  4DV1 I;  2VQE I;  3LNU A;  4LFA E;  4DV7 E;  1HNX I;  3K1J A;  1B63 A;  4HYM A;  4OX9 E;  2UXC I;  1NZ0 A;  4AQY E;  1XMO E;  2HHH E;  3K17 A;  2PNL A;  1OJ4 A;  3GON A;  2O1U A;  1IBM E;  2DEI A;  1N34 I;  5L3J A;  1IBK I;  2Q2E B;  1USU A;  4DR2 I;  4P52 A;  3HUL A;  1HR0 I;  1S16 A;  3QT6 A;  1MX0 A;  4KQV A;  4UT4 A;  1U2R A;  4USM A;  4DUY E;  5IT9 C;  3WU6 A;  4IZK A;  2VQF I;  4DV2 I;  4B3M E;  3ZZ0 A;  4URL A;  1XNR E;  4DR5 I;  4IZJ D;  4X64 E;  1S4E A;  2IOQ A;  4DUZ I;  2UUB E;  4P7A A;  4JI5 I;  4HXZ A;  4HY1 A;  2CGE A;  5BR8 I;  3J7A G;  1PVG A;  4X65 E;  1Z5A A;  4HAC B;  3PYD A;  4FWD A;  3OTO I;  4DR7 E;  1D6T A;  4JV5 I;  1H72 C;  2V2V A;  3J7A M;  4DR1 E;  1FWL A;  2V34 A;  2PNM A;  3WU5 A;  3ZZT A;  1HNZ I;  5IWA I;  4DR6 E;  1BKN A;  4X66 I;  4JYA I;  2Z5B A;  1RR9 A;  2O1V A;  4DPU A;  1PIE A;  1H7S A;  4DR3 E;  5LMN I;  1A6F A;  2R42 A;  4LFB E;  1FNM A;  2ZBK B;  3M6A A;  4LF5 E;  2DEJ A;  4XTJ A;  2HK3 A;  1XNQ E;  3PYF A;  4JI4 E;  2ZIT A;  3P06 A;  4RPF A;  1USV A;  4LFA I;  4DV7 I;  4MYU A;  4JI6 E;  4OX9 I;  4AQY I;  2F4V E;  1XMO I;  2HHH I;  4IZJ B;  2V8P A;  4LF4 E;  2Z5C B;  5GME A;  1IBM I;  1KTV A;  1H73 A;  4M1K A;  4LF9 E;  1HNW E;  2HFS A;  4JI3 E;  4LFC E;  4ZVI A;  1NHI A;  4PU9 A;  1ZXN A;  4B3M I;  3LPS A;  4NXM I;  1FJG E;  2Z5C A;  4JI8 E;  1XNR I;  1Z5C A;  4X64 I;  2UUB I;  3LTO A;  4DV0 I;  4LF6 E;  1Z0E A;  4GKJ I;  4IZK B;  1HK7 A;  4X65 I;  4B3T I;  4USK A;  4NXN E;  1MU5 A;  5FWK A;  1KVK A;  2A2C A;  1DAR A;  3JAM Q;  1N32 E;  2UXB E;  2HFU A;  1UEK A;  4DR1 I;  1ZM4 A;  1EA6 A;  1ZM3 A;  2V2Z A;  3WU3 A;  4YY3 E;  1MG7 A;  4EMD A;  4X62 I;  4DR6 I;  4JI1 I;  1N36 E;  3H4L A;  2IOP A;  4DR3 I;  4GKK E;  1FI4 A;  1IBL E;  4LFB I;  4DV5 E;  2UU9 E;  3T1Y E;  3ZZU A;  3T1H E;  1I94 E;  1Y6Z A;  2Z5B B;  3WU4 A;  1QZR A;  3ZKB A;  1ELO A;  3PRY A;  1Y4S A;  4FN5 A;  4JI4 I;  3QT5 A;  2BM0 A;  4JI0 I;  1N33 E;  4JG4 A;  2VQE E;  2UUC I;  4DV3 E;  2ZM6 E;  4JI6 I;  3D4J A;  1Z0C A;  2F4V I;  4B3S E;  4LF4 I;  1ZXM A;  1Z0G A;  3ZKD A;  3J80 Q;  4LF9 I;  1HNW I;  4WUB A;  3F0N A;  4JI3 I;  4LFC I;  4N3O A;  4MYT A;  4DV4 E;  3V5R A;  1NHH A;  2VQF E;  4DPY A;  2O1T A;  4B3R E;  4DU7 A;  4JI8 I;  4DR5 E;  4DV6 E;  2UXD E;  5FLX Q;  4LF6 I;  3Q1Q A;  4FWH A;  2O1W A;  3JAM C;  2E5L E;  4WUC A;  1H7U A;  1XMQ E;  4NXN I;  3B82 A;  4LF8 E;  1N32 I;  4PRV A;  4FW9 A;  4YY3 I;  4DUY I;  5A2Q C;  4YHH E;  1N36 I;  1FKA E;  1N0V C;  2BV3 A;  4UTG A;  1ZM2 A;  4WUD A;  2CZ9 A;  3Q6M A;  4GKK I;  1B62 A;  1NHJ A;  2X36 A;  1IBL I;  4DR4 E;  5LMU E;  1H74 A;  4DV5 I;  3T1Y I;  2HK2 A;  4LF7 E;  1I94 I;  4K0K E;  4DU8 A;  3PYG A;  2UUA E;  4DR7 I;  4DPX A;  3B78 A;  2J7K A;  1Y4U A;  2XEX A;  1N33 I;  4R1F A;  4DV3 I;  3QT7 A;  3HJC A;  3K85 A;  2ZM6 I;  1Z0T A;  2CG9 A;  3J80 C;  4B3S I;  1FWK A;  5A2Q Q;  4JI7 E;  1KKH A;  4FWG A;  3J81 C;  1J5E E;  4JI2 E;  1Z5B A;  4Z7C A;  1Z0W A;  1XHK A;  4LF5 I;  2WW4 A;  2HKE A;  4DPW A;  5LL6 R;  4DV4 I;  3CWV A;  1XNQ I;  4KHP E;  4NXM E;  4B3R I;  5FLX C;  4DV1 E;  2NPF A;  4DV6 I;  2UXD I;  1HNX E;  4DV0 E;  4DXL A;  4GKJ E;  2UXC E;  2E5L I;  4B3T E;  1XMQ I;  3ZM7 A;  2OI2 A;  2VF3 A;  1EI1 A;  1PKP A;  1N34 E;  1IBK E;  4LF8 I;  3Q6N A;  3QT8 A;  4DR2 E;  1WUU A;  1HR0 E;  4I3H A;  5GMD A;  3J81 Q;  1VIS A;  4X62 E;  4DV2 E;  1Z0B A;  4YHH I;  4JI1 E;  1FJG I;  2GS8 A;  5IT9 Q;  3PYE A;  4HAC A;  2EFG A;  2GQ0 A;  4DPT A;  4DUZ E;  1RRE A;  4JI5 E;  4DR4 I;  5LMU I;  5BR8 E;  3V2U C;  4LF7 I;  1N0U A;  4K0K I;  4PRX A;  2E1R A;  1KIJ A;  2UUA I;  2HKJ A;  3OTO E;  2UXB I;  4JV5 E;  1ZM9 A;  2X7I A;  4JI0 E;  2A2D A;  1Z59 A;  2V2Q A;  1Z0V A;  2UUC E;  1HNZ E;  5IWA E;  4X66 E;  2BM1 A;  4JYA E;  1K47 A;  4ED4 A;  4JI7 I;  1J5E I;  2LJP A;  5LMN E;  4JI2 I;  2UU9 I;  3T1H I;  2AJ4 A;  2Z5E A;  3B8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...