1Z0VA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
195
Chain Sequence
b'KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
molecule tags Hydrolase
source organism Archaeoglobus fulgidus
publication title Pathological crystallography: case studies of several unusual macromolecular crystals.
pubmed doi rcsb
total genus 53
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0vA00
3D4JA 4OX9E 4LF5E 4B3SE 4DPYA 4X65I 1ZM3A 4X64I 4DR5I 1NZ0A 4NXNE 1S16A 4GKKI 4JI7E 1H7SA 4KHPI 4FWDA 3OTOI 1PIEA 1OJ4A 3PYDA 2E5LI 2UXDE 2UUBE 4ED4A 4DV1E 3J81C 4LFBI 1EA6A 1Z5BA 1XMOE 2V2VA 1IBME 4YHHI 1BKNA 2DEIA 1NHIA 1XNQE 4DR1E 2UUAE 5IT9C 3J80Q 5BR8E 1KKHA 2V2ZA 4YY3I 4JYAE 4DR6E 2EFGA 4USMA 1IBLE 1HNZI 5IWAI 4DV3E 5LMNE 1S4EA 3ZM7A 1Z0TA 4JV5I 4DUYI 4Z7CA 1J5EE 2J7KA 3PYFA 2X36A 2VQEI 1N0VC 4JI0I 1FJGE 4DUZE 1ZXMA 4DV5I 1KTVA 4DV6I 2VQEE 3LTOA 4MYUA 4DV2E 1H74A 1NHHA 4DR4I 3QT7A 4JI8E 1XMQI 4P52A 3V2UC 1K47A 4JI4I 4LF8E 2R42A 4HXZA 3WU4A 4DV3I 2R3VA 1Z5CA 4DR6I 4JI8I 4YY3E 3LPSA 1N0UA 4DR7E 4DV2I 4JI2E 2X7IA 4HYMA 3T1HI 2ZM6E 4DR1I 1DARA 3T1YI 3J7AG 1Z0WA 3HULA 1EI1A 1PKPA 4UTGA 4DPUA 4DUYE 1N32I 4JI7I 4GKKE 4P7AA 1IBKE 1Z0EA 4RPFA 3LNUA 4LFCE 4X66I 4LF5I 2HHHE 1XNQI 3WU5A 4DV4I 2UXBE 5GMDA 2BV3A 2VF3A 1IBMI 1H73A 1XMOI 4LFBE 1ZM4A 4AQYE 4DV1I 1N36I 2UU9E 1QZRA 2UUBI 2E5LE 2UXDI 3ZKBA 3OTOE 1UEKA 3ZZ0A 4NXNI 1XHKA 4XTJA 4X64E 1I94E 4LF4E 4X65E 4B3MI 4DV0I 4I3HA 4JI1E 2HK2A 4DV0E 1D6TA 4EMDA 2CZ9A 4B3ME 1ZXNA 3ZKDA 4LF4I 3WU6A 5FLXQ 2XEXA 2A2CA 2VQFI 4K0KI 4LFAE 4DPWA 4DR3E 1B63A 1Z5AA 1HNXE 4JG4A 4B3RE 2UXCE 4PU9A 2HFUA 1RREA 4R1FA 2UXCI 4NXMI 2Q2EB 3CWVA 2UU9I 4DU8A 4DU7A 3GONA 1Z59A 5A2QQ 4PRXA 4AQYI 4K0KE 1FNMA 4DV7E 1B62A 4FN5A 3QT5A 3M6AA 2HHHI 2HFSA 4X66E 1I94I 1Z0GA 1MG7A 1MU5A 3V5RA 1ELOA 4MYTA 4HY1A 4DPXA 4WUBA 4WUCA 1NHJA 1A6FA 2E1RA 1KVKA 4HACB 4JI3E 2ZBKB 5LL6R 3B78A 4DPTA 1XNRE 3PYGA 4DR2I 4B3TI 3T1YE 2AJ4A 2UXBI 1H72C 1Z0BA 2ZM6I 1HR0I 3T1HE 1HNWE 5A2QC 4JI2I 4DR7I 4JI6I 4DXLA 4JI5I 3B8HA 4LFCI 1KIJA 2UUCI 1IBKI 4GKJI 4X62E 2HKEA 3QT6A 2GS8A 4X62I 3PYEA 4LF8I 1FWKA 3ZZUA 1H7UA 2UUCE 1XMQE 1N32E 2V34A 4ZVIA 3J80C 4DR4E 2V2QA 2HKJA 1N33I 2WW4A 4LF6E 1VISA 1HNWI 4DV6E 4DV5E 4LF7E 1N34I 1WUUA 1HR0E 3H4LA 4DUZI 2NPFA 2A2DA 4B3TE 4JI0E 4FWGA 4DR2E 1N34E 4LF7I 1MX0A 4LF6I 4M1KA 3J81Q 1N33E 4HACA 1J5EI 3K1JA 4JI3I 4JV5E 1U2RA 3ZZTA 5IWAE 1HNZE 4GKJE 4JI4E 4UT4A 3QT8A 4JYAI 4JI5E 4JI6E 5BR8I 2V8PA 4FWHA 1FJGI 4YHHE 2DEJA 4DV7I 4URLA 2BM0A 1XNRI 1FWLA 1ZM2A 4FW9A 1PVGA 3F0NA 4B3RI 3Q1QA 1FI4A 1HNXI 5LMNI 4PRVA 1IBLI 4Z7YA 3B82A 2OI2A 4B3SI 3JAMQ 4KQVA 1Z0VA 2UUAI 1Z0CA 5IT9Q 5LMUE 3JAMC 5L3JA 2LJPA 4WUDA 5GMEA 3WU3A 4USKA 4LF9I 4NXME 4KHPE 4LF9E 4DR3I 1N36E 4DR5E 4LFAI 2VQFE 3J7AM 1RR9A 2ZITA 4OX9I 1FKAE 4DV4E 5LMUI 2BM1A 5FLXC 3K17A 2F4VI 4JI1I 2F4VE 2HK3A 1ZM9A
chains in the Genus database with same CATH superfamily
3D4JA 4OX9E 4LF5E 4B3SE 4DPYA 4X65I 2BA1D 4MU1A 1ZM3A 2C39A 4X64I 4BA2B 2O1TA 4DR5I 1NZ0A 1XXEA 3U1YA 4NXNE 5FWKA 3GCMA 1S16A 1R6LA 4GKKI 5K36F 4JI7E 1H7SA 4KHPI 3Q6MA 3PS3A 4FWDA 3OTOI 1PIEA 1OJ4A 3PYDA 2E5LI 2UXDE 2UUBE 4ED4A 4DV1E 3J81C 4LFBI 1EA6A 1Z5BA 1XMOE 1Y5YA 2V2VA 2PO1A 1IBME 4YHHI 1BKNA 2DEIA 1NHIA 1XNQE 4DR1E 3L7ZA 3DD6A 2UUAE 2Z5BB 5IT9C 5C0XC 4J3DA 5BR8E 3J80Q 1KKHA 2V2ZA 2Z5BA 4YY3I 4JYAE 2JEAB 3HKMA 4DR6E 2EFGA 4USMA 4OO1C 1IBLE 5JEAE 4LCHA 5IWAI 1HNZI 4DV3E 2O1VA 5LMNE 1S4EA 3ZM7A 4OO1B 1Z0TA 4JV5I 4DUYI 2C38B 4U3DA 4Z7CA 1J5EE 2J7KA 3PYFA 3P3CA 5JEAC 2X36A 2VQEI 1N0VC 4JI0I 1FJGE 1USVA 4DUZE 1ZXMA 2NN6A 5DRQA 2GQ0A 3GLLA 1KTVA 4DV5I 4DV6I 2VQEE 3LTOA 4MYUA 4DV2E 1H74A 1NHHA 2BA0D 4DR4I 2PNZB 3QT7A 1OYPA 5C0XD 2IERA 2NN6B 4JI8E 1XMQI 4P52A 3V2UC 1K47A 4JI4I 4LF8E 2Z5CB 2O3ZA 2R42A 3PS2A 4HXZA 4IZKB 4IZJD 3WU4A 1VI7A 4DV3I 2R3VA 4OO1F 4MU0A 1Z5CA 4IFDA 4DR6I 4JI8I 2Z5CA 4YY3E 3LPSA 4FW4A 1N0UA 4DR7E 2IOPA 3GMEA 4DV2I 4JI2E 2X7IA 4HYMA 5JEAD 3T1HI 2ZM6E 4DR1I 3M85G 3UHMA 1DARA 3T1YI 3J7AG 2BR2A 4FW7A 2PNMA 5K36A 4AIDA 1Z0WA 1Y4UA 3HULA 1EI1A 1PKPA 3B4TA 2F1DA 3L7ZB 4UTGA 4DPUA 4DUYE 1N32I 4FW6A 4JI7I 4ISAA 2CVEA 4GKKE 4OKGA 2C37B 4P7AA 1IBKE 1Z0EA 4RPFA 3LNUA 4LFCE 4X66I 4LF5I 2HHHE 2PNLA 4LPFA 1XNQI 3WU5A 4DV4I 2GO4A 5GMDA 2UXBE 2BA1G 2BV3A 2VF3A 2GO3A 1IBMI 1E3HA 1H73A 1XMOI 4LFBE 1ZM4A 4AQYE 4DV1I 2NN6F 1N36I 2UU9E 1QZRA 2UUBI 2CGEA 2E5LE 2UXDI 3ZKBA 3OTOE 2J65A 3P06A 1UEKA 1YHCA 3ZZ0A 3CDIA 4NXNI 1XHKA 4XTJA 4X64E 5DRRA 1I94E 5C0XA 2VESA 4LF4E 4X65E 4B3MI 4MQYA 4LCGA 2C38A 4DV0I 4I3HA 5K36B 4JI1E 2HK2A 5C0XE 4DV0E 1D6TA 4EMDA 2CZ9A 4B3ME 4IFDD 1ZXNA 1YH8A 3ZKDA 4LF4I 3WU6A 5FLXQ 2CG9A 2XEXA 2A2CA 2VQFI 4K0KI 4LFAE 4DPWA 4LCFA 4DR3E 5JEAA 1B63A 1Z5AA 1HNXE 4JG4A 4B3RE 2UXCE 1UDOA 4QNJA 4PU9A 4R1FA 2HFUA 3P76A 1RREA 1OYRA 4IFDE 2UXCI 4FW3A 4BA1B 4N3OA 4NXMI 2Q2EB 3NZKA 3CWVA 2UU9I 4DU8A 4DU7A 3GONA 1Z59A 5A2QQ 4PRXA 4AQYI 1UDQA 4K0KE 1FNMA 3Q6NA 1USUA 4MU4A 2PNZA 4DV7E 2PO0A 4IFDF 4OZEA 1B62A 4FN5A 4OO1A 3QT5A 5DNLA 4IZJA 3M6AA 1R6MA 2HHHI 2HFSA 4X66E 1I94I 1Z0GA 1MG7A 1P42A 2C37A 1MU5A 3V5RA 1ELOA 4MYTA 5DROA 4HY1A 4DPXA 4WUBA 4WUCA 4AIMA 5DNXA 1NHJA 1A6FA 2E1RA 1KVKA 4LOMA 4HACB 4JI3E 2NN6C 2O1UA 2ZBKB 5LL6R 3B78A 3P3EA 4OO1E 4DPTA 1XNRE 4FW5A 4IZKA 3PYGA 4NBQA 3M85D 4DR2I 4B3TI 3T1YE 2AJ4A 3M7NG 2UXBI 1H72C 1Z0BA 2ZM6I 5EKWA 1HR0I 3T1HE 2O1WA 1HNWE 5A2QC 4JI2I 5JEAB 4DR7I 4JI6I 4AM3A 1UDSA 2IOQA 4DXLA 4JI5I 3B8HA 4LFCI 1KIJA 3M7ND 4GQUA 2UUCI 1IBKI 4GKJI 4X62E 2HKEA 3QT6A 2GS8A 4X62I 3PYEA 2JEBB 4LF8I 2WNRB 1FWKA 3PRYA 4IZJB 3ZZUA 3P3GA 2C39B 1H7UA 2UUCE 2JT2A 1XMQE 1N32E 3PS1A 2V34A 4ZVIA 3J80C 3K85A 2V2QA 4DR4E 2HKJA 1N33I 2WW4A 4LF6E 1VISA 1HNWI 4DV6E 2IESA 4DV5E 1N34I 4LF7E 1WUUA 1HR0E 3H4LA 4IFDB 4DUZI 2NPFA 2A2DA 4B3TE 4JI0E 4FWGA 4DR2E 1N34E 4LF7I 2NN6E 1MX0A 4IS9A 4M1KA 4LF6I 3J81Q 1N33E 1Y4SA 4HACA 1J5EI 3K1JA 4BA1A 4JI3I 4JV5E 1OYSA 1U2RA 1RHYA 3ZZTA 1Y60A 4OO1D 5IWAE 1HNZE 4GKJE 4JI4E 4UT4A 3QT8A 4JYAI 4JI5E 4JI6E 5BR8I 4QNKA 3U1KA 3H1CA 2V8PA 2JE6A 4FWHA 4IFDC 1FJGI 4YHHE 2DEJA 4DV7I 4URLA 2BM0A 3KRNA 1XNRI 2PO0B 2JE6B 5JEAF 1FWLA 1ZM2A 4BA2A 4FW9A 1PVGA 5DRPA 3F0NA 4B3RI 5K36C 1UDNA 3Q1QA 1FI4A 2Z5EA 1HNXI 5LMNI 4PRVA 2JEAA 1IBLI 2WP8B 4Z7YA 3B82A 5ELWA 2BR2B 2WP8A 2OI2A 4B3SI 3JAMQ 5EL9A 4KQVA 5C0XF 1Z0VA 2UUAI 1Z0CA 5IT9Q 5LMUE 3JAMC 5L3JA 4MDTA 5K36E 2LJPA 4WUDA 5GMEA 3WU3A 2WNRA 4USKA 2PO1B 2BA0G 4LF9I 4NXME 2AE8A 4MU3A 1HK7A 4KHPE 2NN6D 1E3PA 3CDJA 4LF9E 2PO2A 4DR3I 1N36E 5K36D 3HJCA 4DR5E 4LFAI 2PO2B 2VQFE 3J7AM 1RR9A 2ZITA 4U3BA 5C0XB 4OX9I 1FKAE 4DV4E 5LMUI 2BM1A 5FLXC 3K17A 2F4VI 4JI1I 2F4VE 2HK3A 1ZM9A 1Y6ZA 2JEBA
chains in the Genus database with same CATH topology
3D4JA 4OX9E 4LF5E 4B3SE 4DPYA 4X65I 1ZM3A 4X64I 2O1TA 4DR5I 1NZ0A 4NXNE 5FWKA 1S16A 4GKKI 4JI7E 1H7SA 4KHPI 3Q6MA 4FWDA 3OTOI 1PIEA 1OJ4A 3PYDA 2E5LI 2UXDE 2UUBE 4ED4A 4DV1E 3J81C 4LFBI 1EA6A 1Z5BA 1XMOE 2V2VA 1IBME 4YHHI 1BKNA 2DEIA 1NHIA 1XNQE 4DR1E 2UUAE 2Z5BB 5IT9C 3J80Q 5BR8E 1KKHA 2V2ZA 2Z5BA 4YY3I 4JYAE 4DR6E 2EFGA 4USMA 1IBLE 1HNZI 5IWAI 4DV3E 2O1VA 5LMNE 1S4EA 3ZM7A 1Z0TA 4JV5I 4DUYI 4Z7CA 1J5EE 2J7KA 3PYFA 2X36A 2VQEI 1N0VC 4JI0I 1FJGE 1USVA 4DUZE 1ZXMA 2GQ0A 4DV5I 1KTVA 4DV6I 2VQEE 3LTOA 4MYUA 4DV2E 1H74A 1NHHA 4DR4I 3QT7A 4JI8E 1XMQI 4P52A 3V2UC 1K47A 4JI4I 4LF8E 2Z5CB 2R42A 4HXZA 4IZKB 4IZJD 3WU4A 4DV3I 2R3VA 1Z5CA 4DR6I 4JI8I 2Z5CA 4YY3E 3LPSA 1N0UA 4DR7E 2IOPA 4DV2I 4JI2E 2X7IA 4HYMA 3T1HI 2ZM6E 4DR1I 1DARA 3T1YI 3J7AG 2PNMA 1Z0WA 1Y4UA 3HULA 1EI1A 1PKPA 4UTGA 4DPUA 4DUYE 1N32I 4JI7I 4GKKE 4P7AA 1IBKE 1Z0EA 4RPFA 3LNUA 4LFCE 4X66I 4LF5I 2HHHE 2PNLA 1XNQI 3WU5A 4DV4I 2UXBE 5GMDA 2BV3A 2VF3A 1IBMI 1H73A 1XMOI 4LFBE 1ZM4A 4AQYE 4DV1I 1N36I 2UU9E 1QZRA 2UUBI 2CGEA 2E5LE 2UXDI 3ZKBA 3OTOE 3P06A 1UEKA 3ZZ0A 4NXNI 1XHKA 4XTJA 4X64E 1I94E 4LF4E 4X65E 4B3MI 4DV0I 4I3HA 4JI1E 2HK2A 4DV0E 1D6TA 4EMDA 2CZ9A 4B3ME 1ZXNA 3ZKDA 4LF4I 3WU6A 5FLXQ 2CG9A 2XEXA 2A2CA 2VQFI 4K0KI 4LFAE 4DPWA 4DR3E 1B63A 1Z5AA 1HNXE 4JG4A 4B3RE 2UXCE 4PU9A 4R1FA 2HFUA 1RREA 2UXCI 4N3OA 4NXMI 2Q2EB 3CWVA 2UU9I 4DU8A 4DU7A 3GONA 1Z59A 5A2QQ 4PRXA 4AQYI 4K0KE 1FNMA 3Q6NA 1USUA 4DV7E 1B62A 4FN5A 3QT5A 4IZJA 3M6AA 2HHHI 2HFSA 4X66E 1I94I 1Z0GA 1MG7A 1MU5A 3V5RA 1ELOA 4MYTA 4HY1A 4DPXA 4WUBA 4WUCA 1NHJA 1A6FA 2E1RA 1KVKA 4HACB 4JI3E 2O1UA 2ZBKB 5LL6R 3B78A 4DPTA 1XNRE 4IZKA 3PYGA 4DR2I 4B3TI 3T1YE 2AJ4A 2UXBI 1H72C 1Z0BA 2ZM6I 1HR0I 3T1HE 2O1WA 1HNWE 5A2QC 4JI2I 4DR7I 4JI6I 2IOQA 4DXLA 4JI5I 3B8HA 4LFCI 1KIJA 2UUCI 1IBKI 4GKJI 4X62E 2HKEA 3QT6A 2GS8A 4X62I 3PYEA 4LF8I 1FWKA 3PRYA 4IZJB 3ZZUA 1H7UA 2UUCE 1XMQE 1N32E 2V34A 4ZVIA 3J80C 3K85A 2V2QA 4DR4E 2HKJA 1N33I 2WW4A 4LF6E 1VISA 1HNWI 4DV6E 4DV5E 1N34I 4LF7E 1WUUA 1HR0E 3H4LA 4DUZI 2NPFA 2A2DA 4B3TE 4JI0E 4FWGA 4DR2E 1N34E 4LF7I 1MX0A 4M1KA 4LF6I 3J81Q 1N33E 1Y4SA 4HACA 1J5EI 3K1JA 4JI3I 4JV5E 1U2RA 3ZZTA 5IWAE 1HNZE 4GKJE 4JI4E 4UT4A 3QT8A 4JYAI 4JI5E 4JI6E 5BR8I 2V8PA 4FWHA 1FJGI 4YHHE 2DEJA 4DV7I 4URLA 2BM0A 1XNRI 1FWLA 1ZM2A 4FW9A 1PVGA 3F0NA 4B3RI 3Q1QA 1FI4A 2Z5EA 1HNXI 5LMNI 4PRVA 1IBLI 4Z7YA 3B82A 2OI2A 4B3SI 3JAMQ 4KQVA 1Z0VA 2UUAI 1Z0CA 5IT9Q 5LMUE 3JAMC 5L3JA 2LJPA 4WUDA 5GMEA 3WU3A 4USKA 4LF9I 4NXME 1HK7A 4KHPE 4LF9E 4DR3I 1N36E 3HJCA 4DR5E 4LFAI 2VQFE 3J7AM 1RR9A 2ZITA 4OX9I 1FKAE 4DV4E 5LMUI 2BM1A 5FLXC 3K17A 2F4VI 4JI1I 2F4VE 2HK3A 1ZM9A 1Y6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4J A;  4OX9 E;  4LF5 E;  4B3S E;  4DPY A;  4X65 I;  1ZM3 A;  4X64 I;  4DR5 I;  1NZ0 A;  4NXN E;  1S16 A;  4GKK I;  4JI7 E;  1H7S A;  4KHP I;  4FWD A;  3OTO I;  1PIE A;  1OJ4 A;  3PYD A;  2E5L I;  2UXD E;  2UUB E;  4ED4 A;  4DV1 E;  3J81 C;  4LFB I;  1EA6 A;  1Z5B A;  1XMO E;  2V2V A;  1IBM E;  4YHH I;  1BKN A;  2DEI A;  1NHI A;  1XNQ E;  4DR1 E;  2UUA E;  5IT9 C;  3J80 Q;  5BR8 E;  1KKH A;  2V2Z A;  4YY3 I;  4JYA E;  4DR6 E;  2EFG A;  4USM A;  1IBL E;  1HNZ I;  5IWA I;  4DV3 E;  5LMN E;  1S4E A;  3ZM7 A;  1Z0T A;  4JV5 I;  4DUY I;  4Z7C A;  1J5E E;  2J7K A;  3PYF A;  2X36 A;  2VQE I;  1N0V C;  4JI0 I;  1FJG E;  4DUZ E;  1ZXM A;  4DV5 I;  1KTV A;  4DV6 I;  2VQE E;  3LTO A;  4MYU A;  4DV2 E;  1H74 A;  1NHH A;  4DR4 I;  3QT7 A;  4JI8 E;  1XMQ I;  4P52 A;  3V2U C;  1K47 A;  4JI4 I;  4LF8 E;  2R42 A;  4HXZ A;  3WU4 A;  4DV3 I;  2R3V A;  1Z5C A;  4DR6 I;  4JI8 I;  4YY3 E;  3LPS A;  1N0U A;  4DR7 E;  4DV2 I;  4JI2 E;  2X7I A;  4HYM A;  3T1H I;  2ZM6 E;  4DR1 I;  1DAR A;  3T1Y I;  3J7A G;  1Z0W A;  3HUL A;  1EI1 A;  1PKP A;  4UTG A;  4DPU A;  4DUY E;  1N32 I;  4JI7 I;  4GKK E;  4P7A A;  1IBK E;  1Z0E A;  4RPF A;  3LNU A;  4LFC E;  4X66 I;  4LF5 I;  2HHH E;  1XNQ I;  3WU5 A;  4DV4 I;  2UXB E;  5GMD A;  2BV3 A;  2VF3 A;  1IBM I;  1H73 A;  1XMO I;  4LFB E;  1ZM4 A;  4AQY E;  4DV1 I;  1N36 I;  2UU9 E;  1QZR A;  2UUB I;  2E5L E;  2UXD I;  3ZKB A;  3OTO E;  1UEK A;  3ZZ0 A;  4NXN I;  1XHK A;  4XTJ A;  4X64 E;  1I94 E;  4LF4 E;  4X65 E;  4B3M I;  4DV0 I;  4I3H A;  4JI1 E;  2HK2 A;  4DV0 E;  1D6T A;  4EMD A;  2CZ9 A;  4B3M E;  1ZXN A;  3ZKD A;  4LF4 I;  3WU6 A;  5FLX Q;  2XEX A;  2A2C A;  2VQF I;  4K0K I;  4LFA E;  4DPW A;  4DR3 E;  1B63 A;  1Z5A A;  1HNX E;  4JG4 A;  4B3R E;  2UXC E;  4PU9 A;  2HFU A;  1RRE A;  4R1F A;  2UXC I;  4NXM I;  2Q2E B;  3CWV A;  2UU9 I;  4DU8 A;  4DU7 A;  3GON A;  1Z59 A;  5A2Q Q;  4PRX A;  4AQY I;  4K0K E;  1FNM A;  4DV7 E;  1B62 A;  4FN5 A;  3QT5 A;  3M6A A;  2HHH I;  2HFS A;  4X66 E;  1I94 I;  1Z0G A;  1MG7 A;  1MU5 A;  3V5R A;  1ELO A;  4MYT A;  4HY1 A;  4DPX A;  4WUB A;  4WUC A;  1NHJ A;  1A6F A;  2E1R A;  1KVK A;  4HAC B;  4JI3 E;  2ZBK B;  5LL6 R;  3B78 A;  4DPT A;  1XNR E;  3PYG A;  4DR2 I;  4B3T I;  3T1Y E;  2AJ4 A;  2UXB I;  1H72 C;  1Z0B A;  2ZM6 I;  1HR0 I;  3T1H E;  1HNW E;  5A2Q C;  4JI2 I;  4DR7 I;  4JI6 I;  4DXL A;  4JI5 I;  3B8H A;  4LFC I;  1KIJ A;  2UUC I;  1IBK I;  4GKJ I;  4X62 E;  2HKE A;  3QT6 A;  2GS8 A;  4X62 I;  3PYE A;  4LF8 I;  1FWK A;  3ZZU A;  1H7U A;  2UUC E;  1XMQ E;  1N32 E;  2V34 A;  4ZVI A;  3J80 C;  4DR4 E;  2V2Q A;  2HKJ A;  1N33 I;  2WW4 A;  4LF6 E;  1VIS A;  1HNW I;  4DV6 E;  4DV5 E;  4LF7 E;  1N34 I;  1WUU A;  1HR0 E;  3H4L A;  4DUZ I;  2NPF A;  2A2D A;  4B3T E;  4JI0 E;  4FWG A;  4DR2 E;  1N34 E;  4LF7 I;  1MX0 A;  4LF6 I;  4M1K A;  3J81 Q;  1N33 E;  4HAC A;  1J5E I;  3K1J A;  4JI3 I;  4JV5 E;  1U2R A;  3ZZT A;  5IWA E;  1HNZ E;  4GKJ E;  4JI4 E;  4UT4 A;  3QT8 A;  4JYA I;  4JI5 E;  4JI6 E;  5BR8 I;  2V8P A;  4FWH A;  1FJG I;  4YHH E;  2DEJ A;  4DV7 I;  4URL A;  2BM0 A;  1XNR I;  1FWL A;  1ZM2 A;  4FW9 A;  1PVG A;  3F0N A;  4B3R I;  3Q1Q A;  1FI4 A;  1HNX I;  5LMN I;  4PRV A;  1IBL I;  4Z7Y A;  3B82 A;  2OI2 A;  4B3S I;  3JAM Q;  4KQV A;  1Z0V A;  2UUA I;  1Z0C A;  5IT9 Q;  5LMU E;  3JAM C;  5L3J A;  2LJP A;  4WUD A;  5GME A;  3WU3 A;  4USK A;  4LF9 I;  4NXM E;  4KHP E;  4LF9 E;  4DR3 I;  1N36 E;  4DR5 E;  4LFA I;  2VQF E;  3J7A M;  1RR9 A;  2ZIT A;  4OX9 I;  1FKA E;  4DV4 E;  5LMU I;  2BM1 A;  5FLX C;  3K17 A;  2F4V I;  4JI1 I;  2F4V E;  2HK3 A;  1ZM9 A; 
#chains in the Genus database with same CATH topology
 3D4J A;  4OX9 E;  4LF5 E;  4B3S E;  4DPY A;  4X65 I;  2BA1 D;  4MU1 A;  1ZM3 A;  2C39 A;  4X64 I;  4BA2 B;  2O1T A;  4DR5 I;  1NZ0 A;  1XXE A;  3U1Y A;  4NXN E;  5FWK A;  3GCM A;  1S16 A;  1R6L A;  4GKK I;  5K36 F;  4JI7 E;  1H7S A;  4KHP I;  3Q6M A;  3PS3 A;  4FWD A;  3OTO I;  1PIE A;  1OJ4 A;  3PYD A;  2E5L I;  2UXD E;  2UUB E;  4ED4 A;  4DV1 E;  3J81 C;  4LFB I;  1EA6 A;  1Z5B A;  1XMO E;  1Y5Y A;  2V2V A;  2PO1 A;  1IBM E;  4YHH I;  1BKN A;  2DEI A;  1NHI A;  1XNQ E;  4DR1 E;  3L7Z A;  3DD6 A;  2UUA E;  2Z5B B;  5IT9 C;  5C0X C;  4J3D A;  5BR8 E;  3J80 Q;  1KKH A;  2V2Z A;  2Z5B A;  4YY3 I;  4JYA E;  2JEA B;  3HKM A;  4DR6 E;  2EFG A;  4USM A;  4OO1 C;  1IBL E;  5JEA E;  4LCH A;  5IWA I;  1HNZ I;  4DV3 E;  2O1V A;  5LMN E;  1S4E A;  3ZM7 A;  4OO1 B;  1Z0T A;  4JV5 I;  4DUY I;  2C38 B;  4U3D A;  4Z7C A;  1J5E E;  2J7K A;  3PYF A;  3P3C A;  5JEA C;  2X36 A;  2VQE I;  1N0V C;  4JI0 I;  1FJG E;  1USV A;  4DUZ E;  1ZXM A;  2NN6 A;  5DRQ A;  2GQ0 A;  3GLL A;  1KTV A;  4DV5 I;  4DV6 I;  2VQE E;  3LTO A;  4MYU A;  4DV2 E;  1H74 A;  1NHH A;  2BA0 D;  4DR4 I;  2PNZ B;  3QT7 A;  1OYP A;  5C0X D;  2IER A;  2NN6 B;  4JI8 E;  1XMQ I;  4P52 A;  3V2U C;  1K47 A;  4JI4 I;  4LF8 E;  2Z5C B;  2O3Z A;  2R42 A;  3PS2 A;  4HXZ A;  4IZK B;  4IZJ D;  3WU4 A;  1VI7 A;  4DV3 I;  2R3V A;  4OO1 F;  4MU0 A;  1Z5C A;  4IFD A;  4DR6 I;  4JI8 I;  2Z5C A;  4YY3 E;  3LPS A;  4FW4 A;  1N0U A;  4DR7 E;  2IOP A;  3GME A;  4DV2 I;  4JI2 E;  2X7I A;  4HYM A;  5JEA D;  3T1H I;  2ZM6 E;  4DR1 I;  3M85 G;  3UHM A;  1DAR A;  3T1Y I;  3J7A G;  2BR2 A;  4FW7 A;  2PNM A;  5K36 A;  4AID A;  1Z0W A;  1Y4U A;  3HUL A;  1EI1 A;  1PKP A;  3B4T A;  2F1D A;  3L7Z B;  4UTG A;  4DPU A;  4DUY E;  1N32 I;  4FW6 A;  4JI7 I;  4ISA A;  2CVE A;  4GKK E;  4OKG A;  2C37 B;  4P7A A;  1IBK E;  1Z0E A;  4RPF A;  3LNU A;  4LFC E;  4X66 I;  4LF5 I;  2HHH E;  2PNL A;  4LPF A;  1XNQ I;  3WU5 A;  4DV4 I;  2GO4 A;  5GMD A;  2UXB E;  2BA1 G;  2BV3 A;  2VF3 A;  2GO3 A;  1IBM I;  1E3H A;  1H73 A;  1XMO I;  4LFB E;  1ZM4 A;  4AQY E;  4DV1 I;  2NN6 F;  1N36 I;  2UU9 E;  1QZR A;  2UUB I;  2CGE A;  2E5L E;  2UXD I;  3ZKB A;  3OTO E;  2J65 A;  3P06 A;  1UEK A;  1YHC A;  3ZZ0 A;  3CDI A;  4NXN I;  1XHK A;  4XTJ A;  4X64 E;  5DRR A;  1I94 E;  5C0X A;  2VES A;  4LF4 E;  4X65 E;  4B3M I;  4MQY A;  4LCG A;  2C38 A;  4DV0 I;  4I3H A;  5K36 B;  4JI1 E;  2HK2 A;  5C0X E;  4DV0 E;  1D6T A;  4EMD A;  2CZ9 A;  4B3M E;  4IFD D;  1ZXN A;  1YH8 A;  3ZKD A;  4LF4 I;  3WU6 A;  5FLX Q;  2CG9 A;  2XEX A;  2A2C A;  2VQF I;  4K0K I;  4LFA E;  4DPW A;  4LCF A;  4DR3 E;  5JEA A;  1B63 A;  1Z5A A;  1HNX E;  4JG4 A;  4B3R E;  2UXC E;  1UDO A;  4QNJ A;  4PU9 A;  4R1F A;  2HFU A;  3P76 A;  1RRE A;  1OYR A;  4IFD E;  2UXC I;  4FW3 A;  4BA1 B;  4N3O A;  4NXM I;  2Q2E B;  3NZK A;  3CWV A;  2UU9 I;  4DU8 A;  4DU7 A;  3GON A;  1Z59 A;  5A2Q Q;  4PRX A;  4AQY I;  1UDQ A;  4K0K E;  1FNM A;  3Q6N A;  1USU A;  4MU4 A;  2PNZ A;  4DV7 E;  2PO0 A;  4IFD F;  4OZE A;  1B62 A;  4FN5 A;  4OO1 A;  3QT5 A;  5DNL A;  4IZJ A;  3M6A A;  1R6M A;  2HHH I;  2HFS A;  4X66 E;  1I94 I;  1Z0G A;  1MG7 A;  1P42 A;  2C37 A;  1MU5 A;  3V5R A;  1ELO A;  4MYT A;  5DRO A;  4HY1 A;  4DPX A;  4WUB A;  4WUC A;  4AIM A;  5DNX A;  1NHJ A;  1A6F A;  2E1R A;  1KVK A;  4LOM A;  4HAC B;  4JI3 E;  2NN6 C;  2O1U A;  2ZBK B;  5LL6 R;  3B78 A;  3P3E A;  4OO1 E;  4DPT A;  1XNR E;  4FW5 A;  4IZK A;  3PYG A;  4NBQ A;  3M85 D;  4DR2 I;  4B3T I;  3T1Y E;  2AJ4 A;  3M7N G;  2UXB I;  1H72 C;  1Z0B A;  2ZM6 I;  5EKW A;  1HR0 I;  3T1H E;  2O1W A;  1HNW E;  5A2Q C;  4JI2 I;  5JEA B;  4DR7 I;  4JI6 I;  4AM3 A;  1UDS A;  2IOQ A;  4DXL A;  4JI5 I;  3B8H A;  4LFC I;  1KIJ A;  3M7N D;  4GQU A;  2UUC I;  1IBK I;  4GKJ I;  4X62 E;  2HKE A;  3QT6 A;  2GS8 A;  4X62 I;  3PYE A;  2JEB B;  4LF8 I;  2WNR B;  1FWK A;  3PRY A;  4IZJ B;  3ZZU A;  3P3G A;  2C39 B;  1H7U A;  2UUC E;  2JT2 A;  1XMQ E;  1N32 E;  3PS1 A;  2V34 A;  4ZVI A;  3J80 C;  3K85 A;  2V2Q A;  4DR4 E;  2HKJ A;  1N33 I;  2WW4 A;  4LF6 E;  1VIS A;  1HNW I;  4DV6 E;  2IES A;  4DV5 E;  1N34 I;  4LF7 E;  1WUU A;  1HR0 E;  3H4L A;  4IFD B;  4DUZ I;  2NPF A;  2A2D A;  4B3T E;  4JI0 E;  4FWG A;  4DR2 E;  1N34 E;  4LF7 I;  2NN6 E;  1MX0 A;  4IS9 A;  4M1K A;  4LF6 I;  3J81 Q;  1N33 E;  1Y4S A;  4HAC A;  1J5E I;  3K1J A;  4BA1 A;  4JI3 I;  4JV5 E;  1OYS A;  1U2R A;  1RHY A;  3ZZT A;  1Y60 A;  4OO1 D;  5IWA E;  1HNZ E;  4GKJ E;  4JI4 E;  4UT4 A;  3QT8 A;  4JYA I;  4JI5 E;  4JI6 E;  5BR8 I;  4QNK A;  3U1K A;  3H1C A;  2V8P A;  2JE6 A;  4FWH A;  4IFD C;  1FJG I;  4YHH E;  2DEJ A;  4DV7 I;  4URL A;  2BM0 A;  3KRN A;  1XNR I;  2PO0 B;  2JE6 B;  5JEA F;  1FWL A;  1ZM2 A;  4BA2 A;  4FW9 A;  1PVG A;  5DRP A;  3F0N A;  4B3R I;  5K36 C;  1UDN A;  3Q1Q A;  1FI4 A;  2Z5E A;  1HNX I;  5LMN I;  4PRV A;  2JEA A;  1IBL I;  2WP8 B;  4Z7Y A;  3B82 A;  5ELW A;  2BR2 B;  2WP8 A;  2OI2 A;  4B3S I;  3JAM Q;  5EL9 A;  4KQV A;  5C0X F;  1Z0V A;  2UUA I;  1Z0C A;  5IT9 Q;  5LMU E;  3JAM C;  5L3J A;  4MDT A;  5K36 E;  2LJP A;  4WUD A;  5GME A;  3WU3 A;  2WNR A;  4USK A;  2PO1 B;  2BA0 G;  4LF9 I;  4NXM E;  2AE8 A;  4MU3 A;  1HK7 A;  4KHP E;  2NN6 D;  1E3P A;  3CDJ A;  4LF9 E;  2PO2 A;  4DR3 I;  1N36 E;  5K36 D;  3HJC A;  4DR5 E;  4LFA I;  2PO2 B;  2VQF E;  3J7A M;  1RR9 A;  2ZIT A;  4U3B A;  5C0X B;  4OX9 I;  1FKA E;  4DV4 E;  5LMU I;  2BM1 A;  5FLX C;  3K17 A;  2F4V I;  4JI1 I;  2F4V E;  2HK3 A;  1ZM9 A;  1Y6Z A;  2JEB A; 
#chains in the Genus database with same CATH homology
 3D4J A;  4OX9 E;  4LF5 E;  4B3S E;  4DPY A;  4X65 I;  1ZM3 A;  4X64 I;  2O1T A;  4DR5 I;  1NZ0 A;  4NXN E;  5FWK A;  1S16 A;  4GKK I;  4JI7 E;  1H7S A;  4KHP I;  3Q6M A;  4FWD A;  3OTO I;  1PIE A;  1OJ4 A;  3PYD A;  2E5L I;  2UXD E;  2UUB E;  4ED4 A;  4DV1 E;  3J81 C;  4LFB I;  1EA6 A;  1Z5B A;  1XMO E;  2V2V A;  1IBM E;  4YHH I;  1BKN A;  2DEI A;  1NHI A;  1XNQ E;  4DR1 E;  2UUA E;  2Z5B B;  5IT9 C;  3J80 Q;  5BR8 E;  1KKH A;  2V2Z A;  2Z5B A;  4YY3 I;  4JYA E;  4DR6 E;  2EFG A;  4USM A;  1IBL E;  1HNZ I;  5IWA I;  4DV3 E;  2O1V A;  5LMN E;  1S4E A;  3ZM7 A;  1Z0T A;  4JV5 I;  4DUY I;  4Z7C A;  1J5E E;  2J7K A;  3PYF A;  2X36 A;  2VQE I;  1N0V C;  4JI0 I;  1FJG E;  1USV A;  4DUZ E;  1ZXM A;  2GQ0 A;  4DV5 I;  1KTV A;  4DV6 I;  2VQE E;  3LTO A;  4MYU A;  4DV2 E;  1H74 A;  1NHH A;  4DR4 I;  3QT7 A;  4JI8 E;  1XMQ I;  4P52 A;  3V2U C;  1K47 A;  4JI4 I;  4LF8 E;  2Z5C B;  2R42 A;  4HXZ A;  4IZK B;  4IZJ D;  3WU4 A;  4DV3 I;  2R3V A;  1Z5C A;  4DR6 I;  4JI8 I;  2Z5C A;  4YY3 E;  3LPS A;  1N0U A;  4DR7 E;  2IOP A;  4DV2 I;  4JI2 E;  2X7I A;  4HYM A;  3T1H I;  2ZM6 E;  4DR1 I;  1DAR A;  3T1Y I;  3J7A G;  2PNM A;  1Z0W A;  1Y4U A;  3HUL A;  1EI1 A;  1PKP A;  4UTG A;  4DPU A;  4DUY E;  1N32 I;  4JI7 I;  4GKK E;  4P7A A;  1IBK E;  1Z0E A;  4RPF A;  3LNU A;  4LFC E;  4X66 I;  4LF5 I;  2HHH E;  2PNL A;  1XNQ I;  3WU5 A;  4DV4 I;  2UXB E;  5GMD A;  2BV3 A;  2VF3 A;  1IBM I;  1H73 A;  1XMO I;  4LFB E;  1ZM4 A;  4AQY E;  4DV1 I;  1N36 I;  2UU9 E;  1QZR A;  2UUB I;  2CGE A;  2E5L E;  2UXD I;  3ZKB A;  3OTO E;  3P06 A;  1UEK A;  3ZZ0 A;  4NXN I;  1XHK A;  4XTJ A;  4X64 E;  1I94 E;  4LF4 E;  4X65 E;  4B3M I;  4DV0 I;  4I3H A;  4JI1 E;  2HK2 A;  4DV0 E;  1D6T A;  4EMD A;  2CZ9 A;  4B3M E;  1ZXN A;  3ZKD A;  4LF4 I;  3WU6 A;  5FLX Q;  2CG9 A;  2XEX A;  2A2C A;  2VQF I;  4K0K I;  4LFA E;  4DPW A;  4DR3 E;  1B63 A;  1Z5A A;  1HNX E;  4JG4 A;  4B3R E;  2UXC E;  4PU9 A;  4R1F A;  2HFU A;  1RRE A;  2UXC I;  4N3O A;  4NXM I;  2Q2E B;  3CWV A;  2UU9 I;  4DU8 A;  4DU7 A;  3GON A;  1Z59 A;  5A2Q Q;  4PRX A;  4AQY I;  4K0K E;  1FNM A;  3Q6N A;  1USU A;  4DV7 E;  1B62 A;  4FN5 A;  3QT5 A;  4IZJ A;  3M6A A;  2HHH I;  2HFS A;  4X66 E;  1I94 I;  1Z0G A;  1MG7 A;  1MU5 A;  3V5R A;  1ELO A;  4MYT A;  4HY1 A;  4DPX A;  4WUB A;  4WUC A;  1NHJ A;  1A6F A;  2E1R A;  1KVK A;  4HAC B;  4JI3 E;  2O1U A;  2ZBK B;  5LL6 R;  3B78 A;  4DPT A;  1XNR E;  4IZK A;  3PYG A;  4DR2 I;  4B3T I;  3T1Y E;  2AJ4 A;  2UXB I;  1H72 C;  1Z0B A;  2ZM6 I;  1HR0 I;  3T1H E;  2O1W A;  1HNW E;  5A2Q C;  4JI2 I;  4DR7 I;  4JI6 I;  2IOQ A;  4DXL A;  4JI5 I;  3B8H A;  4LFC I;  1KIJ A;  2UUC I;  1IBK I;  4GKJ I;  4X62 E;  2HKE A;  3QT6 A;  2GS8 A;  4X62 I;  3PYE A;  4LF8 I;  1FWK A;  3PRY A;  4IZJ B;  3ZZU A;  1H7U A;  2UUC E;  1XMQ E;  1N32 E;  2V34 A;  4ZVI A;  3J80 C;  3K85 A;  2V2Q A;  4DR4 E;  2HKJ A;  1N33 I;  2WW4 A;  4LF6 E;  1VIS A;  1HNW I;  4DV6 E;  4DV5 E;  1N34 I;  4LF7 E;  1WUU A;  1HR0 E;  3H4L A;  4DUZ I;  2NPF A;  2A2D A;  4B3T E;  4JI0 E;  4FWG A;  4DR2 E;  1N34 E;  4LF7 I;  1MX0 A;  4M1K A;  4LF6 I;  3J81 Q;  1N33 E;  1Y4S A;  4HAC A;  1J5E I;  3K1J A;  4JI3 I;  4JV5 E;  1U2R A;  3ZZT A;  5IWA E;  1HNZ E;  4GKJ E;  4JI4 E;  4UT4 A;  3QT8 A;  4JYA I;  4JI5 E;  4JI6 E;  5BR8 I;  2V8P A;  4FWH A;  1FJG I;  4YHH E;  2DEJ A;  4DV7 I;  4URL A;  2BM0 A;  1XNR I;  1FWL A;  1ZM2 A;  4FW9 A;  1PVG A;  3F0N A;  4B3R I;  3Q1Q A;  1FI4 A;  2Z5E A;  1HNX I;  5LMN I;  4PRV A;  1IBL I;  4Z7Y A;  3B82 A;  2OI2 A;  4B3S I;  3JAM Q;  4KQV A;  1Z0V A;  2UUA I;  1Z0C A;  5IT9 Q;  5LMU E;  3JAM C;  5L3J A;  2LJP A;  4WUD A;  5GME A;  3WU3 A;  4USK A;  4LF9 I;  4NXM E;  1HK7 A;  4KHP E;  4LF9 E;  4DR3 I;  1N36 E;  3HJC A;  4DR5 E;  4LFA I;  2VQF E;  3J7A M;  1RR9 A;  2ZIT A;  4OX9 I;  1FKA E;  4DV4 E;  5LMU I;  2BM1 A;  5FLX C;  3K17 A;  2F4V I;  4JI1 I;  2F4V E;  2HK3 A;  1ZM9 A;  1Y6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...