1Z0VA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pathological crystallography: case studies of several unusual macromolecular crystals.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Putative protease La homolog type
total genus 53
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0vA00
1HNXE 3WU6A 2V2VA 2ZBKB 1H74A 4DU7A 4M1KA 4EMDA 4HY1A 4LF5E 1N36I 1RR9A 1PIEA 1A6FA 4X65E 3B8HA 4HYMA 5LMUI 4DR3E 3ZZ0A 4NXME 4DR6I 4DUYE 1H7SA 3ZM7A 1ZXMA 2V8PA 3J7AG 1XMOI 3LTOA 2UUCI 1N32I 4OX9E 4JI3I 1H7UA 4LF4E 2Q2EB 4MYTA 4GKKE 1K47A 4MYUA 4GKJI 2J7KA 3PYEA 4LFCI 1N36E 1KIJA 2X7IA 4B3TE 2EFGA 4X65I 1DARA 4AQYI 1FWLA 1ZXNA 3K1JA 1S4EA 4DUYI 2WW4A 2HKEA 4B3SE 2ZITA 1U2RA 5L3JA 5IWAI 4DR5I 1J5EI 4LF7E 1H72C 4OX9I 3J80C 4LF9E 4HXZA 4DR4I 2GS8A 1S16A 2UXDE 2ZM6I 4LFCE 3QT6A 1N0VC 4B3TI 1Z5CA 1D6TA 1EA6A 4JI7E 1N33E 4WUBA 1B63A 4LFAE 5GMEA 4I3HA 2BM0A 4HACB 5IWAE 4DR5E 4YHHE 1J5EE 1NHJA 2A2CA 4DPUA 4DPWA 1Z0BA 4LF7I 4DUZI 2UXCE 5LL6R 2HHHI 4Z7YA 4LF9I 4XTJA 1Z0WA 4X62E 1OJ4A 2CZ9A 4HACA 4DPYA 2ZM6E 4UTGA 2UUBE 1FKAE 3WU3A 1Z0TA 4WUCA 4JI4I 4JI6I 1ZM4A 4DR1I 2UUAE 1XNQE 5LMNI 1N33I 4FWDA 2V2QA 4DV7E 4K0KE 4PRXA 4LFAI 4DV3I 2UU9E 4P7AA 3LNUA 1MU5A 4YHHI 3F0NA 1Z0CA 2DEIA 4B3ME 1HR0E 5A2QQ 5A2QC 3T1HE 4DV0E 4JI2I 1IBKE 4KQVA 2DEJA 4YY3E 3H4LA 3JAMC 4JG4A 1RREA 1HNXI 4DV4I 4DR7E 4JI6E 4LF5I 1XNQI 1H73A 4JYAE 2F4VI 2E5LI 2VQFI 4FN5A 1XMQE 5LMUE 4DV3E 2HFSA 2BM1A 2XEXA 3V2UC 4PRVA 5BR8I 2UUCE 4DV0I 1N32E 1IBKI 4LF4I 4ED4A 4X66E 1Z5AA 4GKKI 4DV4E 4DV1I 4DR7I 4FWGA 4GKJE 1XHKA 4JI8E 3QT5A 4JYAI 1EI1A 3OTOE 1B62A 2F4VE 1FNMA 4USKA 2E5LE 4AQYE 4FWHA 4PU9A 1N34I 5FLXQ 1NZ0A 1FJGE 4JI5I 4LF8E 4JI0E 1Z0GA 4ZVIA 4DR2I 4DV5E 3J80Q 1IBME 4X64I 2BV3A 5BR8E 2LJPA 1FWKA 3B78A 4X66I 1HNZI 4P52A 4DR4E 2UXDI 1QZRA 2HK2A 1WUUA 4Z7CA 1MX0A 1ZM9A 4RPFA 3HULA 4NXMI 1N34E 3T1YE 1ELOA 1PVGA 1KKHA 4B3RE 3ZZUA 4DPTA 4JI5E 4JI0I 2HK3A 5IT9Q 1XMOE 1IBMI 2E1RA 1Z0VA 4X64E 4DUZE 2UXCI 3CWVA 2HHHE 2X36A 5GMDA 1HNZE 4X62I 3K17A 3D4JA 3PYFA 1KTVA 3WU5A 4DXLA 2UUBI 3ZKBA 2VQEE 4DR1E 2UUAI 4KHPI 3T1YI 1Z59A 4B3SI 4K0KI 4B3RI 4DV2E 1IBLI 1ZM2A 3WU4A 2UU9I 4JI1E 1VISA 4USMA 4NXNE 3PYGA 3ZKDA 1FI4A 3T1HI 1BKNA 4URLA 1KVKA 1I94I 2V34A 4DV6I 4LFBI 2VQEI 4DPXA 4DU8A 3QT7A 4JI7I 1ZM3A 4KHPE 2UXBI 1HNWE 2VQFE 1XMQI 4DV2I 1IBLE 3V5RA 4JI1I 3LPSA 4NXNI 5IT9C 3Q1QA 1PKPA 3JAMQ 1XNRE 1Z5BA 4JV5E 4FW9A 2R42A 1NHHA 3M6AA 2V2ZA 4LF6E 3J81C 2OI2A 1I94E 4DV6E 4LFBE 4DV1E 4JI4E 1NHIA 4WUDA 4JI8I 2R3VA 5LMNE 2AJ4A 3QT8A 3OTOI 2UXBE 3B82A 2HKJA 3J7AM 2NPFA 4UT4A 1HNWI 4DV7I 3J81Q 4DR3I 4R1FA 4DR6E 5FLXC 1FJGI 1UEKA 2A2DA 4LF8I 4DR2E 1Z0EA 1MG7A 4B3MI 4DV5I 1HR0I 3PYDA 2HFUA 2VF3A 1XNRI 4JV5I 4JI2E 4YY3I 4LF6I 3ZZTA 4JI3E 1N0UA 3GONA
chains in the Genus database with same CATH superfamily
1HNXE 3WU6A 2V2VA 4AIDA 2ZBKB 1H74A 4DU7A 4OO1F 4M1KA 4EMDA 4HY1A 4LF5E 1N36I 1RR9A 1PIEA 4OO1C 1A6FA 3Q6NA 4X65E 3B8HA 4MU3A 3P3EA 4HYMA 5LMUI 4BA2B 4DR3E 3ZZ0A 3U1KA 4NXME 4DR6I 1Y4SA 4DUYE 3PS3A 1H7SA 2BA1G 2C38B 3ZM7A 1ZXMA 2V8PA 3J7AG 4LOMA 1XMOI 4AM3A 4IFDD 3LTOA 1RHYA 2UUCI 2NN6C 1N32I 2BA0D 4OX9E 2PO2A 3UHMA 2C38A 5EL9A 4JI3I 1H7UA 4LF4E 2PNZA 1Y4UA 2Q2EB 2O1VA 4MYTA 5JEAD 4GKKE 4FW7A 1K47A 4MYUA 4GKJI 2J7KA 3PYEA 4LFCI 2O1UA 1N36E 2PO0B 1KIJA 2X7IA 4B3TE 2EFGA 4X65I 1DARA 4AQYI 1FWLA 1ZXNA 3K1JA 1S4EA 3H1CA 4DUYI 2WW4A 2HKEA 4B3SE 4FW3A 2ZITA 2C37A 1U2RA 5C0XF 5L3JA 1Y60A 5IWAI 4DR5I 2C37B 1J5EI 4LF7E 1H72C 4OX9I 3J80C 3L7ZB 4LF9E 4OO1E 4HXZA 5DROA 3B4TA 4DR4I 2Z5CB 2GS8A 1S16A 2UXDE 2ZM6I 4LFCE 3QT6A 4IS9A 5JEAC 1N0VC 4B3TI 3P76A 1Z5CA 2NN6A 1D6TA 3PS1A 1EA6A 3P3CA 4JI7E 4WUBA 1N33E 5K36C 4OO1B 1P42A 2Z5CA 1B63A 4LFAE 5DRRA 5GMEA 4I3HA 2BM0A 4HACB 5IWAE 3M85D 4DR5E 4YHHE 3NZKA 1J5EE 1NHJA 2A2CA 4DPUA 4DPWA 1Z0BA 4LF7I 4DUZI 2UXCE 5LL6R 4OO1A 2BA1D 2HHHI 4Z7YA 4LF9I 4XTJA 1Z0WA 4X62E 4NBQA 1OJ4A 2CZ9A 3P06A 4HACA 1UDSA 4DPYA 2ZM6E 4UTGA 4AIMA 5DRPA 2UUBE 1FKAE 3WU3A 1Z0TA 2NN6D 4WUCA 2J65A 4JI4I 4JI6I 1ZM4A 4DR1I 2UUAE 1XNQE 5LMNI 2O1TA 2PO0A 1N33I 2CGEA 4FWDA 2NN6E 5DRQA 4ISAA 2V2QA 4DV7E 4K0KE 4PRXA 4LFAI 4DV3I 4LCFA 1Y6ZA 2PO2B 4P7AA 2UU9E 3LNUA 1MU5A 4YHHI 3F0NA 1HK7A 1Z0CA 2IOQA 2Z5BA 2DEIA 2GO4A 3Q6MA 4B3ME 1USUA 2IOPA 1HR0E 5A2QQ 5A2QC 3DD6A 3T1HE 2JE6B 4DV0E 4JI2I 1IBKE 4KQVA 2DEJA 4YY3E 2O1WA 3H4LA 3L7ZA 3JAMC 3CDIA 4JG4A 1RREA 2GO3A 1HNXI 2Z5BB 4DV4I 4DR7E 3CDJA 4JI6E 2GQ0A 4LF5I 1XNQI 1H73A 5JEAE 4JYAE 2F4VI 2E5LI 3HKMA 4FN5A 2VQFI 1XMQE 4LCHA 5JEAA 5LMUE 4DV3E 1OYRA 4MQYA 2HFSA 2CG9A 5JEAB 3GLLA 2BM1A 2XEXA 3V2UC 4PRVA 5BR8I 2UUCE 4DV0I 1N32E 4OKGA 1IBKI 3M85G 4LF4I 4ED4A 2JE6A 4X66E 1Z5AA 1VI7A 4GKKI 4DV4E 4DV1I 4DR7I 4FWGA 4GKJE 1XHKA 4JI8E 5FWKA 3QT5A 4JYAI 1EI1A 3OTOE 1B62A 1YHCA 2F4VE 1FNMA 4USKA 2E5LE 1XXEA 1OYSA 4AQYE 4FWHA 4PU9A 1N34I 5FLXQ 1NZ0A 4OZEA 2PNMA 1FJGE 4MDTA 2CVEA 4JI5I 4LF8E 4JI0E 1Z0GA 4ZVIA 4DR2I 4DV5E 3J80Q 2NN6F 1IBME 4X64I 1R6MA 2BV3A 4BA1B 1UDNA 5BR8E 2LJPA 1FWKA 3GMEA 2JT2A 4OO1D 3GCMA 3B78A 4X66I 1HNZI 4P52A 4DR4E 2UXDI 4IFDB 1QZRA 5K36E 2HK2A 1R6LA 5DNXA 1WUUA 5DNLA 1E3HA 2WNRB 2JEAA 5JEAF 4LPFA 4Z7CA 1MX0A 1ZM9A 4RPFA 3HULA 4NXMI 2WP8A 1N34E 3T1YE 1ELOA 1E3PA 2JEBA 1PVGA 5C0XE 1KKHA 4B3RE 3K85A 3ZZUA 4DPTA 4JI5E 4JI0I 2HK3A 5IT9Q 1XMOE 4J3DA 1IBMI 2E1RA 1Z0VA 4X64E 4DUZE 2UXCI 2O3ZA 3CWVA 4U3DA 4U3BA 2WP8B 2HHHE 2BR2B 2X36A 3U1YA 4MU0A 5GMDA 1HNZE 5EKWA 4X62I 3K17A 2BR2A 3D4JA 4IFDC 4QNKA 3PYFA 1KTVA 3WU5A 4DXLA 2UUBI 2PO1B 4MU1A 3ZKBA 2VQEE 4FW5A 4DR1E 1USVA 2UUAI 2PNZB 4IZJA 4KHPI 4IZKA 4IFDE 3T1YI 2JEAB 2WNRA 1Z59A 4B3SI 4K0KI 2AE8A 4B3RI 4DV2E 1IBLI 1ZM2A 3WU4A 3PRYA 4FW6A 2UU9I 4JI1E 1VISA 4USMA 4NXNE 3M7ND 2IERA 3PYGA 3ZKDA 5K36D 3P3GA 4IFDF 1FI4A 5C0XD 1BKNA 3T1HI 4URLA 1KVKA 1I94I 2V34A 2VESA 4DV6I 4LFBI 2VQEI 5C0XA 4IFDA 4DPXA 4DU8A 4MU4A 3QT7A 4JI7I 1ZM3A 4KHPE 5K36B 5C0XC 2UXBI 3HJCA 1HNWE 2VQFE 1XMQI 2C39B 4GQUA 4IZKB 4DV2I 1IBLE 4IZJB 3M7NG 2BA0G 3V5RA 1OYPA 4LCGA 4JI1I 3LPSA 2NN6B 4NXNI 5IT9C 4N3OA 2Z5EA 5ELWA 3Q1QA 1PKPA 3JAMQ 2PNLA 1XNRE 1Z5BA 4JV5E 4FW9A 4QNJA 2R42A 1NHHA 3M6AA 2V2ZA 3J81C 4LF6E 2OI2A 2F1DA 4BA2A 1I94E 4DV6E 4LFBE 4DV1E 4JI4E 5K36F 1NHIA 2JEBB 4WUDA 4JI8I 2R3VA 5LMNE 2AJ4A 3QT8A 3OTOI 5C0XB 2UXBE 3B82A 2HKJA 3J7AM 2NPFA 4UT4A 4BA1A 4DV7I 1HNWI 3KRNA 3J81Q 4DR3I 4R1FA 5K36A 1UDOA 4DR6E 5FLXC 1FJGI 1Y5YA 1UEKA 2A2DA 4FW4A 4LF8I 4DR2E 1Z0EA 1MG7A 4B3MI 4DV5I 3PS2A 1HR0I 3PYDA 2HFUA 2C39A 2VF3A 1XNRI 4JV5I 2PO1A 4JI2E 2IESA 4YY3I 4LF6I 3ZZTA 4JI3E 1YH8A 4IZJD 1N0UA 3GONA 1UDQA
chains in the Genus database with same CATH topology
1HNXE 3WU6A 2V2VA 2ZBKB 1H74A 4DU7A 4M1KA 4EMDA 4HY1A 4LF5E 1N36I 1RR9A 1PIEA 1A6FA 3Q6NA 4X65E 3B8HA 4HYMA 5LMUI 4DR3E 3ZZ0A 4NXME 4DR6I 1Y4SA 4DUYE 1H7SA 3ZM7A 1ZXMA 2V8PA 3J7AG 1XMOI 3LTOA 2UUCI 1N32I 4OX9E 4JI3I 1H7UA 4LF4E 1Y4UA 2Q2EB 2O1VA 4MYTA 4GKKE 1K47A 4MYUA 4GKJI 2J7KA 3PYEA 4LFCI 2O1UA 1N36E 1KIJA 2X7IA 4B3TE 2EFGA 4X65I 1DARA 4AQYI 1FWLA 1ZXNA 3K1JA 1S4EA 4DUYI 2WW4A 2HKEA 4B3SE 2ZITA 1U2RA 5L3JA 5IWAI 4DR5I 1J5EI 4LF7E 1H72C 4OX9I 3J80C 4LF9E 4HXZA 4DR4I 2Z5CB 2GS8A 1S16A 2UXDE 2ZM6I 4LFCE 3QT6A 1N0VC 4B3TI 1Z5CA 1D6TA 1EA6A 4JI7E 1N33E 4WUBA 2Z5CA 1B63A 4LFAE 5GMEA 4I3HA 2BM0A 4HACB 5IWAE 4DR5E 4YHHE 1J5EE 1NHJA 2A2CA 4DPUA 4DPWA 1Z0BA 4LF7I 4DUZI 2UXCE 5LL6R 2HHHI 4Z7YA 4LF9I 4XTJA 1Z0WA 4X62E 1OJ4A 2CZ9A 3P06A 4HACA 4DPYA 2ZM6E 4UTGA 2UUBE 1FKAE 3WU3A 1Z0TA 4WUCA 4JI4I 4JI6I 1ZM4A 4DR1I 2UUAE 1XNQE 5LMNI 2O1TA 1N33I 2CGEA 4FWDA 2V2QA 4DV7E 4K0KE 4PRXA 4LFAI 4DV3I 1Y6ZA 2UU9E 4P7AA 3LNUA 1MU5A 4YHHI 3F0NA 1HK7A 1Z0CA 2IOQA 2Z5BA 2DEIA 3Q6MA 4B3ME 1USUA 2IOPA 1HR0E 5A2QQ 5A2QC 3T1HE 4DV0E 4JI2I 1IBKE 4KQVA 2DEJA 4YY3E 2O1WA 3H4LA 3JAMC 4JG4A 1RREA 1HNXI 2Z5BB 4DV4I 4DR7E 4JI6E 2GQ0A 4LF5I 1XNQI 1H73A 4JYAE 2F4VI 2E5LI 2VQFI 4FN5A 1XMQE 5LMUE 4DV3E 2HFSA 2CG9A 2BM1A 2XEXA 3V2UC 4PRVA 5BR8I 2UUCE 4DV0I 1N32E 1IBKI 4LF4I 4ED4A 4X66E 1Z5AA 4GKKI 4DV4E 4DV1I 4DR7I 4FWGA 4GKJE 1XHKA 4JI8E 5FWKA 3QT5A 4JYAI 1EI1A 3OTOE 1B62A 2F4VE 1FNMA 4USKA 2E5LE 4AQYE 4FWHA 4PU9A 1N34I 5FLXQ 1NZ0A 2PNMA 1FJGE 4JI5I 4LF8E 4JI0E 1Z0GA 4ZVIA 4DR2I 4DV5E 3J80Q 1IBME 4X64I 2BV3A 5BR8E 2LJPA 1FWKA 3B78A 4X66I 1HNZI 4P52A 4DR4E 2UXDI 1QZRA 2HK2A 1WUUA 4Z7CA 1MX0A 1ZM9A 4RPFA 3HULA 4NXMI 1N34E 3T1YE 1ELOA 1PVGA 1KKHA 4B3RE 3K85A 3ZZUA 4DPTA 4JI5E 4JI0I 2HK3A 5IT9Q 1XMOE 1IBMI 2E1RA 1Z0VA 4X64E 4DUZE 2UXCI 3CWVA 2HHHE 2X36A 5GMDA 1HNZE 4X62I 3K17A 3D4JA 3PYFA 1KTVA 3WU5A 4DXLA 2UUBI 3ZKBA 2VQEE 4DR1E 1USVA 2UUAI 4IZJA 4KHPI 4IZKA 3T1YI 1Z59A 4B3SI 4K0KI 4B3RI 4DV2E 1IBLI 1ZM2A 3WU4A 3PRYA 2UU9I 4JI1E 1VISA 4USMA 4NXNE 3PYGA 3ZKDA 1FI4A 3T1HI 1BKNA 4URLA 1KVKA 1I94I 2V34A 4DV6I 4LFBI 2VQEI 4DPXA 4DU8A 3QT7A 4JI7I 1ZM3A 4KHPE 2UXBI 3HJCA 1HNWE 2VQFE 1XMQI 4IZKB 4DV2I 1IBLE 4IZJB 3V5RA 4JI1I 3LPSA 4NXNI 5IT9C 4N3OA 2Z5EA 3Q1QA 1PKPA 3JAMQ 2PNLA 1XNRE 1Z5BA 4JV5E 4FW9A 2R42A 1NHHA 3M6AA 2V2ZA 3J81C 4LF6E 2OI2A 1I94E 4DV6E 4LFBE 4DV1E 4JI4E 1NHIA 4WUDA 4JI8I 2R3VA 5LMNE 2AJ4A 3QT8A 3OTOI 2UXBE 3B82A 2HKJA 3J7AM 2NPFA 4UT4A 1HNWI 4DV7I 3J81Q 4DR3I 4R1FA 4DR6E 5FLXC 1FJGI 1UEKA 2A2DA 4LF8I 4DR2E 1Z0EA 1MG7A 4B3MI 4DV5I 1HR0I 3PYDA 2HFUA 2VF3A 1XNRI 4JV5I 4JI2E 4YY3I 4LF6I 3ZZTA 4JI3E 4IZJD 1N0UA 3GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX E;  3WU6 A;  2V2V A;  2ZBK B;  1H74 A;  4DU7 A;  4M1K A;  4EMD A;  4HY1 A;  4LF5 E;  1N36 I;  1RR9 A;  1PIE A;  1A6F A;  4X65 E;  3B8H A;  4HYM A;  5LMU I;  4DR3 E;  3ZZ0 A;  4NXM E;  4DR6 I;  4DUY E;  1H7S A;  3ZM7 A;  1ZXM A;  2V8P A;  3J7A G;  1XMO I;  3LTO A;  2UUC I;  1N32 I;  4OX9 E;  4JI3 I;  1H7U A;  4LF4 E;  2Q2E B;  4MYT A;  4GKK E;  1K47 A;  4MYU A;  4GKJ I;  2J7K A;  3PYE A;  4LFC I;  1N36 E;  1KIJ A;  2X7I A;  4B3T E;  2EFG A;  4X65 I;  1DAR A;  4AQY I;  1FWL A;  1ZXN A;  3K1J A;  1S4E A;  4DUY I;  2WW4 A;  2HKE A;  4B3S E;  2ZIT A;  1U2R A;  5L3J A;  5IWA I;  4DR5 I;  1J5E I;  4LF7 E;  1H72 C;  4OX9 I;  3J80 C;  4LF9 E;  4HXZ A;  4DR4 I;  2GS8 A;  1S16 A;  2UXD E;  2ZM6 I;  4LFC E;  3QT6 A;  1N0V C;  4B3T I;  1Z5C A;  1D6T A;  1EA6 A;  4JI7 E;  1N33 E;  4WUB A;  1B63 A;  4LFA E;  5GME A;  4I3H A;  2BM0 A;  4HAC B;  5IWA E;  4DR5 E;  4YHH E;  1J5E E;  1NHJ A;  2A2C A;  4DPU A;  4DPW A;  1Z0B A;  4LF7 I;  4DUZ I;  2UXC E;  5LL6 R;  2HHH I;  4Z7Y A;  4LF9 I;  4XTJ A;  1Z0W A;  4X62 E;  1OJ4 A;  2CZ9 A;  4HAC A;  4DPY A;  2ZM6 E;  4UTG A;  2UUB E;  1FKA E;  3WU3 A;  1Z0T A;  4WUC A;  4JI4 I;  4JI6 I;  1ZM4 A;  4DR1 I;  2UUA E;  1XNQ E;  5LMN I;  1N33 I;  4FWD A;  2V2Q A;  4DV7 E;  4K0K E;  4PRX A;  4LFA I;  4DV3 I;  2UU9 E;  4P7A A;  3LNU A;  1MU5 A;  4YHH I;  3F0N A;  1Z0C A;  2DEI A;  4B3M E;  1HR0 E;  5A2Q Q;  5A2Q C;  3T1H E;  4DV0 E;  4JI2 I;  1IBK E;  4KQV A;  2DEJ A;  4YY3 E;  3H4L A;  3JAM C;  4JG4 A;  1RRE A;  1HNX I;  4DV4 I;  4DR7 E;  4JI6 E;  4LF5 I;  1XNQ I;  1H73 A;  4JYA E;  2F4V I;  2E5L I;  2VQF I;  4FN5 A;  1XMQ E;  5LMU E;  4DV3 E;  2HFS A;  2BM1 A;  2XEX A;  3V2U C;  4PRV A;  5BR8 I;  2UUC E;  4DV0 I;  1N32 E;  1IBK I;  4LF4 I;  4ED4 A;  4X66 E;  1Z5A A;  4GKK I;  4DV4 E;  4DV1 I;  4DR7 I;  4FWG A;  4GKJ E;  1XHK A;  4JI8 E;  3QT5 A;  4JYA I;  1EI1 A;  3OTO E;  1B62 A;  2F4V E;  1FNM A;  4USK A;  2E5L E;  4AQY E;  4FWH A;  4PU9 A;  1N34 I;  5FLX Q;  1NZ0 A;  1FJG E;  4JI5 I;  4LF8 E;  4JI0 E;  1Z0G A;  4ZVI A;  4DR2 I;  4DV5 E;  3J80 Q;  1IBM E;  4X64 I;  2BV3 A;  5BR8 E;  2LJP A;  1FWK A;  3B78 A;  4X66 I;  1HNZ I;  4P52 A;  4DR4 E;  2UXD I;  1QZR A;  2HK2 A;  1WUU A;  4Z7C A;  1MX0 A;  1ZM9 A;  4RPF A;  3HUL A;  4NXM I;  1N34 E;  3T1Y E;  1ELO A;  1PVG A;  1KKH A;  4B3R E;  3ZZU A;  4DPT A;  4JI5 E;  4JI0 I;  2HK3 A;  5IT9 Q;  1XMO E;  1IBM I;  2E1R A;  1Z0V A;  4X64 E;  4DUZ E;  2UXC I;  3CWV A;  2HHH E;  2X36 A;  5GMD A;  1HNZ E;  4X62 I;  3K17 A;  3D4J A;  3PYF A;  1KTV A;  3WU5 A;  4DXL A;  2UUB I;  3ZKB A;  2VQE E;  4DR1 E;  2UUA I;  4KHP I;  3T1Y I;  1Z59 A;  4B3S I;  4K0K I;  4B3R I;  4DV2 E;  1IBL I;  1ZM2 A;  3WU4 A;  2UU9 I;  4JI1 E;  1VIS A;  4USM A;  4NXN E;  3PYG A;  3ZKD A;  1FI4 A;  3T1H I;  1BKN A;  4URL A;  1KVK A;  1I94 I;  2V34 A;  4DV6 I;  4LFB I;  2VQE I;  4DPX A;  4DU8 A;  3QT7 A;  4JI7 I;  1ZM3 A;  4KHP E;  2UXB I;  1HNW E;  2VQF E;  1XMQ I;  4DV2 I;  1IBL E;  3V5R A;  4JI1 I;  3LPS A;  4NXN I;  5IT9 C;  3Q1Q A;  1PKP A;  3JAM Q;  1XNR E;  1Z5B A;  4JV5 E;  4FW9 A;  2R42 A;  1NHH A;  3M6A A;  2V2Z A;  4LF6 E;  3J81 C;  2OI2 A;  1I94 E;  4DV6 E;  4LFB E;  4DV1 E;  4JI4 E;  1NHI A;  4WUD A;  4JI8 I;  2R3V A;  5LMN E;  2AJ4 A;  3QT8 A;  3OTO I;  2UXB E;  3B82 A;  2HKJ A;  3J7A M;  2NPF A;  4UT4 A;  1HNW I;  4DV7 I;  3J81 Q;  4DR3 I;  4R1F A;  4DR6 E;  5FLX C;  1FJG I;  1UEK A;  2A2D A;  4LF8 I;  4DR2 E;  1Z0E A;  1MG7 A;  4B3M I;  4DV5 I;  1HR0 I;  3PYD A;  2HFU A;  2VF3 A;  1XNR I;  4JV5 I;  4JI2 E;  4YY3 I;  4LF6 I;  3ZZT A;  4JI3 E;  1N0U A;  3GON A; 
#chains in the Genus database with same CATH topology
 1HNX E;  3WU6 A;  2V2V A;  4AID A;  2ZBK B;  1H74 A;  4DU7 A;  4OO1 F;  4M1K A;  4EMD A;  4HY1 A;  4LF5 E;  1N36 I;  1RR9 A;  1PIE A;  4OO1 C;  1A6F A;  3Q6N A;  4X65 E;  3B8H A;  4MU3 A;  3P3E A;  4HYM A;  5LMU I;  4BA2 B;  4DR3 E;  3ZZ0 A;  3U1K A;  4NXM E;  4DR6 I;  1Y4S A;  4DUY E;  3PS3 A;  1H7S A;  2BA1 G;  2C38 B;  3ZM7 A;  1ZXM A;  2V8P A;  3J7A G;  4LOM A;  1XMO I;  4AM3 A;  4IFD D;  3LTO A;  1RHY A;  2UUC I;  2NN6 C;  1N32 I;  2BA0 D;  4OX9 E;  2PO2 A;  3UHM A;  2C38 A;  5EL9 A;  4JI3 I;  1H7U A;  4LF4 E;  2PNZ A;  1Y4U A;  2Q2E B;  2O1V A;  4MYT A;  5JEA D;  4GKK E;  4FW7 A;  1K47 A;  4MYU A;  4GKJ I;  2J7K A;  3PYE A;  4LFC I;  2O1U A;  1N36 E;  2PO0 B;  1KIJ A;  2X7I A;  4B3T E;  2EFG A;  4X65 I;  1DAR A;  4AQY I;  1FWL A;  1ZXN A;  3K1J A;  1S4E A;  3H1C A;  4DUY I;  2WW4 A;  2HKE A;  4B3S E;  4FW3 A;  2ZIT A;  2C37 A;  1U2R A;  5C0X F;  5L3J A;  1Y60 A;  5IWA I;  4DR5 I;  2C37 B;  1J5E I;  4LF7 E;  1H72 C;  4OX9 I;  3J80 C;  3L7Z B;  4LF9 E;  4OO1 E;  4HXZ A;  5DRO A;  3B4T A;  4DR4 I;  2Z5C B;  2GS8 A;  1S16 A;  2UXD E;  2ZM6 I;  4LFC E;  3QT6 A;  4IS9 A;  5JEA C;  1N0V C;  4B3T I;  3P76 A;  1Z5C A;  2NN6 A;  1D6T A;  3PS1 A;  1EA6 A;  3P3C A;  4JI7 E;  4WUB A;  1N33 E;  5K36 C;  4OO1 B;  1P42 A;  2Z5C A;  1B63 A;  4LFA E;  5DRR A;  5GME A;  4I3H A;  2BM0 A;  4HAC B;  5IWA E;  3M85 D;  4DR5 E;  4YHH E;  3NZK A;  1J5E E;  1NHJ A;  2A2C A;  4DPU A;  4DPW A;  1Z0B A;  4LF7 I;  4DUZ I;  2UXC E;  5LL6 R;  4OO1 A;  2BA1 D;  2HHH I;  4Z7Y A;  4LF9 I;  4XTJ A;  1Z0W A;  4X62 E;  4NBQ A;  1OJ4 A;  2CZ9 A;  3P06 A;  4HAC A;  1UDS A;  4DPY A;  2ZM6 E;  4UTG A;  4AIM A;  5DRP A;  2UUB E;  1FKA E;  3WU3 A;  1Z0T A;  2NN6 D;  4WUC A;  2J65 A;  4JI4 I;  4JI6 I;  1ZM4 A;  4DR1 I;  2UUA E;  1XNQ E;  5LMN I;  2O1T A;  2PO0 A;  1N33 I;  2CGE A;  4FWD A;  2NN6 E;  5DRQ A;  4ISA A;  2V2Q A;  4DV7 E;  4K0K E;  4PRX A;  4LFA I;  4DV3 I;  4LCF A;  1Y6Z A;  2PO2 B;  4P7A A;  2UU9 E;  3LNU A;  1MU5 A;  4YHH I;  3F0N A;  1HK7 A;  1Z0C A;  2IOQ A;  2Z5B A;  2DEI A;  2GO4 A;  3Q6M A;  4B3M E;  1USU A;  2IOP A;  1HR0 E;  5A2Q Q;  5A2Q C;  3DD6 A;  3T1H E;  2JE6 B;  4DV0 E;  4JI2 I;  1IBK E;  4KQV A;  2DEJ A;  4YY3 E;  2O1W A;  3H4L A;  3L7Z A;  3JAM C;  3CDI A;  4JG4 A;  1RRE A;  2GO3 A;  1HNX I;  2Z5B B;  4DV4 I;  4DR7 E;  3CDJ A;  4JI6 E;  2GQ0 A;  4LF5 I;  1XNQ I;  1H73 A;  5JEA E;  4JYA E;  2F4V I;  2E5L I;  3HKM A;  4FN5 A;  2VQF I;  1XMQ E;  4LCH A;  5JEA A;  5LMU E;  4DV3 E;  1OYR A;  4MQY A;  2HFS A;  2CG9 A;  5JEA B;  3GLL A;  2BM1 A;  2XEX A;  3V2U C;  4PRV A;  5BR8 I;  2UUC E;  4DV0 I;  1N32 E;  4OKG A;  1IBK I;  3M85 G;  4LF4 I;  4ED4 A;  2JE6 A;  4X66 E;  1Z5A A;  1VI7 A;  4GKK I;  4DV4 E;  4DV1 I;  4DR7 I;  4FWG A;  4GKJ E;  1XHK A;  4JI8 E;  5FWK A;  3QT5 A;  4JYA I;  1EI1 A;  3OTO E;  1B62 A;  1YHC A;  2F4V E;  1FNM A;  4USK A;  2E5L E;  1XXE A;  1OYS A;  4AQY E;  4FWH A;  4PU9 A;  1N34 I;  5FLX Q;  1NZ0 A;  4OZE A;  2PNM A;  1FJG E;  4MDT A;  2CVE A;  4JI5 I;  4LF8 E;  4JI0 E;  1Z0G A;  4ZVI A;  4DR2 I;  4DV5 E;  3J80 Q;  2NN6 F;  1IBM E;  4X64 I;  1R6M A;  2BV3 A;  4BA1 B;  1UDN A;  5BR8 E;  2LJP A;  1FWK A;  3GME A;  2JT2 A;  4OO1 D;  3GCM A;  3B78 A;  4X66 I;  1HNZ I;  4P52 A;  4DR4 E;  2UXD I;  4IFD B;  1QZR A;  5K36 E;  2HK2 A;  1R6L A;  5DNX A;  1WUU A;  5DNL A;  1E3H A;  2WNR B;  2JEA A;  5JEA F;  4LPF A;  4Z7C A;  1MX0 A;  1ZM9 A;  4RPF A;  3HUL A;  4NXM I;  2WP8 A;  1N34 E;  3T1Y E;  1ELO A;  1E3P A;  2JEB A;  1PVG A;  5C0X E;  1KKH A;  4B3R E;  3K85 A;  3ZZU A;  4DPT A;  4JI5 E;  4JI0 I;  2HK3 A;  5IT9 Q;  1XMO E;  4J3D A;  1IBM I;  2E1R A;  1Z0V A;  4X64 E;  4DUZ E;  2UXC I;  2O3Z A;  3CWV A;  4U3D A;  4U3B A;  2WP8 B;  2HHH E;  2BR2 B;  2X36 A;  3U1Y A;  4MU0 A;  5GMD A;  1HNZ E;  5EKW A;  4X62 I;  3K17 A;  2BR2 A;  3D4J A;  4IFD C;  4QNK A;  3PYF A;  1KTV A;  3WU5 A;  4DXL A;  2UUB I;  2PO1 B;  4MU1 A;  3ZKB A;  2VQE E;  4FW5 A;  4DR1 E;  1USV A;  2UUA I;  2PNZ B;  4IZJ A;  4KHP I;  4IZK A;  4IFD E;  3T1Y I;  2JEA B;  2WNR A;  1Z59 A;  4B3S I;  4K0K I;  2AE8 A;  4B3R I;  4DV2 E;  1IBL I;  1ZM2 A;  3WU4 A;  3PRY A;  4FW6 A;  2UU9 I;  4JI1 E;  1VIS A;  4USM A;  4NXN E;  3M7N D;  2IER A;  3PYG A;  3ZKD A;  5K36 D;  3P3G A;  4IFD F;  1FI4 A;  5C0X D;  1BKN A;  3T1H I;  4URL A;  1KVK A;  1I94 I;  2V34 A;  2VES A;  4DV6 I;  4LFB I;  2VQE I;  5C0X A;  4IFD A;  4DPX A;  4DU8 A;  4MU4 A;  3QT7 A;  4JI7 I;  1ZM3 A;  4KHP E;  5K36 B;  5C0X C;  2UXB I;  3HJC A;  1HNW E;  2VQF E;  1XMQ I;  2C39 B;  4GQU A;  4IZK B;  4DV2 I;  1IBL E;  4IZJ B;  3M7N G;  2BA0 G;  3V5R A;  1OYP A;  4LCG A;  4JI1 I;  3LPS A;  2NN6 B;  4NXN I;  5IT9 C;  4N3O A;  2Z5E A;  5ELW A;  3Q1Q A;  1PKP A;  3JAM Q;  2PNL A;  1XNR E;  1Z5B A;  4JV5 E;  4FW9 A;  4QNJ A;  2R42 A;  1NHH A;  3M6A A;  2V2Z A;  3J81 C;  4LF6 E;  2OI2 A;  2F1D A;  4BA2 A;  1I94 E;  4DV6 E;  4LFB E;  4DV1 E;  4JI4 E;  5K36 F;  1NHI A;  2JEB B;  4WUD A;  4JI8 I;  2R3V A;  5LMN E;  2AJ4 A;  3QT8 A;  3OTO I;  5C0X B;  2UXB E;  3B82 A;  2HKJ A;  3J7A M;  2NPF A;  4UT4 A;  4BA1 A;  4DV7 I;  1HNW I;  3KRN A;  3J81 Q;  4DR3 I;  4R1F A;  5K36 A;  1UDO A;  4DR6 E;  5FLX C;  1FJG I;  1Y5Y A;  1UEK A;  2A2D A;  4FW4 A;  4LF8 I;  4DR2 E;  1Z0E A;  1MG7 A;  4B3M I;  4DV5 I;  3PS2 A;  1HR0 I;  3PYD A;  2HFU A;  2C39 A;  2VF3 A;  1XNR I;  4JV5 I;  2PO1 A;  4JI2 E;  2IES A;  4YY3 I;  4LF6 I;  3ZZT A;  4JI3 E;  1YH8 A;  4IZJ D;  1N0U A;  3GON A;  1UDQ A; 
#chains in the Genus database with same CATH homology
 1HNX E;  3WU6 A;  2V2V A;  2ZBK B;  1H74 A;  4DU7 A;  4M1K A;  4EMD A;  4HY1 A;  4LF5 E;  1N36 I;  1RR9 A;  1PIE A;  1A6F A;  3Q6N A;  4X65 E;  3B8H A;  4HYM A;  5LMU I;  4DR3 E;  3ZZ0 A;  4NXM E;  4DR6 I;  1Y4S A;  4DUY E;  1H7S A;  3ZM7 A;  1ZXM A;  2V8P A;  3J7A G;  1XMO I;  3LTO A;  2UUC I;  1N32 I;  4OX9 E;  4JI3 I;  1H7U A;  4LF4 E;  1Y4U A;  2Q2E B;  2O1V A;  4MYT A;  4GKK E;  1K47 A;  4MYU A;  4GKJ I;  2J7K A;  3PYE A;  4LFC I;  2O1U A;  1N36 E;  1KIJ A;  2X7I A;  4B3T E;  2EFG A;  4X65 I;  1DAR A;  4AQY I;  1FWL A;  1ZXN A;  3K1J A;  1S4E A;  4DUY I;  2WW4 A;  2HKE A;  4B3S E;  2ZIT A;  1U2R A;  5L3J A;  5IWA I;  4DR5 I;  1J5E I;  4LF7 E;  1H72 C;  4OX9 I;  3J80 C;  4LF9 E;  4HXZ A;  4DR4 I;  2Z5C B;  2GS8 A;  1S16 A;  2UXD E;  2ZM6 I;  4LFC E;  3QT6 A;  1N0V C;  4B3T I;  1Z5C A;  1D6T A;  1EA6 A;  4JI7 E;  1N33 E;  4WUB A;  2Z5C A;  1B63 A;  4LFA E;  5GME A;  4I3H A;  2BM0 A;  4HAC B;  5IWA E;  4DR5 E;  4YHH E;  1J5E E;  1NHJ A;  2A2C A;  4DPU A;  4DPW A;  1Z0B A;  4LF7 I;  4DUZ I;  2UXC E;  5LL6 R;  2HHH I;  4Z7Y A;  4LF9 I;  4XTJ A;  1Z0W A;  4X62 E;  1OJ4 A;  2CZ9 A;  3P06 A;  4HAC A;  4DPY A;  2ZM6 E;  4UTG A;  2UUB E;  1FKA E;  3WU3 A;  1Z0T A;  4WUC A;  4JI4 I;  4JI6 I;  1ZM4 A;  4DR1 I;  2UUA E;  1XNQ E;  5LMN I;  2O1T A;  1N33 I;  2CGE A;  4FWD A;  2V2Q A;  4DV7 E;  4K0K E;  4PRX A;  4LFA I;  4DV3 I;  1Y6Z A;  2UU9 E;  4P7A A;  3LNU A;  1MU5 A;  4YHH I;  3F0N A;  1HK7 A;  1Z0C A;  2IOQ A;  2Z5B A;  2DEI A;  3Q6M A;  4B3M E;  1USU A;  2IOP A;  1HR0 E;  5A2Q Q;  5A2Q C;  3T1H E;  4DV0 E;  4JI2 I;  1IBK E;  4KQV A;  2DEJ A;  4YY3 E;  2O1W A;  3H4L A;  3JAM C;  4JG4 A;  1RRE A;  1HNX I;  2Z5B B;  4DV4 I;  4DR7 E;  4JI6 E;  2GQ0 A;  4LF5 I;  1XNQ I;  1H73 A;  4JYA E;  2F4V I;  2E5L I;  2VQF I;  4FN5 A;  1XMQ E;  5LMU E;  4DV3 E;  2HFS A;  2CG9 A;  2BM1 A;  2XEX A;  3V2U C;  4PRV A;  5BR8 I;  2UUC E;  4DV0 I;  1N32 E;  1IBK I;  4LF4 I;  4ED4 A;  4X66 E;  1Z5A A;  4GKK I;  4DV4 E;  4DV1 I;  4DR7 I;  4FWG A;  4GKJ E;  1XHK A;  4JI8 E;  5FWK A;  3QT5 A;  4JYA I;  1EI1 A;  3OTO E;  1B62 A;  2F4V E;  1FNM A;  4USK A;  2E5L E;  4AQY E;  4FWH A;  4PU9 A;  1N34 I;  5FLX Q;  1NZ0 A;  2PNM A;  1FJG E;  4JI5 I;  4LF8 E;  4JI0 E;  1Z0G A;  4ZVI A;  4DR2 I;  4DV5 E;  3J80 Q;  1IBM E;  4X64 I;  2BV3 A;  5BR8 E;  2LJP A;  1FWK A;  3B78 A;  4X66 I;  1HNZ I;  4P52 A;  4DR4 E;  2UXD I;  1QZR A;  2HK2 A;  1WUU A;  4Z7C A;  1MX0 A;  1ZM9 A;  4RPF A;  3HUL A;  4NXM I;  1N34 E;  3T1Y E;  1ELO A;  1PVG A;  1KKH A;  4B3R E;  3K85 A;  3ZZU A;  4DPT A;  4JI5 E;  4JI0 I;  2HK3 A;  5IT9 Q;  1XMO E;  1IBM I;  2E1R A;  1Z0V A;  4X64 E;  4DUZ E;  2UXC I;  3CWV A;  2HHH E;  2X36 A;  5GMD A;  1HNZ E;  4X62 I;  3K17 A;  3D4J A;  3PYF A;  1KTV A;  3WU5 A;  4DXL A;  2UUB I;  3ZKB A;  2VQE E;  4DR1 E;  1USV A;  2UUA I;  4IZJ A;  4KHP I;  4IZK A;  3T1Y I;  1Z59 A;  4B3S I;  4K0K I;  4B3R I;  4DV2 E;  1IBL I;  1ZM2 A;  3WU4 A;  3PRY A;  2UU9 I;  4JI1 E;  1VIS A;  4USM A;  4NXN E;  3PYG A;  3ZKD A;  1FI4 A;  3T1H I;  1BKN A;  4URL A;  1KVK A;  1I94 I;  2V34 A;  4DV6 I;  4LFB I;  2VQE I;  4DPX A;  4DU8 A;  3QT7 A;  4JI7 I;  1ZM3 A;  4KHP E;  2UXB I;  3HJC A;  1HNW E;  2VQF E;  1XMQ I;  4IZK B;  4DV2 I;  1IBL E;  4IZJ B;  3V5R A;  4JI1 I;  3LPS A;  4NXN I;  5IT9 C;  4N3O A;  2Z5E A;  3Q1Q A;  1PKP A;  3JAM Q;  2PNL A;  1XNR E;  1Z5B A;  4JV5 E;  4FW9 A;  2R42 A;  1NHH A;  3M6A A;  2V2Z A;  3J81 C;  4LF6 E;  2OI2 A;  1I94 E;  4DV6 E;  4LFB E;  4DV1 E;  4JI4 E;  1NHI A;  4WUD A;  4JI8 I;  2R3V A;  5LMN E;  2AJ4 A;  3QT8 A;  3OTO I;  2UXB E;  3B82 A;  2HKJ A;  3J7A M;  2NPF A;  4UT4 A;  1HNW I;  4DV7 I;  3J81 Q;  4DR3 I;  4R1F A;  4DR6 E;  5FLX C;  1FJG I;  1UEK A;  2A2D A;  4LF8 I;  4DR2 E;  1Z0E A;  1MG7 A;  4B3M I;  4DV5 I;  1HR0 I;  3PYD A;  2HFU A;  2VF3 A;  1XNR I;  4JV5 I;  4JI2 E;  4YY3 I;  4LF6 I;  3ZZT A;  4JI3 E;  4IZJ D;  1N0U A;  3GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...