1Z0VA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Pathological crystallography: case studies of several unusual macromolecular crystals.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 53
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0vA00
2OI2A 4DR7E 4YY3E 4OX9I 5LMUI 1N0VC 1S4EA 3V5RA 1Z0WA 2UXDE 1PKPA 2HHHE 1KTVA 2VQEI 1J5EE 2UUBE 4JI7E 3GONA 3QT6A 1N34E 4LFAI 3V2UC 1H7SA 3T1YE 4DR4E 4MYUA 4X66E 1S16A 4JI8E 1Z0EA 4DXLA 2UUCI 4JYAI 4DR5E 2UXBI 1N32E 3J7AM 2EFGA 2X36A 4ED4A 2HFUA 1N33E 3H4LA 1FJGI 4NXME 4GKJE 4X65I 4DR3E 4DR1I 4WUBA 2CZ9A 4FWDA 3QT5A 2DEJA 4DV6E 4LF4I 4JI3E 4LF6I 4JI1E 2BM1A 2VQFI 4DUYI 4DV3I 1Z59A 1FWLA 5GMEA 4DPTA 4KHPI 2HK2A 2V2VA 5BR8E 2HKJA 3HULA 1K47A 4LF7E 4I3HA 4DPUA 2F4VI 3D4JA 4GKKI 4DU7A 4JI4E 5LMNI 1HR0I 4LF8I 4X64I 2E1RA 1Z0BA 1XHKA 4JV5E 4LFBE 1IBLE 3ZKBA 4B3RI 2DEIA 2BM0A 4K0KE 2UXCE 3QT7A 1N36E 4AQYI 4DPXA 4LF9E 5IT9Q 4DV1E 4JI6E 2HKEA 1IBKI 2WW4A 4JI2I 1ZM3A 2UUAE 3JAMQ 2E5LI 2ZM6E 1NHJA 1WUUA 4B3MI 4X62E 2HFSA 1H7UA 1XNQE 3Q1QA 1MG7A 1ZM9A 3LNUA 1RR9A 2NPFA 4DV7I 4JI0E 4YHHI 4DV5I 4DR2E 1HNXE 4JI5E 4LFCE 2V2QA 4NXNI 4URLA 5FLXQ 1U2RA 4EMDA 1XMOI 1HNZE 1QZRA 4DUZI 4B3TI 1XNRI 4OX9E 5LMUE 4HACB 4B3SI 1KKHA 4HYMA 3LPSA 2VQEE 2UU9I 4LFAE 4P7AA 3J7AG 3ZZTA 1ZM4A 1HNWI 5L3JA 1MX0A 2V2ZA 1ZXNA 2UUCE 4JYAE 3CWVA 4R1FA 2UXBE 3PYFA 1NHHA 1MU5A 2ZITA 4DR6I 5GMDA 3J81Q 2R42A 4KQVA 2R3VA 1FJGE 4JI1I 2Q2EB 1XMQI 1BKNA 4X65E 5IT9C 4DR1E 2BV3A 1N0UA 4DV2I 4DV0I 4LF5I 1ZXMA 3JAMC 4LF4E 4LF6E 2VQFE 3PYGA 4DUYE 4DV3E 4KHPE 1A6FA 1KIJA 3T1HI 1H73A 2LJPA 2F4VE 4JG4A 1DARA 4GKKE 3QT8A 4USKA 3PYDA 5FLXC 1HR0E 1PVGA 1FNMA 1IBMI 4LF8E 4X64E 2GS8A 4DV4I 3OTOI 1NHIA 1Z0VA 4B3RE 3ZM7A 1H72C 3WU5A 1Z0TA 5IWAI 1RREA 4AQYE 1I94I 2V34A 2VF3A 1OJ4A 1IBKE 4JI2E 1Z5AA 2E5LE 2HK3A 4DR7I 4YY3I 3WU3A 2J7KA 2UXDI 4WUCA 2HHHI 4UT4A 4B3ME 1Z0GA 1ZM2A 4FWGA 3J81C 1J5EI 1Z5BA 4DV7E 2UUBI 4JI7I 1N34I 4YHHE 4DV5E 1EI1A 3T1YI 4DR4I 4RPFA 4NXNE 1UEKA 4X66I 4WUDA 4JI8I 3M6AA 1KVKA 1XMOE 4DUZE 4DR5I 3LTOA 1N32I 4B3TE 3K17A 3WU4A 1XNRE 1ELOA 4XTJA 4Z7CA 1N33I 3ZZUA 1FKAE 4B3SE 5A2QC 4DPYA 4UTGA 4NXMI 4GKJI 4DR3I 4MYTA 4Z7YA 3B82A 1EA6A 2UU9E 1Z5CA 4HXZA 3B78A 1H74A 4DV6I 3J80C 2A2CA 4JI3I 1VISA 1HNWE 2XEXA 1D6TA 3B8HA 3K1JA 4DR6E 5BR8I 1B62A 4HACA 1FWKA 4LF7I 1XMQE 3F0NA 4JI4I 5A2QQ 4PRXA 2A2DA 4DV2E 4DV0E 4LF5E 4JV5I 1FI4A 4LFBI 1IBLI 3J80Q 5LMNE 4PU9A 4K0KI 2UXCI 4ZVIA 1N36I 4LF9I 3T1HE 4P52A 4DV1I 4JI6I 2AJ4A 1PIEA 1B63A 3WU6A 3PYEA 4HY1A 2UUAI 1NZ0A 2V8PA 4FW9A 4PRVA 2ZM6I 1IBME 4DV4E 3OTOE 4X62I 4USMA 1XNQI 5LL6R 3ZZ0A 2ZBKB 4FWHA 4DU8A 5IWAE 4JI0I 4DR2I 1HNXI 4JI5I 2X7IA 4M1KA 1I94E 4LFCI 3ZKDA 4DPWA 1Z0CA 1HNZI 4FN5A
chains in the Genus database with same CATH superfamily
5ELWA 2OI2A 1HK7A 4DR7E 4YY3E 4OX9I 5LMUI 3L7ZB 1N0VC 1S4EA 4IZJA 1Z0WA 4GQUA 3V5RA 1PKPA 2HHHE 2UXDE 1KTVA 5JEAC 1XXEA 3B4TA 5K36D 4MU4A 4FW6A 2VQEI 1J5EE 2UUBE 4JI7E 3GONA 3QT6A 1N34E 4LFAI 1RHYA 3V2UC 4MU1A 2PNZB 2F1DA 1H7SA 3T1YE 4DR4E 4MYUA 4X66E 1S16A 4JI8E 1Z0EA 4DXLA 2PO1B 2UUCI 5C0XC 4JYAI 4DR5E 2UXBI 5JEAE 4NBQA 1N32E 3J7AM 5K36B 2EFGA 2X36A 4ED4A 2JEBA 2HFUA 1N33E 4J3DA 3H4LA 1FJGI 4IFDF 4NXME 4GKJE 4X65I 4DR3E 4DR1I 4WUBA 4OO1A 3K85A 2CZ9A 4FWDA 1E3PA 5C0XE 3QT5A 2DEJA 4DV6E 4LF4I 4JI3E 4LF6I 4JI1E 2BM1A 3PS2A 4AIMA 5JEAD 1R6MA 2VQFI 4DUYI 4DV3I 1Z59A 5DRQA 1FWLA 4BA1B 5GMEA 4DPTA 4KHPI 3PS1A 2HK2A 2V2VA 4IZKA 5BR8E 2HKJA 4OZEA 2GO3A 3HULA 1K47A 4LF7E 4I3HA 3U1KA 4DPUA 5EKWA 2F4VI 3PRYA 3D4JA 4GKKI 4DU7A 1UDOA 4JI4E 4OO1F 1OYPA 5LMNI 5C0XD 4ISAA 5JEAB 1HR0I 4LF8I 4X64I 2E1RA 1Z0BA 3M85G 3P76A 1XHKA 1USVA 4JV5E 5K36C 4LFBE 2GQ0A 1IBLE 3ZKBA 4MDTA 4B3RI 2DEIA 2BM0A 5DNLA 4K0KE 3GCMA 2UXCE 2IESA 3QT7A 1N36E 4AQYI 4DPXA 2Z5BA 2C39A 4LF9E 3M7NG 5IT9Q 2PO2B 4DV1E 4JI6E 2HKEA 5C0XB 4BA2A 1IBKI 2WW4A 4JI2I 1ZM3A 2UUAE 3JAMQ 1OYRA 2E5LI 2NN6A 3Q6MA 2ZM6E 1NHJA 1Y60A 1UDSA 5DROA 3H1CA 1WUUA 2O3ZA 4B3MI 4X62E 2HFSA 1H7UA 1XNQE 3Q1QA 1MG7A 1ZM9A 3LNUA 1RR9A 2NPFA 4DV7I 4JI0E 2CGEA 4YHHI 2PO0B 4DV5I 4DR2E 1HNXE 4JI5E 4LFCE 2V2QA 4NXNI 4URLA 5FLXQ 1U2RA 4EMDA 1XMOI 1HNZE 1QZRA 4FW4A 4DUZI 4U3DA 4B3TI 3M85D 1XNRI 4OX9E 5LMUE 2CVEA 1YH8A 2GO4A 5DNXA 4HACB 4B3SI 5FWKA 2WP8A 2C38B 1KKHA 4HYMA 4FW3A 3LPSA 2VQEE 4IFDC 2UU9I 3M7ND 4LFAE 3HJCA 1VI7A 2J65A 4P7AA 3J7AG 3ZZTA 4OKGA 1ZM4A 3HKMA 1HNWI 5L3JA 1MX0A 2V2ZA 4MU0A 1ZXNA 2UUCE 4JYAE 2BR2B 3CWVA 4R1FA 2UXBE 3PYFA 3UHMA 2BA0G 1NHHA 1MU5A 2ZITA 4DR6I 5GMDA 3J81Q 2O1WA 2PO0A 4MU3A 3L7ZA 4IFDE 3CDIA 2R42A 4KQVA 2R3VA 3P3EA 1UDNA 1FJGE 4JI1I 2JE6B 2Q2EB 1XMQI 1BKNA 4X65E 5IT9C 4DR1E 2BV3A 1N0UA 4DV2I 4DV0I 4OO1C 4LF5I 3NZKA 2PNZA 1ZXMA 2PNLA 3JAMC 4LF4E 4LF6E 4LOMA 2VQFE 3PYGA 1Y4SA 4IZJD 2PO1A 4DUYE 4DV3E 4MQYA 2Z5CB 4KHPE 2C37B 1UDQA 1A6FA 1KIJA 5K36A 4IFDD 3T1HI 3PS3A 2JEAB 1H73A 2LJPA 2WNRB 4OO1E 4FW5A 4JG4A 2F4VE 1DARA 4GKKE 3KRNA 3QT8A 4USKA 3U1YA 3PYDA 5FLXC 1HR0E 1PVGA 1FNMA 1IBMI 4IS9A 2BA1G 2AE8A 4IZJB 4X64E 2GS8A 4LF8E 4DV4I 3OTOI 1R6LA 4IFDB 1NHIA 4AM3A 1Z0VA 4B3RE 3ZM7A 1H72C 2BA0D 3WU5A 1Z0TA 5IWAI 1RREA 4BA1A 4AQYE 1Y6ZA 5K36F 2IOQA 1I94I 2V34A 2VF3A 1OJ4A 4OO1D 1IBKE 4JI2E 3P3CA 1Z5AA 2E5LE 2HK3A 4DR7I 4YY3I 3WU3A 2JEBB 2J7KA 5JEAA 2Z5EA 2UXDI 4WUCA 2HHHI 1YHCA 4UT4A 2O1VA 4B3ME 1Z0GA 4OO1B 1ZM2A 4FWGA 4LCHA 3J81C 2NN6F 1J5EI 1Z5BA 4DV7E 2UUBI 4JI7I 1N34I 4YHHE 4N3OA 4DV5E 2PO2A 1EI1A 3T1YI 4DR4I 4RPFA 4NXNE 1UEKA 4X66I 5C0XA 3Q6NA 3GLLA 4WUDA 4JI8I 2NN6E 1KVKA 3M6AA 1XMOE 4IFDA 4DUZE 4DR5I 3LTOA 2BA1D 1N32I 4IZKB 3K17A 3WU4A 4B3TE 1XNRE 1OYSA 1ELOA 4XTJA 5JEAF 4FW7A 4Z7CA 1N33I 3ZZUA 1FKAE 4B3SE 5A2QC 4DPYA 4UTGA 4NXMI 4GKJI 4DR3I 4U3BA 2VESA 4MYTA 4Z7YA 3B82A 1EA6A 2UU9E 1Z5CA 1E3HA 4HXZA 3B78A 1H74A 4DV6I 3J80C 2A2CA 2NN6D 4JI3I 5C0XF 1VISA 1HNWE 2XEXA 1D6TA 3B8HA 2Z5BB 2C39B 3K1JA 4DR6E 4AIDA 5BR8I 4BA2B 1B62A 4HACA 1FWKA 4LF7I 2C38A 4LCGA 1XMQE 3F0NA 4JI4I 2NN6B 5A2QQ 5DRPA 1Y5YA 4PRXA 2A2DA 4DV2E 4DV0E 3GMEA 4LF5E 2IOPA 4JV5I 1FI4A 2O1UA 5EL9A 4LFBI 1IBLI 3J80Q 5LMNE 4LPFA 4PU9A 4K0KI 2BR2A 2UXCI 4ZVIA 1N36I 4LF9I 4QNJA 3T1HE 4P52A 4DV1I 4JI6I 2AJ4A 2IERA 1PIEA 1B63A 3WU6A 3PYEA 4HY1A 2PNMA 2UUAI 1NZ0A 2JE6A 2V8PA 2CG9A 4FW9A 4PRVA 1P42A 2ZM6I 1IBME 3P06A 2WP8B 4DV4E 3CDJA 3OTOE 4LCFA 4QNKA 4X62I 4USMA 1XNQI 5LL6R 3ZZ0A 2O1TA 2ZBKB 4FWHA 2JT2A 5K36E 4DU8A 5IWAE 5DRRA 4JI0I 1USUA 2Z5CA 3DD6A 4DR2I 1HNXI 2C37A 4JI5I 2NN6C 2X7IA 4M1KA 1I94E 4LFCI 2JEAA 3ZKDA 3P3GA 4DPWA 1Z0CA 1HNZI 2WNRA 4FN5A 1Y4UA
chains in the Genus database with same CATH topology
2OI2A 1HK7A 4DR7E 4YY3E 4OX9I 5LMUI 1N0VC 1S4EA 4IZJA 1Z0WA 3V5RA 2UXDE 1PKPA 2HHHE 1KTVA 2VQEI 1J5EE 2UUBE 4JI7E 3GONA 3QT6A 1N34E 4LFAI 3V2UC 1H7SA 3T1YE 4DR4E 4MYUA 4X66E 1S16A 4JI8E 1Z0EA 4DXLA 2UUCI 4JYAI 4DR5E 2UXBI 1N32E 3J7AM 2EFGA 2X36A 4ED4A 2HFUA 1N33E 3H4LA 1FJGI 4NXME 4GKJE 4X65I 4DR3E 4DR1I 4WUBA 3K85A 2CZ9A 4FWDA 3QT5A 2DEJA 4DV6E 4LF4I 4JI3E 4LF6I 4JI1E 2BM1A 2VQFI 4DUYI 4DV3I 1Z59A 1FWLA 5GMEA 4DPTA 4KHPI 2HK2A 2V2VA 4IZKA 5BR8E 2HKJA 3HULA 1K47A 4LF7E 4I3HA 4DPUA 2F4VI 3PRYA 3D4JA 4GKKI 4DU7A 4JI4E 5LMNI 1HR0I 4LF8I 4X64I 2E1RA 1Z0BA 1XHKA 1USVA 4JV5E 4LFBE 2GQ0A 1IBLE 3ZKBA 4B3RI 2DEIA 2BM0A 4K0KE 2UXCE 3QT7A 1N36E 4AQYI 4DPXA 2Z5BA 4LF9E 5IT9Q 4DV1E 4JI6E 2HKEA 1IBKI 2WW4A 4JI2I 1ZM3A 2UUAE 3JAMQ 2E5LI 3Q6MA 2ZM6E 1NHJA 1WUUA 4B3MI 4X62E 2HFSA 1H7UA 1XNQE 3Q1QA 1MG7A 1ZM9A 3LNUA 1RR9A 2NPFA 4DV7I 4JI0E 2CGEA 4YHHI 4DV5I 4DR2E 1HNXE 4JI5E 4LFCE 2V2QA 4NXNI 4URLA 5FLXQ 1U2RA 4EMDA 1XMOI 1HNZE 1QZRA 4DUZI 4B3TI 1XNRI 4OX9E 5LMUE 4HACB 4B3SI 5FWKA 1KKHA 4HYMA 3LPSA 2VQEE 2UU9I 4LFAE 3HJCA 4P7AA 3J7AG 3ZZTA 1ZM4A 1HNWI 5L3JA 1MX0A 2V2ZA 1ZXNA 2UUCE 4JYAE 3CWVA 4R1FA 2UXBE 3PYFA 1NHHA 1MU5A 2ZITA 4DR6I 5GMDA 3J81Q 2O1WA 2R42A 4KQVA 2R3VA 1FJGE 4JI1I 2Q2EB 1XMQI 1BKNA 4X65E 5IT9C 4DR1E 2BV3A 1N0UA 4DV2I 4DV0I 4LF5I 1ZXMA 2PNLA 3JAMC 4LF4E 4LF6E 2VQFE 3PYGA 1Y4SA 4IZJD 4DUYE 4DV3E 2Z5CB 4KHPE 1A6FA 1KIJA 3T1HI 1H73A 2LJPA 2F4VE 4JG4A 1DARA 4GKKE 3QT8A 4USKA 3PYDA 5FLXC 1HR0E 1PVGA 1FNMA 1IBMI 4LF8E 4IZJB 4X64E 2GS8A 4DV4I 3OTOI 1NHIA 1Z0VA 4B3RE 3ZM7A 1H72C 3WU5A 1Z0TA 5IWAI 1RREA 4AQYE 1Y6ZA 2IOQA 1I94I 2V34A 2VF3A 1OJ4A 1IBKE 4JI2E 1Z5AA 2E5LE 2HK3A 4DR7I 4YY3I 3WU3A 2J7KA 2Z5EA 2UXDI 4WUCA 2HHHI 4UT4A 2O1VA 4B3ME 1Z0GA 1ZM2A 4FWGA 3J81C 1J5EI 1Z5BA 4DV7E 2UUBI 4JI7I 1N34I 4YHHE 4N3OA 4DV5E 1EI1A 3T1YI 4DR4I 4RPFA 4NXNE 1UEKA 4X66I 3Q6NA 4WUDA 4JI8I 3M6AA 1KVKA 1XMOE 4DUZE 4DR5I 3LTOA 1N32I 4IZKB 3K17A 3WU4A 4B3TE 1XNRE 1ELOA 4XTJA 4Z7CA 1N33I 3ZZUA 1FKAE 4B3SE 5A2QC 4DPYA 4UTGA 4NXMI 4GKJI 4DR3I 4MYTA 4Z7YA 3B82A 1EA6A 2UU9E 1Z5CA 4HXZA 3B78A 1H74A 4DV6I 3J80C 2A2CA 4JI3I 1VISA 1HNWE 2XEXA 1D6TA 3B8HA 2Z5BB 3K1JA 4DR6E 5BR8I 1B62A 4HACA 1FWKA 4LF7I 1XMQE 3F0NA 4JI4I 5A2QQ 4PRXA 2A2DA 4DV2E 4DV0E 4LF5E 2IOPA 4JV5I 1FI4A 2O1UA 4LFBI 1IBLI 3J80Q 5LMNE 4PU9A 4K0KI 2UXCI 4ZVIA 1N36I 4LF9I 3T1HE 4P52A 4DV1I 4JI6I 2AJ4A 1PIEA 1B63A 3WU6A 3PYEA 4HY1A 2PNMA 2UUAI 1NZ0A 2V8PA 2CG9A 4FW9A 4PRVA 2ZM6I 1IBME 3P06A 4DV4E 3OTOE 4X62I 4USMA 1XNQI 5LL6R 3ZZ0A 2O1TA 2ZBKB 4FWHA 4DU8A 5IWAE 4JI0I 1USUA 2Z5CA 4DR2I 1HNXI 4JI5I 2X7IA 4M1KA 1I94E 4LFCI 3ZKDA 4DPWA 1Z0CA 1HNZI 4FN5A 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI2 A;  4DR7 E;  4YY3 E;  4OX9 I;  5LMU I;  1N0V C;  1S4E A;  3V5R A;  1Z0W A;  2UXD E;  1PKP A;  2HHH E;  1KTV A;  2VQE I;  1J5E E;  2UUB E;  4JI7 E;  3GON A;  3QT6 A;  1N34 E;  4LFA I;  3V2U C;  1H7S A;  3T1Y E;  4DR4 E;  4MYU A;  4X66 E;  1S16 A;  4JI8 E;  1Z0E A;  4DXL A;  2UUC I;  4JYA I;  4DR5 E;  2UXB I;  1N32 E;  3J7A M;  2EFG A;  2X36 A;  4ED4 A;  2HFU A;  1N33 E;  3H4L A;  1FJG I;  4NXM E;  4GKJ E;  4X65 I;  4DR3 E;  4DR1 I;  4WUB A;  2CZ9 A;  4FWD A;  3QT5 A;  2DEJ A;  4DV6 E;  4LF4 I;  4JI3 E;  4LF6 I;  4JI1 E;  2BM1 A;  2VQF I;  4DUY I;  4DV3 I;  1Z59 A;  1FWL A;  5GME A;  4DPT A;  4KHP I;  2HK2 A;  2V2V A;  5BR8 E;  2HKJ A;  3HUL A;  1K47 A;  4LF7 E;  4I3H A;  4DPU A;  2F4V I;  3D4J A;  4GKK I;  4DU7 A;  4JI4 E;  5LMN I;  1HR0 I;  4LF8 I;  4X64 I;  2E1R A;  1Z0B A;  1XHK A;  4JV5 E;  4LFB E;  1IBL E;  3ZKB A;  4B3R I;  2DEI A;  2BM0 A;  4K0K E;  2UXC E;  3QT7 A;  1N36 E;  4AQY I;  4DPX A;  4LF9 E;  5IT9 Q;  4DV1 E;  4JI6 E;  2HKE A;  1IBK I;  2WW4 A;  4JI2 I;  1ZM3 A;  2UUA E;  3JAM Q;  2E5L I;  2ZM6 E;  1NHJ A;  1WUU A;  4B3M I;  4X62 E;  2HFS A;  1H7U A;  1XNQ E;  3Q1Q A;  1MG7 A;  1ZM9 A;  3LNU A;  1RR9 A;  2NPF A;  4DV7 I;  4JI0 E;  4YHH I;  4DV5 I;  4DR2 E;  1HNX E;  4JI5 E;  4LFC E;  2V2Q A;  4NXN I;  4URL A;  5FLX Q;  1U2R A;  4EMD A;  1XMO I;  1HNZ E;  1QZR A;  4DUZ I;  4B3T I;  1XNR I;  4OX9 E;  5LMU E;  4HAC B;  4B3S I;  1KKH A;  4HYM A;  3LPS A;  2VQE E;  2UU9 I;  4LFA E;  4P7A A;  3J7A G;  3ZZT A;  1ZM4 A;  1HNW I;  5L3J A;  1MX0 A;  2V2Z A;  1ZXN A;  2UUC E;  4JYA E;  3CWV A;  4R1F A;  2UXB E;  3PYF A;  1NHH A;  1MU5 A;  2ZIT A;  4DR6 I;  5GMD A;  3J81 Q;  2R42 A;  4KQV A;  2R3V A;  1FJG E;  4JI1 I;  2Q2E B;  1XMQ I;  1BKN A;  4X65 E;  5IT9 C;  4DR1 E;  2BV3 A;  1N0U A;  4DV2 I;  4DV0 I;  4LF5 I;  1ZXM A;  3JAM C;  4LF4 E;  4LF6 E;  2VQF E;  3PYG A;  4DUY E;  4DV3 E;  4KHP E;  1A6F A;  1KIJ A;  3T1H I;  1H73 A;  2LJP A;  2F4V E;  4JG4 A;  1DAR A;  4GKK E;  3QT8 A;  4USK A;  3PYD A;  5FLX C;  1HR0 E;  1PVG A;  1FNM A;  1IBM I;  4LF8 E;  4X64 E;  2GS8 A;  4DV4 I;  3OTO I;  1NHI A;  1Z0V A;  4B3R E;  3ZM7 A;  1H72 C;  3WU5 A;  1Z0T A;  5IWA I;  1RRE A;  4AQY E;  1I94 I;  2V34 A;  2VF3 A;  1OJ4 A;  1IBK E;  4JI2 E;  1Z5A A;  2E5L E;  2HK3 A;  4DR7 I;  4YY3 I;  3WU3 A;  2J7K A;  2UXD I;  4WUC A;  2HHH I;  4UT4 A;  4B3M E;  1Z0G A;  1ZM2 A;  4FWG A;  3J81 C;  1J5E I;  1Z5B A;  4DV7 E;  2UUB I;  4JI7 I;  1N34 I;  4YHH E;  4DV5 E;  1EI1 A;  3T1Y I;  4DR4 I;  4RPF A;  4NXN E;  1UEK A;  4X66 I;  4WUD A;  4JI8 I;  3M6A A;  1KVK A;  1XMO E;  4DUZ E;  4DR5 I;  3LTO A;  1N32 I;  4B3T E;  3K17 A;  3WU4 A;  1XNR E;  1ELO A;  4XTJ A;  4Z7C A;  1N33 I;  3ZZU A;  1FKA E;  4B3S E;  5A2Q C;  4DPY A;  4UTG A;  4NXM I;  4GKJ I;  4DR3 I;  4MYT A;  4Z7Y A;  3B82 A;  1EA6 A;  2UU9 E;  1Z5C A;  4HXZ A;  3B78 A;  1H74 A;  4DV6 I;  3J80 C;  2A2C A;  4JI3 I;  1VIS A;  1HNW E;  2XEX A;  1D6T A;  3B8H A;  3K1J A;  4DR6 E;  5BR8 I;  1B62 A;  4HAC A;  1FWK A;  4LF7 I;  1XMQ E;  3F0N A;  4JI4 I;  5A2Q Q;  4PRX A;  2A2D A;  4DV2 E;  4DV0 E;  4LF5 E;  4JV5 I;  1FI4 A;  4LFB I;  1IBL I;  3J80 Q;  5LMN E;  4PU9 A;  4K0K I;  2UXC I;  4ZVI A;  1N36 I;  4LF9 I;  3T1H E;  4P52 A;  4DV1 I;  4JI6 I;  2AJ4 A;  1PIE A;  1B63 A;  3WU6 A;  3PYE A;  4HY1 A;  2UUA I;  1NZ0 A;  2V8P A;  4FW9 A;  4PRV A;  2ZM6 I;  1IBM E;  4DV4 E;  3OTO E;  4X62 I;  4USM A;  1XNQ I;  5LL6 R;  3ZZ0 A;  2ZBK B;  4FWH A;  4DU8 A;  5IWA E;  4JI0 I;  4DR2 I;  1HNX I;  4JI5 I;  2X7I A;  4M1K A;  1I94 E;  4LFC I;  3ZKD A;  4DPW A;  1Z0C A;  1HNZ I;  4FN5 A; 
#chains in the Genus database with same CATH topology
 5ELW A;  2OI2 A;  1HK7 A;  4DR7 E;  4YY3 E;  4OX9 I;  5LMU I;  3L7Z B;  1N0V C;  1S4E A;  4IZJ A;  1Z0W A;  4GQU A;  3V5R A;  1PKP A;  2HHH E;  2UXD E;  1KTV A;  5JEA C;  1XXE A;  3B4T A;  5K36 D;  4MU4 A;  4FW6 A;  2VQE I;  1J5E E;  2UUB E;  4JI7 E;  3GON A;  3QT6 A;  1N34 E;  4LFA I;  1RHY A;  3V2U C;  4MU1 A;  2PNZ B;  2F1D A;  1H7S A;  3T1Y E;  4DR4 E;  4MYU A;  4X66 E;  1S16 A;  4JI8 E;  1Z0E A;  4DXL A;  2PO1 B;  2UUC I;  5C0X C;  4JYA I;  4DR5 E;  2UXB I;  5JEA E;  4NBQ A;  1N32 E;  3J7A M;  5K36 B;  2EFG A;  2X36 A;  4ED4 A;  2JEB A;  2HFU A;  1N33 E;  4J3D A;  3H4L A;  1FJG I;  4IFD F;  4NXM E;  4GKJ E;  4X65 I;  4DR3 E;  4DR1 I;  4WUB A;  4OO1 A;  3K85 A;  2CZ9 A;  4FWD A;  1E3P A;  5C0X E;  3QT5 A;  2DEJ A;  4DV6 E;  4LF4 I;  4JI3 E;  4LF6 I;  4JI1 E;  2BM1 A;  3PS2 A;  4AIM A;  5JEA D;  1R6M A;  2VQF I;  4DUY I;  4DV3 I;  1Z59 A;  5DRQ A;  1FWL A;  4BA1 B;  5GME A;  4DPT A;  4KHP I;  3PS1 A;  2HK2 A;  2V2V A;  4IZK A;  5BR8 E;  2HKJ A;  4OZE A;  2GO3 A;  3HUL A;  1K47 A;  4LF7 E;  4I3H A;  3U1K A;  4DPU A;  5EKW A;  2F4V I;  3PRY A;  3D4J A;  4GKK I;  4DU7 A;  1UDO A;  4JI4 E;  4OO1 F;  1OYP A;  5LMN I;  5C0X D;  4ISA A;  5JEA B;  1HR0 I;  4LF8 I;  4X64 I;  2E1R A;  1Z0B A;  3M85 G;  3P76 A;  1XHK A;  1USV A;  4JV5 E;  5K36 C;  4LFB E;  2GQ0 A;  1IBL E;  3ZKB A;  4MDT A;  4B3R I;  2DEI A;  2BM0 A;  5DNL A;  4K0K E;  3GCM A;  2UXC E;  2IES A;  3QT7 A;  1N36 E;  4AQY I;  4DPX A;  2Z5B A;  2C39 A;  4LF9 E;  3M7N G;  5IT9 Q;  2PO2 B;  4DV1 E;  4JI6 E;  2HKE A;  5C0X B;  4BA2 A;  1IBK I;  2WW4 A;  4JI2 I;  1ZM3 A;  2UUA E;  3JAM Q;  1OYR A;  2E5L I;  2NN6 A;  3Q6M A;  2ZM6 E;  1NHJ A;  1Y60 A;  1UDS A;  5DRO A;  3H1C A;  1WUU A;  2O3Z A;  4B3M I;  4X62 E;  2HFS A;  1H7U A;  1XNQ E;  3Q1Q A;  1MG7 A;  1ZM9 A;  3LNU A;  1RR9 A;  2NPF A;  4DV7 I;  4JI0 E;  2CGE A;  4YHH I;  2PO0 B;  4DV5 I;  4DR2 E;  1HNX E;  4JI5 E;  4LFC E;  2V2Q A;  4NXN I;  4URL A;  5FLX Q;  1U2R A;  4EMD A;  1XMO I;  1HNZ E;  1QZR A;  4FW4 A;  4DUZ I;  4U3D A;  4B3T I;  3M85 D;  1XNR I;  4OX9 E;  5LMU E;  2CVE A;  1YH8 A;  2GO4 A;  5DNX A;  4HAC B;  4B3S I;  5FWK A;  2WP8 A;  2C38 B;  1KKH A;  4HYM A;  4FW3 A;  3LPS A;  2VQE E;  4IFD C;  2UU9 I;  3M7N D;  4LFA E;  3HJC A;  1VI7 A;  2J65 A;  4P7A A;  3J7A G;  3ZZT A;  4OKG A;  1ZM4 A;  3HKM A;  1HNW I;  5L3J A;  1MX0 A;  2V2Z A;  4MU0 A;  1ZXN A;  2UUC E;  4JYA E;  2BR2 B;  3CWV A;  4R1F A;  2UXB E;  3PYF A;  3UHM A;  2BA0 G;  1NHH A;  1MU5 A;  2ZIT A;  4DR6 I;  5GMD A;  3J81 Q;  2O1W A;  2PO0 A;  4MU3 A;  3L7Z A;  4IFD E;  3CDI A;  2R42 A;  4KQV A;  2R3V A;  3P3E A;  1UDN A;  1FJG E;  4JI1 I;  2JE6 B;  2Q2E B;  1XMQ I;  1BKN A;  4X65 E;  5IT9 C;  4DR1 E;  2BV3 A;  1N0U A;  4DV2 I;  4DV0 I;  4OO1 C;  4LF5 I;  3NZK A;  2PNZ A;  1ZXM A;  2PNL A;  3JAM C;  4LF4 E;  4LF6 E;  4LOM A;  2VQF E;  3PYG A;  1Y4S A;  4IZJ D;  2PO1 A;  4DUY E;  4DV3 E;  4MQY A;  2Z5C B;  4KHP E;  2C37 B;  1UDQ A;  1A6F A;  1KIJ A;  5K36 A;  4IFD D;  3T1H I;  3PS3 A;  2JEA B;  1H73 A;  2LJP A;  2WNR B;  4OO1 E;  4FW5 A;  4JG4 A;  2F4V E;  1DAR A;  4GKK E;  3KRN A;  3QT8 A;  4USK A;  3U1Y A;  3PYD A;  5FLX C;  1HR0 E;  1PVG A;  1FNM A;  1IBM I;  4IS9 A;  2BA1 G;  2AE8 A;  4IZJ B;  4X64 E;  2GS8 A;  4LF8 E;  4DV4 I;  3OTO I;  1R6L A;  4IFD B;  1NHI A;  4AM3 A;  1Z0V A;  4B3R E;  3ZM7 A;  1H72 C;  2BA0 D;  3WU5 A;  1Z0T A;  5IWA I;  1RRE A;  4BA1 A;  4AQY E;  1Y6Z A;  5K36 F;  2IOQ A;  1I94 I;  2V34 A;  2VF3 A;  1OJ4 A;  4OO1 D;  1IBK E;  4JI2 E;  3P3C A;  1Z5A A;  2E5L E;  2HK3 A;  4DR7 I;  4YY3 I;  3WU3 A;  2JEB B;  2J7K A;  5JEA A;  2Z5E A;  2UXD I;  4WUC A;  2HHH I;  1YHC A;  4UT4 A;  2O1V A;  4B3M E;  1Z0G A;  4OO1 B;  1ZM2 A;  4FWG A;  4LCH A;  3J81 C;  2NN6 F;  1J5E I;  1Z5B A;  4DV7 E;  2UUB I;  4JI7 I;  1N34 I;  4YHH E;  4N3O A;  4DV5 E;  2PO2 A;  1EI1 A;  3T1Y I;  4DR4 I;  4RPF A;  4NXN E;  1UEK A;  4X66 I;  5C0X A;  3Q6N A;  3GLL A;  4WUD A;  4JI8 I;  2NN6 E;  1KVK A;  3M6A A;  1XMO E;  4IFD A;  4DUZ E;  4DR5 I;  3LTO A;  2BA1 D;  1N32 I;  4IZK B;  3K17 A;  3WU4 A;  4B3T E;  1XNR E;  1OYS A;  1ELO A;  4XTJ A;  5JEA F;  4FW7 A;  4Z7C A;  1N33 I;  3ZZU A;  1FKA E;  4B3S E;  5A2Q C;  4DPY A;  4UTG A;  4NXM I;  4GKJ I;  4DR3 I;  4U3B A;  2VES A;  4MYT A;  4Z7Y A;  3B82 A;  1EA6 A;  2UU9 E;  1Z5C A;  1E3H A;  4HXZ A;  3B78 A;  1H74 A;  4DV6 I;  3J80 C;  2A2C A;  2NN6 D;  4JI3 I;  5C0X F;  1VIS A;  1HNW E;  2XEX A;  1D6T A;  3B8H A;  2Z5B B;  2C39 B;  3K1J A;  4DR6 E;  4AID A;  5BR8 I;  4BA2 B;  1B62 A;  4HAC A;  1FWK A;  4LF7 I;  2C38 A;  4LCG A;  1XMQ E;  3F0N A;  4JI4 I;  2NN6 B;  5A2Q Q;  5DRP A;  1Y5Y A;  4PRX A;  2A2D A;  4DV2 E;  4DV0 E;  3GME A;  4LF5 E;  2IOP A;  4JV5 I;  1FI4 A;  2O1U A;  5EL9 A;  4LFB I;  1IBL I;  3J80 Q;  5LMN E;  4LPF A;  4PU9 A;  4K0K I;  2BR2 A;  2UXC I;  4ZVI A;  1N36 I;  4LF9 I;  4QNJ A;  3T1H E;  4P52 A;  4DV1 I;  4JI6 I;  2AJ4 A;  2IER A;  1PIE A;  1B63 A;  3WU6 A;  3PYE A;  4HY1 A;  2PNM A;  2UUA I;  1NZ0 A;  2JE6 A;  2V8P A;  2CG9 A;  4FW9 A;  4PRV A;  1P42 A;  2ZM6 I;  1IBM E;  3P06 A;  2WP8 B;  4DV4 E;  3CDJ A;  3OTO E;  4LCF A;  4QNK A;  4X62 I;  4USM A;  1XNQ I;  5LL6 R;  3ZZ0 A;  2O1T A;  2ZBK B;  4FWH A;  2JT2 A;  5K36 E;  4DU8 A;  5IWA E;  5DRR A;  4JI0 I;  1USU A;  2Z5C A;  3DD6 A;  4DR2 I;  1HNX I;  2C37 A;  4JI5 I;  2NN6 C;  2X7I A;  4M1K A;  1I94 E;  4LFC I;  2JEA A;  3ZKD A;  3P3G A;  4DPW A;  1Z0C A;  1HNZ I;  2WNR A;  4FN5 A;  1Y4U A; 
#chains in the Genus database with same CATH homology
 2OI2 A;  1HK7 A;  4DR7 E;  4YY3 E;  4OX9 I;  5LMU I;  1N0V C;  1S4E A;  4IZJ A;  1Z0W A;  3V5R A;  2UXD E;  1PKP A;  2HHH E;  1KTV A;  2VQE I;  1J5E E;  2UUB E;  4JI7 E;  3GON A;  3QT6 A;  1N34 E;  4LFA I;  3V2U C;  1H7S A;  3T1Y E;  4DR4 E;  4MYU A;  4X66 E;  1S16 A;  4JI8 E;  1Z0E A;  4DXL A;  2UUC I;  4JYA I;  4DR5 E;  2UXB I;  1N32 E;  3J7A M;  2EFG A;  2X36 A;  4ED4 A;  2HFU A;  1N33 E;  3H4L A;  1FJG I;  4NXM E;  4GKJ E;  4X65 I;  4DR3 E;  4DR1 I;  4WUB A;  3K85 A;  2CZ9 A;  4FWD A;  3QT5 A;  2DEJ A;  4DV6 E;  4LF4 I;  4JI3 E;  4LF6 I;  4JI1 E;  2BM1 A;  2VQF I;  4DUY I;  4DV3 I;  1Z59 A;  1FWL A;  5GME A;  4DPT A;  4KHP I;  2HK2 A;  2V2V A;  4IZK A;  5BR8 E;  2HKJ A;  3HUL A;  1K47 A;  4LF7 E;  4I3H A;  4DPU A;  2F4V I;  3PRY A;  3D4J A;  4GKK I;  4DU7 A;  4JI4 E;  5LMN I;  1HR0 I;  4LF8 I;  4X64 I;  2E1R A;  1Z0B A;  1XHK A;  1USV A;  4JV5 E;  4LFB E;  2GQ0 A;  1IBL E;  3ZKB A;  4B3R I;  2DEI A;  2BM0 A;  4K0K E;  2UXC E;  3QT7 A;  1N36 E;  4AQY I;  4DPX A;  2Z5B A;  4LF9 E;  5IT9 Q;  4DV1 E;  4JI6 E;  2HKE A;  1IBK I;  2WW4 A;  4JI2 I;  1ZM3 A;  2UUA E;  3JAM Q;  2E5L I;  3Q6M A;  2ZM6 E;  1NHJ A;  1WUU A;  4B3M I;  4X62 E;  2HFS A;  1H7U A;  1XNQ E;  3Q1Q A;  1MG7 A;  1ZM9 A;  3LNU A;  1RR9 A;  2NPF A;  4DV7 I;  4JI0 E;  2CGE A;  4YHH I;  4DV5 I;  4DR2 E;  1HNX E;  4JI5 E;  4LFC E;  2V2Q A;  4NXN I;  4URL A;  5FLX Q;  1U2R A;  4EMD A;  1XMO I;  1HNZ E;  1QZR A;  4DUZ I;  4B3T I;  1XNR I;  4OX9 E;  5LMU E;  4HAC B;  4B3S I;  5FWK A;  1KKH A;  4HYM A;  3LPS A;  2VQE E;  2UU9 I;  4LFA E;  3HJC A;  4P7A A;  3J7A G;  3ZZT A;  1ZM4 A;  1HNW I;  5L3J A;  1MX0 A;  2V2Z A;  1ZXN A;  2UUC E;  4JYA E;  3CWV A;  4R1F A;  2UXB E;  3PYF A;  1NHH A;  1MU5 A;  2ZIT A;  4DR6 I;  5GMD A;  3J81 Q;  2O1W A;  2R42 A;  4KQV A;  2R3V A;  1FJG E;  4JI1 I;  2Q2E B;  1XMQ I;  1BKN A;  4X65 E;  5IT9 C;  4DR1 E;  2BV3 A;  1N0U A;  4DV2 I;  4DV0 I;  4LF5 I;  1ZXM A;  2PNL A;  3JAM C;  4LF4 E;  4LF6 E;  2VQF E;  3PYG A;  1Y4S A;  4IZJ D;  4DUY E;  4DV3 E;  2Z5C B;  4KHP E;  1A6F A;  1KIJ A;  3T1H I;  1H73 A;  2LJP A;  2F4V E;  4JG4 A;  1DAR A;  4GKK E;  3QT8 A;  4USK A;  3PYD A;  5FLX C;  1HR0 E;  1PVG A;  1FNM A;  1IBM I;  4LF8 E;  4IZJ B;  4X64 E;  2GS8 A;  4DV4 I;  3OTO I;  1NHI A;  1Z0V A;  4B3R E;  3ZM7 A;  1H72 C;  3WU5 A;  1Z0T A;  5IWA I;  1RRE A;  4AQY E;  1Y6Z A;  2IOQ A;  1I94 I;  2V34 A;  2VF3 A;  1OJ4 A;  1IBK E;  4JI2 E;  1Z5A A;  2E5L E;  2HK3 A;  4DR7 I;  4YY3 I;  3WU3 A;  2J7K A;  2Z5E A;  2UXD I;  4WUC A;  2HHH I;  4UT4 A;  2O1V A;  4B3M E;  1Z0G A;  1ZM2 A;  4FWG A;  3J81 C;  1J5E I;  1Z5B A;  4DV7 E;  2UUB I;  4JI7 I;  1N34 I;  4YHH E;  4N3O A;  4DV5 E;  1EI1 A;  3T1Y I;  4DR4 I;  4RPF A;  4NXN E;  1UEK A;  4X66 I;  3Q6N A;  4WUD A;  4JI8 I;  3M6A A;  1KVK A;  1XMO E;  4DUZ E;  4DR5 I;  3LTO A;  1N32 I;  4IZK B;  3K17 A;  3WU4 A;  4B3T E;  1XNR E;  1ELO A;  4XTJ A;  4Z7C A;  1N33 I;  3ZZU A;  1FKA E;  4B3S E;  5A2Q C;  4DPY A;  4UTG A;  4NXM I;  4GKJ I;  4DR3 I;  4MYT A;  4Z7Y A;  3B82 A;  1EA6 A;  2UU9 E;  1Z5C A;  4HXZ A;  3B78 A;  1H74 A;  4DV6 I;  3J80 C;  2A2C A;  4JI3 I;  1VIS A;  1HNW E;  2XEX A;  1D6T A;  3B8H A;  2Z5B B;  3K1J A;  4DR6 E;  5BR8 I;  1B62 A;  4HAC A;  1FWK A;  4LF7 I;  1XMQ E;  3F0N A;  4JI4 I;  5A2Q Q;  4PRX A;  2A2D A;  4DV2 E;  4DV0 E;  4LF5 E;  2IOP A;  4JV5 I;  1FI4 A;  2O1U A;  4LFB I;  1IBL I;  3J80 Q;  5LMN E;  4PU9 A;  4K0K I;  2UXC I;  4ZVI A;  1N36 I;  4LF9 I;  3T1H E;  4P52 A;  4DV1 I;  4JI6 I;  2AJ4 A;  1PIE A;  1B63 A;  3WU6 A;  3PYE A;  4HY1 A;  2PNM A;  2UUA I;  1NZ0 A;  2V8P A;  2CG9 A;  4FW9 A;  4PRV A;  2ZM6 I;  1IBM E;  3P06 A;  4DV4 E;  3OTO E;  4X62 I;  4USM A;  1XNQ I;  5LL6 R;  3ZZ0 A;  2O1T A;  2ZBK B;  4FWH A;  4DU8 A;  5IWA E;  4JI0 I;  1USU A;  2Z5C A;  4DR2 I;  1HNX I;  4JI5 I;  2X7I A;  4M1K A;  1I94 E;  4LFC I;  3ZKD A;  4DPW A;  1Z0C A;  1HNZ I;  4FN5 A;  1Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...