1Z0VA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative protease La homolog type
publication title Pathological crystallography: case studies of several unusual macromolecular crystals.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 53
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0vA00
1N33E 1KKHA 3JAMQ 4B3SI 4LFCE 4AQYE 1N32I 3PYDA 1IBMI 2UXDE 1FWKA 4MYTA 4DR4E 1FNMA 1S16A 1HR0I 3GONA 3HULA 1DARA 5BR8E 2UUAI 2UU9E 3B82A 2UXBI 4UTGA 1Z0TA 4OX9I 3T1HE 4JI2E 5LMNI 3WU3A 2HKEA 4DR5I 2ZM6I 3PYEA 2LJPA 1H72C 4B3ME 4HXZA 1Z0GA 3OTOE 3ZM7A 4X62E 4LF4I 3WU5A 1J5EE 1B63A 1XMOI 4LF7I 4LF5I 4JI7I 4DR1E 1N36E 4WUCA 4LFAI 2UXDI 1HNXE 2UUBI 3QT6A 4JI0I 4YY3E 5GMDA 5IWAE 4X64E 4JV5E 1HNWE 4DV7E 1H74A 1Z5CA 4HACB 2A2DA 2V34A 2AJ4A 4YHHI 4X65E 1N34E 4P7AA 1Z0CA 4K0KE 4DPXA 3ZZUA 1H7UA 4DUYE 3QT7A 4HACA 1H73A 2A2CA 3B8HA 4NXNI 4LFBE 4LF9E 1A6FA 3WU6A 2UXCI 2BM0A 1MU5A 1FI4A 1FJGE 2HHHI 4B3TI 4FWHA 4JYAI 5A2QC 2F4VE 1NHIA 2X7IA 4R1FA 3V5RA 4DV1I 2HK2A 5GMEA 4GKKE 4MYUA 4DV5E 1IBKI 1Z59A 2V2VA 5LL6R 4DV6E 3T1YI 4JI3I 2VF3A 4KHPE 4GKJE 3LNUA 1HNZE 4DPUA 1RR9A 3LPSA 1ZXNA 3ZZTA 1Z0EA 4DR2I 1KVKA 5LMUE 1XNQI 3QT8A 1FKAE 4DR6E 2E1RA 2GS8A 5IT9C 1XMQI 1I94I 2UUCE 4DPTA 4PU9A 4USMA 4DR7E 2BV3A 4FWGA 1NHHA 2E5LE 4WUDA 4DPYA 4JI8E 4JI6I 4KQVA 4DR3E 4LF6I 1NZ0A 1OJ4A 5A2QQ 2XEXA 1B62A 1PIEA 2VQFI 4RPFA 4PRVA 1K47A 4JI1I 4PRXA 4DV4E 2EFGA 4DV2I 1D6TA 1BKNA 1ZXMA 1XHKA 4JI5E 4FW9A 2VQEE 4UT4A 4NXMI 1XNRI 4P52A 4DV3E 2HK3A 1N33I 1XNRE 4X66E 1EI1A 4LFCI 4AQYI 1IBLE 4DR4I 5IT9Q 4JI4E 4ED4A 2ZBKB 4DU7A 3J80C 5BR8I 1MG7A 4B3RE 3QT5A 1QZRA 2UU9I 3T1HI 4JI2I 4LF8E 1Z0BA 4B3MI 3PYGA 3OTOI 2Q2EB 4URLA 4X62I 4DUZE 1J5EI 1EA6A 2ZITA 4B3SE 1N32E 2WW4A 2R42A 1ELOA 1IBME 1U2RA 4DR1I 1N36I 3D4JA 1HNXI 1HR0E 1KTVA 4YY3I 4Z7YA 2UUAE 5IWAI 1UEKA 4X64I 2BM1A 4JV5I 1HNWI 3J80Q 4DV7I 2UXBE 4OX9E 4X65I 1N34I 5LMNE 4EMDA 4K0KI 4DR5E 4DUYI 2ZM6E 2V2QA 1WUUA 4USKA 3V2UC 3WU4A 4LFBI 1VISA 4LF9I 1MX0A 4DV0E 1KIJA 4LF4E 1FJGI 1N0VC 2F4VI 3K1JA 1XMOE 3ZZ0A 4LF7E 2HKJA 3M6AA 4LF5E 2NPFA 4GKKI 4JI7E 5FLXC 4ZVIA 4LFAE 4DV5I 4M1KA 3Q1QA 4DXLA 2R3VA 2UUBE 4DV6I 4JI0E 1FWLA 1ZM9A 4GKJI 4KHPI 4DU8A 4XTJA 2HFUA 1HNZI 2J7KA 3K17A 5LMUI 2CZ9A 4YHHE 4HY1A 4I3HA 4NXNE 4DR6I 3J81C 1PVGA 1Z5AA 1RREA 2UUCI 2UXCE 1Z0WA 4DR7I 1H7SA 4DV0I 2E5LI 1PKPA 2HHHE 4B3TE 4JYAE 3LTOA 4JI8I 4DR3I 4FN5A 2X36A 4DV1E 1ZM4A 2DEIA 1IBKE 1ZM3A 1Z5BA 3T1YE 5FLXQ 4JI3E 4DV4I 3CWVA 3ZKBA 4DR2E 1N0UA 4JI5I 2VQEI 1XNQE 3JAMC 1ZM2A 2V8PA 4DV3I 1XMQE 4X66I 1I94E 3B78A 1IBLI 3PYFA 4DPWA 2HFSA 3J81Q 4JI4I 4FWDA 1S4EA 2V2ZA 1NHJA 3F0NA 4JI6E 4B3RI 4LF6E 4JG4A 4Z7CA 2DEJA 2OI2A 3ZKDA 2VQFE 4JI1E 4LF8I 3J7AG 4HYMA 4DV2E 3H4LA 4WUBA 3J7AM 5L3JA 1Z0VA 4NXME 4DUZI
chains in the Genus database with same CATH superfamily
4BA2B 2CGEA 2JEAA 1N33E 1KKHA 3JAMQ 4B3SI 4LFCE 5DRQA 4AQYE 1N32I 3P3EA 3PYDA 1IBMI 2UXDE 1FWKA 2CVEA 2NN6D 4MYTA 4DR4E 5C0XF 1FNMA 2C39B 1S16A 5JEAD 1HR0I 3GONA 3HULA 2C38A 1DARA 5BR8E 2UUAI 1E3PA 3B4TA 2C39A 2UU9E 3B82A 4IZJB 2UXBI 2CG9A 4UTGA 1Z0TA 4OX9I 3T1HE 5C0XE 4JI2E 5DRPA 5LMNI 3WU3A 2PO2B 2HKEA 3NZKA 4DR5I 2ZM6I 3PYEA 3M85D 2LJPA 3GLLA 4IFDC 1H72C 4B3ME 3P3CA 4HXZA 4BA1B 4MU1A 1Z0GA 3PRYA 3Q6NA 3OTOE 2PO0B 3ZM7A 4X62E 4LF4I 3PS2A 4OO1A 3WU5A 3UHMA 1J5EE 1B63A 1XMOI 2NN6C 2Z5EA 4LF7I 4LF5I 1RHYA 5EKWA 4JI7I 5JEAC 4DR1E 1N36E 4WUCA 4LFAI 2UXDI 1HNXE 4OO1F 4IS9A 4ISAA 2UUBI 3QT6A 4JI0I 4YY3E 4LCHA 4MDTA 2GO4A 5GMDA 5IWAE 4X64E 4JV5E 2GO3A 1HNWE 4DV7E 1H74A 1Z5CA 2BR2B 4MU0A 4HACB 5FWKA 2IOPA 2A2DA 4QNJA 2V34A 2AJ4A 1OYSA 4YHHI 2C37A 4OKGA 4X65E 1N34E 4P7AA 4OO1E 1Z0CA 4K0KE 4IZJD 4DPXA 3ZZUA 1H7UA 4DUYE 5K36A 3QT7A 4HACA 1H73A 2A2CA 3B8HA 4NXNI 4LFBE 4FW6A 4LF9E 1A6FA 3WU6A 2UXCI 5K36F 2BM0A 1MU5A 2Z5BA 1FI4A 1FJGE 2HHHI 5DNXA 4B3TI 4FWHA 4JYAI 5A2QC 2F4VE 1NHIA 2X7IA 4R1FA 3V5RA 4DV1I 2HK2A 2IOQA 5GMEA 4GKKE 2BA0G 4MYUA 4DV5E 2WNRA 1IBKI 1P42A 1Z59A 2V2VA 5LL6R 4LCGA 4DV6E 4MU4A 1UDOA 4U3DA 3T1YI 5K36E 4JI3I 2VF3A 4KHPE 4GKJE 3LNUA 1HNZE 5C0XB 4DPUA 1RR9A 3LPSA 1ZXNA 3ZZTA 1Z0EA 4DR2I 1KVKA 1Y5YA 2NN6F 5LMUE 5JEAF 1XNQI 3QT8A 1FKAE 2C38B 4DR6E 2E1RA 2GS8A 5IT9C 4FW4A 5DNLA 2BA1D 1XMQI 1I94I 2UUCE 4DPTA 4PU9A 4USMA 4DR7E 2BV3A 2NN6E 4FWGA 1NHHA 2E5LE 2JT2A 4WUDA 5JEAE 4DPYA 4JI8E 4JI6I 4KQVA 4DR3E 4LF6I 4LOMA 1NZ0A 1OJ4A 3L7ZA 5A2QQ 2XEXA 1B62A 1PIEA 2VQFI 4RPFA 3U1KA 4PRVA 1K47A 4JI1I 4PRXA 4DV4E 2IERA 2EFGA 4DV2I 1D6TA 4OO1B 1BKNA 1ZXMA 1XHKA 3HKMA 4JI5E 4FW9A 3M85G 2VQEE 1R6LA 1YHCA 5C0XD 4UT4A 1E3HA 4NXMI 2Z5CB 1XNRI 4P52A 4DV3E 2HK3A 3P06A 3KRNA 1N33I 2JEBB 1XNRE 4X66E 3K85A 1EI1A 4LPFA 4LFCI 4AQYI 1IBLE 2Z5CA 4DR4I 5IT9Q 4JI4E 2JEBA 4NBQA 2ZBKB 4DU7A 4ED4A 4GQUA 3J80C 2C37B 5BR8I 3CDJA 1MG7A 3M7ND 4B3RE 1Y4UA 3QT5A 1R6MA 1QZRA 5K36B 2UU9I 1Y4SA 4LCFA 2O1UA 3T1HI 4JI2I 4LF8E 3U1YA 1USUA 3P3GA 2Z5BB 5ELWA 1Z0BA 4QNKA 3P76A 4B3MI 1OYPA 2O1WA 1UDQA 3PYGA 5C0XC 3OTOI 4IFDA 4OO1D 2Q2EB 4URLA 4X62I 4DUZE 2WNRB 1UDNA 4U3BA 2NN6B 1J5EI 1EA6A 2ZITA 4B3SE 3CDIA 1N32E 2WW4A 5JEAB 2R42A 1ELOA 4IFDF 1IBME 2PNMA 1U2RA 4DR1I 1N36I 3D4JA 1HNXI 1HR0E 2NN6A 4FW3A 5DROA 1KTVA 4YY3I 4Z7YA 5JEAA 2UUAE 4MQYA 5IWAI 1UEKA 4X64I 2BM1A 4JV5I 1HNWI 3J80Q 4DV7I 3GCMA 2UXBE 4IFDE 4OX9E 2J65A 4X65I 2PO1A 3GMEA 4MU3A 1N34I 5K36D 5LMNE 2PNLA 4EMDA 4K0KI 4DR5E 4DUYI 2ZM6E 2V2QA 1WUUA 4USKA 3V2UC 3WU4A 4LFBI 1VISA 4LF9I 4OO1C 1MX0A 4DV0E 3L7ZB 2BA1G 2JE6A 1KIJA 4LF4E 1FJGI 1N0VC 2F4VI 3K1JA 1XMOE 2GQ0A 3ZZ0A 4LF7E 3PS1A 2HKJA 3M6AA 2PNZA 4LF5E 1USVA 2NPFA 4GKKI 4JI7E 5FLXC 4ZVIA 4LFAE 4DV5I 4M1KA 4N3OA 3Q1QA 4DXLA 2R3VA 2UUBE 4DV6I 4JI0E 4BA2A 1FWLA 3PS3A 1ZM9A 4GKJI 4KHPI 4DU8A 4XTJA 2HFUA 1HNZI 1Y60A 4AM3A 2J7KA 1VI7A 3K17A 4FW5A 5K36C 5LMUI 2CZ9A 4YHHE 4HY1A 4I3HA 4NXNE 2O1VA 4IZJA 4DR6I 1YH8A 3J81C 1PVGA 1Z5AA 1RREA 2UUCI 2UXCE 1Z0WA 4DR7I 2PO2A 1H7SA 4DV0I 2E5LI 1PKPA 2O3ZA 2HHHE 4B3TE 4JYAE 3LTOA 4JI8I 4BA1A 4DR3I 4FN5A 2PO0A 2X36A 4DV1E 1ZM4A 3M7NG 3HJCA 1OYRA 2DEIA 1HK7A 1IBKE 1ZM3A 1Z5BA 3T1YE 5FLXQ 4JI3E 2F1DA 4IFDB 4DV4I 3CWVA 2WP8B 3ZKBA 4DR2E 1N0UA 4JI5I 4AIDA 2VQEI 4OZEA 4J3DA 1XNQE 3JAMC 1ZM2A 2V8PA 2WP8A 4DV3I 2BR2A 3DD6A 5EL9A 1XMQE 4X66I 1I94E 3B78A 1IBLI 3PYFA 4DPWA 2HFSA 3J81Q 4JI4I 4FWDA 1S4EA 1UDSA 2V2ZA 1NHJA 2PO1B 3F0NA 4JI6E 1XXEA 2BA0D 4B3RI 4LF6E 4JG4A 4Z7CA 4IZKB 2DEJA 2OI2A 3Q6MA 3ZKDA 2VQFE 2VESA 4AIMA 4JI1E 4LF8I 3J7AG 4HYMA 2JE6B 4IZKA 2IESA 4DV2E 3H4LA 3H1CA 4WUBA 3J7AM 5L3JA 4IFDD 2JEAB 5DRRA 1Y6ZA 2PNZB 4FW7A 2AE8A 1Z0VA 4NXME 4DUZI 2O1TA 5C0XA
chains in the Genus database with same CATH topology
2CGEA 1N33E 1KKHA 3JAMQ 4B3SI 4LFCE 4AQYE 1N32I 3PYDA 1IBMI 2UXDE 1FWKA 4MYTA 4DR4E 1FNMA 1S16A 1HR0I 3GONA 3HULA 1DARA 5BR8E 2UUAI 2UU9E 3B82A 4IZJB 2UXBI 2CG9A 4UTGA 1Z0TA 4OX9I 3T1HE 4JI2E 5LMNI 3WU3A 2HKEA 4DR5I 2ZM6I 3PYEA 2LJPA 1H72C 4B3ME 4HXZA 1Z0GA 3PRYA 3Q6NA 3OTOE 3ZM7A 4X62E 4LF4I 3WU5A 1J5EE 1B63A 1XMOI 2Z5EA 4LF7I 4LF5I 4JI7I 4DR1E 1N36E 4WUCA 4LFAI 2UXDI 1HNXE 2UUBI 3QT6A 4JI0I 4YY3E 5GMDA 5IWAE 4X64E 4JV5E 1HNWE 4DV7E 1H74A 1Z5CA 4HACB 5FWKA 2IOPA 2A2DA 2V34A 2AJ4A 4YHHI 4X65E 1N34E 4P7AA 1Z0CA 4K0KE 4IZJD 4DPXA 3ZZUA 1H7UA 4DUYE 3QT7A 4HACA 1H73A 2A2CA 3B8HA 4NXNI 4LFBE 4LF9E 1A6FA 3WU6A 2UXCI 2BM0A 1MU5A 2Z5BA 1FI4A 1FJGE 2HHHI 4B3TI 4FWHA 4JYAI 5A2QC 2F4VE 1NHIA 2X7IA 4R1FA 3V5RA 4DV1I 2HK2A 2IOQA 5GMEA 4GKKE 4MYUA 4DV5E 1IBKI 1Z59A 2V2VA 5LL6R 4DV6E 3T1YI 4JI3I 2VF3A 4KHPE 4GKJE 3LNUA 1HNZE 4DPUA 1RR9A 3LPSA 1ZXNA 3ZZTA 1Z0EA 4DR2I 1KVKA 5LMUE 1XNQI 3QT8A 1FKAE 4DR6E 2E1RA 2GS8A 5IT9C 1XMQI 1I94I 2UUCE 4DPTA 4PU9A 4USMA 4DR7E 2BV3A 4FWGA 1NHHA 2E5LE 4WUDA 4DPYA 4JI8E 4JI6I 4KQVA 4DR3E 4LF6I 1NZ0A 1OJ4A 5A2QQ 2XEXA 1B62A 1PIEA 2VQFI 4RPFA 4PRVA 1K47A 4JI1I 4PRXA 4DV4E 2EFGA 4DV2I 1D6TA 1BKNA 1ZXMA 1XHKA 4JI5E 4FW9A 2VQEE 4UT4A 4NXMI 2Z5CB 1XNRI 4P52A 4DV3E 2HK3A 3P06A 1N33I 1XNRE 4X66E 3K85A 1EI1A 4AQYI 4LFCI 1IBLE 2Z5CA 4DR4I 5IT9Q 4JI4E 4ED4A 2ZBKB 4DU7A 3J80C 5BR8I 1MG7A 4B3RE 1Y4UA 3QT5A 1QZRA 2UU9I 1Y4SA 2O1UA 3T1HI 4JI2I 4LF8E 1USUA 2Z5BB 1Z0BA 4B3MI 2O1WA 3PYGA 3OTOI 2Q2EB 4URLA 4X62I 4DUZE 1J5EI 1EA6A 2ZITA 4B3SE 1N32E 2WW4A 2R42A 1ELOA 1IBME 2PNMA 1U2RA 4DR1I 1N36I 3D4JA 1HNXI 1HR0E 1KTVA 4YY3I 4Z7YA 2UUAE 5IWAI 1UEKA 4X64I 2BM1A 4JV5I 1HNWI 3J80Q 4DV7I 2UXBE 4OX9E 4X65I 1N34I 5LMNE 2PNLA 4EMDA 4K0KI 4DR5E 4DUYI 2ZM6E 2V2QA 1WUUA 4USKA 3V2UC 3WU4A 4LFBI 1VISA 4LF9I 1MX0A 4DV0E 1KIJA 4LF4E 1FJGI 1N0VC 2F4VI 3K1JA 1XMOE 2GQ0A 3ZZ0A 4LF7E 2HKJA 3M6AA 4LF5E 1USVA 2NPFA 4GKKI 4JI7E 5FLXC 4ZVIA 4LFAE 4DV5I 4M1KA 4N3OA 3Q1QA 4DXLA 2R3VA 2UUBE 4DV6I 4JI0E 1FWLA 1ZM9A 4GKJI 4KHPI 4DU8A 4XTJA 2HFUA 1HNZI 2J7KA 3K17A 5LMUI 2CZ9A 4YHHE 4HY1A 4I3HA 4NXNE 2O1VA 4IZJA 4DR6I 3J81C 1PVGA 1Z5AA 1RREA 2UUCI 2UXCE 1Z0WA 4DR7I 1H7SA 4DV0I 2E5LI 1PKPA 2HHHE 4B3TE 4JYAE 3LTOA 4JI8I 4DR3I 4FN5A 2X36A 4DV1E 1ZM4A 3HJCA 2DEIA 1HK7A 1IBKE 1ZM3A 1Z5BA 3T1YE 5FLXQ 4JI3E 4DV4I 3CWVA 3ZKBA 4DR2E 1N0UA 4JI5I 2VQEI 1XNQE 3JAMC 1ZM2A 2V8PA 4DV3I 1XMQE 4X66I 1I94E 3B78A 1IBLI 3PYFA 4DPWA 2HFSA 3J81Q 4JI4I 4FWDA 1S4EA 2V2ZA 1NHJA 3F0NA 4JI6E 4B3RI 4LF6E 4JG4A 4Z7CA 4IZKB 2DEJA 2OI2A 3Q6MA 3ZKDA 2VQFE 4JI1E 4LF8I 3J7AG 4HYMA 4IZKA 4DV2E 3H4LA 4WUBA 3J7AM 5L3JA 1Y6ZA 1Z0VA 4NXME 4DUZI 2O1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 E;  1KKH A;  3JAM Q;  4B3S I;  4LFC E;  4AQY E;  1N32 I;  3PYD A;  1IBM I;  2UXD E;  1FWK A;  4MYT A;  4DR4 E;  1FNM A;  1S16 A;  1HR0 I;  3GON A;  3HUL A;  1DAR A;  5BR8 E;  2UUA I;  2UU9 E;  3B82 A;  2UXB I;  4UTG A;  1Z0T A;  4OX9 I;  3T1H E;  4JI2 E;  5LMN I;  3WU3 A;  2HKE A;  4DR5 I;  2ZM6 I;  3PYE A;  2LJP A;  1H72 C;  4B3M E;  4HXZ A;  1Z0G A;  3OTO E;  3ZM7 A;  4X62 E;  4LF4 I;  3WU5 A;  1J5E E;  1B63 A;  1XMO I;  4LF7 I;  4LF5 I;  4JI7 I;  4DR1 E;  1N36 E;  4WUC A;  4LFA I;  2UXD I;  1HNX E;  2UUB I;  3QT6 A;  4JI0 I;  4YY3 E;  5GMD A;  5IWA E;  4X64 E;  4JV5 E;  1HNW E;  4DV7 E;  1H74 A;  1Z5C A;  4HAC B;  2A2D A;  2V34 A;  2AJ4 A;  4YHH I;  4X65 E;  1N34 E;  4P7A A;  1Z0C A;  4K0K E;  4DPX A;  3ZZU A;  1H7U A;  4DUY E;  3QT7 A;  4HAC A;  1H73 A;  2A2C A;  3B8H A;  4NXN I;  4LFB E;  4LF9 E;  1A6F A;  3WU6 A;  2UXC I;  2BM0 A;  1MU5 A;  1FI4 A;  1FJG E;  2HHH I;  4B3T I;  4FWH A;  4JYA I;  5A2Q C;  2F4V E;  1NHI A;  2X7I A;  4R1F A;  3V5R A;  4DV1 I;  2HK2 A;  5GME A;  4GKK E;  4MYU A;  4DV5 E;  1IBK I;  1Z59 A;  2V2V A;  5LL6 R;  4DV6 E;  3T1Y I;  4JI3 I;  2VF3 A;  4KHP E;  4GKJ E;  3LNU A;  1HNZ E;  4DPU A;  1RR9 A;  3LPS A;  1ZXN A;  3ZZT A;  1Z0E A;  4DR2 I;  1KVK A;  5LMU E;  1XNQ I;  3QT8 A;  1FKA E;  4DR6 E;  2E1R A;  2GS8 A;  5IT9 C;  1XMQ I;  1I94 I;  2UUC E;  4DPT A;  4PU9 A;  4USM A;  4DR7 E;  2BV3 A;  4FWG A;  1NHH A;  2E5L E;  4WUD A;  4DPY A;  4JI8 E;  4JI6 I;  4KQV A;  4DR3 E;  4LF6 I;  1NZ0 A;  1OJ4 A;  5A2Q Q;  2XEX A;  1B62 A;  1PIE A;  2VQF I;  4RPF A;  4PRV A;  1K47 A;  4JI1 I;  4PRX A;  4DV4 E;  2EFG A;  4DV2 I;  1D6T A;  1BKN A;  1ZXM A;  1XHK A;  4JI5 E;  4FW9 A;  2VQE E;  4UT4 A;  4NXM I;  1XNR I;  4P52 A;  4DV3 E;  2HK3 A;  1N33 I;  1XNR E;  4X66 E;  1EI1 A;  4LFC I;  4AQY I;  1IBL E;  4DR4 I;  5IT9 Q;  4JI4 E;  4ED4 A;  2ZBK B;  4DU7 A;  3J80 C;  5BR8 I;  1MG7 A;  4B3R E;  3QT5 A;  1QZR A;  2UU9 I;  3T1H I;  4JI2 I;  4LF8 E;  1Z0B A;  4B3M I;  3PYG A;  3OTO I;  2Q2E B;  4URL A;  4X62 I;  4DUZ E;  1J5E I;  1EA6 A;  2ZIT A;  4B3S E;  1N32 E;  2WW4 A;  2R42 A;  1ELO A;  1IBM E;  1U2R A;  4DR1 I;  1N36 I;  3D4J A;  1HNX I;  1HR0 E;  1KTV A;  4YY3 I;  4Z7Y A;  2UUA E;  5IWA I;  1UEK A;  4X64 I;  2BM1 A;  4JV5 I;  1HNW I;  3J80 Q;  4DV7 I;  2UXB E;  4OX9 E;  4X65 I;  1N34 I;  5LMN E;  4EMD A;  4K0K I;  4DR5 E;  4DUY I;  2ZM6 E;  2V2Q A;  1WUU A;  4USK A;  3V2U C;  3WU4 A;  4LFB I;  1VIS A;  4LF9 I;  1MX0 A;  4DV0 E;  1KIJ A;  4LF4 E;  1FJG I;  1N0V C;  2F4V I;  3K1J A;  1XMO E;  3ZZ0 A;  4LF7 E;  2HKJ A;  3M6A A;  4LF5 E;  2NPF A;  4GKK I;  4JI7 E;  5FLX C;  4ZVI A;  4LFA E;  4DV5 I;  4M1K A;  3Q1Q A;  4DXL A;  2R3V A;  2UUB E;  4DV6 I;  4JI0 E;  1FWL A;  1ZM9 A;  4GKJ I;  4KHP I;  4DU8 A;  4XTJ A;  2HFU A;  1HNZ I;  2J7K A;  3K17 A;  5LMU I;  2CZ9 A;  4YHH E;  4HY1 A;  4I3H A;  4NXN E;  4DR6 I;  3J81 C;  1PVG A;  1Z5A A;  1RRE A;  2UUC I;  2UXC E;  1Z0W A;  4DR7 I;  1H7S A;  4DV0 I;  2E5L I;  1PKP A;  2HHH E;  4B3T E;  4JYA E;  3LTO A;  4JI8 I;  4DR3 I;  4FN5 A;  2X36 A;  4DV1 E;  1ZM4 A;  2DEI A;  1IBK E;  1ZM3 A;  1Z5B A;  3T1Y E;  5FLX Q;  4JI3 E;  4DV4 I;  3CWV A;  3ZKB A;  4DR2 E;  1N0U A;  4JI5 I;  2VQE I;  1XNQ E;  3JAM C;  1ZM2 A;  2V8P A;  4DV3 I;  1XMQ E;  4X66 I;  1I94 E;  3B78 A;  1IBL I;  3PYF A;  4DPW A;  2HFS A;  3J81 Q;  4JI4 I;  4FWD A;  1S4E A;  2V2Z A;  1NHJ A;  3F0N A;  4JI6 E;  4B3R I;  4LF6 E;  4JG4 A;  4Z7C A;  2DEJ A;  2OI2 A;  3ZKD A;  2VQF E;  4JI1 E;  4LF8 I;  3J7A G;  4HYM A;  4DV2 E;  3H4L A;  4WUB A;  3J7A M;  5L3J A;  1Z0V A;  4NXM E;  4DUZ I; 
#chains in the Genus database with same CATH topology
 4BA2 B;  2CGE A;  2JEA A;  1N33 E;  1KKH A;  3JAM Q;  4B3S I;  4LFC E;  5DRQ A;  4AQY E;  1N32 I;  3P3E A;  3PYD A;  1IBM I;  2UXD E;  1FWK A;  2CVE A;  2NN6 D;  4MYT A;  4DR4 E;  5C0X F;  1FNM A;  2C39 B;  1S16 A;  5JEA D;  1HR0 I;  3GON A;  3HUL A;  2C38 A;  1DAR A;  5BR8 E;  2UUA I;  1E3P A;  3B4T A;  2C39 A;  2UU9 E;  3B82 A;  4IZJ B;  2UXB I;  2CG9 A;  4UTG A;  1Z0T A;  4OX9 I;  3T1H E;  5C0X E;  4JI2 E;  5DRP A;  5LMN I;  3WU3 A;  2PO2 B;  2HKE A;  3NZK A;  4DR5 I;  2ZM6 I;  3PYE A;  3M85 D;  2LJP A;  3GLL A;  4IFD C;  1H72 C;  4B3M E;  3P3C A;  4HXZ A;  4BA1 B;  4MU1 A;  1Z0G A;  3PRY A;  3Q6N A;  3OTO E;  2PO0 B;  3ZM7 A;  4X62 E;  4LF4 I;  3PS2 A;  4OO1 A;  3WU5 A;  3UHM A;  1J5E E;  1B63 A;  1XMO I;  2NN6 C;  2Z5E A;  4LF7 I;  4LF5 I;  1RHY A;  5EKW A;  4JI7 I;  5JEA C;  4DR1 E;  1N36 E;  4WUC A;  4LFA I;  2UXD I;  1HNX E;  4OO1 F;  4IS9 A;  4ISA A;  2UUB I;  3QT6 A;  4JI0 I;  4YY3 E;  4LCH A;  4MDT A;  2GO4 A;  5GMD A;  5IWA E;  4X64 E;  4JV5 E;  2GO3 A;  1HNW E;  4DV7 E;  1H74 A;  1Z5C A;  2BR2 B;  4MU0 A;  4HAC B;  5FWK A;  2IOP A;  2A2D A;  4QNJ A;  2V34 A;  2AJ4 A;  1OYS A;  4YHH I;  2C37 A;  4OKG A;  4X65 E;  1N34 E;  4P7A A;  4OO1 E;  1Z0C A;  4K0K E;  4IZJ D;  4DPX A;  3ZZU A;  1H7U A;  4DUY E;  5K36 A;  3QT7 A;  4HAC A;  1H73 A;  2A2C A;  3B8H A;  4NXN I;  4LFB E;  4FW6 A;  4LF9 E;  1A6F A;  3WU6 A;  2UXC I;  5K36 F;  2BM0 A;  1MU5 A;  2Z5B A;  1FI4 A;  1FJG E;  2HHH I;  5DNX A;  4B3T I;  4FWH A;  4JYA I;  5A2Q C;  2F4V E;  1NHI A;  2X7I A;  4R1F A;  3V5R A;  4DV1 I;  2HK2 A;  2IOQ A;  5GME A;  4GKK E;  2BA0 G;  4MYU A;  4DV5 E;  2WNR A;  1IBK I;  1P42 A;  1Z59 A;  2V2V A;  5LL6 R;  4LCG A;  4DV6 E;  4MU4 A;  1UDO A;  4U3D A;  3T1Y I;  5K36 E;  4JI3 I;  2VF3 A;  4KHP E;  4GKJ E;  3LNU A;  1HNZ E;  5C0X B;  4DPU A;  1RR9 A;  3LPS A;  1ZXN A;  3ZZT A;  1Z0E A;  4DR2 I;  1KVK A;  1Y5Y A;  2NN6 F;  5LMU E;  5JEA F;  1XNQ I;  3QT8 A;  1FKA E;  2C38 B;  4DR6 E;  2E1R A;  2GS8 A;  5IT9 C;  4FW4 A;  5DNL A;  2BA1 D;  1XMQ I;  1I94 I;  2UUC E;  4DPT A;  4PU9 A;  4USM A;  4DR7 E;  2BV3 A;  2NN6 E;  4FWG A;  1NHH A;  2E5L E;  2JT2 A;  4WUD A;  5JEA E;  4DPY A;  4JI8 E;  4JI6 I;  4KQV A;  4DR3 E;  4LF6 I;  4LOM A;  1NZ0 A;  1OJ4 A;  3L7Z A;  5A2Q Q;  2XEX A;  1B62 A;  1PIE A;  2VQF I;  4RPF A;  3U1K A;  4PRV A;  1K47 A;  4JI1 I;  4PRX A;  4DV4 E;  2IER A;  2EFG A;  4DV2 I;  1D6T A;  4OO1 B;  1BKN A;  1ZXM A;  1XHK A;  3HKM A;  4JI5 E;  4FW9 A;  3M85 G;  2VQE E;  1R6L A;  1YHC A;  5C0X D;  4UT4 A;  1E3H A;  4NXM I;  2Z5C B;  1XNR I;  4P52 A;  4DV3 E;  2HK3 A;  3P06 A;  3KRN A;  1N33 I;  2JEB B;  1XNR E;  4X66 E;  3K85 A;  1EI1 A;  4LPF A;  4LFC I;  4AQY I;  1IBL E;  2Z5C A;  4DR4 I;  5IT9 Q;  4JI4 E;  2JEB A;  4NBQ A;  2ZBK B;  4DU7 A;  4ED4 A;  4GQU A;  3J80 C;  2C37 B;  5BR8 I;  3CDJ A;  1MG7 A;  3M7N D;  4B3R E;  1Y4U A;  3QT5 A;  1R6M A;  1QZR A;  5K36 B;  2UU9 I;  1Y4S A;  4LCF A;  2O1U A;  3T1H I;  4JI2 I;  4LF8 E;  3U1Y A;  1USU A;  3P3G A;  2Z5B B;  5ELW A;  1Z0B A;  4QNK A;  3P76 A;  4B3M I;  1OYP A;  2O1W A;  1UDQ A;  3PYG A;  5C0X C;  3OTO I;  4IFD A;  4OO1 D;  2Q2E B;  4URL A;  4X62 I;  4DUZ E;  2WNR B;  1UDN A;  4U3B A;  2NN6 B;  1J5E I;  1EA6 A;  2ZIT A;  4B3S E;  3CDI A;  1N32 E;  2WW4 A;  5JEA B;  2R42 A;  1ELO A;  4IFD F;  1IBM E;  2PNM A;  1U2R A;  4DR1 I;  1N36 I;  3D4J A;  1HNX I;  1HR0 E;  2NN6 A;  4FW3 A;  5DRO A;  1KTV A;  4YY3 I;  4Z7Y A;  5JEA A;  2UUA E;  4MQY A;  5IWA I;  1UEK A;  4X64 I;  2BM1 A;  4JV5 I;  1HNW I;  3J80 Q;  4DV7 I;  3GCM A;  2UXB E;  4IFD E;  4OX9 E;  2J65 A;  4X65 I;  2PO1 A;  3GME A;  4MU3 A;  1N34 I;  5K36 D;  5LMN E;  2PNL A;  4EMD A;  4K0K I;  4DR5 E;  4DUY I;  2ZM6 E;  2V2Q A;  1WUU A;  4USK A;  3V2U C;  3WU4 A;  4LFB I;  1VIS A;  4LF9 I;  4OO1 C;  1MX0 A;  4DV0 E;  3L7Z B;  2BA1 G;  2JE6 A;  1KIJ A;  4LF4 E;  1FJG I;  1N0V C;  2F4V I;  3K1J A;  1XMO E;  2GQ0 A;  3ZZ0 A;  4LF7 E;  3PS1 A;  2HKJ A;  3M6A A;  2PNZ A;  4LF5 E;  1USV A;  2NPF A;  4GKK I;  4JI7 E;  5FLX C;  4ZVI A;  4LFA E;  4DV5 I;  4M1K A;  4N3O A;  3Q1Q A;  4DXL A;  2R3V A;  2UUB E;  4DV6 I;  4JI0 E;  4BA2 A;  1FWL A;  3PS3 A;  1ZM9 A;  4GKJ I;  4KHP I;  4DU8 A;  4XTJ A;  2HFU A;  1HNZ I;  1Y60 A;  4AM3 A;  2J7K A;  1VI7 A;  3K17 A;  4FW5 A;  5K36 C;  5LMU I;  2CZ9 A;  4YHH E;  4HY1 A;  4I3H A;  4NXN E;  2O1V A;  4IZJ A;  4DR6 I;  1YH8 A;  3J81 C;  1PVG A;  1Z5A A;  1RRE A;  2UUC I;  2UXC E;  1Z0W A;  4DR7 I;  2PO2 A;  1H7S A;  4DV0 I;  2E5L I;  1PKP A;  2O3Z A;  2HHH E;  4B3T E;  4JYA E;  3LTO A;  4JI8 I;  4BA1 A;  4DR3 I;  4FN5 A;  2PO0 A;  2X36 A;  4DV1 E;  1ZM4 A;  3M7N G;  3HJC A;  1OYR A;  2DEI A;  1HK7 A;  1IBK E;  1ZM3 A;  1Z5B A;  3T1Y E;  5FLX Q;  4JI3 E;  2F1D A;  4IFD B;  4DV4 I;  3CWV A;  2WP8 B;  3ZKB A;  4DR2 E;  1N0U A;  4JI5 I;  4AID A;  2VQE I;  4OZE A;  4J3D A;  1XNQ E;  3JAM C;  1ZM2 A;  2V8P A;  2WP8 A;  4DV3 I;  2BR2 A;  3DD6 A;  5EL9 A;  1XMQ E;  4X66 I;  1I94 E;  3B78 A;  1IBL I;  3PYF A;  4DPW A;  2HFS A;  3J81 Q;  4JI4 I;  4FWD A;  1S4E A;  1UDS A;  2V2Z A;  1NHJ A;  2PO1 B;  3F0N A;  4JI6 E;  1XXE A;  2BA0 D;  4B3R I;  4LF6 E;  4JG4 A;  4Z7C A;  4IZK B;  2DEJ A;  2OI2 A;  3Q6M A;  3ZKD A;  2VQF E;  2VES A;  4AIM A;  4JI1 E;  4LF8 I;  3J7A G;  4HYM A;  2JE6 B;  4IZK A;  2IES A;  4DV2 E;  3H4L A;  3H1C A;  4WUB A;  3J7A M;  5L3J A;  4IFD D;  2JEA B;  5DRR A;  1Y6Z A;  2PNZ B;  4FW7 A;  2AE8 A;  1Z0V A;  4NXM E;  4DUZ I;  2O1T A;  5C0X A; 
#chains in the Genus database with same CATH homology
 2CGE A;  1N33 E;  1KKH A;  3JAM Q;  4B3S I;  4LFC E;  4AQY E;  1N32 I;  3PYD A;  1IBM I;  2UXD E;  1FWK A;  4MYT A;  4DR4 E;  1FNM A;  1S16 A;  1HR0 I;  3GON A;  3HUL A;  1DAR A;  5BR8 E;  2UUA I;  2UU9 E;  3B82 A;  4IZJ B;  2UXB I;  2CG9 A;  4UTG A;  1Z0T A;  4OX9 I;  3T1H E;  4JI2 E;  5LMN I;  3WU3 A;  2HKE A;  4DR5 I;  2ZM6 I;  3PYE A;  2LJP A;  1H72 C;  4B3M E;  4HXZ A;  1Z0G A;  3PRY A;  3Q6N A;  3OTO E;  3ZM7 A;  4X62 E;  4LF4 I;  3WU5 A;  1J5E E;  1B63 A;  1XMO I;  2Z5E A;  4LF7 I;  4LF5 I;  4JI7 I;  4DR1 E;  1N36 E;  4WUC A;  4LFA I;  2UXD I;  1HNX E;  2UUB I;  3QT6 A;  4JI0 I;  4YY3 E;  5GMD A;  5IWA E;  4X64 E;  4JV5 E;  1HNW E;  4DV7 E;  1H74 A;  1Z5C A;  4HAC B;  5FWK A;  2IOP A;  2A2D A;  2V34 A;  2AJ4 A;  4YHH I;  4X65 E;  1N34 E;  4P7A A;  1Z0C A;  4K0K E;  4IZJ D;  4DPX A;  3ZZU A;  1H7U A;  4DUY E;  3QT7 A;  4HAC A;  1H73 A;  2A2C A;  3B8H A;  4NXN I;  4LFB E;  4LF9 E;  1A6F A;  3WU6 A;  2UXC I;  2BM0 A;  1MU5 A;  2Z5B A;  1FI4 A;  1FJG E;  2HHH I;  4B3T I;  4FWH A;  4JYA I;  5A2Q C;  2F4V E;  1NHI A;  2X7I A;  4R1F A;  3V5R A;  4DV1 I;  2HK2 A;  2IOQ A;  5GME A;  4GKK E;  4MYU A;  4DV5 E;  1IBK I;  1Z59 A;  2V2V A;  5LL6 R;  4DV6 E;  3T1Y I;  4JI3 I;  2VF3 A;  4KHP E;  4GKJ E;  3LNU A;  1HNZ E;  4DPU A;  1RR9 A;  3LPS A;  1ZXN A;  3ZZT A;  1Z0E A;  4DR2 I;  1KVK A;  5LMU E;  1XNQ I;  3QT8 A;  1FKA E;  4DR6 E;  2E1R A;  2GS8 A;  5IT9 C;  1XMQ I;  1I94 I;  2UUC E;  4DPT A;  4PU9 A;  4USM A;  4DR7 E;  2BV3 A;  4FWG A;  1NHH A;  2E5L E;  4WUD A;  4DPY A;  4JI8 E;  4JI6 I;  4KQV A;  4DR3 E;  4LF6 I;  1NZ0 A;  1OJ4 A;  5A2Q Q;  2XEX A;  1B62 A;  1PIE A;  2VQF I;  4RPF A;  4PRV A;  1K47 A;  4JI1 I;  4PRX A;  4DV4 E;  2EFG A;  4DV2 I;  1D6T A;  1BKN A;  1ZXM A;  1XHK A;  4JI5 E;  4FW9 A;  2VQE E;  4UT4 A;  4NXM I;  2Z5C B;  1XNR I;  4P52 A;  4DV3 E;  2HK3 A;  3P06 A;  1N33 I;  1XNR E;  4X66 E;  3K85 A;  1EI1 A;  4AQY I;  4LFC I;  1IBL E;  2Z5C A;  4DR4 I;  5IT9 Q;  4JI4 E;  4ED4 A;  2ZBK B;  4DU7 A;  3J80 C;  5BR8 I;  1MG7 A;  4B3R E;  1Y4U A;  3QT5 A;  1QZR A;  2UU9 I;  1Y4S A;  2O1U A;  3T1H I;  4JI2 I;  4LF8 E;  1USU A;  2Z5B B;  1Z0B A;  4B3M I;  2O1W A;  3PYG A;  3OTO I;  2Q2E B;  4URL A;  4X62 I;  4DUZ E;  1J5E I;  1EA6 A;  2ZIT A;  4B3S E;  1N32 E;  2WW4 A;  2R42 A;  1ELO A;  1IBM E;  2PNM A;  1U2R A;  4DR1 I;  1N36 I;  3D4J A;  1HNX I;  1HR0 E;  1KTV A;  4YY3 I;  4Z7Y A;  2UUA E;  5IWA I;  1UEK A;  4X64 I;  2BM1 A;  4JV5 I;  1HNW I;  3J80 Q;  4DV7 I;  2UXB E;  4OX9 E;  4X65 I;  1N34 I;  5LMN E;  2PNL A;  4EMD A;  4K0K I;  4DR5 E;  4DUY I;  2ZM6 E;  2V2Q A;  1WUU A;  4USK A;  3V2U C;  3WU4 A;  4LFB I;  1VIS A;  4LF9 I;  1MX0 A;  4DV0 E;  1KIJ A;  4LF4 E;  1FJG I;  1N0V C;  2F4V I;  3K1J A;  1XMO E;  2GQ0 A;  3ZZ0 A;  4LF7 E;  2HKJ A;  3M6A A;  4LF5 E;  1USV A;  2NPF A;  4GKK I;  4JI7 E;  5FLX C;  4ZVI A;  4LFA E;  4DV5 I;  4M1K A;  4N3O A;  3Q1Q A;  4DXL A;  2R3V A;  2UUB E;  4DV6 I;  4JI0 E;  1FWL A;  1ZM9 A;  4GKJ I;  4KHP I;  4DU8 A;  4XTJ A;  2HFU A;  1HNZ I;  2J7K A;  3K17 A;  5LMU I;  2CZ9 A;  4YHH E;  4HY1 A;  4I3H A;  4NXN E;  2O1V A;  4IZJ A;  4DR6 I;  3J81 C;  1PVG A;  1Z5A A;  1RRE A;  2UUC I;  2UXC E;  1Z0W A;  4DR7 I;  1H7S A;  4DV0 I;  2E5L I;  1PKP A;  2HHH E;  4B3T E;  4JYA E;  3LTO A;  4JI8 I;  4DR3 I;  4FN5 A;  2X36 A;  4DV1 E;  1ZM4 A;  3HJC A;  2DEI A;  1HK7 A;  1IBK E;  1ZM3 A;  1Z5B A;  3T1Y E;  5FLX Q;  4JI3 E;  4DV4 I;  3CWV A;  3ZKB A;  4DR2 E;  1N0U A;  4JI5 I;  2VQE I;  1XNQ E;  3JAM C;  1ZM2 A;  2V8P A;  4DV3 I;  1XMQ E;  4X66 I;  1I94 E;  3B78 A;  1IBL I;  3PYF A;  4DPW A;  2HFS A;  3J81 Q;  4JI4 I;  4FWD A;  1S4E A;  2V2Z A;  1NHJ A;  3F0N A;  4JI6 E;  4B3R I;  4LF6 E;  4JG4 A;  4Z7C A;  4IZK B;  2DEJ A;  2OI2 A;  3Q6M A;  3ZKD A;  2VQF E;  4JI1 E;  4LF8 I;  3J7A G;  4HYM A;  4IZK A;  4DV2 E;  3H4L A;  4WUB A;  3J7A M;  5L3J A;  1Y6Z A;  1Z0V A;  4NXM E;  4DUZ I;  2O1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...