2Z5CA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
144
structure length
124
Chain Sequence
KTISRTIESQPTLDVIATLPADKKIPISLVVGFKQESSSSLSCYYYAIPLMRDRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/hydrolase
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 124
sequence length 144
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cA00
2Z5CA 2Z5BA
chains in the Genus database with same CATH superfamily
1P42A 5GMEA 3D4JA 4YHHI 2UXBE 3P06A 5LMNE 2PO0B 3B82A 3F0NA 2BM0A 1Z5BA 2UUBE 3CDJA 3HKMA 1RR9A 4DV3I 4JG4A 1N32E 4QNKA 1J5EI 1HK7A 1KIJA 2IOPA 1N0VC 5EKWA 2VQFI 5C0XA 4DR3I 2JEBB 3L7ZB 4XTJA 3V5RA 5K36A 1FJGI 2EFGA 2NN6C 1USUA 4OO1B 4NXME 4DV2I 4JI3E 1HNZE 1USVA 2JE6A 5FLXC 5JEAC 2GO3A 2HHHE 2PO2B 2PNZA 1ZXNA 4FWGA 3CDIA 3CWVA 4FW3A 2Z5CA 4FWDA 4JYAI 2HK2A 4UTGA 1XMQI 2AE8A 1ZM9A 2UXDE 2UU9I 4OZEA 2O1UA 1Z0EA 2XEXA 5C0XF 3J80C 1IBME 4JI7I 4IFDB 2C39A 5K36F 4GQUA 1XHKA 2UUAE 4MYUA 4HACA 4DV6I 2ZM6I 2C38A 2UUCE 3QT8A 4B3TE 2PNLA 1E3HA 3LPSA 1OYPA 1OYSA 5DNLA 3OTOE 3B4TA 1RHYA 3NZKA 4DV4E 5JEAA 3HULA 4FW6A 4JI4E 5C0XB 1ZM2A 4JI8I 4MU4A 4DR6E 4JV5E 2UXCE 2CG9A 2V8PA 2A2DA 4DU8A 1D6TA 3PYGA 3DD6A 4AIDA 4X64E 2PO0A 4DR4E 4URLA 4LF4E 2WNRB 1UDQA 4DV1E 1N36E 4B3ME 4X62E 3JAMQ 3QT7A 3PYFA 2E5LE 4MU0A 4DPXA 4JI0E 3WU5A 4JI6E 4NXNI 4DPWA 1N33I 1Z0WA 4K0KE 4FW9A 1ZM3A 4JI1I 5JEAF 5DROA 2PO1B 4LF8E 5GMDA 5L3JA 5LMUE 2Z5BA 2C39B 4DV0E 2NN6B 2VESA 4DV7E 1K47A 1FI4A 4BA1B 4HACB 4OO1A 4WUCA 2C38B 5A2QC 1FNMA 1XMOI 2O1VA 3ZM7A 1XNQE 2R42A 1XNRI 2AJ4A 3PYDA 5JEAB 2PO2A 4DPTA 1Y60A 1H7SA 5IT9Q 2HFUA 1ZXMA 2VQEI 3QT5A 3V2UC 4LF6E 1UDNA 3QT6A 2J7KA 4JI5I 4DUYE 4X65I 4B3RE 5FWKA 4LFAI 2V2QA 4P52A 1YH8A 4IFDA 4PU9A 5K36D 3U1YA 4MDTA 4LOMA 1I94E 4DR1I 1IBKE 2X36A 1HNWI 4OO1F 4Z7YA 1FWKA 3J81Q 4LF5E 3PS3A 1N34I 4PRVA 2V2ZA 3M85G 4LF9I 5BR8I 4LFBE 3ZKDA 1OYRA 2Z5BB 4B3SE 1HNXI 2F4VE 1PKPA 1IBLE 4LF7E 1BKNA 4WUBA 3M7NG 4GKKE 2WNRA 4IFDF 3K17A 3K1JA 3Q6MA 3KRNA 1PIEA 4YHHE 2UUAI 1EI1A 1A6FA 3WU6A 4KQVA 4DR5I 2VF3A 4DR2I 1FKAE 4JI2I 1H72C 2IESA 2DEIA 3B78A 4LPFA 3OTOI 4LCFA 4U3BA 1YHCA 5ELWA 1QZRA 2PO1A 4DV3E 2CZ9A 2BM1A 4UT4A 2NN6A 4HY1A 1J5EE 4JV5I 4DU7A 3M85D 4BA1A 2VQFE 1S4EA 4GKJI 2WP8B 4DV5I 4DR3E 1FJGE 4DR4I 3T1YI 1N36I 4B3MI 4IZJB 4FW7A 4IZKA 4FW5A 3UHMA 4AQYE 4DV2E 2V2VA 3GLLA 3M7ND 3HJCA 2LJPA 1B63A 3Q1QA 1S16A 3U1KA 4Z7CA 1MG7A 2V34A 4M1KA 4LFCI 3LTOA 4DUZI 2R3VA 4MYTA 2GS8A 3ZZ0A 2NPFA 2BR2B 1N0UA 3T1HI 2IERA 2NN6F 1XMQE 3P3CA 2GQ0A 4OO1D 1Y4UA 2UU9E 1KVKA 1UDOA 1B62A 4JI7E 4OX9I 3H4LA 5IWAI 1U2RA 3ZKBA 5K36E 4J3DA 5DNXA 4YY3I 4KHPI 4DV6E 2ZM6E 1Y4SA 2BV3A 2CGEA 2Q2EB 4X66I 4DR7E 3H1CA 1HR0I 1ZM4A 4LF6I 4JI8E 2UXBI 1EA6A 5LMNI 4IFDD 1H73A 3Q6NA 5EL9A 2UUBI 4EMDA 4IZKB 1N32I 4MQYA 1H7UA 2A2CA 2HFSA 5A2QQ 5IT9C 2O1TA 1KTVA 3ZZUA 4P7AA 4PRXA 5C0XD 1MU5A 2HK3A 2JEAB 2BA1G 4I3HA 1N33E 1VISA 4USKA 1DARA 2HKJA 2WP8A 4DXLA 2HKEA 3ZZTA 4NXMI 4JI3I 4N3OA 1HNZI 1Z0BA 5K36C 2J65A 1XXEA 4IS9A 4IZJA 3J81C 4ED4A 2HHHI 3GMEA 4NBQA 1XMOE 2PNMA 1XNRE 4QNJA 3M6AA 4FN5A 2UXDI 2VQEE 1NHJA 1IBMI 2C37B 2NN6D 2BR2A 2JT2A 4JI5E 4X65E 2IOQA 4HXZA 4LFAE 2O3ZA 2UUCI 2BA1D 4B3TI 2X7IA 4FWHA 4MU3A 1FWLA 2BA0G 4OKGA 5JEAD 4DV4I 4DR1E 1HNWE 5FLXQ 4OO1E 4JI4I 4U3DA 4AQYI 1NHHA 1H74A 4ISAA 2ZITA 4DR6I 1Z0TA 3K85A 1N34E 2UXCI 4LF9E 5BR8E 1ELOA 4BA2A 1Z59A 4X64I 1HNXE 1VI7A 4LF4I 1R6LA 4DV1I 4X62I 3J80Q 4DPUA 3LNUA 2GO4A 3WU3A 4USMA 1UDSA 2E5LI 4JI0I 4JI6I 4IFDE 4K0KI 2OI2A 4LF8I 4DR5E 4DR2E 2JEAA 4JI2E 4DR7I 4JYAE 5LMUI 2ZBKB 4DV0I 2BA0D 4DV7I 2Z5EA 3P3EA 5DRQA 3WU4A 3GCMA 3PRYA 5DRRA 5C0XE 4HYMA 5K36B 1Y5YA 1XNQI 3JAMC 4FW4A 1R6MA 1Z0VA 4OO1C 4LCHA 4GKJE 4DV5E 3PS1A 4DPYA 3T1YE 2JE6B 3PYEA 3B8HA 1OJ4A 4DUYI 1Z5CA 2PNZB 4BA2B 2WW4A 1Z5AA 1NZ0A 4MU1A 4ZVIA 4B3RI 1KKHA 2C37A 4RPFA 2Z5CB 5LL6R 2O1WA 4LFCE 1I94I 4DUZE 1IBKI 1NHIA 1RREA 5DRPA 2E1RA 2JEBA 1Z0GA 3L7ZA 1Y6ZA 4IFDC 4LF5I 3T1HE 2F1DA 2NN6E 4IZJD 1UEKA 1E3PA 4LFBI 4R1FA 3PS2A 4LCGA 4OX9E 1Z0CA 5IWAE 1MX0A 4NXNE 3P3GA 4B3SI 3GONA 3J7AG 2DEJA 4JI1E 2CVEA 4YY3E 2F4VI 4KHPE 3P76A 5JEAE 4AM3A 3J7AM 1WUUA 4WUDA 4X66E 5C0XC 1IBLI 4LF7I 1PVGA 4AIMA 1HR0E 4GKKI
chains in the Genus database with same CATH topology
5GMEA 3D4JA 4YHHI 2UXBE 3P06A 5LMNE 3B82A 3F0NA 2BM0A 1Z5BA 2UUBE 1RR9A 4DV3I 4JG4A 1N32E 1J5EI 1HK7A 1KIJA 2IOPA 1N0VC 2VQFI 4DR3I 4XTJA 3V5RA 1FJGI 2EFGA 1USUA 4NXME 4DV2I 4JI3E 1HNZE 1USVA 5FLXC 2HHHE 4FWGA 1ZXNA 3CWVA 2Z5CA 4FWDA 4JYAI 2HK2A 4UTGA 1XMQI 1ZM9A 2UXDE 2UU9I 2O1UA 1Z0EA 2XEXA 3J80C 1IBME 4JI7I 1XHKA 2UUAE 4MYUA 4HACA 4DV6I 2ZM6I 2UUCE 3QT8A 4B3TE 2PNLA 3LPSA 3OTOE 4DV4E 3HULA 4JI4E 1ZM2A 4JI8I 4DR6E 4JV5E 2UXCE 2CG9A 2V8PA 2A2DA 4DU8A 1D6TA 3PYGA 4X64E 4DR4E 4URLA 4LF4E 4DV1E 1N36E 4B3ME 4X62E 3JAMQ 3QT7A 3PYFA 2E5LE 4DPXA 4JI0E 3WU5A 4JI6E 4NXNI 4DPWA 1N33I 1Z0WA 4K0KE 4FW9A 1ZM3A 4JI1I 4LF8E 5GMDA 5L3JA 5LMUE 2Z5BA 4DV0E 4DV7E 1K47A 1FI4A 4HACB 4WUCA 5A2QC 1FNMA 1XMOI 2O1VA 3ZM7A 1XNQE 2R42A 1XNRI 2AJ4A 3PYDA 4DPTA 1H7SA 5IT9Q 2HFUA 1ZXMA 2VQEI 3QT5A 3V2UC 4LF6E 3QT6A 2J7KA 4JI5I 4DUYE 4X65I 4B3RE 5FWKA 4LFAI 2V2QA 4P52A 4PU9A 1I94E 4DR1I 1IBKE 2X36A 1HNWI 4Z7YA 1FWKA 3J81Q 4LF5E 1N34I 4PRVA 2V2ZA 4LF9I 5BR8I 4LFBE 3ZKDA 2Z5BB 4B3SE 1HNXI 2F4VE 1PKPA 1IBLE 4LF7E 1BKNA 4WUBA 4GKKE 3K17A 3K1JA 3Q6MA 1PIEA 4YHHE 2UUAI 1EI1A 1A6FA 3WU6A 4KQVA 4DR5I 2VF3A 4DR2I 1FKAE 4JI2I 1H72C 2DEIA 3B78A 3OTOI 1QZRA 4DV3E 2CZ9A 2BM1A 4UT4A 4HY1A 1J5EE 4JV5I 4DU7A 2VQFE 1S4EA 4GKJI 4DV5I 4DR3E 1FJGE 4DR4I 3T1YI 1N36I 4B3MI 4IZJB 4IZKA 4AQYE 4DV2E 2V2VA 3HJCA 2LJPA 1B63A 3Q1QA 1S16A 4Z7CA 1MG7A 2V34A 4M1KA 4LFCI 3LTOA 4DUZI 2R3VA 4MYTA 2GS8A 3ZZ0A 2NPFA 1XMQE 1N0UA 3T1HI 2GQ0A 1Y4UA 2UU9E 1KVKA 1B62A 4JI7E 4OX9I 3H4LA 5IWAI 1U2RA 3ZKBA 4YY3I 4KHPI 4DV6E 2ZM6E 1Y4SA 2BV3A 2CGEA 2Q2EB 4X66I 4DR7E 1HR0I 1ZM4A 4LF6I 4JI8E 2UXBI 1EA6A 5LMNI 1H73A 3Q6NA 2UUBI 4EMDA 4IZKB 1N32I 1H7UA 2A2CA 2HFSA 5A2QQ 5IT9C 2O1TA 1KTVA 3ZZUA 4P7AA 4PRXA 1MU5A 2HK3A 4I3HA 1N33E 1VISA 4USKA 1DARA 2HKJA 4DXLA 2HKEA 3ZZTA 4NXMI 4JI3I 4N3OA 1HNZI 1Z0BA 4IZJA 3J81C 4ED4A 2HHHI 1XMOE 2PNMA 1XNRE 3M6AA 4FN5A 2UXDI 2VQEE 1NHJA 1IBMI 4JI5E 4X65E 2IOQA 4HXZA 4LFAE 2UUCI 4B3TI 2X7IA 4FWHA 1FWLA 4DV4I 4DR1E 1HNWE 5FLXQ 4JI4I 4AQYI 1NHHA 1H74A 2ZITA 4DR6I 1Z0TA 3K85A 1N34E 2UXCI 4LF9E 5BR8E 1ELOA 1Z59A 4X64I 1HNXE 4LF4I 4DV1I 4X62I 3J80Q 4DPUA 3LNUA 3WU3A 4USMA 2E5LI 4JI0I 4JI6I 4K0KI 2OI2A 4LF8I 4DR5E 4DR2E 4JI2E 4DR7I 4JYAE 5LMUI 2ZBKB 4DV0I 4DV7I 2Z5EA 3WU4A 3PRYA 4HYMA 1XNQI 3JAMC 1Z0VA 4GKJE 4DV5E 4DPYA 3T1YE 3PYEA 3B8HA 1OJ4A 4DUYI 1Z5CA 2WW4A 1Z5AA 1NZ0A 4ZVIA 4B3RI 1KKHA 4RPFA 2Z5CB 5LL6R 2O1WA 4LFCE 1I94I 4DUZE 1IBKI 1NHIA 1RREA 2E1RA 1Z0GA 1Y6ZA 4LF5I 3T1HE 4IZJD 1UEKA 4LFBI 4R1FA 4OX9E 1Z0CA 5IWAE 1MX0A 4NXNE 4B3SI 3GONA 3J7AG 2DEJA 4JI1E 4YY3E 2F4VI 4KHPE 3J7AM 1WUUA 4WUDA 4X66E 1IBLI 4LF7I 1PVGA 1HR0E 4GKKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5C A;  2Z5B A; 
#chains in the Genus database with same CATH topology
 1P42 A;  5GME A;  3D4J A;  4YHH I;  2UXB E;  3P06 A;  5LMN E;  2PO0 B;  3B82 A;  3F0N A;  2BM0 A;  1Z5B A;  2UUB E;  3CDJ A;  3HKM A;  1RR9 A;  4DV3 I;  4JG4 A;  1N32 E;  4QNK A;  1J5E I;  1HK7 A;  1KIJ A;  2IOP A;  1N0V C;  5EKW A;  2VQF I;  5C0X A;  4DR3 I;  2JEB B;  3L7Z B;  4XTJ A;  3V5R A;  5K36 A;  1FJG I;  2EFG A;  2NN6 C;  1USU A;  4OO1 B;  4NXM E;  4DV2 I;  4JI3 E;  1HNZ E;  1USV A;  2JE6 A;  5FLX C;  5JEA C;  2GO3 A;  2HHH E;  2PO2 B;  2PNZ A;  1ZXN A;  4FWG A;  3CDI A;  3CWV A;  4FW3 A;  2Z5C A;  4FWD A;  4JYA I;  2HK2 A;  4UTG A;  1XMQ I;  2AE8 A;  1ZM9 A;  2UXD E;  2UU9 I;  4OZE A;  2O1U A;  1Z0E A;  2XEX A;  5C0X F;  3J80 C;  1IBM E;  4JI7 I;  4IFD B;  2C39 A;  5K36 F;  4GQU A;  1XHK A;  2UUA E;  4MYU A;  4HAC A;  4DV6 I;  2ZM6 I;  2C38 A;  2UUC E;  3QT8 A;  4B3T E;  2PNL A;  1E3H A;  3LPS A;  1OYP A;  1OYS A;  5DNL A;  3OTO E;  3B4T A;  1RHY A;  3NZK A;  4DV4 E;  5JEA A;  3HUL A;  4FW6 A;  4JI4 E;  5C0X B;  1ZM2 A;  4JI8 I;  4MU4 A;  4DR6 E;  4JV5 E;  2UXC E;  2CG9 A;  2V8P A;  2A2D A;  4DU8 A;  1D6T A;  3PYG A;  3DD6 A;  4AID A;  4X64 E;  2PO0 A;  4DR4 E;  4URL A;  4LF4 E;  2WNR B;  1UDQ A;  4DV1 E;  1N36 E;  4B3M E;  4X62 E;  3JAM Q;  3QT7 A;  3PYF A;  2E5L E;  4MU0 A;  4DPX A;  4JI0 E;  3WU5 A;  4JI6 E;  4NXN I;  4DPW A;  1N33 I;  1Z0W A;  4K0K E;  4FW9 A;  1ZM3 A;  4JI1 I;  5JEA F;  5DRO A;  2PO1 B;  4LF8 E;  5GMD A;  5L3J A;  5LMU E;  2Z5B A;  2C39 B;  4DV0 E;  2NN6 B;  2VES A;  4DV7 E;  1K47 A;  1FI4 A;  4BA1 B;  4HAC B;  4OO1 A;  4WUC A;  2C38 B;  5A2Q C;  1FNM A;  1XMO I;  2O1V A;  3ZM7 A;  1XNQ E;  2R42 A;  1XNR I;  2AJ4 A;  3PYD A;  5JEA B;  2PO2 A;  4DPT A;  1Y60 A;  1H7S A;  5IT9 Q;  2HFU A;  1ZXM A;  2VQE I;  3QT5 A;  3V2U C;  4LF6 E;  1UDN A;  3QT6 A;  2J7K A;  4JI5 I;  4DUY E;  4X65 I;  4B3R E;  5FWK A;  4LFA I;  2V2Q A;  4P52 A;  1YH8 A;  4IFD A;  4PU9 A;  5K36 D;  3U1Y A;  4MDT A;  4LOM A;  1I94 E;  4DR1 I;  1IBK E;  2X36 A;  1HNW I;  4OO1 F;  4Z7Y A;  1FWK A;  3J81 Q;  4LF5 E;  3PS3 A;  1N34 I;  4PRV A;  2V2Z A;  3M85 G;  4LF9 I;  5BR8 I;  4LFB E;  3ZKD A;  1OYR A;  2Z5B B;  4B3S E;  1HNX I;  2F4V E;  1PKP A;  1IBL E;  4LF7 E;  1BKN A;  4WUB A;  3M7N G;  4GKK E;  2WNR A;  4IFD F;  3K17 A;  3K1J A;  3Q6M A;  3KRN A;  1PIE A;  4YHH E;  2UUA I;  1EI1 A;  1A6F A;  3WU6 A;  4KQV A;  4DR5 I;  2VF3 A;  4DR2 I;  1FKA E;  4JI2 I;  1H72 C;  2IES A;  2DEI A;  3B78 A;  4LPF A;  3OTO I;  4LCF A;  4U3B A;  1YHC A;  5ELW A;  1QZR A;  2PO1 A;  4DV3 E;  2CZ9 A;  2BM1 A;  4UT4 A;  2NN6 A;  4HY1 A;  1J5E E;  4JV5 I;  4DU7 A;  3M85 D;  4BA1 A;  2VQF E;  1S4E A;  4GKJ I;  2WP8 B;  4DV5 I;  4DR3 E;  1FJG E;  4DR4 I;  3T1Y I;  1N36 I;  4B3M I;  4IZJ B;  4FW7 A;  4IZK A;  4FW5 A;  3UHM A;  4AQY E;  4DV2 E;  2V2V A;  3GLL A;  3M7N D;  3HJC A;  2LJP A;  1B63 A;  3Q1Q A;  1S16 A;  3U1K A;  4Z7C A;  1MG7 A;  2V34 A;  4M1K A;  4LFC I;  3LTO A;  4DUZ I;  2R3V A;  4MYT A;  2GS8 A;  3ZZ0 A;  2NPF A;  2BR2 B;  1N0U A;  3T1H I;  2IER A;  2NN6 F;  1XMQ E;  3P3C A;  2GQ0 A;  4OO1 D;  1Y4U A;  2UU9 E;  1KVK A;  1UDO A;  1B62 A;  4JI7 E;  4OX9 I;  3H4L A;  5IWA I;  1U2R A;  3ZKB A;  5K36 E;  4J3D A;  5DNX A;  4YY3 I;  4KHP I;  4DV6 E;  2ZM6 E;  1Y4S A;  2BV3 A;  2CGE A;  2Q2E B;  4X66 I;  4DR7 E;  3H1C A;  1HR0 I;  1ZM4 A;  4LF6 I;  4JI8 E;  2UXB I;  1EA6 A;  5LMN I;  4IFD D;  1H73 A;  3Q6N A;  5EL9 A;  2UUB I;  4EMD A;  4IZK B;  1N32 I;  4MQY A;  1H7U A;  2A2C A;  2HFS A;  5A2Q Q;  5IT9 C;  2O1T A;  1KTV A;  3ZZU A;  4P7A A;  4PRX A;  5C0X D;  1MU5 A;  2HK3 A;  2JEA B;  2BA1 G;  4I3H A;  1N33 E;  1VIS A;  4USK A;  1DAR A;  2HKJ A;  2WP8 A;  4DXL A;  2HKE A;  3ZZT A;  4NXM I;  4JI3 I;  4N3O A;  1HNZ I;  1Z0B A;  5K36 C;  2J65 A;  1XXE A;  4IS9 A;  4IZJ A;  3J81 C;  4ED4 A;  2HHH I;  3GME A;  4NBQ A;  1XMO E;  2PNM A;  1XNR E;  4QNJ A;  3M6A A;  4FN5 A;  2UXD I;  2VQE E;  1NHJ A;  1IBM I;  2C37 B;  2NN6 D;  2BR2 A;  2JT2 A;  4JI5 E;  4X65 E;  2IOQ A;  4HXZ A;  4LFA E;  2O3Z A;  2UUC I;  2BA1 D;  4B3T I;  2X7I A;  4FWH A;  4MU3 A;  1FWL A;  2BA0 G;  4OKG A;  5JEA D;  4DV4 I;  4DR1 E;  1HNW E;  5FLX Q;  4OO1 E;  4JI4 I;  4U3D A;  4AQY I;  1NHH A;  1H74 A;  4ISA A;  2ZIT A;  4DR6 I;  1Z0T A;  3K85 A;  1N34 E;  2UXC I;  4LF9 E;  5BR8 E;  1ELO A;  4BA2 A;  1Z59 A;  4X64 I;  1HNX E;  1VI7 A;  4LF4 I;  1R6L A;  4DV1 I;  4X62 I;  3J80 Q;  4DPU A;  3LNU A;  2GO4 A;  3WU3 A;  4USM A;  1UDS A;  2E5L I;  4JI0 I;  4JI6 I;  4IFD E;  4K0K I;  2OI2 A;  4LF8 I;  4DR5 E;  4DR2 E;  2JEA A;  4JI2 E;  4DR7 I;  4JYA E;  5LMU I;  2ZBK B;  4DV0 I;  2BA0 D;  4DV7 I;  2Z5E A;  3P3E A;  5DRQ A;  3WU4 A;  3GCM A;  3PRY A;  5DRR A;  5C0X E;  4HYM A;  5K36 B;  1Y5Y A;  1XNQ I;  3JAM C;  4FW4 A;  1R6M A;  1Z0V A;  4OO1 C;  4LCH A;  4GKJ E;  4DV5 E;  3PS1 A;  4DPY A;  3T1Y E;  2JE6 B;  3PYE A;  3B8H A;  1OJ4 A;  4DUY I;  1Z5C A;  2PNZ B;  4BA2 B;  2WW4 A;  1Z5A A;  1NZ0 A;  4MU1 A;  4ZVI A;  4B3R I;  1KKH A;  2C37 A;  4RPF A;  2Z5C B;  5LL6 R;  2O1W A;  4LFC E;  1I94 I;  4DUZ E;  1IBK I;  1NHI A;  1RRE A;  5DRP A;  2E1R A;  2JEB A;  1Z0G A;  3L7Z A;  1Y6Z A;  4IFD C;  4LF5 I;  3T1H E;  2F1D A;  2NN6 E;  4IZJ D;  1UEK A;  1E3P A;  4LFB I;  4R1F A;  3PS2 A;  4LCG A;  4OX9 E;  1Z0C A;  5IWA E;  1MX0 A;  4NXN E;  3P3G A;  4B3S I;  3GON A;  3J7A G;  2DEJ A;  4JI1 E;  2CVE A;  4YY3 E;  2F4V I;  4KHP E;  3P76 A;  5JEA E;  4AM3 A;  3J7A M;  1WUU A;  4WUD A;  4X66 E;  5C0X C;  1IBL I;  4LF7 I;  1PVG A;  4AIM A;  1HR0 E;  4GKK I; 
#chains in the Genus database with same CATH homology
 5GME A;  3D4J A;  4YHH I;  2UXB E;  3P06 A;  5LMN E;  3B82 A;  3F0N A;  2BM0 A;  1Z5B A;  2UUB E;  1RR9 A;  4DV3 I;  4JG4 A;  1N32 E;  1J5E I;  1HK7 A;  1KIJ A;  2IOP A;  1N0V C;  2VQF I;  4DR3 I;  4XTJ A;  3V5R A;  1FJG I;  2EFG A;  1USU A;  4NXM E;  4DV2 I;  4JI3 E;  1HNZ E;  1USV A;  5FLX C;  2HHH E;  4FWG A;  1ZXN A;  3CWV A;  2Z5C A;  4FWD A;  4JYA I;  2HK2 A;  4UTG A;  1XMQ I;  1ZM9 A;  2UXD E;  2UU9 I;  2O1U A;  1Z0E A;  2XEX A;  3J80 C;  1IBM E;  4JI7 I;  1XHK A;  2UUA E;  4MYU A;  4HAC A;  4DV6 I;  2ZM6 I;  2UUC E;  3QT8 A;  4B3T E;  2PNL A;  3LPS A;  3OTO E;  4DV4 E;  3HUL A;  4JI4 E;  1ZM2 A;  4JI8 I;  4DR6 E;  4JV5 E;  2UXC E;  2CG9 A;  2V8P A;  2A2D A;  4DU8 A;  1D6T A;  3PYG A;  4X64 E;  4DR4 E;  4URL A;  4LF4 E;  4DV1 E;  1N36 E;  4B3M E;  4X62 E;  3JAM Q;  3QT7 A;  3PYF A;  2E5L E;  4DPX A;  4JI0 E;  3WU5 A;  4JI6 E;  4NXN I;  4DPW A;  1N33 I;  1Z0W A;  4K0K E;  4FW9 A;  1ZM3 A;  4JI1 I;  4LF8 E;  5GMD A;  5L3J A;  5LMU E;  2Z5B A;  4DV0 E;  4DV7 E;  1K47 A;  1FI4 A;  4HAC B;  4WUC A;  5A2Q C;  1FNM A;  1XMO I;  2O1V A;  3ZM7 A;  1XNQ E;  2R42 A;  1XNR I;  2AJ4 A;  3PYD A;  4DPT A;  1H7S A;  5IT9 Q;  2HFU A;  1ZXM A;  2VQE I;  3QT5 A;  3V2U C;  4LF6 E;  3QT6 A;  2J7K A;  4JI5 I;  4DUY E;  4X65 I;  4B3R E;  5FWK A;  4LFA I;  2V2Q A;  4P52 A;  4PU9 A;  1I94 E;  4DR1 I;  1IBK E;  2X36 A;  1HNW I;  4Z7Y A;  1FWK A;  3J81 Q;  4LF5 E;  1N34 I;  4PRV A;  2V2Z A;  4LF9 I;  5BR8 I;  4LFB E;  3ZKD A;  2Z5B B;  4B3S E;  1HNX I;  2F4V E;  1PKP A;  1IBL E;  4LF7 E;  1BKN A;  4WUB A;  4GKK E;  3K17 A;  3K1J A;  3Q6M A;  1PIE A;  4YHH E;  2UUA I;  1EI1 A;  1A6F A;  3WU6 A;  4KQV A;  4DR5 I;  2VF3 A;  4DR2 I;  1FKA E;  4JI2 I;  1H72 C;  2DEI A;  3B78 A;  3OTO I;  1QZR A;  4DV3 E;  2CZ9 A;  2BM1 A;  4UT4 A;  4HY1 A;  1J5E E;  4JV5 I;  4DU7 A;  2VQF E;  1S4E A;  4GKJ I;  4DV5 I;  4DR3 E;  1FJG E;  4DR4 I;  3T1Y I;  1N36 I;  4B3M I;  4IZJ B;  4IZK A;  4AQY E;  4DV2 E;  2V2V A;  3HJC A;  2LJP A;  1B63 A;  3Q1Q A;  1S16 A;  4Z7C A;  1MG7 A;  2V34 A;  4M1K A;  4LFC I;  3LTO A;  4DUZ I;  2R3V A;  4MYT A;  2GS8 A;  3ZZ0 A;  2NPF A;  1XMQ E;  1N0U A;  3T1H I;  2GQ0 A;  1Y4U A;  2UU9 E;  1KVK A;  1B62 A;  4JI7 E;  4OX9 I;  3H4L A;  5IWA I;  1U2R A;  3ZKB A;  4YY3 I;  4KHP I;  4DV6 E;  2ZM6 E;  1Y4S A;  2BV3 A;  2CGE A;  2Q2E B;  4X66 I;  4DR7 E;  1HR0 I;  1ZM4 A;  4LF6 I;  4JI8 E;  2UXB I;  1EA6 A;  5LMN I;  1H73 A;  3Q6N A;  2UUB I;  4EMD A;  4IZK B;  1N32 I;  1H7U A;  2A2C A;  2HFS A;  5A2Q Q;  5IT9 C;  2O1T A;  1KTV A;  3ZZU A;  4P7A A;  4PRX A;  1MU5 A;  2HK3 A;  4I3H A;  1N33 E;  1VIS A;  4USK A;  1DAR A;  2HKJ A;  4DXL A;  2HKE A;  3ZZT A;  4NXM I;  4JI3 I;  4N3O A;  1HNZ I;  1Z0B A;  4IZJ A;  3J81 C;  4ED4 A;  2HHH I;  1XMO E;  2PNM A;  1XNR E;  3M6A A;  4FN5 A;  2UXD I;  2VQE E;  1NHJ A;  1IBM I;  4JI5 E;  4X65 E;  2IOQ A;  4HXZ A;  4LFA E;  2UUC I;  4B3T I;  2X7I A;  4FWH A;  1FWL A;  4DV4 I;  4DR1 E;  1HNW E;  5FLX Q;  4JI4 I;  4AQY I;  1NHH A;  1H74 A;  2ZIT A;  4DR6 I;  1Z0T A;  3K85 A;  1N34 E;  2UXC I;  4LF9 E;  5BR8 E;  1ELO A;  1Z59 A;  4X64 I;  1HNX E;  4LF4 I;  4DV1 I;  4X62 I;  3J80 Q;  4DPU A;  3LNU A;  3WU3 A;  4USM A;  2E5L I;  4JI0 I;  4JI6 I;  4K0K I;  2OI2 A;  4LF8 I;  4DR5 E;  4DR2 E;  4JI2 E;  4DR7 I;  4JYA E;  5LMU I;  2ZBK B;  4DV0 I;  4DV7 I;  2Z5E A;  3WU4 A;  3PRY A;  4HYM A;  1XNQ I;  3JAM C;  1Z0V A;  4GKJ E;  4DV5 E;  4DPY A;  3T1Y E;  3PYE A;  3B8H A;  1OJ4 A;  4DUY I;  1Z5C A;  2WW4 A;  1Z5A A;  1NZ0 A;  4ZVI A;  4B3R I;  1KKH A;  4RPF A;  2Z5C B;  5LL6 R;  2O1W A;  4LFC E;  1I94 I;  4DUZ E;  1IBK I;  1NHI A;  1RRE A;  2E1R A;  1Z0G A;  1Y6Z A;  4LF5 I;  3T1H E;  4IZJ D;  1UEK A;  4LFB I;  4R1F A;  4OX9 E;  1Z0C A;  5IWA E;  1MX0 A;  4NXN E;  4B3S I;  3GON A;  3J7A G;  2DEJ A;  4JI1 E;  4YY3 E;  2F4V I;  4KHP E;  3J7A M;  1WUU A;  4WUD A;  4X66 E;  1IBL I;  4LF7 I;  1PVG A;  1HR0 E;  4GKK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...