2Z5CA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
144
structure length
124
Chain Sequence
b'KTISRTIESQPTLDVIATLPADKKIPISLVVGFKQESSSSLSCYYYAIPLMRDRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/hydrolase
total genus 33
structure length 124
sequence length 144
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cA00
2Z5BA 2Z5CA
chains in the Genus database with same CATH superfamily
3D4JA 1XNQE 4B3SE 5K36A 1HNZE 4B3TI 3QT5A 4AQYE 1KIJA 4K0KI 3PS1A 1FI4A 5JEAA 2UU9I 4DR4I 1FNMA 1ZXMA 2GQ0A 2IOQA 2C37A 4OO1E 5GMEA 3B82A 3PYGA 4X66E 3WU4A 3WU6A 1Z0BA 1IBKI 1Y6ZA 4X64E 4IZJD 5DRPA 3CWVA 3LTOA 2NN6C 1VI7A 4AIDA 1Z0GA 3PS2A 4YY3E 1N33E 2NN6E 2PNZB 1Z0EA 4MYTA 3GONA 4ED4A 1H74A 1XXEA 2PO1A 1Y60A 4U3BA 3KRNA 1RHYA 1N34E 4I3HA 5DNXA 4LF9E 4JI1E 2XEXA 4KHPE 2C39A 2NN6B 3PS3A 4DV2E 5C0XC 2HKEA 4B3MI 1H7UA 5C0XE 3L7ZB 3JAMQ 4USKA 1R6LA 4IZJA 4YHHE 4OO1D 2BV3A 4JYAE 4LPFA 5C0XB 4LF7E 2WP8B 3GCMA 5LMNE 4UTGA 4DXLA 2BA0D 3F0NA 2E5LE 4JI3E 2J65A 3M85D 2C37B 1QZRA 4DR3E 4JI4E 3HKMA 4X65I 4DV0I 4P52A 3M7ND 1U2RA 4FW9A 1UEKA 4BA1B 3M85G 4DR1E 4MU1A 1EA6A 3PRYA 3M7NG 4LF6I 4Z7CA 2HK3A 5DRQA 4DU7A 4FW3A 1XNRI 4DV1E 4IFDC 4LOMA 2VF3A 4IFDE 3OTOE 1E3PA 4OO1A 1HR0I 4LF8E 1FJGI 1UDQA 2VQEE 5A2QQ 2AJ4A 1UDNA 4MQYA 1UDOA 4OX9I 1R6MA 3T1YI 4BA2A 4MU0A 1S4EA 2UXDI 4IFDB 4DV5I 1USUA 5K36F 1H73A 4JI2E 1HNWE 2BM0A 1NZ0A 4JI6E 2JEBA 2F4VI 4FW6A 4LFAE 5JEAF 1FWKA 2R3VA 4JI5I 2UUCI 4NXMI 4JV5I 2JE6B 4IZJB 3L7ZA 2UUAI 4DR6I 4B3TE 2J7KA 4X62E 3QT7A 4DV6I 4K0KE 2A2DA 3ZZUA 1I94E 4DR4E 4HY1A 1MG7A 1J5EI 5C0XA 2R42A 2WP8A 3UHMA 3B8HA 3J7AM 3U1KA 4DR7E 3PYDA 4ZVIA 1HNXI 1Z0CA 1S16A 4IFDD 2CG9A 4LF5I 5IWAE 3U1YA 1IBKE 4OO1C 5BR8I 4DV4I 3K85A 1N0UA 1Z5AA 4HYMA 1KKHA 4HACA 4BA1A 1Z0WA 4FWDA 3DD6A 4DUZE 4JI7E 1NHIA 4OKGA 4PRXA 4OO1B 1IBMI 2GS8A 4LFBI 4B3SI 3JAMC 1VISA 4DR2I 1HNZI 4BA2B 4XTJA 2IOPA 4DV7I 4JI0I 3CDIA 1XMOI 4U3DA 1A6FA 4GQUA 2JEBB 1KTVA 3LPSA 4IFDA 3QT8A 1OYRA 2ZBKB 4X66I 1XMQE 1USVA 2UXCI 3NZKA 1ELOA 1YH8A 3P06A 3V5RA 4FWHA 4WUBA 4JI8E 2JE6A 4DUYE 4NXNE 1MX0A 1B63A 2VQFE 3CDJA 1N34I 4PU9A 4X65E 4JG4A 1N36I 4USMA 1Z5CA 4GKKE 4JI1I 2F1DA 1KVKA 4OO1F 4KHPI 2ZM6I 4DV3I 1B62A 2UXBE 4DV2I 4DPTA 3ZZ0A 5A2QC 3ZKDA 4LCFA 4HACB 3ZZTA 1NHHA 1Z0TA 3HJCA 4DR5E 2HHHI 3T1HE 2V8PA 3J80Q 2NN6F 4WUCA 5FLXQ 2PNLA 1HR0E 2Z5BA 2X36A 1FJGE 1BKNA 1ZM4A 4YHHI 4JYAI 4FN5A 3P3CA 4EMDA 5EL9A 3T1YE 2C38A 4QNJA 2UXDE 4DV5E 1ZM9A 2V2ZA 3J81C 2AE8A 1N0VC 2HK2A 1WUUA 2BA1D 1P42A 2O1WA 2F4VE 2UUBI 2IERA 4GKJE 2BA1G 1DARA 2JEAB 4LFCI 5C0XF 4JI5E 4NXME 4JV5E 1E3HA 2PO0B 1ZM2A 4DR6E 2DEIA 5K36D 4DV6E 5LMUE 1Z5BA 3J81Q 5ELWA 4DV1I 1N32E 3P76A 5IT9Q 1Z0VA 5LL6R 3PYEA 3OTOI 2IESA 4J3DA 2BR2B 2UU9E 1OJ4A 4WUDA 1MU5A 4LF5E 3B4TA 2LJPA 4N3OA 3LNUA 2HFSA 5BR8E 4OZEA 4LF4I 4DPWA 2OI2A 4LCGA 4DPUA 4PRVA 4MYUA 1Y4SA 1HNWI 4LCHA 4B3RI 4JI6I 2WNRA 2CGEA 1IBLI 1ZXNA 2Z5BB 1IBME 4IFDF 1OYSA 3GMEA 4DR2E 4RPFA 2C38B 3WU3A 4X62I 1Z59A 4DV7E 1I94I 4JI0E 3K17A 1FWLA 5L3JA 1XMOE 3Q1QA 1XNQI 4NBQA 3PYFA 4AQYI 2JT2A 4DR7I 5FWKA 1PKPA 3ZM7A 4B3ME 2UXCE 4MU3A 5IWAI 4Z7YA 2PO2B 2WW4A 2JEAA 2PO0A 1XHKA 4X64I 3M6AA 1Y5YA 4FW7A 3QT6A 3GLLA 1RR9A 4DUZI 4FW5A 1FKAE 4JI7I 3J7AG 1N36E 1PVGA 3P3EA 4HXZA 1N33I 4YY3I 3K1JA 2ZM6E 4DV3E 5DRRA 1UDSA 3J80C 5FLXC 2BR2A 4DV0E 4UT4A 2A2CA 1OYPA 4LF9I 2DEJA 3H1CA 4KQVA 5K36C 4QNKA 4IZKB 3P3GA 5K36E 2HHHE 4DPYA 4M1KA 2V34A 5JEAC 4LF6E 2WNRB 2Z5EA 4ISAA 5JEAE 1XMQI 1ZM3A 2Z5CB 2E1RA 1XNRE 4MDTA 1YHCA 2HFUA 1Y4UA 1H7SA 5K36B 3Q6MA 4P7AA 4JI8I 2CZ9A 4DUYI 5EKWA 4NXNI 5JEAB 4OX9E 3H4LA 2O1VA 4MU4A 2VQFI 1HK7A 1NHJA 4LF7I 5LMNI 2UUBE 2BA0G 4AIMA 2NN6D 4LFCE 3HULA 5IT9C 4GKKI 2E5LI 4JI3I 3WU5A 4AM3A 4R1FA 5DNLA 2UXBI 4DR3I 2X7IA 2VESA 4JI4I 2UUCE 4LFBE 4FW4A 4DR1I 5GMDA 4DR5I 2PO2A 2UUAE 1PIEA 3T1HI 3ZKBA 5C0XD 5DROA 2PO1B 1RREA 4FWGA 2PNZA 1J5EE 2NPFA 5JEAD 4DPXA 3B78A 2ZITA 1H72C 2Q2EB 4LF4E 2C39B 1HNXE 4LF8I 2O1UA 2O1TA 2VQEI 1D6TA 2EFGA 4B3RE 2BM1A 2NN6A 4DV4E 1EI1A 4IS9A 4GKJI 1K47A 1IBLE 4IZKA 2GO4A 2V2VA 4JI2I 2PNMA 2GO3A 3V2UC 4LFAI 2V2QA 2O3ZA 2CVEA 3Q6NA 4URLA 2Z5CA 4DU8A 5LMUI 2HKJA 1N32I
chains in the Genus database with same CATH topology
3D4JA 1XNQE 4B3SE 1HNZE 4B3TI 3QT5A 4AQYE 1KIJA 4K0KI 1FI4A 2UU9I 4DR4I 1FNMA 1ZXMA 2GQ0A 2IOQA 5GMEA 3B82A 3PYGA 4X66E 3WU4A 3WU6A 1Z0BA 1IBKI 1Y6ZA 4X64E 4IZJD 3CWVA 3LTOA 1Z0GA 1N33E 4YY3E 1Z0EA 4MYTA 3GONA 4ED4A 1H74A 1N34E 4I3HA 4LF9E 4JI1E 2XEXA 4KHPE 4DV2E 2HKEA 4B3MI 1H7UA 3JAMQ 4USKA 4IZJA 4YHHE 2BV3A 4JYAE 4LF7E 5LMNE 4UTGA 4DXLA 3F0NA 2E5LE 4JI3E 1QZRA 4DR3E 4JI4E 4X65I 4DV0I 4P52A 1U2RA 4FW9A 1UEKA 4DR1E 1EA6A 3PRYA 4LF6I 4Z7CA 2HK3A 4DU7A 1XNRI 4DV1E 2VF3A 3OTOE 1HR0I 4LF8E 1FJGI 2VQEE 5A2QQ 2AJ4A 4OX9I 3T1YI 1S4EA 2UXDI 4DV5I 1USUA 1H73A 4JI2E 1HNWE 2BM0A 1NZ0A 4JI6E 2F4VI 4LFAE 1FWKA 2R3VA 4JI5I 2UUCI 4NXMI 4JV5I 4IZJB 2UUAI 4DR6I 4B3TE 2J7KA 4X62E 3QT7A 4DV6I 4K0KE 2A2DA 3ZZUA 1I94E 4DR4E 4HY1A 1MG7A 1J5EI 2R42A 3B8HA 3J7AM 4DR7E 3PYDA 4ZVIA 1HNXI 1Z0CA 1S16A 2CG9A 4LF5I 5IWAE 1IBKE 5BR8I 4DV4I 3K85A 1N0UA 1Z5AA 4HYMA 1KKHA 4HACA 1Z0WA 4FWDA 4DUZE 4JI7E 1NHIA 4PRXA 1IBMI 2GS8A 4LFBI 4B3SI 3JAMC 1VISA 4DR2I 1HNZI 4XTJA 2IOPA 4DV7I 4JI0I 1XMOI 1A6FA 1KTVA 3LPSA 3QT8A 2ZBKB 4X66I 1XMQE 1USVA 2UXCI 1ELOA 3P06A 3V5RA 4FWHA 4WUBA 4JI8E 4DUYE 4NXNE 1MX0A 1B63A 2VQFE 1N34I 4PU9A 4X65E 4JG4A 1N36I 4USMA 1Z5CA 4GKKE 4JI1I 1KVKA 4KHPI 2ZM6I 4DV3I 1B62A 2UXBE 4DV2I 4DPTA 3ZZ0A 5A2QC 3ZKDA 4HACB 3ZZTA 1NHHA 1Z0TA 3HJCA 4DR5E 2HHHI 3T1HE 2V8PA 3J80Q 5FLXQ 4WUCA 2PNLA 1HR0E 2Z5BA 2X36A 1FJGE 1BKNA 1ZM4A 4YHHI 4JYAI 4FN5A 4EMDA 3T1YE 2UXDE 4DV5E 1ZM9A 2V2ZA 3J81C 1N0VC 2HK2A 1WUUA 2O1WA 2F4VE 2UUBI 4GKJE 1DARA 4LFCI 4JI5E 4NXME 4JV5E 1ZM2A 4DR6E 2DEIA 4DV6E 5LMUE 1Z5BA 3J81Q 4DV1I 1N32E 5IT9Q 1Z0VA 5LL6R 3PYEA 3OTOI 2UU9E 1OJ4A 4WUDA 1MU5A 4LF5E 2LJPA 4N3OA 3LNUA 2HFSA 5BR8E 4LF4I 4DPWA 2OI2A 4DPUA 4PRVA 4MYUA 1Y4SA 1HNWI 4B3RI 4JI6I 2CGEA 1IBLI 1ZXNA 2Z5BB 1IBME 4DR2E 4RPFA 3WU3A 4X62I 1Z59A 4DV7E 1I94I 4JI0E 3K17A 1FWLA 5L3JA 1XMOE 3Q1QA 1XNQI 3PYFA 4AQYI 4DR7I 5FWKA 1PKPA 3ZM7A 4B3ME 2UXCE 5IWAI 4Z7YA 2WW4A 1XHKA 4X64I 3M6AA 3QT6A 4DUZI 1RR9A 1FKAE 4JI7I 3J7AG 1N36E 1PVGA 4HXZA 1N33I 4YY3I 3K1JA 2ZM6E 4DV3E 3J80C 5FLXC 4DV0E 4UT4A 2A2CA 4LF9I 2DEJA 4KQVA 4IZKB 2HHHE 4DPYA 4M1KA 2V34A 4LF6E 2Z5EA 1XMQI 1ZM3A 2Z5CB 2E1RA 1XNRE 2HFUA 1Y4UA 1H7SA 3Q6MA 4P7AA 4JI8I 2CZ9A 4DUYI 4NXNI 4OX9E 3H4LA 2O1VA 2VQFI 1HK7A 1NHJA 4LF7I 5LMNI 2UUBE 4LFCE 3HULA 5IT9C 4GKKI 2E5LI 4JI3I 3WU5A 4R1FA 2UXBI 4DR3I 2X7IA 4JI4I 2UUCE 4LFBE 4DR1I 5GMDA 4DR5I 2UUAE 1PIEA 3T1HI 3ZKBA 1RREA 4FWGA 1J5EE 2NPFA 4DPXA 3B78A 2ZITA 1H72C 2Q2EB 4LF4E 1HNXE 4LF8I 2O1UA 2O1TA 2VQEI 1D6TA 2EFGA 4B3RE 2BM1A 4DV4E 1EI1A 4GKJI 1K47A 1IBLE 4IZKA 2V2VA 4JI2I 2PNMA 3V2UC 4LFAI 2V2QA 3Q6NA 4URLA 2Z5CA 4DU8A 5LMUI 2HKJA 1N32I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B A;  2Z5C A; 
#chains in the Genus database with same CATH topology
 3D4J A;  1XNQ E;  4B3S E;  5K36 A;  1HNZ E;  4B3T I;  3QT5 A;  4AQY E;  1KIJ A;  4K0K I;  3PS1 A;  1FI4 A;  5JEA A;  2UU9 I;  4DR4 I;  1FNM A;  1ZXM A;  2GQ0 A;  2IOQ A;  2C37 A;  4OO1 E;  5GME A;  3B82 A;  3PYG A;  4X66 E;  3WU4 A;  3WU6 A;  1Z0B A;  1IBK I;  1Y6Z A;  4X64 E;  4IZJ D;  5DRP A;  3CWV A;  3LTO A;  2NN6 C;  1VI7 A;  4AID A;  1Z0G A;  3PS2 A;  4YY3 E;  1N33 E;  2NN6 E;  2PNZ B;  1Z0E A;  4MYT A;  3GON A;  4ED4 A;  1H74 A;  1XXE A;  2PO1 A;  1Y60 A;  4U3B A;  3KRN A;  1RHY A;  1N34 E;  4I3H A;  5DNX A;  4LF9 E;  4JI1 E;  2XEX A;  4KHP E;  2C39 A;  2NN6 B;  3PS3 A;  4DV2 E;  5C0X C;  2HKE A;  4B3M I;  1H7U A;  5C0X E;  3L7Z B;  3JAM Q;  4USK A;  1R6L A;  4IZJ A;  4YHH E;  4OO1 D;  2BV3 A;  4JYA E;  4LPF A;  5C0X B;  4LF7 E;  2WP8 B;  3GCM A;  5LMN E;  4UTG A;  4DXL A;  2BA0 D;  3F0N A;  2E5L E;  4JI3 E;  2J65 A;  3M85 D;  2C37 B;  1QZR A;  4DR3 E;  4JI4 E;  3HKM A;  4X65 I;  4DV0 I;  4P52 A;  3M7N D;  1U2R A;  4FW9 A;  1UEK A;  4BA1 B;  3M85 G;  4DR1 E;  4MU1 A;  1EA6 A;  3PRY A;  3M7N G;  4LF6 I;  4Z7C A;  2HK3 A;  5DRQ A;  4DU7 A;  4FW3 A;  1XNR I;  4DV1 E;  4IFD C;  4LOM A;  2VF3 A;  4IFD E;  3OTO E;  1E3P A;  4OO1 A;  1HR0 I;  4LF8 E;  1FJG I;  1UDQ A;  2VQE E;  5A2Q Q;  2AJ4 A;  1UDN A;  4MQY A;  1UDO A;  4OX9 I;  1R6M A;  3T1Y I;  4BA2 A;  4MU0 A;  1S4E A;  2UXD I;  4IFD B;  4DV5 I;  1USU A;  5K36 F;  1H73 A;  4JI2 E;  1HNW E;  2BM0 A;  1NZ0 A;  4JI6 E;  2JEB A;  2F4V I;  4FW6 A;  4LFA E;  5JEA F;  1FWK A;  2R3V A;  4JI5 I;  2UUC I;  4NXM I;  4JV5 I;  2JE6 B;  4IZJ B;  3L7Z A;  2UUA I;  4DR6 I;  4B3T E;  2J7K A;  4X62 E;  3QT7 A;  4DV6 I;  4K0K E;  2A2D A;  3ZZU A;  1I94 E;  4DR4 E;  4HY1 A;  1MG7 A;  1J5E I;  5C0X A;  2R42 A;  2WP8 A;  3UHM A;  3B8H A;  3J7A M;  3U1K A;  4DR7 E;  3PYD A;  4ZVI A;  1HNX I;  1Z0C A;  1S16 A;  4IFD D;  2CG9 A;  4LF5 I;  5IWA E;  3U1Y A;  1IBK E;  4OO1 C;  5BR8 I;  4DV4 I;  3K85 A;  1N0U A;  1Z5A A;  4HYM A;  1KKH A;  4HAC A;  4BA1 A;  1Z0W A;  4FWD A;  3DD6 A;  4DUZ E;  4JI7 E;  1NHI A;  4OKG A;  4PRX A;  4OO1 B;  1IBM I;  2GS8 A;  4LFB I;  4B3S I;  3JAM C;  1VIS A;  4DR2 I;  1HNZ I;  4BA2 B;  4XTJ A;  2IOP A;  4DV7 I;  4JI0 I;  3CDI A;  1XMO I;  4U3D A;  1A6F A;  4GQU A;  2JEB B;  1KTV A;  3LPS A;  4IFD A;  3QT8 A;  1OYR A;  2ZBK B;  4X66 I;  1XMQ E;  1USV A;  2UXC I;  3NZK A;  1ELO A;  1YH8 A;  3P06 A;  3V5R A;  4FWH A;  4WUB A;  4JI8 E;  2JE6 A;  4DUY E;  4NXN E;  1MX0 A;  1B63 A;  2VQF E;  3CDJ A;  1N34 I;  4PU9 A;  4X65 E;  4JG4 A;  1N36 I;  4USM A;  1Z5C A;  4GKK E;  4JI1 I;  2F1D A;  1KVK A;  4OO1 F;  4KHP I;  2ZM6 I;  4DV3 I;  1B62 A;  2UXB E;  4DV2 I;  4DPT A;  3ZZ0 A;  5A2Q C;  3ZKD A;  4LCF A;  4HAC B;  3ZZT A;  1NHH A;  1Z0T A;  3HJC A;  4DR5 E;  2HHH I;  3T1H E;  2V8P A;  3J80 Q;  2NN6 F;  4WUC A;  5FLX Q;  2PNL A;  1HR0 E;  2Z5B A;  2X36 A;  1FJG E;  1BKN A;  1ZM4 A;  4YHH I;  4JYA I;  4FN5 A;  3P3C A;  4EMD A;  5EL9 A;  3T1Y E;  2C38 A;  4QNJ A;  2UXD E;  4DV5 E;  1ZM9 A;  2V2Z A;  3J81 C;  2AE8 A;  1N0V C;  2HK2 A;  1WUU A;  2BA1 D;  1P42 A;  2O1W A;  2F4V E;  2UUB I;  2IER A;  4GKJ E;  2BA1 G;  1DAR A;  2JEA B;  4LFC I;  5C0X F;  4JI5 E;  4NXM E;  4JV5 E;  1E3H A;  2PO0 B;  1ZM2 A;  4DR6 E;  2DEI A;  5K36 D;  4DV6 E;  5LMU E;  1Z5B A;  3J81 Q;  5ELW A;  4DV1 I;  1N32 E;  3P76 A;  5IT9 Q;  1Z0V A;  5LL6 R;  3PYE A;  3OTO I;  2IES A;  4J3D A;  2BR2 B;  2UU9 E;  1OJ4 A;  4WUD A;  1MU5 A;  4LF5 E;  3B4T A;  2LJP A;  4N3O A;  3LNU A;  2HFS A;  5BR8 E;  4OZE A;  4LF4 I;  4DPW A;  2OI2 A;  4LCG A;  4DPU A;  4PRV A;  4MYU A;  1Y4S A;  1HNW I;  4LCH A;  4B3R I;  4JI6 I;  2WNR A;  2CGE A;  1IBL I;  1ZXN A;  2Z5B B;  1IBM E;  4IFD F;  1OYS A;  3GME A;  4DR2 E;  4RPF A;  2C38 B;  3WU3 A;  4X62 I;  1Z59 A;  4DV7 E;  1I94 I;  4JI0 E;  3K17 A;  1FWL A;  5L3J A;  1XMO E;  3Q1Q A;  1XNQ I;  4NBQ A;  3PYF A;  4AQY I;  2JT2 A;  4DR7 I;  5FWK A;  1PKP A;  3ZM7 A;  4B3M E;  2UXC E;  4MU3 A;  5IWA I;  4Z7Y A;  2PO2 B;  2WW4 A;  2JEA A;  2PO0 A;  1XHK A;  4X64 I;  3M6A A;  1Y5Y A;  4FW7 A;  3QT6 A;  3GLL A;  1RR9 A;  4DUZ I;  4FW5 A;  1FKA E;  4JI7 I;  3J7A G;  1N36 E;  1PVG A;  3P3E A;  4HXZ A;  1N33 I;  4YY3 I;  3K1J A;  2ZM6 E;  4DV3 E;  5DRR A;  1UDS A;  3J80 C;  5FLX C;  2BR2 A;  4DV0 E;  4UT4 A;  2A2C A;  1OYP A;  4LF9 I;  2DEJ A;  3H1C A;  4KQV A;  5K36 C;  4QNK A;  4IZK B;  3P3G A;  5K36 E;  2HHH E;  4DPY A;  4M1K A;  2V34 A;  5JEA C;  4LF6 E;  2WNR B;  2Z5E A;  4ISA A;  5JEA E;  1XMQ I;  1ZM3 A;  2Z5C B;  2E1R A;  1XNR E;  4MDT A;  1YHC A;  2HFU A;  1Y4U A;  1H7S A;  5K36 B;  3Q6M A;  4P7A A;  4JI8 I;  2CZ9 A;  4DUY I;  5EKW A;  4NXN I;  5JEA B;  4OX9 E;  3H4L A;  2O1V A;  4MU4 A;  2VQF I;  1HK7 A;  1NHJ A;  4LF7 I;  5LMN I;  2UUB E;  2BA0 G;  4AIM A;  2NN6 D;  4LFC E;  3HUL A;  5IT9 C;  4GKK I;  2E5L I;  4JI3 I;  3WU5 A;  4AM3 A;  4R1F A;  5DNL A;  2UXB I;  4DR3 I;  2X7I A;  2VES A;  4JI4 I;  2UUC E;  4LFB E;  4FW4 A;  4DR1 I;  5GMD A;  4DR5 I;  2PO2 A;  2UUA E;  1PIE A;  3T1H I;  3ZKB A;  5C0X D;  5DRO A;  2PO1 B;  1RRE A;  4FWG A;  2PNZ A;  1J5E E;  2NPF A;  5JEA D;  4DPX A;  3B78 A;  2ZIT A;  1H72 C;  2Q2E B;  4LF4 E;  2C39 B;  1HNX E;  4LF8 I;  2O1U A;  2O1T A;  2VQE I;  1D6T A;  2EFG A;  4B3R E;  2BM1 A;  2NN6 A;  4DV4 E;  1EI1 A;  4IS9 A;  4GKJ I;  1K47 A;  1IBL E;  4IZK A;  2GO4 A;  2V2V A;  4JI2 I;  2PNM A;  2GO3 A;  3V2U C;  4LFA I;  2V2Q A;  2O3Z A;  2CVE A;  3Q6N A;  4URL A;  2Z5C A;  4DU8 A;  5LMU I;  2HKJ A;  1N32 I; 
#chains in the Genus database with same CATH homology
 3D4J A;  1XNQ E;  4B3S E;  1HNZ E;  4B3T I;  3QT5 A;  4AQY E;  1KIJ A;  4K0K I;  1FI4 A;  2UU9 I;  4DR4 I;  1FNM A;  1ZXM A;  2GQ0 A;  2IOQ A;  5GME A;  3B82 A;  3PYG A;  4X66 E;  3WU4 A;  3WU6 A;  1Z0B A;  1IBK I;  1Y6Z A;  4X64 E;  4IZJ D;  3CWV A;  3LTO A;  1Z0G A;  1N33 E;  4YY3 E;  1Z0E A;  4MYT A;  3GON A;  4ED4 A;  1H74 A;  1N34 E;  4I3H A;  4LF9 E;  4JI1 E;  2XEX A;  4KHP E;  4DV2 E;  2HKE A;  4B3M I;  1H7U A;  3JAM Q;  4USK A;  4IZJ A;  4YHH E;  2BV3 A;  4JYA E;  4LF7 E;  5LMN E;  4UTG A;  4DXL A;  3F0N A;  2E5L E;  4JI3 E;  1QZR A;  4DR3 E;  4JI4 E;  4X65 I;  4DV0 I;  4P52 A;  1U2R A;  4FW9 A;  1UEK A;  4DR1 E;  1EA6 A;  3PRY A;  4LF6 I;  4Z7C A;  2HK3 A;  4DU7 A;  1XNR I;  4DV1 E;  2VF3 A;  3OTO E;  1HR0 I;  4LF8 E;  1FJG I;  2VQE E;  5A2Q Q;  2AJ4 A;  4OX9 I;  3T1Y I;  1S4E A;  2UXD I;  4DV5 I;  1USU A;  1H73 A;  4JI2 E;  1HNW E;  2BM0 A;  1NZ0 A;  4JI6 E;  2F4V I;  4LFA E;  1FWK A;  2R3V A;  4JI5 I;  2UUC I;  4NXM I;  4JV5 I;  4IZJ B;  2UUA I;  4DR6 I;  4B3T E;  2J7K A;  4X62 E;  3QT7 A;  4DV6 I;  4K0K E;  2A2D A;  3ZZU A;  1I94 E;  4DR4 E;  4HY1 A;  1MG7 A;  1J5E I;  2R42 A;  3B8H A;  3J7A M;  4DR7 E;  3PYD A;  4ZVI A;  1HNX I;  1Z0C A;  1S16 A;  2CG9 A;  4LF5 I;  5IWA E;  1IBK E;  5BR8 I;  4DV4 I;  3K85 A;  1N0U A;  1Z5A A;  4HYM A;  1KKH A;  4HAC A;  1Z0W A;  4FWD A;  4DUZ E;  4JI7 E;  1NHI A;  4PRX A;  1IBM I;  2GS8 A;  4LFB I;  4B3S I;  3JAM C;  1VIS A;  4DR2 I;  1HNZ I;  4XTJ A;  2IOP A;  4DV7 I;  4JI0 I;  1XMO I;  1A6F A;  1KTV A;  3LPS A;  3QT8 A;  2ZBK B;  4X66 I;  1XMQ E;  1USV A;  2UXC I;  1ELO A;  3P06 A;  3V5R A;  4FWH A;  4WUB A;  4JI8 E;  4DUY E;  4NXN E;  1MX0 A;  1B63 A;  2VQF E;  1N34 I;  4PU9 A;  4X65 E;  4JG4 A;  1N36 I;  4USM A;  1Z5C A;  4GKK E;  4JI1 I;  1KVK A;  4KHP I;  2ZM6 I;  4DV3 I;  1B62 A;  2UXB E;  4DV2 I;  4DPT A;  3ZZ0 A;  5A2Q C;  3ZKD A;  4HAC B;  3ZZT A;  1NHH A;  1Z0T A;  3HJC A;  4DR5 E;  2HHH I;  3T1H E;  2V8P A;  3J80 Q;  5FLX Q;  4WUC A;  2PNL A;  1HR0 E;  2Z5B A;  2X36 A;  1FJG E;  1BKN A;  1ZM4 A;  4YHH I;  4JYA I;  4FN5 A;  4EMD A;  3T1Y E;  2UXD E;  4DV5 E;  1ZM9 A;  2V2Z A;  3J81 C;  1N0V C;  2HK2 A;  1WUU A;  2O1W A;  2F4V E;  2UUB I;  4GKJ E;  1DAR A;  4LFC I;  4JI5 E;  4NXM E;  4JV5 E;  1ZM2 A;  4DR6 E;  2DEI A;  4DV6 E;  5LMU E;  1Z5B A;  3J81 Q;  4DV1 I;  1N32 E;  5IT9 Q;  1Z0V A;  5LL6 R;  3PYE A;  3OTO I;  2UU9 E;  1OJ4 A;  4WUD A;  1MU5 A;  4LF5 E;  2LJP A;  4N3O A;  3LNU A;  2HFS A;  5BR8 E;  4LF4 I;  4DPW A;  2OI2 A;  4DPU A;  4PRV A;  4MYU A;  1Y4S A;  1HNW I;  4B3R I;  4JI6 I;  2CGE A;  1IBL I;  1ZXN A;  2Z5B B;  1IBM E;  4DR2 E;  4RPF A;  3WU3 A;  4X62 I;  1Z59 A;  4DV7 E;  1I94 I;  4JI0 E;  3K17 A;  1FWL A;  5L3J A;  1XMO E;  3Q1Q A;  1XNQ I;  3PYF A;  4AQY I;  4DR7 I;  5FWK A;  1PKP A;  3ZM7 A;  4B3M E;  2UXC E;  5IWA I;  4Z7Y A;  2WW4 A;  1XHK A;  4X64 I;  3M6A A;  3QT6 A;  4DUZ I;  1RR9 A;  1FKA E;  4JI7 I;  3J7A G;  1N36 E;  1PVG A;  4HXZ A;  1N33 I;  4YY3 I;  3K1J A;  2ZM6 E;  4DV3 E;  3J80 C;  5FLX C;  4DV0 E;  4UT4 A;  2A2C A;  4LF9 I;  2DEJ A;  4KQV A;  4IZK B;  2HHH E;  4DPY A;  4M1K A;  2V34 A;  4LF6 E;  2Z5E A;  1XMQ I;  1ZM3 A;  2Z5C B;  2E1R A;  1XNR E;  2HFU A;  1Y4U A;  1H7S A;  3Q6M A;  4P7A A;  4JI8 I;  2CZ9 A;  4DUY I;  4NXN I;  4OX9 E;  3H4L A;  2O1V A;  2VQF I;  1HK7 A;  1NHJ A;  4LF7 I;  5LMN I;  2UUB E;  4LFC E;  3HUL A;  5IT9 C;  4GKK I;  2E5L I;  4JI3 I;  3WU5 A;  4R1F A;  2UXB I;  4DR3 I;  2X7I A;  4JI4 I;  2UUC E;  4LFB E;  4DR1 I;  5GMD A;  4DR5 I;  2UUA E;  1PIE A;  3T1H I;  3ZKB A;  1RRE A;  4FWG A;  1J5E E;  2NPF A;  4DPX A;  3B78 A;  2ZIT A;  1H72 C;  2Q2E B;  4LF4 E;  1HNX E;  4LF8 I;  2O1U A;  2O1T A;  2VQE I;  1D6T A;  2EFG A;  4B3R E;  2BM1 A;  4DV4 E;  1EI1 A;  4GKJ I;  1K47 A;  1IBL E;  4IZK A;  2V2V A;  4JI2 I;  2PNM A;  3V2U C;  4LFA I;  2V2Q A;  3Q6N A;  4URL A;  2Z5C A;  4DU8 A;  5LMU I;  2HKJ A;  1N32 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...