2Z5CA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
144
structure length
124
Chain Sequence
KTISRTIESQPTLDVIATLPADKKIPISLVVGFKQESSSSLSCYYYAIPLMRDRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/hydrolase
molecule keywords Protein YPL144W
total genus 33
structure length 124
sequence length 144
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cA00
2Z5BA 2Z5CA
chains in the Genus database with same CATH superfamily
3J81C 5FWKA 1Y6ZA 2UUBI 1FWLA 4IZJD 4HACA 1FWKA 1OYRA 4URLA 2IESA 5LMUE 3ZZTA 3L7ZA 2PO2A 5GMDA 2PO0A 4LCFA 2WW4A 3J81Q 1R6MA 1Z0WA 1XMOI 1P42A 1HNXI 5K36F 4UTGA 4JI4E 3ZKBA 2V2VA 2BA0D 2JE6A 4YY3I 4OO1D 2ZITA 1XNQE 1FJGI 3PS2A 4JYAE 2XEXA 4JI3I 3B8HA 4P7AA 2VQEI 4DPTA 4DPYA 2J7KA 1USVA 1Z5BA 1I94E 4JI0I 4LFBI 2Z5CA 2J65A 1N36I 3ZZ0A 1N33E 2VESA 4LF9E 4BA1A 2BA1D 2BA1G 5LMNE 5K36E 3P76A 1E3PA 4DPXA 3WU3A 4NBQA 2C37A 4FWDA 2V34A 5C0XD 4HYMA 4BA2B 2C37B 3H4LA 5C0XA 4DV3E 4K0KE 1H73A 2NN6F 1WUUA 1Z5AA 4HXZA 4B3TI 3WU6A 1OYSA 3U1YA 3PS1A 5JEAB 4XTJA 2F4VI 4MU4A 4DR5E 4WUCA 4LF6I 4KQVA 4Z7YA 4NXME 3ZKDA 3PYGA 4JYAI 2X7IA 1H74A 4AIMA 4NXNE 5A2QQ 3NZKA 4OKGA 4JV5I 3WU5A 3M85D 3PYDA 4MQYA 4USKA 4LF5E 4DUYI 1UDOA 1PKPA 1UDQA 1Y4SA 4OZEA 4FN5A 2A2DA 4AM3A 4AIDA 2AE8A 4FW3A 5BR8I 4LF4E 2WNRB 2CZ9A 1XNRI 2GO4A 1B63A 5JEAE 1E3HA 3B78A 2CVEA 2PO1B 1UEKA 1HNWI 5LMNI 4X66I 2Z5BA 4DV7I 2HK3A 2JEAB 3PYEA 2IOPA 4J3DA 1Z0CA 3F0NA 4JI8E 4OO1B 2Z5BB 4JI0E 3K1JA 1K47A 4DV6I 1RR9A 3J7AM 1Z0TA 1R6LA 1XXEA 1U2RA 5C0XB 1KIJA 2JEBB 4KHPE 4AQYE 4BA1B 3U1KA 1XMQE 4DV5I 4FWGA 1IBKE 4R1FA 2HFUA 1MX0A 2O1WA 3H1CA 4DR5I 1MG7A 4JI2I 2C38B 4OX9E 2BA0G 1Z0BA 4X65I 4MU0A 4USMA 4UT4A 4DV2E 4OO1F 4U3DA 2EFGA 4PRVA 3GCMA 1KKHA 4LCHA 4JI6E 2NPFA 1H72C 1RHYA 2CGEA 3J80Q 2C39B 4DR1E 1ZM4A 2UXCI 2E1RA 3P3CA 2IOQA 2JE6B 3OTOI 3CWVA 4NXMI 5C0XE 1MU5A 4DV4I 3QT7A 2BM0A 3PS3A 5JEAC 3PYFA 1YH8A 2BR2A 1VISA 4JI4I 5DNXA 5K36D 5C0XF 5GMEA 1EA6A 2BR2B 5C0XC 3T1YI 4LFAI 1N0VC 3CDJA 1HR0I 4DU8A 4IFDB 2LJPA 4FW5A 4LFCI 5BR8E 5FLXC 3T1YE 1XMQI 2DEJA 4X62I 1PVGA 4I3HA 3K85A 4ZVIA 1Y4UA 1OYPA 1FI4A 3M6AA 5DRPA 4JI5E 4U3BA 2CG9A 3HKMA 5A2QC 2NN6D 2BM1A 4DR1I 4YHHI 1HK7A 2VQFE 4LF6E 5JEAA 2X36A 4LF9I 4LOMA 2HFSA 3QT5A 4IFDE 4B3MI 3Q6NA 4GKKI 1D6TA 4DV4E 1NHJA 4AQYI 2C38A 1H7UA 1J5EE 4ISAA 4DV5E 2UXDE 1FNMA 1ELOA 3M85G 2PNMA 2UU9I 5IT9Q 3GMEA 4K0KI 4MU1A 4B3TE 1UDSA 4B3RE 2WNRA 4JG4A 4DV1I 4DR3E 4BA2A 2OI2A 1NZ0A 4JI6I 3Q1QA 2NN6A 4DXLA 1B62A 2WP8A 3ZZUA 2NN6B 1I94I 3DD6A 4GKJI 2HHHI 5ELWA 5JEAD 1N33I 2F1DA 2R3VA 4NXNI 4DR7I 3HULA 4IZJB 3WU4A 4JI8I 1IBLE 4JI1E 4X62E 1PIEA 2O1TA 4IZKB 4DPWA 1NHIA 3PRYA 1HNWE 1Z0GA 1N0UA 4DUZE 4B3ME 4DR7E 4GKKE 4DV0I 1Z5CA 2UXBI 2ZM6E 2GS8A 1IBLI 5IWAE 4LF7E 1BKNA 4YHHE 2VQFI 2F4VE 1S4EA 3P3EA 5EL9A 2UUCE 3Q6MA 3L7ZB 4IZKA 3P06A 5IWAI 3T1HI 4JV5E 2Q2EB 1OJ4A 1N34E 4IFDF 1ZM9A 1UDNA 4DU7A 3JAMC 4YY3E 2C39A 3J7AG 1A6FA 2HK2A 2VF3A 4DR6E 4PU9A 1IBME 4FW6A 4JI3E 3T1HE 4OO1C 1N32I 3QT8A 5DRQA 3JAMQ 4EMDA 2UXDI 4DR4I 2O3ZA 1USUA 1FJGE 1XNQI 2GQ0A 4LFBE 4FW7A 3M7ND 4GKJE 1HR0E 4FW4A 4DR2I 2HHHE 1N36E 4DR6I 3V2UC 4MYTA 2UUAE 1HNXE 4JI7I 4DUZI 4HY1A 4M1KA 2PO1A 2A2CA 2VQEE 4DV0E 2UXBE 5IT9C 1XHKA 4PRXA 2UXCE 4LCGA 4LF7I 4MDTA 2JEBA 4DV3I 2WP8B 2UUAI 4OO1E 3B82A 4IFDC 4IFDD 1HNZE 4IZJA 1ZM3A 4DPUA 4X64E 4LFCE 2V2ZA 1EI1A 4ED4A 1KVKA 1Y5YA 1Z0EA 4JI1I 5LL6R 1IBKI 1NHHA 3KRNA 4MU3A 4HACB 4MYUA 4X66E 2Z5CB 1Z59A 2AJ4A 2IERA 2GO3A 1KTVA 3D4JA 2UUBE 2PNZB 1IBMI 2R42A 3CDIA 5EKWA 1N32E 1RREA 1Z0VA 5LMUI 4P52A 1QZRA 2UU9E 1FKAE 4LF5I 2V2QA 4DUYE 2JEAA 4B3RI 4FW9A 2PNZA 2HKJA 1XMOE 2PNLA 4DV1E 4DR3I 3M7NG 2UUCI 1DARA 1YHCA 4LPFA 4JI7E 2Z5EA 2PO0B 1J5EI 5DROA 1N34I 4DR4E 2HKEA 4B3SE 4LF8E 4IFDA 3GONA 4DV2I 1H7SA 4DR2E 5K36A 4WUBA 2O1UA 3LNUA 3J80C 1HNZI 4LF4I 5K36B 4X64I 1ZM2A 2O1VA 2BV3A 1XNRE 2NN6C 2E5LI 4B3SI 4LF8I 5FLXQ 4RPFA 3HJCA 4DV6E 4QNJA 3UHMA 3QT6A 5JEAF 4DV7E 4GQUA 2E5LE 4FWHA 1VI7A 4LFAE 2DEIA 3B4TA 3GLLA 4IS9A 4JI2E 4OX9I 1Y60A 2ZBKB 3LPSA 4OO1A 4X65E 5DNLA 3V5RA 1S16A 3P3GA 4KHPI 2ZM6I 3ZM7A 2NN6E 4WUDA 2V8PA 3LTOA 4QNKA 2JT2A 4N3OA 4Z7CA 5K36C 1ZXNA 5DRRA 3K17A 1ZXMA 5L3JA 4JI5I 2PO2B 3OTOE
chains in the Genus database with same CATH topology
3J81C 5FWKA 1Y6ZA 2UUBI 1FWLA 4IZJD 4HACA 1FWKA 4URLA 5LMUE 3ZZTA 5GMDA 3J81Q 2WW4A 1Z0WA 1XMOI 1HNXI 4UTGA 4JI4E 3ZKBA 2V2VA 4YY3I 2ZITA 1XNQE 1FJGI 4JYAE 2XEXA 4JI3I 3B8HA 4P7AA 2VQEI 4DPTA 4DPYA 2J7KA 1USVA 1Z5BA 1I94E 4JI0I 4LFBI 2Z5CA 1N36I 3ZZ0A 1N33E 4LF9E 5LMNE 4DPXA 3WU3A 4FWDA 2V34A 4HYMA 3H4LA 4K0KE 4DV3E 1H73A 1WUUA 1Z5AA 4HXZA 4B3TI 3WU6A 4XTJA 2F4VI 4DR5E 4WUCA 4LF6I 4KQVA 4Z7YA 4NXME 3ZKDA 3PYGA 4JYAI 2X7IA 1H74A 4NXNE 5A2QQ 4JV5I 3WU5A 3PYDA 4USKA 4LF5E 4DUYI 1PKPA 1Y4SA 4FN5A 2A2DA 5BR8I 4LF4E 2CZ9A 1XNRI 1B63A 3B78A 1UEKA 1HNWI 5LMNI 4X66I 2Z5BA 4DV7I 2HK3A 3PYEA 2IOPA 1Z0CA 3F0NA 4JI8E 2Z5BB 4JI0E 3K1JA 1K47A 4DV6I 1RR9A 3J7AM 1Z0TA 1U2RA 1KIJA 4KHPE 4AQYE 1XMQE 4DV5I 4FWGA 1IBKE 4R1FA 2HFUA 1MX0A 2O1WA 4DR5I 1MG7A 4JI2I 4OX9E 1Z0BA 4X65I 4USMA 4UT4A 4DV2E 2EFGA 4PRVA 1KKHA 4JI6E 2NPFA 1H72C 2CGEA 3J80Q 4DR1E 1ZM4A 2UXCI 2E1RA 2IOQA 3OTOI 3CWVA 4NXMI 1MU5A 4DV4I 3QT7A 2BM0A 3PYFA 1VISA 4JI4I 5GMEA 1EA6A 3T1YI 4LFAI 1N0VC 1HR0I 4DU8A 2LJPA 4LFCI 5BR8E 5FLXC 3T1YE 1XMQI 2DEJA 4X62I 1PVGA 4I3HA 3K85A 4ZVIA 1Y4UA 1FI4A 3M6AA 4JI5E 2CG9A 5A2QC 2BM1A 4DR1I 4YHHI 1HK7A 2VQFE 4LF6E 2X36A 4LF9I 2HFSA 3QT5A 4B3MI 3Q6NA 4GKKI 1D6TA 4DV4E 1NHJA 4AQYI 1H7UA 1J5EE 4DV5E 2UXDE 1FNMA 1ELOA 2PNMA 2UU9I 5IT9Q 4K0KI 4B3TE 4B3RE 4JG4A 4DV1I 4DR3E 2OI2A 1NZ0A 4JI6I 3Q1QA 4DXLA 1B62A 3ZZUA 1I94I 4GKJI 2HHHI 1N33I 2R3VA 4NXNI 4DR7I 3HULA 4IZJB 3WU4A 4JI8I 1IBLE 4JI1E 4X62E 1PIEA 2O1TA 4IZKB 4DPWA 1NHIA 3PRYA 1HNWE 1Z0GA 1N0UA 4DUZE 4B3ME 4DR7E 4GKKE 4DV0I 1Z5CA 2UXBI 2ZM6E 2GS8A 1IBLI 5IWAE 4LF7E 1BKNA 4YHHE 2VQFI 2F4VE 1S4EA 2UUCE 3Q6MA 4IZKA 3P06A 5IWAI 3T1HI 4JV5E 2Q2EB 1OJ4A 1N34E 1ZM9A 4DU7A 3JAMC 4YY3E 3J7AG 1A6FA 2HK2A 2VF3A 4DR6E 4PU9A 1IBME 4JI3E 3T1HE 1N32I 3QT8A 3JAMQ 4EMDA 2UXDI 4DR4I 1USUA 1FJGE 1XNQI 2GQ0A 4LFBE 4GKJE 1HR0E 4DR2I 2HHHE 1N36E 4DR6I 3V2UC 4MYTA 2UUAE 1HNXE 4JI7I 4DUZI 4HY1A 4M1KA 2A2CA 2VQEE 4DV0E 2UXBE 5IT9C 1XHKA 4PRXA 2UXCE 4LF7I 4DV3I 2UUAI 3B82A 1HNZE 4IZJA 1ZM3A 4DPUA 4X64E 4LFCE 2V2ZA 1EI1A 4ED4A 1KVKA 1Z0EA 4JI1I 5LL6R 1IBKI 1NHHA 4HACB 4MYUA 4X66E 2Z5CB 1Z59A 2AJ4A 3D4JA 2UUBE 1KTVA 1IBMI 2R42A 1N32E 1RREA 1Z0VA 5LMUI 4P52A 1QZRA 2UU9E 1FKAE 4LF5I 2V2QA 4DUYE 4B3RI 4FW9A 2HKJA 1XMOE 2PNLA 4DV1E 4DR3I 2UUCI 1DARA 4JI7E 2Z5EA 1J5EI 1N34I 4DR4E 2HKEA 4B3SE 4LF8E 3GONA 4DV2I 1H7SA 4DR2E 4WUBA 2O1UA 3LNUA 3J80C 1HNZI 4LF4I 4X64I 1ZM2A 2O1VA 2BV3A 1XNRE 2E5LI 4B3SI 4LF8I 5FLXQ 4RPFA 3HJCA 4DV6E 3QT6A 4DV7E 2E5LE 4FWHA 4LFAE 2DEIA 4JI2E 4OX9I 2ZBKB 3LPSA 4X65E 3V5RA 1S16A 4KHPI 2ZM6I 3ZM7A 4WUDA 2V8PA 3LTOA 4N3OA 4Z7CA 1ZXNA 3K17A 1ZXMA 5L3JA 4JI5I 3OTOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B A;  2Z5C A; 
#chains in the Genus database with same CATH topology
 3J81 C;  5FWK A;  1Y6Z A;  2UUB I;  1FWL A;  4IZJ D;  4HAC A;  1FWK A;  1OYR A;  4URL A;  2IES A;  5LMU E;  3ZZT A;  3L7Z A;  2PO2 A;  5GMD A;  2PO0 A;  4LCF A;  2WW4 A;  3J81 Q;  1R6M A;  1Z0W A;  1XMO I;  1P42 A;  1HNX I;  5K36 F;  4UTG A;  4JI4 E;  3ZKB A;  2V2V A;  2BA0 D;  2JE6 A;  4YY3 I;  4OO1 D;  2ZIT A;  1XNQ E;  1FJG I;  3PS2 A;  4JYA E;  2XEX A;  4JI3 I;  3B8H A;  4P7A A;  2VQE I;  4DPT A;  4DPY A;  2J7K A;  1USV A;  1Z5B A;  1I94 E;  4JI0 I;  4LFB I;  2Z5C A;  2J65 A;  1N36 I;  3ZZ0 A;  1N33 E;  2VES A;  4LF9 E;  4BA1 A;  2BA1 D;  2BA1 G;  5LMN E;  5K36 E;  3P76 A;  1E3P A;  4DPX A;  3WU3 A;  4NBQ A;  2C37 A;  4FWD A;  2V34 A;  5C0X D;  4HYM A;  4BA2 B;  2C37 B;  3H4L A;  5C0X A;  4DV3 E;  4K0K E;  1H73 A;  2NN6 F;  1WUU A;  1Z5A A;  4HXZ A;  4B3T I;  3WU6 A;  1OYS A;  3U1Y A;  3PS1 A;  5JEA B;  4XTJ A;  2F4V I;  4MU4 A;  4DR5 E;  4WUC A;  4LF6 I;  4KQV A;  4Z7Y A;  4NXM E;  3ZKD A;  3PYG A;  4JYA I;  2X7I A;  1H74 A;  4AIM A;  4NXN E;  5A2Q Q;  3NZK A;  4OKG A;  4JV5 I;  3WU5 A;  3M85 D;  3PYD A;  4MQY A;  4USK A;  4LF5 E;  4DUY I;  1UDO A;  1PKP A;  1UDQ A;  1Y4S A;  4OZE A;  4FN5 A;  2A2D A;  4AM3 A;  4AID A;  2AE8 A;  4FW3 A;  5BR8 I;  4LF4 E;  2WNR B;  2CZ9 A;  1XNR I;  2GO4 A;  1B63 A;  5JEA E;  1E3H A;  3B78 A;  2CVE A;  2PO1 B;  1UEK A;  1HNW I;  5LMN I;  4X66 I;  2Z5B A;  4DV7 I;  2HK3 A;  2JEA B;  3PYE A;  2IOP A;  4J3D A;  1Z0C A;  3F0N A;  4JI8 E;  4OO1 B;  2Z5B B;  4JI0 E;  3K1J A;  1K47 A;  4DV6 I;  1RR9 A;  3J7A M;  1Z0T A;  1R6L A;  1XXE A;  1U2R A;  5C0X B;  1KIJ A;  2JEB B;  4KHP E;  4AQY E;  4BA1 B;  3U1K A;  1XMQ E;  4DV5 I;  4FWG A;  1IBK E;  4R1F A;  2HFU A;  1MX0 A;  2O1W A;  3H1C A;  4DR5 I;  1MG7 A;  4JI2 I;  2C38 B;  4OX9 E;  2BA0 G;  1Z0B A;  4X65 I;  4MU0 A;  4USM A;  4UT4 A;  4DV2 E;  4OO1 F;  4U3D A;  2EFG A;  4PRV A;  3GCM A;  1KKH A;  4LCH A;  4JI6 E;  2NPF A;  1H72 C;  1RHY A;  2CGE A;  3J80 Q;  2C39 B;  4DR1 E;  1ZM4 A;  2UXC I;  2E1R A;  3P3C A;  2IOQ A;  2JE6 B;  3OTO I;  3CWV A;  4NXM I;  5C0X E;  1MU5 A;  4DV4 I;  3QT7 A;  2BM0 A;  3PS3 A;  5JEA C;  3PYF A;  1YH8 A;  2BR2 A;  1VIS A;  4JI4 I;  5DNX A;  5K36 D;  5C0X F;  5GME A;  1EA6 A;  2BR2 B;  5C0X C;  3T1Y I;  4LFA I;  1N0V C;  3CDJ A;  1HR0 I;  4DU8 A;  4IFD B;  2LJP A;  4FW5 A;  4LFC I;  5BR8 E;  5FLX C;  3T1Y E;  1XMQ I;  2DEJ A;  4X62 I;  1PVG A;  4I3H A;  3K85 A;  4ZVI A;  1Y4U A;  1OYP A;  1FI4 A;  3M6A A;  5DRP A;  4JI5 E;  4U3B A;  2CG9 A;  3HKM A;  5A2Q C;  2NN6 D;  2BM1 A;  4DR1 I;  4YHH I;  1HK7 A;  2VQF E;  4LF6 E;  5JEA A;  2X36 A;  4LF9 I;  4LOM A;  2HFS A;  3QT5 A;  4IFD E;  4B3M I;  3Q6N A;  4GKK I;  1D6T A;  4DV4 E;  1NHJ A;  4AQY I;  2C38 A;  1H7U A;  1J5E E;  4ISA A;  4DV5 E;  2UXD E;  1FNM A;  1ELO A;  3M85 G;  2PNM A;  2UU9 I;  5IT9 Q;  3GME A;  4K0K I;  4MU1 A;  4B3T E;  1UDS A;  4B3R E;  2WNR A;  4JG4 A;  4DV1 I;  4DR3 E;  4BA2 A;  2OI2 A;  1NZ0 A;  4JI6 I;  3Q1Q A;  2NN6 A;  4DXL A;  1B62 A;  2WP8 A;  3ZZU A;  2NN6 B;  1I94 I;  3DD6 A;  4GKJ I;  2HHH I;  5ELW A;  5JEA D;  1N33 I;  2F1D A;  2R3V A;  4NXN I;  4DR7 I;  3HUL A;  4IZJ B;  3WU4 A;  4JI8 I;  1IBL E;  4JI1 E;  4X62 E;  1PIE A;  2O1T A;  4IZK B;  4DPW A;  1NHI A;  3PRY A;  1HNW E;  1Z0G A;  1N0U A;  4DUZ E;  4B3M E;  4DR7 E;  4GKK E;  4DV0 I;  1Z5C A;  2UXB I;  2ZM6 E;  2GS8 A;  1IBL I;  5IWA E;  4LF7 E;  1BKN A;  4YHH E;  2VQF I;  2F4V E;  1S4E A;  3P3E A;  5EL9 A;  2UUC E;  3Q6M A;  3L7Z B;  4IZK A;  3P06 A;  5IWA I;  3T1H I;  4JV5 E;  2Q2E B;  1OJ4 A;  1N34 E;  4IFD F;  1ZM9 A;  1UDN A;  4DU7 A;  3JAM C;  4YY3 E;  2C39 A;  3J7A G;  1A6F A;  2HK2 A;  2VF3 A;  4DR6 E;  4PU9 A;  1IBM E;  4FW6 A;  4JI3 E;  3T1H E;  4OO1 C;  1N32 I;  3QT8 A;  5DRQ A;  3JAM Q;  4EMD A;  2UXD I;  4DR4 I;  2O3Z A;  1USU A;  1FJG E;  1XNQ I;  2GQ0 A;  4LFB E;  4FW7 A;  3M7N D;  4GKJ E;  1HR0 E;  4FW4 A;  4DR2 I;  2HHH E;  1N36 E;  4DR6 I;  3V2U C;  4MYT A;  2UUA E;  1HNX E;  4JI7 I;  4DUZ I;  4HY1 A;  4M1K A;  2PO1 A;  2A2C A;  2VQE E;  4DV0 E;  2UXB E;  5IT9 C;  1XHK A;  4PRX A;  2UXC E;  4LCG A;  4LF7 I;  4MDT A;  2JEB A;  4DV3 I;  2WP8 B;  2UUA I;  4OO1 E;  3B82 A;  4IFD C;  4IFD D;  1HNZ E;  4IZJ A;  1ZM3 A;  4DPU A;  4X64 E;  4LFC E;  2V2Z A;  1EI1 A;  4ED4 A;  1KVK A;  1Y5Y A;  1Z0E A;  4JI1 I;  5LL6 R;  1IBK I;  1NHH A;  3KRN A;  4MU3 A;  4HAC B;  4MYU A;  4X66 E;  2Z5C B;  1Z59 A;  2AJ4 A;  2IER A;  2GO3 A;  1KTV A;  3D4J A;  2UUB E;  2PNZ B;  1IBM I;  2R42 A;  3CDI A;  5EKW A;  1N32 E;  1RRE A;  1Z0V A;  5LMU I;  4P52 A;  1QZR A;  2UU9 E;  1FKA E;  4LF5 I;  2V2Q A;  4DUY E;  2JEA A;  4B3R I;  4FW9 A;  2PNZ A;  2HKJ A;  1XMO E;  2PNL A;  4DV1 E;  4DR3 I;  3M7N G;  2UUC I;  1DAR A;  1YHC A;  4LPF A;  4JI7 E;  2Z5E A;  2PO0 B;  1J5E I;  5DRO A;  1N34 I;  4DR4 E;  2HKE A;  4B3S E;  4LF8 E;  4IFD A;  3GON A;  4DV2 I;  1H7S A;  4DR2 E;  5K36 A;  4WUB A;  2O1U A;  3LNU A;  3J80 C;  1HNZ I;  4LF4 I;  5K36 B;  4X64 I;  1ZM2 A;  2O1V A;  2BV3 A;  1XNR E;  2NN6 C;  2E5L I;  4B3S I;  4LF8 I;  5FLX Q;  4RPF A;  3HJC A;  4DV6 E;  4QNJ A;  3UHM A;  3QT6 A;  5JEA F;  4DV7 E;  4GQU A;  2E5L E;  4FWH A;  1VI7 A;  4LFA E;  2DEI A;  3B4T A;  3GLL A;  4IS9 A;  4JI2 E;  4OX9 I;  1Y60 A;  2ZBK B;  3LPS A;  4OO1 A;  4X65 E;  5DNL A;  3V5R A;  1S16 A;  3P3G A;  4KHP I;  2ZM6 I;  3ZM7 A;  2NN6 E;  4WUD A;  2V8P A;  3LTO A;  4QNK A;  2JT2 A;  4N3O A;  4Z7C A;  5K36 C;  1ZXN A;  5DRR A;  3K17 A;  1ZXM A;  5L3J A;  4JI5 I;  2PO2 B;  3OTO E; 
#chains in the Genus database with same CATH homology
 3J81 C;  5FWK A;  1Y6Z A;  2UUB I;  1FWL A;  4IZJ D;  4HAC A;  1FWK A;  4URL A;  5LMU E;  3ZZT A;  5GMD A;  3J81 Q;  2WW4 A;  1Z0W A;  1XMO I;  1HNX I;  4UTG A;  4JI4 E;  3ZKB A;  2V2V A;  4YY3 I;  2ZIT A;  1XNQ E;  1FJG I;  4JYA E;  2XEX A;  4JI3 I;  3B8H A;  4P7A A;  2VQE I;  4DPT A;  4DPY A;  2J7K A;  1USV A;  1Z5B A;  1I94 E;  4JI0 I;  4LFB I;  2Z5C A;  1N36 I;  3ZZ0 A;  1N33 E;  4LF9 E;  5LMN E;  4DPX A;  3WU3 A;  4FWD A;  2V34 A;  4HYM A;  3H4L A;  4K0K E;  4DV3 E;  1H73 A;  1WUU A;  1Z5A A;  4HXZ A;  4B3T I;  3WU6 A;  4XTJ A;  2F4V I;  4DR5 E;  4WUC A;  4LF6 I;  4KQV A;  4Z7Y A;  4NXM E;  3ZKD A;  3PYG A;  4JYA I;  2X7I A;  1H74 A;  4NXN E;  5A2Q Q;  4JV5 I;  3WU5 A;  3PYD A;  4USK A;  4LF5 E;  4DUY I;  1PKP A;  1Y4S A;  4FN5 A;  2A2D A;  5BR8 I;  4LF4 E;  2CZ9 A;  1XNR I;  1B63 A;  3B78 A;  1UEK A;  1HNW I;  5LMN I;  4X66 I;  2Z5B A;  4DV7 I;  2HK3 A;  3PYE A;  2IOP A;  1Z0C A;  3F0N A;  4JI8 E;  2Z5B B;  4JI0 E;  3K1J A;  1K47 A;  4DV6 I;  1RR9 A;  3J7A M;  1Z0T A;  1U2R A;  1KIJ A;  4KHP E;  4AQY E;  1XMQ E;  4DV5 I;  4FWG A;  1IBK E;  4R1F A;  2HFU A;  1MX0 A;  2O1W A;  4DR5 I;  1MG7 A;  4JI2 I;  4OX9 E;  1Z0B A;  4X65 I;  4USM A;  4UT4 A;  4DV2 E;  2EFG A;  4PRV A;  1KKH A;  4JI6 E;  2NPF A;  1H72 C;  2CGE A;  3J80 Q;  4DR1 E;  1ZM4 A;  2UXC I;  2E1R A;  2IOQ A;  3OTO I;  3CWV A;  4NXM I;  1MU5 A;  4DV4 I;  3QT7 A;  2BM0 A;  3PYF A;  1VIS A;  4JI4 I;  5GME A;  1EA6 A;  3T1Y I;  4LFA I;  1N0V C;  1HR0 I;  4DU8 A;  2LJP A;  4LFC I;  5BR8 E;  5FLX C;  3T1Y E;  1XMQ I;  2DEJ A;  4X62 I;  1PVG A;  4I3H A;  3K85 A;  4ZVI A;  1Y4U A;  1FI4 A;  3M6A A;  4JI5 E;  2CG9 A;  5A2Q C;  2BM1 A;  4DR1 I;  4YHH I;  1HK7 A;  2VQF E;  4LF6 E;  2X36 A;  4LF9 I;  2HFS A;  3QT5 A;  4B3M I;  3Q6N A;  4GKK I;  1D6T A;  4DV4 E;  1NHJ A;  4AQY I;  1H7U A;  1J5E E;  4DV5 E;  2UXD E;  1FNM A;  1ELO A;  2PNM A;  2UU9 I;  5IT9 Q;  4K0K I;  4B3T E;  4B3R E;  4JG4 A;  4DV1 I;  4DR3 E;  2OI2 A;  1NZ0 A;  4JI6 I;  3Q1Q A;  4DXL A;  1B62 A;  3ZZU A;  1I94 I;  4GKJ I;  2HHH I;  1N33 I;  2R3V A;  4NXN I;  4DR7 I;  3HUL A;  4IZJ B;  3WU4 A;  4JI8 I;  1IBL E;  4JI1 E;  4X62 E;  1PIE A;  2O1T A;  4IZK B;  4DPW A;  1NHI A;  3PRY A;  1HNW E;  1Z0G A;  1N0U A;  4DUZ E;  4B3M E;  4DR7 E;  4GKK E;  4DV0 I;  1Z5C A;  2UXB I;  2ZM6 E;  2GS8 A;  1IBL I;  5IWA E;  4LF7 E;  1BKN A;  4YHH E;  2VQF I;  2F4V E;  1S4E A;  2UUC E;  3Q6M A;  4IZK A;  3P06 A;  5IWA I;  3T1H I;  4JV5 E;  2Q2E B;  1OJ4 A;  1N34 E;  1ZM9 A;  4DU7 A;  3JAM C;  4YY3 E;  3J7A G;  1A6F A;  2HK2 A;  2VF3 A;  4DR6 E;  4PU9 A;  1IBM E;  4JI3 E;  3T1H E;  1N32 I;  3QT8 A;  3JAM Q;  4EMD A;  2UXD I;  4DR4 I;  1USU A;  1FJG E;  1XNQ I;  2GQ0 A;  4LFB E;  4GKJ E;  1HR0 E;  4DR2 I;  2HHH E;  1N36 E;  4DR6 I;  3V2U C;  4MYT A;  2UUA E;  1HNX E;  4JI7 I;  4DUZ I;  4HY1 A;  4M1K A;  2A2C A;  2VQE E;  4DV0 E;  2UXB E;  5IT9 C;  1XHK A;  4PRX A;  2UXC E;  4LF7 I;  4DV3 I;  2UUA I;  3B82 A;  1HNZ E;  4IZJ A;  1ZM3 A;  4DPU A;  4X64 E;  4LFC E;  2V2Z A;  1EI1 A;  4ED4 A;  1KVK A;  1Z0E A;  4JI1 I;  5LL6 R;  1IBK I;  1NHH A;  4HAC B;  4MYU A;  4X66 E;  2Z5C B;  1Z59 A;  2AJ4 A;  3D4J A;  2UUB E;  1KTV A;  1IBM I;  2R42 A;  1N32 E;  1RRE A;  1Z0V A;  5LMU I;  4P52 A;  1QZR A;  2UU9 E;  1FKA E;  4LF5 I;  2V2Q A;  4DUY E;  4B3R I;  4FW9 A;  2HKJ A;  1XMO E;  2PNL A;  4DV1 E;  4DR3 I;  2UUC I;  1DAR A;  4JI7 E;  2Z5E A;  1J5E I;  1N34 I;  4DR4 E;  2HKE A;  4B3S E;  4LF8 E;  3GON A;  4DV2 I;  1H7S A;  4DR2 E;  4WUB A;  2O1U A;  3LNU A;  3J80 C;  1HNZ I;  4LF4 I;  4X64 I;  1ZM2 A;  2O1V A;  2BV3 A;  1XNR E;  2E5L I;  4B3S I;  4LF8 I;  5FLX Q;  4RPF A;  3HJC A;  4DV6 E;  3QT6 A;  4DV7 E;  2E5L E;  4FWH A;  4LFA E;  2DEI A;  4JI2 E;  4OX9 I;  2ZBK B;  3LPS A;  4X65 E;  3V5R A;  1S16 A;  4KHP I;  2ZM6 I;  3ZM7 A;  4WUD A;  2V8P A;  3LTO A;  4N3O A;  4Z7C A;  1ZXN A;  3K17 A;  1ZXM A;  5L3J A;  4JI5 I;  3OTO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...