2Z5CA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
144
structure length
124
Chain Sequence
KTISRTIESQPTLDVIATLPADKKIPISLVVGFKQESSSSLSCYYYAIPLMRDRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/hydrolase
total genus 33
structure length 124
sequence length 144
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cA00
2Z5CA 2Z5BA
chains in the Genus database with same CATH superfamily
4LF6E 4LFBE 4MU3A 5LMUE 4DR5E 4MU1A 1HNZE 3P06A 2UXDI 1Y6ZA 5IT9C 5EKWA 3GONA 2IOQA 1XNRE 2GQ0A 2Z5EA 3UHMA 1OYRA 5GMEA 4OO1F 4U3BA 1ELOA 2VQFE 4HACB 4X62I 4MYUA 4IZJD 4FW9A 4ED4A 2IERA 2E1RA 4EMDA 4BA1A 4B3SI 3Q6MA 4OO1E 1PKPA 4USKA 3ZZUA 1XNQE 2E5LE 4NBQA 2PNLA 4YHHI 2A2CA 4M1KA 4B3TE 4MYTA 4ZVIA 1D6TA 4JI7I 5K36F 4DR7I 4LF9I 1N0VC 4RPFA 2C37B 2BR2B 4OKGA 4NXNI 4FWHA 1HK7A 5K36E 2NN6A 3PYEA 4P52A 5FWKA 4JI4E 1E3PA 4DV0E 2V34A 1XMOI 4KHPE 3F0NA 3CDJA 4DV2I 1IBKE 2NPFA 2UXBE 4X65I 4DR2I 2BM0A 4JI6E 2AJ4A 1OJ4A 2DEJA 2VQEE 2CVEA 4JI5I 4LOMA 2OI2A 1USVA 4IFDD 2J65A 1Z5BA 3LPSA 4DV6I 2PO0A 1B63A 1ZM4A 3K1JA 4JI2I 1J5EE 3B4TA 4IZJA 3WU3A 1NHIA 4LF8I 4DUYE 3GCMA 1Z0BA 3B82A 3PYFA 4DUZI 1MU5A 4DR3E 4JYAE 2UUAE 3H4LA 4U3DA 3CDIA 4X64I 4PRVA 2Q2EB 2BA0G 4JI3E 4K0KI 4FW5A 3M6AA 5IWAE 5BR8I 4OO1D 4JI0I 1MG7A 4WUCA 4LCFA 2JE6B 3OTOI 5C0XE 1H72C 1Z0GA 4AQYE 1HNWI 1IBMI 4DV4I 5JEAE 4B3ME 1Z5AA 1UDNA 2F4VE 2V2VA 1Z0TA 4IZKB 5K36D 2IESA 2J7KA 1VI7A 2O1UA 2UXCE 3K17A 4IFDA 2BA0D 4DV7I 1ZXNA 4USMA 1ZM3A 2CGEA 1U2RA 1EA6A 3B8HA 1KVKA 4X66I 2GO3A 1OYSA 5LMNI 2HKEA 4MDTA 3K85A 4DV3E 5L3JA 1VISA 1ZM2A 2V2ZA 4KQVA 4JI8I 2HHHE 1MX0A 1XXEA 4GKKE 4AIDA 4JG4A 1E3HA 1Y60A 4JI1I 4BA1B 3ZZ0A 3V2UC 3M7NG 1Z5CA 4DR4I 3GLLA 3ZKBA 4OO1A 1Z0CA 3M85G 4DV1I 4YY3I 4LF7I 5FLXQ 2Z5CA 4MU0A 3J81C 4HY1A 1HR0E 4WUDA 4URLA 5DRPA 1S4EA 2O3ZA 5A2QC 4YHHE 2NN6B 2V8PA 2ZBKB 1N34E 1NZ0A 4JI7E 5K36A 4DR7E 4LF9E 2HFUA 1N32I 1XNQI 4LFAI 3T1YE 2BA1G 4NXNE 3P76A 5C0XD 3J80Q 3NZKA 5JEAD 3P3EA 4GKJI 3M7ND 4DR1I 3M85D 1R6MA 2JEBA 2CZ9A 1IBLE 4LF4I 3LNUA 2LJPA 2NN6F 1Z59A 4DV2E 3PS3A 2ZM6I 4DR6E 2PO0B 2X36A 4JV5I 5IT9Q 1N33I 4FWDA 3L7ZA 4IZJB 4JI5E 1UDSA 4WUBA 1B62A 2WP8B 3T1HE 5LL6R 4DV6E 2BA1D 1UDQA 2UUCI 1XMQI 3QT6A 3Q1QA 4JI2E 2WW4A 1H7SA 1KTVA 2WP8A 4Z7CA 2WNRA 2Z5BA 1BKNA 4QNJA 4LF8E 2C39A 3J81Q 3PYDA 2VF3A 4DPTA 1Y5YA 4DUZE 2V2QA 1H73A 2DEIA 2PNZA 1I94I 2NN6C 5ELWA 4X64E 4MU4A 1OYPA 1KKHA 4K0KE 4R1FA 3P3CA 4DR3I 4LFCI 5BR8E 5DNXA 2UUAI 5C0XA 5JEAA 4JI0E 3HJCA 3HKMA 2UU9I 4NXMI 1RR9A 3WU6A 3OTOE 2UUBI 2R42A 4DV5I 2PO2A 2CG9A 4QNKA 1UEKA 1HNWE 1IBME 5IWAI 4DV4E 1HNXI 4IFDB 4DXLA 1WUUA 1Y4UA 4FW7A 4LF5I 2O1TA 4B3RI 4DU8A 3KRNA 5EL9A 3QT5A 1A6FA 2HK3A 4UT4A 4DV7E 4DPUA 4XTJA 2VESA 1N36E 4OX9I 4X66E 1S16A 2PNMA 2PO1A 4IFDF 4IS9A 2UXCI 5LMNE 4MQYA 3J7AG 3PS1A 4LCGA 2GS8A 1RHYA 3Q6NA 4BA2A 2UXDE 3DD6A 3B78A 1H74A 1KIJA 2HFSA 1FJGI 3HULA 4OO1B 1NHHA 4LF6I 4LFBI 4AIMA 5LMUI 4ISAA 1N0UA 2Z5CB 4DR5I 1HNZI 4JI1E 2EFGA 4PRXA 2HHHI 2HK2A 3H1CA 3JAMC 4X62E 2BV3A 4DR4E 4DV1E 4LCHA 4YY3E 4B3SE 1XNRI 4GKKI 4LF7E 4GQUA 1K47A 3U1KA 2VQFI 5K36B 4FW6A 1DARA 2GO4A 4IFDC 1NHJA 5DRQA 3U1YA 1FWLA 4AM3A 3J7AM 5DRRA 1FKAE 2E5LI 2F1DA 1HR0I 1FWKA 4HACA 2A2DA 4DU7A 2JEBB 1P42A 4N3OA 1N32E 2JEAB 1H7UA 4LFAE 4B3TI 1R6LA 1USUA 2JEAA 1XMOE 2IOPA 1N34I 1QZRA 4GKJE 4DR1E 3P3GA 2O1VA 3T1YI 4DPYA 1FNMA 4FN5A 3L7ZB 4JI4I 4X65E 4DR2E 4DV0I 4KHPI 4LF4E 1Z0VA 2C37A 2BR2A 4HYMA 2ZM6E 2NN6E 3PS2A 3QT8A 4OO1C 4JV5E 4FW3A 1IBKI 1N33E 1IBLI 4J3DA 2UXBI 3PYGA 1YH8A 2WNRB 4JI6I 2Z5BB 3GMEA 4I3HA 1EI1A 5GMDA 2VQEI 3ZM7A 2C39B 4P7AA 4DR6I 3CWVA 3ZKDA 2UUCE 1XMQE 3PRYA 3JAMQ 2PNZB 1J5EI 5K36C 3T1HI 2X7IA 2BM1A 3WU4A 1FI4A 1ZXMA 4FWGA 2R3VA 5A2QQ 4DUYI 1PIEA 5C0XB 1I94E 3QT7A 5JEAB 1YHCA 4UTGA 3LTOA 4JYAI 2PO2B 4OZEA 4LFCE 4PU9A 5DROA 4JI3I 2UU9E 1XHKA 4NXME 1Y4SA 1UDOA 2UUBE 2JT2A 4DV5E 3D4JA 1PVGA 4Z7YA 5FLXC 5C0XF 1HNXE 5JEAF 4AQYI 2HKJA 4LF5E 4B3MI 1Z0EA 4DPWA 2F4VI 4B3RE 4DPXA 2JE6A 2PO1B 2AE8A 1RREA 5DNLA 2C38B 4BA2B 4OX9E 3J80C 2C38A 3ZZTA 2NN6D 1ZM9A 4IFDE 3V5RA 4IZKA 2ZITA 4JI8E 1N36I 2O1WA 2XEXA 1Z0WA 4FW4A 4HXZA 3WU5A 5C0XC 4DV3I 1FJGE 5JEAC 4LPFA
chains in the Genus database with same CATH topology
4LF6E 4LFBE 5LMUE 4DR5E 1HNZE 3P06A 2UXDI 1Y6ZA 5IT9C 3GONA 2IOQA 1XNRE 2GQ0A 2Z5EA 5GMEA 1ELOA 2VQFE 4HACB 4X62I 4MYUA 4IZJD 4FW9A 4ED4A 2E1RA 4EMDA 4B3SI 3Q6MA 1PKPA 4USKA 3ZZUA 1XNQE 2E5LE 2PNLA 4YHHI 2A2CA 4M1KA 4B3TE 4MYTA 4ZVIA 1D6TA 4JI7I 4DR7I 4LF9I 1N0VC 4RPFA 4NXNI 4FWHA 1HK7A 3PYEA 4P52A 4JI4E 4DV0E 2V34A 1XMOI 4KHPE 3F0NA 4DV2I 1IBKE 2NPFA 2UXBE 4X65I 4DR2I 2BM0A 4JI6E 2AJ4A 1OJ4A 2DEJA 2VQEE 4JI5I 2OI2A 1USVA 1Z5BA 3LPSA 4DV6I 1B63A 1ZM4A 3K1JA 4JI2I 1J5EE 4IZJA 3WU3A 1NHIA 4LF8I 4DUYE 1Z0BA 3B82A 3PYFA 4DUZI 1MU5A 4DR3E 4JYAE 2UUAE 3H4LA 4X64I 4PRVA 2Q2EB 4JI3E 4K0KI 3M6AA 5IWAE 5BR8I 4JI0I 1MG7A 4WUCA 3OTOI 1H72C 1Z0GA 4AQYE 1HNWI 1IBMI 4DV4I 4B3ME 1Z5AA 2F4VE 2V2VA 1Z0TA 4IZKB 2J7KA 2O1UA 2UXCE 3K17A 4DV7I 1ZXNA 4USMA 1ZM3A 2CGEA 1U2RA 1EA6A 3B8HA 1KVKA 4X66I 5LMNI 2HKEA 3K85A 4DV3E 5L3JA 1VISA 1ZM2A 2V2ZA 4KQVA 4JI8I 2HHHE 1MX0A 4GKKE 4JG4A 4JI1I 3ZZ0A 3V2UC 1Z5CA 4DR4I 4DV1I 3ZKBA 1Z0CA 4YY3I 4LF7I 5FLXQ 2Z5CA 3J81C 4HY1A 1HR0E 4WUDA 4URLA 1S4EA 5A2QC 4YHHE 2V8PA 2ZBKB 1N34E 1NZ0A 4JI7E 4DR7E 4LF9E 2HFUA 1N32I 1XNQI 4LFAI 3T1YE 4NXNE 3J80Q 4GKJI 4DR1I 2CZ9A 1IBLE 4LF4I 3LNUA 2LJPA 4DV2E 1Z59A 2ZM6I 4DR6E 2X36A 4JV5I 5IT9Q 1N33I 4FWDA 4IZJB 4JI5E 4WUBA 1B62A 3T1HE 5LL6R 4DV6E 2UUCI 1XMQI 3QT6A 3Q1QA 4JI2E 2WW4A 1H7SA 1KTVA 4Z7CA 2Z5BA 1BKNA 4LF8E 3J81Q 3PYDA 2VF3A 4DPTA 4DUZE 2V2QA 1H73A 2DEIA 1I94I 4X64E 1KKHA 4K0KE 4R1FA 4DR3I 4LFCI 5BR8E 2UUAI 4JI0E 3HJCA 2UU9I 4NXMI 1RR9A 3WU6A 3OTOE 2UUBI 2R42A 4DV5I 2CG9A 1UEKA 1HNWE 1IBME 5IWAI 4DV4E 1HNXI 4DXLA 1WUUA 1Y4UA 4LF5I 2O1TA 4B3RI 4DU8A 3QT5A 1A6FA 2HK3A 4UT4A 4DV7E 4DPUA 4XTJA 1N36E 4OX9I 4X66E 1S16A 2PNMA 2UXCI 5LMNE 3J7AG 2GS8A 3Q6NA 2UXDE 3B78A 1H74A 1KIJA 2HFSA 1FJGI 3HULA 1NHHA 4LF6I 4LFBI 5LMUI 1N0UA 2Z5CB 4DR5I 1HNZI 4JI1E 2EFGA 4PRXA 2HHHI 2HK2A 3JAMC 4X62E 2BV3A 4DR4E 4DV1E 4B3SE 4YY3E 1XNRI 4GKKI 4LF7E 1K47A 2VQFI 1DARA 1NHJA 1FWLA 3J7AM 1FKAE 2E5LI 1HR0I 1FWKA 4HACA 2A2DA 4DU7A 4N3OA 1N32E 1H7UA 4LFAE 4B3TI 1USUA 1XMOE 2IOPA 1N34I 1QZRA 4GKJE 4DR1E 2O1VA 3T1YI 4DPYA 1FNMA 4FN5A 4JI4I 4X65E 4DR2E 4DV0I 4KHPI 4LF4E 1Z0VA 4HYMA 2ZM6E 3QT8A 4JV5E 1IBKI 1N33E 1IBLI 2UXBI 3PYGA 4JI6I 2Z5BB 4I3HA 1EI1A 5GMDA 2VQEI 3ZM7A 4P7AA 4DR6I 3CWVA 3ZKDA 2UUCE 1XMQE 3PRYA 3JAMQ 1J5EI 3T1HI 2X7IA 2BM1A 3WU4A 1FI4A 1ZXMA 4FWGA 2R3VA 5A2QQ 4DUYI 1PIEA 1I94E 3QT7A 4UTGA 3LTOA 4JYAI 4LFCE 4PU9A 4JI3I 2UU9E 1XHKA 4NXME 1Y4SA 2UUBE 4DV5E 3D4JA 1PVGA 4Z7YA 5FLXC 1HNXE 4AQYI 2HKJA 4LF5E 4B3MI 1Z0EA 4DPWA 2F4VI 4B3RE 4DPXA 1RREA 4OX9E 3J80C 3ZZTA 1ZM9A 3V5RA 4IZKA 2ZITA 4JI8E 1N36I 2O1WA 2XEXA 1Z0WA 4HXZA 3WU5A 4DV3I 1FJGE 5FWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5C A;  2Z5B A; 
#chains in the Genus database with same CATH topology
 4LF6 E;  4LFB E;  4MU3 A;  5LMU E;  4DR5 E;  4MU1 A;  1HNZ E;  3P06 A;  2UXD I;  1Y6Z A;  5IT9 C;  5EKW A;  3GON A;  2IOQ A;  1XNR E;  2GQ0 A;  2Z5E A;  3UHM A;  1OYR A;  5GME A;  4OO1 F;  4U3B A;  1ELO A;  2VQF E;  4HAC B;  4X62 I;  4MYU A;  4IZJ D;  4FW9 A;  4ED4 A;  2IER A;  2E1R A;  4EMD A;  4BA1 A;  4B3S I;  3Q6M A;  4OO1 E;  1PKP A;  4USK A;  3ZZU A;  1XNQ E;  2E5L E;  4NBQ A;  2PNL A;  4YHH I;  2A2C A;  4M1K A;  4B3T E;  4MYT A;  4ZVI A;  1D6T A;  4JI7 I;  5K36 F;  4DR7 I;  4LF9 I;  1N0V C;  4RPF A;  2C37 B;  2BR2 B;  4OKG A;  4NXN I;  4FWH A;  1HK7 A;  5K36 E;  2NN6 A;  3PYE A;  4P52 A;  5FWK A;  4JI4 E;  1E3P A;  4DV0 E;  2V34 A;  1XMO I;  4KHP E;  3F0N A;  3CDJ A;  4DV2 I;  1IBK E;  2NPF A;  2UXB E;  4X65 I;  4DR2 I;  2BM0 A;  4JI6 E;  2AJ4 A;  1OJ4 A;  2DEJ A;  2VQE E;  2CVE A;  4JI5 I;  4LOM A;  2OI2 A;  1USV A;  4IFD D;  2J65 A;  1Z5B A;  3LPS A;  4DV6 I;  2PO0 A;  1B63 A;  1ZM4 A;  3K1J A;  4JI2 I;  1J5E E;  3B4T A;  4IZJ A;  3WU3 A;  1NHI A;  4LF8 I;  4DUY E;  3GCM A;  1Z0B A;  3B82 A;  3PYF A;  4DUZ I;  1MU5 A;  4DR3 E;  4JYA E;  2UUA E;  3H4L A;  4U3D A;  3CDI A;  4X64 I;  4PRV A;  2Q2E B;  2BA0 G;  4JI3 E;  4K0K I;  4FW5 A;  3M6A A;  5IWA E;  5BR8 I;  4OO1 D;  4JI0 I;  1MG7 A;  4WUC A;  4LCF A;  2JE6 B;  3OTO I;  5C0X E;  1H72 C;  1Z0G A;  4AQY E;  1HNW I;  1IBM I;  4DV4 I;  5JEA E;  4B3M E;  1Z5A A;  1UDN A;  2F4V E;  2V2V A;  1Z0T A;  4IZK B;  5K36 D;  2IES A;  2J7K A;  1VI7 A;  2O1U A;  2UXC E;  3K17 A;  4IFD A;  2BA0 D;  4DV7 I;  1ZXN A;  4USM A;  1ZM3 A;  2CGE A;  1U2R A;  1EA6 A;  3B8H A;  1KVK A;  4X66 I;  2GO3 A;  1OYS A;  5LMN I;  2HKE A;  4MDT A;  3K85 A;  4DV3 E;  5L3J A;  1VIS A;  1ZM2 A;  2V2Z A;  4KQV A;  4JI8 I;  2HHH E;  1MX0 A;  1XXE A;  4GKK E;  4AID A;  4JG4 A;  1E3H A;  1Y60 A;  4JI1 I;  4BA1 B;  3ZZ0 A;  3V2U C;  3M7N G;  1Z5C A;  4DR4 I;  3GLL A;  3ZKB A;  4OO1 A;  1Z0C A;  3M85 G;  4DV1 I;  4YY3 I;  4LF7 I;  5FLX Q;  2Z5C A;  4MU0 A;  3J81 C;  4HY1 A;  1HR0 E;  4WUD A;  4URL A;  5DRP A;  1S4E A;  2O3Z A;  5A2Q C;  4YHH E;  2NN6 B;  2V8P A;  2ZBK B;  1N34 E;  1NZ0 A;  4JI7 E;  5K36 A;  4DR7 E;  4LF9 E;  2HFU A;  1N32 I;  1XNQ I;  4LFA I;  3T1Y E;  2BA1 G;  4NXN E;  3P76 A;  5C0X D;  3J80 Q;  3NZK A;  5JEA D;  3P3E A;  4GKJ I;  3M7N D;  4DR1 I;  3M85 D;  1R6M A;  2JEB A;  2CZ9 A;  1IBL E;  4LF4 I;  3LNU A;  2LJP A;  2NN6 F;  1Z59 A;  4DV2 E;  3PS3 A;  2ZM6 I;  4DR6 E;  2PO0 B;  2X36 A;  4JV5 I;  5IT9 Q;  1N33 I;  4FWD A;  3L7Z A;  4IZJ B;  4JI5 E;  1UDS A;  4WUB A;  1B62 A;  2WP8 B;  3T1H E;  5LL6 R;  4DV6 E;  2BA1 D;  1UDQ A;  2UUC I;  1XMQ I;  3QT6 A;  3Q1Q A;  4JI2 E;  2WW4 A;  1H7S A;  1KTV A;  2WP8 A;  4Z7C A;  2WNR A;  2Z5B A;  1BKN A;  4QNJ A;  4LF8 E;  2C39 A;  3J81 Q;  3PYD A;  2VF3 A;  4DPT A;  1Y5Y A;  4DUZ E;  2V2Q A;  1H73 A;  2DEI A;  2PNZ A;  1I94 I;  2NN6 C;  5ELW A;  4X64 E;  4MU4 A;  1OYP A;  1KKH A;  4K0K E;  4R1F A;  3P3C A;  4DR3 I;  4LFC I;  5BR8 E;  5DNX A;  2UUA I;  5C0X A;  5JEA A;  4JI0 E;  3HJC A;  3HKM A;  2UU9 I;  4NXM I;  1RR9 A;  3WU6 A;  3OTO E;  2UUB I;  2R42 A;  4DV5 I;  2PO2 A;  2CG9 A;  4QNK A;  1UEK A;  1HNW E;  1IBM E;  5IWA I;  4DV4 E;  1HNX I;  4IFD B;  4DXL A;  1WUU A;  1Y4U A;  4FW7 A;  4LF5 I;  2O1T A;  4B3R I;  4DU8 A;  3KRN A;  5EL9 A;  3QT5 A;  1A6F A;  2HK3 A;  4UT4 A;  4DV7 E;  4DPU A;  4XTJ A;  2VES A;  1N36 E;  4OX9 I;  4X66 E;  1S16 A;  2PNM A;  2PO1 A;  4IFD F;  4IS9 A;  2UXC I;  5LMN E;  4MQY A;  3J7A G;  3PS1 A;  4LCG A;  2GS8 A;  1RHY A;  3Q6N A;  4BA2 A;  2UXD E;  3DD6 A;  3B78 A;  1H74 A;  1KIJ A;  2HFS A;  1FJG I;  3HUL A;  4OO1 B;  1NHH A;  4LF6 I;  4LFB I;  4AIM A;  5LMU I;  4ISA A;  1N0U A;  2Z5C B;  4DR5 I;  1HNZ I;  4JI1 E;  2EFG A;  4PRX A;  2HHH I;  2HK2 A;  3H1C A;  3JAM C;  4X62 E;  2BV3 A;  4DR4 E;  4DV1 E;  4LCH A;  4YY3 E;  4B3S E;  1XNR I;  4GKK I;  4LF7 E;  4GQU A;  1K47 A;  3U1K A;  2VQF I;  5K36 B;  4FW6 A;  1DAR A;  2GO4 A;  4IFD C;  1NHJ A;  5DRQ A;  3U1Y A;  1FWL A;  4AM3 A;  3J7A M;  5DRR A;  1FKA E;  2E5L I;  2F1D A;  1HR0 I;  1FWK A;  4HAC A;  2A2D A;  4DU7 A;  2JEB B;  1P42 A;  4N3O A;  1N32 E;  2JEA B;  1H7U A;  4LFA E;  4B3T I;  1R6L A;  1USU A;  2JEA A;  1XMO E;  2IOP A;  1N34 I;  1QZR A;  4GKJ E;  4DR1 E;  3P3G A;  2O1V A;  3T1Y I;  4DPY A;  1FNM A;  4FN5 A;  3L7Z B;  4JI4 I;  4X65 E;  4DR2 E;  4DV0 I;  4KHP I;  4LF4 E;  1Z0V A;  2C37 A;  2BR2 A;  4HYM A;  2ZM6 E;  2NN6 E;  3PS2 A;  3QT8 A;  4OO1 C;  4JV5 E;  4FW3 A;  1IBK I;  1N33 E;  1IBL I;  4J3D A;  2UXB I;  3PYG A;  1YH8 A;  2WNR B;  4JI6 I;  2Z5B B;  3GME A;  4I3H A;  1EI1 A;  5GMD A;  2VQE I;  3ZM7 A;  2C39 B;  4P7A A;  4DR6 I;  3CWV A;  3ZKD A;  2UUC E;  1XMQ E;  3PRY A;  3JAM Q;  2PNZ B;  1J5E I;  5K36 C;  3T1H I;  2X7I A;  2BM1 A;  3WU4 A;  1FI4 A;  1ZXM A;  4FWG A;  2R3V A;  5A2Q Q;  4DUY I;  1PIE A;  5C0X B;  1I94 E;  3QT7 A;  5JEA B;  1YHC A;  4UTG A;  3LTO A;  4JYA I;  2PO2 B;  4OZE A;  4LFC E;  4PU9 A;  5DRO A;  4JI3 I;  2UU9 E;  1XHK A;  4NXM E;  1Y4S A;  1UDO A;  2UUB E;  2JT2 A;  4DV5 E;  3D4J A;  1PVG A;  4Z7Y A;  5FLX C;  5C0X F;  1HNX E;  5JEA F;  4AQY I;  2HKJ A;  4LF5 E;  4B3M I;  1Z0E A;  4DPW A;  2F4V I;  4B3R E;  4DPX A;  2JE6 A;  2PO1 B;  2AE8 A;  1RRE A;  5DNL A;  2C38 B;  4BA2 B;  4OX9 E;  3J80 C;  2C38 A;  3ZZT A;  2NN6 D;  1ZM9 A;  4IFD E;  3V5R A;  4IZK A;  2ZIT A;  4JI8 E;  1N36 I;  2O1W A;  2XEX A;  1Z0W A;  4FW4 A;  4HXZ A;  3WU5 A;  5C0X C;  4DV3 I;  1FJG E;  5JEA C;  4LPF A; 
#chains in the Genus database with same CATH homology
 4LF6 E;  4LFB E;  5LMU E;  4DR5 E;  1HNZ E;  3P06 A;  2UXD I;  1Y6Z A;  5IT9 C;  3GON A;  2IOQ A;  1XNR E;  2GQ0 A;  2Z5E A;  5GME A;  1ELO A;  2VQF E;  4HAC B;  4X62 I;  4MYU A;  4IZJ D;  4FW9 A;  4ED4 A;  2E1R A;  4EMD A;  4B3S I;  3Q6M A;  1PKP A;  4USK A;  3ZZU A;  1XNQ E;  2E5L E;  2PNL A;  4YHH I;  2A2C A;  4M1K A;  4B3T E;  4MYT A;  4ZVI A;  1D6T A;  4JI7 I;  4DR7 I;  4LF9 I;  1N0V C;  4RPF A;  4NXN I;  4FWH A;  1HK7 A;  3PYE A;  4P52 A;  4JI4 E;  4DV0 E;  2V34 A;  1XMO I;  4KHP E;  3F0N A;  4DV2 I;  1IBK E;  2NPF A;  2UXB E;  4X65 I;  4DR2 I;  2BM0 A;  4JI6 E;  2AJ4 A;  1OJ4 A;  2DEJ A;  2VQE E;  4JI5 I;  2OI2 A;  1USV A;  1Z5B A;  3LPS A;  4DV6 I;  1B63 A;  1ZM4 A;  3K1J A;  4JI2 I;  1J5E E;  4IZJ A;  3WU3 A;  1NHI A;  4LF8 I;  4DUY E;  1Z0B A;  3B82 A;  3PYF A;  4DUZ I;  1MU5 A;  4DR3 E;  4JYA E;  2UUA E;  3H4L A;  4X64 I;  4PRV A;  2Q2E B;  4JI3 E;  4K0K I;  3M6A A;  5IWA E;  5BR8 I;  4JI0 I;  1MG7 A;  4WUC A;  3OTO I;  1H72 C;  1Z0G A;  4AQY E;  1HNW I;  1IBM I;  4DV4 I;  4B3M E;  1Z5A A;  2F4V E;  2V2V A;  1Z0T A;  4IZK B;  2J7K A;  2O1U A;  2UXC E;  3K17 A;  4DV7 I;  1ZXN A;  4USM A;  1ZM3 A;  2CGE A;  1U2R A;  1EA6 A;  3B8H A;  1KVK A;  4X66 I;  5LMN I;  2HKE A;  3K85 A;  4DV3 E;  5L3J A;  1VIS A;  1ZM2 A;  2V2Z A;  4KQV A;  4JI8 I;  2HHH E;  1MX0 A;  4GKK E;  4JG4 A;  4JI1 I;  3ZZ0 A;  3V2U C;  1Z5C A;  4DR4 I;  4DV1 I;  3ZKB A;  1Z0C A;  4YY3 I;  4LF7 I;  5FLX Q;  2Z5C A;  3J81 C;  4HY1 A;  1HR0 E;  4WUD A;  4URL A;  1S4E A;  5A2Q C;  4YHH E;  2V8P A;  2ZBK B;  1N34 E;  1NZ0 A;  4JI7 E;  4DR7 E;  4LF9 E;  2HFU A;  1N32 I;  1XNQ I;  4LFA I;  3T1Y E;  4NXN E;  3J80 Q;  4GKJ I;  4DR1 I;  2CZ9 A;  1IBL E;  4LF4 I;  3LNU A;  2LJP A;  4DV2 E;  1Z59 A;  2ZM6 I;  4DR6 E;  2X36 A;  4JV5 I;  5IT9 Q;  1N33 I;  4FWD A;  4IZJ B;  4JI5 E;  4WUB A;  1B62 A;  3T1H E;  5LL6 R;  4DV6 E;  2UUC I;  1XMQ I;  3QT6 A;  3Q1Q A;  4JI2 E;  2WW4 A;  1H7S A;  1KTV A;  4Z7C A;  2Z5B A;  1BKN A;  4LF8 E;  3J81 Q;  3PYD A;  2VF3 A;  4DPT A;  4DUZ E;  2V2Q A;  1H73 A;  2DEI A;  1I94 I;  4X64 E;  1KKH A;  4K0K E;  4R1F A;  4DR3 I;  4LFC I;  5BR8 E;  2UUA I;  4JI0 E;  3HJC A;  2UU9 I;  4NXM I;  1RR9 A;  3WU6 A;  3OTO E;  2UUB I;  2R42 A;  4DV5 I;  2CG9 A;  1UEK A;  1HNW E;  1IBM E;  5IWA I;  4DV4 E;  1HNX I;  4DXL A;  1WUU A;  1Y4U A;  4LF5 I;  2O1T A;  4B3R I;  4DU8 A;  3QT5 A;  1A6F A;  2HK3 A;  4UT4 A;  4DV7 E;  4DPU A;  4XTJ A;  1N36 E;  4OX9 I;  4X66 E;  1S16 A;  2PNM A;  2UXC I;  5LMN E;  3J7A G;  2GS8 A;  3Q6N A;  2UXD E;  3B78 A;  1H74 A;  1KIJ A;  2HFS A;  1FJG I;  3HUL A;  1NHH A;  4LF6 I;  4LFB I;  5LMU I;  1N0U A;  2Z5C B;  4DR5 I;  1HNZ I;  4JI1 E;  2EFG A;  4PRX A;  2HHH I;  2HK2 A;  3JAM C;  4X62 E;  2BV3 A;  4DR4 E;  4DV1 E;  4B3S E;  4YY3 E;  1XNR I;  4GKK I;  4LF7 E;  1K47 A;  2VQF I;  1DAR A;  1NHJ A;  1FWL A;  3J7A M;  1FKA E;  2E5L I;  1HR0 I;  1FWK A;  4HAC A;  2A2D A;  4DU7 A;  4N3O A;  1N32 E;  1H7U A;  4LFA E;  4B3T I;  1USU A;  1XMO E;  2IOP A;  1N34 I;  1QZR A;  4GKJ E;  4DR1 E;  2O1V A;  3T1Y I;  4DPY A;  1FNM A;  4FN5 A;  4JI4 I;  4X65 E;  4DR2 E;  4DV0 I;  4KHP I;  4LF4 E;  1Z0V A;  4HYM A;  2ZM6 E;  3QT8 A;  4JV5 E;  1IBK I;  1N33 E;  1IBL I;  2UXB I;  3PYG A;  4JI6 I;  2Z5B B;  4I3H A;  1EI1 A;  5GMD A;  2VQE I;  3ZM7 A;  4P7A A;  4DR6 I;  3CWV A;  3ZKD A;  2UUC E;  1XMQ E;  3PRY A;  3JAM Q;  1J5E I;  3T1H I;  2X7I A;  2BM1 A;  3WU4 A;  1FI4 A;  1ZXM A;  4FWG A;  2R3V A;  5A2Q Q;  4DUY I;  1PIE A;  1I94 E;  3QT7 A;  4UTG A;  3LTO A;  4JYA I;  4LFC E;  4PU9 A;  4JI3 I;  2UU9 E;  1XHK A;  4NXM E;  1Y4S A;  2UUB E;  4DV5 E;  3D4J A;  1PVG A;  4Z7Y A;  5FLX C;  1HNX E;  4AQY I;  2HKJ A;  4LF5 E;  4B3M I;  1Z0E A;  4DPW A;  2F4V I;  4B3R E;  4DPX A;  1RRE A;  4OX9 E;  3J80 C;  3ZZT A;  1ZM9 A;  3V5R A;  4IZK A;  2ZIT A;  4JI8 E;  1N36 I;  2O1W A;  2XEX A;  1Z0W A;  4HXZ A;  3WU5 A;  4DV3 I;  1FJG E;  5FWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...