2Z5CA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
144
structure length
124
Chain Sequence
KTISRTIESQPTLDVIATLPADKKIPISLVVGFKQESSSSLSCYYYAIPLMRDRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/hydrolase
molecule keywords Protein YPL144W
total genus 33
structure length 124
sequence length 144
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cA00
2Z5CA 2Z5BA
chains in the Genus database with same CATH superfamily
4JI0E 2UUBE 1ZM9A 2C38B 3J81Q 4LF7E 4LFBE 4DV5E 4LF5E 4N3OA 1B63A 4JI8E 4DR6I 1UDNA 4FW7A 2UU9E 3B4TA 1XXEA 4IFDC 4B3RI 4IFDB 4X66E 2HFUA 5L3JA 5C0XA 4DPUA 1ZXNA 2X7IA 4FW3A 5DROA 3D4JA 2E1RA 2PO2A 3KRNA 4DR2I 1N34E 4OO1E 2JT2A 2JE6B 1QZRA 4K0KE 2NN6E 4JI6I 2BA0D 5ELWA 4FW4A 3DD6A 2JEBB 1N34I 2C39B 2UUAE 3GLLA 3PS3A 4JG4A 5JEAC 4KHPI 4DR5E 4QNKA 5JEAE 4IZJA 1FWKA 1FJGE 2A2DA 4AIMA 5LL6R 4IFDA 2HFSA 1N0UA 2V2QA 2O1UA 3LTOA 2GO4A 4B3RE 2UU9I 2BV3A 1HR0E 4JI2I 1KTVA 3HJCA 1IBLE 3U1KA 3M7NG 2Q2EB 1H74A 1FI4A 4X64E 2UUBI 1A6FA 4YHHE 3P76A 4DV3I 3P3GA 4JI0I 1I94I 4UTGA 4LCGA 1XNRE 1YHCA 4DU7A 1Z0CA 1OYRA 2BM0A 1BKNA 2IOPA 3QT6A 1Z5AA 3OTOE 4JI5I 4DPYA 3HULA 4LF4E 2JEAA 2VQEE 4MU4A 1Y6ZA 2XEXA 3WU4A 4LF6I 3P3EA 4AQYI 3ZM7A 2A2CA 1KVKA 2BR2B 4NBQA 4HYMA 3T1YI 5BR8I 4IZKB 3WU3A 1USVA 2V8PA 5GMDA 4J3DA 5LMUI 2OI2A 3JAMC 4JI4I 1HNXE 4OKGA 2PNZB 4JI3I 1MG7A 4URLA 4R1FA 3ZZ0A 4OZEA 3M7ND 1S4EA 3H4LA 3J7AG 4P7AA 2PO1B 4JI3E 2C38A 1HNXI 1XMQI 3CDIA 3B8HA 5K36E 1WUUA 3K85A 4DV0E 2CZ9A 4DUZI 2E5LE 1EI1A 1XHKA 3ZKBA 1E3PA 5JEAB 5K36A 4DV6I 3PS2A 4B3SI 1Z0VA 5LMNI 1UEKA 2VQEI 3T1HE 4LOMA 3J80Q 1Z5CA 3OTOI 5IT9Q 4HACA 1H73A 3L7ZB 4DV4E 1XMOI 4HXZA 1IBME 3Q6NA 4JV5I 2X36A 2WNRB 4B3ME 1NHIA 1ELOA 2C37A 4MYUA 5FWKA 4FN5A 2DEIA 1MX0A 4BA1B 4YHHI 4IFDF 1HNZE 1E3HA 2GS8A 5C0XF 1IBLI 4LF9I 4U3DA 5FLXC 4DR3I 3U1YA 2VQFE 4DV2E 1KIJA 1Z59A 4MU3A 1ZXMA 1Y60A 1OJ4A 4XTJA 3Q1QA 4JV5E 5EKWA 4LCFA 2DEJA 4JI7E 2Z5BB 3T1HI 1VI7A 5IWAE 4LFCE 3GMEA 3M85D 1EA6A 4PRVA 4DUZE 4JI6E 4I3HA 4K0KI 3PRYA 1H7SA 1OYSA 1UDQA 4DV3E 4EMDA 4DR2E 4PU9A 1N32I 1N36I 2BA1G 2PO0A 5DRQA 4HY1A 3WU6A 1FKAE 5IT9C 2O1TA 3K17A 1H72C 4USMA 3V2UC 4DR7I 2F4VE 2WP8A 3QT7A 2NN6F 5DRPA 5JEAA 4JI8I 3V5RA 4LF5I 2UXBE 1MU5A 1HNWE 4DV5I 2PNLA 2VESA 4LF7I 1Y4SA 1FWLA 3PYDA 3WU5A 4X65I 1Y5YA 2NN6C 4GKJE 4MU1A 3QT8A 4BA2B 4WUCA 4OO1B 1Z0GA 4FWDA 4OO1A 4LFAE 5K36F 4LF8I 4DR4E 2GQ0A 2UXDI 4ED4A 2JEBA 4LCHA 4MQYA 2BA0G 4YY3E 5GMEA 4LF4I 4DUYI 1R6LA 4OX9I 4IFDE 4DUYE 2CGEA 1ZM2A 4MYTA 2JEAB 2UXDE 2CVEA 4LF8E 2O1WA 4DR4I 1DARA 4LFAI 3J81C 4GKKE 1XNRI 4BA2A 1I94E 4AM3A 4IS9A 2O1VA 1XNQE 2R42A 1Z0TA 4Z7YA 3P06A 4GKJI 2J7KA 4IZKA 4X65E 2NN6A 4DU8A 4X64I 5C0XB 2UUCI 1HNWI 4DPTA 4DXLA 2AJ4A 4FW9A 2V2ZA 2UXBI 2V2VA 4JI2E 1HR0I 5JEAD 3NZKA 1RHYA 5C0XE 5K36B 1PIEA 2F4VI 4GQUA 5DNLA 1HK7A 1ZM4A 2WP8B 4DR7E 1RREA 2ZITA 1YH8A 4DPWA 4U3BA 2HHHE 1FJGI 5JEAF 1N36E 1NHJA 2WW4A 1N32E 4PRXA 4ZVIA 3Q6MA 4HACB 4DR5I 4KHPE 2ZBKB 2ZM6E 5FLXQ 1KKHA 2UUAI 4DR1I 4RPFA 1U2RA 2NPFA 4IZJD 1UDSA 3ZZTA 3QT5A 2IESA 1NZ0A 3GONA 1IBKE 1N33E 4LFCI 5IWAI 5C0XD 5A2QC 4FW6A 3PYGA 1N0VC 1R6MA 4JI7I 4DV7I 4X66I 3JAMQ 3M6AA 3J80C 3ZKDA 3LPSA 2O3ZA 3B78A 1J5EI 2VQFI 4DV2I 4NXNI 3GCMA 4DR3E 4DR6E 4DV1E 4QNJA 1NHHA 4LFBI 1VISA 4LPFA 4LF9E 1UDOA 2PNZA 4FW5A 5K36D 2PNMA 4P52A 1HNZI 3J7AM 4DV1I 5DRRA 3F0NA 2Z5CB 4NXNE 1S16A 3HKMA 3PYEA 2V34A 1J5EE 4Z7CA 4UT4A 1XMOE 2BR2A 1Z0WA 4DV7E 4DV4I 4B3MI 2Z5EA 4WUDA 2HKJA 2PO0B 1IBMI 5LMNE 1N33I 4OO1C 1IBKI 2EFGA 2BM1A 4JYAE 1Z5BA 2E5LI 1USUA 4DV6E 4B3SE 4M1KA 4X62E 4DR1E 2IOQA 4FWGA 4DV0I 4FWHA 1FNMA 3B82A 1H7UA 2ZM6I 4NXME 1PKPA 2CG9A 2Z5BA 1XMQE 4IFDD 2Z5CA 2PO1A 1PVGA 1K47A 3L7ZA 4IZJB 2HHHI 4OO1D 4B3TE 2UXCE 4JI1E 4AIDA 4USKA 2LJPA 2VF3A 3CWVA 3PS1A 2GO3A 4ISAA 5DNXA 4JI1I 2JE6A 2HK3A 4B3TI 2NN6B 1Y4UA 2AE8A 2UXCI 5K36C 1B62A 2IERA 4JI4E 1OYPA 3CDJA 3PYFA 2PO2B 2UUCE 4BA1A 2HK2A 1Z0EA 4NXMI 2HKEA 2J65A 1Z0BA 2C37B 5LMUE 1XNQI 2BA1D 3T1YE 4X62I 2WNRA 2C39A 5EL9A 2R3VA 4AQYE 5BR8E 4GKKI 4LF6E 4OO1F 4JYAI 3LNUA 4KQVA 3K1JA 4MDTA 4JI5E 4OX9E 3M85G 4YY3I 5C0XC 3P3CA 1ZM3A 3UHMA 1P42A 1D6TA 4DPXA 3ZZUA 2F1DA 5A2QQ 1RR9A 4WUBA 4MU0A 3H1CA 2NN6D
chains in the Genus database with same CATH topology
4JI0E 2UUBE 1ZM9A 3J81Q 4LF7E 4LFBE 4DV5E 4LF5E 4N3OA 1B63A 4JI8E 4DR6I 2UU9E 4B3RI 4X66E 2HFUA 5L3JA 4DPUA 1ZXNA 2X7IA 3D4JA 2E1RA 4DR2I 1N34E 1QZRA 4K0KE 4JI6I 1N34I 2UUAE 4JG4A 4KHPI 4DR5E 4IZJA 1FWKA 1FJGE 2A2DA 5LL6R 2HFSA 1N0UA 2V2QA 2O1UA 3LTOA 4B3RE 2UU9I 2BV3A 1HR0E 4JI2I 1KTVA 3HJCA 1IBLE 2Q2EB 1H74A 1FI4A 4X64E 2UUBI 1A6FA 4YHHE 4DV3I 4JI0I 1I94I 4UTGA 1XNRE 4DU7A 1Z0CA 2BM0A 1BKNA 2IOPA 3QT6A 1Z5AA 3OTOE 4JI5I 4DPYA 3HULA 4LF4E 2VQEE 1Y6ZA 2XEXA 3WU4A 4LF6I 4AQYI 3ZM7A 2A2CA 1KVKA 3T1YI 4HYMA 5BR8I 4IZKB 3WU3A 1USVA 2V8PA 5GMDA 5LMUI 2OI2A 3JAMC 4JI4I 1HNXE 4JI3I 1MG7A 4URLA 4R1FA 3ZZ0A 1S4EA 3H4LA 3J7AG 4P7AA 4JI3E 1HNXI 1XMQI 3B8HA 1WUUA 3K85A 4DV0E 2CZ9A 4DUZI 2E5LE 1EI1A 1XHKA 3ZKBA 4DV6I 4B3SI 1Z0VA 5LMNI 1UEKA 2VQEI 3T1HE 3J80Q 1Z5CA 3OTOI 5IT9Q 4HACA 1H73A 4DV4E 1XMOI 4HXZA 1IBME 3Q6NA 4JV5I 2X36A 4B3ME 1NHIA 1ELOA 4MYUA 5FWKA 4FN5A 2DEIA 1MX0A 4YHHI 1HNZE 2GS8A 1IBLI 4LF9I 5FLXC 4DR3I 2VQFE 4DV2E 1KIJA 1Z59A 1ZXMA 1OJ4A 4XTJA 3Q1QA 4JV5E 2DEJA 4JI7E 2Z5BB 3T1HI 5IWAE 4LFCE 1EA6A 4PRVA 4DUZE 4JI6E 4I3HA 4K0KI 3PRYA 1H7SA 4EMDA 4DR2E 4PU9A 1N32I 1N36I 4HY1A 3WU6A 1FKAE 5IT9C 2O1TA 3K17A 1H72C 4USMA 3V2UC 4DR7I 2F4VE 3QT7A 4JI8I 3V5RA 4LF5I 2UXBE 1MU5A 1HNWE 4DV5I 2PNLA 4LF7I 1Y4SA 1FWLA 3PYDA 3WU5A 4X65I 4GKJE 3QT8A 4WUCA 1Z0GA 4FWDA 4LFAE 4LF8I 4DR4E 2GQ0A 2UXDI 4ED4A 4YY3E 5GMEA 4LF4I 4DUYI 4OX9I 4DUYE 2CGEA 1ZM2A 4MYTA 2UXDE 4LF8E 2O1WA 4DR4I 1DARA 4LFAI 3J81C 4GKKE 1XNRI 1I94E 2O1VA 1XNQE 2R42A 1Z0TA 4Z7YA 3P06A 4GKJI 2J7KA 4IZKA 4X65E 4DU8A 4X64I 2UUCI 1HNWI 4DPTA 4DXLA 2AJ4A 4FW9A 2V2ZA 2UXBI 2V2VA 4JI2E 1HR0I 1PIEA 2F4VI 1HK7A 1ZM4A 4DR7E 1RREA 2ZITA 4DPWA 2HHHE 1FJGI 1N36E 1NHJA 2WW4A 1N32E 4PRXA 4ZVIA 3Q6MA 4HACB 4DR5I 4KHPE 2ZBKB 2ZM6E 5FLXQ 1KKHA 2UUAI 4DR1I 4RPFA 1U2RA 2NPFA 4IZJD 3ZZTA 3QT5A 3GONA 1NZ0A 1IBKE 1N33E 4LFCI 5IWAI 5A2QC 3PYGA 1N0VC 4JI7I 4DV7I 4X66I 3JAMQ 3J80C 3M6AA 3ZKDA 3LPSA 3B78A 1J5EI 2VQFI 4DV2I 4NXNI 4DR3E 4DR6E 4DV1E 1NHHA 4LFBI 1VISA 4LF9E 2PNMA 4P52A 1HNZI 3J7AM 4DV1I 3F0NA 2Z5CB 4NXNE 1S16A 3PYEA 2V34A 1J5EE 4Z7CA 4UT4A 1XMOE 1Z0WA 4DV7E 4DV4I 4B3MI 2Z5EA 4WUDA 2HKJA 1IBMI 5LMNE 1N33I 1IBKI 2EFGA 2BM1A 4JYAE 1Z5BA 2E5LI 1USUA 4DV6E 4B3SE 4M1KA 4X62E 4DR1E 2IOQA 4FWGA 4DV0I 4FWHA 1FNMA 3B82A 1H7UA 2ZM6I 4NXME 1PKPA 2CG9A 1XMQE 2Z5BA 2Z5CA 1PVGA 1K47A 4IZJB 2HHHI 4B3TE 2UXCE 4JI1E 4USKA 2LJPA 2VF3A 3CWVA 4JI1I 2HK3A 4B3TI 2UXCI 1Y4UA 1B62A 4JI4E 3PYFA 2UUCE 2HK2A 1Z0EA 4NXMI 2HKEA 1Z0BA 5LMUE 1XNQI 3T1YE 4X62I 2R3VA 4AQYE 5BR8E 4GKKI 4LF6E 4JYAI 3LNUA 4KQVA 3K1JA 4JI5E 4OX9E 4YY3I 1ZM3A 1D6TA 4DPXA 3ZZUA 5A2QQ 1RR9A 4WUBA 4DV3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5C A;  2Z5B A; 
#chains in the Genus database with same CATH topology
 4JI0 E;  2UUB E;  1ZM9 A;  2C38 B;  3J81 Q;  4LF7 E;  4LFB E;  4DV5 E;  4LF5 E;  4N3O A;  1B63 A;  4JI8 E;  4DR6 I;  1UDN A;  4FW7 A;  2UU9 E;  3B4T A;  1XXE A;  4IFD C;  4B3R I;  4IFD B;  4X66 E;  2HFU A;  5L3J A;  5C0X A;  4DPU A;  1ZXN A;  2X7I A;  4FW3 A;  5DRO A;  3D4J A;  2E1R A;  2PO2 A;  3KRN A;  4DR2 I;  1N34 E;  4OO1 E;  2JT2 A;  2JE6 B;  1QZR A;  4K0K E;  2NN6 E;  4JI6 I;  2BA0 D;  5ELW A;  4FW4 A;  3DD6 A;  2JEB B;  1N34 I;  2C39 B;  2UUA E;  3GLL A;  3PS3 A;  4JG4 A;  5JEA C;  4KHP I;  4DR5 E;  4QNK A;  5JEA E;  4IZJ A;  1FWK A;  1FJG E;  2A2D A;  4AIM A;  5LL6 R;  4IFD A;  2HFS A;  1N0U A;  2V2Q A;  2O1U A;  3LTO A;  2GO4 A;  4B3R E;  2UU9 I;  2BV3 A;  1HR0 E;  4JI2 I;  1KTV A;  3HJC A;  1IBL E;  3U1K A;  3M7N G;  2Q2E B;  1H74 A;  1FI4 A;  4X64 E;  2UUB I;  1A6F A;  4YHH E;  3P76 A;  4DV3 I;  3P3G A;  4JI0 I;  1I94 I;  4UTG A;  4LCG A;  1XNR E;  1YHC A;  4DU7 A;  1Z0C A;  1OYR A;  2BM0 A;  1BKN A;  2IOP A;  3QT6 A;  1Z5A A;  3OTO E;  4JI5 I;  4DPY A;  3HUL A;  4LF4 E;  2JEA A;  2VQE E;  4MU4 A;  1Y6Z A;  2XEX A;  3WU4 A;  4LF6 I;  3P3E A;  4AQY I;  3ZM7 A;  2A2C A;  1KVK A;  2BR2 B;  4NBQ A;  4HYM A;  3T1Y I;  5BR8 I;  4IZK B;  3WU3 A;  1USV A;  2V8P A;  5GMD A;  4J3D A;  5LMU I;  2OI2 A;  3JAM C;  4JI4 I;  1HNX E;  4OKG A;  2PNZ B;  4JI3 I;  1MG7 A;  4URL A;  4R1F A;  3ZZ0 A;  4OZE A;  3M7N D;  1S4E A;  3H4L A;  3J7A G;  4P7A A;  2PO1 B;  4JI3 E;  2C38 A;  1HNX I;  1XMQ I;  3CDI A;  3B8H A;  5K36 E;  1WUU A;  3K85 A;  4DV0 E;  2CZ9 A;  4DUZ I;  2E5L E;  1EI1 A;  1XHK A;  3ZKB A;  1E3P A;  5JEA B;  5K36 A;  4DV6 I;  3PS2 A;  4B3S I;  1Z0V A;  5LMN I;  1UEK A;  2VQE I;  3T1H E;  4LOM A;  3J80 Q;  1Z5C A;  3OTO I;  5IT9 Q;  4HAC A;  1H73 A;  3L7Z B;  4DV4 E;  1XMO I;  4HXZ A;  1IBM E;  3Q6N A;  4JV5 I;  2X36 A;  2WNR B;  4B3M E;  1NHI A;  1ELO A;  2C37 A;  4MYU A;  5FWK A;  4FN5 A;  2DEI A;  1MX0 A;  4BA1 B;  4YHH I;  4IFD F;  1HNZ E;  1E3H A;  2GS8 A;  5C0X F;  1IBL I;  4LF9 I;  4U3D A;  5FLX C;  4DR3 I;  3U1Y A;  2VQF E;  4DV2 E;  1KIJ A;  1Z59 A;  4MU3 A;  1ZXM A;  1Y60 A;  1OJ4 A;  4XTJ A;  3Q1Q A;  4JV5 E;  5EKW A;  4LCF A;  2DEJ A;  4JI7 E;  2Z5B B;  3T1H I;  1VI7 A;  5IWA E;  4LFC E;  3GME A;  3M85 D;  1EA6 A;  4PRV A;  4DUZ E;  4JI6 E;  4I3H A;  4K0K I;  3PRY A;  1H7S A;  1OYS A;  1UDQ A;  4DV3 E;  4EMD A;  4DR2 E;  4PU9 A;  1N32 I;  1N36 I;  2BA1 G;  2PO0 A;  5DRQ A;  4HY1 A;  3WU6 A;  1FKA E;  5IT9 C;  2O1T A;  3K17 A;  1H72 C;  4USM A;  3V2U C;  4DR7 I;  2F4V E;  2WP8 A;  3QT7 A;  2NN6 F;  5DRP A;  5JEA A;  4JI8 I;  3V5R A;  4LF5 I;  2UXB E;  1MU5 A;  1HNW E;  4DV5 I;  2PNL A;  2VES A;  4LF7 I;  1Y4S A;  1FWL A;  3PYD A;  3WU5 A;  4X65 I;  1Y5Y A;  2NN6 C;  4GKJ E;  4MU1 A;  3QT8 A;  4BA2 B;  4WUC A;  4OO1 B;  1Z0G A;  4FWD A;  4OO1 A;  4LFA E;  5K36 F;  4LF8 I;  4DR4 E;  2GQ0 A;  2UXD I;  4ED4 A;  2JEB A;  4LCH A;  4MQY A;  2BA0 G;  4YY3 E;  5GME A;  4LF4 I;  4DUY I;  1R6L A;  4OX9 I;  4IFD E;  4DUY E;  2CGE A;  1ZM2 A;  4MYT A;  2JEA B;  2UXD E;  2CVE A;  4LF8 E;  2O1W A;  4DR4 I;  1DAR A;  4LFA I;  3J81 C;  4GKK E;  1XNR I;  4BA2 A;  1I94 E;  4AM3 A;  4IS9 A;  2O1V A;  1XNQ E;  2R42 A;  1Z0T A;  4Z7Y A;  3P06 A;  4GKJ I;  2J7K A;  4IZK A;  4X65 E;  2NN6 A;  4DU8 A;  4X64 I;  5C0X B;  2UUC I;  1HNW I;  4DPT A;  4DXL A;  2AJ4 A;  4FW9 A;  2V2Z A;  2UXB I;  2V2V A;  4JI2 E;  1HR0 I;  5JEA D;  3NZK A;  1RHY A;  5C0X E;  5K36 B;  1PIE A;  2F4V I;  4GQU A;  5DNL A;  1HK7 A;  1ZM4 A;  2WP8 B;  4DR7 E;  1RRE A;  2ZIT A;  1YH8 A;  4DPW A;  4U3B A;  2HHH E;  1FJG I;  5JEA F;  1N36 E;  1NHJ A;  2WW4 A;  1N32 E;  4PRX A;  4ZVI A;  3Q6M A;  4HAC B;  4DR5 I;  4KHP E;  2ZBK B;  2ZM6 E;  5FLX Q;  1KKH A;  2UUA I;  4DR1 I;  4RPF A;  1U2R A;  2NPF A;  4IZJ D;  1UDS A;  3ZZT A;  3QT5 A;  2IES A;  1NZ0 A;  3GON A;  1IBK E;  1N33 E;  4LFC I;  5IWA I;  5C0X D;  5A2Q C;  4FW6 A;  3PYG A;  1N0V C;  1R6M A;  4JI7 I;  4DV7 I;  4X66 I;  3JAM Q;  3M6A A;  3J80 C;  3ZKD A;  3LPS A;  2O3Z A;  3B78 A;  1J5E I;  2VQF I;  4DV2 I;  4NXN I;  3GCM A;  4DR3 E;  4DR6 E;  4DV1 E;  4QNJ A;  1NHH A;  4LFB I;  1VIS A;  4LPF A;  4LF9 E;  1UDO A;  2PNZ A;  4FW5 A;  5K36 D;  2PNM A;  4P52 A;  1HNZ I;  3J7A M;  4DV1 I;  5DRR A;  3F0N A;  2Z5C B;  4NXN E;  1S16 A;  3HKM A;  3PYE A;  2V34 A;  1J5E E;  4Z7C A;  4UT4 A;  1XMO E;  2BR2 A;  1Z0W A;  4DV7 E;  4DV4 I;  4B3M I;  2Z5E A;  4WUD A;  2HKJ A;  2PO0 B;  1IBM I;  5LMN E;  1N33 I;  4OO1 C;  1IBK I;  2EFG A;  2BM1 A;  4JYA E;  1Z5B A;  2E5L I;  1USU A;  4DV6 E;  4B3S E;  4M1K A;  4X62 E;  4DR1 E;  2IOQ A;  4FWG A;  4DV0 I;  4FWH A;  1FNM A;  3B82 A;  1H7U A;  2ZM6 I;  4NXM E;  1PKP A;  2CG9 A;  2Z5B A;  1XMQ E;  4IFD D;  2Z5C A;  2PO1 A;  1PVG A;  1K47 A;  3L7Z A;  4IZJ B;  2HHH I;  4OO1 D;  4B3T E;  2UXC E;  4JI1 E;  4AID A;  4USK A;  2LJP A;  2VF3 A;  3CWV A;  3PS1 A;  2GO3 A;  4ISA A;  5DNX A;  4JI1 I;  2JE6 A;  2HK3 A;  4B3T I;  2NN6 B;  1Y4U A;  2AE8 A;  2UXC I;  5K36 C;  1B62 A;  2IER A;  4JI4 E;  1OYP A;  3CDJ A;  3PYF A;  2PO2 B;  2UUC E;  4BA1 A;  2HK2 A;  1Z0E A;  4NXM I;  2HKE A;  2J65 A;  1Z0B A;  2C37 B;  5LMU E;  1XNQ I;  2BA1 D;  3T1Y E;  4X62 I;  2WNR A;  2C39 A;  5EL9 A;  2R3V A;  4AQY E;  5BR8 E;  4GKK I;  4LF6 E;  4OO1 F;  4JYA I;  3LNU A;  4KQV A;  3K1J A;  4MDT A;  4JI5 E;  4OX9 E;  3M85 G;  4YY3 I;  5C0X C;  3P3C A;  1ZM3 A;  3UHM A;  1P42 A;  1D6T A;  4DPX A;  3ZZU A;  2F1D A;  5A2Q Q;  1RR9 A;  4WUB A;  4MU0 A;  3H1C A;  2NN6 D; 
#chains in the Genus database with same CATH homology
 4JI0 E;  2UUB E;  1ZM9 A;  3J81 Q;  4LF7 E;  4LFB E;  4DV5 E;  4LF5 E;  4N3O A;  1B63 A;  4JI8 E;  4DR6 I;  2UU9 E;  4B3R I;  4X66 E;  2HFU A;  5L3J A;  4DPU A;  1ZXN A;  2X7I A;  3D4J A;  2E1R A;  4DR2 I;  1N34 E;  1QZR A;  4K0K E;  4JI6 I;  1N34 I;  2UUA E;  4JG4 A;  4KHP I;  4DR5 E;  4IZJ A;  1FWK A;  1FJG E;  2A2D A;  5LL6 R;  2HFS A;  1N0U A;  2V2Q A;  2O1U A;  3LTO A;  4B3R E;  2UU9 I;  2BV3 A;  1HR0 E;  4JI2 I;  1KTV A;  3HJC A;  1IBL E;  2Q2E B;  1H74 A;  1FI4 A;  4X64 E;  2UUB I;  1A6F A;  4YHH E;  4DV3 I;  4JI0 I;  1I94 I;  4UTG A;  1XNR E;  4DU7 A;  1Z0C A;  2BM0 A;  1BKN A;  2IOP A;  3QT6 A;  1Z5A A;  3OTO E;  4JI5 I;  4DPY A;  3HUL A;  4LF4 E;  2VQE E;  1Y6Z A;  2XEX A;  3WU4 A;  4LF6 I;  4AQY I;  3ZM7 A;  2A2C A;  1KVK A;  3T1Y I;  4HYM A;  5BR8 I;  4IZK B;  3WU3 A;  1USV A;  2V8P A;  5GMD A;  5LMU I;  2OI2 A;  3JAM C;  4JI4 I;  1HNX E;  4JI3 I;  1MG7 A;  4URL A;  4R1F A;  3ZZ0 A;  1S4E A;  3H4L A;  3J7A G;  4P7A A;  4JI3 E;  1HNX I;  1XMQ I;  3B8H A;  1WUU A;  3K85 A;  4DV0 E;  2CZ9 A;  4DUZ I;  2E5L E;  1EI1 A;  1XHK A;  3ZKB A;  4DV6 I;  4B3S I;  1Z0V A;  5LMN I;  1UEK A;  2VQE I;  3T1H E;  3J80 Q;  1Z5C A;  3OTO I;  5IT9 Q;  4HAC A;  1H73 A;  4DV4 E;  1XMO I;  4HXZ A;  1IBM E;  3Q6N A;  4JV5 I;  2X36 A;  4B3M E;  1NHI A;  1ELO A;  4MYU A;  5FWK A;  4FN5 A;  2DEI A;  1MX0 A;  4YHH I;  1HNZ E;  2GS8 A;  1IBL I;  4LF9 I;  5FLX C;  4DR3 I;  2VQF E;  4DV2 E;  1KIJ A;  1Z59 A;  1ZXM A;  1OJ4 A;  4XTJ A;  3Q1Q A;  4JV5 E;  2DEJ A;  4JI7 E;  2Z5B B;  3T1H I;  5IWA E;  4LFC E;  1EA6 A;  4PRV A;  4DUZ E;  4JI6 E;  4I3H A;  4K0K I;  3PRY A;  1H7S A;  4EMD A;  4DR2 E;  4PU9 A;  1N32 I;  1N36 I;  4HY1 A;  3WU6 A;  1FKA E;  5IT9 C;  2O1T A;  3K17 A;  1H72 C;  4USM A;  3V2U C;  4DR7 I;  2F4V E;  3QT7 A;  4JI8 I;  3V5R A;  4LF5 I;  2UXB E;  1MU5 A;  1HNW E;  4DV5 I;  2PNL A;  4LF7 I;  1Y4S A;  1FWL A;  3PYD A;  3WU5 A;  4X65 I;  4GKJ E;  3QT8 A;  4WUC A;  1Z0G A;  4FWD A;  4LFA E;  4LF8 I;  4DR4 E;  2GQ0 A;  2UXD I;  4ED4 A;  4YY3 E;  5GME A;  4LF4 I;  4DUY I;  4OX9 I;  4DUY E;  2CGE A;  1ZM2 A;  4MYT A;  2UXD E;  4LF8 E;  2O1W A;  4DR4 I;  1DAR A;  4LFA I;  3J81 C;  4GKK E;  1XNR I;  1I94 E;  2O1V A;  1XNQ E;  2R42 A;  1Z0T A;  4Z7Y A;  3P06 A;  4GKJ I;  2J7K A;  4IZK A;  4X65 E;  4DU8 A;  4X64 I;  2UUC I;  1HNW I;  4DPT A;  4DXL A;  2AJ4 A;  4FW9 A;  2V2Z A;  2UXB I;  2V2V A;  4JI2 E;  1HR0 I;  1PIE A;  2F4V I;  1HK7 A;  1ZM4 A;  4DR7 E;  1RRE A;  2ZIT A;  4DPW A;  2HHH E;  1FJG I;  1N36 E;  1NHJ A;  2WW4 A;  1N32 E;  4PRX A;  4ZVI A;  3Q6M A;  4HAC B;  4DR5 I;  4KHP E;  2ZBK B;  2ZM6 E;  5FLX Q;  1KKH A;  2UUA I;  4DR1 I;  4RPF A;  1U2R A;  2NPF A;  4IZJ D;  3ZZT A;  3QT5 A;  3GON A;  1NZ0 A;  1IBK E;  1N33 E;  4LFC I;  5IWA I;  5A2Q C;  3PYG A;  1N0V C;  4JI7 I;  4DV7 I;  4X66 I;  3JAM Q;  3J80 C;  3M6A A;  3ZKD A;  3LPS A;  3B78 A;  1J5E I;  2VQF I;  4DV2 I;  4NXN I;  4DR3 E;  4DR6 E;  4DV1 E;  1NHH A;  4LFB I;  1VIS A;  4LF9 E;  2PNM A;  4P52 A;  1HNZ I;  3J7A M;  4DV1 I;  3F0N A;  2Z5C B;  4NXN E;  1S16 A;  3PYE A;  2V34 A;  1J5E E;  4Z7C A;  4UT4 A;  1XMO E;  1Z0W A;  4DV7 E;  4DV4 I;  4B3M I;  2Z5E A;  4WUD A;  2HKJ A;  1IBM I;  5LMN E;  1N33 I;  1IBK I;  2EFG A;  2BM1 A;  4JYA E;  1Z5B A;  2E5L I;  1USU A;  4DV6 E;  4B3S E;  4M1K A;  4X62 E;  4DR1 E;  2IOQ A;  4FWG A;  4DV0 I;  4FWH A;  1FNM A;  3B82 A;  1H7U A;  2ZM6 I;  4NXM E;  1PKP A;  2CG9 A;  1XMQ E;  2Z5B A;  2Z5C A;  1PVG A;  1K47 A;  4IZJ B;  2HHH I;  4B3T E;  2UXC E;  4JI1 E;  4USK A;  2LJP A;  2VF3 A;  3CWV A;  4JI1 I;  2HK3 A;  4B3T I;  2UXC I;  1Y4U A;  1B62 A;  4JI4 E;  3PYF A;  2UUC E;  2HK2 A;  1Z0E A;  4NXM I;  2HKE A;  1Z0B A;  5LMU E;  1XNQ I;  3T1Y E;  4X62 I;  2R3V A;  4AQY E;  5BR8 E;  4GKK I;  4LF6 E;  4JYA I;  3LNU A;  4KQV A;  3K1J A;  4JI5 E;  4OX9 E;  4YY3 I;  1ZM3 A;  1D6T A;  4DPX A;  3ZZU A;  5A2Q Q;  1RR9 A;  4WUB A;  4DV3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...