2Z5CA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
144
structure length
124
Chain Sequence
b'KTISRTIESQPTLDVIATLPADKKIPISLVVGFKQESSSSLSCYYYAIPLMRDRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YPL144W
molecule tags Chaperone/hydrolase
source organism Saccharomyces cerevisiae
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
total genus 33
structure length 124
sequence length 144
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cA00
2Z5BA 2Z5CA
chains in the Genus database with same CATH superfamily
1MG7A 4FW9A 4LF9I 2E5LE 3P76A 5K36B 1I94E 4JV5E 2F1DA 3PYEA 2C39B 2UUAI 4KQVA 1USVA 4FW5A 1HNZE 4JI2E 5JEAC 4GKKI 4IS9A 3F0NA 4DPUA 2BA0D 3J7AG 1B62A 1N33E 4MU3A 4LF7E 1NHHA 2HFSA 1EA6A 4MYTA 4LFBI 1XNQI 4B3RI 2WP8A 3B82A 4Z7YA 3V5RA 2GQ0A 3K1JA 4DUYE 1E3PA 4DR4I 3LPSA 4GQUA 3J81Q 2WP8B 4YHHI 1ZM4A 2XEXA 2IESA 4HXZA 2BA1D 4JYAI 4LF9E 2UU9I 3U1YA 4K0KI 1U2RA 1Z0EA 3J80Q 4JI2I 2UXDI 3HKMA 4DV0I 1S16A 3PYDA 5LMUI 1FI4A 4DR1I 4DV3I 5C0XC 4DR6I 1QZRA 3GLLA 3PYFA 4NXME 4DV7E 4R1FA 1RR9A 4B3SE 1RHYA 4LCHA 4AQYI 4B3RE 4FWDA 4WUBA 2HK2A 3WU5A 4DV1E 4IFDA 1H7SA 2DEJA 4YHHE 4LOMA 4P52A 4JYAE 3PS3A 4JI1I 2NN6D 3T1YI 1Y4SA 4DU7A 2UXDE 1HNWE 2BA0G 2V2ZA 1USUA 2PNLA 2NN6F 4HACB 1J5EE 4OO1A 4DR1E 4DV3E 4X65I 4JI7I 2BR2A 3M85D 1HR0I 4M1KA 2UUBE 5BR8E 4NXMI 1XMQE 4LF6I 3T1HE 1UDSA 4WUCA 3GCMA 4MQYA 4DV4E 4MU1A 4DV2I 3PS2A 4HACA 2BM0A 4IFDE 4FW7A 3PYGA 1OJ4A 5JEAD 4JI3I 2CZ9A 2V34A 4JI8I 2PNZA 3Q6MA 4MU0A 4JI7E 4X65E 4LCGA 4USMA 2F4VI 4NBQA 4OO1E 4OKGA 4U3DA 4QNKA 4DR3I 1XMOI 1H74A 1I94I 1N34I 3ZKBA 4FWGA 4NXNI 4X64E 2PNMA 2Z5CB 4DV2E 2UXBI 2HFUA 3J7AM 1Y5YA 4DV5I 2HKJA 2NN6C 4DR2E 4LCFA 1Z0WA 3LTOA 4B3MI 5K36D 2AJ4A 4BA1B 3K17A 4FW4A 2J7KA 2C38B 2IOQA 1DARA 3CDIA 4DUZE 1UDQA 2PO2A 5LL6R 2VF3A 1IBLI 4FW6A 1FKAE 4OX9I 5FWKA 5FLXC 4JV5I 1B63A 2PO1A 1PKPA 3JAMQ 2O1WA 1N0UA 1KKHA 1D6TA 1Z5BA 2UXBE 5EL9A 5DNXA 1YH8A 3ZKDA 4EMDA 1H72C 2VESA 4ZVIA 3LNUA 4DUYI 2Z5EA 4DV1I 2UUCI 4DUZI 4UT4A 4IZJD 3P3GA 4URLA 4OZEA 4JI1E 3P3CA 4RPFA 4K0KE 2IOPA 5ELWA 1N36I 1HNWI 3KRNA 1N32I 3J80C 2UUAE 2GO3A 1Z5CA 3PRYA 2OI2A 3WU3A 1HR0E 3M7ND 5K36E 4JI5E 3CDJA 2X7IA 2JEAA 1H7UA 1MX0A 4DR7I 3ZZ0A 2VQFI 1UEKA 2JT2A 3M6AA 2HK3A 3WU4A 4OO1B 3H4LA 2UXCI 2IERA 1ELOA 1ZM2A 5FLXQ 4X66E 1NHIA 1E3HA 2F4VE 5LMUE 1Y6ZA 4JI5I 2NPFA 3H1CA 4DR6E 3P3EA 5A2QC 1XMQI 2V2QA 4JI6I 2CVEA 5K36A 3T1HI 3L7ZB 2AE8A 5C0XE 4DV7I 1VISA 4DPXA 1NZ0A 2VQFE 3WU6A 4DPWA 2HKEA 1NHJA 2VQEI 2NN6B 4LFCI 3HULA 2ZITA 2UXCE 1OYSA 1R6MA 1ZM9A 1HK7A 4AIMA 4OO1F 2R42A 1MU5A 5JEAF 5JEAB 4OX9E 2PO2B 4AIDA 5K36C 1XNRE 5JEAA 3M85G 2Z5BA 4NXNE 4X64I 3QT7A 5DNLA 4U3BA 1IBME 2A2CA 4DV5E 4DR2I 4DV4I 2CGEA 1Z0BA 2J65A 4N3OA 5LMNE 2NN6A 4JI0E 2Z5CA 5C0XD 4GKJI 3GONA 1XHKA 2C37B 5DRRA 2UUCE 2GS8A 3ZZTA 4IFDD 1KIJA 1Z0GA 3UHMA 4DR5E 2LJPA 3L7ZA 4IFDF 1ZXNA 4P7AA 4IZKB 2E1RA 1P42A 1WUUA 1ZM3A 5IWAE 1H73A 1FWLA 4BA2A 1IBKE 1N33I 4LF7I 4GKJE 4LF4I 4LF8E 3V2UC 5GMEA 2NN6E 4DV6I 3PS1A 4PU9A 1UDNA 2ZM6E 2PO1B 1A6FA 3U1KA 2DEIA 4JG4A 1N0VC 1Y60A 4LFAE 2BV3A 3OTOI 2JEAB 5C0XB 2PO0B 5A2QQ 5DROA 2BA1G 2GO4A 4FWHA 3JAMC 1N32E 5IWAI 2EFGA 5K36F 2A2DA 2O1VA 4BA2B 1FJGE 2HHHE 4XTJA 4KHPE 4ISAA 4MU4A 4AQYE 2V8PA 4PRVA 3QT6A 5IT9Q 2ZM6I 4DXLA 3GMEA 5EKWA 4LFAI 2C37A 1UDOA 3ZM7A 1FWKA 4AM3A 1PIEA 2WW4A 1PVGA 3NZKA 2JEBA 3B4TA 5GMDA 1N36E 4LPFA 3M7NG 1OYPA 3CWVA 3B8HA 4DV0E 1Z0CA 2R3VA 4B3TI 2HHHI 3Q6NA 4LF6E 4JI6E 5C0XA 4FN5A 2WNRB 1Z5AA 1KVKA 4IFDC 1FNMA 2O1TA 4LFBE 4DR7E 2C38A 4DPYA 4DR4E 2ZBKB 3QT5A 2JE6B 1K47A 4I3HA 5LMNI 1RREA 4FW3A 4LFCE 1Z59A 2O1UA 4JI0I 2BR2B 2UU9E 2JEBB 4DU8A 1S4EA 4Z7CA 3T1YE 2BM1A 4OO1D 2X36A 3ZZUA 4HYMA 1J5EI 3Q1QA 4B3TE 3K85A 4DR3E 4X66I 1XMOE 4UTGA 1XXEA 4DPTA 3HJCA 5JEAE 4B3SI 4X62I 1EI1A 4JI4I 4PRXA 2PNZB 1KTVA 4WUDA 4OO1C 1IBKI 4LF5E 5IT9C 2Q2EB 4MDTA 5L3JA 1BKNA 5DRPA 4LF4E 2VQEE 3D4JA 4DV6E 2CG9A 3DD6A 2PO0A 3QT8A 5DRQA 4IZJB 1HNXE 1Z0TA 4DR5I 4YY3E 2JE6A 1IBLE 2V2VA 3OTOE 2UUBI 2Z5BB 1OYRA 4MYUA 5BR8I 3B78A 2E5LI 1N34E 1Z0VA 4QNJA 4X62E 2WNRA 4IZJA 1VI7A 4JI4E 1XNRI 5C0XF 1HNZI 4GKKE 4BA1A 3P06A 1FJGI 4J3DA 4LF5I 4KHPI 1IBMI 3J81C 4LF8I 4JI3E 4B3ME 4HY1A 4IZKA 1XNQE 1HNXI 2C39A 2O3ZA 1Y4UA 4IFDB 1YHCA 4JI8E 1ZXMA 4ED4A 4YY3I 1R6LA 4USKA
chains in the Genus database with same CATH topology
1MG7A 4FW9A 4LF9I 2E5LE 1I94E 4JV5E 3PYEA 2UUAI 4KQVA 1USVA 1HNZE 4JI2E 4GKKI 3F0NA 4DPUA 3J7AG 1B62A 1N33E 4LF7E 1NHHA 2HFSA 1EA6A 4MYTA 4LFBI 1XNQI 4B3RI 3B82A 4Z7YA 3V5RA 2GQ0A 3K1JA 4DUYE 4DR4I 3LPSA 3J81Q 4YHHI 1ZM4A 2XEXA 4HXZA 4JYAI 4LF9E 2UU9I 4K0KI 1U2RA 1Z0EA 3J80Q 4JI2I 2UXDI 4DV0I 1S16A 3PYDA 5LMUI 1FI4A 4DR1I 4DV3I 4DR6I 1QZRA 3PYFA 4NXME 4DV7E 4R1FA 4B3SE 1RR9A 4AQYI 4B3RE 4FWDA 4WUBA 2HK2A 3WU5A 4DV1E 1H7SA 2DEJA 4YHHE 4P52A 4JYAE 4JI1I 3T1YI 1Y4SA 4DU7A 2UXDE 1HNWE 2V2ZA 1USUA 2PNLA 4HACB 1J5EE 4DR1E 4DV3E 4X65I 4JI7I 1HR0I 4M1KA 2UUBE 5BR8E 4NXMI 1XMQE 4LF6I 3T1HE 4WUCA 4DV4E 4DV2I 4HACA 2BM0A 3PYGA 1OJ4A 4JI3I 2CZ9A 2V34A 3Q6MA 4JI8I 4JI7E 4X65E 4USMA 2F4VI 4DR3I 1XMOI 1H74A 1I94I 1N34I 3ZKBA 4FWGA 4NXNI 4X64E 2PNMA 2Z5CB 4DV2E 2UXBI 2HFUA 3J7AM 4DV5I 2HKJA 4DR2E 1Z0WA 3LTOA 4B3MI 2AJ4A 3K17A 2J7KA 2IOQA 1DARA 4DUZE 5LL6R 2VF3A 1IBLI 1FKAE 4OX9I 5FWKA 5FLXC 4JV5I 1B63A 1PKPA 3JAMQ 2O1WA 1N0UA 1KKHA 1D6TA 1Z5BA 2UXBE 3ZKDA 4EMDA 1H72C 4ZVIA 3LNUA 4DUYI 2Z5EA 4DV1I 2UUCI 4DUZI 4UT4A 4IZJD 4URLA 4JI1E 4RPFA 4K0KE 2IOPA 1N36I 1HNWI 1N32I 3J80C 2UUAE 1Z5CA 3PRYA 2OI2A 3WU3A 1HR0E 4JI5E 2X7IA 1H7UA 1MX0A 4DR7I 3ZZ0A 2VQFI 1UEKA 3M6AA 2HK3A 3WU4A 3H4LA 2UXCI 1ELOA 1ZM2A 5FLXQ 4X66E 1NHIA 2F4VE 5LMUE 1Y6ZA 4JI5I 2NPFA 4DR6E 5A2QC 1XMQI 2V2QA 4JI6I 3T1HI 4DV7I 1VISA 4DPXA 1NZ0A 2VQFE 3WU6A 4DPWA 2HKEA 1NHJA 2VQEI 4LFCI 3HULA 2ZITA 2UXCE 1ZM9A 1HK7A 2R42A 1MU5A 4OX9E 1XNRE 2Z5BA 4NXNE 4X64I 3QT7A 1IBME 2A2CA 4DV5E 4DR2I 4DV4I 2CGEA 1Z0BA 4N3OA 5LMNE 4JI0E 2Z5CA 4GKJI 3GONA 1XHKA 2UUCE 2GS8A 3ZZTA 1KIJA 1Z0GA 4DR5E 2LJPA 1ZXNA 4P7AA 4IZKB 2E1RA 1WUUA 1ZM3A 5IWAE 1H73A 1FWLA 1IBKE 1N33I 4LF7I 4GKJE 4LF4I 4LF8E 3V2UC 5GMEA 4DV6I 4PU9A 2ZM6E 1A6FA 2DEIA 4JG4A 1N0VC 4LFAE 2BV3A 3OTOI 5A2QQ 4FWHA 3JAMC 1N32E 5IWAI 2EFGA 2A2DA 2O1VA 1FJGE 2HHHE 4XTJA 4KHPE 4AQYE 2V8PA 4PRVA 3QT6A 5IT9Q 2ZM6I 4DXLA 4LFAI 3ZM7A 1FWKA 1PIEA 2WW4A 1PVGA 5GMDA 1N36E 3CWVA 3B8HA 4DV0E 1Z0CA 2R3VA 4B3TI 2HHHI 3Q6NA 4LF6E 4JI6E 4FN5A 1Z5AA 1KVKA 1FNMA 2O1TA 4LFBE 4DR7E 4DPYA 4DR4E 2ZBKB 3QT5A 1K47A 4I3HA 5LMNI 1RREA 4LFCE 1Z59A 2O1UA 4JI0I 2UU9E 4DU8A 1S4EA 4Z7CA 3T1YE 2BM1A 2X36A 3ZZUA 4HYMA 1J5EI 3Q1QA 4B3TE 3K85A 4DR3E 4X66I 1XMOE 4UTGA 4DPTA 3HJCA 4B3SI 4X62I 1EI1A 4JI4I 4PRXA 1KTVA 4WUDA 1IBKI 4LF5E 5IT9C 2Q2EB 5L3JA 1BKNA 4LF4E 2VQEE 3D4JA 4DV6E 2CG9A 3QT8A 1HNXE 4IZJB 1Z0TA 4DR5I 4YY3E 1IBLE 2V2VA 3OTOE 2UUBI 2Z5BB 4MYUA 5BR8I 3B78A 2E5LI 1N34E 1Z0VA 4X62E 4IZJA 4JI4E 1XNRI 1HNZI 4GKKE 3P06A 1FJGI 4LF5I 4KHPI 1IBMI 3J81C 4LF8I 4JI3E 4B3ME 4HY1A 4IZKA 1XNQE 1HNXI 1Y4UA 4JI8E 1ZXMA 4ED4A 4YY3I 4USKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B A;  2Z5C A; 
#chains in the Genus database with same CATH topology
 1MG7 A;  4FW9 A;  4LF9 I;  2E5L E;  3P76 A;  5K36 B;  1I94 E;  4JV5 E;  2F1D A;  3PYE A;  2C39 B;  2UUA I;  4KQV A;  1USV A;  4FW5 A;  1HNZ E;  4JI2 E;  5JEA C;  4GKK I;  4IS9 A;  3F0N A;  4DPU A;  2BA0 D;  3J7A G;  1B62 A;  1N33 E;  4MU3 A;  4LF7 E;  1NHH A;  2HFS A;  1EA6 A;  4MYT A;  4LFB I;  1XNQ I;  4B3R I;  2WP8 A;  3B82 A;  4Z7Y A;  3V5R A;  2GQ0 A;  3K1J A;  4DUY E;  1E3P A;  4DR4 I;  3LPS A;  4GQU A;  3J81 Q;  2WP8 B;  4YHH I;  1ZM4 A;  2XEX A;  2IES A;  4HXZ A;  2BA1 D;  4JYA I;  4LF9 E;  2UU9 I;  3U1Y A;  4K0K I;  1U2R A;  1Z0E A;  3J80 Q;  4JI2 I;  2UXD I;  3HKM A;  4DV0 I;  1S16 A;  3PYD A;  5LMU I;  1FI4 A;  4DR1 I;  4DV3 I;  5C0X C;  4DR6 I;  1QZR A;  3GLL A;  3PYF A;  4NXM E;  4DV7 E;  4R1F A;  1RR9 A;  4B3S E;  1RHY A;  4LCH A;  4AQY I;  4B3R E;  4FWD A;  4WUB A;  2HK2 A;  3WU5 A;  4DV1 E;  4IFD A;  1H7S A;  2DEJ A;  4YHH E;  4LOM A;  4P52 A;  4JYA E;  3PS3 A;  4JI1 I;  2NN6 D;  3T1Y I;  1Y4S A;  4DU7 A;  2UXD E;  1HNW E;  2BA0 G;  2V2Z A;  1USU A;  2PNL A;  2NN6 F;  4HAC B;  1J5E E;  4OO1 A;  4DR1 E;  4DV3 E;  4X65 I;  4JI7 I;  2BR2 A;  3M85 D;  1HR0 I;  4M1K A;  2UUB E;  5BR8 E;  4NXM I;  1XMQ E;  4LF6 I;  3T1H E;  1UDS A;  4WUC A;  3GCM A;  4MQY A;  4DV4 E;  4MU1 A;  4DV2 I;  3PS2 A;  4HAC A;  2BM0 A;  4IFD E;  4FW7 A;  3PYG A;  1OJ4 A;  5JEA D;  4JI3 I;  2CZ9 A;  2V34 A;  4JI8 I;  2PNZ A;  3Q6M A;  4MU0 A;  4JI7 E;  4X65 E;  4LCG A;  4USM A;  2F4V I;  4NBQ A;  4OO1 E;  4OKG A;  4U3D A;  4QNK A;  4DR3 I;  1XMO I;  1H74 A;  1I94 I;  1N34 I;  3ZKB A;  4FWG A;  4NXN I;  4X64 E;  2PNM A;  2Z5C B;  4DV2 E;  2UXB I;  2HFU A;  3J7A M;  1Y5Y A;  4DV5 I;  2HKJ A;  2NN6 C;  4DR2 E;  4LCF A;  1Z0W A;  3LTO A;  4B3M I;  5K36 D;  2AJ4 A;  4BA1 B;  3K17 A;  4FW4 A;  2J7K A;  2C38 B;  2IOQ A;  1DAR A;  3CDI A;  4DUZ E;  1UDQ A;  2PO2 A;  5LL6 R;  2VF3 A;  1IBL I;  4FW6 A;  1FKA E;  4OX9 I;  5FWK A;  5FLX C;  4JV5 I;  1B63 A;  2PO1 A;  1PKP A;  3JAM Q;  2O1W A;  1N0U A;  1KKH A;  1D6T A;  1Z5B A;  2UXB E;  5EL9 A;  5DNX A;  1YH8 A;  3ZKD A;  4EMD A;  1H72 C;  2VES A;  4ZVI A;  3LNU A;  4DUY I;  2Z5E A;  4DV1 I;  2UUC I;  4DUZ I;  4UT4 A;  4IZJ D;  3P3G A;  4URL A;  4OZE A;  4JI1 E;  3P3C A;  4RPF A;  4K0K E;  2IOP A;  5ELW A;  1N36 I;  1HNW I;  3KRN A;  1N32 I;  3J80 C;  2UUA E;  2GO3 A;  1Z5C A;  3PRY A;  2OI2 A;  3WU3 A;  1HR0 E;  3M7N D;  5K36 E;  4JI5 E;  3CDJ A;  2X7I A;  2JEA A;  1H7U A;  1MX0 A;  4DR7 I;  3ZZ0 A;  2VQF I;  1UEK A;  2JT2 A;  3M6A A;  2HK3 A;  3WU4 A;  4OO1 B;  3H4L A;  2UXC I;  2IER A;  1ELO A;  1ZM2 A;  5FLX Q;  4X66 E;  1NHI A;  1E3H A;  2F4V E;  5LMU E;  1Y6Z A;  4JI5 I;  2NPF A;  3H1C A;  4DR6 E;  3P3E A;  5A2Q C;  1XMQ I;  2V2Q A;  4JI6 I;  2CVE A;  5K36 A;  3T1H I;  3L7Z B;  2AE8 A;  5C0X E;  4DV7 I;  1VIS A;  4DPX A;  1NZ0 A;  2VQF E;  3WU6 A;  4DPW A;  2HKE A;  1NHJ A;  2VQE I;  2NN6 B;  4LFC I;  3HUL A;  2ZIT A;  2UXC E;  1OYS A;  1R6M A;  1ZM9 A;  1HK7 A;  4AIM A;  4OO1 F;  2R42 A;  1MU5 A;  5JEA F;  5JEA B;  4OX9 E;  2PO2 B;  4AID A;  5K36 C;  1XNR E;  5JEA A;  3M85 G;  2Z5B A;  4NXN E;  4X64 I;  3QT7 A;  5DNL A;  4U3B A;  1IBM E;  2A2C A;  4DV5 E;  4DR2 I;  4DV4 I;  2CGE A;  1Z0B A;  2J65 A;  4N3O A;  5LMN E;  2NN6 A;  4JI0 E;  2Z5C A;  5C0X D;  4GKJ I;  3GON A;  1XHK A;  2C37 B;  5DRR A;  2UUC E;  2GS8 A;  3ZZT A;  4IFD D;  1KIJ A;  1Z0G A;  3UHM A;  4DR5 E;  2LJP A;  3L7Z A;  4IFD F;  1ZXN A;  4P7A A;  4IZK B;  2E1R A;  1P42 A;  1WUU A;  1ZM3 A;  5IWA E;  1H73 A;  1FWL A;  4BA2 A;  1IBK E;  1N33 I;  4LF7 I;  4GKJ E;  4LF4 I;  4LF8 E;  3V2U C;  5GME A;  2NN6 E;  4DV6 I;  3PS1 A;  4PU9 A;  1UDN A;  2ZM6 E;  2PO1 B;  1A6F A;  3U1K A;  2DEI A;  4JG4 A;  1N0V C;  1Y60 A;  4LFA E;  2BV3 A;  3OTO I;  2JEA B;  5C0X B;  2PO0 B;  5A2Q Q;  5DRO A;  2BA1 G;  2GO4 A;  4FWH A;  3JAM C;  1N32 E;  5IWA I;  2EFG A;  5K36 F;  2A2D A;  2O1V A;  4BA2 B;  1FJG E;  2HHH E;  4XTJ A;  4KHP E;  4ISA A;  4MU4 A;  4AQY E;  2V8P A;  4PRV A;  3QT6 A;  5IT9 Q;  2ZM6 I;  4DXL A;  3GME A;  5EKW A;  4LFA I;  2C37 A;  1UDO A;  3ZM7 A;  1FWK A;  4AM3 A;  1PIE A;  2WW4 A;  1PVG A;  3NZK A;  2JEB A;  3B4T A;  5GMD A;  1N36 E;  4LPF A;  3M7N G;  1OYP A;  3CWV A;  3B8H A;  4DV0 E;  1Z0C A;  2R3V A;  4B3T I;  2HHH I;  3Q6N A;  4LF6 E;  4JI6 E;  5C0X A;  4FN5 A;  2WNR B;  1Z5A A;  1KVK A;  4IFD C;  1FNM A;  2O1T A;  4LFB E;  4DR7 E;  2C38 A;  4DPY A;  4DR4 E;  2ZBK B;  3QT5 A;  2JE6 B;  1K47 A;  4I3H A;  5LMN I;  1RRE A;  4FW3 A;  4LFC E;  1Z59 A;  2O1U A;  4JI0 I;  2BR2 B;  2UU9 E;  2JEB B;  4DU8 A;  1S4E A;  4Z7C A;  3T1Y E;  2BM1 A;  4OO1 D;  2X36 A;  3ZZU A;  4HYM A;  1J5E I;  3Q1Q A;  4B3T E;  3K85 A;  4DR3 E;  4X66 I;  1XMO E;  4UTG A;  1XXE A;  4DPT A;  3HJC A;  5JEA E;  4B3S I;  4X62 I;  1EI1 A;  4JI4 I;  4PRX A;  2PNZ B;  1KTV A;  4WUD A;  4OO1 C;  1IBK I;  4LF5 E;  5IT9 C;  2Q2E B;  4MDT A;  5L3J A;  1BKN A;  5DRP A;  4LF4 E;  2VQE E;  3D4J A;  4DV6 E;  2CG9 A;  3DD6 A;  2PO0 A;  3QT8 A;  5DRQ A;  4IZJ B;  1HNX E;  1Z0T A;  4DR5 I;  4YY3 E;  2JE6 A;  1IBL E;  2V2V A;  3OTO E;  2UUB I;  2Z5B B;  1OYR A;  4MYU A;  5BR8 I;  3B78 A;  2E5L I;  1N34 E;  1Z0V A;  4QNJ A;  4X62 E;  2WNR A;  4IZJ A;  1VI7 A;  4JI4 E;  1XNR I;  5C0X F;  1HNZ I;  4GKK E;  4BA1 A;  3P06 A;  1FJG I;  4J3D A;  4LF5 I;  4KHP I;  1IBM I;  3J81 C;  4LF8 I;  4JI3 E;  4B3M E;  4HY1 A;  4IZK A;  1XNQ E;  1HNX I;  2C39 A;  2O3Z A;  1Y4U A;  4IFD B;  1YHC A;  4JI8 E;  1ZXM A;  4ED4 A;  4YY3 I;  1R6L A;  4USK A; 
#chains in the Genus database with same CATH homology
 1MG7 A;  4FW9 A;  4LF9 I;  2E5L E;  1I94 E;  4JV5 E;  3PYE A;  2UUA I;  4KQV A;  1USV A;  1HNZ E;  4JI2 E;  4GKK I;  3F0N A;  4DPU A;  3J7A G;  1B62 A;  1N33 E;  4LF7 E;  1NHH A;  2HFS A;  1EA6 A;  4MYT A;  4LFB I;  1XNQ I;  4B3R I;  3B82 A;  4Z7Y A;  3V5R A;  2GQ0 A;  3K1J A;  4DUY E;  4DR4 I;  3LPS A;  3J81 Q;  4YHH I;  1ZM4 A;  2XEX A;  4HXZ A;  4JYA I;  4LF9 E;  2UU9 I;  4K0K I;  1U2R A;  1Z0E A;  3J80 Q;  4JI2 I;  2UXD I;  4DV0 I;  1S16 A;  3PYD A;  5LMU I;  1FI4 A;  4DR1 I;  4DV3 I;  4DR6 I;  1QZR A;  3PYF A;  4NXM E;  4DV7 E;  4R1F A;  4B3S E;  1RR9 A;  4AQY I;  4B3R E;  4FWD A;  4WUB A;  2HK2 A;  3WU5 A;  4DV1 E;  1H7S A;  2DEJ A;  4YHH E;  4P52 A;  4JYA E;  4JI1 I;  3T1Y I;  1Y4S A;  4DU7 A;  2UXD E;  1HNW E;  2V2Z A;  1USU A;  2PNL A;  4HAC B;  1J5E E;  4DR1 E;  4DV3 E;  4X65 I;  4JI7 I;  1HR0 I;  4M1K A;  2UUB E;  5BR8 E;  4NXM I;  1XMQ E;  4LF6 I;  3T1H E;  4WUC A;  4DV4 E;  4DV2 I;  4HAC A;  2BM0 A;  3PYG A;  1OJ4 A;  4JI3 I;  2CZ9 A;  2V34 A;  3Q6M A;  4JI8 I;  4JI7 E;  4X65 E;  4USM A;  2F4V I;  4DR3 I;  1XMO I;  1H74 A;  1I94 I;  1N34 I;  3ZKB A;  4FWG A;  4NXN I;  4X64 E;  2PNM A;  2Z5C B;  4DV2 E;  2UXB I;  2HFU A;  3J7A M;  4DV5 I;  2HKJ A;  4DR2 E;  1Z0W A;  3LTO A;  4B3M I;  2AJ4 A;  3K17 A;  2J7K A;  2IOQ A;  1DAR A;  4DUZ E;  5LL6 R;  2VF3 A;  1IBL I;  1FKA E;  4OX9 I;  5FWK A;  5FLX C;  4JV5 I;  1B63 A;  1PKP A;  3JAM Q;  2O1W A;  1N0U A;  1KKH A;  1D6T A;  1Z5B A;  2UXB E;  3ZKD A;  4EMD A;  1H72 C;  4ZVI A;  3LNU A;  4DUY I;  2Z5E A;  4DV1 I;  2UUC I;  4DUZ I;  4UT4 A;  4IZJ D;  4URL A;  4JI1 E;  4RPF A;  4K0K E;  2IOP A;  1N36 I;  1HNW I;  1N32 I;  3J80 C;  2UUA E;  1Z5C A;  3PRY A;  2OI2 A;  3WU3 A;  1HR0 E;  4JI5 E;  2X7I A;  1H7U A;  1MX0 A;  4DR7 I;  3ZZ0 A;  2VQF I;  1UEK A;  3M6A A;  2HK3 A;  3WU4 A;  3H4L A;  2UXC I;  1ELO A;  1ZM2 A;  5FLX Q;  4X66 E;  1NHI A;  2F4V E;  5LMU E;  1Y6Z A;  4JI5 I;  2NPF A;  4DR6 E;  5A2Q C;  1XMQ I;  2V2Q A;  4JI6 I;  3T1H I;  4DV7 I;  1VIS A;  4DPX A;  1NZ0 A;  2VQF E;  3WU6 A;  4DPW A;  2HKE A;  1NHJ A;  2VQE I;  4LFC I;  3HUL A;  2ZIT A;  2UXC E;  1ZM9 A;  1HK7 A;  2R42 A;  1MU5 A;  4OX9 E;  1XNR E;  2Z5B A;  4NXN E;  4X64 I;  3QT7 A;  1IBM E;  2A2C A;  4DV5 E;  4DR2 I;  4DV4 I;  2CGE A;  1Z0B A;  4N3O A;  5LMN E;  4JI0 E;  2Z5C A;  4GKJ I;  3GON A;  1XHK A;  2UUC E;  2GS8 A;  3ZZT A;  1KIJ A;  1Z0G A;  4DR5 E;  2LJP A;  1ZXN A;  4P7A A;  4IZK B;  2E1R A;  1WUU A;  1ZM3 A;  5IWA E;  1H73 A;  1FWL A;  1IBK E;  1N33 I;  4LF7 I;  4GKJ E;  4LF4 I;  4LF8 E;  3V2U C;  5GME A;  4DV6 I;  4PU9 A;  2ZM6 E;  1A6F A;  2DEI A;  4JG4 A;  1N0V C;  4LFA E;  2BV3 A;  3OTO I;  5A2Q Q;  4FWH A;  3JAM C;  1N32 E;  5IWA I;  2EFG A;  2A2D A;  2O1V A;  1FJG E;  2HHH E;  4XTJ A;  4KHP E;  4AQY E;  2V8P A;  4PRV A;  3QT6 A;  5IT9 Q;  2ZM6 I;  4DXL A;  4LFA I;  3ZM7 A;  1FWK A;  1PIE A;  2WW4 A;  1PVG A;  5GMD A;  1N36 E;  3CWV A;  3B8H A;  4DV0 E;  1Z0C A;  2R3V A;  4B3T I;  2HHH I;  3Q6N A;  4LF6 E;  4JI6 E;  4FN5 A;  1Z5A A;  1KVK A;  1FNM A;  2O1T A;  4LFB E;  4DR7 E;  4DPY A;  4DR4 E;  2ZBK B;  3QT5 A;  1K47 A;  4I3H A;  5LMN I;  1RRE A;  4LFC E;  1Z59 A;  2O1U A;  4JI0 I;  2UU9 E;  4DU8 A;  1S4E A;  4Z7C A;  3T1Y E;  2BM1 A;  2X36 A;  3ZZU A;  4HYM A;  1J5E I;  3Q1Q A;  4B3T E;  3K85 A;  4DR3 E;  4X66 I;  1XMO E;  4UTG A;  4DPT A;  3HJC A;  4B3S I;  4X62 I;  1EI1 A;  4JI4 I;  4PRX A;  1KTV A;  4WUD A;  1IBK I;  4LF5 E;  5IT9 C;  2Q2E B;  5L3J A;  1BKN A;  4LF4 E;  2VQE E;  3D4J A;  4DV6 E;  2CG9 A;  3QT8 A;  1HNX E;  4IZJ B;  1Z0T A;  4DR5 I;  4YY3 E;  1IBL E;  2V2V A;  3OTO E;  2UUB I;  2Z5B B;  4MYU A;  5BR8 I;  3B78 A;  2E5L I;  1N34 E;  1Z0V A;  4X62 E;  4IZJ A;  4JI4 E;  1XNR I;  1HNZ I;  4GKK E;  3P06 A;  1FJG I;  4LF5 I;  4KHP I;  1IBM I;  3J81 C;  4LF8 I;  4JI3 E;  4B3M E;  4HY1 A;  4IZK A;  1XNQ E;  1HNX I;  1Y4U A;  4JI8 E;  1ZXM A;  4ED4 A;  4YY3 I;  4USK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...