2UXCE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcE02
1FJGE 1Z5BA 4DV0E 4JI3E 1XMQI 1IBKE 4LFBE 1RREA 4JI2I 4LFAI 1H72C 2HK2A 1H7UA 1WUUA 1N32E 2YT4A 2HFSA 4I3HA 1ZXMA 1XHKA 1RR9A 2NA2A 3WU4A 2E5LE 1MG7A 3J81C 1FWLA 2F4VE 2L2MA 4X8WA 4LF9E 5CFFE 1MU5A 2LBSB 2L33A 1ZM9A 4DV3E 4LF9I 1DARA 4HACB 1OJ4A 4LF7I 4LF8E 1T4OA 4UTGA 2Q2EB 4ZVIA 2E5LI 4FWDA 4DV4I 4DU8A 1Z0BA 5IT9Q 3ZZ0A 4LFAE 4EMDA 5GMDA 1FNMA 2A2DA 1FJGI 4JI7E 1I94I 2ZM6I 2ZITA 4HACA 1IBLE 5IWAE 1VISA 4DV6E 1HNZI 1GQEA 1IBME 2ZBKB 4JV5E 4DUZI 4JI8I 4RPFA 1Z5CA 4P52A 2OI2A 4USMA 1H74A 3GONA 1HNWI 3P1XA 1NZ0A 1XNRE 2BM0A 3ZZUA 4JI5I 3Q1QA 5LMUE 4JG4A 4R1FA 4DV2I 1A6FA 2V2ZA 4DR6I 2B3TB 2UXBE 1K47A 4LF6I 3ZZTA 2VQFI 3WU5A 4B3SI 4DR4I 1J5EI 4UT4A 1HR0E 3ADJA 1RC7A 2LUQA 3B8HA 4X65I 4JI1I 1H7SA 3ZM7A 1O0WA 2BV3A 4WYQB 2NPFA 2L3JA 1X47A 4JI2E 4M2ZA 1YYKA 4PU9A 2VQEE 2UU9E 2UXCI 4DR6E 4DV2E 1ZM2A 4DR1E 3T1YE 2DB2A 5LMNI 1XNRI 3ZKDA 3D4JA 4JI6I 1ZXNA 2B7VA 2XEXA 3V5RA 4DPTA 4WUBA 3J7AM 5IWAI 4DXLA 4DV7E 4DR3I 2BM1A 1Z5AA 1KIJA 3B82A 4DU7A 4K0KI 4KQVA 4URLA 3QT8A 5FLXQ 1ZBTA 4YHHE 1QZRA 2VQEI 1X49A 5LMUI 4FW9A 4JI5E 4M1KA 4OOGC 1EA6A 1N36E 4HYMA 4DUZE 2HK3A 4JV5I 1Z0TA 2LTRA 4DV6I 1ELOA 4B3ME 2IHR1 1ZM4A 2LRSA 4B3SE 2HHHI 5BR8E 4X62I 3OTOE 2NUEA 4GKJI 1S4EA 1H73A 1FKAE 4LFCI 4DPUA 1N33I 5FLXC 2DEJA 4GKJE 4DV4E 4LF7E 1UEKA 2CZ9A 5LL6R 4DUYI 1X48A 2NUGA 3HTXA 4JI8E 3J81Q 4JI0I 1J26A 1WHNA 4ED4A 4DR2E 3VYXA 3VYYA 5GMEA 2R3VA 4B3RE 4JI0E 2F4VI 2LJHA 2ZM6E 1QU6A 1S16A 4WFTA 4JI7I 1HNXE 2LTSA 4JYAE 4GKKI 2HKEA 2VF3A 2X36A 4HY1A 4YHHI 1N33E 4JI3I 4JYAI 4X64I 5IT9C 4K0KE 4JI4I 1ZM3A 4MYTA 2UUBI 4LF8I 4DR5E 3ADIA 4AQYE 1BKNA 4DR2I 4Z7YA 2E1RA 3V2UC 2JVAA 4DR1I 2RS7A 1N34E 4FN5A 3CWVA 2UXCE 2UU9I 1IBKI 1N0VC 3OTOI 3J7Yp 2R42A 1STUA 1EI1A 2V2VA 3QT7A 4LF5E 4DPWA 4DPXA 2B7TA 2UUCE 2RS6A 4NXNE 2DMYA 1B62A 3F0NA 3LPSA 3JAMC 1T4NA 1Z0GA 2DIXA 2WW4A 4DR4E 3QT6A 3JAMQ 4P7AA 2UXDE 4XTJA 1WHQA 2AJ4A 4OX9I 3K17A 4DR7I 1KKHA 3M6AA 4DV5E 2UUAI 3T1HI 4PRXA 2L3CA 4M30A 4WUCA 2V8PA 3H4LA 3J7AG 4NXNI 4X65E 1FWKA 2X7IA 1XNQE 4KHPI 4DV1I 4JI6E 1Z0VA 4USKA 4LF5I 1I94E 4NXMI 5LMNE 1J5EE 1NHIA 5L3JA 4DUYE 1T4LB 4LF6E 2UXBI 3PYGA 1YYWA 2A2CA 1Z0WA 1MX0A 3LTOA 4DKKA 4DV3I 1KVKA 4LF4E 4NXME 4AQYI 4DV1E 4KHPE 4LF4I 2VQFE 1EKZA 3B78A 2LJPA 4FWHA 3ADGA 1B63A 4LFBI 1XMQE 1D6TA 2RSMA 1HNXI 1PIEA 4HXZA 1HNWE 5A2QQ 2EFGA 1IBMI 5A2QC 4YY3E 2GS8A 4DR3E 3PYFA 2HFUA 3C4TA 4PRVA 2N3HA 1XNQI 1RQ0A 2KHXA 2L2KB 1U2RA 2V34A 2DEIA 3QT5A 1YZ9A 2UUCI 1Z0CA 2LUPB 4FWGA 1N32I 1UILA 4LFCE 4X66I 1UHZA 4X62E 5BR8I 4OX9E 4DR7E 2HHHE 1PVGA 3WU3A 4DPYA 3ZKBA 1N34I 2UXDI 2EZ6A 4B3MI 3PYDA 4B3TE 2CPNA 1KTVA 1XMOE 2RTXA 1XMOI 4JI1E 1N36I 1YYOA 2NUFA 4DR5I 1NHHA 1HR0I 3T1HE 3C4BA 4DV0I 3LLHA 4X66E 2UUAE 4DV5I 4X64E 3K1JA 4WUDA 2V2QA 3WU6A 4DV7I 4GKKE 1Z0EA 1DI2A 1PKPA 1NHJA 3HULA 2JY9A 2MDRA 1N0UA 3PYEA 2J7KA 3LNUA 2HKJA 3J80Q 2L2NA 2N3GA 4B3RI 1FI4A 4MYUA 4YY3I 3J80C 1HNZE 4B3TI 3ADLA 1IBLI 2UUBE 3T1YI 1Z59A 4JI4E 4Z7CA
chains in the Genus database with same CATH superfamily
1FJGE 1Z5BA 4DV0E 2DGCA 4JI3E 1T38A 3NZKA 1XMQI 1IBKE 4JI4E 2EL5A 4LFBE 1RREA 4LOMA 1H72C 3M85G 4JI2I 2ELYA 1KJKA 2HK2A 4LFAI 1H7UA 1WUUA 4BA2A 4AM3A 1N32E 2YT4A 2HFSA 4I3HA 1USUA 1ZXMA 1XHKA 1Z1BA 1RR9A 2GHFA 2NA2A 3WU4A 4R2QA 3THNA 2EPMX 2E5LE 2M7QA 3J81C 1MG7A 2EOHA 1FWLA 3JU0A 2F4VE 2L2MA 4X8WA 1RHYA 1QNTA 5FWKA 2EMBA 1ZAAC 4LF9E 2PNMA 3F6HA 5CFFE 1MU5A 2LBSB 2L33A 1ZM9A 4DV3E 1IQSA 4LF9I 1DARA 2NN6C 4HACB 1OJ4A 2C39B 4LF7I 4LF8E 4BC7A 1KYQA 1T4OA 4UTGA 2Q2EB 4ZVIA 2E5LI 4FWDA 4DV4I 4DU8A 2YTOA 2MC6A 1Z0BA 5IT9Q 2M1SA 2LT7A 3ZZ0A 4LFAE 2Z5BA 2CGEA 4EMDA 1A1JA 5GMDA 2JXPA 1YHCA 1FNMA 2WBUA 2PO0B 2RSIA 1Y5YA 4JI7E 2EOQA 2A2DA 1FJGI 2EQ1A 2PO2A 4MU0A 4F6MA 3EQ1A 1E3PA 4DV2I 2ZM6I 2ZITA 1I94I 2EM3A 4HACA 1IBLE 5IWAE 3DF6A 1VISA 4DV6E 1HNZI 1GQEA 2EMHA 1IBME 2ZBKB 3BBGA 4JV5E 4DUZI 4JI8I 3H1CA 1Z5CA 4RPFA 4P52A 2OI2A 4U3DA 4USMA 1H74A 3GONA 5AC5A 2PNLA 5AE2A 1HNWI 1MGTA 4IZJA 2E1MA 3P1XA 1NZ0A 1XNRE 2BM0A 2L8TA 3ZZUA 4JI5I 3PRYA 3Q1QA 5LMUE 4BA1A 1GTKA 2PO0A 4JG4A 4FW5A 2LCEA 4R1FA 1NEIA 2LVHA 3C6KA 4F9BB 2JE6B 3HXLA 1A6FA 2EM5A 2V2ZA 4MU1A 4OZEA 4U3BA 2B3TB 4DR6I 2UXBE 1K47A 3GLLA 4LF6I 2JEBA 2YU8A 3ZZTA 2VQFI 2EOSA 3WU5A 4B3SI 4DR4I 1J5EI 2PRTA 4UT4A 3UK3C 1HR0E 3P3CA 3ADJA 3H09A 1PDAA 2LUQA 1RC7A 1GZ6A 3B8HA 4IZKA 3LMLA 1A1FA 2N8XA 4X65I 2K7IA 5KL6A 3HJCA 2M9AA 4JI1I 1H7SA 5C0XC 4ZYDA 4M9VC 3ZM7A 1O0WA 4OO1E 1A1LA 1Y4SA 2BV3A 3K85A 4WYQB 3QG5C 2NPFA 2L3JA 3EPHA 2MKDA 1X47A 4FK5C 2JT2A 2EQ0A 4JI2E 2WZOA 3TQMA 2V88A 4M2ZA 2CTDA 1YYKA 2BA1D 4NHRA 5K36E 4PU9A 3Q6MA 5KL5A 2VQEE 2EMAA 2UU9E 2UXCI 4KWYA 1PJTA 4DR6E 4DV2E 2AE8A 1UBDC 1ZM2A 4DR1E 3T1YE 1UN6B 4BCAA 2DB2A 4R2EA 1AAYA 5LMNI 5K36D 2WNRA 1XNRI 1RMDA 3ZKDA 3D4JA 3IWBA 4JI6I 4Z7CA 2LV2A 2YRMA 5A6BA 2CG9A 1ZXNA 2B7VA 2XEXA 2O3ZA 2EPNA 4LCFA 3V5RA 2JYAA 1YPNA 4NZVA 4DPTA 4WUBA 3J7AM 2ADRA 2Z5EA 5IWAI 4DXLA 4DV7E 1SFEA 2DMIA 2NN6E 4DR3I 2EOYA 5EL9A 5C0XE 2BM1A 1Z5AA 2YTNA 1KIJA 3B82A 3CDIA 4DU7A 5JEAE 4K0KI 4KQVA 4QNJA 4Q28A 4URLA 2V8QB 3QT8A 4FW3A 5FLXQ 4R2RA 2V83A 1WXRA 1ZBTA 4YHHE 1QZRA 4R03A 2IERA 1IQOA 3PS1A 1X49A 2VQEI 2JPAA 4GQUA 4FW9A 3HPSA 2JP9A 4JI5E 1L4SA 4IZJB 4M1KA 5LMUI 1YUIA 4OOGC 2EMXA 1EA6A 1N36E 3BF2A 3MSWA 1F2IG 3PS2A 4MQYA 4HYMA 5ADZA 4R2CA 2EOFA 4LCHA 4DUZE 4IJDA 2HK3A 2C37A 2O1TA 1Z0TA 3GCMA 2LTRA 4JV5I 5K36B 2BR2B 5JEAB 5KL2A 4KZSA 4DV6I 1YFHA 4F9CB 1ELOA 2JWOA 2WBTA 4B3ME 2PO2B 2IHR1 4J3DA 3M85D 1ZM4A 2YTIA 4IS9A 2LRSA 4B3SE 2YSPA 2HHHI 4AIDA 5BR8E 4X62I 3OTOE 2NUEA 2EJ4A 4GKJI 3KRNA 1S4EA 3L00A 1H73A 2EPCA 1FKAE 2ELZA 4LFCI 2EP3A 4DPUA 1N33I 2EQ3A 2EM9A 2EPXA 3MHHC 4MLQA 5FLXC 5A6KA 2DEJA 2BB8A 3U1YA 4GKJE 4DV4E 1P47A 3HPZA 2GO4A 2ODRC 4LF7E 1UEKA 2WP8B 2CZ9A 5LL6R 3FIGA 2MC5A 2D9HA 1X48A 4GZNC 4IZJD 2NUGA 1WJPA 4JI8E 3HTXA 3J81Q 4ZYGA 4JI0I 1J26A 4F54A 1WHNA 4ED4A 4DR2E 3VYXA 3VYYA 4LPFA 4R2AA 2EN4A 5GMEA 2R3VA 4B3RE 2EMIA 4JI0E 4I8OA 4ZYEA 1X5WA 2F4VI 2LJHA 2ZM6E 3M7NG 1QU6A 1S16A 5JEAD 4WFTA 2R1FA 5IXMB 2NN6D 1X6FA 4JI7I 1HNXE 2EM0A 2YWQA 2LTSA 5A6JA 1X3CA 2YTDA 4JYAE 1EH8A 2IOPA 5LLQA 4TUIA 4GKKI 2CVEA 2HKEA 2VF3A 2X36A 3P06A 4HY1A 3U1KA 4YHHI 3JTZA 1N33E 2R76A 4JI3I 2Z5BB 4JYAI 4X64I 5IT9C 3RMPA 2F1DA 4K0KE 2C38B 3OMLA 1A1HA 4JI4I 5DRRA 1TF6A 4R2PA 1ZM3A 5C0XF 4MYTA 2UUBI 4LF8I 4LTYA 4DR5E 3AV0A 1JK2A 3ADIA 1Y6ZA 4IFDB 4AQYE 2FGGA 1BKNA 4MLVA 2Q8UA 5DNLA 2YTQA 4DR2I 4Z7YA 1JK1A 2KONA 4OO1B 2WBSA 2E1RA 4M0VA 2WCC3 3V2UC 2BR2A 4R8OA 2JEAA 1EH7A 2JVAA 2Z5CA 3DJWA 5JEAC 2EOXA 2EPOA 4TUGA 4DUYI 4DR1I 4J8ZA 2YZTA 2RS7A 3KWRA 2L6MA 1N34E 1YUJA 2NN6B 3CWVA 4FN5A 2UXCE 2UU9I 1IBKI 5IV8B 2IESA 2EMYA 1N0VC 4BA2B 3OTOI 3J7Yp 1B69A 5C0XA 2EPPA 4X9JA 2FTXB 2Z5CB 4O4KA 1STUA 2R42A 2YTGA 1EI1A 2V2VA 3CDJA 2JEAB 3ZOQB 2I13A 3QT7A 4LF5E 1G2FC 4DPWA 1A1KA 4DPXA 2B7TA 2UUCE 4OO1A 2RS6A 4WX9A 4NXNE 4IZKB 2DMYA 1B62A 5DROA 3F0NA 4RHBB 5EKWA 4IFDA 2V85A 4IFDD 4F6NA 3LPSA 2PO1B 3JAMC 2BA1G 4Q35B 2EM4A 2EN6A 1T4NA 1HK7A 2DIXA 1Z0GA 2WW4A 4DR4E 2JEBB 4OO1D 3QT6A 2H36X 3EPLA 3JAMQ 4P78A 2UXDE 4P7AA 2EPKX 4XTJA 5C0XB 1WHQA 2YTEA 2LJUA 1DQ3A 2AJ4A 5AE3A 1NCSA 1UDQA 4OX9I 3K17A 4DR7I 2EMFA 2VRDA 1KKHA 1G2DC 3M6AA 4HEIA 4DV5E 2UUAI 4FW6A 2O1WA 3EPJA 3T1HI 3BGHA 2MKNA 2EOOA 2ENHA 4PRXA 2YRKA 2L3CA 3KZZA 4M30A 2EMWA 3B4TA 4WSGA 2V8PA 4L8NA 2O1VA 3H4LA 3J7AG 4WUCA 4R2DA 4N3OA 4NXNI 1OYSA 2LMZA 2E72A 4X65E 2K4VA 1FWKA 2X7IA 4WSPA 1XNQE 4KHPI 4DV1I 4JI6E 1Z0VA 5KL7A 4USKA 2WP8A 1BBOA 4LF5I 1I94E 5ELWA 3AUZA 5K36F 5A6AA 2EN7A 4NXMI 5LMNE 4N4RB 1J5EE 1NHIA 1MEYC 4BBYA 3L7ZB 5L3JA 4OO1C 4DUYE 4LCGA 1T4LB 4LF6E 4MU3A 1N3GA 4IS1C 4ISAA 2UXBI 2HJJA 3PYGA 1LLMC 1PJQA 2B9DA 1YYWA 1X6EA 2EN1A 1TF3A 5C0XD 2A2CA 2EPRA 2DLKA 1Z0WA 2VESA 2V86A 5AE1A 2NN6F 2YPNA 5KL4A 1E3HA 1SR9A 2EPAA 1MX0A 3LTOA 4BA1B 2EN2A 2YTFA 2ODRD 4DKKA 3IWDA 4DV3I 3M99B 3Q6NA 1KVKA 4LF4E 1OYRA 4NXME 2O1UA 4AQYI 4O43A 4GEQB 4DV1E 4F2JC 4KHPE 1P42A 4LF4I 2FV4B 1TN9A 3VK6A 5K36C 2MDGA 2VQFE 1EKZA 2HC5A 3B78A 1ZR9A 3EPKA 2LE2A 2V87A 2LJPA 3P76A 4FWHA 4BC9A 2L92A 4QNKA 2I9IA 3P3EA 5DRPA 3ADGA 1B63A 2EM2A 4LFBI 1XMQE 1Y4UA 4AIMA 3MHSC 1D6TA 2RSMA 1HNXI 3F6GA 3ECRA 1PIEA 4HXZA 1HNWE 2J65A 3K6QA 5A2QQ 2GPIA 4LU9A 2RQLA 2BA0G 1UDOA 5F3WA 2EFGA 4FW7A 1IBMI 5A2QC 3HQ1A 2EL6A 3IWCA 4YY3E 4DR3E 4BHBA 2C39A 2GS8A 2EMKA 2HFUA 3C4TA 3HKMA 3PYFA 4PRVA 2N3HA 2YTPA 1XNQI 2YTJA 4HTGA 1BBGA 1UDNA 2C37B 2LO3A 3DD6A 5DRQA 1RQ0A 2KHXA 2L2KB 2KOUA 1U2RA 5DNXA 5JEAA 2EN3A 2DEIA 5AASA 1YH8A 2V34A 2EL4A 1YZ9A 2WNRB 3QT5A 5K36A 2GLIA 2EMCA 2UUCI 3VHTB 1Z0CA 2LUPB 4FWGA 1X6HA 2EWLA 2NABA 1N32I 1UILA 1WRJA 2CSHA 2ENAA 1R6MA 4DMIA 1YSAC 4LFCE 3PS3A 1USVA 2EOZA 4NBQA 4X66I 4WXCA 4F9AB 1UHZA 2JR1A 2BBGA 2IOQA 4X62E 1EH6A 5BR8I 1PJSA 4OX9E 4DR7E 2HHHE 1PVGA 3WU3A 4DPYA 3ZKBA 5T6JA 1N34I 2YSOA 2UXDI 3BIDA 3KZYA 2CT1A 3C6MA 2EZ6A 4B3MI 2EMGA 3PYDA 2DLQA 3GMEA 4B3TE 3L7ZA 2EPUA 2CPNA 2YRHA 1KTVA 1DGCA 2EOIA 2ENCA 4ZYHA 2RTXA 1XMOE 5JEAF 4OO1F 2V89A 2EMZA 4MDTA 1AH5A 2GO3A 4OKGA 2PNZA 1A1GA 1XMOI 4JI1E 2M4IA 4IFDF 4IFDC 5KL3A 2F8BA 4RH8A 1N36I 2DRPA 1R6LA 4FW4A 1YYOA 2NUFA 4WPYA 4DR5I 2G7HA 1NHHA 2EN8A 1HR0I 4R2SA 3C4BA 3T1HE 2EORA 2EPLX 1OYPA 4DV0I 1UDSA 2JOBA 3LLHA 4BMJA 2NN6A 4P7DA 4X66E 2RPCA 2UUAE 4DV5I 1ZBQA 5A69A 2J7JA 3M7ND 5DNYA 2EM7A 2DSYA 5AC4A 4X64E 3K1JA 4WUDA 2V2QA 4O5GA 3WU6A 4O24A 2EM8A 2EM6A 4DV7I 5TSEA 4GKKE 4L5NC 1Z0EA 4MU4A 1DI2A 1IMUA 2A25A 1PKPA 2YU5A 1NHJA 2JY9A 2VF1A 2MDRA 1T39A 1N0UA 2EOEA 3HULA 3PYEA 2HGHA 2J7KA 3LNUA 2HKJA 2JOXA 3THOB 2BA0D 2L2NA 3J80Q 2N3GA 1Y60A 2GQ0A 2EE8A 1BB8A 3UHMA 2PO1A 2EPZA 1VI7A 4B3RI 2PNZB 1FI4A 4MYUA 4YY3I 3J80C 2EMLA 1HNZE 3P3GA 4B3TI 3ADLA 2EOJA 1IBLI 2UUBE 3T1YI 4BS9A 2C38A 2VE7C 5A6BD 1A1IA 1XXEA 4IFDE 4BHCA 1Z59A 2EOMA 2JE6A 4WXDA 1ZU1A
chains in the Genus database with same CATH topology
1FJGE 1Z5BA 4DV0E 4JI3E 1XMQI 1IBKE 4LFBE 1RREA 4JI2I 4LFAI 1H72C 2HK2A 1H7UA 1WUUA 1N32E 2YT4A 2HFSA 4I3HA 1USUA 1ZXMA 1XHKA 1RR9A 2NA2A 3WU4A 2E5LE 1MG7A 2M7QA 3J81C 1FWLA 3JU0A 2F4VE 2L2MA 4X8WA 5FWKA 4LF9E 2PNMA 3F6HA 5CFFE 1MU5A 2LBSB 2L33A 1ZM9A 4DV3E 4LF9I 1DARA 4HACB 1OJ4A 4LF7I 4LF8E 4BC7A 1T4OA 4UTGA 2Q2EB 4ZVIA 2E5LI 4FWDA 4DV4I 4DU8A 2MC6A 1Z0BA 5IT9Q 2M1SA 3ZZ0A 4LFAE 2Z5BA 2CGEA 4EMDA 5GMDA 1FNMA 2A2DA 1FJGI 4JI7E 1I94I 2ZM6I 2ZITA 4HACA 1IBLE 5IWAE 3DF6A 1VISA 4DV6E 1HNZI 1GQEA 1IBME 2ZBKB 4JV5E 4DUZI 4JI8I 4RPFA 1Z5CA 4P52A 2OI2A 4USMA 1H74A 3GONA 2PNLA 5AE2A 1HNWI 4IZJA 2E1MA 3P1XA 1NZ0A 1XNRE 2BM0A 2L8TA 3ZZUA 4JI5I 3PRYA 3Q1QA 5LMUE 4JG4A 4R1FA 4F9BB 4DV2I 1A6FA 3HXLA 2V2ZA 4DR6I 2B3TB 2UXBE 1K47A 4LF6I 3ZZTA 2VQFI 3WU5A 4B3SI 4DR4I 1J5EI 4UT4A 1HR0E 3ADJA 3H09A 1RC7A 2LUQA 3B8HA 1GZ6A 4IZKA 3LMLA 4X65I 3HJCA 4JI1I 1H7SA 3ZM7A 1O0WA 1Y4SA 2BV3A 3K85A 4WYQB 2NPFA 2L3JA 1X47A 4JI2E 2WZOA 2V88A 4M2ZA 1YYKA 4PU9A 3Q6MA 2VQEE 2UU9E 2UXCI 4DR6E 4DV2E 1ZM2A 4DR1E 3T1YE 4BCAA 2DB2A 5LMNI 1XNRI 3ZKDA 3D4JA 3IWBA 4JI6I 2CG9A 1ZXNA 2B7VA 2XEXA 3V5RA 4DPTA 4WUBA 3J7AM 2Z5EA 5IWAI 4DXLA 4DV7E 4DR3I 2BM1A 1Z5AA 1KIJA 3B82A 4DU7A 4K0KI 4KQVA 4Q28A 4URLA 2V8QB 3QT8A 5FLXQ 2V83A 1WXRA 1ZBTA 4YHHE 1QZRA 4R03A 2VQEI 1X49A 5LMUI 4IZJB 4FW9A 3HPSA 4JI5E 4M1KA 4OOGC 1EA6A 1N36E 3MSWA 4HYMA 5ADZA 4DUZE 2HK3A 2O1TA 4JV5I 1Z0TA 2LTRA 4KZSA 4DV6I 4F9CB 1ELOA 2JWOA 4B3ME 2IHR1 1ZM4A 2LRSA 4B3SE 2HHHI 5BR8E 4X62I 3OTOE 2NUEA 4GKJI 1S4EA 1H73A 1FKAE 4LFCI 4DPUA 1N33I 5FLXC 2DEJA 4GKJE 4DV4E 3HPZA 2ODRC 4LF7E 1UEKA 2CZ9A 3FIGA 2MC5A 5LL6R 4IZJD 1X48A 4DUYI 2NUGA 3HTXA 4JI8E 3J81Q 4JI0I 1J26A 4F54A 1WHNA 4ED4A 4DR2E 3VYXA 3VYYA 5GMEA 2R3VA 4B3RE 4JI0E 4I8OA 2F4VI 2LJHA 2ZM6E 1QU6A 1S16A 4WFTA 4JI7I 1HNXE 2LTSA 4JYAE 2IOPA 4GKKI 4TUIA 2HKEA 2VF3A 2X36A 3P06A 4HY1A 4YHHI 3JTZA 1N33E 4JI3I 2Z5BB 4JYAI 4X64I 5IT9C 3RMPA 4K0KE 3OMLA 4JI4I 1ZM3A 4MYTA 2UUBI 4LF8I 4LTYA 4DR5E 3AV0A 3ADIA 1Y6ZA 4AQYE 2FGGA 1BKNA 4DR2I 4Z7YA 2KONA 2E1RA 4M0VA 3V2UC 4R8OA 2JVAA 2Z5CA 3DJWA 4TUGA 4DR1I 4J8ZA 2YZTA 2RS7A 3KWRA 2L6MA 1N34E 4FN5A 3CWVA 2UXCE 2UU9I 1IBKI 1N0VC 3OTOI 3J7Yp 2FTXB 2Z5CB 2R42A 1STUA 1EI1A 2V2VA 3ZOQB 3QT7A 4LF5E 4DPWA 4DPXA 2B7TA 2UUCE 2RS6A 4NXNE 4IZKB 2DMYA 1B62A 3F0NA 2V85A 3LPSA 3JAMC 1T4NA 1HK7A 2DIXA 1Z0GA 2WW4A 4DR4E 3QT6A 2H36X 3JAMQ 4P78A 2UXDE 4P7AA 4XTJA 1WHQA 1DQ3A 2AJ4A 5AE3A 4OX9I 3K17A 4DR7I 1KKHA 3M6AA 4DV5E 2UUAI 2O1WA 3T1HI 4PRXA 2L3CA 4M30A 4WUCA 2V8PA 4L8NA 2O1VA 3H4LA 3J7AG 4N3OA 4NXNI 2LMZA 4X65E 1FWKA 2K4VA 2X7IA 4WSPA 1XNQE 4KHPI 4DV1I 4JI6E 1Z0VA 4USKA 4LF5I 1I94E 3AUZA 4NXMI 5LMNE 1J5EE 1NHIA 5L3JA 4BBYA 4DUYE 1T4LB 4LF6E 2UXBI 3PYGA 2B9DA 1YYWA 2A2CA 1Z0WA 2V86A 5AE1A 1SR9A 1MX0A 3LTOA 2ODRD 4DKKA 3IWDA 4DV3I 3Q6NA 1KVKA 4LF4E 4NXME 2O1UA 4AQYI 4GEQB 4DV1E 4KHPE 4LF4I 2FV4B 3VK6A 2VQFE 1EKZA 3B78A 2LE2A 2V87A 2LJPA 4FWHA 4BC9A 2L92A 3ADGA 1B63A 4LFBI 1XMQE 1Y4UA 1D6TA 2RSMA 1HNXI 3F6GA 1PIEA 4HXZA 1HNWE 3K6QA 5A2QQ 4LU9A 5F3WA 2EFGA 1IBMI 5A2QC 3HQ1A 4YY3E 3IWCA 2GS8A 4DR3E 3PYFA 2HFUA 3C4TA 4PRVA 2N3HA 1XNQI 1RQ0A 2KHXA 2L2KB 2KOUA 1U2RA 2V34A 2DEIA 5AASA 3QT5A 1YZ9A 2UUCI 1Z0CA 2LUPB 4FWGA 2EWLA 1N32I 1UILA 4DMIA 4LFCE 1USVA 4X66I 4F9AB 1UHZA 2JR1A 2IOQA 4X62E 5BR8I 4OX9E 4DR7E 2HHHE 1PVGA 3WU3A 4DPYA 3ZKBA 5T6JA 1N34I 2UXDI 2EZ6A 4B3MI 3PYDA 4B3TE 2CPNA 1KTVA 1XMOE 2RTXA 2V89A 1XMOI 4JI1E 2M4IA 2F8BA 1N36I 1YYOA 2NUFA 4WPYA 4DR5I 2G7HA 1NHHA 1HR0I 3T1HE 3C4BA 4DV0I 2JOBA 3LLHA 4BMJA 4P7DA 4X66E 2UUAE 4DV5I 1ZBQA 5DNYA 2DSYA 4X64E 3K1JA 4WUDA 2V2QA 3WU6A 4DV7I 4GKKE 4L5NC 1Z0EA 1DI2A 1PKPA 1NHJA 2JY9A 2MDRA 2VF1A 1N0UA 3HULA 3PYEA 2J7KA 3LNUA 2HKJA 2JOXA 3J80Q 2L2NA 2N3GA 2GQ0A 4B3RI 1FI4A 4MYUA 4YY3I 3J80C 1HNZE 4B3TI 3ADLA 1IBLI 2UUBE 3T1YI 4BS9A 2VE7C 1Z59A 4JI4E 4Z7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG E;  1Z5B A;  4DV0 E;  4JI3 E;  1XMQ I;  1IBK E;  4LFB E;  1RRE A;  4JI2 I;  4LFA I;  1H72 C;  2HK2 A;  1H7U A;  1WUU A;  1N32 E;  2YT4 A;  2HFS A;  4I3H A;  1ZXM A;  1XHK A;  1RR9 A;  2NA2 A;  3WU4 A;  2E5L E;  1MG7 A;  3J81 C;  1FWL A;  2F4V E;  2L2M A;  4X8W A;  4LF9 E;  5CFF E;  1MU5 A;  2LBS B;  2L33 A;  1ZM9 A;  4DV3 E;  4LF9 I;  1DAR A;  4HAC B;  1OJ4 A;  4LF7 I;  4LF8 E;  1T4O A;  4UTG A;  2Q2E B;  4ZVI A;  2E5L I;  4FWD A;  4DV4 I;  4DU8 A;  1Z0B A;  5IT9 Q;  3ZZ0 A;  4LFA E;  4EMD A;  5GMD A;  1FNM A;  2A2D A;  1FJG I;  4JI7 E;  1I94 I;  2ZM6 I;  2ZIT A;  4HAC A;  1IBL E;  5IWA E;  1VIS A;  4DV6 E;  1HNZ I;  1GQE A;  1IBM E;  2ZBK B;  4JV5 E;  4DUZ I;  4JI8 I;  4RPF A;  1Z5C A;  4P52 A;  2OI2 A;  4USM A;  1H74 A;  3GON A;  1HNW I;  3P1X A;  1NZ0 A;  1XNR E;  2BM0 A;  3ZZU A;  4JI5 I;  3Q1Q A;  5LMU E;  4JG4 A;  4R1F A;  4DV2 I;  1A6F A;  2V2Z A;  4DR6 I;  2B3T B;  2UXB E;  1K47 A;  4LF6 I;  3ZZT A;  2VQF I;  3WU5 A;  4B3S I;  4DR4 I;  1J5E I;  4UT4 A;  1HR0 E;  3ADJ A;  1RC7 A;  2LUQ A;  3B8H A;  4X65 I;  4JI1 I;  1H7S A;  3ZM7 A;  1O0W A;  2BV3 A;  4WYQ B;  2NPF A;  2L3J A;  1X47 A;  4JI2 E;  4M2Z A;  1YYK A;  4PU9 A;  2VQE E;  2UU9 E;  2UXC I;  4DR6 E;  4DV2 E;  1ZM2 A;  4DR1 E;  3T1Y E;  2DB2 A;  5LMN I;  1XNR I;  3ZKD A;  3D4J A;  4JI6 I;  1ZXN A;  2B7V A;  2XEX A;  3V5R A;  4DPT A;  4WUB A;  3J7A M;  5IWA I;  4DXL A;  4DV7 E;  4DR3 I;  2BM1 A;  1Z5A A;  1KIJ A;  3B82 A;  4DU7 A;  4K0K I;  4KQV A;  4URL A;  3QT8 A;  5FLX Q;  1ZBT A;  4YHH E;  1QZR A;  2VQE I;  1X49 A;  5LMU I;  4FW9 A;  4JI5 E;  4M1K A;  4OOG C;  1EA6 A;  1N36 E;  4HYM A;  4DUZ E;  2HK3 A;  4JV5 I;  1Z0T A;  2LTR A;  4DV6 I;  1ELO A;  4B3M E;  2IHR 1;  1ZM4 A;  2LRS A;  4B3S E;  2HHH I;  5BR8 E;  4X62 I;  3OTO E;  2NUE A;  4GKJ I;  1S4E A;  1H73 A;  1FKA E;  4LFC I;  4DPU A;  1N33 I;  5FLX C;  2DEJ A;  4GKJ E;  4DV4 E;  4LF7 E;  1UEK A;  2CZ9 A;  5LL6 R;  4DUY I;  1X48 A;  2NUG A;  3HTX A;  4JI8 E;  3J81 Q;  4JI0 I;  1J26 A;  1WHN A;  4ED4 A;  4DR2 E;  3VYX A;  3VYY A;  5GME A;  2R3V A;  4B3R E;  4JI0 E;  2F4V I;  2LJH A;  2ZM6 E;  1QU6 A;  1S16 A;  4WFT A;  4JI7 I;  1HNX E;  2LTS A;  4JYA E;  4GKK I;  2HKE A;  2VF3 A;  2X36 A;  4HY1 A;  4YHH I;  1N33 E;  4JI3 I;  4JYA I;  4X64 I;  5IT9 C;  4K0K E;  4JI4 I;  1ZM3 A;  4MYT A;  2UUB I;  4LF8 I;  4DR5 E;  3ADI A;  4AQY E;  1BKN A;  4DR2 I;  4Z7Y A;  2E1R A;  3V2U C;  2JVA A;  4DR1 I;  2RS7 A;  1N34 E;  4FN5 A;  3CWV A;  2UXC E;  2UU9 I;  1IBK I;  1N0V C;  3OTO I;  3J7Y p;  2R42 A;  1STU A;  1EI1 A;  2V2V A;  3QT7 A;  4LF5 E;  4DPW A;  4DPX A;  2B7T A;  2UUC E;  2RS6 A;  4NXN E;  2DMY A;  1B62 A;  3F0N A;  3LPS A;  3JAM C;  1T4N A;  1Z0G A;  2DIX A;  2WW4 A;  4DR4 E;  3QT6 A;  3JAM Q;  4P7A A;  2UXD E;  4XTJ A;  1WHQ A;  2AJ4 A;  4OX9 I;  3K17 A;  4DR7 I;  1KKH A;  3M6A A;  4DV5 E;  2UUA I;  3T1H I;  4PRX A;  2L3C A;  4M30 A;  4WUC A;  2V8P A;  3H4L A;  3J7A G;  4NXN I;  4X65 E;  1FWK A;  2X7I A;  1XNQ E;  4KHP I;  4DV1 I;  4JI6 E;  1Z0V A;  4USK A;  4LF5 I;  1I94 E;  4NXM I;  5LMN E;  1J5E E;  1NHI A;  5L3J A;  4DUY E;  1T4L B;  4LF6 E;  2UXB I;  3PYG A;  1YYW A;  2A2C A;  1Z0W A;  1MX0 A;  3LTO A;  4DKK A;  4DV3 I;  1KVK A;  4LF4 E;  4NXM E;  4AQY I;  4DV1 E;  4KHP E;  4LF4 I;  2VQF E;  1EKZ A;  3B78 A;  2LJP A;  4FWH A;  3ADG A;  1B63 A;  4LFB I;  1XMQ E;  1D6T A;  2RSM A;  1HNX I;  1PIE A;  4HXZ A;  1HNW E;  5A2Q Q;  2EFG A;  1IBM I;  5A2Q C;  4YY3 E;  2GS8 A;  4DR3 E;  3PYF A;  2HFU A;  3C4T A;  4PRV A;  2N3H A;  1XNQ I;  1RQ0 A;  2KHX A;  2L2K B;  1U2R A;  2V34 A;  2DEI A;  3QT5 A;  1YZ9 A;  2UUC I;  1Z0C A;  2LUP B;  4FWG A;  1N32 I;  1UIL A;  4LFC E;  4X66 I;  1UHZ A;  4X62 E;  5BR8 I;  4OX9 E;  4DR7 E;  2HHH E;  1PVG A;  3WU3 A;  4DPY A;  3ZKB A;  1N34 I;  2UXD I;  2EZ6 A;  4B3M I;  3PYD A;  4B3T E;  2CPN A;  1KTV A;  1XMO E;  2RTX A;  1XMO I;  4JI1 E;  1N36 I;  1YYO A;  2NUF A;  4DR5 I;  1NHH A;  1HR0 I;  3T1H E;  3C4B A;  4DV0 I;  3LLH A;  4X66 E;  2UUA E;  4DV5 I;  4X64 E;  3K1J A;  4WUD A;  2V2Q A;  3WU6 A;  4DV7 I;  4GKK E;  1Z0E A;  1DI2 A;  1PKP A;  1NHJ A;  3HUL A;  2JY9 A;  2MDR A;  1N0U A;  3PYE A;  2J7K A;  3LNU A;  2HKJ A;  3J80 Q;  2L2N A;  2N3G A;  4B3R I;  1FI4 A;  4MYU A;  4YY3 I;  3J80 C;  1HNZ E;  4B3T I;  3ADL A;  1IBL I;  2UUB E;  3T1Y I;  1Z59 A;  4JI4 E;  4Z7C A; 
#chains in the Genus database with same CATH topology
 1FJG E;  1Z5B A;  4DV0 E;  2DGC A;  4JI3 E;  1T38 A;  3NZK A;  1XMQ I;  1IBK E;  4JI4 E;  2EL5 A;  4LFB E;  1RRE A;  4LOM A;  1H72 C;  3M85 G;  4JI2 I;  2ELY A;  1KJK A;  2HK2 A;  4LFA I;  1H7U A;  1WUU A;  4BA2 A;  4AM3 A;  1N32 E;  2YT4 A;  2HFS A;  4I3H A;  1USU A;  1ZXM A;  1XHK A;  1Z1B A;  1RR9 A;  2GHF A;  2NA2 A;  3WU4 A;  4R2Q A;  3THN A;  2EPM X;  2E5L E;  2M7Q A;  3J81 C;  1MG7 A;  2EOH A;  1FWL A;  3JU0 A;  2F4V E;  2L2M A;  4X8W A;  1RHY A;  1QNT A;  5FWK A;  2EMB A;  1ZAA C;  4LF9 E;  2PNM A;  3F6H A;  5CFF E;  1MU5 A;  2LBS B;  2L33 A;  1ZM9 A;  4DV3 E;  1IQS A;  4LF9 I;  1DAR A;  2NN6 C;  4HAC B;  1OJ4 A;  2C39 B;  4LF7 I;  4LF8 E;  4BC7 A;  1KYQ A;  1T4O A;  4UTG A;  2Q2E B;  4ZVI A;  2E5L I;  4FWD A;  4DV4 I;  4DU8 A;  2YTO A;  2MC6 A;  1Z0B A;  5IT9 Q;  2M1S A;  2LT7 A;  3ZZ0 A;  4LFA E;  2Z5B A;  2CGE A;  4EMD A;  1A1J A;  5GMD A;  2JXP A;  1YHC A;  1FNM A;  2WBU A;  2PO0 B;  2RSI A;  1Y5Y A;  4JI7 E;  2EOQ A;  2A2D A;  1FJG I;  2EQ1 A;  2PO2 A;  4MU0 A;  4F6M A;  3EQ1 A;  1E3P A;  4DV2 I;  2ZM6 I;  2ZIT A;  1I94 I;  2EM3 A;  4HAC A;  1IBL E;  5IWA E;  3DF6 A;  1VIS A;  4DV6 E;  1HNZ I;  1GQE A;  2EMH A;  1IBM E;  2ZBK B;  3BBG A;  4JV5 E;  4DUZ I;  4JI8 I;  3H1C A;  1Z5C A;  4RPF A;  4P52 A;  2OI2 A;  4U3D A;  4USM A;  1H74 A;  3GON A;  5AC5 A;  2PNL A;  5AE2 A;  1HNW I;  1MGT A;  4IZJ A;  2E1M A;  3P1X A;  1NZ0 A;  1XNR E;  2BM0 A;  2L8T A;  3ZZU A;  4JI5 I;  3PRY A;  3Q1Q A;  5LMU E;  4BA1 A;  1GTK A;  2PO0 A;  4JG4 A;  4FW5 A;  2LCE A;  4R1F A;  1NEI A;  2LVH A;  3C6K A;  4F9B B;  2JE6 B;  3HXL A;  1A6F A;  2EM5 A;  2V2Z A;  4MU1 A;  4OZE A;  4U3B A;  2B3T B;  4DR6 I;  2UXB E;  1K47 A;  3GLL A;  4LF6 I;  2JEB A;  2YU8 A;  3ZZT A;  2VQF I;  2EOS A;  3WU5 A;  4B3S I;  4DR4 I;  1J5E I;  2PRT A;  4UT4 A;  3UK3 C;  1HR0 E;  3P3C A;  3ADJ A;  3H09 A;  1PDA A;  2LUQ A;  1RC7 A;  1GZ6 A;  3B8H A;  4IZK A;  3LML A;  1A1F A;  2N8X A;  4X65 I;  2K7I A;  5KL6 A;  3HJC A;  2M9A A;  4JI1 I;  1H7S A;  5C0X C;  4ZYD A;  4M9V C;  3ZM7 A;  1O0W A;  4OO1 E;  1A1L A;  1Y4S A;  2BV3 A;  3K85 A;  4WYQ B;  3QG5 C;  2NPF A;  2L3J A;  3EPH A;  2MKD A;  1X47 A;  4FK5 C;  2JT2 A;  2EQ0 A;  4JI2 E;  2WZO A;  3TQM A;  2V88 A;  4M2Z A;  2CTD A;  1YYK A;  2BA1 D;  4NHR A;  5K36 E;  4PU9 A;  3Q6M A;  5KL5 A;  2VQE E;  2EMA A;  2UU9 E;  2UXC I;  4KWY A;  1PJT A;  4DR6 E;  4DV2 E;  2AE8 A;  1UBD C;  1ZM2 A;  4DR1 E;  3T1Y E;  1UN6 B;  4BCA A;  2DB2 A;  4R2E A;  1AAY A;  5LMN I;  5K36 D;  2WNR A;  1XNR I;  1RMD A;  3ZKD A;  3D4J A;  3IWB A;  4JI6 I;  4Z7C A;  2LV2 A;  2YRM A;  5A6B A;  2CG9 A;  1ZXN A;  2B7V A;  2XEX A;  2O3Z A;  2EPN A;  4LCF A;  3V5R A;  2JYA A;  1YPN A;  4NZV A;  4DPT A;  4WUB A;  3J7A M;  2ADR A;  2Z5E A;  5IWA I;  4DXL A;  4DV7 E;  1SFE A;  2DMI A;  2NN6 E;  4DR3 I;  2EOY A;  5EL9 A;  5C0X E;  2BM1 A;  1Z5A A;  2YTN A;  1KIJ A;  3B82 A;  3CDI A;  4DU7 A;  5JEA E;  4K0K I;  4KQV A;  4QNJ A;  4Q28 A;  4URL A;  2V8Q B;  3QT8 A;  4FW3 A;  5FLX Q;  4R2R A;  2V83 A;  1WXR A;  1ZBT A;  4YHH E;  1QZR A;  4R03 A;  2IER A;  1IQO A;  3PS1 A;  1X49 A;  2VQE I;  2JPA A;  4GQU A;  4FW9 A;  3HPS A;  2JP9 A;  4JI5 E;  1L4S A;  4IZJ B;  4M1K A;  5LMU I;  1YUI A;  4OOG C;  2EMX A;  1EA6 A;  1N36 E;  3BF2 A;  3MSW A;  1F2I G;  3PS2 A;  4MQY A;  4HYM A;  5ADZ A;  4R2C A;  2EOF A;  4LCH A;  4DUZ E;  4IJD A;  2HK3 A;  2C37 A;  2O1T A;  1Z0T A;  3GCM A;  2LTR A;  4JV5 I;  5K36 B;  2BR2 B;  5JEA B;  5KL2 A;  4KZS A;  4DV6 I;  1YFH A;  4F9C B;  1ELO A;  2JWO A;  2WBT A;  4B3M E;  2PO2 B;  2IHR 1;  4J3D A;  3M85 D;  1ZM4 A;  2YTI A;  4IS9 A;  2LRS A;  4B3S E;  2YSP A;  2HHH I;  4AID A;  5BR8 E;  4X62 I;  3OTO E;  2NUE A;  2EJ4 A;  4GKJ I;  3KRN A;  1S4E A;  3L00 A;  1H73 A;  2EPC A;  1FKA E;  2ELZ A;  4LFC I;  2EP3 A;  4DPU A;  1N33 I;  2EQ3 A;  2EM9 A;  2EPX A;  3MHH C;  4MLQ A;  5FLX C;  5A6K A;  2DEJ A;  2BB8 A;  3U1Y A;  4GKJ E;  4DV4 E;  1P47 A;  3HPZ A;  2GO4 A;  2ODR C;  4LF7 E;  1UEK A;  2WP8 B;  2CZ9 A;  5LL6 R;  3FIG A;  2MC5 A;  2D9H A;  1X48 A;  4GZN C;  4IZJ D;  2NUG A;  1WJP A;  4JI8 E;  3HTX A;  3J81 Q;  4ZYG A;  4JI0 I;  1J26 A;  4F54 A;  1WHN A;  4ED4 A;  4DR2 E;  3VYX A;  3VYY A;  4LPF A;  4R2A A;  2EN4 A;  5GME A;  2R3V A;  4B3R E;  2EMI A;  4JI0 E;  4I8O A;  4ZYE A;  1X5W A;  2F4V I;  2LJH A;  2ZM6 E;  3M7N G;  1QU6 A;  1S16 A;  5JEA D;  4WFT A;  2R1F A;  5IXM B;  2NN6 D;  1X6F A;  4JI7 I;  1HNX E;  2EM0 A;  2YWQ A;  2LTS A;  5A6J A;  1X3C A;  2YTD A;  4JYA E;  1EH8 A;  2IOP A;  5LLQ A;  4TUI A;  4GKK I;  2CVE A;  2HKE A;  2VF3 A;  2X36 A;  3P06 A;  4HY1 A;  3U1K A;  4YHH I;  3JTZ A;  1N33 E;  2R76 A;  4JI3 I;  2Z5B B;  4JYA I;  4X64 I;  5IT9 C;  3RMP A;  2F1D A;  4K0K E;  2C38 B;  3OML A;  1A1H A;  4JI4 I;  5DRR A;  1TF6 A;  4R2P A;  1ZM3 A;  5C0X F;  4MYT A;  2UUB I;  4LF8 I;  4LTY A;  4DR5 E;  3AV0 A;  1JK2 A;  3ADI A;  1Y6Z A;  4IFD B;  4AQY E;  2FGG A;  1BKN A;  4MLV A;  2Q8U A;  5DNL A;  2YTQ A;  4DR2 I;  4Z7Y A;  1JK1 A;  2KON A;  4OO1 B;  2WBS A;  2E1R A;  4M0V A;  2WCC 3;  3V2U C;  2BR2 A;  4R8O A;  2JEA A;  1EH7 A;  2JVA A;  2Z5C A;  3DJW A;  5JEA C;  2EOX A;  2EPO A;  4TUG A;  4DUY I;  4DR1 I;  4J8Z A;  2YZT A;  2RS7 A;  3KWR A;  2L6M A;  1N34 E;  1YUJ A;  2NN6 B;  3CWV A;  4FN5 A;  2UXC E;  2UU9 I;  1IBK I;  5IV8 B;  2IES A;  2EMY A;  1N0V C;  4BA2 B;  3OTO I;  3J7Y p;  1B69 A;  5C0X A;  2EPP A;  4X9J A;  2FTX B;  2Z5C B;  4O4K A;  1STU A;  2R42 A;  2YTG A;  1EI1 A;  2V2V A;  3CDJ A;  2JEA B;  3ZOQ B;  2I13 A;  3QT7 A;  4LF5 E;  1G2F C;  4DPW A;  1A1K A;  4DPX A;  2B7T A;  2UUC E;  4OO1 A;  2RS6 A;  4WX9 A;  4NXN E;  4IZK B;  2DMY A;  1B62 A;  5DRO A;  3F0N A;  4RHB B;  5EKW A;  4IFD A;  2V85 A;  4IFD D;  4F6N A;  3LPS A;  2PO1 B;  3JAM C;  2BA1 G;  4Q35 B;  2EM4 A;  2EN6 A;  1T4N A;  1HK7 A;  2DIX A;  1Z0G A;  2WW4 A;  4DR4 E;  2JEB B;  4OO1 D;  3QT6 A;  2H36 X;  3EPL A;  3JAM Q;  4P78 A;  2UXD E;  4P7A A;  2EPK X;  4XTJ A;  5C0X B;  1WHQ A;  2YTE A;  2LJU A;  1DQ3 A;  2AJ4 A;  5AE3 A;  1NCS A;  1UDQ A;  4OX9 I;  3K17 A;  4DR7 I;  2EMF A;  2VRD A;  1KKH A;  1G2D C;  3M6A A;  4HEI A;  4DV5 E;  2UUA I;  4FW6 A;  2O1W A;  3EPJ A;  3T1H I;  3BGH A;  2MKN A;  2EOO A;  2ENH A;  4PRX A;  2YRK A;  2L3C A;  3KZZ A;  4M30 A;  2EMW A;  3B4T A;  4WSG A;  2V8P A;  4L8N A;  2O1V A;  3H4L A;  3J7A G;  4WUC A;  4R2D A;  4N3O A;  4NXN I;  1OYS A;  2LMZ A;  2E72 A;  4X65 E;  2K4V A;  1FWK A;  2X7I A;  4WSP A;  1XNQ E;  4KHP I;  4DV1 I;  4JI6 E;  1Z0V A;  5KL7 A;  4USK A;  2WP8 A;  1BBO A;  4LF5 I;  1I94 E;  5ELW A;  3AUZ A;  5K36 F;  5A6A A;  2EN7 A;  4NXM I;  5LMN E;  4N4R B;  1J5E E;  1NHI A;  1MEY C;  4BBY A;  3L7Z B;  5L3J A;  4OO1 C;  4DUY E;  4LCG A;  1T4L B;  4LF6 E;  4MU3 A;  1N3G A;  4IS1 C;  4ISA A;  2UXB I;  2HJJ A;  3PYG A;  1LLM C;  1PJQ A;  2B9D A;  1YYW A;  1X6E A;  2EN1 A;  1TF3 A;  5C0X D;  2A2C A;  2EPR A;  2DLK A;  1Z0W A;  2VES A;  2V86 A;  5AE1 A;  2NN6 F;  2YPN A;  5KL4 A;  1E3H A;  1SR9 A;  2EPA A;  1MX0 A;  3LTO A;  4BA1 B;  2EN2 A;  2YTF A;  2ODR D;  4DKK A;  3IWD A;  4DV3 I;  3M99 B;  3Q6N A;  1KVK A;  4LF4 E;  1OYR A;  4NXM E;  2O1U A;  4AQY I;  4O43 A;  4GEQ B;  4DV1 E;  4F2J C;  4KHP E;  1P42 A;  4LF4 I;  2FV4 B;  1TN9 A;  3VK6 A;  5K36 C;  2MDG A;  2VQF E;  1EKZ A;  2HC5 A;  3B78 A;  1ZR9 A;  3EPK A;  2LE2 A;  2V87 A;  2LJP A;  3P76 A;  4FWH A;  4BC9 A;  2L92 A;  4QNK A;  2I9I A;  3P3E A;  5DRP A;  3ADG A;  1B63 A;  2EM2 A;  4LFB I;  1XMQ E;  1Y4U A;  4AIM A;  3MHS C;  1D6T A;  2RSM A;  1HNX I;  3F6G A;  3ECR A;  1PIE A;  4HXZ A;  1HNW E;  2J65 A;  3K6Q A;  5A2Q Q;  2GPI A;  4LU9 A;  2RQL A;  2BA0 G;  1UDO A;  5F3W A;  2EFG A;  4FW7 A;  1IBM I;  5A2Q C;  3HQ1 A;  2EL6 A;  3IWC A;  4YY3 E;  4DR3 E;  4BHB A;  2C39 A;  2GS8 A;  2EMK A;  2HFU A;  3C4T A;  3HKM A;  3PYF A;  4PRV A;  2N3H A;  2YTP A;  1XNQ I;  2YTJ A;  4HTG A;  1BBG A;  1UDN A;  2C37 B;  2LO3 A;  3DD6 A;  5DRQ A;  1RQ0 A;  2KHX A;  2L2K B;  2KOU A;  1U2R A;  5DNX A;  5JEA A;  2EN3 A;  2DEI A;  5AAS A;  1YH8 A;  2V34 A;  2EL4 A;  1YZ9 A;  2WNR B;  3QT5 A;  5K36 A;  2GLI A;  2EMC A;  2UUC I;  3VHT B;  1Z0C A;  2LUP B;  4FWG A;  1X6H A;  2EWL A;  2NAB A;  1N32 I;  1UIL A;  1WRJ A;  2CSH A;  2ENA A;  1R6M A;  4DMI A;  1YSA C;  4LFC E;  3PS3 A;  1USV A;  2EOZ A;  4NBQ A;  4X66 I;  4WXC A;  4F9A B;  1UHZ A;  2JR1 A;  2BBG A;  2IOQ A;  4X62 E;  1EH6 A;  5BR8 I;  1PJS A;  4OX9 E;  4DR7 E;  2HHH E;  1PVG A;  3WU3 A;  4DPY A;  3ZKB A;  5T6J A;  1N34 I;  2YSO A;  2UXD I;  3BID A;  3KZY A;  2CT1 A;  3C6M A;  2EZ6 A;  4B3M I;  2EMG A;  3PYD A;  2DLQ A;  3GME A;  4B3T E;  3L7Z A;  2EPU A;  2CPN A;  2YRH A;  1KTV A;  1DGC A;  2EOI A;  2ENC A;  4ZYH A;  2RTX A;  1XMO E;  5JEA F;  4OO1 F;  2V89 A;  2EMZ A;  4MDT A;  1AH5 A;  2GO3 A;  4OKG A;  2PNZ A;  1A1G A;  1XMO I;  4JI1 E;  2M4I A;  4IFD F;  4IFD C;  5KL3 A;  2F8B A;  4RH8 A;  1N36 I;  2DRP A;  1R6L A;  4FW4 A;  1YYO A;  2NUF A;  4WPY A;  4DR5 I;  2G7H A;  1NHH A;  2EN8 A;  1HR0 I;  4R2S A;  3C4B A;  3T1H E;  2EOR A;  2EPL X;  1OYP A;  4DV0 I;  1UDS A;  2JOB A;  3LLH A;  4BMJ A;  2NN6 A;  4P7D A;  4X66 E;  2RPC A;  2UUA E;  4DV5 I;  1ZBQ A;  5A69 A;  2J7J A;  3M7N D;  5DNY A;  2EM7 A;  2DSY A;  5AC4 A;  4X64 E;  3K1J A;  4WUD A;  2V2Q A;  4O5G A;  3WU6 A;  4O24 A;  2EM8 A;  2EM6 A;  4DV7 I;  5TSE A;  4GKK E;  4L5N C;  1Z0E A;  4MU4 A;  1DI2 A;  1IMU A;  2A25 A;  1PKP A;  2YU5 A;  1NHJ A;  2JY9 A;  2VF1 A;  2MDR A;  1T39 A;  1N0U A;  2EOE A;  3HUL A;  3PYE A;  2HGH A;  2J7K A;  3LNU A;  2HKJ A;  2JOX A;  3THO B;  2BA0 D;  2L2N A;  3J80 Q;  2N3G A;  1Y60 A;  2GQ0 A;  2EE8 A;  1BB8 A;  3UHM A;  2PO1 A;  2EPZ A;  1VI7 A;  4B3R I;  2PNZ B;  1FI4 A;  4MYU A;  4YY3 I;  3J80 C;  2EML A;  1HNZ E;  3P3G A;  4B3T I;  3ADL A;  2EOJ A;  1IBL I;  2UUB E;  3T1Y I;  4BS9 A;  2C38 A;  2VE7 C;  5A6B D;  1A1I A;  1XXE A;  4IFD E;  4BHC A;  1Z59 A;  2EOM A;  2JE6 A;  4WXD A;  1ZU1 A; 
#chains in the Genus database with same CATH homology
 1FJG E;  1Z5B A;  4DV0 E;  4JI3 E;  1XMQ I;  1IBK E;  4LFB E;  1RRE A;  4JI2 I;  4LFA I;  1H72 C;  2HK2 A;  1H7U A;  1WUU A;  1N32 E;  2YT4 A;  2HFS A;  4I3H A;  1USU A;  1ZXM A;  1XHK A;  1RR9 A;  2NA2 A;  3WU4 A;  2E5L E;  1MG7 A;  2M7Q A;  3J81 C;  1FWL A;  3JU0 A;  2F4V E;  2L2M A;  4X8W A;  5FWK A;  4LF9 E;  2PNM A;  3F6H A;  5CFF E;  1MU5 A;  2LBS B;  2L33 A;  1ZM9 A;  4DV3 E;  4LF9 I;  1DAR A;  4HAC B;  1OJ4 A;  4LF7 I;  4LF8 E;  4BC7 A;  1T4O A;  4UTG A;  2Q2E B;  4ZVI A;  2E5L I;  4FWD A;  4DV4 I;  4DU8 A;  2MC6 A;  1Z0B A;  5IT9 Q;  2M1S A;  3ZZ0 A;  4LFA E;  2Z5B A;  2CGE A;  4EMD A;  5GMD A;  1FNM A;  2A2D A;  1FJG I;  4JI7 E;  1I94 I;  2ZM6 I;  2ZIT A;  4HAC A;  1IBL E;  5IWA E;  3DF6 A;  1VIS A;  4DV6 E;  1HNZ I;  1GQE A;  1IBM E;  2ZBK B;  4JV5 E;  4DUZ I;  4JI8 I;  4RPF A;  1Z5C A;  4P52 A;  2OI2 A;  4USM A;  1H74 A;  3GON A;  2PNL A;  5AE2 A;  1HNW I;  4IZJ A;  2E1M A;  3P1X A;  1NZ0 A;  1XNR E;  2BM0 A;  2L8T A;  3ZZU A;  4JI5 I;  3PRY A;  3Q1Q A;  5LMU E;  4JG4 A;  4R1F A;  4F9B B;  4DV2 I;  1A6F A;  3HXL A;  2V2Z A;  4DR6 I;  2B3T B;  2UXB E;  1K47 A;  4LF6 I;  3ZZT A;  2VQF I;  3WU5 A;  4B3S I;  4DR4 I;  1J5E I;  4UT4 A;  1HR0 E;  3ADJ A;  3H09 A;  1RC7 A;  2LUQ A;  3B8H A;  1GZ6 A;  4IZK A;  3LML A;  4X65 I;  3HJC A;  4JI1 I;  1H7S A;  3ZM7 A;  1O0W A;  1Y4S A;  2BV3 A;  3K85 A;  4WYQ B;  2NPF A;  2L3J A;  1X47 A;  4JI2 E;  2WZO A;  2V88 A;  4M2Z A;  1YYK A;  4PU9 A;  3Q6M A;  2VQE E;  2UU9 E;  2UXC I;  4DR6 E;  4DV2 E;  1ZM2 A;  4DR1 E;  3T1Y E;  4BCA A;  2DB2 A;  5LMN I;  1XNR I;  3ZKD A;  3D4J A;  3IWB A;  4JI6 I;  2CG9 A;  1ZXN A;  2B7V A;  2XEX A;  3V5R A;  4DPT A;  4WUB A;  3J7A M;  2Z5E A;  5IWA I;  4DXL A;  4DV7 E;  4DR3 I;  2BM1 A;  1Z5A A;  1KIJ A;  3B82 A;  4DU7 A;  4K0K I;  4KQV A;  4Q28 A;  4URL A;  2V8Q B;  3QT8 A;  5FLX Q;  2V83 A;  1WXR A;  1ZBT A;  4YHH E;  1QZR A;  4R03 A;  2VQE I;  1X49 A;  5LMU I;  4IZJ B;  4FW9 A;  3HPS A;  4JI5 E;  4M1K A;  4OOG C;  1EA6 A;  1N36 E;  3MSW A;  4HYM A;  5ADZ A;  4DUZ E;  2HK3 A;  2O1T A;  4JV5 I;  1Z0T A;  2LTR A;  4KZS A;  4DV6 I;  4F9C B;  1ELO A;  2JWO A;  4B3M E;  2IHR 1;  1ZM4 A;  2LRS A;  4B3S E;  2HHH I;  5BR8 E;  4X62 I;  3OTO E;  2NUE A;  4GKJ I;  1S4E A;  1H73 A;  1FKA E;  4LFC I;  4DPU A;  1N33 I;  5FLX C;  2DEJ A;  4GKJ E;  4DV4 E;  3HPZ A;  2ODR C;  4LF7 E;  1UEK A;  2CZ9 A;  3FIG A;  2MC5 A;  5LL6 R;  4IZJ D;  1X48 A;  4DUY I;  2NUG A;  3HTX A;  4JI8 E;  3J81 Q;  4JI0 I;  1J26 A;  4F54 A;  1WHN A;  4ED4 A;  4DR2 E;  3VYX A;  3VYY A;  5GME A;  2R3V A;  4B3R E;  4JI0 E;  4I8O A;  2F4V I;  2LJH A;  2ZM6 E;  1QU6 A;  1S16 A;  4WFT A;  4JI7 I;  1HNX E;  2LTS A;  4JYA E;  2IOP A;  4GKK I;  4TUI A;  2HKE A;  2VF3 A;  2X36 A;  3P06 A;  4HY1 A;  4YHH I;  3JTZ A;  1N33 E;  4JI3 I;  2Z5B B;  4JYA I;  4X64 I;  5IT9 C;  3RMP A;  4K0K E;  3OML A;  4JI4 I;  1ZM3 A;  4MYT A;  2UUB I;  4LF8 I;  4LTY A;  4DR5 E;  3AV0 A;  3ADI A;  1Y6Z A;  4AQY E;  2FGG A;  1BKN A;  4DR2 I;  4Z7Y A;  2KON A;  2E1R A;  4M0V A;  3V2U C;  4R8O A;  2JVA A;  2Z5C A;  3DJW A;  4TUG A;  4DR1 I;  4J8Z A;  2YZT A;  2RS7 A;  3KWR A;  2L6M A;  1N34 E;  4FN5 A;  3CWV A;  2UXC E;  2UU9 I;  1IBK I;  1N0V C;  3OTO I;  3J7Y p;  2FTX B;  2Z5C B;  2R42 A;  1STU A;  1EI1 A;  2V2V A;  3ZOQ B;  3QT7 A;  4LF5 E;  4DPW A;  4DPX A;  2B7T A;  2UUC E;  2RS6 A;  4NXN E;  4IZK B;  2DMY A;  1B62 A;  3F0N A;  2V85 A;  3LPS A;  3JAM C;  1T4N A;  1HK7 A;  2DIX A;  1Z0G A;  2WW4 A;  4DR4 E;  3QT6 A;  2H36 X;  3JAM Q;  4P78 A;  2UXD E;  4P7A A;  4XTJ A;  1WHQ A;  1DQ3 A;  2AJ4 A;  5AE3 A;  4OX9 I;  3K17 A;  4DR7 I;  1KKH A;  3M6A A;  4DV5 E;  2UUA I;  2O1W A;  3T1H I;  4PRX A;  2L3C A;  4M30 A;  4WUC A;  2V8P A;  4L8N A;  2O1V A;  3H4L A;  3J7A G;  4N3O A;  4NXN I;  2LMZ A;  4X65 E;  1FWK A;  2K4V A;  2X7I A;  4WSP A;  1XNQ E;  4KHP I;  4DV1 I;  4JI6 E;  1Z0V A;  4USK A;  4LF5 I;  1I94 E;  3AUZ A;  4NXM I;  5LMN E;  1J5E E;  1NHI A;  5L3J A;  4BBY A;  4DUY E;  1T4L B;  4LF6 E;  2UXB I;  3PYG A;  2B9D A;  1YYW A;  2A2C A;  1Z0W A;  2V86 A;  5AE1 A;  1SR9 A;  1MX0 A;  3LTO A;  2ODR D;  4DKK A;  3IWD A;  4DV3 I;  3Q6N A;  1KVK A;  4LF4 E;  4NXM E;  2O1U A;  4AQY I;  4GEQ B;  4DV1 E;  4KHP E;  4LF4 I;  2FV4 B;  3VK6 A;  2VQF E;  1EKZ A;  3B78 A;  2LE2 A;  2V87 A;  2LJP A;  4FWH A;  4BC9 A;  2L92 A;  3ADG A;  1B63 A;  4LFB I;  1XMQ E;  1Y4U A;  1D6T A;  2RSM A;  1HNX I;  3F6G A;  1PIE A;  4HXZ A;  1HNW E;  3K6Q A;  5A2Q Q;  4LU9 A;  5F3W A;  2EFG A;  1IBM I;  5A2Q C;  3HQ1 A;  4YY3 E;  3IWC A;  2GS8 A;  4DR3 E;  3PYF A;  2HFU A;  3C4T A;  4PRV A;  2N3H A;  1XNQ I;  1RQ0 A;  2KHX A;  2L2K B;  2KOU A;  1U2R A;  2V34 A;  2DEI A;  5AAS A;  3QT5 A;  1YZ9 A;  2UUC I;  1Z0C A;  2LUP B;  4FWG A;  2EWL A;  1N32 I;  1UIL A;  4DMI A;  4LFC E;  1USV A;  4X66 I;  4F9A B;  1UHZ A;  2JR1 A;  2IOQ A;  4X62 E;  5BR8 I;  4OX9 E;  4DR7 E;  2HHH E;  1PVG A;  3WU3 A;  4DPY A;  3ZKB A;  5T6J A;  1N34 I;  2UXD I;  2EZ6 A;  4B3M I;  3PYD A;  4B3T E;  2CPN A;  1KTV A;  1XMO E;  2RTX A;  2V89 A;  1XMO I;  4JI1 E;  2M4I A;  2F8B A;  1N36 I;  1YYO A;  2NUF A;  4WPY A;  4DR5 I;  2G7H A;  1NHH A;  1HR0 I;  3T1H E;  3C4B A;  4DV0 I;  2JOB A;  3LLH A;  4BMJ A;  4P7D A;  4X66 E;  2UUA E;  4DV5 I;  1ZBQ A;  5DNY A;  2DSY A;  4X64 E;  3K1J A;  4WUD A;  2V2Q A;  3WU6 A;  4DV7 I;  4GKK E;  4L5N C;  1Z0E A;  1DI2 A;  1PKP A;  1NHJ A;  2JY9 A;  2MDR A;  2VF1 A;  1N0U A;  3HUL A;  3PYE A;  2J7K A;  3LNU A;  2HKJ A;  2JOX A;  3J80 Q;  2L2N A;  2N3G A;  2GQ0 A;  4B3R I;  1FI4 A;  4MYU A;  4YY3 I;  3J80 C;  1HNZ E;  4B3T I;  3ADL A;  1IBL I;  2UUB E;  3T1Y I;  4BS9 A;  2VE7 C;  1Z59 A;  4JI4 E;  4Z7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...