2UXCE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcE02
1HR0E 1MU5A 2L3JA 4LFAE 4YY3E 1XMQI 2YT4A 4JI7I 4USKA 3M6AA 1RQ0A 2UU9I 4DV5E 5IT9C 4JI2I 1PVGA 3CWVA 1HNWE 1YZ9A 2V2VA 2RS6A 2LTSA 2BM1A 4LF4I 2F4VI 1VISA 3B8HA 2LTRA 3VYXA 4JI6E 3PYGA 5GMDA 5IWAI 4DR6E 4DPYA 5A2QC 2ZBKB 4DPTA 4OX9I 4LFCE 4DV2I 4Z7CA 3VYYA 1WUUA 4DPUA 2UXBI 3GONA 1WHQA 2LUPB 2E5LE 1DARA 3V2UC 4FN5A 1Z5CA 1UILA 3WU3A 4MYUA 3JAMC 4JI7E 3J81C 3ZZTA 5IWAE 4JV5I 1O0WA 1H72C 1J5EI 1B63A 3LTOA 1FJGI 2HFUA 4LF7E 2RS7A 1T4LB 4JI0E 1Z0CA 1FJGE 4JI6I 1Z0WA 4JI4I 1RR9A 2OI2A 1N0UA 2VQFI 4DKKA 4B3SE 4DPWA 4FWDA 2DB2A 3K17A 1RREA 2UXBE 1N32I 4JI1I 4WUDA 3C4BA 1HR0I 2XEXA 1ZM4A 5A2QQ 2GS8A 2NUEA 2KHXA 4K0KI 2RTXA 3JAMQ 1Z0EA 4X66I 2UUBI 1PKPA 3F0NA 4DV1I 4B3RE 3LLHA 1S4EA 1OJ4A 4X64E 2HFSA 2F4VE 4JI5I 5BR8I 1XMQE 4YY3I 1UEKA 1ZM9A 3K1JA 1ZBTA 4DXLA 4JI2E 1Z0VA 1H73A 4GKJE 1J26A 1B62A 4X62E 4DU8A 3ADGA 2V2QA 2V34A 4DR2I 4OX9E 4P7AA 4LF8I 1I94E 4DV0I 4KHPI 2LBSB 4DR4E 3PYEA 4YHHI 1X48A 2A2CA 1EA6A 3ZM7A 4LF5I 2L33A 3T1YI 3OTOE 4USMA 1J5EE 2DEJA 1NHJA 4LF4E 1T4NA 4DV0E 4KHPE 4X8WA 2L2NA 3B82A 1DI2A 4DUYE 4M30A 2A2DA 1N34I 4B3TE 1IBLE 1WHNA 2X36A 4DV6E 1IBKI 3HULA 4DV4E 4B3SI 2BV3A 3QT7A 4DR5I 3B78A 1K47A 2LUQA 3P1XA 4M1KA 2HK2A 4B3ME 2N3GA 5LMNI 1YYKA 1N36E 2LJHA 4EMDA 3ZZUA 1A6FA 4JI0I 4GKKE 4JYAE 1KKHA 4HACA 4DV3I 4R1FA 4JYAI 1IBMI 4YHHE 2VQEE 4OOGC 2UUAI 1BKNA 5FLXQ 4DU7A 4WFTA 2L2KB 4DV7I 1XMOI 2RSMA 1U2RA 4KQVA 4DV5I 4LFBE 4DR5E 2B7VA 4DUZE 2MDRA 1HNZE 1N33I 1HNXI 4DR7E 4LFCI 1EI1A 1XMOE 2X7IA 5LMUI 2CPNA 2HKJA 2UUCI 1PIEA 2JY9A 1HNXE 2V2ZA 4DV4I 2B7TA 3QT5A 3OTOI 2UXDI 4DR3E 4NXNE 1ZXNA 4M2ZA 4DV7E 4DUYI 1H7SA 1H7UA 4PRVA 1I94I 3J81Q 2UXCE 1ELOA 3LPSA 2DIXA 4JI8E 2L3CA 2VQEI 3Q1QA 2R3VA 1FWLA 3QT8A 1MX0A 1XHKA 1QU6A 5CFFE 1Z0TA 4RPFA 2EZ6A 3T1HE 3WU4A 2B3TB 2NPFA 3ZKBA 4DR1E 3H4LA 2JVAA 1N0VC 4Z7YA 3D4JA 3WU5A 1QZRA 4DR1I 1Z59A 4I3HA 2VQFE 4X65E 2VF3A 4LF6I 1T4OA 2NA2A 4DV3E 4JI3I 4HY1A 2N3HA 2DMYA 4FWGA 4X65I 3PYDA 1NHHA 3ADJA 3J7Yp 1Z0BA 4DR7I 2WW4A 1D6TA 4LF5E 3ADLA 1N33E 4P52A 1HNZI 4JI1E 2ZM6E 4ZVIA 4X62I 2BM0A 1YYWA 2HK3A 2UUCE 4UT4A 5LMNE 4B3MI 1NZ0A 4ED4A 1NHIA 4DV2E 1IBME 1IBKE 2DEIA 4DV6I 2ZITA 4DUZI 4DPXA 3T1YE 4FWHA 4B3RI 3QT6A 1H74A 4MYTA 1FNMA 4LF6E 1XNQE 3ADIA 4UTGA 4JI5E 4WUBA 5GMEA 4NXNI 4JI3E 1KIJA 1X49A 4DV1E 2UXDE 1YYOA 4URLA 1N32E 3J80C 1IBLI 2E5LI 1ZM3A 1XNRE 1S16A 4JI8I 2AJ4A 4JV5E 4LFAI 3T1HI 4NXME 1KVKA 4B3TI 1EKZA 4GKJI 1Z0GA 3PYFA 3ZZ0A 2L2MA 1STUA 4LF7I 5LL6R 3C4TA 2UXCI 4HXZA 3LNUA 2IHR1 1KTVA 1Z5AA 5FLXC 1N36I 1UHZA 5BR8E 2UUAE 3J80Q 1XNQI 1MG7A 4LF8E 4JI4E 1RC7A 1FKAE 4DR3I 2CZ9A 2R42A 1GQEA 2V8PA 4DR6I 2EFGA 1N34E 1HNWI 4FW9A 4XTJA 4HYMA 4HACB 2HKEA 2LJPA 1ZM2A 3HTXA 4DR2E 5L3JA 1Z5BA 1ZXMA 1FWKA 4PU9A 3J7AG 2LRSA 4X64I 2ZM6I 3ZKDA 1XNRI 4LFBI 1X47A 2NUGA 2UU9E 4X66E 2UUBE 4PRXA 2Q2EB 4AQYI 3J7AM 3V5RA 2HHHI 4LF9I 4WYQB 2E1RA 1FI4A 3WU6A 4AQYE 4GKKI 2J7KA 4DR4I 4K0KE 2HHHE 2NUFA 4LF9E 4NXMI 5LMUE 4JG4A 5IT9Q 4WUCA
chains in the Genus database with same CATH superfamily
1HR0E 1MU5A 5T6JA 2JR1A 2L3JA 4LFAE 4YY3E 1XMQI 2NN6A 2YT4A 4JI7I 4USKA 2YSPA 3EQ1A 3M6AA 1RQ0A 2UU9I 4DV5E 2FV4B 5IT9C 4JI2I 1KJKA 1PVGA 3CWVA 1HNWE 2V88A 3AV0A 5C0XC 1Y4SA 1YZ9A 2V2VA 2EOMA 3M85G 2EQ1A 2RS6A 3PS2A 2LTSA 2BM1A 5A6KA 4LF4I 5FWKA 4IZJD 2F4VI 1VISA 2C39A 1Y6ZA 3B8HA 2LTRA 2EM4A 2WZOA 2EOQA 3VYXA 4JI6E 3M85D 3H1CA 4BHBA 3PYGA 1UDSA 5GMDA 2PRTA 5IWAI 2EM2A 3HPSA 1Y60A 4DR6E 4X9JA 4DPYA 4DUZI 5A2QC 2MKDA 2ZBKB 4M9VC 2EP3A 2Z5EA 4DPTA 2YTEA 2YRMA 2JP9A 4OX9I 2EMCA 4LFCE 3B4TA 4DV2I 4AIDA 4WXDA 4R2EA 2C39B 2AE8A 1DGCA 3P06A 2IOPA 4Z7CA 3VYYA 1YPNA 2ELZA 3BF2A 1USUA 1WUUA 3ECRA 4DPUA 2ENAA 2YTFA 3GONA 1WHQA 2LUPB 5K36B 3IWBA 2E5LE 1DARA 1XXEA 3V2UC 3PS3A 2YPNA 2ODRC 4FN5A 4IZKB 1Z5CA 4Q28A 1UILA 1T39A 4F9AB 3WU3A 3JAMC 2HGHA 4MYUA 4JI7E 3J81C 3ZZTA 5IWAE 2JOBA 4R8OA 4JV5I 1O0WA 1PDAA 1Z1BA 1YUJA 2EMFA 1H72C 1RHYA 1J5EI 1B63A 4F6MA 3LTOA 2EL6A 3EPJA 3JTZA 1A1GA 1FJGI 4ISAA 1TF6A 2HFUA 3C6MA 2EE8A 4WPYA 4F54A 4LF7E 2RS7A 1T4LB 4JI0E 2PNLA 1Z0CA 1FJGE 2EN8A 5A6AA 2IOQA 4JI6I 1Z0WA 1A1FA 1WRJA 4JI4I 1RR9A 2M1SA 4IS1C 2BB8A 2EM5A 3HXLA 4DMIA 1T38A 4RHBB 1N0UA 2OI2A 2M4IA 2VQFI 4DKKA 4B3SE 4DPWA 3U1KA 3MHHC 4FWDA 1N36I 3UHMA 2MC5A 5KL5A 2NABA 2F8BA 2DB2A 3K17A 1RREA 3DJWA 3BBGA 1UBDC 1YFHA 3IWDA 2UXBE 4IZJA 4O24A 1N32I 4JI1I 4WUDA 5DNXA 2RPCA 3C4BA 1A1IA 1X6HA 2EPCA 5AC4A 1YSAC 2EM9A 2L92A 5ADZA 1HR0I 2XEXA 1ZM4A 2C37A 5A2QQ 2WP8B 2EN3A 1ZU1A 2EM0A 2NUEA 2GS8A 4R2QA 1IMUA 4IFDD 4BC7A 2EPZA 2EMIA 2KHXA 2RTXA 3JAMQ 4K0KI 3EPKA 1Z0EA 5F3WA 4X66I 2V83A 3CDJA 2UUBI 1PKPA 3F0NA 2YTGA 4DV1I 4B3RE 3LLHA 1S4EA 4O4KA 4P78A 4HEIA 4MLVA 1OJ4A 5JEAD 2WCC3 4R2DA 5DRRA 4X64E 2HFSA 2F4VE 4JI5I 2HC5A 2EPRA 5BR8I 1XMQE 4YY3I 1UEKA 2PNZA 3EPLA 3NZKA 4IFDB 4LCHA 3MHSC 1ZM9A 2C37B 1N3GA 2EORA 2EMAA 3F6HA 3K1JA 4O43A 1ZBTA 3DF6A 2PO0A 4DXLA 4JI2E 2BR2B 1Z0VA 1H73A 4OKGA 2VE7C 4GKJE 4MLQA 2EPPA 4KWYA 1J26A 4X62E 1B62A 4DU8A 2PO1A 3GCMA 3ADGA 2V2QA 2K4VA 2ODRD 2V8QB 5LLQA 2V34A 2WNRA 3IWCA 4BA1B 2ELYA 1BBOA 1F2IG 4DR2I 2GHFA 3H09A 4ZYHA 4OX9E 1P42A 1R6MA 4P7AA 4LF8I 2EOSA 1TF3A 3THOB 2JT2A 3JU0A 1R6LA 1AAYA 5A6BA 2EM6A 2EMWA 2EN7A 5A69A 3HQ1A 1I94E 4TUIA 3CDIA 5DRPA 4QNKA 4DV0I 2EN6A 1PJQA 4KHPI 2LBSB 4DR4E 3PYEA 4R03A 4BC9A 2GLIA 4TUGA 2YTNA 2JEBB 4YHHI 1X48A 2EOYA 2A2CA 2PO0B 4L8NA 4IS9A 1EA6A 3ZM7A 4LF5I 2L33A 4GEQB 3T1YI 1Y5YA 3OTOE 4USMA 3L7ZA 1QNTA 1J5EE 2DEJA 2G7HA 2DSYA 4BA2A 1SFEA 2YWQA 1NHJA 4OO1B 4LF4E 2HJJA 5KL3A 3Q6NA 1T4NA 4DV0E 4KHPE 2JEAA 4X8WA 2JPAA 2L2NA 2I9IA 1A1KA 2VRDA 3B82A 1DI2A 4F9BB 4DUYE 3TQMA 2JE6B 2EMZA 4M30A 4F2JC 5C0XF 4U3DA 2EN1A 2V87A 2A2DA 1N34I 4B3TE 1IBLE 3M99B 1WHNA 2YU8A 2X36A 2JOXA 2DLKA 4DV6E 1IBKI 3HULA 2LO3A 4DV4E 4OO1D 4B3SI 4ZYEA 2BV3A 3GLLA 3QT7A 1JK1A 1E3HA 4FW7A 4DR5I 3B78A 1K47A 5A6BD 2LUQA 3P1XA 1E3PA 1AH5A 4M1KA 2HK2A 1B69A 4B3ME 2N3GA 3KZYA 4N4RB 3VK6A 1N36E 1YYKA 1YHCA 2LJHA 4U3BA 4OO1F 4EMDA 3ZZUA 1A6FA 4JI0I 4OO1C 3P3GA 3EPHA 2A25A 2EOHA 1BBGA 4GKKE 4JYAE 1KKHA 2Z5BB 4F9CB 4HACA 4DV3I 1MEYC 2LMZA 4R1FA 2L6MA 3HPZA 4JYAI 2MKNA 1IBMI 4YHHE 2VQEE 4OOGC 2Z5CB 1BKNA 2UUAI 5FLXQ 3FIGA 2EL5A 1OYRA 5K36C 2PNMA 5DRQA 4DU7A 2R1FA 2YTOA 4WFTA 2DLQA 3AUZA 5A6JA 3QG5C 2L2KB 4DV7I 1XMOI 4J8ZA 2RSMA 2K7IA 4R2CA 1U2RA 2M7QA 4KQVA 4DV5I 4LFBE 4DR5E 2B7VA 4DUZE 2JEBA 4OZEA 2WBUA 2MDRA 1HNZE 2L8TA 3HKMA 2V86A 4FW6A 1N33I 2EOJA 1HNXI 2BA0G 5JEAB 4DR7E 4LFCI 5TSEA 5KL2A 1EI1A 1XMOE 2X7IA 5LMUI 4MU1A 2CPNA 2HKJA 4FW4A 2LJUA 2UUCI 2VF1A 5K36E 5DROA 2BA1G 4R2SA 1PIEA 5AE3A 2JY9A 1HNXE 1KYQA 2V2ZA 4DV4I 2B7TA 3QT5A 3OTOI 2UXDI 2WBTA 5EKWA 4DR3E 4NXNE 1ZXNA 3F6GA 2EPLX 2YZTA 2BA1D 2NN6D 4M2ZA 2EMXA 4DV7E 4LU9A 5C0XA 4DUYI 1VI7A 2PNZB 4OO1E 1H7SA 1H7UA 4PRVA 1I94I 3J81Q 2EPOA 2UXCE 1ELOA 3LPSA 4R2RA 2EMKA 2DIXA 2EM8A 4JI8E 2L3CA 2VQEI 5AC5A 3M7NG 3Q1QA 4AM3A 3K6QA 4RH8A 2R76A 1FWLA 2R3VA 3QT8A 2C38A 2CG9A 1MX0A 1XHKA 1NCSA 2J65A 1MGTA 1QU6A 5CFFE 1Z0TA 4RPFA 2EZ6A 2KONA 3T1HE 2EOFA 4HTGA 4M0VA 1DQ3A 2ENCA 3WU4A 2B3TB 5C0XE 2CGEA 2NPFA 3ZKBA 4DR1E 1HK7A 3H4LA 4AIMA 2IERA 2WP8A 2JVAA 1N0VC 4Z7YA 3D4JA 3WU5A 1QZRA 4DR1I 2EM3A 1Z59A 4I3HA 2EPKX 2VQFE 4X65E 3P3EA 2BBGA 2VF3A 4LF6I 1T4OA 5ELWA 4MU4A 1Y4UA 2NA2A 1EH7A 4DV3E 5AE2A 1GZ6A 2LE2A 2EOEA 1RMDA 4JI3I 4HY1A 4N3OA 5K36D 2EN4A 2EPXA 2N3HA 2EMYA 2DMYA 1USVA 4FWGA 1G2FC 4IZJB 4X65I 2YRHA 3PYDA 1NHHA 1TN9A 2O1TA 2GQ0A 3ADJA 2V85A 3MSWA 3PS1A 1EH6A 2NN6B 4MQYA 5K36A 3J7Yp 2EMHA 4R2PA 1ZBQA 2BR2A 3LMLA 1Z0BA 4IZKA 2WW4A 2GO4A 4DR7I 4LF5E 1D6TA 3ADLA 1N33E 4ZYDA 2BA0D 2YU5A 4P52A 1HNZI 4JI1E 2ZM6E 4ZVIA 4X62I 1YUIA 4IFDF 2E1MA 2EMGA 2BM0A 1YYWA 4BHCA 3VHTB 2HK3A 2ENHA 1X6FA 2UUCE 1X6EA 4OO1A 5LMNE 4UT4A 5JEAE 4B3MI 1UDNA 2EPNA 1A1LA 1LLMC 4BS9A 3KZZA 2V89A 1UN6B 1NZ0A 2FTXB 4ED4A 2YTPA 1NHIA 4GQUA 4DV2E 2E72A 2EWLA 1IBME 1IBKE 2DEIA 4DV6I 2EMBA 2ZITA 3Q6MA 2H36X 2EPMX 5KL4A 3T1YE 1YH8A 4LPFA 4Q35B 4MU0A 4FWHA 4DPXA 3P76A 2CVEA 2EN2A 2N8XA 2YTQA 1H74A 3QT6A 4MYTA 2VESA 4B3RI 2DGCA 2JYAA 4LF6E 1FNMA 1JK2A 1XNQE 3ADIA 5AASA 2EPUA 3UK3C 2GO3A 4LCFA 4UTGA 3M7ND 5C0XD 2YSOA 4BCAA 4JI5E 4IFDC 4WUBA 1PJTA 2FGGA 5EL9A 5GMEA 2JWOA 1UDOA 4LTYA 4NXNI 2O1UA 4JI3E 1KIJA 1X49A 2O1WA 4DV1E 2UXDE 1YYOA 4NHRA 4WSGA 4URLA 3GMEA 3J80C 1N32E 4FK5C 1G2DC 1WXRA 2Q8UA 1IBLI 5IXMB 5C0XB 1ZM3A 2E5LI 1GTKA 2D9HA 1XNRE 2KOUA 3KWRA 4L5NC 1S16A 2PO2B 1ZR9A 2AJ4A 2Z5CA 4JI8I 3OMLA 2DMIA 2O1VA 4WSPA 4BA2B 2YTDA 4JV5E 3U1YA 4LFAI 4F6NA 4IFDA 2EM7A 4BBYA 3T1HI 1IQSA 5KL6A 4NXME 1X5WA 2ADRA 1KVKA 3THNA 4B3TI 1EKZA 1BB8A 1Z0GA 4GKJI 3PYFA 2EOXA 3L7ZB 3ZZ0A 2NN6C 3P3CA 2L2MA 1STUA 3L00A 3ZOQB 2CTDA 2WBSA 4LF7I 5LL6R 4KZSA 3C4TA 2PO1B 5JEAA 2JEAB 1EH8A 2UXCI 1A1HA 4HXZA 2EOIA 2IHR1 3LNUA 4LCGA 1KTVA 4I8OA 5FLXC 1Z5AA 1UHZA 2YTIA 2DRPA 5BR8E 2F1DA 2EQ0A 4P7DA 2UUAE 2PO2A 3J80Q 1XNQI 2JE6A 1MG7A 4LF8E 2MC6A 2RSIA 4JI4E 2NN6E 4IFDE 1UDQA 1RC7A 4QNJA 1FKAE 4DR3I 4FW3A 2CZ9A 4NZVA 1WJPA 2R42A 3K85A 1A1JA 1SR9A 4FW5A 1GQEA 2V8PA 2LVHA 2LCEA 2I13A 2WNRB 4DR6I 2EJ4A 2EFGA 2NN6F 3KRNA 1N34E 1HNWI 4FW9A 4WXCA 5IV8B 4XTJA 1PJSA 1L4SA 3HJCA 4HACB 2HKEA 2LJPA 4HYMA 4WX9A 4LOMA 5K36F 4R2AA 2IESA 1X3CA 1ZM2A 3HTXA 2LT7A 4DR2E 5L3JA 1Z5BA 2EQ3A 2YTJA 5DNYA 1FWKA 1ZXMA 4PU9A 2EOOA 3J7AG 2LRSA 4X64I 2ZM6I 5JEAF 5DNLA 2EMLA 3ZKDA 1XNRI 5AE1A 4LFBI 1X47A 5JEAC 2YRKA 4BMJA 4J3DA 2J7JA 1OYPA 2EL4A 2NUGA 2UU9E 2EPAA 4X66E 4GZNC 1P47A 2UUBE 2Q2EB 4PRXA 4AQYI 2EOZA 1IQOA 2B9DA 3BIDA 2GPIA 4BA1A 2UXBI 4MDTA 3J7AM 3V5RA 2O3ZA 3C6KA 4MU3A 4O5GA 2HHHI 4LF9I 1NEIA 2C38B 4NBQA 4WYQB 2E1RA 4ZYGA 1FI4A 5KL7A 2JXPA 1OYSA 4AQYE 3WU6A 3RMPA 2J7KA 4GKKI 1ZAAC 4DR4I 2M9AA 4K0KE 3BGHA 2LV2A 2CSHA 2MDGA 2Z5BA 4IJDA 3DD6A 2RQLA 5LMNI 2HHHE 2NUFA 4LF9E 4NXMI 5LMUE 4JG4A 5IT9Q 3PRYA 2CT1A 4WUCA
chains in the Genus database with same CATH topology
1HR0E 1MU5A 5T6JA 2JR1A 2L3JA 4LFAE 4YY3E 1XMQI 2YT4A 4JI7I 4USKA 3M6AA 1RQ0A 2UU9I 4DV5E 2FV4B 5IT9C 4JI2I 1PVGA 3CWVA 1HNWE 2V88A 3AV0A 1Y4SA 1YZ9A 2V2VA 2RS6A 2LTSA 2BM1A 4LF4I 5FWKA 4IZJD 2F4VI 1VISA 1Y6ZA 3B8HA 2LTRA 2WZOA 3VYXA 4JI6E 3PYGA 5GMDA 5IWAI 3HPSA 4DR6E 4DPYA 5A2QC 2ZBKB 2Z5EA 4DPTA 4OX9I 4LFCE 4DV2I 3P06A 4Z7CA 2IOPA 3VYYA 1WUUA 1USUA 4DPUA 2UXBI 3GONA 1WHQA 2LUPB 3IWBA 2E5LE 1DARA 3V2UC 2ODRC 4FN5A 4IZKB 1Z5CA 4Q28A 1UILA 4F9AB 3WU3A 3JAMC 4MYUA 4JI7E 3J81C 3ZZTA 5IWAE 2JOBA 4R8OA 4JV5I 1O0WA 1H72C 1J5EI 1B63A 3LTOA 3JTZA 1FJGI 2HFUA 4F54A 4WPYA 4LF7E 2RS7A 1T4LB 4JI0E 2PNLA 1Z0CA 1FJGE 2IOQA 4JI6I 1Z0WA 4JI4I 1RR9A 2M1SA 2OI2A 3HXLA 1N0UA 4DMIA 2M4IA 2VQFI 4DKKA 4B3SE 4DPWA 4FWDA 2MC5A 2F8BA 2DB2A 3K17A 1RREA 3DJWA 2UXBE 3IWDA 4IZJA 1N32I 4JI1I 4WUDA 3C4BA 2L92A 5ADZA 1HR0I 2XEXA 1ZM4A 5A2QQ 2NUEA 2GS8A 4BC7A 2KHXA 4K0KI 2RTXA 3JAMQ 1Z0EA 5F3WA 4X66I 2V83A 2UUBI 1PKPA 3F0NA 4DV1I 4B3RE 3LLHA 1S4EA 4P78A 1OJ4A 4X64E 2HFSA 2F4VE 4JI5I 5BR8I 1XMQE 4YY3I 1UEKA 1ZM9A 3F6HA 3K1JA 1ZBTA 3DF6A 4DXLA 4JI2E 1Z0VA 1H73A 2VE7C 4GKJE 1J26A 1B62A 4X62E 4DU8A 3ADGA 2V2QA 2K4VA 2ODRD 2V8QB 2V34A 3IWCA 4DR2I 3H09A 4OX9E 4P7AA 4LF8I 3JU0A 3HQ1A 1I94E 4TUIA 4DV0I 4KHPI 2LBSB 4DR4E 3PYEA 4R03A 4BC9A 4TUGA 4YHHI 1X48A 2A2CA 4L8NA 1EA6A 3ZM7A 4LF5I 2L33A 4GEQB 3T1YI 3OTOE 4USMA 1J5EE 2DEJA 2G7HA 2DSYA 1NHJA 4LF4E 3Q6NA 1T4NA 4DV0E 4KHPE 4X8WA 2L2NA 3B82A 1DI2A 4F9BB 4DUYE 4M30A 2V87A 2A2DA 1N34I 4B3TE 1IBLE 1WHNA 2X36A 2JOXA 4DV6E 1IBKI 3HULA 4DV4E 4B3SI 2BV3A 3QT7A 4DR5I 3B78A 1K47A 2LUQA 3P1XA 4M1KA 2HK2A 4B3ME 2N3GA 5LMNI 3VK6A 1YYKA 1N36E 2LJHA 4EMDA 3ZZUA 1A6FA 4JI0I 4GKKE 4JYAE 1KKHA 2Z5BB 4F9CB 4HACA 4DV3I 2LMZA 4R1FA 2L6MA 3HPZA 4JYAI 1IBMI 4YHHE 2VQEE 4OOGC 2Z5CB 1BKNA 2UUAI 5FLXQ 3FIGA 2PNMA 4DU7A 4WFTA 3AUZA 2L2KB 4DV7I 1XMOI 4J8ZA 2RSMA 1U2RA 2M7QA 4KQVA 4DV5I 4LFBE 4DR5E 2B7VA 4DUZE 2MDRA 1HNZE 2L8TA 2V86A 1N33I 1HNXI 4DR7E 4LFCI 1EI1A 1XMOE 2X7IA 5LMUI 2CPNA 2HKJA 2UUCI 2VF1A 1PIEA 5AE3A 2JY9A 1HNXE 2V2ZA 4DV4I 2B7TA 3QT5A 3OTOI 2UXDI 4DR3E 4NXNE 1ZXNA 3F6GA 2YZTA 4M2ZA 4DV7E 4LU9A 4DUYI 1H7SA 1H7UA 4PRVA 1I94I 3J81Q 2UXCE 1ELOA 3LPSA 2DIXA 4JI8E 2L3CA 2VQEI 3Q1QA 3K6QA 2R3VA 1FWLA 3QT8A 2CG9A 1MX0A 1XHKA 1QU6A 5CFFE 1Z0TA 4RPFA 2EZ6A 2KONA 3T1HE 4M0VA 1DQ3A 3WU4A 2B3TB 2CGEA 2NPFA 3ZKBA 4DR1E 1HK7A 3H4LA 2JVAA 1N0VC 4Z7YA 3D4JA 3WU5A 1QZRA 4DR1I 1Z59A 4I3HA 2VQFE 4X65E 2VF3A 4LF6I 1T4OA 1Y4UA 2NA2A 4DV3E 5AE2A 1GZ6A 2LE2A 4JI3I 4HY1A 4N3OA 2N3HA 1USVA 2DMYA 4FWGA 4IZJB 4X65I 3PYDA 1NHHA 2O1TA 2GQ0A 3ADJA 2V85A 3MSWA 3J7Yp 1ZBQA 3LMLA 1Z0BA 4IZKA 2WW4A 4DR7I 1D6TA 4LF5E 3ADLA 1N33E 4P52A 1HNZI 4JI1E 2ZM6E 4ZVIA 4X62I 2E1MA 2BM0A 1YYWA 2HK3A 2UUCE 4UT4A 5LMNE 4B3MI 4BS9A 2V89A 1NZ0A 2FTXB 4ED4A 1NHIA 4DV2E 2EWLA 1IBME 1IBKE 2DEIA 4DV6I 2ZITA 3Q6MA 2H36X 4DUZI 4DPXA 3T1YE 4FWHA 4B3RI 3QT6A 1H74A 4MYTA 1FNMA 4LF6E 1XNQE 3ADIA 5AASA 4UTGA 4BCAA 4JI5E 4WUBA 2FGGA 5GMEA 2JWOA 4LTYA 4NXNI 2O1UA 4JI3E 1KIJA 1X49A 2O1WA 4DV1E 2UXDE 1YYOA 4URLA 3J80C 1N32E 1WXRA 1IBLI 2E5LI 1ZM3A 1XNRE 1S16A 2KOUA 3KWRA 4L5NC 2Z5CA 4JI8I 2AJ4A 3OMLA 2O1VA 4WSPA 4JV5E 4LFAI 4BBYA 3T1HI 4NXME 1KVKA 4B3TI 1EKZA 4GKJI 1Z0GA 3PYFA 3ZZ0A 2L2MA 1STUA 3ZOQB 4LF7I 4KZSA 5LL6R 3C4TA 2UXCI 4HXZA 3LNUA 2IHR1 1KTVA 4I8OA 5FLXC 1Z5AA 1UHZA 1N36I 5BR8E 4P7DA 2UUAE 3J80Q 1XNQI 1MG7A 4LF8E 2MC6A 4JI4E 1RC7A 1FKAE 4DR3I 2CZ9A 2R42A 3K85A 1SR9A 1GQEA 2V8PA 4DR6I 2EFGA 1N34E 1HNWI 4FW9A 4XTJA 4HYMA 3HJCA 4HACB 2HKEA 2LJPA 1ZM2A 3HTXA 4DR2E 5L3JA 1Z5BA 1ZXMA 5DNYA 1FWKA 4PU9A 3J7AG 2LRSA 4X64I 2ZM6I 3ZKDA 1XNRI 5AE1A 4LFBI 1X47A 4BMJA 2NUGA 2UU9E 4X66E 2UUBE 4PRXA 2Q2EB 4AQYI 2B9DA 3J7AM 3V5RA 2HHHI 4LF9I 4WYQB 2E1RA 1FI4A 3WU6A 4AQYE 4GKKI 3RMPA 2J7KA 4DR4I 4K0KE 2Z5BA 2HHHE 2NUFA 4LF9E 4NXMI 5LMUE 4JG4A 5IT9Q 3PRYA 4WUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 E;  1MU5 A;  2L3J A;  4LFA E;  4YY3 E;  1XMQ I;  2YT4 A;  4JI7 I;  4USK A;  3M6A A;  1RQ0 A;  2UU9 I;  4DV5 E;  5IT9 C;  4JI2 I;  1PVG A;  3CWV A;  1HNW E;  1YZ9 A;  2V2V A;  2RS6 A;  2LTS A;  2BM1 A;  4LF4 I;  2F4V I;  1VIS A;  3B8H A;  2LTR A;  3VYX A;  4JI6 E;  3PYG A;  5GMD A;  5IWA I;  4DR6 E;  4DPY A;  5A2Q C;  2ZBK B;  4DPT A;  4OX9 I;  4LFC E;  4DV2 I;  4Z7C A;  3VYY A;  1WUU A;  4DPU A;  2UXB I;  3GON A;  1WHQ A;  2LUP B;  2E5L E;  1DAR A;  3V2U C;  4FN5 A;  1Z5C A;  1UIL A;  3WU3 A;  4MYU A;  3JAM C;  4JI7 E;  3J81 C;  3ZZT A;  5IWA E;  4JV5 I;  1O0W A;  1H72 C;  1J5E I;  1B63 A;  3LTO A;  1FJG I;  2HFU A;  4LF7 E;  2RS7 A;  1T4L B;  4JI0 E;  1Z0C A;  1FJG E;  4JI6 I;  1Z0W A;  4JI4 I;  1RR9 A;  2OI2 A;  1N0U A;  2VQF I;  4DKK A;  4B3S E;  4DPW A;  4FWD A;  2DB2 A;  3K17 A;  1RRE A;  2UXB E;  1N32 I;  4JI1 I;  4WUD A;  3C4B A;  1HR0 I;  2XEX A;  1ZM4 A;  5A2Q Q;  2GS8 A;  2NUE A;  2KHX A;  4K0K I;  2RTX A;  3JAM Q;  1Z0E A;  4X66 I;  2UUB I;  1PKP A;  3F0N A;  4DV1 I;  4B3R E;  3LLH A;  1S4E A;  1OJ4 A;  4X64 E;  2HFS A;  2F4V E;  4JI5 I;  5BR8 I;  1XMQ E;  4YY3 I;  1UEK A;  1ZM9 A;  3K1J A;  1ZBT A;  4DXL A;  4JI2 E;  1Z0V A;  1H73 A;  4GKJ E;  1J26 A;  1B62 A;  4X62 E;  4DU8 A;  3ADG A;  2V2Q A;  2V34 A;  4DR2 I;  4OX9 E;  4P7A A;  4LF8 I;  1I94 E;  4DV0 I;  4KHP I;  2LBS B;  4DR4 E;  3PYE A;  4YHH I;  1X48 A;  2A2C A;  1EA6 A;  3ZM7 A;  4LF5 I;  2L33 A;  3T1Y I;  3OTO E;  4USM A;  1J5E E;  2DEJ A;  1NHJ A;  4LF4 E;  1T4N A;  4DV0 E;  4KHP E;  4X8W A;  2L2N A;  3B82 A;  1DI2 A;  4DUY E;  4M30 A;  2A2D A;  1N34 I;  4B3T E;  1IBL E;  1WHN A;  2X36 A;  4DV6 E;  1IBK I;  3HUL A;  4DV4 E;  4B3S I;  2BV3 A;  3QT7 A;  4DR5 I;  3B78 A;  1K47 A;  2LUQ A;  3P1X A;  4M1K A;  2HK2 A;  4B3M E;  2N3G A;  5LMN I;  1YYK A;  1N36 E;  2LJH A;  4EMD A;  3ZZU A;  1A6F A;  4JI0 I;  4GKK E;  4JYA E;  1KKH A;  4HAC A;  4DV3 I;  4R1F A;  4JYA I;  1IBM I;  4YHH E;  2VQE E;  4OOG C;  2UUA I;  1BKN A;  5FLX Q;  4DU7 A;  4WFT A;  2L2K B;  4DV7 I;  1XMO I;  2RSM A;  1U2R A;  4KQV A;  4DV5 I;  4LFB E;  4DR5 E;  2B7V A;  4DUZ E;  2MDR A;  1HNZ E;  1N33 I;  1HNX I;  4DR7 E;  4LFC I;  1EI1 A;  1XMO E;  2X7I A;  5LMU I;  2CPN A;  2HKJ A;  2UUC I;  1PIE A;  2JY9 A;  1HNX E;  2V2Z A;  4DV4 I;  2B7T A;  3QT5 A;  3OTO I;  2UXD I;  4DR3 E;  4NXN E;  1ZXN A;  4M2Z A;  4DV7 E;  4DUY I;  1H7S A;  1H7U A;  4PRV A;  1I94 I;  3J81 Q;  2UXC E;  1ELO A;  3LPS A;  2DIX A;  4JI8 E;  2L3C A;  2VQE I;  3Q1Q A;  2R3V A;  1FWL A;  3QT8 A;  1MX0 A;  1XHK A;  1QU6 A;  5CFF E;  1Z0T A;  4RPF A;  2EZ6 A;  3T1H E;  3WU4 A;  2B3T B;  2NPF A;  3ZKB A;  4DR1 E;  3H4L A;  2JVA A;  1N0V C;  4Z7Y A;  3D4J A;  3WU5 A;  1QZR A;  4DR1 I;  1Z59 A;  4I3H A;  2VQF E;  4X65 E;  2VF3 A;  4LF6 I;  1T4O A;  2NA2 A;  4DV3 E;  4JI3 I;  4HY1 A;  2N3H A;  2DMY A;  4FWG A;  4X65 I;  3PYD A;  1NHH A;  3ADJ A;  3J7Y p;  1Z0B A;  4DR7 I;  2WW4 A;  1D6T A;  4LF5 E;  3ADL A;  1N33 E;  4P52 A;  1HNZ I;  4JI1 E;  2ZM6 E;  4ZVI A;  4X62 I;  2BM0 A;  1YYW A;  2HK3 A;  2UUC E;  4UT4 A;  5LMN E;  4B3M I;  1NZ0 A;  4ED4 A;  1NHI A;  4DV2 E;  1IBM E;  1IBK E;  2DEI A;  4DV6 I;  2ZIT A;  4DUZ I;  4DPX A;  3T1Y E;  4FWH A;  4B3R I;  3QT6 A;  1H74 A;  4MYT A;  1FNM A;  4LF6 E;  1XNQ E;  3ADI A;  4UTG A;  4JI5 E;  4WUB A;  5GME A;  4NXN I;  4JI3 E;  1KIJ A;  1X49 A;  4DV1 E;  2UXD E;  1YYO A;  4URL A;  1N32 E;  3J80 C;  1IBL I;  2E5L I;  1ZM3 A;  1XNR E;  1S16 A;  4JI8 I;  2AJ4 A;  4JV5 E;  4LFA I;  3T1H I;  4NXM E;  1KVK A;  4B3T I;  1EKZ A;  4GKJ I;  1Z0G A;  3PYF A;  3ZZ0 A;  2L2M A;  1STU A;  4LF7 I;  5LL6 R;  3C4T A;  2UXC I;  4HXZ A;  3LNU A;  2IHR 1;  1KTV A;  1Z5A A;  5FLX C;  1N36 I;  1UHZ A;  5BR8 E;  2UUA E;  3J80 Q;  1XNQ I;  1MG7 A;  4LF8 E;  4JI4 E;  1RC7 A;  1FKA E;  4DR3 I;  2CZ9 A;  2R42 A;  1GQE A;  2V8P A;  4DR6 I;  2EFG A;  1N34 E;  1HNW I;  4FW9 A;  4XTJ A;  4HYM A;  4HAC B;  2HKE A;  2LJP A;  1ZM2 A;  3HTX A;  4DR2 E;  5L3J A;  1Z5B A;  1ZXM A;  1FWK A;  4PU9 A;  3J7A G;  2LRS A;  4X64 I;  2ZM6 I;  3ZKD A;  1XNR I;  4LFB I;  1X47 A;  2NUG A;  2UU9 E;  4X66 E;  2UUB E;  4PRX A;  2Q2E B;  4AQY I;  3J7A M;  3V5R A;  2HHH I;  4LF9 I;  4WYQ B;  2E1R A;  1FI4 A;  3WU6 A;  4AQY E;  4GKK I;  2J7K A;  4DR4 I;  4K0K E;  2HHH E;  2NUF A;  4LF9 E;  4NXM I;  5LMU E;  4JG4 A;  5IT9 Q;  4WUC A; 
#chains in the Genus database with same CATH topology
 1HR0 E;  1MU5 A;  5T6J A;  2JR1 A;  2L3J A;  4LFA E;  4YY3 E;  1XMQ I;  2NN6 A;  2YT4 A;  4JI7 I;  4USK A;  2YSP A;  3EQ1 A;  3M6A A;  1RQ0 A;  2UU9 I;  4DV5 E;  2FV4 B;  5IT9 C;  4JI2 I;  1KJK A;  1PVG A;  3CWV A;  1HNW E;  2V88 A;  3AV0 A;  5C0X C;  1Y4S A;  1YZ9 A;  2V2V A;  2EOM A;  3M85 G;  2EQ1 A;  2RS6 A;  3PS2 A;  2LTS A;  2BM1 A;  5A6K A;  4LF4 I;  5FWK A;  4IZJ D;  2F4V I;  1VIS A;  2C39 A;  1Y6Z A;  3B8H A;  2LTR A;  2EM4 A;  2WZO A;  2EOQ A;  3VYX A;  4JI6 E;  3M85 D;  3H1C A;  4BHB A;  3PYG A;  1UDS A;  5GMD A;  2PRT A;  5IWA I;  2EM2 A;  3HPS A;  1Y60 A;  4DR6 E;  4X9J A;  4DPY A;  4DUZ I;  5A2Q C;  2MKD A;  2ZBK B;  4M9V C;  2EP3 A;  2Z5E A;  4DPT A;  2YTE A;  2YRM A;  2JP9 A;  4OX9 I;  2EMC A;  4LFC E;  3B4T A;  4DV2 I;  4AID A;  4WXD A;  4R2E A;  2C39 B;  2AE8 A;  1DGC A;  3P06 A;  2IOP A;  4Z7C A;  3VYY A;  1YPN A;  2ELZ A;  3BF2 A;  1USU A;  1WUU A;  3ECR A;  4DPU A;  2ENA A;  2YTF A;  3GON A;  1WHQ A;  2LUP B;  5K36 B;  3IWB A;  2E5L E;  1DAR A;  1XXE A;  3V2U C;  3PS3 A;  2YPN A;  2ODR C;  4FN5 A;  4IZK B;  1Z5C A;  4Q28 A;  1UIL A;  1T39 A;  4F9A B;  3WU3 A;  3JAM C;  2HGH A;  4MYU A;  4JI7 E;  3J81 C;  3ZZT A;  5IWA E;  2JOB A;  4R8O A;  4JV5 I;  1O0W A;  1PDA A;  1Z1B A;  1YUJ A;  2EMF A;  1H72 C;  1RHY A;  1J5E I;  1B63 A;  4F6M A;  3LTO A;  2EL6 A;  3EPJ A;  3JTZ A;  1A1G A;  1FJG I;  4ISA A;  1TF6 A;  2HFU A;  3C6M A;  2EE8 A;  4WPY A;  4F54 A;  4LF7 E;  2RS7 A;  1T4L B;  4JI0 E;  2PNL A;  1Z0C A;  1FJG E;  2EN8 A;  5A6A A;  2IOQ A;  4JI6 I;  1Z0W A;  1A1F A;  1WRJ A;  4JI4 I;  1RR9 A;  2M1S A;  4IS1 C;  2BB8 A;  2EM5 A;  3HXL A;  4DMI A;  1T38 A;  4RHB B;  1N0U A;  2OI2 A;  2M4I A;  2VQF I;  4DKK A;  4B3S E;  4DPW A;  3U1K A;  3MHH C;  4FWD A;  1N36 I;  3UHM A;  2MC5 A;  5KL5 A;  2NAB A;  2F8B A;  2DB2 A;  3K17 A;  1RRE A;  3DJW A;  3BBG A;  1UBD C;  1YFH A;  3IWD A;  2UXB E;  4IZJ A;  4O24 A;  1N32 I;  4JI1 I;  4WUD A;  5DNX A;  2RPC A;  3C4B A;  1A1I A;  1X6H A;  2EPC A;  5AC4 A;  1YSA C;  2EM9 A;  2L92 A;  5ADZ A;  1HR0 I;  2XEX A;  1ZM4 A;  2C37 A;  5A2Q Q;  2WP8 B;  2EN3 A;  1ZU1 A;  2EM0 A;  2NUE A;  2GS8 A;  4R2Q A;  1IMU A;  4IFD D;  4BC7 A;  2EPZ A;  2EMI A;  2KHX A;  2RTX A;  3JAM Q;  4K0K I;  3EPK A;  1Z0E A;  5F3W A;  4X66 I;  2V83 A;  3CDJ A;  2UUB I;  1PKP A;  3F0N A;  2YTG A;  4DV1 I;  4B3R E;  3LLH A;  1S4E A;  4O4K A;  4P78 A;  4HEI A;  4MLV A;  1OJ4 A;  5JEA D;  2WCC 3;  4R2D A;  5DRR A;  4X64 E;  2HFS A;  2F4V E;  4JI5 I;  2HC5 A;  2EPR A;  5BR8 I;  1XMQ E;  4YY3 I;  1UEK A;  2PNZ A;  3EPL A;  3NZK A;  4IFD B;  4LCH A;  3MHS C;  1ZM9 A;  2C37 B;  1N3G A;  2EOR A;  2EMA A;  3F6H A;  3K1J A;  4O43 A;  1ZBT A;  3DF6 A;  2PO0 A;  4DXL A;  4JI2 E;  2BR2 B;  1Z0V A;  1H73 A;  4OKG A;  2VE7 C;  4GKJ E;  4MLQ A;  2EPP A;  4KWY A;  1J26 A;  4X62 E;  1B62 A;  4DU8 A;  2PO1 A;  3GCM A;  3ADG A;  2V2Q A;  2K4V A;  2ODR D;  2V8Q B;  5LLQ A;  2V34 A;  2WNR A;  3IWC A;  4BA1 B;  2ELY A;  1BBO A;  1F2I G;  4DR2 I;  2GHF A;  3H09 A;  4ZYH A;  4OX9 E;  1P42 A;  1R6M A;  4P7A A;  4LF8 I;  2EOS A;  1TF3 A;  3THO B;  2JT2 A;  3JU0 A;  1R6L A;  1AAY A;  5A6B A;  2EM6 A;  2EMW A;  2EN7 A;  5A69 A;  3HQ1 A;  1I94 E;  4TUI A;  3CDI A;  5DRP A;  4QNK A;  4DV0 I;  2EN6 A;  1PJQ A;  4KHP I;  2LBS B;  4DR4 E;  3PYE A;  4R03 A;  4BC9 A;  2GLI A;  4TUG A;  2YTN A;  2JEB B;  4YHH I;  1X48 A;  2EOY A;  2A2C A;  2PO0 B;  4L8N A;  4IS9 A;  1EA6 A;  3ZM7 A;  4LF5 I;  2L33 A;  4GEQ B;  3T1Y I;  1Y5Y A;  3OTO E;  4USM A;  3L7Z A;  1QNT A;  1J5E E;  2DEJ A;  2G7H A;  2DSY A;  4BA2 A;  1SFE A;  2YWQ A;  1NHJ A;  4OO1 B;  4LF4 E;  2HJJ A;  5KL3 A;  3Q6N A;  1T4N A;  4DV0 E;  4KHP E;  2JEA A;  4X8W A;  2JPA A;  2L2N A;  2I9I A;  1A1K A;  2VRD A;  3B82 A;  1DI2 A;  4F9B B;  4DUY E;  3TQM A;  2JE6 B;  2EMZ A;  4M30 A;  4F2J C;  5C0X F;  4U3D A;  2EN1 A;  2V87 A;  2A2D A;  1N34 I;  4B3T E;  1IBL E;  3M99 B;  1WHN A;  2YU8 A;  2X36 A;  2JOX A;  2DLK A;  4DV6 E;  1IBK I;  3HUL A;  2LO3 A;  4DV4 E;  4OO1 D;  4B3S I;  4ZYE A;  2BV3 A;  3GLL A;  3QT7 A;  1JK1 A;  1E3H A;  4FW7 A;  4DR5 I;  3B78 A;  1K47 A;  5A6B D;  2LUQ A;  3P1X A;  1E3P A;  1AH5 A;  4M1K A;  2HK2 A;  1B69 A;  4B3M E;  2N3G A;  3KZY A;  4N4R B;  3VK6 A;  1N36 E;  1YYK A;  1YHC A;  2LJH A;  4U3B A;  4OO1 F;  4EMD A;  3ZZU A;  1A6F A;  4JI0 I;  4OO1 C;  3P3G A;  3EPH A;  2A25 A;  2EOH A;  1BBG A;  4GKK E;  4JYA E;  1KKH A;  2Z5B B;  4F9C B;  4HAC A;  4DV3 I;  1MEY C;  2LMZ A;  4R1F A;  2L6M A;  3HPZ A;  4JYA I;  2MKN A;  1IBM I;  4YHH E;  2VQE E;  4OOG C;  2Z5C B;  1BKN A;  2UUA I;  5FLX Q;  3FIG A;  2EL5 A;  1OYR A;  5K36 C;  2PNM A;  5DRQ A;  4DU7 A;  2R1F A;  2YTO A;  4WFT A;  2DLQ A;  3AUZ A;  5A6J A;  3QG5 C;  2L2K B;  4DV7 I;  1XMO I;  4J8Z A;  2RSM A;  2K7I A;  4R2C A;  1U2R A;  2M7Q A;  4KQV A;  4DV5 I;  4LFB E;  4DR5 E;  2B7V A;  4DUZ E;  2JEB A;  4OZE A;  2WBU A;  2MDR A;  1HNZ E;  2L8T A;  3HKM A;  2V86 A;  4FW6 A;  1N33 I;  2EOJ A;  1HNX I;  2BA0 G;  5JEA B;  4DR7 E;  4LFC I;  5TSE A;  5KL2 A;  1EI1 A;  1XMO E;  2X7I A;  5LMU I;  4MU1 A;  2CPN A;  2HKJ A;  4FW4 A;  2LJU A;  2UUC I;  2VF1 A;  5K36 E;  5DRO A;  2BA1 G;  4R2S A;  1PIE A;  5AE3 A;  2JY9 A;  1HNX E;  1KYQ A;  2V2Z A;  4DV4 I;  2B7T A;  3QT5 A;  3OTO I;  2UXD I;  2WBT A;  5EKW A;  4DR3 E;  4NXN E;  1ZXN A;  3F6G A;  2EPL X;  2YZT A;  2BA1 D;  2NN6 D;  4M2Z A;  2EMX A;  4DV7 E;  4LU9 A;  5C0X A;  4DUY I;  1VI7 A;  2PNZ B;  4OO1 E;  1H7S A;  1H7U A;  4PRV A;  1I94 I;  3J81 Q;  2EPO A;  2UXC E;  1ELO A;  3LPS A;  4R2R A;  2EMK A;  2DIX A;  2EM8 A;  4JI8 E;  2L3C A;  2VQE I;  5AC5 A;  3M7N G;  3Q1Q A;  4AM3 A;  3K6Q A;  4RH8 A;  2R76 A;  1FWL A;  2R3V A;  3QT8 A;  2C38 A;  2CG9 A;  1MX0 A;  1XHK A;  1NCS A;  2J65 A;  1MGT A;  1QU6 A;  5CFF E;  1Z0T A;  4RPF A;  2EZ6 A;  2KON A;  3T1H E;  2EOF A;  4HTG A;  4M0V A;  1DQ3 A;  2ENC A;  3WU4 A;  2B3T B;  5C0X E;  2CGE A;  2NPF A;  3ZKB A;  4DR1 E;  1HK7 A;  3H4L A;  4AIM A;  2IER A;  2WP8 A;  2JVA A;  1N0V C;  4Z7Y A;  3D4J A;  3WU5 A;  1QZR A;  4DR1 I;  2EM3 A;  1Z59 A;  4I3H A;  2EPK X;  2VQF E;  4X65 E;  3P3E A;  2BBG A;  2VF3 A;  4LF6 I;  1T4O A;  5ELW A;  4MU4 A;  1Y4U A;  2NA2 A;  1EH7 A;  4DV3 E;  5AE2 A;  1GZ6 A;  2LE2 A;  2EOE A;  1RMD A;  4JI3 I;  4HY1 A;  4N3O A;  5K36 D;  2EN4 A;  2EPX A;  2N3H A;  2EMY A;  2DMY A;  1USV A;  4FWG A;  1G2F C;  4IZJ B;  4X65 I;  2YRH A;  3PYD A;  1NHH A;  1TN9 A;  2O1T A;  2GQ0 A;  3ADJ A;  2V85 A;  3MSW A;  3PS1 A;  1EH6 A;  2NN6 B;  4MQY A;  5K36 A;  3J7Y p;  2EMH A;  4R2P A;  1ZBQ A;  2BR2 A;  3LML A;  1Z0B A;  4IZK A;  2WW4 A;  2GO4 A;  4DR7 I;  4LF5 E;  1D6T A;  3ADL A;  1N33 E;  4ZYD A;  2BA0 D;  2YU5 A;  4P52 A;  1HNZ I;  4JI1 E;  2ZM6 E;  4ZVI A;  4X62 I;  1YUI A;  4IFD F;  2E1M A;  2EMG A;  2BM0 A;  1YYW A;  4BHC A;  3VHT B;  2HK3 A;  2ENH A;  1X6F A;  2UUC E;  1X6E A;  4OO1 A;  5LMN E;  4UT4 A;  5JEA E;  4B3M I;  1UDN A;  2EPN A;  1A1L A;  1LLM C;  4BS9 A;  3KZZ A;  2V89 A;  1UN6 B;  1NZ0 A;  2FTX B;  4ED4 A;  2YTP A;  1NHI A;  4GQU A;  4DV2 E;  2E72 A;  2EWL A;  1IBM E;  1IBK E;  2DEI A;  4DV6 I;  2EMB A;  2ZIT A;  3Q6M A;  2H36 X;  2EPM X;  5KL4 A;  3T1Y E;  1YH8 A;  4LPF A;  4Q35 B;  4MU0 A;  4FWH A;  4DPX A;  3P76 A;  2CVE A;  2EN2 A;  2N8X A;  2YTQ A;  1H74 A;  3QT6 A;  4MYT A;  2VES A;  4B3R I;  2DGC A;  2JYA A;  4LF6 E;  1FNM A;  1JK2 A;  1XNQ E;  3ADI A;  5AAS A;  2EPU A;  3UK3 C;  2GO3 A;  4LCF A;  4UTG A;  3M7N D;  5C0X D;  2YSO A;  4BCA A;  4JI5 E;  4IFD C;  4WUB A;  1PJT A;  2FGG A;  5EL9 A;  5GME A;  2JWO A;  1UDO A;  4LTY A;  4NXN I;  2O1U A;  4JI3 E;  1KIJ A;  1X49 A;  2O1W A;  4DV1 E;  2UXD E;  1YYO A;  4NHR A;  4WSG A;  4URL A;  3GME A;  3J80 C;  1N32 E;  4FK5 C;  1G2D C;  1WXR A;  2Q8U A;  1IBL I;  5IXM B;  5C0X B;  1ZM3 A;  2E5L I;  1GTK A;  2D9H A;  1XNR E;  2KOU A;  3KWR A;  4L5N C;  1S16 A;  2PO2 B;  1ZR9 A;  2AJ4 A;  2Z5C A;  4JI8 I;  3OML A;  2DMI A;  2O1V A;  4WSP A;  4BA2 B;  2YTD A;  4JV5 E;  3U1Y A;  4LFA I;  4F6N A;  4IFD A;  2EM7 A;  4BBY A;  3T1H I;  1IQS A;  5KL6 A;  4NXM E;  1X5W A;  2ADR A;  1KVK A;  3THN A;  4B3T I;  1EKZ A;  1BB8 A;  1Z0G A;  4GKJ I;  3PYF A;  2EOX A;  3L7Z B;  3ZZ0 A;  2NN6 C;  3P3C A;  2L2M A;  1STU A;  3L00 A;  3ZOQ B;  2CTD A;  2WBS A;  4LF7 I;  5LL6 R;  4KZS A;  3C4T A;  2PO1 B;  5JEA A;  2JEA B;  1EH8 A;  2UXC I;  1A1H A;  4HXZ A;  2EOI A;  2IHR 1;  3LNU A;  4LCG A;  1KTV A;  4I8O A;  5FLX C;  1Z5A A;  1UHZ A;  2YTI A;  2DRP A;  5BR8 E;  2F1D A;  2EQ0 A;  4P7D A;  2UUA E;  2PO2 A;  3J80 Q;  1XNQ I;  2JE6 A;  1MG7 A;  4LF8 E;  2MC6 A;  2RSI A;  4JI4 E;  2NN6 E;  4IFD E;  1UDQ A;  1RC7 A;  4QNJ A;  1FKA E;  4DR3 I;  4FW3 A;  2CZ9 A;  4NZV A;  1WJP A;  2R42 A;  3K85 A;  1A1J A;  1SR9 A;  4FW5 A;  1GQE A;  2V8P A;  2LVH A;  2LCE A;  2I13 A;  2WNR B;  4DR6 I;  2EJ4 A;  2EFG A;  2NN6 F;  3KRN A;  1N34 E;  1HNW I;  4FW9 A;  4WXC A;  5IV8 B;  4XTJ A;  1PJS A;  1L4S A;  3HJC A;  4HAC B;  2HKE A;  2LJP A;  4HYM A;  4WX9 A;  4LOM A;  5K36 F;  4R2A A;  2IES A;  1X3C A;  1ZM2 A;  3HTX A;  2LT7 A;  4DR2 E;  5L3J A;  1Z5B A;  2EQ3 A;  2YTJ A;  5DNY A;  1FWK A;  1ZXM A;  4PU9 A;  2EOO A;  3J7A G;  2LRS A;  4X64 I;  2ZM6 I;  5JEA F;  5DNL A;  2EML A;  3ZKD A;  1XNR I;  5AE1 A;  4LFB I;  1X47 A;  5JEA C;  2YRK A;  4BMJ A;  4J3D A;  2J7J A;  1OYP A;  2EL4 A;  2NUG A;  2UU9 E;  2EPA A;  4X66 E;  4GZN C;  1P47 A;  2UUB E;  2Q2E B;  4PRX A;  4AQY I;  2EOZ A;  1IQO A;  2B9D A;  3BID A;  2GPI A;  4BA1 A;  2UXB I;  4MDT A;  3J7A M;  3V5R A;  2O3Z A;  3C6K A;  4MU3 A;  4O5G A;  2HHH I;  4LF9 I;  1NEI A;  2C38 B;  4NBQ A;  4WYQ B;  2E1R A;  4ZYG A;  1FI4 A;  5KL7 A;  2JXP A;  1OYS A;  4AQY E;  3WU6 A;  3RMP A;  2J7K A;  4GKK I;  1ZAA C;  4DR4 I;  2M9A A;  4K0K E;  3BGH A;  2LV2 A;  2CSH A;  2MDG A;  2Z5B A;  4IJD A;  3DD6 A;  2RQL A;  5LMN I;  2HHH E;  2NUF A;  4LF9 E;  4NXM I;  5LMU E;  4JG4 A;  5IT9 Q;  3PRY A;  2CT1 A;  4WUC A; 
#chains in the Genus database with same CATH homology
 1HR0 E;  1MU5 A;  5T6J A;  2JR1 A;  2L3J A;  4LFA E;  4YY3 E;  1XMQ I;  2YT4 A;  4JI7 I;  4USK A;  3M6A A;  1RQ0 A;  2UU9 I;  4DV5 E;  2FV4 B;  5IT9 C;  4JI2 I;  1PVG A;  3CWV A;  1HNW E;  2V88 A;  3AV0 A;  1Y4S A;  1YZ9 A;  2V2V A;  2RS6 A;  2LTS A;  2BM1 A;  4LF4 I;  5FWK A;  4IZJ D;  2F4V I;  1VIS A;  1Y6Z A;  3B8H A;  2LTR A;  2WZO A;  3VYX A;  4JI6 E;  3PYG A;  5GMD A;  5IWA I;  3HPS A;  4DR6 E;  4DPY A;  5A2Q C;  2ZBK B;  2Z5E A;  4DPT A;  4OX9 I;  4LFC E;  4DV2 I;  3P06 A;  4Z7C A;  2IOP A;  3VYY A;  1WUU A;  1USU A;  4DPU A;  2UXB I;  3GON A;  1WHQ A;  2LUP B;  3IWB A;  2E5L E;  1DAR A;  3V2U C;  2ODR C;  4FN5 A;  4IZK B;  1Z5C A;  4Q28 A;  1UIL A;  4F9A B;  3WU3 A;  3JAM C;  4MYU A;  4JI7 E;  3J81 C;  3ZZT A;  5IWA E;  2JOB A;  4R8O A;  4JV5 I;  1O0W A;  1H72 C;  1J5E I;  1B63 A;  3LTO A;  3JTZ A;  1FJG I;  2HFU A;  4F54 A;  4WPY A;  4LF7 E;  2RS7 A;  1T4L B;  4JI0 E;  2PNL A;  1Z0C A;  1FJG E;  2IOQ A;  4JI6 I;  1Z0W A;  4JI4 I;  1RR9 A;  2M1S A;  2OI2 A;  3HXL A;  1N0U A;  4DMI A;  2M4I A;  2VQF I;  4DKK A;  4B3S E;  4DPW A;  4FWD A;  2MC5 A;  2F8B A;  2DB2 A;  3K17 A;  1RRE A;  3DJW A;  2UXB E;  3IWD A;  4IZJ A;  1N32 I;  4JI1 I;  4WUD A;  3C4B A;  2L92 A;  5ADZ A;  1HR0 I;  2XEX A;  1ZM4 A;  5A2Q Q;  2NUE A;  2GS8 A;  4BC7 A;  2KHX A;  4K0K I;  2RTX A;  3JAM Q;  1Z0E A;  5F3W A;  4X66 I;  2V83 A;  2UUB I;  1PKP A;  3F0N A;  4DV1 I;  4B3R E;  3LLH A;  1S4E A;  4P78 A;  1OJ4 A;  4X64 E;  2HFS A;  2F4V E;  4JI5 I;  5BR8 I;  1XMQ E;  4YY3 I;  1UEK A;  1ZM9 A;  3F6H A;  3K1J A;  1ZBT A;  3DF6 A;  4DXL A;  4JI2 E;  1Z0V A;  1H73 A;  2VE7 C;  4GKJ E;  1J26 A;  1B62 A;  4X62 E;  4DU8 A;  3ADG A;  2V2Q A;  2K4V A;  2ODR D;  2V8Q B;  2V34 A;  3IWC A;  4DR2 I;  3H09 A;  4OX9 E;  4P7A A;  4LF8 I;  3JU0 A;  3HQ1 A;  1I94 E;  4TUI A;  4DV0 I;  4KHP I;  2LBS B;  4DR4 E;  3PYE A;  4R03 A;  4BC9 A;  4TUG A;  4YHH I;  1X48 A;  2A2C A;  4L8N A;  1EA6 A;  3ZM7 A;  4LF5 I;  2L33 A;  4GEQ B;  3T1Y I;  3OTO E;  4USM A;  1J5E E;  2DEJ A;  2G7H A;  2DSY A;  1NHJ A;  4LF4 E;  3Q6N A;  1T4N A;  4DV0 E;  4KHP E;  4X8W A;  2L2N A;  3B82 A;  1DI2 A;  4F9B B;  4DUY E;  4M30 A;  2V87 A;  2A2D A;  1N34 I;  4B3T E;  1IBL E;  1WHN A;  2X36 A;  2JOX A;  4DV6 E;  1IBK I;  3HUL A;  4DV4 E;  4B3S I;  2BV3 A;  3QT7 A;  4DR5 I;  3B78 A;  1K47 A;  2LUQ A;  3P1X A;  4M1K A;  2HK2 A;  4B3M E;  2N3G A;  5LMN I;  3VK6 A;  1YYK A;  1N36 E;  2LJH A;  4EMD A;  3ZZU A;  1A6F A;  4JI0 I;  4GKK E;  4JYA E;  1KKH A;  2Z5B B;  4F9C B;  4HAC A;  4DV3 I;  2LMZ A;  4R1F A;  2L6M A;  3HPZ A;  4JYA I;  1IBM I;  4YHH E;  2VQE E;  4OOG C;  2Z5C B;  1BKN A;  2UUA I;  5FLX Q;  3FIG A;  2PNM A;  4DU7 A;  4WFT A;  3AUZ A;  2L2K B;  4DV7 I;  1XMO I;  4J8Z A;  2RSM A;  1U2R A;  2M7Q A;  4KQV A;  4DV5 I;  4LFB E;  4DR5 E;  2B7V A;  4DUZ E;  2MDR A;  1HNZ E;  2L8T A;  2V86 A;  1N33 I;  1HNX I;  4DR7 E;  4LFC I;  1EI1 A;  1XMO E;  2X7I A;  5LMU I;  2CPN A;  2HKJ A;  2UUC I;  2VF1 A;  1PIE A;  5AE3 A;  2JY9 A;  1HNX E;  2V2Z A;  4DV4 I;  2B7T A;  3QT5 A;  3OTO I;  2UXD I;  4DR3 E;  4NXN E;  1ZXN A;  3F6G A;  2YZT A;  4M2Z A;  4DV7 E;  4LU9 A;  4DUY I;  1H7S A;  1H7U A;  4PRV A;  1I94 I;  3J81 Q;  2UXC E;  1ELO A;  3LPS A;  2DIX A;  4JI8 E;  2L3C A;  2VQE I;  3Q1Q A;  3K6Q A;  2R3V A;  1FWL A;  3QT8 A;  2CG9 A;  1MX0 A;  1XHK A;  1QU6 A;  5CFF E;  1Z0T A;  4RPF A;  2EZ6 A;  2KON A;  3T1H E;  4M0V A;  1DQ3 A;  3WU4 A;  2B3T B;  2CGE A;  2NPF A;  3ZKB A;  4DR1 E;  1HK7 A;  3H4L A;  2JVA A;  1N0V C;  4Z7Y A;  3D4J A;  3WU5 A;  1QZR A;  4DR1 I;  1Z59 A;  4I3H A;  2VQF E;  4X65 E;  2VF3 A;  4LF6 I;  1T4O A;  1Y4U A;  2NA2 A;  4DV3 E;  5AE2 A;  1GZ6 A;  2LE2 A;  4JI3 I;  4HY1 A;  4N3O A;  2N3H A;  1USV A;  2DMY A;  4FWG A;  4IZJ B;  4X65 I;  3PYD A;  1NHH A;  2O1T A;  2GQ0 A;  3ADJ A;  2V85 A;  3MSW A;  3J7Y p;  1ZBQ A;  3LML A;  1Z0B A;  4IZK A;  2WW4 A;  4DR7 I;  1D6T A;  4LF5 E;  3ADL A;  1N33 E;  4P52 A;  1HNZ I;  4JI1 E;  2ZM6 E;  4ZVI A;  4X62 I;  2E1M A;  2BM0 A;  1YYW A;  2HK3 A;  2UUC E;  4UT4 A;  5LMN E;  4B3M I;  4BS9 A;  2V89 A;  1NZ0 A;  2FTX B;  4ED4 A;  1NHI A;  4DV2 E;  2EWL A;  1IBM E;  1IBK E;  2DEI A;  4DV6 I;  2ZIT A;  3Q6M A;  2H36 X;  4DUZ I;  4DPX A;  3T1Y E;  4FWH A;  4B3R I;  3QT6 A;  1H74 A;  4MYT A;  1FNM A;  4LF6 E;  1XNQ E;  3ADI A;  5AAS A;  4UTG A;  4BCA A;  4JI5 E;  4WUB A;  2FGG A;  5GME A;  2JWO A;  4LTY A;  4NXN I;  2O1U A;  4JI3 E;  1KIJ A;  1X49 A;  2O1W A;  4DV1 E;  2UXD E;  1YYO A;  4URL A;  3J80 C;  1N32 E;  1WXR A;  1IBL I;  2E5L I;  1ZM3 A;  1XNR E;  1S16 A;  2KOU A;  3KWR A;  4L5N C;  2Z5C A;  4JI8 I;  2AJ4 A;  3OML A;  2O1V A;  4WSP A;  4JV5 E;  4LFA I;  4BBY A;  3T1H I;  4NXM E;  1KVK A;  4B3T I;  1EKZ A;  4GKJ I;  1Z0G A;  3PYF A;  3ZZ0 A;  2L2M A;  1STU A;  3ZOQ B;  4LF7 I;  4KZS A;  5LL6 R;  3C4T A;  2UXC I;  4HXZ A;  3LNU A;  2IHR 1;  1KTV A;  4I8O A;  5FLX C;  1Z5A A;  1UHZ A;  1N36 I;  5BR8 E;  4P7D A;  2UUA E;  3J80 Q;  1XNQ I;  1MG7 A;  4LF8 E;  2MC6 A;  4JI4 E;  1RC7 A;  1FKA E;  4DR3 I;  2CZ9 A;  2R42 A;  3K85 A;  1SR9 A;  1GQE A;  2V8P A;  4DR6 I;  2EFG A;  1N34 E;  1HNW I;  4FW9 A;  4XTJ A;  4HYM A;  3HJC A;  4HAC B;  2HKE A;  2LJP A;  1ZM2 A;  3HTX A;  4DR2 E;  5L3J A;  1Z5B A;  1ZXM A;  5DNY A;  1FWK A;  4PU9 A;  3J7A G;  2LRS A;  4X64 I;  2ZM6 I;  3ZKD A;  1XNR I;  5AE1 A;  4LFB I;  1X47 A;  4BMJ A;  2NUG A;  2UU9 E;  4X66 E;  2UUB E;  4PRX A;  2Q2E B;  4AQY I;  2B9D A;  3J7A M;  3V5R A;  2HHH I;  4LF9 I;  4WYQ B;  2E1R A;  1FI4 A;  3WU6 A;  4AQY E;  4GKK I;  3RMP A;  2J7K A;  4DR4 I;  4K0K E;  2Z5B A;  2HHH E;  2NUF A;  4LF9 E;  4NXM I;  5LMU E;  4JG4 A;  5IT9 Q;  3PRY A;  4WUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...