2UXCE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcE02
1ZM9A 4KQVA 4DV4E 1FJGE 1T4NA 1WHQA 2LUPB 4X64E 3PYDA 1YYOA 1K47A 4WFTA 3QT6A 1HR0E 4PRXA 1A6FA 1UILA 1N33E 1PKPA 2DB2A 4ZVIA 3OTOE 2LJHA 2UUCE 2DEIA 1X47A 4PU9A 4JI5I 3ADIA 1XMOE 4DV5I 3K17A 4B3ME 1KKHA 1N34E 4JI6E 2L33A 2CPNA 4DR5I 3B78A 2ZITA 2UXCE 1ZM3A 4JI0E 5FLXQ 4JI8I 4DR4E 4DXLA 4OX9I 2F4VI 3GONA 1XMQE 4DV0I 2DEJA 4LFBE 5IWAI 4DPWA 1VISA 2B7VA 5GMEA 4P7AA 4USKA 1J26A 2BM1A 3HULA 1DARA 4LFCI 3WU4A 4DV6I 4DR1I 1ZXNA 4MYTA 4UTGA 4FWDA 2UUBI 1MG7A 1EKZA 3LLHA 4X8WA 2NUGA 2A2DA 1N32I 2ZM6I 4DKKA 4WUBA 2VF3A 5GMDA 1HNWI 4DV1I 2HHHI 5A2QC 4JI5E 4DV5E 1RREA 4R1FA 1EI1A 3JAMC 4B3TI 1WHNA 1RQ0A 4DR5E 4FN5A 2X36A 4JI1I 4DPYA 4LF4I 1BKNA 4JI8E 4DUZI 2V2ZA 4OX9E 5LMUI 4KHPI 1WUUA 4AQYI 2F4VE 4DV0E 5BR8I 4M2ZA 1B63A 4DV7I 2LUQA 5IWAE 4URLA 4DR2I 3WU6A 4LF8I 4MYUA 3HTXA 1ZBTA 1PVGA 1J5EI 4LFCE 4DV6E 1FWKA 4DR1E 2BM0A 3J81C 1IBLI 2AJ4A 2UUBE 2LTSA 2A2CA 3QT7A 4DUYE 2HKJA 1N32E 2ZM6E 4DR7I 2ZBKB 4JI7I 3B8HA 4DR3I 1HNWE 3J7AG 1Z5CA 4WYQB 4DV1E 3J7AM 2HHHE 2UUAI 2UXBI 2Q2EB 2V2VA 1N0UA 1H72C 4JI3I 1Z0WA 4B3TE 4DR6E 1Z0BA 4LF6E 4JYAI 1UEKA 3P1XA 3D4JA 2B3TB 3F0NA 1MU5A 4JI1E 4LF4E 3QT5A 4M30A 4LF7I 4DUZE 1X49A 5LMUE 4NXME 2HK2A 4AQYE 1PIEA 1XNRI 1N36I 3K1JA 2XEXA 1I94I 5BR8E 2V34A 3WU5A 1D6TA 4I3HA 4DV7E 1RC7A 4DR2E 4XTJA 4HYMA 1YZ9A 4UT4A 1ZXMA 4JV5I 4LF8E 4DPTA 5IT9Q 3JAMQ 3VYXA 4NXNI 4LFAI 2OI2A 2VQEI 2KHXA 1J5EE 3ZZUA 3V2UC 1UHZA 4YHHI 1IBLE 4FWHA 4M1KA 4LF9I 2HFSA 2L3JA 2BV3A 1EA6A 1QZRA 4USMA 4LF5I 3ADLA 1U2RA 4K0KI 1YYKA 4DV2I 4DR7E 2N3HA 5FLXC 4JI7E 1T4LB 4DR3E 3PYEA 1Z5BA 2WW4A 2V2QA 3LNUA 2X7IA 3J80C 2UUAE 2UXBE 5LL6R 4YY3I 4GKKI 4WUDA 2UUCI 4JI3E 1MX0A 1HNXI 4DU7A 4B3MI 2MDRA 3J81Q 4X62E 2NA2A 2YT4A 1YYWA 2RSMA 4ED4A 1N0VC 4LF7E 1FWLA 1Z0VA 2R3VA 1N36E 2J7KA 1DI2A 1I94E 2EFGA 4RPFA 4DU8A 4Z7YA 4JV5E 3T1YE 2UXDI 4LFAE 4NXNE 2VQEE 2V8PA 1XNQI 3C4TA 2EZ6A 2RS6A 3J7Yp 1Z0TA 1X48A 4Z7CA 4YHHE 1KIJA 4DPXA 4LF9E 4P52A 4LF5E 4K0KE 2E5LI 4FW9A 4DV2E 2LBSB 3T1HI 1T4OA 3WU3A 2GS8A 1IBMI 3ADJA 4B3RI 4GKJI 1ZM4A 2VQFI 5CFFE 2L2MA 4JI2I 4YY3E 4GKKE 1HNXE 2N3GA 4X66I 4DV3I 1H7UA 4WUCA 2NUFA 4X65I 4B3SI 2UU9I 1KVKA 1GQEA 3LTOA 3C4BA 1H73A 4JI4I 4KHPE 3M6AA 2JY9A 2L2KB 1B62A 2L3CA 1HNZI 5A2QQ 1IBKI 1QU6A 2B7TA 2NUEA 3ZM7A 3J80Q 1ZM2A 1NZ0A 2DMYA 2UXDE 3ZZTA 1FI4A 5LMNI 2CZ9A 1XNQE 1STUA 1NHIA 4X62I 3T1YI 1FKAE 4DV4I 1FJGI 4HY1A 4X64I 1Z0CA 4EMDA 2E5LE 3T1HE 1HR0I 2L2NA 4DUYI 1H74A 4PRVA 3ZZ0A 4JG4A 1N33I 1IBME 3OTOI 4B3RE 4GKJE 2VQFE 2HK3A 1XMOI 4JI2E 4HXZA 3VYYA 3ZKDA 1NHJA 1N34I 4JYAE 2LRSA 4OOGC 1S16A 2RTXA 2NPFA 4X66E 1Z0EA 3ADGA 3CWVA 4JI6I 4DV3E 1H7SA 3Q1QA 1Z0GA 2RS7A 4X65E 5IT9C 4B3SE 4DPUA 2UU9E 2E1RA 4DR6I 4JI4E 2UXCI 3B82A 4JI0I 2IHR1 1RR9A 1Z59A 5L3JA 4LF6I 1XNRE 4DR4I 4HACB 1HNZE 2HKEA 1NHHA 1IBKE 1XMQI 1Z5AA 2LJPA 3PYFA 3PYGA 2LTRA 1S4EA 2JVAA 4LFBI 4NXMI 1O0WA 3H4LA 3LPSA 1ELOA 1KTVA 1OJ4A 2R42A 1XHKA 5LMNE 3ZKBA 2DIXA 2HFUA 3QT8A 1FNMA 4HACA 3V5RA 4FWGA
chains in the Genus database with same CATH superfamily
2EN2A 1ZM9A 4KQVA 4DV4E 1FJGE 1T4NA 1WHQA 1E3HA 4IZJB 2PO0A 2LUPB 5AE3A 4X64E 3CDIA 1UDQA 3PYDA 2EM3A 2EQ0A 1YYOA 1K47A 2EPPA 2LE2A 4WFTA 3NZKA 2C39A 3QT6A 1HR0E 3HQ1A 2BR2B 5JEAA 4PRXA 2EOZA 4Q28A 2YPNA 3THNA 1A1IA 3IWCA 1UILA 2FTXB 1YUJA 3EPJA 1N33E 1PDAA 1A6FA 1PKPA 2DB2A 2Z5EA 4ZVIA 3OTOE 2LJHA 2UUCE 2DEIA 2L6MA 1X47A 4R8OA 2C37A 4PU9A 4JI5I 2EMWA 1XMOE 3ADIA 2EL5A 2EM7A 4DV5I 4QNJA 1SR9A 2JXPA 3K17A 4B3ME 1KKHA 2V87A 1N34E 2PNZA 4WSGA 5C0XF 2V8QB 5IV8B 4IFDC 5ADZA 4F9BB 2JWOA 4DMIA 1A1KA 4IZJA 3B4TA 5C0XC 4JI6E 1YPNA 2YTFA 2E1MA 4F9AB 2L33A 2CPNA 2EMYA 2EOIA 2HJJA 4R03A 2AE8A 2CG9A 2EL6A 4LOMA 4DR5I 2ENAA 2BBGA 4ZYEA 2ZITA 1IMUA 3B78A 4FW4A 1A1FA 2BR2A 2YTGA 2UXCE 1ZM3A 4JI0E 2EMGA 4WX9A 4O5GA 1OYRA 5FLXQ 2JE6A 3GLLA 4JI8I 4DR4E 2PNLA 4DXLA 5AE1A 3CDJA 4OX9I 1X3CA 4OO1C 1GZ6A 2LMZA 3HKMA 2F4VI 2WBTA 3GONA 1X5WA 1XMQE 1G2DC 2V83A 2DEJA 2LT7A 4DV0I 2EP3A 4LFBE 5IWAI 4DPWA 2EM5A 4BC7A 2EQ1A 1VISA 3P76A 2ELYA 4O4KA 2RSIA 2EOSA 2B7VA 2GPIA 5GMEA 4P7AA 4USKA 2YZTA 1J26A 2BM1A 1G2FC 3HULA 2WBUA 1DARA 4LFCI 5DRQA 3KZYA 3WU4A 3L00A 4DV6I 4DR1I 2EMFA 1ZXNA 1EH7A 1XXEA 4MYTA 5K36D 4UTGA 4FWDA 2UUBI 1MG7A 1EKZA 3LLHA 3K85A 2NN6E 4X8WA 2KOUA 2NUGA 4FW7A 4IZKB 2YTPA 4MU4A 4U3DA 2YU8A 2A2DA 1RHYA 1N32I 2ZM6I 4DKKA 4WUBA 1WXRA 4WPYA 2VF3A 5GMDA 5KL5A 1HNWI 3BGHA 2LO3A 4DV1I 2HHHI 2NN6B 2YTJA 5A2QC 4QNKA 3ZOQB 5DNYA 4JI5E 1YHCA 4DV5E 4FW6A 1MEYC 1RREA 4P7DA 2DGCA 5EKWA 4R1FA 2L92A 1EI1A 3JAMC 5KL6A 4R2EA 4B3TI 4LCGA 3F6HA 1WHNA 3UK3C 2EORA 1MGTA 4GZNC 4IZKA 4MLQA 4WXCA 2YRKA 4AIDA 1RQ0A 1TF6A 2EOEA 2EMZA 4DR5E 2JR1A 4FN5A 2EMXA 5JEAE 2X36A 5JEAF 3H1CA 2JP9A 2LCEA 4JI1I 4FK5C 4DPYA 4LF4I 2I9IA 4LU9A 1BKNA 4JI8E 4DUZI 2V2ZA 2EPZA 1A1LA 4OX9E 4J8ZA 1WRJA 5LMUI 4KHPI 1WUUA 4AQYI 2F4VE 2C39B 3C6MA 1RMDA 4DV0E 2EOXA 5BR8I 2VE7C 5T6JA 2BA1D 4O43A 4M2ZA 1B63A 4DV7I 2L8TA 2LUQA 5IWAE 4URLA 4DR2I 5K36B 2C37B 1X6HA 2EN8A 4IJDA 3HPZA 3WU6A 4LF8I 3TQMA 1Z1BA 4MYUA 3HTXA 4ZYHA 2EPLX 2PNZB 4MLVA 1ZBTA 1PVGA 1J5EI 2J65A 4LFCE 2O1WA 4IFDD 5C0XD 4DV6E 1FWKA 5ELWA 4DR1E 2BM0A 4OZEA 3J81C 1DQ3A 1IBLI 2EM6A 5DROA 2AJ4A 2UUBE 3MSWA 2LTSA 2A2CA 2M7QA 3QT7A 2EM8A 4F2JC 4DUYE 2WZOA 3PS3A 5KL7A 2HKJA 4WXDA 2JE6B 2O3ZA 2VESA 2ODRC 1N32E 2ZM6E 4DR7I 2N8XA 2ZBKB 2EN7A 4HACA 1Y4UA 2GQ0A 5K36A 4BS9A 4M0VA 4JI7I 4OO1D 3HXLA 3B8HA 4DR3I 1HNWE 4R2AA 3J7AG 1Z5CA 4WYQB 2IOPA 4DV1E 1VI7A 2EPKX 3J7AM 2CSHA 2HHHE 2UUAI 4ZYGA 4BBYA 2Q2EB 2UXBI 2V2VA 2YTNA 5A6KA 4U3BA 1N0UA 5DRPA 2JOBA 2DRPA 1Y60A 2CVEA 1H72C 2YRMA 4R2SA 4NHRA 1Y6ZA 4JI3I 1Z0WA 2EPAA 4B3TE 4DR6E 4I8OA 1Z0BA 1AAYA 3P06A 4BMJA 4LF6E 4BHCA 4JYAI 2HGHA 1UEKA 3P1XA 4ISAA 3D4JA 4AM3A 2EWLA 2EOJA 2EM9A 2EMLA 2B3TB 3EQ1A 3F0NA 3L7ZB 1MU5A 5F3WA 4L5NC 5IXMB 2D9HA 2EM4A 4JI1E 2V88A 4R2QA 4M30A 4LF4E 3QT5A 4LF7I 4DUZE 2V86A 1X49A 5LMUE 4NXME 2MC5A 2HK2A 4AQYE 3PS1A 1PIEA 3M85D 2V85A 2M4IA 4RH8A 1N36I 3K1JA 2YTQA 1XNRI 2XEXA 1I94I 2VF1A 5BR8E 4IFDB 1P47A 1ZR9A 5C0XB 4BHBA 3WU5A 1D6TA 2YRHA 4I3HA 4DV7E 1RC7A 2ELZA 3ECRA 4DR2E 4XTJA 4HYMA 1YZ9A 4BA1B 1ZXMA 4UT4A 1NEIA 2PO2B 4LF8E 4JV5I 4DPTA 2JEAB 4TUIA 3JAMQ 5IT9Q 3VYXA 4NXNI 4LFAI 2OI2A 3PRYA 2VQEI 2KHXA 1UDNA 1J5EE 2ADRA 3L7ZA 4RHBB 3ZZUA 3V2UC 1X6FA 2BB8A 3JTZA 4LCFA 4MU1A 1UHZA 2NN6F 3P3CA 2WBSA 4YHHI 4MDTA 1IBLE 1TN9A 4FWHA 4OO1B 2NN6C 1GTKA 4M1KA 3OMLA 4LF9I 2EOQA 2HFSA 2L3JA 2EOYA 2BV3A 1EA6A 1QZRA 4USMA 4LF5I 2Z5CB 2MKNA 4Q35B 3ADLA 1UDSA 1U2RA 4IFDA 5C0XA 4K0KI 1B69A 1YYKA 4DV2I 3RMPA 4DR7E 3GCMA 1Y5YA 3KZZA 2N3HA 2LVHA 5FLXC 4JI7E 1WJPA 4BA1A 4M9VC 1T4LB 2H36X 2PO2A 4DR3E 3PYEA 2JEAA 1Z5BA 2WW4A 5DRRA 2V2QA 3LNUA 5A6BD 3EPLA 1N3GA 3QG5C 3J80C 2UUAE 2UXBE 2X7IA 3BF2A 2EMAA 2YSPA 5LL6R 4YY3I 2NABA 4GKKI 2IERA 4FWGA 4WUDA 3LMLA 3P3EA 2UUCI 4OO1A 5LLQA 2GHFA 4GEQB 4JI3E 1MX0A 3UHMA 1HNXI 4DU7A 1USUA 4B3MI 2MDRA 3C6KA 2I13A 1YUIA 1AH5A 2Z5CA 4MU3A 2EMCA 3J81Q 5JEAC 2NA2A 4ZYDA 3M7ND 5K36E 1KYQA 3DJWA 1IQSA 2YT4A 4O24A 2EQ3A 5K36F 1YYWA 2EM0A 1YFHA 1UDOA 1EH8A 4IS1C 3GMEA 2RSMA 4ED4A 5TSEA 3K6QA 1N0VC 3HJCA 4LF7E 1E3PA 1BBOA 1A1JA 4NBQA 1FWLA 2ODRD 1Z0VA 4FW3A 4GQUA 2YWQA 5AE2A 4R2DA 2BA1G 2BA0D 2M1SA 1N36E 3DF6A 2WCC3 1UBDC 2R3VA 2WNRA 2J7KA 1DI2A 1I94E 4J3DA 2EOHA 2MDGA 2DLKA 5A6AA 2EFGA 1LLMC 4RPFA 3P3GA 4DU8A 2EMIA 4Z7YA 4MQYA 3EPKA 3T1YE 4JV5E 2UXDI 4LFAE 4NXNE 2JPAA 4TUGA 4N3OA 1BBGA 4X9JA 2VQEE 2V8PA 2YTEA 1ZU1A 3C4TA 2O1TA 2EZ6A 1NCSA 2RS6A 3J7Yp 3Q6MA 1XNQI 2FGGA 4L8NA 2JEBA 2EPRA 1X48A 1SFEA 2EL4A 2J7JA 1Z0TA 4Z7CA 2LJUA 4YHHE 4FW5A 1KIJA 4DPXA 4BCAA 3JU0A 2ENCA 4LF9E 2K4VA 2PO1A 2CGEA 4P52A 4KZSA 2B9DA 4LF5E 2EN6A 3BBGA 3MHHC 2O1VA 4K0KE 2E5LI 2KONA 4FW9A 2YTIA 4DV2E 2LBSB 3T1HI 1T4OA 4F54A 2GO3A 3H09A 4F9CB 1OYSA 5KL4A 3WU3A 2GS8A 2F1DA 1IBMI 2FV4B 3ADJA 4B3RI 4GKJI 1ZM4A 2VQFI 2EPMX 2MC6A 2Q8UA 2L2MA 5CFFE 2WP8B 1TF3A 2HC5A 4JI2I 2A25A 4HTGA 4YY3E 5FWKA 5AASA 4R2RA 4GKKE 2C38B 1OYPA 3THOB 1HNXE 2MKDA 2N3GA 4X66I 2JT2A 4KWYA 2EPNA 5A6BA 4IFDE 2EPOA 4DV3I 5C0XE 2EMKA 2EOFA 2EPUA 1H7UA 2E72A 2NUFA 4WUCA 4X65I 4IFDF 2EN1A 4B3SI 2UU9I 2YTDA 1PJTA 1KVKA 1YH8A 4MU0A 2PNMA 1GQEA 3LTOA 3C4BA 3HPSA 1H73A 4JI4I 2NN6D 3BIDA 4KHPE 1P42A 3M6AA 2O1UA 2JY9A 5KL3A 4F6MA 2L2KB 1B62A 1L4SA 3U1YA 3M85G 3DD6A 1DGCA 2L3CA 2IOQA 1HNZI 3F6GA 2R76A 5A2QQ 2WP8A 4F6NA 1IBKI 4BC9A 3VK6A 1QU6A 4WSPA 2YU5A 4OO1E 4LTYA 2EN3A 2B7TA 2C38A 4OO1F 2NUEA 2F8BA 3ZM7A 1R6MA 3J80Q 3KWRA 1ZM2A 3EPHA 2RQLA 1USVA 5DNXA 1F2IG 1NZ0A 2EE8A 5A69A 2DMYA 2UXDE 3ZZTA 1FI4A 3PS2A 5A6JA 4OKGA 5LMNI 2CZ9A 4IS9A 1JK2A 2V89A 1XNQE 1STUA 2RPCA 2JOXA 1ZAAC 1NHIA 4X62I 3T1YI 1PJSA 1R6LA 2EN4A 1A1HA 1X6EA 1FKAE 4LCHA 5JEAD 5EL9A 4DV4I 1FJGI 1IQOA 2YSOA 3VHTB 4HY1A 2EOOA 2ENHA 4X64I 1QNTA 1Z0CA 4EMDA 3FIGA 2IESA 2E5LE 3T1HE 3MHSC 2EMHA 4BA2B 1HR0I 2L2NA 4DUYI 4R2PA 1H74A 4AIMA 1BB8A 2EJ4A 4PRVA 4JG4A 3ZZ0A 1N33I 1ZBQA 1IBME 3KRNA 2WNRB 4B3RE 4IZJD 4GKJE 3OTOI 5KL2A 4LPFA 2EPCA 2VQFE 2HK3A 1XMOI 1EH6A 4JI2E 2DLQA 1T38A 4HXZA 3U1KA 3VYYA 3ZKDA 1NHJA 3IWBA 1N34I 4JYAE 2LRSA 4OOGC 1S16A 2EMBA 2EM2A 2RTXA 2NPFA 2EPXA 2JYAA 4X66E 3M99B 3ADGA 1UN6B 1Z0EA 4N4RB 3CWVA 4JI6I 1T39A 3M7NG 4DV3E 1H7SA 3Q1QA 1Z0GA 2RS7A 5K36C 4X65E 1A1GA 5IT9C 4B3SE 1HK7A 2UU9E 2JEBB 2G7HA 5AC5A 2E1RA 4DPUA 4DR6I 4BA2A 4JI4E 2UXCI 3B82A 4JI0I 2IHR1 1RR9A 1Z59A 5L3JA 2Z5BB 4LF6I 2GO4A 2PO1B 2DSYA 1XNRE 2R1FA 4DR4I 2BA0G 4HACB 1HNZE 2HKEA 4R2CA 1Y4SA 2LV2A 1NHHA 1IBKE 1JK1A 1XMQI 1Z5AA 2LJPA 2PO0B 3PYFA 3PYGA 2LTRA 1S4EA 2JVAA 2NN6A 4HEIA 4LFBI 3AUZA 1KJKA 3Q6NA 2CT1A 4NXMI 3AV0A 1O0WA 3H4LA 2GLIA 3LPSA 1ELOA 5JEAB 2CTDA 2PRTA 1KTVA 1OJ4A 2R42A 5DNLA 1XHKA 2DMIA 2EOMA 2YTOA 5AC4A 5LMNE 1YSAC 3ZKBA 2K7IA 2M9AA 2VRDA 2DIXA 2Z5BA 2HFUA 3QT8A 1PJQA 4NZVA 1FNMA 3IWDA 4P78A 4X62E 3V5RA 2V34A
chains in the Genus database with same CATH topology
1ZM9A 4KQVA 4DV4E 1FJGE 1T4NA 1WHQA 4IZJB 2LUPB 5AE3A 4X64E 3PYDA 1YYOA 1K47A 2LE2A 4WFTA 3QT6A 1HR0E 3HQ1A 4PRXA 4Q28A 1A6FA 3IWCA 1UILA 2FTXB 1N33E 1PKPA 2DB2A 2Z5EA 4ZVIA 3OTOE 2LJHA 2UUCE 2DEIA 2L6MA 1X47A 4R8OA 4PU9A 4JI5I 3ADIA 1XMOE 4DV5I 1SR9A 3K17A 4B3ME 1KKHA 2V87A 1N34E 2V8QB 5ADZA 4F9BB 2JWOA 4DMIA 4IZJA 4JI6E 4F9AB 2E1MA 2L33A 2CPNA 4R03A 2CG9A 4DR5I 3B78A 2ZITA 2UXCE 1ZM3A 4JI0E 5FLXQ 4JI8I 4DR4E 2PNLA 4DXLA 5AE1A 4OX9I 1GZ6A 2LMZA 2F4VI 3GONA 1XMQE 2V83A 2DEJA 4DV0I 4LFBE 5IWAI 4DPWA 4BC7A 1VISA 2B7VA 5GMEA 4P7AA 4USKA 2YZTA 1J26A 2BM1A 3HULA 1DARA 4LFCI 3WU4A 4DV6I 4DR1I 1ZXNA 4MYTA 4UTGA 4FWDA 2UUBI 1MG7A 1EKZA 3LLHA 3K85A 4X8WA 2KOUA 2NUGA 4IZKB 2A2DA 1N32I 2ZM6I 4DKKA 4WUBA 1WXRA 4WPYA 2VF3A 5GMDA 1HNWI 4DV1I 2HHHI 5A2QC 3ZOQB 5DNYA 4JI5E 4DV5E 1RREA 4P7DA 4R1FA 2L92A 1EI1A 3JAMC 4B3TI 3F6HA 1WHNA 4IZKA 1RQ0A 4DR5E 2JR1A 4FN5A 2X36A 4JI1I 4DPYA 4LF4I 4LU9A 1BKNA 4JI8E 4DUZI 2V2ZA 4OX9E 4J8ZA 5LMUI 4KHPI 1WUUA 4AQYI 2F4VE 4DV0E 5BR8I 2VE7C 5T6JA 4M2ZA 1B63A 4DV7I 2L8TA 2LUQA 5IWAE 4URLA 4DR2I 3HPZA 3WU6A 4LF8I 4MYUA 3HTXA 1ZBTA 1PVGA 1J5EI 4LFCE 2O1WA 4DV6E 1FWKA 4DR1E 2BM0A 3J81C 1DQ3A 1IBLI 2AJ4A 2UUBE 3MSWA 2LTSA 2A2CA 2M7QA 3QT7A 4DUYE 2WZOA 2HKJA 2ODRC 1N32E 2ZM6E 4DR7I 2ZBKB 4HACA 1Y4UA 2GQ0A 4BS9A 4M0VA 4JI7I 3HXLA 3B8HA 4DR3I 1HNWE 3J7AG 1Z5CA 4WYQB 2IOPA 4DV1E 3J7AM 2HHHE 2UUAI 2UXBI 4BBYA 2Q2EB 2V2VA 1N0UA 2JOBA 1H72C 1Y6ZA 4JI3I 1Z0WA 4B3TE 4DR6E 4I8OA 1Z0BA 3P06A 4BMJA 4LF6E 4JYAI 1UEKA 3P1XA 3D4JA 2EWLA 2B3TB 3F0NA 1MU5A 5F3WA 4L5NC 4JI1E 2V88A 4LF4E 4M30A 3QT5A 4LF7I 4DUZE 2V86A 1X49A 5LMUE 4NXME 2MC5A 2HK2A 4AQYE 1PIEA 2V85A 2M4IA 1N36I 1XNRI 3K1JA 2XEXA 1I94I 2VF1A 5BR8E 3WU5A 1D6TA 4I3HA 4DV7E 1RC7A 4DR2E 4XTJA 4HYMA 1YZ9A 4UT4A 1ZXMA 4JV5I 4LF8E 4DPTA 4TUIA 3JAMQ 5IT9Q 3VYXA 4NXNI 4LFAI 2OI2A 3PRYA 2VQEI 2KHXA 1J5EE 3ZZUA 3V2UC 3JTZA 1UHZA 4YHHI 1IBLE 4FWHA 4M1KA 3OMLA 4LF9I 2HFSA 2L3JA 2BV3A 1EA6A 1QZRA 4USMA 4LF5I 2Z5CB 3ADLA 1U2RA 4K0KI 1YYKA 4DV2I 3RMPA 4DR7E 2N3HA 5FLXC 4JI7E 1T4LB 2H36X 4DR3E 3PYEA 1Z5BA 2WW4A 2V2QA 3LNUA 3J80C 2X7IA 2UUAE 2UXBE 5LL6R 4YY3I 4GKKI 4FWGA 4WUDA 3LMLA 2UUCI 4GEQB 4JI3E 1MX0A 1HNXI 4DU7A 1USUA 4B3MI 2MDRA 2Z5CA 3J81Q 4X62E 2NA2A 3DJWA 2YT4A 1YYWA 2RSMA 4ED4A 3K6QA 1N0VC 3HJCA 4LF7E 1FWLA 2ODRD 1Z0VA 5AE2A 2R3VA 2M1SA 1N36E 3DF6A 2J7KA 1DI2A 1I94E 2EFGA 4RPFA 4DU8A 4Z7YA 4JV5E 2UXDI 4LFAE 4NXNE 4TUGA 4N3OA 2VQEE 2V8PA 1XNQI 3C4TA 2O1TA 2EZ6A 2RS6A 3J7Yp 3Q6MA 2FGGA 4L8NA 1Z0TA 1X48A 4Z7CA 4YHHE 1KIJA 4DPXA 4BCAA 3JU0A 4LF9E 2K4VA 2CGEA 4P52A 4KZSA 2B9DA 4LF5E 2O1VA 4K0KE 2E5LI 2KONA 4FW9A 4DV2E 2LBSB 3T1HI 1T4OA 4F54A 3H09A 4F9CB 3WU3A 2GS8A 1IBMI 2FV4B 3ADJA 4B3RI 4GKJI 1ZM4A 2VQFI 2MC6A 5CFFE 2L2MA 4JI2I 4YY3E 5FWKA 5AASA 4GKKE 1HNXE 2N3GA 4X66I 4DV3I 1H7UA 4WUCA 2NUFA 4X65I 4B3SI 2UU9I 1KVKA 2PNMA 1GQEA 3LTOA 3C4BA 3HPSA 1H73A 4JI4I 4KHPE 3M6AA 2O1UA 2JY9A 2L2KB 1B62A 2L3CA 2IOQA 1HNZI 3F6GA 5A2QQ 1IBKI 4BC9A 3VK6A 1QU6A 4WSPA 4LTYA 2B7TA 2NUEA 2F8BA 3ZM7A 3J80Q 3KWRA 1ZM2A 1USVA 1NZ0A 2DMYA 2UXDE 3ZZTA 1FI4A 5LMNI 2CZ9A 2V89A 1XNQE 1STUA 2JOXA 1NHIA 4X62I 3T1YI 1FKAE 4DV4I 1FJGI 4HY1A 4X64I 1Z0CA 4EMDA 3FIGA 2E5LE 3T1HE 1HR0I 2L2NA 4DUYI 1H74A 4PRVA 3ZZ0A 4JG4A 1N33I 1ZBQA 1IBME 4IZJD 3OTOI 4B3RE 4GKJE 2VQFE 2HK3A 1XMOI 4JI2E 4HXZA 3VYYA 3ZKDA 1NHJA 3IWBA 1N34I 4JYAE 2LRSA 4OOGC 1S16A 2RTXA 2NPFA 4X66E 1Z0EA 3ADGA 3CWVA 4JI6I 4DV3E 1H7SA 3Q1QA 1Z0GA 2RS7A 4X65E 5IT9C 4B3SE 1HK7A 2UU9E 4DPUA 2G7HA 2E1RA 4DR6I 4JI4E 2UXCI 3B82A 4JI0I 2IHR1 1RR9A 1Z59A 5L3JA 2Z5BB 4LF6I 2DSYA 1XNRE 4DR4I 4HACB 1HNZE 2HKEA 1Y4SA 1NHHA 1IBKE 1XMQI 1Z5AA 2LJPA 3PYFA 3PYGA 2LTRA 1S4EA 2JVAA 4LFBI 3AUZA 3Q6NA 4NXMI 3AV0A 1O0WA 3H4LA 3LPSA 1ELOA 1KTVA 1OJ4A 2R42A 1XHKA 5LMNE 3ZKBA 2DIXA 2Z5BA 2HFUA 3QT8A 1FNMA 3IWDA 4P78A 3T1YE 3V5RA 2V34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM9 A;  4KQV A;  4DV4 E;  1FJG E;  1T4N A;  1WHQ A;  2LUP B;  4X64 E;  3PYD A;  1YYO A;  1K47 A;  4WFT A;  3QT6 A;  1HR0 E;  4PRX A;  1A6F A;  1UIL A;  1N33 E;  1PKP A;  2DB2 A;  4ZVI A;  3OTO E;  2LJH A;  2UUC E;  2DEI A;  1X47 A;  4PU9 A;  4JI5 I;  3ADI A;  1XMO E;  4DV5 I;  3K17 A;  4B3M E;  1KKH A;  1N34 E;  4JI6 E;  2L33 A;  2CPN A;  4DR5 I;  3B78 A;  2ZIT A;  2UXC E;  1ZM3 A;  4JI0 E;  5FLX Q;  4JI8 I;  4DR4 E;  4DXL A;  4OX9 I;  2F4V I;  3GON A;  1XMQ E;  4DV0 I;  2DEJ A;  4LFB E;  5IWA I;  4DPW A;  1VIS A;  2B7V A;  5GME A;  4P7A A;  4USK A;  1J26 A;  2BM1 A;  3HUL A;  1DAR A;  4LFC I;  3WU4 A;  4DV6 I;  4DR1 I;  1ZXN A;  4MYT A;  4UTG A;  4FWD A;  2UUB I;  1MG7 A;  1EKZ A;  3LLH A;  4X8W A;  2NUG A;  2A2D A;  1N32 I;  2ZM6 I;  4DKK A;  4WUB A;  2VF3 A;  5GMD A;  1HNW I;  4DV1 I;  2HHH I;  5A2Q C;  4JI5 E;  4DV5 E;  1RRE A;  4R1F A;  1EI1 A;  3JAM C;  4B3T I;  1WHN A;  1RQ0 A;  4DR5 E;  4FN5 A;  2X36 A;  4JI1 I;  4DPY A;  4LF4 I;  1BKN A;  4JI8 E;  4DUZ I;  2V2Z A;  4OX9 E;  5LMU I;  4KHP I;  1WUU A;  4AQY I;  2F4V E;  4DV0 E;  5BR8 I;  4M2Z A;  1B63 A;  4DV7 I;  2LUQ A;  5IWA E;  4URL A;  4DR2 I;  3WU6 A;  4LF8 I;  4MYU A;  3HTX A;  1ZBT A;  1PVG A;  1J5E I;  4LFC E;  4DV6 E;  1FWK A;  4DR1 E;  2BM0 A;  3J81 C;  1IBL I;  2AJ4 A;  2UUB E;  2LTS A;  2A2C A;  3QT7 A;  4DUY E;  2HKJ A;  1N32 E;  2ZM6 E;  4DR7 I;  2ZBK B;  4JI7 I;  3B8H A;  4DR3 I;  1HNW E;  3J7A G;  1Z5C A;  4WYQ B;  4DV1 E;  3J7A M;  2HHH E;  2UUA I;  2UXB I;  2Q2E B;  2V2V A;  1N0U A;  1H72 C;  4JI3 I;  1Z0W A;  4B3T E;  4DR6 E;  1Z0B A;  4LF6 E;  4JYA I;  1UEK A;  3P1X A;  3D4J A;  2B3T B;  3F0N A;  1MU5 A;  4JI1 E;  4LF4 E;  3QT5 A;  4M30 A;  4LF7 I;  4DUZ E;  1X49 A;  5LMU E;  4NXM E;  2HK2 A;  4AQY E;  1PIE A;  1XNR I;  1N36 I;  3K1J A;  2XEX A;  1I94 I;  5BR8 E;  2V34 A;  3WU5 A;  1D6T A;  4I3H A;  4DV7 E;  1RC7 A;  4DR2 E;  4XTJ A;  4HYM A;  1YZ9 A;  4UT4 A;  1ZXM A;  4JV5 I;  4LF8 E;  4DPT A;  5IT9 Q;  3JAM Q;  3VYX A;  4NXN I;  4LFA I;  2OI2 A;  2VQE I;  2KHX A;  1J5E E;  3ZZU A;  3V2U C;  1UHZ A;  4YHH I;  1IBL E;  4FWH A;  4M1K A;  4LF9 I;  2HFS A;  2L3J A;  2BV3 A;  1EA6 A;  1QZR A;  4USM A;  4LF5 I;  3ADL A;  1U2R A;  4K0K I;  1YYK A;  4DV2 I;  4DR7 E;  2N3H A;  5FLX C;  4JI7 E;  1T4L B;  4DR3 E;  3PYE A;  1Z5B A;  2WW4 A;  2V2Q A;  3LNU A;  2X7I A;  3J80 C;  2UUA E;  2UXB E;  5LL6 R;  4YY3 I;  4GKK I;  4WUD A;  2UUC I;  4JI3 E;  1MX0 A;  1HNX I;  4DU7 A;  4B3M I;  2MDR A;  3J81 Q;  4X62 E;  2NA2 A;  2YT4 A;  1YYW A;  2RSM A;  4ED4 A;  1N0V C;  4LF7 E;  1FWL A;  1Z0V A;  2R3V A;  1N36 E;  2J7K A;  1DI2 A;  1I94 E;  2EFG A;  4RPF A;  4DU8 A;  4Z7Y A;  4JV5 E;  3T1Y E;  2UXD I;  4LFA E;  4NXN E;  2VQE E;  2V8P A;  1XNQ I;  3C4T A;  2EZ6 A;  2RS6 A;  3J7Y p;  1Z0T A;  1X48 A;  4Z7C A;  4YHH E;  1KIJ A;  4DPX A;  4LF9 E;  4P52 A;  4LF5 E;  4K0K E;  2E5L I;  4FW9 A;  4DV2 E;  2LBS B;  3T1H I;  1T4O A;  3WU3 A;  2GS8 A;  1IBM I;  3ADJ A;  4B3R I;  4GKJ I;  1ZM4 A;  2VQF I;  5CFF E;  2L2M A;  4JI2 I;  4YY3 E;  4GKK E;  1HNX E;  2N3G A;  4X66 I;  4DV3 I;  1H7U A;  4WUC A;  2NUF A;  4X65 I;  4B3S I;  2UU9 I;  1KVK A;  1GQE A;  3LTO A;  3C4B A;  1H73 A;  4JI4 I;  4KHP E;  3M6A A;  2JY9 A;  2L2K B;  1B62 A;  2L3C A;  1HNZ I;  5A2Q Q;  1IBK I;  1QU6 A;  2B7T A;  2NUE A;  3ZM7 A;  3J80 Q;  1ZM2 A;  1NZ0 A;  2DMY A;  2UXD E;  3ZZT A;  1FI4 A;  5LMN I;  2CZ9 A;  1XNQ E;  1STU A;  1NHI A;  4X62 I;  3T1Y I;  1FKA E;  4DV4 I;  1FJG I;  4HY1 A;  4X64 I;  1Z0C A;  4EMD A;  2E5L E;  3T1H E;  1HR0 I;  2L2N A;  4DUY I;  1H74 A;  4PRV A;  3ZZ0 A;  4JG4 A;  1N33 I;  1IBM E;  3OTO I;  4B3R E;  4GKJ E;  2VQF E;  2HK3 A;  1XMO I;  4JI2 E;  4HXZ A;  3VYY A;  3ZKD A;  1NHJ A;  1N34 I;  4JYA E;  2LRS A;  4OOG C;  1S16 A;  2RTX A;  2NPF A;  4X66 E;  1Z0E A;  3ADG A;  3CWV A;  4JI6 I;  4DV3 E;  1H7S A;  3Q1Q A;  1Z0G A;  2RS7 A;  4X65 E;  5IT9 C;  4B3S E;  4DPU A;  2UU9 E;  2E1R A;  4DR6 I;  4JI4 E;  2UXC I;  3B82 A;  4JI0 I;  2IHR 1;  1RR9 A;  1Z59 A;  5L3J A;  4LF6 I;  1XNR E;  4DR4 I;  4HAC B;  1HNZ E;  2HKE A;  1NHH A;  1IBK E;  1XMQ I;  1Z5A A;  2LJP A;  3PYF A;  3PYG A;  2LTR A;  1S4E A;  2JVA A;  4LFB I;  4NXM I;  1O0W A;  3H4L A;  3LPS A;  1ELO A;  1KTV A;  1OJ4 A;  2R42 A;  1XHK A;  5LMN E;  3ZKB A;  2DIX A;  2HFU A;  3QT8 A;  1FNM A;  4HAC A;  3V5R A;  4FWG A; 
#chains in the Genus database with same CATH topology
 2EN2 A;  1ZM9 A;  4KQV A;  4DV4 E;  1FJG E;  1T4N A;  1WHQ A;  1E3H A;  4IZJ B;  2PO0 A;  2LUP B;  5AE3 A;  4X64 E;  3CDI A;  1UDQ A;  3PYD A;  2EM3 A;  2EQ0 A;  1YYO A;  1K47 A;  2EPP A;  2LE2 A;  4WFT A;  3NZK A;  2C39 A;  3QT6 A;  1HR0 E;  3HQ1 A;  2BR2 B;  5JEA A;  4PRX A;  2EOZ A;  4Q28 A;  2YPN A;  3THN A;  1A1I A;  3IWC A;  1UIL A;  2FTX B;  1YUJ A;  3EPJ A;  1N33 E;  1PDA A;  1A6F A;  1PKP A;  2DB2 A;  2Z5E A;  4ZVI A;  3OTO E;  2LJH A;  2UUC E;  2DEI A;  2L6M A;  1X47 A;  4R8O A;  2C37 A;  4PU9 A;  4JI5 I;  2EMW A;  1XMO E;  3ADI A;  2EL5 A;  2EM7 A;  4DV5 I;  4QNJ A;  1SR9 A;  2JXP A;  3K17 A;  4B3M E;  1KKH A;  2V87 A;  1N34 E;  2PNZ A;  4WSG A;  5C0X F;  2V8Q B;  5IV8 B;  4IFD C;  5ADZ A;  4F9B B;  2JWO A;  4DMI A;  1A1K A;  4IZJ A;  3B4T A;  5C0X C;  4JI6 E;  1YPN A;  2YTF A;  2E1M A;  4F9A B;  2L33 A;  2CPN A;  2EMY A;  2EOI A;  2HJJ A;  4R03 A;  2AE8 A;  2CG9 A;  2EL6 A;  4LOM A;  4DR5 I;  2ENA A;  2BBG A;  4ZYE A;  2ZIT A;  1IMU A;  3B78 A;  4FW4 A;  1A1F A;  2BR2 A;  2YTG A;  2UXC E;  1ZM3 A;  4JI0 E;  2EMG A;  4WX9 A;  4O5G A;  1OYR A;  5FLX Q;  2JE6 A;  3GLL A;  4JI8 I;  4DR4 E;  2PNL A;  4DXL A;  5AE1 A;  3CDJ A;  4OX9 I;  1X3C A;  4OO1 C;  1GZ6 A;  2LMZ A;  3HKM A;  2F4V I;  2WBT A;  3GON A;  1X5W A;  1XMQ E;  1G2D C;  2V83 A;  2DEJ A;  2LT7 A;  4DV0 I;  2EP3 A;  4LFB E;  5IWA I;  4DPW A;  2EM5 A;  4BC7 A;  2EQ1 A;  1VIS A;  3P76 A;  2ELY A;  4O4K A;  2RSI A;  2EOS A;  2B7V A;  2GPI A;  5GME A;  4P7A A;  4USK A;  2YZT A;  1J26 A;  2BM1 A;  1G2F C;  3HUL A;  2WBU A;  1DAR A;  4LFC I;  5DRQ A;  3KZY A;  3WU4 A;  3L00 A;  4DV6 I;  4DR1 I;  2EMF A;  1ZXN A;  1EH7 A;  1XXE A;  4MYT A;  5K36 D;  4UTG A;  4FWD A;  2UUB I;  1MG7 A;  1EKZ A;  3LLH A;  3K85 A;  2NN6 E;  4X8W A;  2KOU A;  2NUG A;  4FW7 A;  4IZK B;  2YTP A;  4MU4 A;  4U3D A;  2YU8 A;  2A2D A;  1RHY A;  1N32 I;  2ZM6 I;  4DKK A;  4WUB A;  1WXR A;  4WPY A;  2VF3 A;  5GMD A;  5KL5 A;  1HNW I;  3BGH A;  2LO3 A;  4DV1 I;  2HHH I;  2NN6 B;  2YTJ A;  5A2Q C;  4QNK A;  3ZOQ B;  5DNY A;  4JI5 E;  1YHC A;  4DV5 E;  4FW6 A;  1MEY C;  1RRE A;  4P7D A;  2DGC A;  5EKW A;  4R1F A;  2L92 A;  1EI1 A;  3JAM C;  5KL6 A;  4R2E A;  4B3T I;  4LCG A;  3F6H A;  1WHN A;  3UK3 C;  2EOR A;  1MGT A;  4GZN C;  4IZK A;  4MLQ A;  4WXC A;  2YRK A;  4AID A;  1RQ0 A;  1TF6 A;  2EOE A;  2EMZ A;  4DR5 E;  2JR1 A;  4FN5 A;  2EMX A;  5JEA E;  2X36 A;  5JEA F;  3H1C A;  2JP9 A;  2LCE A;  4JI1 I;  4FK5 C;  4DPY A;  4LF4 I;  2I9I A;  4LU9 A;  1BKN A;  4JI8 E;  4DUZ I;  2V2Z A;  2EPZ A;  1A1L A;  4OX9 E;  4J8Z A;  1WRJ A;  5LMU I;  4KHP I;  1WUU A;  4AQY I;  2F4V E;  2C39 B;  3C6M A;  1RMD A;  4DV0 E;  2EOX A;  5BR8 I;  2VE7 C;  5T6J A;  2BA1 D;  4O43 A;  4M2Z A;  1B63 A;  4DV7 I;  2L8T A;  2LUQ A;  5IWA E;  4URL A;  4DR2 I;  5K36 B;  2C37 B;  1X6H A;  2EN8 A;  4IJD A;  3HPZ A;  3WU6 A;  4LF8 I;  3TQM A;  1Z1B A;  4MYU A;  3HTX A;  4ZYH A;  2EPL X;  2PNZ B;  4MLV A;  1ZBT A;  1PVG A;  1J5E I;  2J65 A;  4LFC E;  2O1W A;  4IFD D;  5C0X D;  4DV6 E;  1FWK A;  5ELW A;  4DR1 E;  2BM0 A;  4OZE A;  3J81 C;  1DQ3 A;  1IBL I;  2EM6 A;  5DRO A;  2AJ4 A;  2UUB E;  3MSW A;  2LTS A;  2A2C A;  2M7Q A;  3QT7 A;  2EM8 A;  4F2J C;  4DUY E;  2WZO A;  3PS3 A;  5KL7 A;  2HKJ A;  4WXD A;  2JE6 B;  2O3Z A;  2VES A;  2ODR C;  1N32 E;  2ZM6 E;  4DR7 I;  2N8X A;  2ZBK B;  2EN7 A;  4HAC A;  1Y4U A;  2GQ0 A;  5K36 A;  4BS9 A;  4M0V A;  4JI7 I;  4OO1 D;  3HXL A;  3B8H A;  4DR3 I;  1HNW E;  4R2A A;  3J7A G;  1Z5C A;  4WYQ B;  2IOP A;  4DV1 E;  1VI7 A;  2EPK X;  3J7A M;  2CSH A;  2HHH E;  2UUA I;  4ZYG A;  4BBY A;  2Q2E B;  2UXB I;  2V2V A;  2YTN A;  5A6K A;  4U3B A;  1N0U A;  5DRP A;  2JOB A;  2DRP A;  1Y60 A;  2CVE A;  1H72 C;  2YRM A;  4R2S A;  4NHR A;  1Y6Z A;  4JI3 I;  1Z0W A;  2EPA A;  4B3T E;  4DR6 E;  4I8O A;  1Z0B A;  1AAY A;  3P06 A;  4BMJ A;  4LF6 E;  4BHC A;  4JYA I;  2HGH A;  1UEK A;  3P1X A;  4ISA A;  3D4J A;  4AM3 A;  2EWL A;  2EOJ A;  2EM9 A;  2EML A;  2B3T B;  3EQ1 A;  3F0N A;  3L7Z B;  1MU5 A;  5F3W A;  4L5N C;  5IXM B;  2D9H A;  2EM4 A;  4JI1 E;  2V88 A;  4R2Q A;  4M30 A;  4LF4 E;  3QT5 A;  4LF7 I;  4DUZ E;  2V86 A;  1X49 A;  5LMU E;  4NXM E;  2MC5 A;  2HK2 A;  4AQY E;  3PS1 A;  1PIE A;  3M85 D;  2V85 A;  2M4I A;  4RH8 A;  1N36 I;  3K1J A;  2YTQ A;  1XNR I;  2XEX A;  1I94 I;  2VF1 A;  5BR8 E;  4IFD B;  1P47 A;  1ZR9 A;  5C0X B;  4BHB A;  3WU5 A;  1D6T A;  2YRH A;  4I3H A;  4DV7 E;  1RC7 A;  2ELZ A;  3ECR A;  4DR2 E;  4XTJ A;  4HYM A;  1YZ9 A;  4BA1 B;  1ZXM A;  4UT4 A;  1NEI A;  2PO2 B;  4LF8 E;  4JV5 I;  4DPT A;  2JEA B;  4TUI A;  3JAM Q;  5IT9 Q;  3VYX A;  4NXN I;  4LFA I;  2OI2 A;  3PRY A;  2VQE I;  2KHX A;  1UDN A;  1J5E E;  2ADR A;  3L7Z A;  4RHB B;  3ZZU A;  3V2U C;  1X6F A;  2BB8 A;  3JTZ A;  4LCF A;  4MU1 A;  1UHZ A;  2NN6 F;  3P3C A;  2WBS A;  4YHH I;  4MDT A;  1IBL E;  1TN9 A;  4FWH A;  4OO1 B;  2NN6 C;  1GTK A;  4M1K A;  3OML A;  4LF9 I;  2EOQ A;  2HFS A;  2L3J A;  2EOY A;  2BV3 A;  1EA6 A;  1QZR A;  4USM A;  4LF5 I;  2Z5C B;  2MKN A;  4Q35 B;  3ADL A;  1UDS A;  1U2R A;  4IFD A;  5C0X A;  4K0K I;  1B69 A;  1YYK A;  4DV2 I;  3RMP A;  4DR7 E;  3GCM A;  1Y5Y A;  3KZZ A;  2N3H A;  2LVH A;  5FLX C;  4JI7 E;  1WJP A;  4BA1 A;  4M9V C;  1T4L B;  2H36 X;  2PO2 A;  4DR3 E;  3PYE A;  2JEA A;  1Z5B A;  2WW4 A;  5DRR A;  2V2Q A;  3LNU A;  5A6B D;  3EPL A;  1N3G A;  3QG5 C;  3J80 C;  2UUA E;  2UXB E;  2X7I A;  3BF2 A;  2EMA A;  2YSP A;  5LL6 R;  4YY3 I;  2NAB A;  4GKK I;  2IER A;  4FWG A;  4WUD A;  3LML A;  3P3E A;  2UUC I;  4OO1 A;  5LLQ A;  2GHF A;  4GEQ B;  4JI3 E;  1MX0 A;  3UHM A;  1HNX I;  4DU7 A;  1USU A;  4B3M I;  2MDR A;  3C6K A;  2I13 A;  1YUI A;  1AH5 A;  2Z5C A;  4MU3 A;  2EMC A;  3J81 Q;  5JEA C;  2NA2 A;  4ZYD A;  3M7N D;  5K36 E;  1KYQ A;  3DJW A;  1IQS A;  2YT4 A;  4O24 A;  2EQ3 A;  5K36 F;  1YYW A;  2EM0 A;  1YFH A;  1UDO A;  1EH8 A;  4IS1 C;  3GME A;  2RSM A;  4ED4 A;  5TSE A;  3K6Q A;  1N0V C;  3HJC A;  4LF7 E;  1E3P A;  1BBO A;  1A1J A;  4NBQ A;  1FWL A;  2ODR D;  1Z0V A;  4FW3 A;  4GQU A;  2YWQ A;  5AE2 A;  4R2D A;  2BA1 G;  2BA0 D;  2M1S A;  1N36 E;  3DF6 A;  2WCC 3;  1UBD C;  2R3V A;  2WNR A;  2J7K A;  1DI2 A;  1I94 E;  4J3D A;  2EOH A;  2MDG A;  2DLK A;  5A6A A;  2EFG A;  1LLM C;  4RPF A;  3P3G A;  4DU8 A;  2EMI A;  4Z7Y A;  4MQY A;  3EPK A;  3T1Y E;  4JV5 E;  2UXD I;  4LFA E;  4NXN E;  2JPA A;  4TUG A;  4N3O A;  1BBG A;  4X9J A;  2VQE E;  2V8P A;  2YTE A;  1ZU1 A;  3C4T A;  2O1T A;  2EZ6 A;  1NCS A;  2RS6 A;  3J7Y p;  3Q6M A;  1XNQ I;  2FGG A;  4L8N A;  2JEB A;  2EPR A;  1X48 A;  1SFE A;  2EL4 A;  2J7J A;  1Z0T A;  4Z7C A;  2LJU A;  4YHH E;  4FW5 A;  1KIJ A;  4DPX A;  4BCA A;  3JU0 A;  2ENC A;  4LF9 E;  2K4V A;  2PO1 A;  2CGE A;  4P52 A;  4KZS A;  2B9D A;  4LF5 E;  2EN6 A;  3BBG A;  3MHH C;  2O1V A;  4K0K E;  2E5L I;  2KON A;  4FW9 A;  2YTI A;  4DV2 E;  2LBS B;  3T1H I;  1T4O A;  4F54 A;  2GO3 A;  3H09 A;  4F9C B;  1OYS A;  5KL4 A;  3WU3 A;  2GS8 A;  2F1D A;  1IBM I;  2FV4 B;  3ADJ A;  4B3R I;  4GKJ I;  1ZM4 A;  2VQF I;  2EPM X;  2MC6 A;  2Q8U A;  2L2M A;  5CFF E;  2WP8 B;  1TF3 A;  2HC5 A;  4JI2 I;  2A25 A;  4HTG A;  4YY3 E;  5FWK A;  5AAS A;  4R2R A;  4GKK E;  2C38 B;  1OYP A;  3THO B;  1HNX E;  2MKD A;  2N3G A;  4X66 I;  2JT2 A;  4KWY A;  2EPN A;  5A6B A;  4IFD E;  2EPO A;  4DV3 I;  5C0X E;  2EMK A;  2EOF A;  2EPU A;  1H7U A;  2E72 A;  2NUF A;  4WUC A;  4X65 I;  4IFD F;  2EN1 A;  4B3S I;  2UU9 I;  2YTD A;  1PJT A;  1KVK A;  1YH8 A;  4MU0 A;  2PNM A;  1GQE A;  3LTO A;  3C4B A;  3HPS A;  1H73 A;  4JI4 I;  2NN6 D;  3BID A;  4KHP E;  1P42 A;  3M6A A;  2O1U A;  2JY9 A;  5KL3 A;  4F6M A;  2L2K B;  1B62 A;  1L4S A;  3U1Y A;  3M85 G;  3DD6 A;  1DGC A;  2L3C A;  2IOQ A;  1HNZ I;  3F6G A;  2R76 A;  5A2Q Q;  2WP8 A;  4F6N A;  1IBK I;  4BC9 A;  3VK6 A;  1QU6 A;  4WSP A;  2YU5 A;  4OO1 E;  4LTY A;  2EN3 A;  2B7T A;  2C38 A;  4OO1 F;  2NUE A;  2F8B A;  3ZM7 A;  1R6M A;  3J80 Q;  3KWR A;  1ZM2 A;  3EPH A;  2RQL A;  1USV A;  5DNX A;  1F2I G;  1NZ0 A;  2EE8 A;  5A69 A;  2DMY A;  2UXD E;  3ZZT A;  1FI4 A;  3PS2 A;  5A6J A;  4OKG A;  5LMN I;  2CZ9 A;  4IS9 A;  1JK2 A;  2V89 A;  1XNQ E;  1STU A;  2RPC A;  2JOX A;  1ZAA C;  1NHI A;  4X62 I;  3T1Y I;  1PJS A;  1R6L A;  2EN4 A;  1A1H A;  1X6E A;  1FKA E;  4LCH A;  5JEA D;  5EL9 A;  4DV4 I;  1FJG I;  1IQO A;  2YSO A;  3VHT B;  4HY1 A;  2EOO A;  2ENH A;  4X64 I;  1QNT A;  1Z0C A;  4EMD A;  3FIG A;  2IES A;  2E5L E;  3T1H E;  3MHS C;  2EMH A;  4BA2 B;  1HR0 I;  2L2N A;  4DUY I;  4R2P A;  1H74 A;  4AIM A;  1BB8 A;  2EJ4 A;  4PRV A;  4JG4 A;  3ZZ0 A;  1N33 I;  1ZBQ A;  1IBM E;  3KRN A;  2WNR B;  4B3R E;  4IZJ D;  4GKJ E;  3OTO I;  5KL2 A;  4LPF A;  2EPC A;  2VQF E;  2HK3 A;  1XMO I;  1EH6 A;  4JI2 E;  2DLQ A;  1T38 A;  4HXZ A;  3U1K A;  3VYY A;  3ZKD A;  1NHJ A;  3IWB A;  1N34 I;  4JYA E;  2LRS A;  4OOG C;  1S16 A;  2EMB A;  2EM2 A;  2RTX A;  2NPF A;  2EPX A;  2JYA A;  4X66 E;  3M99 B;  3ADG A;  1UN6 B;  1Z0E A;  4N4R B;  3CWV A;  4JI6 I;  1T39 A;  3M7N G;  4DV3 E;  1H7S A;  3Q1Q A;  1Z0G A;  2RS7 A;  5K36 C;  4X65 E;  1A1G A;  5IT9 C;  4B3S E;  1HK7 A;  2UU9 E;  2JEB B;  2G7H A;  5AC5 A;  2E1R A;  4DPU A;  4DR6 I;  4BA2 A;  4JI4 E;  2UXC I;  3B82 A;  4JI0 I;  2IHR 1;  1RR9 A;  1Z59 A;  5L3J A;  2Z5B B;  4LF6 I;  2GO4 A;  2PO1 B;  2DSY A;  1XNR E;  2R1F A;  4DR4 I;  2BA0 G;  4HAC B;  1HNZ E;  2HKE A;  4R2C A;  1Y4S A;  2LV2 A;  1NHH A;  1IBK E;  1JK1 A;  1XMQ I;  1Z5A A;  2LJP A;  2PO0 B;  3PYF A;  3PYG A;  2LTR A;  1S4E A;  2JVA A;  2NN6 A;  4HEI A;  4LFB I;  3AUZ A;  1KJK A;  3Q6N A;  2CT1 A;  4NXM I;  3AV0 A;  1O0W A;  3H4L A;  2GLI A;  3LPS A;  1ELO A;  5JEA B;  2CTD A;  2PRT A;  1KTV A;  1OJ4 A;  2R42 A;  5DNL A;  1XHK A;  2DMI A;  2EOM A;  2YTO A;  5AC4 A;  5LMN E;  1YSA C;  3ZKB A;  2K7I A;  2M9A A;  2VRD A;  2DIX A;  2Z5B A;  2HFU A;  3QT8 A;  1PJQ A;  4NZV A;  1FNM A;  3IWD A;  4P78 A;  4X62 E;  3V5R A;  2V34 A; 
#chains in the Genus database with same CATH homology
 1ZM9 A;  4KQV A;  4DV4 E;  1FJG E;  1T4N A;  1WHQ A;  4IZJ B;  2LUP B;  5AE3 A;  4X64 E;  3PYD A;  1YYO A;  1K47 A;  2LE2 A;  4WFT A;  3QT6 A;  1HR0 E;  3HQ1 A;  4PRX A;  4Q28 A;  1A6F A;  3IWC A;  1UIL A;  2FTX B;  1N33 E;  1PKP A;  2DB2 A;  2Z5E A;  4ZVI A;  3OTO E;  2LJH A;  2UUC E;  2DEI A;  2L6M A;  1X47 A;  4R8O A;  4PU9 A;  4JI5 I;  3ADI A;  1XMO E;  4DV5 I;  1SR9 A;  3K17 A;  4B3M E;  1KKH A;  2V87 A;  1N34 E;  2V8Q B;  5ADZ A;  4F9B B;  2JWO A;  4DMI A;  4IZJ A;  4JI6 E;  4F9A B;  2E1M A;  2L33 A;  2CPN A;  4R03 A;  2CG9 A;  4DR5 I;  3B78 A;  2ZIT A;  2UXC E;  1ZM3 A;  4JI0 E;  5FLX Q;  4JI8 I;  4DR4 E;  2PNL A;  4DXL A;  5AE1 A;  4OX9 I;  1GZ6 A;  2LMZ A;  2F4V I;  3GON A;  1XMQ E;  2V83 A;  2DEJ A;  4DV0 I;  4LFB E;  5IWA I;  4DPW A;  4BC7 A;  1VIS A;  2B7V A;  5GME A;  4P7A A;  4USK A;  2YZT A;  1J26 A;  2BM1 A;  3HUL A;  1DAR A;  4LFC I;  3WU4 A;  4DV6 I;  4DR1 I;  1ZXN A;  4MYT A;  4UTG A;  4FWD A;  2UUB I;  1MG7 A;  1EKZ A;  3LLH A;  3K85 A;  4X8W A;  2KOU A;  2NUG A;  4IZK B;  2A2D A;  1N32 I;  2ZM6 I;  4DKK A;  4WUB A;  1WXR A;  4WPY A;  2VF3 A;  5GMD A;  1HNW I;  4DV1 I;  2HHH I;  5A2Q C;  3ZOQ B;  5DNY A;  4JI5 E;  4DV5 E;  1RRE A;  4P7D A;  4R1F A;  2L92 A;  1EI1 A;  3JAM C;  4B3T I;  3F6H A;  1WHN A;  4IZK A;  1RQ0 A;  4DR5 E;  2JR1 A;  4FN5 A;  2X36 A;  4JI1 I;  4DPY A;  4LF4 I;  4LU9 A;  1BKN A;  4JI8 E;  4DUZ I;  2V2Z A;  4OX9 E;  4J8Z A;  5LMU I;  4KHP I;  1WUU A;  4AQY I;  2F4V E;  4DV0 E;  5BR8 I;  2VE7 C;  5T6J A;  4M2Z A;  1B63 A;  4DV7 I;  2L8T A;  2LUQ A;  5IWA E;  4URL A;  4DR2 I;  3HPZ A;  3WU6 A;  4LF8 I;  4MYU A;  3HTX A;  1ZBT A;  1PVG A;  1J5E I;  4LFC E;  2O1W A;  4DV6 E;  1FWK A;  4DR1 E;  2BM0 A;  3J81 C;  1DQ3 A;  1IBL I;  2AJ4 A;  2UUB E;  3MSW A;  2LTS A;  2A2C A;  2M7Q A;  3QT7 A;  4DUY E;  2WZO A;  2HKJ A;  2ODR C;  1N32 E;  2ZM6 E;  4DR7 I;  2ZBK B;  4HAC A;  1Y4U A;  2GQ0 A;  4BS9 A;  4M0V A;  4JI7 I;  3HXL A;  3B8H A;  4DR3 I;  1HNW E;  3J7A G;  1Z5C A;  4WYQ B;  2IOP A;  4DV1 E;  3J7A M;  2HHH E;  2UUA I;  2UXB I;  4BBY A;  2Q2E B;  2V2V A;  1N0U A;  2JOB A;  1H72 C;  1Y6Z A;  4JI3 I;  1Z0W A;  4B3T E;  4DR6 E;  4I8O A;  1Z0B A;  3P06 A;  4BMJ A;  4LF6 E;  4JYA I;  1UEK A;  3P1X A;  3D4J A;  2EWL A;  2B3T B;  3F0N A;  1MU5 A;  5F3W A;  4L5N C;  4JI1 E;  2V88 A;  4LF4 E;  4M30 A;  3QT5 A;  4LF7 I;  4DUZ E;  2V86 A;  1X49 A;  5LMU E;  4NXM E;  2MC5 A;  2HK2 A;  4AQY E;  1PIE A;  2V85 A;  2M4I A;  1N36 I;  1XNR I;  3K1J A;  2XEX A;  1I94 I;  2VF1 A;  5BR8 E;  3WU5 A;  1D6T A;  4I3H A;  4DV7 E;  1RC7 A;  4DR2 E;  4XTJ A;  4HYM A;  1YZ9 A;  4UT4 A;  1ZXM A;  4JV5 I;  4LF8 E;  4DPT A;  4TUI A;  3JAM Q;  5IT9 Q;  3VYX A;  4NXN I;  4LFA I;  2OI2 A;  3PRY A;  2VQE I;  2KHX A;  1J5E E;  3ZZU A;  3V2U C;  3JTZ A;  1UHZ A;  4YHH I;  1IBL E;  4FWH A;  4M1K A;  3OML A;  4LF9 I;  2HFS A;  2L3J A;  2BV3 A;  1EA6 A;  1QZR A;  4USM A;  4LF5 I;  2Z5C B;  3ADL A;  1U2R A;  4K0K I;  1YYK A;  4DV2 I;  3RMP A;  4DR7 E;  2N3H A;  5FLX C;  4JI7 E;  1T4L B;  2H36 X;  4DR3 E;  3PYE A;  1Z5B A;  2WW4 A;  2V2Q A;  3LNU A;  3J80 C;  2X7I A;  2UUA E;  2UXB E;  5LL6 R;  4YY3 I;  4GKK I;  4FWG A;  4WUD A;  3LML A;  2UUC I;  4GEQ B;  4JI3 E;  1MX0 A;  1HNX I;  4DU7 A;  1USU A;  4B3M I;  2MDR A;  2Z5C A;  3J81 Q;  4X62 E;  2NA2 A;  3DJW A;  2YT4 A;  1YYW A;  2RSM A;  4ED4 A;  3K6Q A;  1N0V C;  3HJC A;  4LF7 E;  1FWL A;  2ODR D;  1Z0V A;  5AE2 A;  2R3V A;  2M1S A;  1N36 E;  3DF6 A;  2J7K A;  1DI2 A;  1I94 E;  2EFG A;  4RPF A;  4DU8 A;  4Z7Y A;  4JV5 E;  2UXD I;  4LFA E;  4NXN E;  4TUG A;  4N3O A;  2VQE E;  2V8P A;  1XNQ I;  3C4T A;  2O1T A;  2EZ6 A;  2RS6 A;  3J7Y p;  3Q6M A;  2FGG A;  4L8N A;  1Z0T A;  1X48 A;  4Z7C A;  4YHH E;  1KIJ A;  4DPX A;  4BCA A;  3JU0 A;  4LF9 E;  2K4V A;  2CGE A;  4P52 A;  4KZS A;  2B9D A;  4LF5 E;  2O1V A;  4K0K E;  2E5L I;  2KON A;  4FW9 A;  4DV2 E;  2LBS B;  3T1H I;  1T4O A;  4F54 A;  3H09 A;  4F9C B;  3WU3 A;  2GS8 A;  1IBM I;  2FV4 B;  3ADJ A;  4B3R I;  4GKJ I;  1ZM4 A;  2VQF I;  2MC6 A;  5CFF E;  2L2M A;  4JI2 I;  4YY3 E;  5FWK A;  5AAS A;  4GKK E;  1HNX E;  2N3G A;  4X66 I;  4DV3 I;  1H7U A;  4WUC A;  2NUF A;  4X65 I;  4B3S I;  2UU9 I;  1KVK A;  2PNM A;  1GQE A;  3LTO A;  3C4B A;  3HPS A;  1H73 A;  4JI4 I;  4KHP E;  3M6A A;  2O1U A;  2JY9 A;  2L2K B;  1B62 A;  2L3C A;  2IOQ A;  1HNZ I;  3F6G A;  5A2Q Q;  1IBK I;  4BC9 A;  3VK6 A;  1QU6 A;  4WSP A;  4LTY A;  2B7T A;  2NUE A;  2F8B A;  3ZM7 A;  3J80 Q;  3KWR A;  1ZM2 A;  1USV A;  1NZ0 A;  2DMY A;  2UXD E;  3ZZT A;  1FI4 A;  5LMN I;  2CZ9 A;  2V89 A;  1XNQ E;  1STU A;  2JOX A;  1NHI A;  4X62 I;  3T1Y I;  1FKA E;  4DV4 I;  1FJG I;  4HY1 A;  4X64 I;  1Z0C A;  4EMD A;  3FIG A;  2E5L E;  3T1H E;  1HR0 I;  2L2N A;  4DUY I;  1H74 A;  4PRV A;  3ZZ0 A;  4JG4 A;  1N33 I;  1ZBQ A;  1IBM E;  4IZJ D;  3OTO I;  4B3R E;  4GKJ E;  2VQF E;  2HK3 A;  1XMO I;  4JI2 E;  4HXZ A;  3VYY A;  3ZKD A;  1NHJ A;  3IWB A;  1N34 I;  4JYA E;  2LRS A;  4OOG C;  1S16 A;  2RTX A;  2NPF A;  4X66 E;  1Z0E A;  3ADG A;  3CWV A;  4JI6 I;  4DV3 E;  1H7S A;  3Q1Q A;  1Z0G A;  2RS7 A;  4X65 E;  5IT9 C;  4B3S E;  1HK7 A;  2UU9 E;  4DPU A;  2G7H A;  2E1R A;  4DR6 I;  4JI4 E;  2UXC I;  3B82 A;  4JI0 I;  2IHR 1;  1RR9 A;  1Z59 A;  5L3J A;  2Z5B B;  4LF6 I;  2DSY A;  1XNR E;  4DR4 I;  4HAC B;  1HNZ E;  2HKE A;  1Y4S A;  1NHH A;  1IBK E;  1XMQ I;  1Z5A A;  2LJP A;  3PYF A;  3PYG A;  2LTR A;  1S4E A;  2JVA A;  4LFB I;  3AUZ A;  3Q6N A;  4NXM I;  3AV0 A;  1O0W A;  3H4L A;  3LPS A;  1ELO A;  1KTV A;  1OJ4 A;  2R42 A;  1XHK A;  5LMN E;  3ZKB A;  2DIX A;  2Z5B A;  2HFU A;  3QT8 A;  1FNM A;  3IWD A;  4P78 A;  3T1Y E;  3V5R A;  2V34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...