2UXCE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcE02
1DARA 1VISA 1U2RA 1ZM3A 2UU9E 2V8PA 2LUQA 4GKKI 3LTOA 4UT4A 2F4VI 2VF3A 4WUDA 2HHHI 1ELOA 4ED4A 1X47A 3V5RA 1ZM9A 4DR6E 2UUCI 4DR5I 4DV4E 2E5LI 3T1HI 2IHR1 2L2NA 4JI8E 1H7UA 4DPYA 2UXCE 4DUZE 4PU9A 4UTGA 2NUGA 2JY9A 4DV7I 1FWLA 2WW4A 1XNRE 3ZM7A 3WU6A 2AJ4A 1NHJA 4DR7I 4ZVIA 3OTOE 2L33A 1BKNA 1N33I 2X36A 2LTRA 4JV5I 2LBSB 2DIXA 4KQVA 3PYGA 4LF7E 4Z7CA 1ZXNA 4I3HA 1I94I 2ZM6I 4JI1I 2MDRA 4M1KA 3J7Yp 1KTVA 1PIEA 5A2QC 5FLXQ 2UUAI 3WU3A 4DU7A 4B3SE 4HACA 1N32E 1DI2A 4LF6E 4GKJI 1QZRA 3HULA 1D6TA 2HKJA 4LF4I 4DV2E 4LF9E 4K0KE 2NPFA 1YYKA 2CPNA 1IBMI 2NUEA 4FN5A 1HNZE 2KHXA 1WUUA 4JI0I 4DXLA 4JI4E 2F4VE 4YHHI 4DPUA 1GQEA 1STUA 3J80Q 1Z5AA 4DV0I 4JI3I 1YYOA 3PYDA 4DR5E 2ZITA 2E5LE 3JAMC 4JI5I 4X65I 2BM1A 2HFUA 3J81C 5LMUE 1FI4A 3T1YI 1N0UA 5LMNI 3K1JA 4JYAI 4DR2E 2JVAA 4HY1A 1HNWE 4B3RE 4DR7E 5GMEA 1XMOI 4LF8I 1FKAE 4NXNI 4LFAI 4DUYI 1K47A 2XEXA 3QT6A 4DR4I 2BV3A 1FNMA 5BR8E 2V2ZA 2R3VA 4HYMA 2ZM6E 4B3MI 1UHZA 2UUBE 1ZM2A 1XNQI 2EZ6A 2ZBKB 4KHPI 3ADGA 1N36I 4B3TI 2UUAE 5IT9Q 2HK3A 4DV3E 1FWKA 4EMDA 1IBLI 1Z0CA 4LF4E 4JI7E 1NZ0A 1MX0A 1H74A 3ZKDA 1KKHA 3PYEA 4JI0E 3CWVA 4YHHE 5FLXC 4NXMI 4JI2E 3VYYA 4P52A 4JI3E 4PRXA 4RPFA 2OI2A 2V2QA 4JI5E 4DU8A 4DR1I 2DB2A 4FWHA 4LF5I 2LJHA 1FJGI 1EA6A 2L2MA 3LLHA 4JYAE 4M30A 3QT5A 1WHNA 1A6FA 1Z0EA 4JI6E 5IWAI 1Z5BA 3C4TA 2LJPA 2EFGA 3F0NA 1J5EE 2L3CA 4LF8E 4WUBA 3WU4A 1N0VC 1T4NA 3LNUA 2HKEA 4PRVA 2UU9I 3GONA 4XTJA 1XHKA 2RTXA 2LTSA 1HR0E 4FW9A 3ZZUA 4GKKE 4B3ME 3Q1QA 2HHHE 1IBKI 2N3GA 1X48A 2DEJA 4DV1I 2UUCE 1N34I 1N36E 4B3TE 2UXDI 2UXCI 2A2CA 4OX9I 1H72C 3LPSA 4X66I 3T1HE 2B7VA 4JG4A 1B63A 2R42A 2HK2A 4DV7E 3J7AG 2E1RA 2VQEI 1B62A 4LF7I 1ZM4A 1Z0VA 5GMDA 1MG7A 1T4OA 4NXME 5IT9C 1N33E 2RS6A 2UXBI 4JV5E 4M2ZA 4X62I 1XMQI 4DR1E 4OOGC 1I94E 4MYTA 4JI1E 4LFCI 4LF6I 1Z0WA 2V2VA 2VQFI 1PKPA 1NHHA 4YY3I 4WUCA 5IWAE 1T4LB 1UILA 4DV2I 1KVKA 4GKJE 4K0KI 4P7AA 1S4EA 1HNZI 2LRSA 1S16A 4DV6I 4JI4I 2RSMA 2RS7A 4X64I 5CFFE 3ADJA 1IBME 3B8HA 2B7TA 2X7IA 4DR3I 4AQYI 1PVGA 1Z0GA 4DV5I 2B3TB 4WFTA 1IBKE 1OJ4A 4DV1E 1UEKA 5LMUI 4DV0E 1Z0BA 2Q2EB 3H4LA 3ZZ0A 1N34E 2UXDE 4OX9E 2BM0A 4DR2I 4X66E 2YT4A 4MYUA 1RC7A 1HNWI 4X65E 4B3RI 3D4JA 2L3JA 3T1YE 5LMNE 4HACB 3WU5A 3ADIA 1Z59A 3QT8A 1RQ0A 2GS8A 2VQEE 3ZZTA 4LFBI 3J80C 1XMOE 4FWDA 3J7AM 1HNXI 2N3HA 1O0WA 1YYWA 4NXNE 5BR8I 4LFAE 4DUYE 1RR9A 2NA2A 2UXBE 2UUBI 3P1XA 1YZ9A 4DR4E 4X62E 4X8WA 1XMQE 2V34A 2A2DA 4DR6I 4DV4I 4Z7YA 4LFCE 4DPWA 4DV3I 3V2UC 1XNQE 1H7SA 4DPXA 2VQFE 4JI8I 4FWGA 4KHPE 4YY3E 3B78A 4DPTA 3K17A 4JI7I 4WYQB 4DUZI 4USKA 2NUFA 3PYFA 4USMA 1ZXMA 4URLA 3QT7A 3ADLA 3C4BA 1IBLE 3M6AA 1XNRI 5A2QQ 1EI1A 1KIJA 5LL6R 1H73A 4DV6E 3OTOI 1MU5A 4X64E 1Z5CA 4JI2I 4DR3E 4AQYE 4DV5E 2HFSA 5L3JA 3ZKBA 2DMYA 4R1FA 2LUPB 3B82A 1ZBTA 4LF5E 2L2KB 2CZ9A 2DEIA 2J7KA 4JI6I 1FJGE 4B3SI 1N32I 1Z0TA 1J5EI 3VYXA 3JAMQ 3HTXA 1RREA 4HXZA 1EKZA 1X49A 4LFBE 4LF9I 1NHIA 3J81Q 1WHQA 1J26A 1HNXE 1HR0I 4DKKA 1QU6A
chains in the Genus database with same CATH superfamily
1DARA 1VISA 3UHMA 1U2RA 1ZM3A 2UU9E 2JT2A 2LUQA 4R2DA 2JEBB 2V8PA 2F1DA 3Q6MA 3LTOA 4UT4A 4GKKI 2F4VI 3F6GA 2VF3A 4WUDA 2HHHI 1ELOA 2EPRA 4ED4A 2EPCA 1X47A 3V5RA 1ZM9A 4DR6E 2C37B 2UUCI 1T39A 2BA1G 4DR5I 1NCSA 4DV4E 1MEYC 2E5LI 3QG5C 2BA0G 2NN6A 3T1HI 2PO1A 2O1VA 4IZJA 5JEAF 4J8ZA 2IHR1 2L2NA 4JI8E 2EJ4A 1H7UA 4DPYA 4IFDE 2JR1A 4IZKA 3BF2A 4F9CB 4WPYA 4DUZE 2UXCE 4PU9A 2KONA 3HPSA 5TSEA 3K6QA 2NUGA 4UTGA 3EPKA 2Z5CA 2JY9A 4DV7I 2F8BA 1FWLA 4LU9A 1PDAA 1YUJA 2WW4A 1XNRE 3PRYA 3ZM7A 4FW6A 3WU6A 2AJ4A 1NHJA 4DR7I 4LFBI 4P78A 4ZVIA 3OTOE 2PRTA 2V85A 5C0XF 2L33A 3THOB 2IOPA 1UN6B 1BKNA 1N33I 1EH7A 4N4RB 3Q6NA 2EM9A 3M99B 2X36A 2LTRA 2VF1A 2EOOA 4JV5I 2EN1A 2EPMX 2LBSB 2DIXA 4KQVA 3PYGA 4LF7E 2JEAB 3DJWA 2CGEA 5DRQA 4Z7CA 1G2DC 1ZXNA 2G7HA 4I3HA 2JP9A 2EMLA 1RMDA 2ODRD 4LCFA 3JU0A 2ZM6I 4OO1A 1I94I 4JI1I 2MDRA 4LTYA 1USVA 2PO2B 3EQ1A 1E3HA 1A1IA 3J7Yp 3PS1A 3LMLA 4IZJD 4M1KA 5K36F 1KTVA 1PIEA 5A2QC 3H1CA 1ZU1A 4WSPA 1MGTA 5FLXQ 2UUAI 3WU3A 4DU7A 4B3SE 4HACA 1N32E 1DI2A 4LF6E 3P3GA 4GKJI 1QZRA 4IFDA 1RHYA 2JXPA 3F6HA 3HULA 5C0XC 1D6TA 2HKJA 4LF4I 4BCAA 4DV2E 4LF9E 4K0KE 1R6MA 2NPFA 5K36B 1YYKA 2EPKX 2CPNA 1IBMI 2C38A 1EH8A 2NUEA 2YRKA 1HNZE 4FN5A 2KHXA 1WUUA 1IMUA 4JI0I 2N8XA 4DXLA 4JI4E 2YZTA 4BMJA 2F4VE 4YHHI 3B4TA 4DPUA 2EM2A 5K36C 2C39B 2LE2A 1F2IG 2YTJA 1GQEA 5A6JA 5EL9A 2E1MA 1DGCA 1STUA 3J80Q 1Z5AA 4U3DA 4DV0I 2EOFA 3HPZA 3P3EA 4JI3I 1YYOA 3PYDA 4DR5E 2RSIA 2ZITA 2E5LE 5A69A 3JAMC 2JE6B 3DD6A 5DRRA 4JI5I 3CDJA 2V83A 4X65I 2YTFA 2BM1A 2HFUA 1BBGA 3J81C 5LMUE 3GMEA 1FI4A 1PJTA 3VK6A 2Z5BA 5ELWA 1N0UA 5LMNI 3K1JA 2WP8A 3T1YI 4JYAI 2EOSA 4IFDD 4DR2E 2JVAA 4HY1A 4MU1A 2YWQA 2YTDA 1HNWE 4B3RE 2YRMA 4M9VC 5AC4A 1VI7A 2AE8A 4QNKA 1GTKA 4DR7E 2NN6F 2ENHA 1OYPA 5GMEA 1XMOI 4LF8I 3ZOQB 3AV0A 3MSWA 4IS1C 2V87A 4IJDA 1FKAE 1BB8A 4NXNI 2GHFA 4DUYI 1K47A 4LFAI 2XEXA 2ELZA 4L5NC 2YTOA 4KWYA 3QT6A 4LPFA 1USUA 4GEQB 2YU8A 4RHBB 2O1UA 4DR4I 2BV3A 2VESA 2JPAA 4BA2A 1A1GA 1FNMA 2EN2A 5BR8E 2V2ZA 2DRPA 2R3VA 2EM3A 2K4VA 4ZYDA 2EORA 2ZM6E 3RMPA 4HYMA 4U3BA 1UHZA 4B3MI 2UUBE 2EMIA 4TUGA 2WBUA 1ZM2A 1XNQI 2M9AA 2LJUA 2BB8A 2EZ6A 2ZBKB 4L8NA 4KHPI 1YFHA 3ADGA 5C0XE 4OO1B 1N36I 1A1HA 1EH6A 2UUAE 4B3TI 4MQYA 5IT9Q 2HK3A 4DV3E 4ZYGA 1FWKA 3EPJA 4EMDA 4LF9I 2NN6C 2GQ0A 1TF6A 1YPNA 3UK3C 4O4KA 3P76A 1Z0CA 2EM8A 1IBLI 2EMBA 2GO4A 4OO1C 4LOMA 4LF4E 1OYSA 4JI7E 4F9BB 1NZ0A 4BA1A 1MX0A 1H74A 3ZKDA 4F2JC 1KKHA 2EL4A 1N3GA 2EOIA 2MKDA 1QNTA 4F6NA 2EN7A 2DLKA 3FIGA 2BR2B 5DNXA 2JEBA 3PYEA 4IFDF 4JI0E 2L8TA 4YHHE 2EMAA 5FLXC 5AC5A 3CWVA 4NBQA 2HJJA 1KJKA 4NXMI 1YUIA 5JEAB 1A1JA 4BHBA 4JI2E 3VYYA 2YTGA 4P52A 2C37A 4JI3E 2EMFA 3L7ZA 4PRXA 4R8OA 4RPFA 5KL7A 3OMLA 2OI2A 2V2QA 4JI5E 4M0VA 4DU8A 4DR1I 3EPHA 4FW3A 5JEAC 2DB2A 2JOBA 1TN9A 4FWHA 4LF5I 2LJHA 2M7QA 1FJGI 3IWDA 1Y4UA 1EA6A 4NZVA 2L2MA 3LLHA 2CG9A 1SFEA 2EMZA 4JYAE 4M30A 4MU4A 3QT5A 1DQ3A 5C0XB 1WHNA 1A6FA 1Z0EA 2J65A 4JI6E 2PO0B 2EOEA 1Z5BA 2MDGA 5IWAI 3C4TA 5LLQA 2LJPA 2EFGA 2I13A 1Y60A 3F0NA 1J5EE 2L3CA 4LF8E 3EPLA 2HGHA 5AE2A 4WUBA 3WU4A 2C38B 1N0VC 2LCEA 1T4NA 2JOXA 3LNUA 2HKEA 4PRVA 2UU9I 4FW4A 5A6BA 3GONA 2EQ1A 4XTJA 1Y4SA 3DF6A 5AE3A 1XHKA 4BHCA 2RTXA 2JEAA 2R1FA 2PNZB 3VHTB 2LTSA 2EOMA 1HR0E 3HQ1A 2H36X 2B9DA 4FW9A 2EOZA 3ZZUA 4GKKE 4B3ME 3Q1QA 5FWKA 2PO2A 1Z1BA 1ZBQA 3NZKA 2HHHE 1IBKI 2N3GA 1X48A 2K7IA 2EN4A 2DEJA 4DV1I 2EPXA 3TQMA 2UUCE 1N34I 2YTIA 1N36E 4B3TE 2Z5BB 2UXDI 2UXCI 2A2CA 4OX9I 1H72C 2FV4B 4R2CA 4DMIA 3LPSA 1YHCA 4X66I 3T1HE 2WNRB 2ELYA 2V86A 2EMCA 5IXMB 3HKMA 2B7VA 4JG4A 1B63A 1A1LA 3HJCA 5A6AA 2R42A 2O1WA 2CVEA 2HK2A 5KL3A 2MC6A 4DV7E 1B69A 3C6KA 4ZYHA 3J7AG 2E1RA 5A6BD 2VQEI 1B62A 2EMKA 4LF7I 1X6EA 3GCMA 4RH8A 1ZM4A 2EMGA 1PJQA 1Z0VA 1X5WA 1MG7A 2C39A 1T4OA 2ENCA 2LO3A 5IT9C 4NXME 1N33E 5EKWA 2EPNA 2EPAA 2RS6A 4R03A 2UXBI 1WJPA 5ADZA 2EN3A 3BBGA 4JV5E 2FGGA 4OO1E 4BBYA 2YTQA 2JE6A 4M2ZA 4FK5C 4X62I 1XMQI 5DROA 4DR1E 1WRJA 1Y6ZA 5IV8B 4OOGC 4O5GA 4AM3A 3AUZA 1I94E 2PNLA 1P47A 4MYTA 4JI1E 1IQOA 5DNLA 4LFCI 2EOHA 4LF6I 3HXLA 2NN6B 1Z0WA 2PO1B 4IZJB 2V2VA 2VQFI 1PKPA 1NHHA 4YY3I 4IZKB 4WUCA 2CSHA 1TF3A 4I8OA 2ODRC 5IWAE 2GO3A 4MU3A 4WSGA 2YSPA 4MLVA 1UILA 1T4LB 1YSAC 1KVKA 2O3ZA 1LLMC 4GKJE 4FW7A 4IS9A 2Z5CB 4DV2I 4K0KI 5K36D 4P7AA 2M1SA 2Q8UA 2YSOA 1S4EA 2L92A 2JYAA 4Q28A 1HNZI 2LRSA 2I9IA 2GLIA 1S16A 2IOQA 5JEAE 1AH5A 2DSYA 1OYRA 2EE8A 2EOYA 2EPPA 4DV6I 4JI4I 2A25A 2RSMA 2EL6A 2RS7A 2MC5A 4P7DA 3ADJA 5CFFE 1IBME 3B8HA 4X64I 2B7TA 4QNJA 2GPIA 2X7IA 4KZSA 1E3PA 3L7ZB 1WXRA 1X6FA 4DR3I 4ZYEA 4AQYI 1PVGA 1Z0GA 4DV5I 2B3TB 1UDQA 4WFTA 5KL4A 1L4SA 1IBKE 1P42A 1UDSA 1OJ4A 2RPCA 4DV1E 1UEKA 3IWCA 2ENAA 5LMUI 4DV0E 2J7JA 1Z0BA 4R2SA 2Q2EB 2ADRA 1N34E 4O43A 3H4LA 4N3OA 5KL6A 2UXDE 3PS2A 3ZZ0A 4DKKA 4F6MA 4OX9E 1R6LA 2BM0A 2YTNA 2R76A 3C6MA 4NHRA 4X66E 4TUIA 2YT4A 4DR2I 4MYUA 1RC7A 2DLQA 5DRPA 4AIDA 2V89A 4X65E 4B3RI 4BC7A 3CDIA 1HNWI 1A1KA 5GMDA 2EMHA 4O24A 2EM7A 1AAYA 2L3JA 3D4JA 3T1YE 5LMNE 4HACB 1ZAAC 3WU5A 4IFDB 2EN8A 3ADIA 4ISAA 1X6HA 1Z59A 3QT8A 4R2EA 5K36E 2EOXA 1RQ0A 3L00A 1Y5YA 2GS8A 3BIDA 1SR9A 2VQEE 2LVHA 4R2AA 2JWOA 5AASA 1UDOA 1PJSA 2L6MA 2BR2A 4GQUA 3ZZTA 3J80C 2EQ3A 1HR0I 2EP3A 2VE7C 4IFDC 1XMOE 4FWDA 3J7AM 1HK7A 3M85D 3U1YA 1HNXI 2EWLA 2VRDA 2N3HA 1O0WA 5T6JA 4NXNE 1YYWA 4LFAE 4DUYE 3U1KA 5JEAA 5BR8I 1RR9A 1JK2A 2NA2A 2PNMA 2UXBE 2UUBI 4WX9A 3MHSC 3P1XA 2NN6D 1YZ9A 4DR4E 3KRNA 4WXDA 4X62E 4X8WA 1XMQE 4OZEA 3P06A 3M7ND 4AIMA 2V34A 4OO1D 3KZZA 2A2DA 1G2FC 4DR6I 3ECRA 1BBOA 4MLQA 4GZNC 4DV4I 4Z7YA 4LFCE 4DPWA 4DV3I 3V2UC 1XNQE 1X3CA 1H7SA 4LCGA 2VQFE 4DPXA 5C0XA 4JI8I 4FWGA 2EM5A 4KHPE 2LMZA 4BS9A 5AE1A 4YY3E 3B78A 2MKNA 4DPTA 5A6KA 3M85G 3K17A 2PO0A 4BC9A 4X9JA 4JI7I 4WYQB 2WP8B 4DUZI 4USKA 2NUFA 3PYFA 3JTZA 4USMA 1NEIA 1ZXMA 4URLA 1IQSA 2EOQA 3QT7A 3GLLA 3ADLA 4J3DA 2EOJA 3C4BA 1IBLE 3M6AA 2HC5A 1XNRI 2BBGA 4LCHA 5A2QQ 3M7NG 2WCC3 4FW5A 4WXCA 1EI1A 2WZOA 2CT1A 1KIJA 5LL6R 3K85A 5KL2A 2IESA 1H73A 4R2PA 4DV6E 3OTOI 5K36A 3THNA 2EL5A 2EMWA 1MU5A 2EM4A 2PNZA 4X64E 1Z5CA 5JEAD 2M4IA 2YPNA 2YTPA 4JI2I 5DNYA 2EMXA 4DR3E 4AQYE 2YTEA 1YH8A 3KZYA 1UDNA 4DV5E 2HFSA 1KYQA 2EPUA 4BA2B 5L3JA 4F9AB 3ZKBA 3IWBA 2DMYA 2V8QB 2NN6E 4MU0A 1UBDC 2D9HA 2E72A 4R2RA 2EQ0A 4R1FA 3PS3A 2LUPB 2O1TA 4Q35B 3B82A 4MDTA 5C0XD 1ZBTA 3KWRA 2EPZA 1A1FA 2EM0A 2WNRA 4LF5E 4HEIA 2L2KB 2CZ9A 2DEIA 2J7KA 4JI6I 2FTXB 3BGHA 3MHHC 2EMYA 4R2QA 1FJGE 4OKGA 2LV2A 2V88A 4HTGA 4B3SI 1N32I 2LT7A 1Z0TA 2YRHA 1XXEA 1J5EI 5F3WA 1ZR9A 3VYXA 2BA1D 2EN6A 2EPLX 2RQLA 2CTDA 4OO1F 3H09A 3HTXA 3JAMQ 1RREA 1GZ6A 2BA0D 2DMIA 5KL5A 1EKZA 1X49A 4LFBE 4HXZA 4BA1B 4F54A 2WBTA 2IERA 3P3CA 1NHIA 2EM6A 2YU5A 2DGCA 3J81Q 2EPOA 1WHQA 2NABA 1J26A 1JK1A 1T38A 2WBSA 1HNXE 2Z5EA 2KOUA 1QU6A
chains in the Genus database with same CATH topology
1DARA 1VISA 1U2RA 1ZM3A 2UU9E 2V8PA 2LUQA 3Q6MA 4GKKI 3LTOA 4UT4A 2F4VI 3F6GA 2VF3A 4WUDA 2HHHI 1ELOA 4ED4A 1X47A 3V5RA 1ZM9A 4DR6E 2UUCI 4DR5I 4DV4E 2E5LI 3T1HI 2O1VA 4IZJA 4J8ZA 2IHR1 2L2NA 4JI8E 1H7UA 4DPYA 2JR1A 4IZKA 4F9CB 4WPYA 4DUZE 2UXCE 4PU9A 2KONA 3HPSA 4UTGA 3K6QA 2NUGA 2Z5CA 2JY9A 4DV7I 2F8BA 1FWLA 4LU9A 2WW4A 3PRYA 1XNRE 3ZM7A 3WU6A 2AJ4A 1NHJA 4DR7I 4P78A 4ZVIA 3OTOE 2V85A 2L33A 2IOPA 1BKNA 1N33I 3Q6NA 2X36A 2LTRA 2VF1A 4JV5I 2LBSB 2DIXA 4KQVA 3PYGA 4LF7E 3DJWA 2CGEA 4Z7CA 1ZXNA 2G7HA 4I3HA 1I94I 2ODRD 3JU0A 2ZM6I 4JI1I 2MDRA 4LTYA 1USVA 4M1KA 3J7Yp 4IZJD 3LMLA 1KTVA 1PIEA 5A2QC 4WSPA 5FLXQ 2UUAI 3WU3A 4DU7A 4B3SE 4HACA 1N32E 1DI2A 4LF6E 4GKJI 1QZRA 3HULA 3F6HA 1D6TA 2HKJA 4LF4I 4BCAA 4DV2E 4LF9E 4K0KE 2NPFA 1YYKA 2CPNA 1IBMI 2NUEA 1HNZE 4FN5A 2KHXA 1WUUA 4JI0I 4DXLA 4JI4E 2YZTA 4BMJA 2F4VE 4YHHI 4DPUA 2LE2A 1GQEA 2E1MA 1STUA 3J80Q 1Z5AA 4DV0I 4JI3I 3HPZA 1YYOA 3PYDA 4DR5E 2ZITA 2E5LE 3JAMC 4JI5I 2V83A 4X65I 2BM1A 2HFUA 3J81C 5LMUE 1FI4A 3VK6A 2Z5BA 3T1YI 1N0UA 5LMNI 3K1JA 4JYAI 4DR2E 2JVAA 4HY1A 1HNWE 4B3RE 4DR7E 5GMEA 1XMOI 4LF8I 3ZOQB 3AV0A 3MSWA 1FKAE 2V87A 4NXNI 4LFAI 4DUYI 1K47A 2XEXA 4L5NC 3QT6A 1USUA 4GEQB 4DR4I 2O1UA 2BV3A 1FNMA 5BR8E 2V2ZA 2R3VA 3RMPA 2K4VA 2ZM6E 4HYMA 4B3MI 1UHZA 2UUBE 4TUGA 1ZM2A 1XNQI 2EZ6A 2ZBKB 4L8NA 4KHPI 3ADGA 1N36I 4B3TI 2UUAE 5IT9Q 2HK3A 4DV3E 1FWKA 4EMDA 2GQ0A 1IBLI 1Z0CA 4LF4E 4JI7E 4F9BB 1NZ0A 1MX0A 1H74A 3ZKDA 1KKHA 3FIGA 3PYEA 4JI0E 2L8TA 4YHHE 3CWVA 5FLXC 4NXMI 4JI2E 3VYYA 4P52A 4JI3E 4PRXA 4RPFA 4R8OA 3OMLA 2OI2A 2V2QA 4JI5E 4M0VA 4DU8A 4DR1I 2DB2A 2JOBA 4FWHA 4LF5I 2LJHA 2M7QA 1FJGI 3IWDA 1Y4UA 1EA6A 2CG9A 2L2MA 3LLHA 4JYAE 4M30A 3QT5A 1DQ3A 1WHNA 1A6FA 1Z0EA 4JI6E 5IWAI 1Z5BA 3C4TA 2LJPA 2EFGA 3F0NA 1J5EE 2L3CA 4LF8E 5AE2A 4WUBA 3WU4A 1N0VC 1T4NA 2JOXA 3LNUA 2HKEA 4PRVA 2UU9I 3GONA 4XTJA 1Y4SA 3DF6A 5AE3A 1XHKA 2RTXA 2LTSA 1HR0E 3HQ1A 2H36X 2B9DA 4FW9A 3ZZUA 4GKKE 4B3ME 3Q1QA 5FWKA 1ZBQA 2HHHE 1IBKI 2N3GA 1X48A 2DEJA 4DV1I 2UUCE 1N34I 1N36E 4B3TE 2Z5BB 2UXDI 2UXCI 2A2CA 4OX9I 1H72C 2FV4B 3LPSA 4DMIA 4X66I 3T1HE 2V86A 2B7VA 4JG4A 1B63A 3HJCA 2R42A 2O1WA 2HK2A 2MC6A 4DV7E 3J7AG 2E1RA 2VQEI 1B62A 4LF7I 1ZM4A 1Z0VA 5GMDA 1MG7A 1T4OA 5IT9C 4NXME 1N33E 4R03A 2RS6A 2UXBI 5ADZA 4JV5E 2FGGA 4BBYA 4M2ZA 4X62I 1XMQI 4DR1E 1Y6ZA 4OOGC 3AUZA 1I94E 2PNLA 4MYTA 4JI1E 4LFCI 4LF6I 3HXLA 1Z0WA 4IZJB 2V2VA 2VQFI 1PKPA 1NHHA 4YY3I 4IZKB 4WUCA 4I8OA 2ODRC 5IWAE 1T4LB 1UILA 4DV2I 1KVKA 4GKJE 4K0KI 2Z5CB 4P7AA 2M1SA 1S4EA 2L92A 4Q28A 1HNZI 2LRSA 1S16A 2IOQA 2DSYA 4DV6I 4JI4I 2RSMA 2RS7A 4X64I 2MC5A 4P7DA 3ADJA 5CFFE 1IBME 3B8HA 2B7TA 2X7IA 4KZSA 1WXRA 4DR3I 4AQYI 1PVGA 1Z0GA 4DV5I 2B3TB 4WFTA 1IBKE 1OJ4A 4DV1E 1UEKA 3IWCA 5LMUI 4DV0E 1Z0BA 2Q2EB 3H4LA 4N3OA 1N34E 3ZZ0A 2UXDE 4OX9E 2BM0A 4DR2I 4X66E 4TUIA 2YT4A 4MYUA 1RC7A 1HNWI 2V89A 4X65E 4B3RI 4BC7A 3D4JA 2L3JA 3T1YE 5LMNE 4HACB 3WU5A 3ADIA 1Z59A 3QT8A 1RQ0A 2GS8A 1SR9A 2VQEE 3ZZTA 2JWOA 5AASA 4LFBI 2L6MA 3J80C 1HR0I 2VE7C 1XMOE 4FWDA 3J7AM 1HK7A 1HNXI 2EWLA 5T6JA 2N3HA 1O0WA 1YYWA 4NXNE 5BR8I 4LFAE 4DUYE 1RR9A 2PNMA 2NA2A 2UXBE 2UUBI 3P1XA 1YZ9A 4DR4E 4X62E 4X8WA 1XMQE 3P06A 2V34A 2A2DA 4DR6I 4DV4I 4Z7YA 4LFCE 4DPWA 4DV3I 3V2UC 1XNQE 1H7SA 4DPXA 2VQFE 4JI8I 4FWGA 4KHPE 2LMZA 4BS9A 5AE1A 4YY3E 3B78A 4DPTA 3K17A 4BC9A 4JI7I 4WYQB 4DUZI 4USKA 2NUFA 3PYFA 3JTZA 4USMA 1ZXMA 4URLA 3QT7A 3ADLA 3C4BA 1IBLE 3M6AA 1XNRI 5A2QQ 1EI1A 3K85A 2WZOA 1KIJA 5LL6R 1H73A 4DV6E 3OTOI 1MU5A 4X64E 1Z5CA 2M4IA 4JI2I 5DNYA 4DR3E 4AQYE 4DV5E 2HFSA 5L3JA 4F9AB 3ZKBA 3IWBA 2DMYA 2V8QB 4R1FA 2LUPB 2O1TA 3B82A 1ZBTA 3KWRA 4LF5E 2L2KB 2CZ9A 2DEIA 2J7KA 4JI6I 2FTXB 1FJGE 2V88A 4B3SI 1N32I 1Z0TA 1J5EI 5F3WA 3VYXA 3H09A 3HTXA 3JAMQ 1RREA 1GZ6A 1EKZA 1X49A 4LFBE 4HXZA 4LF9I 4F54A 1NHIA 3J81Q 1WHQA 2KOUA 1J26A 1HNXE 2Z5EA 4DKKA 1QU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DAR A;  1VIS A;  1U2R A;  1ZM3 A;  2UU9 E;  2V8P A;  2LUQ A;  4GKK I;  3LTO A;  4UT4 A;  2F4V I;  2VF3 A;  4WUD A;  2HHH I;  1ELO A;  4ED4 A;  1X47 A;  3V5R A;  1ZM9 A;  4DR6 E;  2UUC I;  4DR5 I;  4DV4 E;  2E5L I;  3T1H I;  2IHR 1;  2L2N A;  4JI8 E;  1H7U A;  4DPY A;  2UXC E;  4DUZ E;  4PU9 A;  4UTG A;  2NUG A;  2JY9 A;  4DV7 I;  1FWL A;  2WW4 A;  1XNR E;  3ZM7 A;  3WU6 A;  2AJ4 A;  1NHJ A;  4DR7 I;  4ZVI A;  3OTO E;  2L33 A;  1BKN A;  1N33 I;  2X36 A;  2LTR A;  4JV5 I;  2LBS B;  2DIX A;  4KQV A;  3PYG A;  4LF7 E;  4Z7C A;  1ZXN A;  4I3H A;  1I94 I;  2ZM6 I;  4JI1 I;  2MDR A;  4M1K A;  3J7Y p;  1KTV A;  1PIE A;  5A2Q C;  5FLX Q;  2UUA I;  3WU3 A;  4DU7 A;  4B3S E;  4HAC A;  1N32 E;  1DI2 A;  4LF6 E;  4GKJ I;  1QZR A;  3HUL A;  1D6T A;  2HKJ A;  4LF4 I;  4DV2 E;  4LF9 E;  4K0K E;  2NPF A;  1YYK A;  2CPN A;  1IBM I;  2NUE A;  4FN5 A;  1HNZ E;  2KHX A;  1WUU A;  4JI0 I;  4DXL A;  4JI4 E;  2F4V E;  4YHH I;  4DPU A;  1GQE A;  1STU A;  3J80 Q;  1Z5A A;  4DV0 I;  4JI3 I;  1YYO A;  3PYD A;  4DR5 E;  2ZIT A;  2E5L E;  3JAM C;  4JI5 I;  4X65 I;  2BM1 A;  2HFU A;  3J81 C;  5LMU E;  1FI4 A;  3T1Y I;  1N0U A;  5LMN I;  3K1J A;  4JYA I;  4DR2 E;  2JVA A;  4HY1 A;  1HNW E;  4B3R E;  4DR7 E;  5GME A;  1XMO I;  4LF8 I;  1FKA E;  4NXN I;  4LFA I;  4DUY I;  1K47 A;  2XEX A;  3QT6 A;  4DR4 I;  2BV3 A;  1FNM A;  5BR8 E;  2V2Z A;  2R3V A;  4HYM A;  2ZM6 E;  4B3M I;  1UHZ A;  2UUB E;  1ZM2 A;  1XNQ I;  2EZ6 A;  2ZBK B;  4KHP I;  3ADG A;  1N36 I;  4B3T I;  2UUA E;  5IT9 Q;  2HK3 A;  4DV3 E;  1FWK A;  4EMD A;  1IBL I;  1Z0C A;  4LF4 E;  4JI7 E;  1NZ0 A;  1MX0 A;  1H74 A;  3ZKD A;  1KKH A;  3PYE A;  4JI0 E;  3CWV A;  4YHH E;  5FLX C;  4NXM I;  4JI2 E;  3VYY A;  4P52 A;  4JI3 E;  4PRX A;  4RPF A;  2OI2 A;  2V2Q A;  4JI5 E;  4DU8 A;  4DR1 I;  2DB2 A;  4FWH A;  4LF5 I;  2LJH A;  1FJG I;  1EA6 A;  2L2M A;  3LLH A;  4JYA E;  4M30 A;  3QT5 A;  1WHN A;  1A6F A;  1Z0E A;  4JI6 E;  5IWA I;  1Z5B A;  3C4T A;  2LJP A;  2EFG A;  3F0N A;  1J5E E;  2L3C A;  4LF8 E;  4WUB A;  3WU4 A;  1N0V C;  1T4N A;  3LNU A;  2HKE A;  4PRV A;  2UU9 I;  3GON A;  4XTJ A;  1XHK A;  2RTX A;  2LTS A;  1HR0 E;  4FW9 A;  3ZZU A;  4GKK E;  4B3M E;  3Q1Q A;  2HHH E;  1IBK I;  2N3G A;  1X48 A;  2DEJ A;  4DV1 I;  2UUC E;  1N34 I;  1N36 E;  4B3T E;  2UXD I;  2UXC I;  2A2C A;  4OX9 I;  1H72 C;  3LPS A;  4X66 I;  3T1H E;  2B7V A;  4JG4 A;  1B63 A;  2R42 A;  2HK2 A;  4DV7 E;  3J7A G;  2E1R A;  2VQE I;  1B62 A;  4LF7 I;  1ZM4 A;  1Z0V A;  5GMD A;  1MG7 A;  1T4O A;  4NXM E;  5IT9 C;  1N33 E;  2RS6 A;  2UXB I;  4JV5 E;  4M2Z A;  4X62 I;  1XMQ I;  4DR1 E;  4OOG C;  1I94 E;  4MYT A;  4JI1 E;  4LFC I;  4LF6 I;  1Z0W A;  2V2V A;  2VQF I;  1PKP A;  1NHH A;  4YY3 I;  4WUC A;  5IWA E;  1T4L B;  1UIL A;  4DV2 I;  1KVK A;  4GKJ E;  4K0K I;  4P7A A;  1S4E A;  1HNZ I;  2LRS A;  1S16 A;  4DV6 I;  4JI4 I;  2RSM A;  2RS7 A;  4X64 I;  5CFF E;  3ADJ A;  1IBM E;  3B8H A;  2B7T A;  2X7I A;  4DR3 I;  4AQY I;  1PVG A;  1Z0G A;  4DV5 I;  2B3T B;  4WFT A;  1IBK E;  1OJ4 A;  4DV1 E;  1UEK A;  5LMU I;  4DV0 E;  1Z0B A;  2Q2E B;  3H4L A;  3ZZ0 A;  1N34 E;  2UXD E;  4OX9 E;  2BM0 A;  4DR2 I;  4X66 E;  2YT4 A;  4MYU A;  1RC7 A;  1HNW I;  4X65 E;  4B3R I;  3D4J A;  2L3J A;  3T1Y E;  5LMN E;  4HAC B;  3WU5 A;  3ADI A;  1Z59 A;  3QT8 A;  1RQ0 A;  2GS8 A;  2VQE E;  3ZZT A;  4LFB I;  3J80 C;  1XMO E;  4FWD A;  3J7A M;  1HNX I;  2N3H A;  1O0W A;  1YYW A;  4NXN E;  5BR8 I;  4LFA E;  4DUY E;  1RR9 A;  2NA2 A;  2UXB E;  2UUB I;  3P1X A;  1YZ9 A;  4DR4 E;  4X62 E;  4X8W A;  1XMQ E;  2V34 A;  2A2D A;  4DR6 I;  4DV4 I;  4Z7Y A;  4LFC E;  4DPW A;  4DV3 I;  3V2U C;  1XNQ E;  1H7S A;  4DPX A;  2VQF E;  4JI8 I;  4FWG A;  4KHP E;  4YY3 E;  3B78 A;  4DPT A;  3K17 A;  4JI7 I;  4WYQ B;  4DUZ I;  4USK A;  2NUF A;  3PYF A;  4USM A;  1ZXM A;  4URL A;  3QT7 A;  3ADL A;  3C4B A;  1IBL E;  3M6A A;  1XNR I;  5A2Q Q;  1EI1 A;  1KIJ A;  5LL6 R;  1H73 A;  4DV6 E;  3OTO I;  1MU5 A;  4X64 E;  1Z5C A;  4JI2 I;  4DR3 E;  4AQY E;  4DV5 E;  2HFS A;  5L3J A;  3ZKB A;  2DMY A;  4R1F A;  2LUP B;  3B82 A;  1ZBT A;  4LF5 E;  2L2K B;  2CZ9 A;  2DEI A;  2J7K A;  4JI6 I;  1FJG E;  4B3S I;  1N32 I;  1Z0T A;  1J5E I;  3VYX A;  3JAM Q;  3HTX A;  1RRE A;  4HXZ A;  1EKZ A;  1X49 A;  4LFB E;  4LF9 I;  1NHI A;  3J81 Q;  1WHQ A;  1J26 A;  1HNX E;  1HR0 I;  4DKK A;  1QU6 A; 
#chains in the Genus database with same CATH topology
 1DAR A;  1VIS A;  3UHM A;  1U2R A;  1ZM3 A;  2UU9 E;  2JT2 A;  2LUQ A;  4R2D A;  2JEB B;  2V8P A;  2F1D A;  3Q6M A;  3LTO A;  4UT4 A;  4GKK I;  2F4V I;  3F6G A;  2VF3 A;  4WUD A;  2HHH I;  1ELO A;  2EPR A;  4ED4 A;  2EPC A;  1X47 A;  3V5R A;  1ZM9 A;  4DR6 E;  2C37 B;  2UUC I;  1T39 A;  2BA1 G;  4DR5 I;  1NCS A;  4DV4 E;  1MEY C;  2E5L I;  3QG5 C;  2BA0 G;  2NN6 A;  3T1H I;  2PO1 A;  2O1V A;  4IZJ A;  5JEA F;  4J8Z A;  2IHR 1;  2L2N A;  4JI8 E;  2EJ4 A;  1H7U A;  4DPY A;  4IFD E;  2JR1 A;  4IZK A;  3BF2 A;  4F9C B;  4WPY A;  4DUZ E;  2UXC E;  4PU9 A;  2KON A;  3HPS A;  5TSE A;  3K6Q A;  2NUG A;  4UTG A;  3EPK A;  2Z5C A;  2JY9 A;  4DV7 I;  2F8B A;  1FWL A;  4LU9 A;  1PDA A;  1YUJ A;  2WW4 A;  1XNR E;  3PRY A;  3ZM7 A;  4FW6 A;  3WU6 A;  2AJ4 A;  1NHJ A;  4DR7 I;  4LFB I;  4P78 A;  4ZVI A;  3OTO E;  2PRT A;  2V85 A;  5C0X F;  2L33 A;  3THO B;  2IOP A;  1UN6 B;  1BKN A;  1N33 I;  1EH7 A;  4N4R B;  3Q6N A;  2EM9 A;  3M99 B;  2X36 A;  2LTR A;  2VF1 A;  2EOO A;  4JV5 I;  2EN1 A;  2EPM X;  2LBS B;  2DIX A;  4KQV A;  3PYG A;  4LF7 E;  2JEA B;  3DJW A;  2CGE A;  5DRQ A;  4Z7C A;  1G2D C;  1ZXN A;  2G7H A;  4I3H A;  2JP9 A;  2EML A;  1RMD A;  2ODR D;  4LCF A;  3JU0 A;  2ZM6 I;  4OO1 A;  1I94 I;  4JI1 I;  2MDR A;  4LTY A;  1USV A;  2PO2 B;  3EQ1 A;  1E3H A;  1A1I A;  3J7Y p;  3PS1 A;  3LML A;  4IZJ D;  4M1K A;  5K36 F;  1KTV A;  1PIE A;  5A2Q C;  3H1C A;  1ZU1 A;  4WSP A;  1MGT A;  5FLX Q;  2UUA I;  3WU3 A;  4DU7 A;  4B3S E;  4HAC A;  1N32 E;  1DI2 A;  4LF6 E;  3P3G A;  4GKJ I;  1QZR A;  4IFD A;  1RHY A;  2JXP A;  3F6H A;  3HUL A;  5C0X C;  1D6T A;  2HKJ A;  4LF4 I;  4BCA A;  4DV2 E;  4LF9 E;  4K0K E;  1R6M A;  2NPF A;  5K36 B;  1YYK A;  2EPK X;  2CPN A;  1IBM I;  2C38 A;  1EH8 A;  2NUE A;  2YRK A;  1HNZ E;  4FN5 A;  2KHX A;  1WUU A;  1IMU A;  4JI0 I;  2N8X A;  4DXL A;  4JI4 E;  2YZT A;  4BMJ A;  2F4V E;  4YHH I;  3B4T A;  4DPU A;  2EM2 A;  5K36 C;  2C39 B;  2LE2 A;  1F2I G;  2YTJ A;  1GQE A;  5A6J A;  5EL9 A;  2E1M A;  1DGC A;  1STU A;  3J80 Q;  1Z5A A;  4U3D A;  4DV0 I;  2EOF A;  3HPZ A;  3P3E A;  4JI3 I;  1YYO A;  3PYD A;  4DR5 E;  2RSI A;  2ZIT A;  2E5L E;  5A69 A;  3JAM C;  2JE6 B;  3DD6 A;  5DRR A;  4JI5 I;  3CDJ A;  2V83 A;  4X65 I;  2YTF A;  2BM1 A;  2HFU A;  1BBG A;  3J81 C;  5LMU E;  3GME A;  1FI4 A;  1PJT A;  3VK6 A;  2Z5B A;  5ELW A;  1N0U A;  5LMN I;  3K1J A;  2WP8 A;  3T1Y I;  4JYA I;  2EOS A;  4IFD D;  4DR2 E;  2JVA A;  4HY1 A;  4MU1 A;  2YWQ A;  2YTD A;  1HNW E;  4B3R E;  2YRM A;  4M9V C;  5AC4 A;  1VI7 A;  2AE8 A;  4QNK A;  1GTK A;  4DR7 E;  2NN6 F;  2ENH A;  1OYP A;  5GME A;  1XMO I;  4LF8 I;  3ZOQ B;  3AV0 A;  3MSW A;  4IS1 C;  2V87 A;  4IJD A;  1FKA E;  1BB8 A;  4NXN I;  2GHF A;  4DUY I;  1K47 A;  4LFA I;  2XEX A;  2ELZ A;  4L5N C;  2YTO A;  4KWY A;  3QT6 A;  4LPF A;  1USU A;  4GEQ B;  2YU8 A;  4RHB B;  2O1U A;  4DR4 I;  2BV3 A;  2VES A;  2JPA A;  4BA2 A;  1A1G A;  1FNM A;  2EN2 A;  5BR8 E;  2V2Z A;  2DRP A;  2R3V A;  2EM3 A;  2K4V A;  4ZYD A;  2EOR A;  2ZM6 E;  3RMP A;  4HYM A;  4U3B A;  1UHZ A;  4B3M I;  2UUB E;  2EMI A;  4TUG A;  2WBU A;  1ZM2 A;  1XNQ I;  2M9A A;  2LJU A;  2BB8 A;  2EZ6 A;  2ZBK B;  4L8N A;  4KHP I;  1YFH A;  3ADG A;  5C0X E;  4OO1 B;  1N36 I;  1A1H A;  1EH6 A;  2UUA E;  4B3T I;  4MQY A;  5IT9 Q;  2HK3 A;  4DV3 E;  4ZYG A;  1FWK A;  3EPJ A;  4EMD A;  4LF9 I;  2NN6 C;  2GQ0 A;  1TF6 A;  1YPN A;  3UK3 C;  4O4K A;  3P76 A;  1Z0C A;  2EM8 A;  1IBL I;  2EMB A;  2GO4 A;  4OO1 C;  4LOM A;  4LF4 E;  1OYS A;  4JI7 E;  4F9B B;  1NZ0 A;  4BA1 A;  1MX0 A;  1H74 A;  3ZKD A;  4F2J C;  1KKH A;  2EL4 A;  1N3G A;  2EOI A;  2MKD A;  1QNT A;  4F6N A;  2EN7 A;  2DLK A;  3FIG A;  2BR2 B;  5DNX A;  2JEB A;  3PYE A;  4IFD F;  4JI0 E;  2L8T A;  4YHH E;  2EMA A;  5FLX C;  5AC5 A;  3CWV A;  4NBQ A;  2HJJ A;  1KJK A;  4NXM I;  1YUI A;  5JEA B;  1A1J A;  4BHB A;  4JI2 E;  3VYY A;  2YTG A;  4P52 A;  2C37 A;  4JI3 E;  2EMF A;  3L7Z A;  4PRX A;  4R8O A;  4RPF A;  5KL7 A;  3OML A;  2OI2 A;  2V2Q A;  4JI5 E;  4M0V A;  4DU8 A;  4DR1 I;  3EPH A;  4FW3 A;  5JEA C;  2DB2 A;  2JOB A;  1TN9 A;  4FWH A;  4LF5 I;  2LJH A;  2M7Q A;  1FJG I;  3IWD A;  1Y4U A;  1EA6 A;  4NZV A;  2L2M A;  3LLH A;  2CG9 A;  1SFE A;  2EMZ A;  4JYA E;  4M30 A;  4MU4 A;  3QT5 A;  1DQ3 A;  5C0X B;  1WHN A;  1A6F A;  1Z0E A;  2J65 A;  4JI6 E;  2PO0 B;  2EOE A;  1Z5B A;  2MDG A;  5IWA I;  3C4T A;  5LLQ A;  2LJP A;  2EFG A;  2I13 A;  1Y60 A;  3F0N A;  1J5E E;  2L3C A;  4LF8 E;  3EPL A;  2HGH A;  5AE2 A;  4WUB A;  3WU4 A;  2C38 B;  1N0V C;  2LCE A;  1T4N A;  2JOX A;  3LNU A;  2HKE A;  4PRV A;  2UU9 I;  4FW4 A;  5A6B A;  3GON A;  2EQ1 A;  4XTJ A;  1Y4S A;  3DF6 A;  5AE3 A;  1XHK A;  4BHC A;  2RTX A;  2JEA A;  2R1F A;  2PNZ B;  3VHT B;  2LTS A;  2EOM A;  1HR0 E;  3HQ1 A;  2H36 X;  2B9D A;  4FW9 A;  2EOZ A;  3ZZU A;  4GKK E;  4B3M E;  3Q1Q A;  5FWK A;  2PO2 A;  1Z1B A;  1ZBQ A;  3NZK A;  2HHH E;  1IBK I;  2N3G A;  1X48 A;  2K7I A;  2EN4 A;  2DEJ A;  4DV1 I;  2EPX A;  3TQM A;  2UUC E;  1N34 I;  2YTI A;  1N36 E;  4B3T E;  2Z5B B;  2UXD I;  2UXC I;  2A2C A;  4OX9 I;  1H72 C;  2FV4 B;  4R2C A;  4DMI A;  3LPS A;  1YHC A;  4X66 I;  3T1H E;  2WNR B;  2ELY A;  2V86 A;  2EMC A;  5IXM B;  3HKM A;  2B7V A;  4JG4 A;  1B63 A;  1A1L A;  3HJC A;  5A6A A;  2R42 A;  2O1W A;  2CVE A;  2HK2 A;  5KL3 A;  2MC6 A;  4DV7 E;  1B69 A;  3C6K A;  4ZYH A;  3J7A G;  2E1R A;  5A6B D;  2VQE I;  1B62 A;  2EMK A;  4LF7 I;  1X6E A;  3GCM A;  4RH8 A;  1ZM4 A;  2EMG A;  1PJQ A;  1Z0V A;  1X5W A;  1MG7 A;  2C39 A;  1T4O A;  2ENC A;  2LO3 A;  5IT9 C;  4NXM E;  1N33 E;  5EKW A;  2EPN A;  2EPA A;  2RS6 A;  4R03 A;  2UXB I;  1WJP A;  5ADZ A;  2EN3 A;  3BBG A;  4JV5 E;  2FGG A;  4OO1 E;  4BBY A;  2YTQ A;  2JE6 A;  4M2Z A;  4FK5 C;  4X62 I;  1XMQ I;  5DRO A;  4DR1 E;  1WRJ A;  1Y6Z A;  5IV8 B;  4OOG C;  4O5G A;  4AM3 A;  3AUZ A;  1I94 E;  2PNL A;  1P47 A;  4MYT A;  4JI1 E;  1IQO A;  5DNL A;  4LFC I;  2EOH A;  4LF6 I;  3HXL A;  2NN6 B;  1Z0W A;  2PO1 B;  4IZJ B;  2V2V A;  2VQF I;  1PKP A;  1NHH A;  4YY3 I;  4IZK B;  4WUC A;  2CSH A;  1TF3 A;  4I8O A;  2ODR C;  5IWA E;  2GO3 A;  4MU3 A;  4WSG A;  2YSP A;  4MLV A;  1UIL A;  1T4L B;  1YSA C;  1KVK A;  2O3Z A;  1LLM C;  4GKJ E;  4FW7 A;  4IS9 A;  2Z5C B;  4DV2 I;  4K0K I;  5K36 D;  4P7A A;  2M1S A;  2Q8U A;  2YSO A;  1S4E A;  2L92 A;  2JYA A;  4Q28 A;  1HNZ I;  2LRS A;  2I9I A;  2GLI A;  1S16 A;  2IOQ A;  5JEA E;  1AH5 A;  2DSY A;  1OYR A;  2EE8 A;  2EOY A;  2EPP A;  4DV6 I;  4JI4 I;  2A25 A;  2RSM A;  2EL6 A;  2RS7 A;  2MC5 A;  4P7D A;  3ADJ A;  5CFF E;  1IBM E;  3B8H A;  4X64 I;  2B7T A;  4QNJ A;  2GPI A;  2X7I A;  4KZS A;  1E3P A;  3L7Z B;  1WXR A;  1X6F A;  4DR3 I;  4ZYE A;  4AQY I;  1PVG A;  1Z0G A;  4DV5 I;  2B3T B;  1UDQ A;  4WFT A;  5KL4 A;  1L4S A;  1IBK E;  1P42 A;  1UDS A;  1OJ4 A;  2RPC A;  4DV1 E;  1UEK A;  3IWC A;  2ENA A;  5LMU I;  4DV0 E;  2J7J A;  1Z0B A;  4R2S A;  2Q2E B;  2ADR A;  1N34 E;  4O43 A;  3H4L A;  4N3O A;  5KL6 A;  2UXD E;  3PS2 A;  3ZZ0 A;  4DKK A;  4F6M A;  4OX9 E;  1R6L A;  2BM0 A;  2YTN A;  2R76 A;  3C6M A;  4NHR A;  4X66 E;  4TUI A;  2YT4 A;  4DR2 I;  4MYU A;  1RC7 A;  2DLQ A;  5DRP A;  4AID A;  2V89 A;  4X65 E;  4B3R I;  4BC7 A;  3CDI A;  1HNW I;  1A1K A;  5GMD A;  2EMH A;  4O24 A;  2EM7 A;  1AAY A;  2L3J A;  3D4J A;  3T1Y E;  5LMN E;  4HAC B;  1ZAA C;  3WU5 A;  4IFD B;  2EN8 A;  3ADI A;  4ISA A;  1X6H A;  1Z59 A;  3QT8 A;  4R2E A;  5K36 E;  2EOX A;  1RQ0 A;  3L00 A;  1Y5Y A;  2GS8 A;  3BID A;  1SR9 A;  2VQE E;  2LVH A;  4R2A A;  2JWO A;  5AAS A;  1UDO A;  1PJS A;  2L6M A;  2BR2 A;  4GQU A;  3ZZT A;  3J80 C;  2EQ3 A;  1HR0 I;  2EP3 A;  2VE7 C;  4IFD C;  1XMO E;  4FWD A;  3J7A M;  1HK7 A;  3M85 D;  3U1Y A;  1HNX I;  2EWL A;  2VRD A;  2N3H A;  1O0W A;  5T6J A;  4NXN E;  1YYW A;  4LFA E;  4DUY E;  3U1K A;  5JEA A;  5BR8 I;  1RR9 A;  1JK2 A;  2NA2 A;  2PNM A;  2UXB E;  2UUB I;  4WX9 A;  3MHS C;  3P1X A;  2NN6 D;  1YZ9 A;  4DR4 E;  3KRN A;  4WXD A;  4X62 E;  4X8W A;  1XMQ E;  4OZE A;  3P06 A;  3M7N D;  4AIM A;  2V34 A;  4OO1 D;  3KZZ A;  2A2D A;  1G2F C;  4DR6 I;  3ECR A;  1BBO A;  4MLQ A;  4GZN C;  4DV4 I;  4Z7Y A;  4LFC E;  4DPW A;  4DV3 I;  3V2U C;  1XNQ E;  1X3C A;  1H7S A;  4LCG A;  2VQF E;  4DPX A;  5C0X A;  4JI8 I;  4FWG A;  2EM5 A;  4KHP E;  2LMZ A;  4BS9 A;  5AE1 A;  4YY3 E;  3B78 A;  2MKN A;  4DPT A;  5A6K A;  3M85 G;  3K17 A;  2PO0 A;  4BC9 A;  4X9J A;  4JI7 I;  4WYQ B;  2WP8 B;  4DUZ I;  4USK A;  2NUF A;  3PYF A;  3JTZ A;  4USM A;  1NEI A;  1ZXM A;  4URL A;  1IQS A;  2EOQ A;  3QT7 A;  3GLL A;  3ADL A;  4J3D A;  2EOJ A;  3C4B A;  1IBL E;  3M6A A;  2HC5 A;  1XNR I;  2BBG A;  4LCH A;  5A2Q Q;  3M7N G;  2WCC 3;  4FW5 A;  4WXC A;  1EI1 A;  2WZO A;  2CT1 A;  1KIJ A;  5LL6 R;  3K85 A;  5KL2 A;  2IES A;  1H73 A;  4R2P A;  4DV6 E;  3OTO I;  5K36 A;  3THN A;  2EL5 A;  2EMW A;  1MU5 A;  2EM4 A;  2PNZ A;  4X64 E;  1Z5C A;  5JEA D;  2M4I A;  2YPN A;  2YTP A;  4JI2 I;  5DNY A;  2EMX A;  4DR3 E;  4AQY E;  2YTE A;  1YH8 A;  3KZY A;  1UDN A;  4DV5 E;  2HFS A;  1KYQ A;  2EPU A;  4BA2 B;  5L3J A;  4F9A B;  3ZKB A;  3IWB A;  2DMY A;  2V8Q B;  2NN6 E;  4MU0 A;  1UBD C;  2D9H A;  2E72 A;  4R2R A;  2EQ0 A;  4R1F A;  3PS3 A;  2LUP B;  2O1T A;  4Q35 B;  3B82 A;  4MDT A;  5C0X D;  1ZBT A;  3KWR A;  2EPZ A;  1A1F A;  2EM0 A;  2WNR A;  4LF5 E;  4HEI A;  2L2K B;  2CZ9 A;  2DEI A;  2J7K A;  4JI6 I;  2FTX B;  3BGH A;  3MHH C;  2EMY A;  4R2Q A;  1FJG E;  4OKG A;  2LV2 A;  2V88 A;  4HTG A;  4B3S I;  1N32 I;  2LT7 A;  1Z0T A;  2YRH A;  1XXE A;  1J5E I;  5F3W A;  1ZR9 A;  3VYX A;  2BA1 D;  2EN6 A;  2EPL X;  2RQL A;  2CTD A;  4OO1 F;  3H09 A;  3HTX A;  3JAM Q;  1RRE A;  1GZ6 A;  2BA0 D;  2DMI A;  5KL5 A;  1EKZ A;  1X49 A;  4LFB E;  4HXZ A;  4BA1 B;  4F54 A;  2WBT A;  2IER A;  3P3C A;  1NHI A;  2EM6 A;  2YU5 A;  2DGC A;  3J81 Q;  2EPO A;  1WHQ A;  2NAB A;  1J26 A;  1JK1 A;  1T38 A;  2WBS A;  1HNX E;  2Z5E A;  2KOU A;  1QU6 A; 
#chains in the Genus database with same CATH homology
 1DAR A;  1VIS A;  1U2R A;  1ZM3 A;  2UU9 E;  2V8P A;  2LUQ A;  3Q6M A;  4GKK I;  3LTO A;  4UT4 A;  2F4V I;  3F6G A;  2VF3 A;  4WUD A;  2HHH I;  1ELO A;  4ED4 A;  1X47 A;  3V5R A;  1ZM9 A;  4DR6 E;  2UUC I;  4DR5 I;  4DV4 E;  2E5L I;  3T1H I;  2O1V A;  4IZJ A;  4J8Z A;  2IHR 1;  2L2N A;  4JI8 E;  1H7U A;  4DPY A;  2JR1 A;  4IZK A;  4F9C B;  4WPY A;  4DUZ E;  2UXC E;  4PU9 A;  2KON A;  3HPS A;  4UTG A;  3K6Q A;  2NUG A;  2Z5C A;  2JY9 A;  4DV7 I;  2F8B A;  1FWL A;  4LU9 A;  2WW4 A;  3PRY A;  1XNR E;  3ZM7 A;  3WU6 A;  2AJ4 A;  1NHJ A;  4DR7 I;  4P78 A;  4ZVI A;  3OTO E;  2V85 A;  2L33 A;  2IOP A;  1BKN A;  1N33 I;  3Q6N A;  2X36 A;  2LTR A;  2VF1 A;  4JV5 I;  2LBS B;  2DIX A;  4KQV A;  3PYG A;  4LF7 E;  3DJW A;  2CGE A;  4Z7C A;  1ZXN A;  2G7H A;  4I3H A;  1I94 I;  2ODR D;  3JU0 A;  2ZM6 I;  4JI1 I;  2MDR A;  4LTY A;  1USV A;  4M1K A;  3J7Y p;  4IZJ D;  3LML A;  1KTV A;  1PIE A;  5A2Q C;  4WSP A;  5FLX Q;  2UUA I;  3WU3 A;  4DU7 A;  4B3S E;  4HAC A;  1N32 E;  1DI2 A;  4LF6 E;  4GKJ I;  1QZR A;  3HUL A;  3F6H A;  1D6T A;  2HKJ A;  4LF4 I;  4BCA A;  4DV2 E;  4LF9 E;  4K0K E;  2NPF A;  1YYK A;  2CPN A;  1IBM I;  2NUE A;  1HNZ E;  4FN5 A;  2KHX A;  1WUU A;  4JI0 I;  4DXL A;  4JI4 E;  2YZT A;  4BMJ A;  2F4V E;  4YHH I;  4DPU A;  2LE2 A;  1GQE A;  2E1M A;  1STU A;  3J80 Q;  1Z5A A;  4DV0 I;  4JI3 I;  3HPZ A;  1YYO A;  3PYD A;  4DR5 E;  2ZIT A;  2E5L E;  3JAM C;  4JI5 I;  2V83 A;  4X65 I;  2BM1 A;  2HFU A;  3J81 C;  5LMU E;  1FI4 A;  3VK6 A;  2Z5B A;  3T1Y I;  1N0U A;  5LMN I;  3K1J A;  4JYA I;  4DR2 E;  2JVA A;  4HY1 A;  1HNW E;  4B3R E;  4DR7 E;  5GME A;  1XMO I;  4LF8 I;  3ZOQ B;  3AV0 A;  3MSW A;  1FKA E;  2V87 A;  4NXN I;  4LFA I;  4DUY I;  1K47 A;  2XEX A;  4L5N C;  3QT6 A;  1USU A;  4GEQ B;  4DR4 I;  2O1U A;  2BV3 A;  1FNM A;  5BR8 E;  2V2Z A;  2R3V A;  3RMP A;  2K4V A;  2ZM6 E;  4HYM A;  4B3M I;  1UHZ A;  2UUB E;  4TUG A;  1ZM2 A;  1XNQ I;  2EZ6 A;  2ZBK B;  4L8N A;  4KHP I;  3ADG A;  1N36 I;  4B3T I;  2UUA E;  5IT9 Q;  2HK3 A;  4DV3 E;  1FWK A;  4EMD A;  2GQ0 A;  1IBL I;  1Z0C A;  4LF4 E;  4JI7 E;  4F9B B;  1NZ0 A;  1MX0 A;  1H74 A;  3ZKD A;  1KKH A;  3FIG A;  3PYE A;  4JI0 E;  2L8T A;  4YHH E;  3CWV A;  5FLX C;  4NXM I;  4JI2 E;  3VYY A;  4P52 A;  4JI3 E;  4PRX A;  4RPF A;  4R8O A;  3OML A;  2OI2 A;  2V2Q A;  4JI5 E;  4M0V A;  4DU8 A;  4DR1 I;  2DB2 A;  2JOB A;  4FWH A;  4LF5 I;  2LJH A;  2M7Q A;  1FJG I;  3IWD A;  1Y4U A;  1EA6 A;  2CG9 A;  2L2M A;  3LLH A;  4JYA E;  4M30 A;  3QT5 A;  1DQ3 A;  1WHN A;  1A6F A;  1Z0E A;  4JI6 E;  5IWA I;  1Z5B A;  3C4T A;  2LJP A;  2EFG A;  3F0N A;  1J5E E;  2L3C A;  4LF8 E;  5AE2 A;  4WUB A;  3WU4 A;  1N0V C;  1T4N A;  2JOX A;  3LNU A;  2HKE A;  4PRV A;  2UU9 I;  3GON A;  4XTJ A;  1Y4S A;  3DF6 A;  5AE3 A;  1XHK A;  2RTX A;  2LTS A;  1HR0 E;  3HQ1 A;  2H36 X;  2B9D A;  4FW9 A;  3ZZU A;  4GKK E;  4B3M E;  3Q1Q A;  5FWK A;  1ZBQ A;  2HHH E;  1IBK I;  2N3G A;  1X48 A;  2DEJ A;  4DV1 I;  2UUC E;  1N34 I;  1N36 E;  4B3T E;  2Z5B B;  2UXD I;  2UXC I;  2A2C A;  4OX9 I;  1H72 C;  2FV4 B;  3LPS A;  4DMI A;  4X66 I;  3T1H E;  2V86 A;  2B7V A;  4JG4 A;  1B63 A;  3HJC A;  2R42 A;  2O1W A;  2HK2 A;  2MC6 A;  4DV7 E;  3J7A G;  2E1R A;  2VQE I;  1B62 A;  4LF7 I;  1ZM4 A;  1Z0V A;  5GMD A;  1MG7 A;  1T4O A;  5IT9 C;  4NXM E;  1N33 E;  4R03 A;  2RS6 A;  2UXB I;  5ADZ A;  4JV5 E;  2FGG A;  4BBY A;  4M2Z A;  4X62 I;  1XMQ I;  4DR1 E;  1Y6Z A;  4OOG C;  3AUZ A;  1I94 E;  2PNL A;  4MYT A;  4JI1 E;  4LFC I;  4LF6 I;  3HXL A;  1Z0W A;  4IZJ B;  2V2V A;  2VQF I;  1PKP A;  1NHH A;  4YY3 I;  4IZK B;  4WUC A;  4I8O A;  2ODR C;  5IWA E;  1T4L B;  1UIL A;  4DV2 I;  1KVK A;  4GKJ E;  4K0K I;  2Z5C B;  4P7A A;  2M1S A;  1S4E A;  2L92 A;  4Q28 A;  1HNZ I;  2LRS A;  1S16 A;  2IOQ A;  2DSY A;  4DV6 I;  4JI4 I;  2RSM A;  2RS7 A;  4X64 I;  2MC5 A;  4P7D A;  3ADJ A;  5CFF E;  1IBM E;  3B8H A;  2B7T A;  2X7I A;  4KZS A;  1WXR A;  4DR3 I;  4AQY I;  1PVG A;  1Z0G A;  4DV5 I;  2B3T B;  4WFT A;  1IBK E;  1OJ4 A;  4DV1 E;  1UEK A;  3IWC A;  5LMU I;  4DV0 E;  1Z0B A;  2Q2E B;  3H4L A;  4N3O A;  1N34 E;  3ZZ0 A;  2UXD E;  4OX9 E;  2BM0 A;  4DR2 I;  4X66 E;  4TUI A;  2YT4 A;  4MYU A;  1RC7 A;  1HNW I;  2V89 A;  4X65 E;  4B3R I;  4BC7 A;  3D4J A;  2L3J A;  3T1Y E;  5LMN E;  4HAC B;  3WU5 A;  3ADI A;  1Z59 A;  3QT8 A;  1RQ0 A;  2GS8 A;  1SR9 A;  2VQE E;  3ZZT A;  2JWO A;  5AAS A;  4LFB I;  2L6M A;  3J80 C;  1HR0 I;  2VE7 C;  1XMO E;  4FWD A;  3J7A M;  1HK7 A;  1HNX I;  2EWL A;  5T6J A;  2N3H A;  1O0W A;  1YYW A;  4NXN E;  5BR8 I;  4LFA E;  4DUY E;  1RR9 A;  2PNM A;  2NA2 A;  2UXB E;  2UUB I;  3P1X A;  1YZ9 A;  4DR4 E;  4X62 E;  4X8W A;  1XMQ E;  3P06 A;  2V34 A;  2A2D A;  4DR6 I;  4DV4 I;  4Z7Y A;  4LFC E;  4DPW A;  4DV3 I;  3V2U C;  1XNQ E;  1H7S A;  4DPX A;  2VQF E;  4JI8 I;  4FWG A;  4KHP E;  2LMZ A;  4BS9 A;  5AE1 A;  4YY3 E;  3B78 A;  4DPT A;  3K17 A;  4BC9 A;  4JI7 I;  4WYQ B;  4DUZ I;  4USK A;  2NUF A;  3PYF A;  3JTZ A;  4USM A;  1ZXM A;  4URL A;  3QT7 A;  3ADL A;  3C4B A;  1IBL E;  3M6A A;  1XNR I;  5A2Q Q;  1EI1 A;  3K85 A;  2WZO A;  1KIJ A;  5LL6 R;  1H73 A;  4DV6 E;  3OTO I;  1MU5 A;  4X64 E;  1Z5C A;  2M4I A;  4JI2 I;  5DNY A;  4DR3 E;  4AQY E;  4DV5 E;  2HFS A;  5L3J A;  4F9A B;  3ZKB A;  3IWB A;  2DMY A;  2V8Q B;  4R1F A;  2LUP B;  2O1T A;  3B82 A;  1ZBT A;  3KWR A;  4LF5 E;  2L2K B;  2CZ9 A;  2DEI A;  2J7K A;  4JI6 I;  2FTX B;  1FJG E;  2V88 A;  4B3S I;  1N32 I;  1Z0T A;  1J5E I;  5F3W A;  3VYX A;  3H09 A;  3HTX A;  3JAM Q;  1RRE A;  1GZ6 A;  1EKZ A;  1X49 A;  4LFB E;  4HXZ A;  4LF9 I;  4F54 A;  1NHI A;  3J81 Q;  1WHQ A;  2KOU A;  1J26 A;  1HNX E;  2Z5E A;  4DKK A;  1QU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...