2UXCE

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uxcE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcE02
2DEJA 4DV4I 3ZKBA 1QZRA 1N34I 1T4NA 4LF5E 2VQFE 4HXZA 4M1KA 4DV1E 3H4LA 1IBME 4DU8A 1N0UA 4DV7I 4X8WA 5BR8I 1X48A 4JV5I 4JI2E 4HYMA 3HULA 2WW4A 4EMDA 3B78A 1FJGI 4KHPE 2V8PA 3J81Q 2UUCI 2VQEE 2UXDE 4JI6E 1HNXE 2UUAE 3P1XA 2HHHI 3ZM7A 2F4VI 3ZZUA 4AQYI 4DXLA 4Z7YA 4LF9I 4NXNE 2B7TA 3ADJA 2A2CA 4LF4E 1O0WA 2J7KA 3V5RA 2ZITA 1N36I 1Z0TA 1DI2A 4JI0E 5LMUE 4GKKI 3WU4A 2IHR1 2L2NA 4DR4E 4UT4A 1IBLI 5L3JA 1HNWI 2L2KB 4B3RI 2VF3A 5A2QQ 4DU7A 1FNMA 1FI4A 1YZ9A 4JI5I 4LFBE 2UXBE 2R3VA 5IWAI 3J80Q 1N32E 4GKJE 3K17A 4K0KE 2DB2A 3T1YE 4PRXA 2UXCE 1A6FA 2DMYA 2LTSA 4LF8I 2HK2A 4WUDA 4DUYI 4DV5E 4DV3I 4JYAI 3ZKDA 3JAMC 1B63A 4I3HA 2VQFI 4JI4I 4JI7I 1KTVA 1EI1A 4JI8E 4JI2I 1B62A 1NHHA 2L2MA 2ZM6E 2N3HA 1UEKA 2UXDI 1KIJA 1Z0GA 4X65I 3LNUA 2NUGA 1Z0CA 4YHHE 1H72C 1N33E 1U2RA 3ADGA 2RS6A 3VYXA 3J7AM 2MDRA 1OJ4A 1XMOE 2LJPA 1H74A 4JI0I 1S16A 2HKJA 3QT6A 4DUZE 1ZM4A 4DR4I 1HNZI 4X64E 4YY3E 1J5EE 4PRVA 3HTXA 4DV0E 2V2VA 2B7VA 1RR9A 3T1HE 3PYFA 4JI3E 1S4EA 2BM1A 1Z0BA 3LTOA 1N32I 4K0KI 1QU6A 2UUBI 2R42A 3T1YI 2X36A 4DR6I 4XTJA 3WU3A 1D6TA 2E5LE 4B3TE 1XHKA 4DR7I 1NHJA 4NXMI 4HY1A 4FWGA 4DR3E 4DV6I 1STUA 2N3GA 2UU9E 4DR5E 1GQEA 4X66E 1WHQA 5GMDA 5LMNI 4DV2E 4DR2I 1YYWA 5IT9C 3C4TA 4YHHI 4B3MI 3QT5A 2RS7A 4DR1E 1XNQE 1BKNA 4X62E 4DPYA 1I94E 2LRSA 4JI1E 4FN5A 2L3CA 1MG7A 1IBKE 3CWVA 1Z0EA 1XNRE 4B3SI 4JG4A 1ZM2A 4WYQB 4DV4E 4X64I 3OTOI 2LTRA 1X49A 3B82A 3WU6A 4DV7E 2OI2A 4LF5I 5BR8E 4JV5E 4LFCE 4DV1I 4LF6E 1IBMI 4DV0I 1FWKA 4MYTA 2CZ9A 2EFGA 2UUCE 1PVGA 1NZ0A 4KHPI 4DPXA 2HHHE 2F4VE 1ELOA 3J81C 2VQEI 4JI6I 4FWDA 1HNXI 4AQYE 1PIEA 2LJHA 2LUPB 2UUAI 4LF9E 2B3TB 4PU9A 1KKHA 1RREA 2E5LI 3J7AG 1EKZA 1YYOA 4NXNI 2RTXA 1FWLA 4Z7CA 4LF4I 4HACB 3ADLA 4DR3I 1VISA 4DR5I 3D4JA 5LMUI 3M6AA 4X66I 1UHZA 2NA2A 1J26A 2XEXA 4B3RE 1RQ0A 4KQVA 4WFTA 2JVAA 1UILA 2BV3A 2E1RA 1RC7A 4DR1I 4JI5E 4USKA 4OOGC 3LPSA 4LFAE 4X62I 5IWAE 4P52A 5LL6R 4LFBI 2UXBI 1MU5A 1HR0E 1IBKI 4LF8E 3GONA 1EA6A 3ZZ0A 3J80C 4GKJI 1XNRI 1Z0WA 2UXCI 4DUYE 1ZBTA 2HK3A 1KVKA 4DV3E 4JYAE 3JAMQ 2NUEA 4R1FA 1ZXNA 4WUBA 4JI4E 4DV5I 4JI7E 4DPUA 1XMQE 4LFCI 4DKKA 4LF6I 2L33A 1ZM3A 4JI8I 3ADIA 4USMA 4X65E 2ZM6I 3B8HA 2HFUA 1YYKA 2DEIA 3F0NA 3PYDA 2V2QA 5GMEA 2GS8A 1N33I 2RSMA 5FLXC 2L3JA 2KHXA 4OX9E 4UTGA 2V34A 1XMOI 2LBSB 1T4LB 1H7SA 1HNZE 4DPWA 4LF7E 2Q2EB 1FKAE 3QT8A 4DUZI 1Z0VA 1H7UA 4RPFA 1N34E 1WHNA 3J7Yp 4YY3I 1J5EI 2AJ4A 2V2ZA 3QT7A 4LFAI 2NUFA 2CPNA 1FJGE 3T1HI 3C4BA 3K1JA 4JI3I 2UUBE 5CFFE 4DR6E 2X7IA 1HR0I 2HFSA 2A2DA 1NHIA 4HACA 3Q1QA 3ZZTA 1Z5CA 2ZBKB 4MYUA 2NPFA 4DR7E 4NXME 1DARA 4B3TI 4WUCA 1XMQI 4DV6E 1PKPA 1N36E 4FW9A 2EZ6A 2LUQA 4GKKE 4FWHA 1ZM9A 2DIXA 5LMNE 1Z5BA 2UU9I 4DR2E 3PYGA 1IBLE 2JY9A 5IT9Q 1HNWE 4DV2I 1K47A 4DPTA 4B3ME 1Z5AA 5FLXQ 3WU5A 1Z59A 5A2QC 4ED4A 1XNQI 4M30A 1ZXMA 1X47A 4OX9I 4P7AA 2YT4A 1T4OA 2HKEA 3LLHA 1WUUA 1I94I 1MX0A 4JI1I 4URLA 4M2ZA 4B3SE 3V2UC 1N0VC 4LF7I 3OTOE 2BM0A 3PYEA 3VYYA 4ZVIA 1H73A
chains in the Genus database with same CATH superfamily
2DEJA 4M0VA 4FW6A 4IZKA 4DV4I 2BA1G 3ZKBA 1QZRA 1N34I 2FGGA 1T4NA 3C6MA 4LF5E 2VQFE 4HXZA 4M1KA 4DV1E 3H4LA 1IBME 3M99B 4P78A 2C38A 3L7ZA 4DU8A 2EQ1A 1N0UA 4DV7I 2LT7A 2YTEA 4X8WA 5BR8I 1X48A 3BGHA 2BR2A 4JV5I 4JI2E 4HYMA 5C0XE 2EPKX 3HULA 2EPPA 2JEAA 2WW4A 4EMDA 3B78A 2VE7C 1FJGI 2EOZA 4F6NA 1A1GA 2EPOA 4KHPE 2V8PA 3J81Q 2UUCI 2VQEE 2UXDE 4JI6E 1HNXE 1SR9A 2UUAE 1YHCA 3P1XA 4U3DA 1SFEA 2EOHA 2HHHI 3ZM7A 2F4VI 3ZZUA 1WXRA 4AQYI 4DXLA 2JP9A 4Z7YA 5A6JA 1PDAA 3ZOQB 4LF9I 4NXNE 3K6QA 2B7TA 2PNLA 2EN4A 2EWLA 2YTOA 3ADJA 4RH8A 5AE2A 4LF4E 2A2CA 2GQ0A 4OO1D 1O0WA 2E72A 2J7KA 3V5RA 4BC9A 4KZSA 1OYSA 2ZITA 1N36I 2LJUA 1Z0TA 2EN7A 1DI2A 4JI0E 2EOQA 4IFDF 2EN1A 5AASA 4WX9A 5LMUE 1BB8A 4GQUA 3WU4A 4GKKI 2MC5A 2DGCA 2IHR1 2L2NA 2WNRA 2K4VA 4DR4E 2EQ0A 1B69A 3M7ND 2EPLX 4UT4A 1IBLI 1MEYC 2YTIA 1YPNA 5L3JA 1HNWI 1IMUA 2L2KB 4M9VC 2EN8A 4B3RI 4R2CA 2VF3A 5A2QQ 1R6MA 5JEAC 3AUZA 4DU7A 2FTXB 3HQ1A 2V88A 2M4IA 1FNMA 1FI4A 3Q6NA 1YZ9A 4OO1E 2EN2A 3H1CA 5AC4A 4JI5I 1WRJA 1ZBQA 2DLQA 4R2AA 4MU1A 5K36B 2WBUA 5JEAA 2Z5CA 5C0XF 4LFBE 2UXBE 2R3VA 5IWAI 5KL3A 3J80Q 5DRPA 1N32E 2EOJA 4GKJE 2JEBA 2PO2A 2EM5A 4K0KE 3OMLA 3K17A 2DB2A 4R2EA 3T1YE 4PRXA 2UXCE 1UDSA 1A6FA 2EE8A 2DMYA 3EQ1A 2LTSA 4BBYA 2Z5EA 4LF8I 2EMKA 4IS1C 2HK2A 3B4TA 4RHBB 4MU4A 2YU5A 4WUDA 4DUYI 5DNLA 4DV5E 5ADZA 4DV3I 4JYAI 5DRQA 2ODRC 2R76A 3ZKDA 3JAMC 5A6BA 1B63A 1KJKA 4I3HA 2VQFI 3EPJA 4JI4I 3KZZA 4WPYA 3BF2A 4JI7I 1KTVA 2YTQA 2Z5BA 2PO1A 1EI1A 2C39B 4IZJB 4JI8E 4L5NC 4JI2I 1B62A 3U1YA 1YSAC 5DROA 4R2RA 3IWBA 1HK7A 2L2MA 1NHHA 1UDOA 2A25A 2ZM6E 1E3PA 4BA2B 2N3HA 2L8TA 2YSOA 1TF3A 4ZYGA 1IQOA 1UEKA 2C37B 2UXDI 2M1SA 1KIJA 1Z0GA 4X65I 1IQSA 3NZKA 4X9JA 3MHSC 3LNUA 2NUGA 1X6EA 1Z0CA 1A1KA 3AV0A 2EOFA 3U1KA 4YHHE 4WSPA 1H72C 2O3ZA 1N33E 2GPIA 1U2RA 4BS9A 2MDGA 2DLKA 1A1JA 3ADGA 2RS6A 3VYXA 2BA1D 3J7AM 2YTDA 2LV2A 2R1FA 2L92A 1A1IA 2MDRA 2NN6D 1OJ4A 4MLQA 4L8NA 1XMOE 2EPXA 2LJPA 4MU0A 1Y6ZA 1H74A 3HKMA 2JXPA 3DD6A 1UN6B 4JI0I 5LLQA 2EN6A 1S16A 2H36X 2HKJA 3QT6A 2YTFA 4DUZE 1ZM4A 2F1DA 4DR4I 3KRNA 1HNZI 4QNKA 4X64E 3H09A 3JU0A 2IERA 2EM6A 3M85G 4TUGA 1Y5YA 2I13A 4R2PA 2V87A 4YY3E 2ENCA 2EMBA 1J5EE 3PS2A 2MKNA 4PRVA 4IFDB 3HTXA 3Q6MA 4DV0E 2V2VA 2KOUA 2B7VA 2NN6E 1RR9A 1YUJA 3T1HE 3PYFA 2LMZA 1PJSA 2HGHA 4JI3E 2ELYA 1S4EA 2BM1A 1Z0BA 2PO0B 4HEIA 5A69A 2EM2A 2CGEA 3LTOA 3UHMA 4AM3A 4LCGA 2GLIA 1N32I 4LU9A 2BA0D 1QU6A 2UUBI 4K0KI 2JR1A 2R42A 3T1YI 2ADRA 2X36A 4DR6I 4XTJA 2EL6A 2JPAA 2F8BA 3WU3A 5FWKA 2WZOA 1D6TA 3GMEA 2E5LE 2K7IA 4B3TE 3RMPA 5C0XB 1T38A 2EMCA 1XHKA 3EPKA 4OZEA 4BHBA 2LO3A 1NHJA 4DR7I 4NXMI 1AH5A 2CG9A 1DGCA 4N4RB 5K36C 4HY1A 4FWGA 4R2DA 2YTGA 2EM7A 4DR3E 4DV6I 1STUA 4O4KA 4P7DA 2HJJA 2N3GA 5AC5A 5AE1A 2EMXA 4DR5E 2UU9E 2WP8B 2PNZB 1R6LA 1Y4UA 1GQEA 2BA0G 4X66E 1WHQA 5GMDA 5LMNI 5K36A 4DV2E 4BMJA 2KONA 4DR2I 3HPZA 1YYWA 2PNMA 1G2DC 2EPMX 4FW7A 5IV8B 5IT9C 2VRDA 1A1HA 1USUA 3C4TA 4YHHI 4B3MI 2G7HA 2JE6B 2EPAA 3QT5A 2RS7A 1UBDC 5DNXA 4DR1E 4QNJA 3VHTB 2EL4A 3ECRA 4BHCA 1XNQE 2V8QB 4ISAA 1BKNA 2DSYA 4R03A 4LTYA 4X62E 4DPYA 2NN6F 1I94E 2LRSA 5JEAD 4JI1E 1E3HA 4FN5A 4J8ZA 2L3CA 3HJCA 2EM3A 2EMAA 2CT1A 1F2IG 1Y4SA 1MG7A 1DQ3A 1IBKE 4J3DA 3CWVA 4AIMA 3C6KA 1A1FA 4IZJA 4FW4A 4F9BB 2YTPA 1Z0EA 1XNRE 4B3SI 3K85A 1EH8A 4JG4A 1ZM2A 3LMLA 4WYQB 4DV4E 4X64I 5DRRA 3OTOI 2LTRA 1X49A 4OO1B 3B82A 5AE3A 4BA2A 3WU6A 1YH8A 2C37A 5A6BD 4LCHA 4DV7E 2OI2A 4LF5I 5BR8E 4JV5E 4LFCE 4DV1I 4LF6E 1IBMI 4DV0I 1GTKA 1FWKA 3F6HA 2EMWA 2EPZA 2GHFA 5KL5A 4MYTA 2CZ9A 1BBGA 2ODRD 3P3GA 2EFGA 5JEAE 4HTGA 2UUCE 1PVGA 4ZYHA 4TUIA 2EOYA 1NZ0A 1EH7A 2YTNA 4BA1B 2LCEA 2V86A 3THNA 4ZYEA 2HHHE 4DPXA 4KHPI 3J81C 2F4VE 1ELOA 2EOMA 4DMIA 2VQEI 4JI6I 2EOEA 4NZVA 4FWDA 1KYQA 4AQYE 1PIEA 2LJHA 2LUPB 1HNXI 2UUAI 4FW3A 5EKWA 2EOOA 4LF9E 2B3TB 2JWOA 4PU9A 3M85D 1N3GA 3QG5C 1KKHA 1RREA 5IXMB 2E5LI 2V83A 4IFDC 3J7AG 2WBTA 1EKZA 4IS9A 1YYOA 2JOXA 2YPNA 4NXNI 1X6FA 2RTXA 2E1MA 1FWLA 4Z7CA 4LF4I 4F54A 5KL6A 4HACB 3ADLA 4DR3I 4WXDA 1T39A 4IFDA 2MC6A 3FIGA 3BBGA 1VISA 4DR5I 5TSEA 4ZYDA 3D4JA 5LMUI 5K36F 2EM8A 1JK2A 3M6AA 4X66I 1UHZA 2EM9A 2NA2A 2CSHA 4BC7A 1J26A 2XEXA 4B3RE 1RQ0A 2PO0A 5ELWA 2RSIA 4U3BA 1X5WA 3P06A 1UDQA 2O1UA 2M9AA 4WFTA 3PS1A 4KQVA 2JVAA 4KWYA 1VI7A 1X6HA 2YZTA 5C0XC 1UILA 2BV3A 2E1RA 1RC7A 4DR1I 4JI5E 4USKA 4OOGC 1Z1BA 2EMYA 3F6GA 3EPLA 3LPSA 2Q8UA 4LFAE 3TQMA 2D9HA 4X62I 2O1WA 5IWAE 5C0XA 1GZ6A 4P52A 1MGTA 5JEAF 5LL6R 2EORA 2EOIA 4LFBI 2UXBI 1A1LA 2IOQA 2CVEA 4O5GA 1HR0E 3IWCA 4LF8E 1EA6A 1MU5A 2EQ3A 3J80C 3GONA 4F2JC 3ZZ0A 1IBKI 4GKJI 1XNRI 1Z0WA 2UXCI 2WP8A 4DUYE 2PNZA 3P3CA 1ZBTA 2HK3A 1KVKA 3L00A 4DV3E 4JYAE 4Q28A 3JAMQ 2NUEA 2EM0A 2NN6B 2V85A 4R1FA 4F9CB 2RQLA 1ZXNA 2EM4A 1Y60A 4NBQA 4WUBA 2HC5A 4JI4E 2EMIA 2EL5A 2YRHA 4DV5I 4JI7E 1LLMC 4DPUA 2MKDA 1XMQE 3IWDA 2PRTA 4LFCI 3GCMA 4DKKA 4LF6I 2JE6A 2L33A 1ZM3A 2M7QA 2FV4B 3P3EA 3MHHC 1USVA 1ZU1A 2EOXA 2YU8A 4FW5A 4JI8I 1UDNA 3ADIA 4USMA 3BIDA 4FK5C 5A6AA 4IZKB 3GLLA 4LPFA 2YRMA 2N8XA 2EMGA 5K36D 4X65E 4AIDA 2ZM6I 1P47A 4LCFA 2YTJA 2HFUA 2V89A 3B8HA 1YYKA 2DEIA 4OO1C 4F6MA 4I8OA 4GEQB 2CTDA 2C38B 2DRPA 2GO3A 2O1TA 3F0NA 1ZR9A 3L7ZB 3PYDA 2LE2A 4IJDA 3HPSA 3PS3A 2V2QA 1RMDA 2BR2B 2LVHA 5GMEA 4BCAA 2RPCA 2GS8A 2NABA 1N33I 2JEAB 2RSMA 4LOMA 3P76A 5FLXC 2I9IA 2L3JA 4O43A 2KHXA 4OX9E 2ELZA 4OO1A 4UTGA 1BBOA 2V34A 1G2FC 4R8OA 2EJ4A 4O24A 1JK1A 4GZNC 2JOBA 1XMOI 2LBSB 1YFHA 2EP3A 1T4LB 2EPUA 1H7SA 2YRKA 1HNZE 4IZJD 4DPWA 4LF7E 2Q2EB 1FKAE 5K36E 2C39A 1PJQA 2WCC3 1YUIA 3QT8A 4DUZI 2O1VA 3KZYA 2YWQA 1Z0VA 1H7UA 1NEIA 4RPFA 2BB8A 4BA1A 1ZAAC 1N34E 1WHNA 3J7Yp 4YY3I 1J5EI 2AJ4A 1OYRA 5F3WA 2J65A 2WNRB 4MQYA 2V2ZA 3QT7A 4LFAI 2NUFA 5T6JA 5A6KA 2CPNA 1FJGE 1L4SA 2AE8A 3C4BA 3T1HI 2WBSA 2EMHA 3K1JA 2ENHA 4JI3I 4MU3A 2UUBE 3M7NG 5CFFE 4DR6E 2X7IA 3HXLA 1HR0I 1XXEA 2HFSA 2A2DA 1NHIA 4HACA 1EH6A 4Q35B 5EL9A 3Q1QA 3ZZTA 2YSPA 1TN9A 2GO4A 2ENAA 1X3CA 1Z5CA 4N3OA 2ZBKB 4MYUA 2NPFA 1WJPA 4F9AB 1RHYA 3THOB 3VK6A 1PJTA 3JTZA 4R2SA 4DR7E 5JEAB 4NXME 2Z5CB 4NHRA 2DMIA 1DARA 1P42A 4B3TI 4WUCA 1XMQI 4DV6E 2JEBB 2PO2B 2JYAA 1PKPA 1N36E 4FW9A 3UK3C 3KWRA 2EZ6A 2J7JA 3DF6A 2LUQA 4IFDD 4GKKE 1OYPA 4FWHA 4OKGA 1ZM9A 2DIXA 5LMNE 2EMLA 3MSWA 1Z5BA 2IOPA 2UU9I 2EOSA 4DR2E 3PYGA 1QNTA 1IBLE 2JY9A 3DJWA 5IT9Q 1HNWE 2EMFA 2EMZA 2JT2A 4DV2I 1K47A 1AAYA 4MDTA 4B3ME 2NN6C 3CDIA 4WSGA 1Z5AA 4DPTA 5FLXQ 2Z5BB 3WU5A 2PO1B 5KL4A 2B9DA 1Z59A 4OO1F 3CDJA 5A2QC 2EN3A 4ED4A 1XNQI 4M30A 2EPRA 2EPNA 2NN6A 1ZXMA 1X47A 4OX9I 4P7AA 2VF1A 1T4OA 2YT4A 5C0XD 2HKEA 3LLHA 1WUUA 2BBGA 1I94I 4IFDE 1MX0A 1TF6A 5KL2A 5KL7A 4JI1I 4URLA 2VESA 2EPCA 4R2QA 4M2ZA 4B3SE 3V2UC 1N0VC 1NCSA 4MLVA 3PRYA 2IESA 4LF7I 3OTOE 2BM0A 3PYEA 5DNYA 3VYYA 4ZVIA 2L6MA 4WXCA 3EPHA 1H73A
chains in the Genus database with same CATH topology
2DEJA 4M0VA 4IZKA 4DV4I 3ZKBA 1QZRA 1N34I 2FGGA 1T4NA 4LF5E 2VQFE 4HXZA 4M1KA 4DV1E 3H4LA 1IBME 4P78A 4DU8A 1N0UA 4DV7I 4X8WA 5BR8I 1X48A 4JV5I 4JI2E 4HYMA 3HULA 2WW4A 4EMDA 3B78A 2VE7C 1FJGI 4KHPE 2V8PA 3J81Q 2UUCI 2VQEE 2UXDE 4JI6E 1HNXE 1SR9A 2UUAE 3P1XA 2HHHI 3ZM7A 2F4VI 3ZZUA 1WXRA 4AQYI 4DXLA 4Z7YA 3ZOQB 4LF9I 4NXNE 3K6QA 2B7TA 2PNLA 2EWLA 3ADJA 5AE2A 2A2CA 2GQ0A 4LF4E 1O0WA 2J7KA 3V5RA 4BC9A 4KZSA 2ZITA 1N36I 1Z0TA 1DI2A 4JI0E 5AASA 5LMUE 4GKKI 3WU4A 2MC5A 2IHR1 2L2NA 2K4VA 4DR4E 4UT4A 1IBLI 5L3JA 1HNWI 2L2KB 4B3RI 2VF3A 5A2QQ 3AUZA 4DU7A 2FTXB 3HQ1A 2V88A 2M4IA 1FNMA 1FI4A 3Q6NA 1YZ9A 4JI5I 1ZBQA 2Z5CA 4LFBE 2UXBE 2R3VA 5IWAI 3J80Q 1N32E 4GKJE 3K17A 4K0KE 3OMLA 2DB2A 3T1YE 4PRXA 2UXCE 2Z5EA 1A6FA 2DMYA 4BBYA 2LTSA 4LF8I 2HK2A 4WUDA 4DUYI 4DV5E 5ADZA 4DV3I 4JYAI 3ZKDA 2ODRC 3JAMC 1B63A 4I3HA 2VQFI 4JI4I 4WPYA 4JI7I 1KTVA 2Z5BA 1EI1A 4IZJB 4JI8E 4L5NC 4JI2I 1B62A 1HK7A 3IWBA 1NHHA 2L2MA 2ZM6E 2N3HA 2L8TA 1UEKA 2UXDI 2M1SA 1KIJA 1Z0GA 4X65I 3LNUA 2NUGA 1Z0CA 3AV0A 4YHHE 4WSPA 1H72C 1N33E 1U2RA 4BS9A 3ADGA 2RS6A 3VYXA 3J7AM 2L92A 2MDRA 1OJ4A 4L8NA 1XMOE 2LJPA 1Y6ZA 1H74A 4JI0I 1S16A 2H36X 2HKJA 3QT6A 4DUZE 1ZM4A 4DR4I 1HNZI 4X64E 3H09A 3JU0A 4TUGA 2V87A 4YY3E 1J5EE 4PRVA 3HTXA 3Q6MA 4DV0E 2V2VA 2KOUA 2B7VA 1RR9A 3T1HE 3PYFA 2LMZA 4JI3E 1S4EA 2BM1A 1Z0BA 2CGEA 3LTOA 1N32I 4LU9A 4K0KI 1QU6A 2UUBI 2JR1A 2R42A 3T1YI 2X36A 4DR6I 4XTJA 2F8BA 3WU3A 5FWKA 2WZOA 1D6TA 2E5LE 4B3TE 3RMPA 1XHKA 4DR7I 1NHJA 4NXMI 2CG9A 4HY1A 4FWGA 4DR3E 4DV6I 1STUA 4P7DA 5AE1A 2N3GA 2UU9E 4DR5E 1Y4UA 1GQEA 4X66E 1WHQA 5GMDA 5LMNI 4DV2E 4BMJA 2KONA 4DR2I 3HPZA 1YYWA 2PNMA 5IT9C 1USUA 3C4TA 4YHHI 4B3MI 2G7HA 3QT5A 2RS7A 4DR1E 1XNQE 2V8QB 1BKNA 2DSYA 4R03A 4LTYA 4X62E 4DPYA 1I94E 2LRSA 4JI1E 4FN5A 4J8ZA 2L3CA 3HJCA 1Y4SA 1MG7A 1DQ3A 1IBKE 3CWVA 4IZJA 4F9BB 1Z0EA 1XNRE 4B3SI 3K85A 4JG4A 1ZM2A 3LMLA 4WYQB 4DV4E 4X64I 3OTOI 2LTRA 1X49A 3B82A 5AE3A 3WU6A 4DV7E 2OI2A 4LF5I 5BR8E 4JV5E 4LFCE 4DV1I 4LF6E 1IBMI 4DV0I 1FWKA 3F6HA 4MYTA 2CZ9A 2ODRD 2EFGA 2UUCE 1PVGA 4TUIA 1NZ0A 2V86A 4KHPI 4DPXA 2HHHE 3J81C 2F4VE 1ELOA 2VQEI 4DMIA 4JI6I 4FWDA 1HNXI 4AQYE 1PIEA 2LJHA 2LUPB 2UUAI 4LF9E 2B3TB 2JWOA 4PU9A 1KKHA 1RREA 2E5LI 2V83A 3J7AG 1EKZA 1YYOA 2JOXA 4NXNI 2RTXA 2E1MA 1FWLA 4Z7CA 4LF4I 4F54A 4HACB 3ADLA 4DR3I 2MC6A 3FIGA 1VISA 4DR5I 3D4JA 5LMUI 3M6AA 4X66I 1UHZA 2NA2A 1J26A 4BC7A 2XEXA 4B3RE 1RQ0A 3P06A 2O1UA 4KQVA 4WFTA 2JVAA 2YZTA 1UILA 2BV3A 2E1RA 1RC7A 4DR1I 4JI5E 4USKA 4OOGC 3LPSA 3F6GA 4LFAE 4X62I 2O1WA 5IWAE 1GZ6A 4P52A 5LL6R 4LFBI 2UXBI 2IOQA 1MU5A 1HR0E 3IWCA 4LF8E 1EA6A 3GONA 3ZZ0A 3J80C 1IBKI 4GKJI 1XNRI 1Z0WA 2UXCI 4DUYE 1ZBTA 2HK3A 1KVKA 4DV3E 4JYAE 4Q28A 3JAMQ 2NUEA 2V85A 4R1FA 4F9CB 1ZXNA 4WUBA 4JI4E 4DV5I 4JI7E 4DPUA 1XMQE 3IWDA 4LFCI 4DKKA 4LF6I 2L33A 1ZM3A 2M7QA 2FV4B 1USVA 4JI8I 3ADIA 4USMA 4IZKB 4X65E 2ZM6I 3B8HA 2HFUA 2V89A 1YYKA 2DEIA 4I8OA 4GEQB 2O1TA 3F0NA 3PYDA 2LE2A 3HPSA 2V2QA 5GMEA 4BCAA 2GS8A 1N33I 2RSMA 5FLXC 2L3JA 2KHXA 4OX9E 4UTGA 2V34A 4R8OA 2JOBA 1XMOI 2LBSB 1T4LB 4IZJD 1H7SA 1HNZE 4DPWA 4LF7E 2Q2EB 1FKAE 3QT8A 4DUZI 2O1VA 1Z0VA 1H7UA 4RPFA 1N34E 1WHNA 3J7Yp 4YY3I 1J5EI 2AJ4A 5F3WA 2V2ZA 3QT7A 4LFAI 2NUFA 5T6JA 2CPNA 1FJGE 3T1HI 3C4BA 3K1JA 4JI3I 2UUBE 5CFFE 4DR6E 2X7IA 3HXLA 1HR0I 2HFSA 2A2DA 1NHIA 4HACA 3Q1QA 3ZZTA 1Z5CA 4N3OA 2ZBKB 4MYUA 2NPFA 4F9AB 3VK6A 3JTZA 4DR7E 4NXME 2Z5CB 1DARA 4B3TI 4WUCA 1XMQI 4DV6E 1PKPA 1N36E 4FW9A 3KWRA 2EZ6A 3DF6A 2LUQA 4GKKE 4FWHA 1ZM9A 2DIXA 5LMNE 3MSWA 1Z5BA 2IOPA 2UU9I 4DR2E 3PYGA 1IBLE 2JY9A 3DJWA 5IT9Q 1HNWE 4DV2I 1K47A 4DPTA 4B3ME 1Z5AA 5FLXQ 2Z5BB 3WU5A 2B9DA 1Z59A 5A2QC 4ED4A 1XNQI 4M30A 1ZXMA 1X47A 4OX9I 4P7AA 2VF1A 1T4OA 2YT4A 2HKEA 3LLHA 1WUUA 1I94I 1MX0A 4JI1I 4URLA 4M2ZA 4B3SE 3V2UC 1N0VC 3PRYA 4LF7I 3OTOE 2BM0A 3PYEA 5DNYA 3VYYA 4ZVIA 2L6MA 1H73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEJ A;  4DV4 I;  3ZKB A;  1QZR A;  1N34 I;  1T4N A;  4LF5 E;  2VQF E;  4HXZ A;  4M1K A;  4DV1 E;  3H4L A;  1IBM E;  4DU8 A;  1N0U A;  4DV7 I;  4X8W A;  5BR8 I;  1X48 A;  4JV5 I;  4JI2 E;  4HYM A;  3HUL A;  2WW4 A;  4EMD A;  3B78 A;  1FJG I;  4KHP E;  2V8P A;  3J81 Q;  2UUC I;  2VQE E;  2UXD E;  4JI6 E;  1HNX E;  2UUA E;  3P1X A;  2HHH I;  3ZM7 A;  2F4V I;  3ZZU A;  4AQY I;  4DXL A;  4Z7Y A;  4LF9 I;  4NXN E;  2B7T A;  3ADJ A;  2A2C A;  4LF4 E;  1O0W A;  2J7K A;  3V5R A;  2ZIT A;  1N36 I;  1Z0T A;  1DI2 A;  4JI0 E;  5LMU E;  4GKK I;  3WU4 A;  2IHR 1;  2L2N A;  4DR4 E;  4UT4 A;  1IBL I;  5L3J A;  1HNW I;  2L2K B;  4B3R I;  2VF3 A;  5A2Q Q;  4DU7 A;  1FNM A;  1FI4 A;  1YZ9 A;  4JI5 I;  4LFB E;  2UXB E;  2R3V A;  5IWA I;  3J80 Q;  1N32 E;  4GKJ E;  3K17 A;  4K0K E;  2DB2 A;  3T1Y E;  4PRX A;  2UXC E;  1A6F A;  2DMY A;  2LTS A;  4LF8 I;  2HK2 A;  4WUD A;  4DUY I;  4DV5 E;  4DV3 I;  4JYA I;  3ZKD A;  3JAM C;  1B63 A;  4I3H A;  2VQF I;  4JI4 I;  4JI7 I;  1KTV A;  1EI1 A;  4JI8 E;  4JI2 I;  1B62 A;  1NHH A;  2L2M A;  2ZM6 E;  2N3H A;  1UEK A;  2UXD I;  1KIJ A;  1Z0G A;  4X65 I;  3LNU A;  2NUG A;  1Z0C A;  4YHH E;  1H72 C;  1N33 E;  1U2R A;  3ADG A;  2RS6 A;  3VYX A;  3J7A M;  2MDR A;  1OJ4 A;  1XMO E;  2LJP A;  1H74 A;  4JI0 I;  1S16 A;  2HKJ A;  3QT6 A;  4DUZ E;  1ZM4 A;  4DR4 I;  1HNZ I;  4X64 E;  4YY3 E;  1J5E E;  4PRV A;  3HTX A;  4DV0 E;  2V2V A;  2B7V A;  1RR9 A;  3T1H E;  3PYF A;  4JI3 E;  1S4E A;  2BM1 A;  1Z0B A;  3LTO A;  1N32 I;  4K0K I;  1QU6 A;  2UUB I;  2R42 A;  3T1Y I;  2X36 A;  4DR6 I;  4XTJ A;  3WU3 A;  1D6T A;  2E5L E;  4B3T E;  1XHK A;  4DR7 I;  1NHJ A;  4NXM I;  4HY1 A;  4FWG A;  4DR3 E;  4DV6 I;  1STU A;  2N3G A;  2UU9 E;  4DR5 E;  1GQE A;  4X66 E;  1WHQ A;  5GMD A;  5LMN I;  4DV2 E;  4DR2 I;  1YYW A;  5IT9 C;  3C4T A;  4YHH I;  4B3M I;  3QT5 A;  2RS7 A;  4DR1 E;  1XNQ E;  1BKN A;  4X62 E;  4DPY A;  1I94 E;  2LRS A;  4JI1 E;  4FN5 A;  2L3C A;  1MG7 A;  1IBK E;  3CWV A;  1Z0E A;  1XNR E;  4B3S I;  4JG4 A;  1ZM2 A;  4WYQ B;  4DV4 E;  4X64 I;  3OTO I;  2LTR A;  1X49 A;  3B82 A;  3WU6 A;  4DV7 E;  2OI2 A;  4LF5 I;  5BR8 E;  4JV5 E;  4LFC E;  4DV1 I;  4LF6 E;  1IBM I;  4DV0 I;  1FWK A;  4MYT A;  2CZ9 A;  2EFG A;  2UUC E;  1PVG A;  1NZ0 A;  4KHP I;  4DPX A;  2HHH E;  2F4V E;  1ELO A;  3J81 C;  2VQE I;  4JI6 I;  4FWD A;  1HNX I;  4AQY E;  1PIE A;  2LJH A;  2LUP B;  2UUA I;  4LF9 E;  2B3T B;  4PU9 A;  1KKH A;  1RRE A;  2E5L I;  3J7A G;  1EKZ A;  1YYO A;  4NXN I;  2RTX A;  1FWL A;  4Z7C A;  4LF4 I;  4HAC B;  3ADL A;  4DR3 I;  1VIS A;  4DR5 I;  3D4J A;  5LMU I;  3M6A A;  4X66 I;  1UHZ A;  2NA2 A;  1J26 A;  2XEX A;  4B3R E;  1RQ0 A;  4KQV A;  4WFT A;  2JVA A;  1UIL A;  2BV3 A;  2E1R A;  1RC7 A;  4DR1 I;  4JI5 E;  4USK A;  4OOG C;  3LPS A;  4LFA E;  4X62 I;  5IWA E;  4P52 A;  5LL6 R;  4LFB I;  2UXB I;  1MU5 A;  1HR0 E;  1IBK I;  4LF8 E;  3GON A;  1EA6 A;  3ZZ0 A;  3J80 C;  4GKJ I;  1XNR I;  1Z0W A;  2UXC I;  4DUY E;  1ZBT A;  2HK3 A;  1KVK A;  4DV3 E;  4JYA E;  3JAM Q;  2NUE A;  4R1F A;  1ZXN A;  4WUB A;  4JI4 E;  4DV5 I;  4JI7 E;  4DPU A;  1XMQ E;  4LFC I;  4DKK A;  4LF6 I;  2L33 A;  1ZM3 A;  4JI8 I;  3ADI A;  4USM A;  4X65 E;  2ZM6 I;  3B8H A;  2HFU A;  1YYK A;  2DEI A;  3F0N A;  3PYD A;  2V2Q A;  5GME A;  2GS8 A;  1N33 I;  2RSM A;  5FLX C;  2L3J A;  2KHX A;  4OX9 E;  4UTG A;  2V34 A;  1XMO I;  2LBS B;  1T4L B;  1H7S A;  1HNZ E;  4DPW A;  4LF7 E;  2Q2E B;  1FKA E;  3QT8 A;  4DUZ I;  1Z0V A;  1H7U A;  4RPF A;  1N34 E;  1WHN A;  3J7Y p;  4YY3 I;  1J5E I;  2AJ4 A;  2V2Z A;  3QT7 A;  4LFA I;  2NUF A;  2CPN A;  1FJG E;  3T1H I;  3C4B A;  3K1J A;  4JI3 I;  2UUB E;  5CFF E;  4DR6 E;  2X7I A;  1HR0 I;  2HFS A;  2A2D A;  1NHI A;  4HAC A;  3Q1Q A;  3ZZT A;  1Z5C A;  2ZBK B;  4MYU A;  2NPF A;  4DR7 E;  4NXM E;  1DAR A;  4B3T I;  4WUC A;  1XMQ I;  4DV6 E;  1PKP A;  1N36 E;  4FW9 A;  2EZ6 A;  2LUQ A;  4GKK E;  4FWH A;  1ZM9 A;  2DIX A;  5LMN E;  1Z5B A;  2UU9 I;  4DR2 E;  3PYG A;  1IBL E;  2JY9 A;  5IT9 Q;  1HNW E;  4DV2 I;  1K47 A;  4DPT A;  4B3M E;  1Z5A A;  5FLX Q;  3WU5 A;  1Z59 A;  5A2Q C;  4ED4 A;  1XNQ I;  4M30 A;  1ZXM A;  1X47 A;  4OX9 I;  4P7A A;  2YT4 A;  1T4O A;  2HKE A;  3LLH A;  1WUU A;  1I94 I;  1MX0 A;  4JI1 I;  4URL A;  4M2Z A;  4B3S E;  3V2U C;  1N0V C;  4LF7 I;  3OTO E;  2BM0 A;  3PYE A;  3VYY A;  4ZVI A;  1H73 A; 
#chains in the Genus database with same CATH topology
 2DEJ A;  4M0V A;  4FW6 A;  4IZK A;  4DV4 I;  2BA1 G;  3ZKB A;  1QZR A;  1N34 I;  2FGG A;  1T4N A;  3C6M A;  4LF5 E;  2VQF E;  4HXZ A;  4M1K A;  4DV1 E;  3H4L A;  1IBM E;  3M99 B;  4P78 A;  2C38 A;  3L7Z A;  4DU8 A;  2EQ1 A;  1N0U A;  4DV7 I;  2LT7 A;  2YTE A;  4X8W A;  5BR8 I;  1X48 A;  3BGH A;  2BR2 A;  4JV5 I;  4JI2 E;  4HYM A;  5C0X E;  2EPK X;  3HUL A;  2EPP A;  2JEA A;  2WW4 A;  4EMD A;  3B78 A;  2VE7 C;  1FJG I;  2EOZ A;  4F6N A;  1A1G A;  2EPO A;  4KHP E;  2V8P A;  3J81 Q;  2UUC I;  2VQE E;  2UXD E;  4JI6 E;  1HNX E;  1SR9 A;  2UUA E;  1YHC A;  3P1X A;  4U3D A;  1SFE A;  2EOH A;  2HHH I;  3ZM7 A;  2F4V I;  3ZZU A;  1WXR A;  4AQY I;  4DXL A;  2JP9 A;  4Z7Y A;  5A6J A;  1PDA A;  3ZOQ B;  4LF9 I;  4NXN E;  3K6Q A;  2B7T A;  2PNL A;  2EN4 A;  2EWL A;  2YTO A;  3ADJ A;  4RH8 A;  5AE2 A;  4LF4 E;  2A2C A;  2GQ0 A;  4OO1 D;  1O0W A;  2E72 A;  2J7K A;  3V5R A;  4BC9 A;  4KZS A;  1OYS A;  2ZIT A;  1N36 I;  2LJU A;  1Z0T A;  2EN7 A;  1DI2 A;  4JI0 E;  2EOQ A;  4IFD F;  2EN1 A;  5AAS A;  4WX9 A;  5LMU E;  1BB8 A;  4GQU A;  3WU4 A;  4GKK I;  2MC5 A;  2DGC A;  2IHR 1;  2L2N A;  2WNR A;  2K4V A;  4DR4 E;  2EQ0 A;  1B69 A;  3M7N D;  2EPL X;  4UT4 A;  1IBL I;  1MEY C;  2YTI A;  1YPN A;  5L3J A;  1HNW I;  1IMU A;  2L2K B;  4M9V C;  2EN8 A;  4B3R I;  4R2C A;  2VF3 A;  5A2Q Q;  1R6M A;  5JEA C;  3AUZ A;  4DU7 A;  2FTX B;  3HQ1 A;  2V88 A;  2M4I A;  1FNM A;  1FI4 A;  3Q6N A;  1YZ9 A;  4OO1 E;  2EN2 A;  3H1C A;  5AC4 A;  4JI5 I;  1WRJ A;  1ZBQ A;  2DLQ A;  4R2A A;  4MU1 A;  5K36 B;  2WBU A;  5JEA A;  2Z5C A;  5C0X F;  4LFB E;  2UXB E;  2R3V A;  5IWA I;  5KL3 A;  3J80 Q;  5DRP A;  1N32 E;  2EOJ A;  4GKJ E;  2JEB A;  2PO2 A;  2EM5 A;  4K0K E;  3OML A;  3K17 A;  2DB2 A;  4R2E A;  3T1Y E;  4PRX A;  2UXC E;  1UDS A;  1A6F A;  2EE8 A;  2DMY A;  3EQ1 A;  2LTS A;  4BBY A;  2Z5E A;  4LF8 I;  2EMK A;  4IS1 C;  2HK2 A;  3B4T A;  4RHB B;  4MU4 A;  2YU5 A;  4WUD A;  4DUY I;  5DNL A;  4DV5 E;  5ADZ A;  4DV3 I;  4JYA I;  5DRQ A;  2ODR C;  2R76 A;  3ZKD A;  3JAM C;  5A6B A;  1B63 A;  1KJK A;  4I3H A;  2VQF I;  3EPJ A;  4JI4 I;  3KZZ A;  4WPY A;  3BF2 A;  4JI7 I;  1KTV A;  2YTQ A;  2Z5B A;  2PO1 A;  1EI1 A;  2C39 B;  4IZJ B;  4JI8 E;  4L5N C;  4JI2 I;  1B62 A;  3U1Y A;  1YSA C;  5DRO A;  4R2R A;  3IWB A;  1HK7 A;  2L2M A;  1NHH A;  1UDO A;  2A25 A;  2ZM6 E;  1E3P A;  4BA2 B;  2N3H A;  2L8T A;  2YSO A;  1TF3 A;  4ZYG A;  1IQO A;  1UEK A;  2C37 B;  2UXD I;  2M1S A;  1KIJ A;  1Z0G A;  4X65 I;  1IQS A;  3NZK A;  4X9J A;  3MHS C;  3LNU A;  2NUG A;  1X6E A;  1Z0C A;  1A1K A;  3AV0 A;  2EOF A;  3U1K A;  4YHH E;  4WSP A;  1H72 C;  2O3Z A;  1N33 E;  2GPI A;  1U2R A;  4BS9 A;  2MDG A;  2DLK A;  1A1J A;  3ADG A;  2RS6 A;  3VYX A;  2BA1 D;  3J7A M;  2YTD A;  2LV2 A;  2R1F A;  2L92 A;  1A1I A;  2MDR A;  2NN6 D;  1OJ4 A;  4MLQ A;  4L8N A;  1XMO E;  2EPX A;  2LJP A;  4MU0 A;  1Y6Z A;  1H74 A;  3HKM A;  2JXP A;  3DD6 A;  1UN6 B;  4JI0 I;  5LLQ A;  2EN6 A;  1S16 A;  2H36 X;  2HKJ A;  3QT6 A;  2YTF A;  4DUZ E;  1ZM4 A;  2F1D A;  4DR4 I;  3KRN A;  1HNZ I;  4QNK A;  4X64 E;  3H09 A;  3JU0 A;  2IER A;  2EM6 A;  3M85 G;  4TUG A;  1Y5Y A;  2I13 A;  4R2P A;  2V87 A;  4YY3 E;  2ENC A;  2EMB A;  1J5E E;  3PS2 A;  2MKN A;  4PRV A;  4IFD B;  3HTX A;  3Q6M A;  4DV0 E;  2V2V A;  2KOU A;  2B7V A;  2NN6 E;  1RR9 A;  1YUJ A;  3T1H E;  3PYF A;  2LMZ A;  1PJS A;  2HGH A;  4JI3 E;  2ELY A;  1S4E A;  2BM1 A;  1Z0B A;  2PO0 B;  4HEI A;  5A69 A;  2EM2 A;  2CGE A;  3LTO A;  3UHM A;  4AM3 A;  4LCG A;  2GLI A;  1N32 I;  4LU9 A;  2BA0 D;  1QU6 A;  2UUB I;  4K0K I;  2JR1 A;  2R42 A;  3T1Y I;  2ADR A;  2X36 A;  4DR6 I;  4XTJ A;  2EL6 A;  2JPA A;  2F8B A;  3WU3 A;  5FWK A;  2WZO A;  1D6T A;  3GME A;  2E5L E;  2K7I A;  4B3T E;  3RMP A;  5C0X B;  1T38 A;  2EMC A;  1XHK A;  3EPK A;  4OZE A;  4BHB A;  2LO3 A;  1NHJ A;  4DR7 I;  4NXM I;  1AH5 A;  2CG9 A;  1DGC A;  4N4R B;  5K36 C;  4HY1 A;  4FWG A;  4R2D A;  2YTG A;  2EM7 A;  4DR3 E;  4DV6 I;  1STU A;  4O4K A;  4P7D A;  2HJJ A;  2N3G A;  5AC5 A;  5AE1 A;  2EMX A;  4DR5 E;  2UU9 E;  2WP8 B;  2PNZ B;  1R6L A;  1Y4U A;  1GQE A;  2BA0 G;  4X66 E;  1WHQ A;  5GMD A;  5LMN I;  5K36 A;  4DV2 E;  4BMJ A;  2KON A;  4DR2 I;  3HPZ A;  1YYW A;  2PNM A;  1G2D C;  2EPM X;  4FW7 A;  5IV8 B;  5IT9 C;  2VRD A;  1A1H A;  1USU A;  3C4T A;  4YHH I;  4B3M I;  2G7H A;  2JE6 B;  2EPA A;  3QT5 A;  2RS7 A;  1UBD C;  5DNX A;  4DR1 E;  4QNJ A;  3VHT B;  2EL4 A;  3ECR A;  4BHC A;  1XNQ E;  2V8Q B;  4ISA A;  1BKN A;  2DSY A;  4R03 A;  4LTY A;  4X62 E;  4DPY A;  2NN6 F;  1I94 E;  2LRS A;  5JEA D;  4JI1 E;  1E3H A;  4FN5 A;  4J8Z A;  2L3C A;  3HJC A;  2EM3 A;  2EMA A;  2CT1 A;  1F2I G;  1Y4S A;  1MG7 A;  1DQ3 A;  1IBK E;  4J3D A;  3CWV A;  4AIM A;  3C6K A;  1A1F A;  4IZJ A;  4FW4 A;  4F9B B;  2YTP A;  1Z0E A;  1XNR E;  4B3S I;  3K85 A;  1EH8 A;  4JG4 A;  1ZM2 A;  3LML A;  4WYQ B;  4DV4 E;  4X64 I;  5DRR A;  3OTO I;  2LTR A;  1X49 A;  4OO1 B;  3B82 A;  5AE3 A;  4BA2 A;  3WU6 A;  1YH8 A;  2C37 A;  5A6B D;  4LCH A;  4DV7 E;  2OI2 A;  4LF5 I;  5BR8 E;  4JV5 E;  4LFC E;  4DV1 I;  4LF6 E;  1IBM I;  4DV0 I;  1GTK A;  1FWK A;  3F6H A;  2EMW A;  2EPZ A;  2GHF A;  5KL5 A;  4MYT A;  2CZ9 A;  1BBG A;  2ODR D;  3P3G A;  2EFG A;  5JEA E;  4HTG A;  2UUC E;  1PVG A;  4ZYH A;  4TUI A;  2EOY A;  1NZ0 A;  1EH7 A;  2YTN A;  4BA1 B;  2LCE A;  2V86 A;  3THN A;  4ZYE A;  2HHH E;  4DPX A;  4KHP I;  3J81 C;  2F4V E;  1ELO A;  2EOM A;  4DMI A;  2VQE I;  4JI6 I;  2EOE A;  4NZV A;  4FWD A;  1KYQ A;  4AQY E;  1PIE A;  2LJH A;  2LUP B;  1HNX I;  2UUA I;  4FW3 A;  5EKW A;  2EOO A;  4LF9 E;  2B3T B;  2JWO A;  4PU9 A;  3M85 D;  1N3G A;  3QG5 C;  1KKH A;  1RRE A;  5IXM B;  2E5L I;  2V83 A;  4IFD C;  3J7A G;  2WBT A;  1EKZ A;  4IS9 A;  1YYO A;  2JOX A;  2YPN A;  4NXN I;  1X6F A;  2RTX A;  2E1M A;  1FWL A;  4Z7C A;  4LF4 I;  4F54 A;  5KL6 A;  4HAC B;  3ADL A;  4DR3 I;  4WXD A;  1T39 A;  4IFD A;  2MC6 A;  3FIG A;  3BBG A;  1VIS A;  4DR5 I;  5TSE A;  4ZYD A;  3D4J A;  5LMU I;  5K36 F;  2EM8 A;  1JK2 A;  3M6A A;  4X66 I;  1UHZ A;  2EM9 A;  2NA2 A;  2CSH A;  4BC7 A;  1J26 A;  2XEX A;  4B3R E;  1RQ0 A;  2PO0 A;  5ELW A;  2RSI A;  4U3B A;  1X5W A;  3P06 A;  1UDQ A;  2O1U A;  2M9A A;  4WFT A;  3PS1 A;  4KQV A;  2JVA A;  4KWY A;  1VI7 A;  1X6H A;  2YZT A;  5C0X C;  1UIL A;  2BV3 A;  2E1R A;  1RC7 A;  4DR1 I;  4JI5 E;  4USK A;  4OOG C;  1Z1B A;  2EMY A;  3F6G A;  3EPL A;  3LPS A;  2Q8U A;  4LFA E;  3TQM A;  2D9H A;  4X62 I;  2O1W A;  5IWA E;  5C0X A;  1GZ6 A;  4P52 A;  1MGT A;  5JEA F;  5LL6 R;  2EOR A;  2EOI A;  4LFB I;  2UXB I;  1A1L A;  2IOQ A;  2CVE A;  4O5G A;  1HR0 E;  3IWC A;  4LF8 E;  1EA6 A;  1MU5 A;  2EQ3 A;  3J80 C;  3GON A;  4F2J C;  3ZZ0 A;  1IBK I;  4GKJ I;  1XNR I;  1Z0W A;  2UXC I;  2WP8 A;  4DUY E;  2PNZ A;  3P3C A;  1ZBT A;  2HK3 A;  1KVK A;  3L00 A;  4DV3 E;  4JYA E;  4Q28 A;  3JAM Q;  2NUE A;  2EM0 A;  2NN6 B;  2V85 A;  4R1F A;  4F9C B;  2RQL A;  1ZXN A;  2EM4 A;  1Y60 A;  4NBQ A;  4WUB A;  2HC5 A;  4JI4 E;  2EMI A;  2EL5 A;  2YRH A;  4DV5 I;  4JI7 E;  1LLM C;  4DPU A;  2MKD A;  1XMQ E;  3IWD A;  2PRT A;  4LFC I;  3GCM A;  4DKK A;  4LF6 I;  2JE6 A;  2L33 A;  1ZM3 A;  2M7Q A;  2FV4 B;  3P3E A;  3MHH C;  1USV A;  1ZU1 A;  2EOX A;  2YU8 A;  4FW5 A;  4JI8 I;  1UDN A;  3ADI A;  4USM A;  3BID A;  4FK5 C;  5A6A A;  4IZK B;  3GLL A;  4LPF A;  2YRM A;  2N8X A;  2EMG A;  5K36 D;  4X65 E;  4AID A;  2ZM6 I;  1P47 A;  4LCF A;  2YTJ A;  2HFU A;  2V89 A;  3B8H A;  1YYK A;  2DEI A;  4OO1 C;  4F6M A;  4I8O A;  4GEQ B;  2CTD A;  2C38 B;  2DRP A;  2GO3 A;  2O1T A;  3F0N A;  1ZR9 A;  3L7Z B;  3PYD A;  2LE2 A;  4IJD A;  3HPS A;  3PS3 A;  2V2Q A;  1RMD A;  2BR2 B;  2LVH A;  5GME A;  4BCA A;  2RPC A;  2GS8 A;  2NAB A;  1N33 I;  2JEA B;  2RSM A;  4LOM A;  3P76 A;  5FLX C;  2I9I A;  2L3J A;  4O43 A;  2KHX A;  4OX9 E;  2ELZ A;  4OO1 A;  4UTG A;  1BBO A;  2V34 A;  1G2F C;  4R8O A;  2EJ4 A;  4O24 A;  1JK1 A;  4GZN C;  2JOB A;  1XMO I;  2LBS B;  1YFH A;  2EP3 A;  1T4L B;  2EPU A;  1H7S A;  2YRK A;  1HNZ E;  4IZJ D;  4DPW A;  4LF7 E;  2Q2E B;  1FKA E;  5K36 E;  2C39 A;  1PJQ A;  2WCC 3;  1YUI A;  3QT8 A;  4DUZ I;  2O1V A;  3KZY A;  2YWQ A;  1Z0V A;  1H7U A;  1NEI A;  4RPF A;  2BB8 A;  4BA1 A;  1ZAA C;  1N34 E;  1WHN A;  3J7Y p;  4YY3 I;  1J5E I;  2AJ4 A;  1OYR A;  5F3W A;  2J65 A;  2WNR B;  4MQY A;  2V2Z A;  3QT7 A;  4LFA I;  2NUF A;  5T6J A;  5A6K A;  2CPN A;  1FJG E;  1L4S A;  2AE8 A;  3C4B A;  3T1H I;  2WBS A;  2EMH A;  3K1J A;  2ENH A;  4JI3 I;  4MU3 A;  2UUB E;  3M7N G;  5CFF E;  4DR6 E;  2X7I A;  3HXL A;  1HR0 I;  1XXE A;  2HFS A;  2A2D A;  1NHI A;  4HAC A;  1EH6 A;  4Q35 B;  5EL9 A;  3Q1Q A;  3ZZT A;  2YSP A;  1TN9 A;  2GO4 A;  2ENA A;  1X3C A;  1Z5C A;  4N3O A;  2ZBK B;  4MYU A;  2NPF A;  1WJP A;  4F9A B;  1RHY A;  3THO B;  3VK6 A;  1PJT A;  3JTZ A;  4R2S A;  4DR7 E;  5JEA B;  4NXM E;  2Z5C B;  4NHR A;  2DMI A;  1DAR A;  1P42 A;  4B3T I;  4WUC A;  1XMQ I;  4DV6 E;  2JEB B;  2PO2 B;  2JYA A;  1PKP A;  1N36 E;  4FW9 A;  3UK3 C;  3KWR A;  2EZ6 A;  2J7J A;  3DF6 A;  2LUQ A;  4IFD D;  4GKK E;  1OYP A;  4FWH A;  4OKG A;  1ZM9 A;  2DIX A;  5LMN E;  2EML A;  3MSW A;  1Z5B A;  2IOP A;  2UU9 I;  2EOS A;  4DR2 E;  3PYG A;  1QNT A;  1IBL E;  2JY9 A;  3DJW A;  5IT9 Q;  1HNW E;  2EMF A;  2EMZ A;  2JT2 A;  4DV2 I;  1K47 A;  1AAY A;  4MDT A;  4B3M E;  2NN6 C;  3CDI A;  4WSG A;  1Z5A A;  4DPT A;  5FLX Q;  2Z5B B;  3WU5 A;  2PO1 B;  5KL4 A;  2B9D A;  1Z59 A;  4OO1 F;  3CDJ A;  5A2Q C;  2EN3 A;  4ED4 A;  1XNQ I;  4M30 A;  2EPR A;  2EPN A;  2NN6 A;  1ZXM A;  1X47 A;  4OX9 I;  4P7A A;  2VF1 A;  1T4O A;  2YT4 A;  5C0X D;  2HKE A;  3LLH A;  1WUU A;  2BBG A;  1I94 I;  4IFD E;  1MX0 A;  1TF6 A;  5KL2 A;  5KL7 A;  4JI1 I;  4URL A;  2VES A;  2EPC A;  4R2Q A;  4M2Z A;  4B3S E;  3V2U C;  1N0V C;  1NCS A;  4MLV A;  3PRY A;  2IES A;  4LF7 I;  3OTO E;  2BM0 A;  3PYE A;  5DNY A;  3VYY A;  4ZVI A;  2L6M A;  4WXC A;  3EPH A;  1H73 A; 
#chains in the Genus database with same CATH homology
 2DEJ A;  4M0V A;  4IZK A;  4DV4 I;  3ZKB A;  1QZR A;  1N34 I;  2FGG A;  1T4N A;  4LF5 E;  2VQF E;  4HXZ A;  4M1K A;  4DV1 E;  3H4L A;  1IBM E;  4P78 A;  4DU8 A;  1N0U A;  4DV7 I;  4X8W A;  5BR8 I;  1X48 A;  4JV5 I;  4JI2 E;  4HYM A;  3HUL A;  2WW4 A;  4EMD A;  3B78 A;  2VE7 C;  1FJG I;  4KHP E;  2V8P A;  3J81 Q;  2UUC I;  2VQE E;  2UXD E;  4JI6 E;  1HNX E;  1SR9 A;  2UUA E;  3P1X A;  2HHH I;  3ZM7 A;  2F4V I;  3ZZU A;  1WXR A;  4AQY I;  4DXL A;  4Z7Y A;  3ZOQ B;  4LF9 I;  4NXN E;  3K6Q A;  2B7T A;  2PNL A;  2EWL A;  3ADJ A;  5AE2 A;  2A2C A;  2GQ0 A;  4LF4 E;  1O0W A;  2J7K A;  3V5R A;  4BC9 A;  4KZS A;  2ZIT A;  1N36 I;  1Z0T A;  1DI2 A;  4JI0 E;  5AAS A;  5LMU E;  4GKK I;  3WU4 A;  2MC5 A;  2IHR 1;  2L2N A;  2K4V A;  4DR4 E;  4UT4 A;  1IBL I;  5L3J A;  1HNW I;  2L2K B;  4B3R I;  2VF3 A;  5A2Q Q;  3AUZ A;  4DU7 A;  2FTX B;  3HQ1 A;  2V88 A;  2M4I A;  1FNM A;  1FI4 A;  3Q6N A;  1YZ9 A;  4JI5 I;  1ZBQ A;  2Z5C A;  4LFB E;  2UXB E;  2R3V A;  5IWA I;  3J80 Q;  1N32 E;  4GKJ E;  3K17 A;  4K0K E;  3OML A;  2DB2 A;  3T1Y E;  4PRX A;  2UXC E;  2Z5E A;  1A6F A;  2DMY A;  4BBY A;  2LTS A;  4LF8 I;  2HK2 A;  4WUD A;  4DUY I;  4DV5 E;  5ADZ A;  4DV3 I;  4JYA I;  3ZKD A;  2ODR C;  3JAM C;  1B63 A;  4I3H A;  2VQF I;  4JI4 I;  4WPY A;  4JI7 I;  1KTV A;  2Z5B A;  1EI1 A;  4IZJ B;  4JI8 E;  4L5N C;  4JI2 I;  1B62 A;  1HK7 A;  3IWB A;  1NHH A;  2L2M A;  2ZM6 E;  2N3H A;  2L8T A;  1UEK A;  2UXD I;  2M1S A;  1KIJ A;  1Z0G A;  4X65 I;  3LNU A;  2NUG A;  1Z0C A;  3AV0 A;  4YHH E;  4WSP A;  1H72 C;  1N33 E;  1U2R A;  4BS9 A;  3ADG A;  2RS6 A;  3VYX A;  3J7A M;  2L92 A;  2MDR A;  1OJ4 A;  4L8N A;  1XMO E;  2LJP A;  1Y6Z A;  1H74 A;  4JI0 I;  1S16 A;  2H36 X;  2HKJ A;  3QT6 A;  4DUZ E;  1ZM4 A;  4DR4 I;  1HNZ I;  4X64 E;  3H09 A;  3JU0 A;  4TUG A;  2V87 A;  4YY3 E;  1J5E E;  4PRV A;  3HTX A;  3Q6M A;  4DV0 E;  2V2V A;  2KOU A;  2B7V A;  1RR9 A;  3T1H E;  3PYF A;  2LMZ A;  4JI3 E;  1S4E A;  2BM1 A;  1Z0B A;  2CGE A;  3LTO A;  1N32 I;  4LU9 A;  4K0K I;  1QU6 A;  2UUB I;  2JR1 A;  2R42 A;  3T1Y I;  2X36 A;  4DR6 I;  4XTJ A;  2F8B A;  3WU3 A;  5FWK A;  2WZO A;  1D6T A;  2E5L E;  4B3T E;  3RMP A;  1XHK A;  4DR7 I;  1NHJ A;  4NXM I;  2CG9 A;  4HY1 A;  4FWG A;  4DR3 E;  4DV6 I;  1STU A;  4P7D A;  5AE1 A;  2N3G A;  2UU9 E;  4DR5 E;  1Y4U A;  1GQE A;  4X66 E;  1WHQ A;  5GMD A;  5LMN I;  4DV2 E;  4BMJ A;  2KON A;  4DR2 I;  3HPZ A;  1YYW A;  2PNM A;  5IT9 C;  1USU A;  3C4T A;  4YHH I;  4B3M I;  2G7H A;  3QT5 A;  2RS7 A;  4DR1 E;  1XNQ E;  2V8Q B;  1BKN A;  2DSY A;  4R03 A;  4LTY A;  4X62 E;  4DPY A;  1I94 E;  2LRS A;  4JI1 E;  4FN5 A;  4J8Z A;  2L3C A;  3HJC A;  1Y4S A;  1MG7 A;  1DQ3 A;  1IBK E;  3CWV A;  4IZJ A;  4F9B B;  1Z0E A;  1XNR E;  4B3S I;  3K85 A;  4JG4 A;  1ZM2 A;  3LML A;  4WYQ B;  4DV4 E;  4X64 I;  3OTO I;  2LTR A;  1X49 A;  3B82 A;  5AE3 A;  3WU6 A;  4DV7 E;  2OI2 A;  4LF5 I;  5BR8 E;  4JV5 E;  4LFC E;  4DV1 I;  4LF6 E;  1IBM I;  4DV0 I;  1FWK A;  3F6H A;  4MYT A;  2CZ9 A;  2ODR D;  2EFG A;  2UUC E;  1PVG A;  4TUI A;  1NZ0 A;  2V86 A;  4KHP I;  4DPX A;  2HHH E;  3J81 C;  2F4V E;  1ELO A;  2VQE I;  4DMI A;  4JI6 I;  4FWD A;  1HNX I;  4AQY E;  1PIE A;  2LJH A;  2LUP B;  2UUA I;  4LF9 E;  2B3T B;  2JWO A;  4PU9 A;  1KKH A;  1RRE A;  2E5L I;  2V83 A;  3J7A G;  1EKZ A;  1YYO A;  2JOX A;  4NXN I;  2RTX A;  2E1M A;  1FWL A;  4Z7C A;  4LF4 I;  4F54 A;  4HAC B;  3ADL A;  4DR3 I;  2MC6 A;  3FIG A;  1VIS A;  4DR5 I;  3D4J A;  5LMU I;  3M6A A;  4X66 I;  1UHZ A;  2NA2 A;  1J26 A;  4BC7 A;  2XEX A;  4B3R E;  1RQ0 A;  3P06 A;  2O1U A;  4KQV A;  4WFT A;  2JVA A;  2YZT A;  1UIL A;  2BV3 A;  2E1R A;  1RC7 A;  4DR1 I;  4JI5 E;  4USK A;  4OOG C;  3LPS A;  3F6G A;  4LFA E;  4X62 I;  2O1W A;  5IWA E;  1GZ6 A;  4P52 A;  5LL6 R;  4LFB I;  2UXB I;  2IOQ A;  1MU5 A;  1HR0 E;  3IWC A;  4LF8 E;  1EA6 A;  3GON A;  3ZZ0 A;  3J80 C;  1IBK I;  4GKJ I;  1XNR I;  1Z0W A;  2UXC I;  4DUY E;  1ZBT A;  2HK3 A;  1KVK A;  4DV3 E;  4JYA E;  4Q28 A;  3JAM Q;  2NUE A;  2V85 A;  4R1F A;  4F9C B;  1ZXN A;  4WUB A;  4JI4 E;  4DV5 I;  4JI7 E;  4DPU A;  1XMQ E;  3IWD A;  4LFC I;  4DKK A;  4LF6 I;  2L33 A;  1ZM3 A;  2M7Q A;  2FV4 B;  1USV A;  4JI8 I;  3ADI A;  4USM A;  4IZK B;  4X65 E;  2ZM6 I;  3B8H A;  2HFU A;  2V89 A;  1YYK A;  2DEI A;  4I8O A;  4GEQ B;  2O1T A;  3F0N A;  3PYD A;  2LE2 A;  3HPS A;  2V2Q A;  5GME A;  4BCA A;  2GS8 A;  1N33 I;  2RSM A;  5FLX C;  2L3J A;  2KHX A;  4OX9 E;  4UTG A;  2V34 A;  4R8O A;  2JOB A;  1XMO I;  2LBS B;  1T4L B;  4IZJ D;  1H7S A;  1HNZ E;  4DPW A;  4LF7 E;  2Q2E B;  1FKA E;  3QT8 A;  4DUZ I;  2O1V A;  1Z0V A;  1H7U A;  4RPF A;  1N34 E;  1WHN A;  3J7Y p;  4YY3 I;  1J5E I;  2AJ4 A;  5F3W A;  2V2Z A;  3QT7 A;  4LFA I;  2NUF A;  5T6J A;  2CPN A;  1FJG E;  3T1H I;  3C4B A;  3K1J A;  4JI3 I;  2UUB E;  5CFF E;  4DR6 E;  2X7I A;  3HXL A;  1HR0 I;  2HFS A;  2A2D A;  1NHI A;  4HAC A;  3Q1Q A;  3ZZT A;  1Z5C A;  4N3O A;  2ZBK B;  4MYU A;  2NPF A;  4F9A B;  3VK6 A;  3JTZ A;  4DR7 E;  4NXM E;  2Z5C B;  1DAR A;  4B3T I;  4WUC A;  1XMQ I;  4DV6 E;  1PKP A;  1N36 E;  4FW9 A;  3KWR A;  2EZ6 A;  3DF6 A;  2LUQ A;  4GKK E;  4FWH A;  1ZM9 A;  2DIX A;  5LMN E;  3MSW A;  1Z5B A;  2IOP A;  2UU9 I;  4DR2 E;  3PYG A;  1IBL E;  2JY9 A;  3DJW A;  5IT9 Q;  1HNW E;  4DV2 I;  1K47 A;  4DPT A;  4B3M E;  1Z5A A;  5FLX Q;  2Z5B B;  3WU5 A;  2B9D A;  1Z59 A;  5A2Q C;  4ED4 A;  1XNQ I;  4M30 A;  1ZXM A;  1X47 A;  4OX9 I;  4P7A A;  2VF1 A;  1T4O A;  2YT4 A;  2HKE A;  3LLH A;  1WUU A;  1I94 I;  1MX0 A;  4JI1 I;  4URL A;  4M2Z A;  4B3S E;  3V2U C;  1N0V C;  3PRY A;  4LF7 I;  3OTO E;  2BM0 A;  3PYE A;  5DNY A;  3VYY A;  4ZVI A;  2L6M A;  1H73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...