4GKKE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4gkkE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkkE02
1Z0BA 1RC7A 1PVGA 2F4VE 4B3TE 4M1KA 2ZITA 3B82A 1FJGI 4KQVA 1IBKI 4HXZA 4LF9I 1D6TA 1N33E 4WYQB 2VF3A 1Z0CA 2HFSA 1ZBTA 4FWGA 2LJPA 4OX9E 1I94E 1UILA 1KIJA 3WU3A 1EI1A 4X66E 4HACB 4DR4E 4Z7YA 1PKPA 3K1JA 1RQ0A 3ADJA 1T4LB 2UXBI 2L3CA 5CFFE 4DR5I 3QT7A 2AJ4A 3HTXA 1STUA 5L3JA 3LLHA 2VQEI 4JI5E 2NA2A 4JI7I 5A2QQ 4YY3E 2ZBKB 1XNRI 2DMYA 2LUQA 2IHR1 4PU9A 1HNZE 1HR0E 2NPFA 2L2NA 1Z5CA 4LF4I 5A2QC 5IWAI 4USMA 4DV7E 4DR1I 3ADGA 2EFGA 2HK2A 1N36I 5LMNE 4DV3E 2BV3A 4JV5E 1XNQE 3B8HA 4YHHI 4DR7E 2WW4A 4X62E 3J7Yp 4LFAE 3T1YI 3PYFA 3T1HI 1EA6A 1XMOE 4KHPE 2RSMA 2A2CA 2DEJA 1VISA 4DUZI 2X36A 4FWHA 1FI4A 1ZM4A 4WUBA 4RPFA 4DR3I 1MU5A 1H7SA 2GS8A 1BKNA 3F0NA 3K17A 1IBME 4LFBE 2BM1A 5BR8E 4HYMA 2UUCE 4B3ME 4GKKE 4PRXA 2RTXA 4DPYA 3J80Q 4DV1I 4GKJE 4K0KE 4JI2E 2RS6A 3ADIA 4JI0I 1ELOA 1HNXI 4NXNE 2N3GA 4ED4A 2R42A 4MYTA 4JI6I 2Q2EB 2CPNA 3J81Q 4X65E 3VYXA 3M6AA 2R3VA 2DEIA 4UT4A 1WUUA 1FWLA 3LTOA 4B3RE 4LF5E 5LMUE 1KTVA 4I3HA 4DV2I 4DV4E 4DPWA 4JI4E 1XHKA 2BM0A 1H72C 1FKAE 1N34E 2L2KB 2V2ZA 4JI1E 2DB2A 4DV6E 1ZM9A 5LL6R 3QT6A 2V2VA 1Z0TA 4DV0I 2UXDE 3B78A 1UHZA 4M2ZA 2LTSA 3WU5A 1J26A 4LF8I 3J7AM 3OTOI 2UUAI 1YYKA 2KHXA 4JYAE 4DU7A 4P52A 2NUFA 3P1XA 3JAMQ 3LNUA 4DUYI 1YYWA 2E5LI 2UU9I 1K47A 1X48A 2XEXA 4LF6I 4LFCE 1FJGE 1IBKE 4LF9E 3ZZTA 1J5EI 1B62A 1S4EA 5FLXQ 1RREA 1N0VC 1Z5BA 1NZ0A 1HNWI 3VYYA 4OOGC 2B3TB 2VQFI 4KHPI 4DR2I 4LF7I 2UXBE 3ZZUA 2E1RA 4JG4A 4PRVA 4DR5E 2UUBI 1Z59A 4DV5I 4B3SI 1IBLI 2VQEE 4DR6I 4JI7E 2DIXA 4DPXA 1XNRE 3WU6A 1H7UA 4WUCA 4JI8I 4WUDA 1S16A 2MDRA 2HHHI 2ZM6I 4DKKA 4LF4E 3ZM7A 1XMQI 1U2RA 4JI3I 5IWAE 2NUGA 1A6FA 3CWVA 4NXMI 4AQYI 4DR1E 1N36E 1N32I 2A2DA 3PYDA 2RS7A 1FNMA 3QT8A 2HK3A 2UXCI 4M30A 4YHHE 1X47A 4X64I 5IT9Q 3J80C 3T1YE 3T1HE 3PYGA 4DPTA 2F4VI 1NHIA 3GONA 4DUZE 3J81C 4B3TI 3C4TA 4WFTA 3V2UC 2L2MA 1N33I 1QU6A 1WHNA 4DR3E 1FWKA 1X49A 1YYOA 5GMEA 4FN5A 2L3JA 4DV1E 4OX9I 3ZKDA 1I94I 1DI2A 4JI0E 1HNXE 3Q1QA 4MYUA 4X66I 4JI6E 4DR4I 1H74A 3V5RA 1Z0WA 4XTJA 3ZZ0A 3PYEA 3D4JA 4ZVIA 4JI5I 3HULA 2LRSA 4YY3I 4DV2E 3QT5A 4LFCI 1NHHA 2NUEA 1H73A 3ADLA 1HNZI 1HR0I 4DXLA 1YZ9A 2B7TA 3J7AG 4EMDA 2HKJA 1UEKA 3WU4A 2JY9A 1ZXMA 5GMDA 3JAMC 4DV7I 2L33A 3LPSA 4HY1A 2LTRA 5LMNI 1Z0GA 4DV0E 4DV3I 4JV5I 1XNQI 1N0UA 1ZM3A 4R1FA 4DR7I 2HFUA 4LF8E 3OTOE 2UUAE 4X62I 1EKZA 3C4BA 4FW9A 4LFAI 4Z7CA 1XMOI 4HACA 5FLXC 4X8WA 1Z0VA 4DUYE 2E5LE 1ZXNA 2V8PA 2UU9E 4P7AA 4DU8A 1WHQA 4LF6E 1IBMI 4LFBI 2N3HA 5BR8I 2UUCI 4B3MI 4GKKI 4GKJI 4K0KI 4JI2I 1J5EE 4NXNI 1MX0A 1RR9A 4URLA 1NHJA 2V34A 4X65I 1HNWE 1O0WA 4B3RI 2LUPB 4LF5I 2VQFE 4DR2E 5LMUI 1GQEA 1KVKA 4DPUA 4LF7E 2B7VA 2EZ6A 4DV4I 1MG7A 1ZM2A 4JI4I 1N34I 2UUBE 4DV5E 4B3SE 1IBLE 2JVAA 1OJ4A 1T4OA 4DR6E 2V2QA 4JI1I 2HKEA 4DV6I 4USKA 4JI8E 2HHHE 2YT4A 1KKHA 5IT9C 1T4NA 2ZM6E 2CZ9A 4UTGA 2UXDI 1B63A 1QZRA 2LBSB 1XMQE 4JI3E 4NXME 1DARA 4AQYE 4JYAI 2X7IA 1N32E 4FWDA 2UXCE 1Z0EA 2J7KA 1PIEA 1Z5AA 2LJHA 4X64E 2OI2A 3ZKBA 3H4LA
chains in the Genus database with same CATH superfamily
3QG5C 2EORA 2YSPA 1RC7A 1Z0BA 1PVGA 3CDIA 2F4VE 2YTOA 4B3TE 4M1KA 2RQLA 5F3WA 2ZITA 2EMGA 3B82A 3EQ1A 3Q6MA 1FJGI 4KQVA 2V89A 4HXZA 1IBKI 4LF9I 2F1DA 1N33E 1D6TA 4WYQB 2JEBA 2FGGA 2VF3A 2BA1G 1Y5YA 1Z0CA 2YTQA 3F6GA 2BA1D 2HFSA 1ZBTA 2A25A 1ZR9A 2AE8A 4FWGA 2YTGA 1JK1A 2LJPA 4BHCA 4WX9A 2YRHA 2O1TA 4OX9E 2G7HA 2YSOA 1I94E 1UILA 2KOUA 1KIJA 3WU3A 3OMLA 1OYPA 1Y6ZA 2EMAA 2V85A 2LVHA 4MLQA 4X66E 1EI1A 4HACB 2WBUA 4DR4E 4Z7YA 2EOFA 1BBOA 2B9DA 1PKPA 3K1JA 3LMLA 1RQ0A 3ADJA 1T4LB 1SR9A 4IZKB 2PNZB 2UXBI 2L3CA 2MKNA 2O1VA 2EOJA 3HKMA 2EMKA 5CFFE 4DR5I 3QT7A 2AJ4A 3HTXA 1STUA 5L3JA 3LLHA 2VQEI 4JI5E 3JTZA 2NA2A 5K36E 4JI7I 2Q8UA 3THNA 2JE6A 5A2QQ 1WXRA 4YY3E 2V87A 2ZBKB 1XNRI 4BS9A 2DMYA 2LUQA 2IHR1 1AAYA 4PU9A 4O5GA 1HNZE 1HR0E 1UN6B 2NPFA 5K36B 2EPCA 1ZBQA 2L2NA 1Z5CA 4LF4I 2EM9A 2Z5CB 1G2DC 2EJ4A 5A2QC 4MDTA 2JYAA 2K4VA 5IWAI 1YPNA 1SFEA 4USMA 2E1MA 2JEAB 4ISAA 4DV7E 1Z1BA 3F6HA 2EOQA 2EPXA 5JEAE 4DR1I 3ADGA 2PO1B 2EFGA 2CG9A 2HK2A 4F6NA 1N36I 1X3CA 4GZNC 5LMNE 4R8OA 5A69A 4DV3E 1T38A 4JV5E 1NEIA 2BV3A 1XNQE 3B8HA 2CSHA 1P47A 3UHMA 2YRMA 2BA0G 2Z5CA 4YHHI 4FK5C 4F9AB 4DR7E 2EQ3A 2GHFA 2WW4A 2ODRC 4X62E 3J7Yp 5JEAB 4LFAE 1BB8A 5DNLA 3T1YI 3PYFA 2DMIA 4ZYEA 3T1HI 5LLQA 4R2AA 1EA6A 1XMOE 1IQSA 4KHPE 2EN7A 2NN6C 2RSMA 2A2CA 2DEJA 1G2FC 1VISA 4DUZI 2X36A 4FWHA 2MC5A 2EMHA 2L8TA 3BF2A 4WXDA 3VHTB 1FI4A 1ZM4A 1A1JA 4WUBA 2MDGA 4RPFA 4DR3I 5DNYA 1MU5A 1H7SA 2GS8A 4IFDF 4HEIA 2ELYA 1BKNA 3F0NA 3K17A 1IBME 5AC4A 4LFBE 2IESA 2BM1A 5BR8E 4HYMA 2UUCE 4B3ME 4GKKE 1P42A 2RTXA 4PRXA 4QNKA 1UDOA 4DPYA 5KL2A 3J80Q 4DV1I 3ZOQB 4GKJE 4K0KE 4JI2E 2NABA 2EMWA 5A6AA 3EPJA 2NN6F 2RS6A 3ADIA 4JI0I 4OO1C 1ELOA 2BR2A 1HNXI 4NXNE 2EN2A 2N3GA 4ED4A 2R42A 4MYTA 4WXCA 1EH6A 2Q2EB 3GLLA 4JI6I 2CPNA 2JOXA 3J81Q 2C37B 3K6QA 2L6MA 5AE3A 4X65E 3UK3C 3VYXA 2C39A 4ZYGA 1TN9A 2R3VA 2JR1A 2DEIA 3M6AA 3P06A 5C0XB 2EOOA 4P7DA 4UT4A 4BMJA 1WUUA 1FWLA 1UDSA 3U1KA 1UDQA 3LTOA 2O3ZA 4B3RE 4LF5E 2LJUA 5LMUE 4FW3A 1KTVA 2CVEA 2PO0B 1VI7A 4BC7A 4I3HA 4DV2I 4OO1F 1QNTA 2RSIA 4DV4E 1USVA 1X6EA 1A1HA 5KL7A 2GLIA 4JI4E 4LCFA 4DPWA 5KL3A 5FWKA 5KL6A 1XHKA 2BM0A 2JEBB 1H72C 1FKAE 1N34E 1E3HA 1E3PA 5AE1A 3IWBA 2L2KB 2V2ZA 3BIDA 3DJWA 2O1WA 1A1IA 4JI1E 2N8XA 2DB2A 4BCAA 2BBGA 2FTXB 4DV6E 2I13A 2PO0A 2EPAA 1ZM9A 2GO4A 5LL6R 1A1KA 3QT6A 2LMZA 2V2VA 1Z0TA 5TSEA 1YFHA 1TF6A 4DV0I 5T6JA 2UXDE 1RHYA 3PRYA 1NCSA 2VE7C 5DRRA 3B78A 1UHZA 4WPYA 3M7NG 4HTGA 4M2ZA 2PO2A 2LTSA 2FV4B 2L92A 4IZJD 3WU5A 3H09A 1J26A 1N3GA 2EQ1A 4R2SA 1OYSA 3OTOI 2UUAI 4ZYHA 4LF8I 3J7AM 2EPPA 1YYKA 2KHXA 4JYAE 4DU7A 1F2IG 3NZKA 3MHSC 4P52A 2JE6B 3THOB 2NUFA 3P1XA 3PS1A 3JAMQ 1B69A 3LNUA 4RH8A 3KWRA 1YYWA 4DUYI 2E5LI 4MQYA 4L8NA 4R03A 2C38A 4NZVA 2WBSA 3M85G 2UU9I 1K47A 1X48A 2YU8A 5K36C 4IFDD 2EN3A 4M9VC 2XEXA 4LF6I 5A6KA 2GPIA 1Y4SA 1GZ6A 2ODRD 4TUGA 4LFCE 4MU0A 3C6MA 1FJGE 4LPFA 2O1UA 4BC9A 1IBKE 4LF9E 3ZZTA 4FW7A 2ADRA 4NBQA 1J5EI 2EM8A 2NN6D 2JXPA 1X5WA 1B62A 2EPLX 2LV2A 1S4EA 1EH8A 4MU1A 5AE2A 5FLXQ 1RREA 1R6MA 3KZYA 3GCMA 2LO3A 3PS3A 1N0VC 1YUJA 1NZ0A 2E72A 1Z5BA 3VYYA 1HNWI 5K36F 2EOIA 2YTNA 4X9JA 1A1FA 2V83A 2LT7A 2WCC3 2HJJA 4OOGC 2B3TB 2M9AA 1RMDA 2VQFI 4KHPI 4DR2I 4IS9A 4U3BA 1T39A 3P3EA 4LF7I 5DRPA 4AIDA 2UXBE 2J65A 2Z5EA 4OO1D 3ZZUA 4IFDC 2EMLA 2E1RA 4JG4A 2BA0D 4PRVA 2EOHA 1X6FA 3M99B 4DR5E 1Z59A 4OZEA 4DV5I 2UUBI 4B3SI 3EPKA 2VQEE 2IOQA 1IBLI 4DR6I 4JI7E 2EOYA 5AASA 4BA2A 4N4RB 2WZOA 2DIXA 4DPXA 5DRQA 2WBTA 1BBGA 1XNRE 3WU6A 5JEAF 1H7UA 2EOSA 4WUCA 4JI8I 2EWLA 4DMIA 1UBDC 2DGCA 4WUDA 1S16A 2BB8A 2MDRA 2HHHI 2BR2B 2Z5BA 2EM6A 1IQOA 2EOXA 2WNRA 2ZM6I 4DKKA 1L4SA 2JWOA 3IWCA 2EP3A 4LF4E 2EM3A 2YTPA 2C39B 3PS2A 2EMFA 3ZM7A 1XMQI 1R6LA 2EL5A 1U2RA 5IWAE 4JI3I 4J3DA 5C0XC 2NUGA 4Q35B 1A6FA 3CWVA 4NXMI 2DLKA 1ZAAC 4AQYI 2EE8A 4DR1E 2EMCA 1N36E 4IZJA 4M0VA 2EN4A 2R1FA 1PJSA 5EL9A 2A2DA 2EOEA 4IS1C 2IOPA 1N32I 3PYDA 2RS7A 1FNMA 3QT8A 2HK3A 2UXCI 4M30A 4YHHE 2EPOA 1A1GA 1KJKA 2GQ0A 4LOMA 2YTJA 1X47A 4X64I 5IT9Q 3J80C 5AC5A 2H36X 2PNLA 3KRNA 2HC5A 3T1YE 4R2QA 3T1HE 5C0XF 3PYGA 4F54A 4DPTA 2EMYA 2YTDA 2F4VI 1NHIA 1Y4UA 3GONA 4DUZE 3J81C 4B3TI 2I9IA 4U3DA 4IFDA 3C4TA 4WFTA 3V2UC 2KONA 2CT1A 2L2MA 4OO1E 1N33I 2PRTA 1QU6A 2EOMA 3K85A 2LE2A 1WHNA 4DR3E 1FWKA 1X49A 2EMXA 1WJPA 1YYOA 3TQMA 2NN6A 5GMEA 4FN5A 2PO2B 2L3JA 4LCGA 1Y60A 3L00A 4DV1E 4LCHA 4OX9I 4IZKA 3ZKDA 1X6HA 4OO1B 2VRDA 1I94I 5K36D 1AH5A 2EQ0A 4JI0E 1DI2A 2EN6A 1HNXE 1PDAA 4MYUA 3Q1QA 4ZYDA 4X66I 3MSWA 1MEYC 4JI6E 2HGHA 4DR4I 1H74A 3V5RA 1Z0WA 4XTJA 3ZZ0A 1GTKA 2EL4A 4BHBA 3PYEA 3M7ND 2C38B 3D4JA 4ZVIA 4OO1A 3HQ1A 2EPKX 3L7ZA 3P76A 4JI5I 3HULA 4MU4A 4FW4A 2LRSA 1KYQA 3BGHA 4YY3I 4DV2E 3QT5A 4LFCI 1WRJA 4R2RA 2JPAA 2NUEA 1NHHA 5JEAD 4AIMA 1XXEA 1OYRA 1H73A 3ADLA 2EMZA 1HNZI 1HR0I 2M4IA 4DXLA 4IJDA 1JK2A 2RPCA 4F9BB 4GEQB 1YZ9A 2B7TA 5KL5A 3J7AG 2HKJA 2CTDA 1UEKA 1PJQA 3MHHC 2ELZA 3WU4A 4F6MA 4EMDA 4NHRA 3M85D 2LCEA 2JY9A 3KZZA 1ZXMA 3HPSA 1YUIA 2IERA 3ECRA 4BBYA 5GMDA 3JAMC 3U1YA 2ENCA 4DV7I 2EMBA 2L33A 5A6JA 3LPSA 4FW5A 3IWDA 4HY1A 4RHBB 1A1LA 2LTRA 2VESA 5LMNI 4O24A 4DV0E 1Z0GA 2DLQA 4DV3I 4JV5I 1XNQI 3H1CA 5DNXA 1N0UA 2EPUA 1ZM3A 4R1FA 5A6BD 2MKDA 1YHCA 4DR7I 3AUZA 2HFUA 4R2CA 4LF8E 3OTOE 3DF6A 2UUAE 4X62I 1EKZA 2EPNA 3C4BA 4FW9A 4LFAI 5JEAC 4Z7CA 2EPRA 4BA2B 2YTEA 2EMIA 5C0XD 4HACA 1XMOI 3HJCA 2M1SA 4KWYA 5EKWA 2V88A 5FLXC 1ZU1A 2PNZA 3CDJA 4X8WA 1Z0VA 4FW6A 4R2EA 2V8QB 5ADZA 4DUYE 2E5LE 4I8OA 1ZXNA 4BA1B 2Z5BB 1USUA 2V8PA 2WP8B 2WNRB 1YSAC 2UU9E 4P7AA 2VF1A 4DU8A 1EH7A 4QNJA 1WHQA 1YH8A 2R76A 2MC6A 4LF6E 2EM0A 1IBMI 1DGCA 2N3HA 4LFBI 5BR8I 4WSGA 5IXMB 2UUCI 4B3MI 4GKKI 1TF3A 2J7JA 3DD6A 3GMEA 4JI2I 4GKJI 4K0KI 4LU9A 2JT2A 5ELWA 1J5EE 4O4KA 4IZJB 4P78A 2DRPA 4BA1A 4NXNI 1MX0A 2WP8A 2EPZA 4F9CB 3P3GA 5K36A 2JP9A 1RR9A 4AM3A 4URLA 1NHJA 2V34A 4X65I 4IFDE 2D9HA 4R2DA 1HNWE 3B4TA 2JOBA 1O0WA 2JEAA 4L5NC 2PO1A 4B3RI 2YU5A 4LTYA 2LUPB 4LF5I 3Q6NA 2VQFE 4O43A 4DR2E 5LMUI 2GO3A 2PNMA 2YZTA 4GQUA 1GQEA 2YRKA 2YWQA 1KVKA 2NN6E 2DSYA 3P3CA 4DPUA 4LF7E 2EPMX 2B7VA 1IMUA 4IFDB 2EZ6A 4DV4I 1MG7A 1ZM2A 4JI4I 2EM7A 1PJTA 2K7IA 2UUBE 1N34I 5JEAA 4DV5E 4B3SE 4KZSA 1IBLE 2JVAA 1OJ4A 4MU3A 1T4OA 4DR6E 2V86A 3JU0A 2V2QA 2NN6B 4JI1I 1MGTA 5C0XE 2EN8A 4Q28A 2HKEA 5DROA 4DV6I 4USKA 4JI8E 3EPLA 2HHHE 2YPNA 2YT4A 5IT9C 1KKHA 4WSPA 4N3OA 4MLVA 1T4NA 2ZM6E 2CZ9A 4UTGA 2EM2A 2ENAA 3RMPA 2UXDI 1B63A 1QZRA 2LBSB 1XMQE 4JI3E 1HK7A 3VK6A 3EPHA 2EM4A 4NXME 2EN1A 1DARA 1DQ3A 2ENHA 4R2PA 4AQYE 3HPZA 1LLMC 4F2JC 3L7ZB 5IV8B 4JYAI 5A6BA 2YTFA 2X7IA 2EOZA 2M7QA 3HXLA 3AV0A 5KL4A 1N32E 2CGEA 4FWDA 2UXCE 1UDNA 1Z0EA 2C37A 4OKGA 2EM5A 2J7KA 2EL6A 3FIGA 1PIEA 1Z5AA 4J8ZA 2LJHA 5C0XA 4X64E 4TUIA 3C6KA 2OI2A 3ZKBA 2F8BA 3H4LA 3BBGA 2YTIA
chains in the Genus database with same CATH topology
1Z0BA 1RC7A 1PVGA 2F4VE 4B3TE 4M1KA 5F3WA 2ZITA 3B82A 3Q6MA 1FJGI 4KQVA 2V89A 4HXZA 1IBKI 4LF9I 1D6TA 1N33E 4WYQB 2FGGA 2VF3A 1Z0CA 3F6GA 2HFSA 1ZBTA 4FWGA 2LJPA 2O1TA 4OX9E 2G7HA 1I94E 1UILA 2KOUA 1KIJA 3WU3A 3OMLA 1Y6ZA 2V85A 1EI1A 4X66E 4HACB 5FWKA 4DR4E 4Z7YA 2B9DA 1PKPA 3K1JA 3LMLA 1RQ0A 3ADJA 1T4LB 1SR9A 4IZKB 2UXBI 2L3CA 2O1VA 5CFFE 4DR5I 3QT7A 2AJ4A 3HTXA 1STUA 5L3JA 3LLHA 2VQEI 4JI5E 3JTZA 2NA2A 4JI7I 5A2QQ 1WXRA 4YY3E 2V87A 2ZBKB 1XNRI 4BS9A 2DMYA 2LUQA 2IHR1 4PU9A 1HNZE 1HR0E 2NPFA 1ZBQA 2L2NA 1Z5CA 4LF4I 2Z5CB 5A2QC 2K4VA 5IWAI 4USMA 2E1MA 4DV7E 3F6HA 4DR1I 3ADGA 2EFGA 2CG9A 2HK2A 1N36I 5LMNE 4R8OA 4DV3E 2BV3A 4JV5E 1XNQE 3B8HA 2Z5CA 4YHHI 4F9AB 4DR7E 2WW4A 2ODRC 4X62E 3J7Yp 4LFAE 3T1YI 3PYFA 3T1HI 1EA6A 1XMOE 4KHPE 2RSMA 2A2CA 2DEJA 1VISA 4DUZI 2X36A 4FWHA 2MC5A 2L8TA 1FI4A 1ZM4A 4WUBA 4RPFA 4DR3I 5DNYA 1MU5A 1H7SA 2GS8A 1BKNA 3F0NA 3K17A 1IBME 4LFBE 2BM1A 5BR8E 4HYMA 2UUCE 4B3ME 4GKKE 4PRXA 2RTXA 4DPYA 3J80Q 4DV1I 3ZOQB 4GKJE 4K0KE 4JI2E 2RS6A 3ADIA 4JI0I 1ELOA 1HNXI 4NXNE 2N3GA 4ED4A 2R42A 4MYTA 4JI6I 2Q2EB 2CPNA 2JOXA 3J81Q 3K6QA 2L6MA 5AE3A 4X65E 3VYXA 3M6AA 3P06A 2R3VA 2JR1A 2DEIA 4P7DA 4UT4A 4BMJA 1WUUA 1FWLA 3LTOA 4B3RE 4LF5E 5LMUE 1KTVA 4BC7A 4I3HA 4DV2I 4DV4E 1USVA 4DPWA 4JI4E 1XHKA 2BM0A 1H72C 1FKAE 1N34E 5AE1A 3IWBA 2L2KB 2V2ZA 3DJWA 2O1WA 4JI1E 4BCAA 2DB2A 2FTXB 4DV6E 1ZM9A 5LL6R 3QT6A 2LMZA 2V2VA 1Z0TA 4DV0I 5T6JA 2UXDE 3PRYA 2VE7C 3B78A 1UHZA 4WPYA 4M2ZA 2LTSA 2FV4B 2L92A 4IZJD 3WU5A 3H09A 1J26A 4LF8I 3OTOI 2UUAI 3J7AM 1YYKA 2KHXA 4JYAE 4DU7A 4P52A 2NUFA 3P1XA 3JAMQ 3LNUA 3KWRA 1YYWA 4DUYI 2E5LI 4L8NA 4R03A 2UU9I 1K47A 1X48A 2XEXA 4LF6I 1Y4SA 1GZ6A 2ODRD 4TUGA 4LFCE 1FJGE 2O1UA 4BC9A 1IBKE 4LF9E 3ZZTA 1J5EI 1B62A 1S4EA 5AE2A 5FLXQ 1RREA 1N0VC 1Z5BA 1NZ0A 1HNWI 3VYYA 2V83A 4OOGC 2B3TB 2VQFI 4KHPI 4DR2I 4LF7I 2UXBE 2Z5EA 3ZZUA 2E1RA 4JG4A 4PRVA 4DR5E 2UUBI 1Z59A 4DV5I 4B3SI 1IBLI 2VQEE 2IOQA 4DR6I 4JI7E 5AASA 2WZOA 2DIXA 4DPXA 1XNRE 3WU6A 1H7UA 4WUCA 4JI8I 2EWLA 4DMIA 4WUDA 1S16A 2MDRA 2HHHI 2Z5BA 2ZM6I 4DKKA 2JWOA 3IWCA 4LF4E 3ZM7A 1XMQI 1U2RA 4JI3I 5IWAE 2NUGA 1A6FA 3CWVA 4NXMI 4AQYI 4DR1E 1N36E 4IZJA 4M0VA 1N32I 2A2DA 2IOPA 3PYDA 1FNMA 2RS7A 3QT8A 2HK3A 2UXCI 4M30A 4YHHE 2GQ0A 1X47A 4X64I 5IT9Q 3J80C 2PNLA 2H36X 3T1YE 3T1HE 3PYGA 4F54A 4DPTA 2F4VI 1NHIA 1Y4UA 3GONA 4DUZE 3J81C 4B3TI 3C4TA 4WFTA 3V2UC 2KONA 2L2MA 1N33I 1QU6A 3K85A 2LE2A 1WHNA 4DR3E 1FWKA 1X49A 1YYOA 5GMEA 4FN5A 2L3JA 4DV1E 4OX9I 3ZKDA 1I94I 1DI2A 4JI0E 1HNXE 3Q1QA 4MYUA 4X66I 3MSWA 4JI6E 4DR4I 1H74A 3V5RA 1Z0WA 4XTJA 3ZZ0A 3PYEA 3D4JA 4ZVIA 3HQ1A 4JI5I 3HULA 2LRSA 4YY3I 4DV2E 3QT5A 4LFCI 1NHHA 2NUEA 1H73A 3ADLA 1HNZI 1HR0I 2M4IA 4DXLA 4F9BB 4GEQB 1YZ9A 2B7TA 3J7AG 4EMDA 2HKJA 1UEKA 3WU4A 2JY9A 1ZXMA 3HPSA 5GMDA 4BBYA 3JAMC 4DV7I 2L33A 3LPSA 3IWDA 4HY1A 2LTRA 5LMNI 1Z0GA 4DV0E 4DV3I 4JV5I 1XNQI 1N0UA 1ZM3A 4R1FA 4DR7I 3AUZA 2HFUA 4LF8E 3OTOE 3DF6A 2UUAE 4X62I 1EKZA 3C4BA 4FW9A 4LFAI 4Z7CA 1XMOI 4HACA 3HJCA 2M1SA 2V88A 5FLXC 4X8WA 1Z0VA 4IZKA 4DUYE 2V8QB 5ADZA 2E5LE 1ZXNA 4I8OA 2Z5BB 1USUA 2V8PA 2UU9E 4P7AA 2VF1A 4DU8A 1WHQA 2MC6A 4LF6E 1IBMI 4LFBI 2N3HA 5BR8I 2UUCI 4B3MI 4GKKI 4GKJI 4K0KI 4JI2I 4LU9A 1J5EE 4IZJB 4P78A 4NXNI 1MX0A 4F9CB 1RR9A 4URLA 1NHJA 2V34A 4X65I 1HNWE 2JOBA 1O0WA 4L5NC 4B3RI 4LTYA 2LUPB 4LF5I 3Q6NA 2VQFE 4DR2E 5LMUI 2PNMA 2YZTA 1GQEA 1KVKA 4DPUA 2DSYA 4LF7E 2B7VA 2EZ6A 4DV4I 1MG7A 1ZM2A 4JI4I 1N34I 2UUBE 4DV5E 4B3SE 4KZSA 1IBLE 2JVAA 1OJ4A 1T4OA 4DR6E 2V86A 3JU0A 2V2QA 4JI1I 4Q28A 2HKEA 4DV6I 4USKA 4JI8E 2HHHE 2YT4A 5IT9C 1KKHA 4WSPA 4N3OA 1T4NA 2ZM6E 2CZ9A 4UTGA 3RMPA 2UXDI 1B63A 1QZRA 2LBSB 1XMQE 4JI3E 1HK7A 3VK6A 4NXME 1DARA 1DQ3A 4AQYE 3HPZA 4JYAI 2X7IA 2M7QA 3HXLA 3AV0A 1N32E 2CGEA 4FWDA 2UXCE 1Z0EA 2J7KA 3FIGA 1PIEA 1Z5AA 4J8ZA 2LJHA 4X64E 4TUIA 2OI2A 3ZKBA 2F8BA 3H4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0B A;  1RC7 A;  1PVG A;  2F4V E;  4B3T E;  4M1K A;  2ZIT A;  3B82 A;  1FJG I;  4KQV A;  1IBK I;  4HXZ A;  4LF9 I;  1D6T A;  1N33 E;  4WYQ B;  2VF3 A;  1Z0C A;  2HFS A;  1ZBT A;  4FWG A;  2LJP A;  4OX9 E;  1I94 E;  1UIL A;  1KIJ A;  3WU3 A;  1EI1 A;  4X66 E;  4HAC B;  4DR4 E;  4Z7Y A;  1PKP A;  3K1J A;  1RQ0 A;  3ADJ A;  1T4L B;  2UXB I;  2L3C A;  5CFF E;  4DR5 I;  3QT7 A;  2AJ4 A;  3HTX A;  1STU A;  5L3J A;  3LLH A;  2VQE I;  4JI5 E;  2NA2 A;  4JI7 I;  5A2Q Q;  4YY3 E;  2ZBK B;  1XNR I;  2DMY A;  2LUQ A;  2IHR 1;  4PU9 A;  1HNZ E;  1HR0 E;  2NPF A;  2L2N A;  1Z5C A;  4LF4 I;  5A2Q C;  5IWA I;  4USM A;  4DV7 E;  4DR1 I;  3ADG A;  2EFG A;  2HK2 A;  1N36 I;  5LMN E;  4DV3 E;  2BV3 A;  4JV5 E;  1XNQ E;  3B8H A;  4YHH I;  4DR7 E;  2WW4 A;  4X62 E;  3J7Y p;  4LFA E;  3T1Y I;  3PYF A;  3T1H I;  1EA6 A;  1XMO E;  4KHP E;  2RSM A;  2A2C A;  2DEJ A;  1VIS A;  4DUZ I;  2X36 A;  4FWH A;  1FI4 A;  1ZM4 A;  4WUB A;  4RPF A;  4DR3 I;  1MU5 A;  1H7S A;  2GS8 A;  1BKN A;  3F0N A;  3K17 A;  1IBM E;  4LFB E;  2BM1 A;  5BR8 E;  4HYM A;  2UUC E;  4B3M E;  4GKK E;  4PRX A;  2RTX A;  4DPY A;  3J80 Q;  4DV1 I;  4GKJ E;  4K0K E;  4JI2 E;  2RS6 A;  3ADI A;  4JI0 I;  1ELO A;  1HNX I;  4NXN E;  2N3G A;  4ED4 A;  2R42 A;  4MYT A;  4JI6 I;  2Q2E B;  2CPN A;  3J81 Q;  4X65 E;  3VYX A;  3M6A A;  2R3V A;  2DEI A;  4UT4 A;  1WUU A;  1FWL A;  3LTO A;  4B3R E;  4LF5 E;  5LMU E;  1KTV A;  4I3H A;  4DV2 I;  4DV4 E;  4DPW A;  4JI4 E;  1XHK A;  2BM0 A;  1H72 C;  1FKA E;  1N34 E;  2L2K B;  2V2Z A;  4JI1 E;  2DB2 A;  4DV6 E;  1ZM9 A;  5LL6 R;  3QT6 A;  2V2V A;  1Z0T A;  4DV0 I;  2UXD E;  3B78 A;  1UHZ A;  4M2Z A;  2LTS A;  3WU5 A;  1J26 A;  4LF8 I;  3J7A M;  3OTO I;  2UUA I;  1YYK A;  2KHX A;  4JYA E;  4DU7 A;  4P52 A;  2NUF A;  3P1X A;  3JAM Q;  3LNU A;  4DUY I;  1YYW A;  2E5L I;  2UU9 I;  1K47 A;  1X48 A;  2XEX A;  4LF6 I;  4LFC E;  1FJG E;  1IBK E;  4LF9 E;  3ZZT A;  1J5E I;  1B62 A;  1S4E A;  5FLX Q;  1RRE A;  1N0V C;  1Z5B A;  1NZ0 A;  1HNW I;  3VYY A;  4OOG C;  2B3T B;  2VQF I;  4KHP I;  4DR2 I;  4LF7 I;  2UXB E;  3ZZU A;  2E1R A;  4JG4 A;  4PRV A;  4DR5 E;  2UUB I;  1Z59 A;  4DV5 I;  4B3S I;  1IBL I;  2VQE E;  4DR6 I;  4JI7 E;  2DIX A;  4DPX A;  1XNR E;  3WU6 A;  1H7U A;  4WUC A;  4JI8 I;  4WUD A;  1S16 A;  2MDR A;  2HHH I;  2ZM6 I;  4DKK A;  4LF4 E;  3ZM7 A;  1XMQ I;  1U2R A;  4JI3 I;  5IWA E;  2NUG A;  1A6F A;  3CWV A;  4NXM I;  4AQY I;  4DR1 E;  1N36 E;  1N32 I;  2A2D A;  3PYD A;  2RS7 A;  1FNM A;  3QT8 A;  2HK3 A;  2UXC I;  4M30 A;  4YHH E;  1X47 A;  4X64 I;  5IT9 Q;  3J80 C;  3T1Y E;  3T1H E;  3PYG A;  4DPT A;  2F4V I;  1NHI A;  3GON A;  4DUZ E;  3J81 C;  4B3T I;  3C4T A;  4WFT A;  3V2U C;  2L2M A;  1N33 I;  1QU6 A;  1WHN A;  4DR3 E;  1FWK A;  1X49 A;  1YYO A;  5GME A;  4FN5 A;  2L3J A;  4DV1 E;  4OX9 I;  3ZKD A;  1I94 I;  1DI2 A;  4JI0 E;  1HNX E;  3Q1Q A;  4MYU A;  4X66 I;  4JI6 E;  4DR4 I;  1H74 A;  3V5R A;  1Z0W A;  4XTJ A;  3ZZ0 A;  3PYE A;  3D4J A;  4ZVI A;  4JI5 I;  3HUL A;  2LRS A;  4YY3 I;  4DV2 E;  3QT5 A;  4LFC I;  1NHH A;  2NUE A;  1H73 A;  3ADL A;  1HNZ I;  1HR0 I;  4DXL A;  1YZ9 A;  2B7T A;  3J7A G;  4EMD A;  2HKJ A;  1UEK A;  3WU4 A;  2JY9 A;  1ZXM A;  5GMD A;  3JAM C;  4DV7 I;  2L33 A;  3LPS A;  4HY1 A;  2LTR A;  5LMN I;  1Z0G A;  4DV0 E;  4DV3 I;  4JV5 I;  1XNQ I;  1N0U A;  1ZM3 A;  4R1F A;  4DR7 I;  2HFU A;  4LF8 E;  3OTO E;  2UUA E;  4X62 I;  1EKZ A;  3C4B A;  4FW9 A;  4LFA I;  4Z7C A;  1XMO I;  4HAC A;  5FLX C;  4X8W A;  1Z0V A;  4DUY E;  2E5L E;  1ZXN A;  2V8P A;  2UU9 E;  4P7A A;  4DU8 A;  1WHQ A;  4LF6 E;  1IBM I;  4LFB I;  2N3H A;  5BR8 I;  2UUC I;  4B3M I;  4GKK I;  4GKJ I;  4K0K I;  4JI2 I;  1J5E E;  4NXN I;  1MX0 A;  1RR9 A;  4URL A;  1NHJ A;  2V34 A;  4X65 I;  1HNW E;  1O0W A;  4B3R I;  2LUP B;  4LF5 I;  2VQF E;  4DR2 E;  5LMU I;  1GQE A;  1KVK A;  4DPU A;  4LF7 E;  2B7V A;  2EZ6 A;  4DV4 I;  1MG7 A;  1ZM2 A;  4JI4 I;  1N34 I;  2UUB E;  4DV5 E;  4B3S E;  1IBL E;  2JVA A;  1OJ4 A;  1T4O A;  4DR6 E;  2V2Q A;  4JI1 I;  2HKE A;  4DV6 I;  4USK A;  4JI8 E;  2HHH E;  2YT4 A;  1KKH A;  5IT9 C;  1T4N A;  2ZM6 E;  2CZ9 A;  4UTG A;  2UXD I;  1B63 A;  1QZR A;  2LBS B;  1XMQ E;  4JI3 E;  4NXM E;  1DAR A;  4AQY E;  4JYA I;  2X7I A;  1N32 E;  4FWD A;  2UXC E;  1Z0E A;  2J7K A;  1PIE A;  1Z5A A;  2LJH A;  4X64 E;  2OI2 A;  3ZKB A;  3H4L A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  2EOR A;  2YSP A;  1RC7 A;  1Z0B A;  1PVG A;  3CDI A;  2F4V E;  2YTO A;  4B3T E;  4M1K A;  2RQL A;  5F3W A;  2ZIT A;  2EMG A;  3B82 A;  3EQ1 A;  3Q6M A;  1FJG I;  4KQV A;  2V89 A;  4HXZ A;  1IBK I;  4LF9 I;  2F1D A;  1N33 E;  1D6T A;  4WYQ B;  2JEB A;  2FGG A;  2VF3 A;  2BA1 G;  1Y5Y A;  1Z0C A;  2YTQ A;  3F6G A;  2BA1 D;  2HFS A;  1ZBT A;  2A25 A;  1ZR9 A;  2AE8 A;  4FWG A;  2YTG A;  1JK1 A;  2LJP A;  4BHC A;  4WX9 A;  2YRH A;  2O1T A;  4OX9 E;  2G7H A;  2YSO A;  1I94 E;  1UIL A;  2KOU A;  1KIJ A;  3WU3 A;  3OML A;  1OYP A;  1Y6Z A;  2EMA A;  2V85 A;  2LVH A;  4MLQ A;  4X66 E;  1EI1 A;  4HAC B;  2WBU A;  4DR4 E;  4Z7Y A;  2EOF A;  1BBO A;  2B9D A;  1PKP A;  3K1J A;  3LML A;  1RQ0 A;  3ADJ A;  1T4L B;  1SR9 A;  4IZK B;  2PNZ B;  2UXB I;  2L3C A;  2MKN A;  2O1V A;  2EOJ A;  3HKM A;  2EMK A;  5CFF E;  4DR5 I;  3QT7 A;  2AJ4 A;  3HTX A;  1STU A;  5L3J A;  3LLH A;  2VQE I;  4JI5 E;  3JTZ A;  2NA2 A;  5K36 E;  4JI7 I;  2Q8U A;  3THN A;  2JE6 A;  5A2Q Q;  1WXR A;  4YY3 E;  2V87 A;  2ZBK B;  1XNR I;  4BS9 A;  2DMY A;  2LUQ A;  2IHR 1;  1AAY A;  4PU9 A;  4O5G A;  1HNZ E;  1HR0 E;  1UN6 B;  2NPF A;  5K36 B;  2EPC A;  1ZBQ A;  2L2N A;  1Z5C A;  4LF4 I;  2EM9 A;  2Z5C B;  1G2D C;  2EJ4 A;  5A2Q C;  4MDT A;  2JYA A;  2K4V A;  5IWA I;  1YPN A;  1SFE A;  4USM A;  2E1M A;  2JEA B;  4ISA A;  4DV7 E;  1Z1B A;  3F6H A;  2EOQ A;  2EPX A;  5JEA E;  4DR1 I;  3ADG A;  2PO1 B;  2EFG A;  2CG9 A;  2HK2 A;  4F6N A;  1N36 I;  1X3C A;  4GZN C;  5LMN E;  4R8O A;  5A69 A;  4DV3 E;  1T38 A;  4JV5 E;  1NEI A;  2BV3 A;  1XNQ E;  3B8H A;  2CSH A;  1P47 A;  3UHM A;  2YRM A;  2BA0 G;  2Z5C A;  4YHH I;  4FK5 C;  4F9A B;  4DR7 E;  2EQ3 A;  2GHF A;  2WW4 A;  2ODR C;  4X62 E;  3J7Y p;  5JEA B;  4LFA E;  1BB8 A;  5DNL A;  3T1Y I;  3PYF A;  2DMI A;  4ZYE A;  3T1H I;  5LLQ A;  4R2A A;  1EA6 A;  1XMO E;  1IQS A;  4KHP E;  2EN7 A;  2NN6 C;  2RSM A;  2A2C A;  2DEJ A;  1G2F C;  1VIS A;  4DUZ I;  2X36 A;  4FWH A;  2MC5 A;  2EMH A;  2L8T A;  3BF2 A;  4WXD A;  3VHT B;  1FI4 A;  1ZM4 A;  1A1J A;  4WUB A;  2MDG A;  4RPF A;  4DR3 I;  5DNY A;  1MU5 A;  1H7S A;  2GS8 A;  4IFD F;  4HEI A;  2ELY A;  1BKN A;  3F0N A;  3K17 A;  1IBM E;  5AC4 A;  4LFB E;  2IES A;  2BM1 A;  5BR8 E;  4HYM A;  2UUC E;  4B3M E;  4GKK E;  1P42 A;  2RTX A;  4PRX A;  4QNK A;  1UDO A;  4DPY A;  5KL2 A;  3J80 Q;  4DV1 I;  3ZOQ B;  4GKJ E;  4K0K E;  4JI2 E;  2NAB A;  2EMW A;  5A6A A;  3EPJ A;  2NN6 F;  2RS6 A;  3ADI A;  4JI0 I;  4OO1 C;  1ELO A;  2BR2 A;  1HNX I;  4NXN E;  2EN2 A;  2N3G A;  4ED4 A;  2R42 A;  4MYT A;  4WXC A;  1EH6 A;  2Q2E B;  3GLL A;  4JI6 I;  2CPN A;  2JOX A;  3J81 Q;  2C37 B;  3K6Q A;  2L6M A;  5AE3 A;  4X65 E;  3UK3 C;  3VYX A;  2C39 A;  4ZYG A;  1TN9 A;  2R3V A;  2JR1 A;  2DEI A;  3M6A A;  3P06 A;  5C0X B;  2EOO A;  4P7D A;  4UT4 A;  4BMJ A;  1WUU A;  1FWL A;  1UDS A;  3U1K A;  1UDQ A;  3LTO A;  2O3Z A;  4B3R E;  4LF5 E;  2LJU A;  5LMU E;  4FW3 A;  1KTV A;  2CVE A;  2PO0 B;  1VI7 A;  4BC7 A;  4I3H A;  4DV2 I;  4OO1 F;  1QNT A;  2RSI A;  4DV4 E;  1USV A;  1X6E A;  1A1H A;  5KL7 A;  2GLI A;  4JI4 E;  4LCF A;  4DPW A;  5KL3 A;  5FWK A;  5KL6 A;  1XHK A;  2BM0 A;  2JEB B;  1H72 C;  1FKA E;  1N34 E;  1E3H A;  1E3P A;  5AE1 A;  3IWB A;  2L2K B;  2V2Z A;  3BID A;  3DJW A;  2O1W A;  1A1I A;  4JI1 E;  2N8X A;  2DB2 A;  4BCA A;  2BBG A;  2FTX B;  4DV6 E;  2I13 A;  2PO0 A;  2EPA A;  1ZM9 A;  2GO4 A;  5LL6 R;  1A1K A;  3QT6 A;  2LMZ A;  2V2V A;  1Z0T A;  5TSE A;  1YFH A;  1TF6 A;  4DV0 I;  5T6J A;  2UXD E;  1RHY A;  3PRY A;  1NCS A;  2VE7 C;  5DRR A;  3B78 A;  1UHZ A;  4WPY A;  3M7N G;  4HTG A;  4M2Z A;  2PO2 A;  2LTS A;  2FV4 B;  2L92 A;  4IZJ D;  3WU5 A;  3H09 A;  1J26 A;  1N3G A;  2EQ1 A;  4R2S A;  1OYS A;  3OTO I;  2UUA I;  4ZYH A;  4LF8 I;  3J7A M;  2EPP A;  1YYK A;  2KHX A;  4JYA E;  4DU7 A;  1F2I G;  3NZK A;  3MHS C;  4P52 A;  2JE6 B;  3THO B;  2NUF A;  3P1X A;  3PS1 A;  3JAM Q;  1B69 A;  3LNU A;  4RH8 A;  3KWR A;  1YYW A;  4DUY I;  2E5L I;  4MQY A;  4L8N A;  4R03 A;  2C38 A;  4NZV A;  2WBS A;  3M85 G;  2UU9 I;  1K47 A;  1X48 A;  2YU8 A;  5K36 C;  4IFD D;  2EN3 A;  4M9V C;  2XEX A;  4LF6 I;  5A6K A;  2GPI A;  1Y4S A;  1GZ6 A;  2ODR D;  4TUG A;  4LFC E;  4MU0 A;  3C6M A;  1FJG E;  4LPF A;  2O1U A;  4BC9 A;  1IBK E;  4LF9 E;  3ZZT A;  4FW7 A;  2ADR A;  4NBQ A;  1J5E I;  2EM8 A;  2NN6 D;  2JXP A;  1X5W A;  1B62 A;  2EPL X;  2LV2 A;  1S4E A;  1EH8 A;  4MU1 A;  5AE2 A;  5FLX Q;  1RRE A;  1R6M A;  3KZY A;  3GCM A;  2LO3 A;  3PS3 A;  1N0V C;  1YUJ A;  1NZ0 A;  2E72 A;  1Z5B A;  3VYY A;  1HNW I;  5K36 F;  2EOI A;  2YTN A;  4X9J A;  1A1F A;  2V83 A;  2LT7 A;  2WCC 3;  2HJJ A;  4OOG C;  2B3T B;  2M9A A;  1RMD A;  2VQF I;  4KHP I;  4DR2 I;  4IS9 A;  4U3B A;  1T39 A;  3P3E A;  4LF7 I;  5DRP A;  4AID A;  2UXB E;  2J65 A;  2Z5E A;  4OO1 D;  3ZZU A;  4IFD C;  2EML A;  2E1R A;  4JG4 A;  2BA0 D;  4PRV A;  2EOH A;  1X6F A;  3M99 B;  4DR5 E;  1Z59 A;  4OZE A;  4DV5 I;  2UUB I;  4B3S I;  3EPK A;  2VQE E;  2IOQ A;  1IBL I;  4DR6 I;  4JI7 E;  2EOY A;  5AAS A;  4BA2 A;  4N4R B;  2WZO A;  2DIX A;  4DPX A;  5DRQ A;  2WBT A;  1BBG A;  1XNR E;  3WU6 A;  5JEA F;  1H7U A;  2EOS A;  4WUC A;  4JI8 I;  2EWL A;  4DMI A;  1UBD C;  2DGC A;  4WUD A;  1S16 A;  2BB8 A;  2MDR A;  2HHH I;  2BR2 B;  2Z5B A;  2EM6 A;  1IQO A;  2EOX A;  2WNR A;  2ZM6 I;  4DKK A;  1L4S A;  2JWO A;  3IWC A;  2EP3 A;  4LF4 E;  2EM3 A;  2YTP A;  2C39 B;  3PS2 A;  2EMF A;  3ZM7 A;  1XMQ I;  1R6L A;  2EL5 A;  1U2R A;  5IWA E;  4JI3 I;  4J3D A;  5C0X C;  2NUG A;  4Q35 B;  1A6F A;  3CWV A;  4NXM I;  2DLK A;  1ZAA C;  4AQY I;  2EE8 A;  4DR1 E;  2EMC A;  1N36 E;  4IZJ A;  4M0V A;  2EN4 A;  2R1F A;  1PJS A;  5EL9 A;  2A2D A;  2EOE A;  4IS1 C;  2IOP A;  1N32 I;  3PYD A;  2RS7 A;  1FNM A;  3QT8 A;  2HK3 A;  2UXC I;  4M30 A;  4YHH E;  2EPO A;  1A1G A;  1KJK A;  2GQ0 A;  4LOM A;  2YTJ A;  1X47 A;  4X64 I;  5IT9 Q;  3J80 C;  5AC5 A;  2H36 X;  2PNL A;  3KRN A;  2HC5 A;  3T1Y E;  4R2Q A;  3T1H E;  5C0X F;  3PYG A;  4F54 A;  4DPT A;  2EMY A;  2YTD A;  2F4V I;  1NHI A;  1Y4U A;  3GON A;  4DUZ E;  3J81 C;  4B3T I;  2I9I A;  4U3D A;  4IFD A;  3C4T A;  4WFT A;  3V2U C;  2KON A;  2CT1 A;  2L2M A;  4OO1 E;  1N33 I;  2PRT A;  1QU6 A;  2EOM A;  3K85 A;  2LE2 A;  1WHN A;  4DR3 E;  1FWK A;  1X49 A;  2EMX A;  1WJP A;  1YYO A;  3TQM A;  2NN6 A;  5GME A;  4FN5 A;  2PO2 B;  2L3J A;  4LCG A;  1Y60 A;  3L00 A;  4DV1 E;  4LCH A;  4OX9 I;  4IZK A;  3ZKD A;  1X6H A;  4OO1 B;  2VRD A;  1I94 I;  5K36 D;  1AH5 A;  2EQ0 A;  4JI0 E;  1DI2 A;  2EN6 A;  1HNX E;  1PDA A;  4MYU A;  3Q1Q A;  4ZYD A;  4X66 I;  3MSW A;  1MEY C;  4JI6 E;  2HGH A;  4DR4 I;  1H74 A;  3V5R A;  1Z0W A;  4XTJ A;  3ZZ0 A;  1GTK A;  2EL4 A;  4BHB A;  3PYE A;  3M7N D;  2C38 B;  3D4J A;  4ZVI A;  4OO1 A;  3HQ1 A;  2EPK X;  3L7Z A;  3P76 A;  4JI5 I;  3HUL A;  4MU4 A;  4FW4 A;  2LRS A;  1KYQ A;  3BGH A;  4YY3 I;  4DV2 E;  3QT5 A;  4LFC I;  1WRJ A;  4R2R A;  2JPA A;  2NUE A;  1NHH A;  5JEA D;  4AIM A;  1XXE A;  1OYR A;  1H73 A;  3ADL A;  2EMZ A;  1HNZ I;  1HR0 I;  2M4I A;  4DXL A;  4IJD A;  1JK2 A;  2RPC A;  4F9B B;  4GEQ B;  1YZ9 A;  2B7T A;  5KL5 A;  3J7A G;  2HKJ A;  2CTD A;  1UEK A;  1PJQ A;  3MHH C;  2ELZ A;  3WU4 A;  4F6M A;  4EMD A;  4NHR A;  3M85 D;  2LCE A;  2JY9 A;  3KZZ A;  1ZXM A;  3HPS A;  1YUI A;  2IER A;  3ECR A;  4BBY A;  5GMD A;  3JAM C;  3U1Y A;  2ENC A;  4DV7 I;  2EMB A;  2L33 A;  5A6J A;  3LPS A;  4FW5 A;  3IWD A;  4HY1 A;  4RHB B;  1A1L A;  2LTR A;  2VES A;  5LMN I;  4O24 A;  4DV0 E;  1Z0G A;  2DLQ A;  4DV3 I;  4JV5 I;  1XNQ I;  3H1C A;  5DNX A;  1N0U A;  2EPU A;  1ZM3 A;  4R1F A;  5A6B D;  2MKD A;  1YHC A;  4DR7 I;  3AUZ A;  2HFU A;  4R2C A;  4LF8 E;  3OTO E;  3DF6 A;  2UUA E;  4X62 I;  1EKZ A;  2EPN A;  3C4B A;  4FW9 A;  4LFA I;  5JEA C;  4Z7C A;  2EPR A;  4BA2 B;  2YTE A;  2EMI A;  5C0X D;  4HAC A;  1XMO I;  3HJC A;  2M1S A;  4KWY A;  5EKW A;  2V88 A;  5FLX C;  1ZU1 A;  2PNZ A;  3CDJ A;  4X8W A;  1Z0V A;  4FW6 A;  4R2E A;  2V8Q B;  5ADZ A;  4DUY E;  2E5L E;  4I8O A;  1ZXN A;  4BA1 B;  2Z5B B;  1USU A;  2V8P A;  2WP8 B;  2WNR B;  1YSA C;  2UU9 E;  4P7A A;  2VF1 A;  4DU8 A;  1EH7 A;  4QNJ A;  1WHQ A;  1YH8 A;  2R76 A;  2MC6 A;  4LF6 E;  2EM0 A;  1IBM I;  1DGC A;  2N3H A;  4LFB I;  5BR8 I;  4WSG A;  5IXM B;  2UUC I;  4B3M I;  4GKK I;  1TF3 A;  2J7J A;  3DD6 A;  3GME A;  4JI2 I;  4GKJ I;  4K0K I;  4LU9 A;  2JT2 A;  5ELW A;  1J5E E;  4O4K A;  4IZJ B;  4P78 A;  2DRP A;  4BA1 A;  4NXN I;  1MX0 A;  2WP8 A;  2EPZ A;  4F9C B;  3P3G A;  5K36 A;  2JP9 A;  1RR9 A;  4AM3 A;  4URL A;  1NHJ A;  2V34 A;  4X65 I;  4IFD E;  2D9H A;  4R2D A;  1HNW E;  3B4T A;  2JOB A;  1O0W A;  2JEA A;  4L5N C;  2PO1 A;  4B3R I;  2YU5 A;  4LTY A;  2LUP B;  4LF5 I;  3Q6N A;  2VQF E;  4O43 A;  4DR2 E;  5LMU I;  2GO3 A;  2PNM A;  2YZT A;  4GQU A;  1GQE A;  2YRK A;  2YWQ A;  1KVK A;  2NN6 E;  2DSY A;  3P3C A;  4DPU A;  4LF7 E;  2EPM X;  2B7V A;  1IMU A;  4IFD B;  2EZ6 A;  4DV4 I;  1MG7 A;  1ZM2 A;  4JI4 I;  2EM7 A;  1PJT A;  2K7I A;  2UUB E;  1N34 I;  5JEA A;  4DV5 E;  4B3S E;  4KZS A;  1IBL E;  2JVA A;  1OJ4 A;  4MU3 A;  1T4O A;  4DR6 E;  2V86 A;  3JU0 A;  2V2Q A;  2NN6 B;  4JI1 I;  1MGT A;  5C0X E;  2EN8 A;  4Q28 A;  2HKE A;  5DRO A;  4DV6 I;  4USK A;  4JI8 E;  3EPL A;  2HHH E;  2YPN A;  2YT4 A;  5IT9 C;  1KKH A;  4WSP A;  4N3O A;  4MLV A;  1T4N A;  2ZM6 E;  2CZ9 A;  4UTG A;  2EM2 A;  2ENA A;  3RMP A;  2UXD I;  1B63 A;  1QZR A;  2LBS B;  1XMQ E;  4JI3 E;  1HK7 A;  3VK6 A;  3EPH A;  2EM4 A;  4NXM E;  2EN1 A;  1DAR A;  1DQ3 A;  2ENH A;  4R2P A;  4AQY E;  3HPZ A;  1LLM C;  4F2J C;  3L7Z B;  5IV8 B;  4JYA I;  5A6B A;  2YTF A;  2X7I A;  2EOZ A;  2M7Q A;  3HXL A;  3AV0 A;  5KL4 A;  1N32 E;  2CGE A;  4FWD A;  2UXC E;  1UDN A;  1Z0E A;  2C37 A;  4OKG A;  2EM5 A;  2J7K A;  2EL6 A;  3FIG A;  1PIE A;  1Z5A A;  4J8Z A;  2LJH A;  5C0X A;  4X64 E;  4TUI A;  3C6K A;  2OI2 A;  3ZKB A;  2F8B A;  3H4L A;  3BBG A;  2YTI A; 
#chains in the Genus database with same CATH homology
 1Z0B A;  1RC7 A;  1PVG A;  2F4V E;  4B3T E;  4M1K A;  5F3W A;  2ZIT A;  3B82 A;  3Q6M A;  1FJG I;  4KQV A;  2V89 A;  4HXZ A;  1IBK I;  4LF9 I;  1D6T A;  1N33 E;  4WYQ B;  2FGG A;  2VF3 A;  1Z0C A;  3F6G A;  2HFS A;  1ZBT A;  4FWG A;  2LJP A;  2O1T A;  4OX9 E;  2G7H A;  1I94 E;  1UIL A;  2KOU A;  1KIJ A;  3WU3 A;  3OML A;  1Y6Z A;  2V85 A;  1EI1 A;  4X66 E;  4HAC B;  5FWK A;  4DR4 E;  4Z7Y A;  2B9D A;  1PKP A;  3K1J A;  3LML A;  1RQ0 A;  3ADJ A;  1T4L B;  1SR9 A;  4IZK B;  2UXB I;  2L3C A;  2O1V A;  5CFF E;  4DR5 I;  3QT7 A;  2AJ4 A;  3HTX A;  1STU A;  5L3J A;  3LLH A;  2VQE I;  4JI5 E;  3JTZ A;  2NA2 A;  4JI7 I;  5A2Q Q;  1WXR A;  4YY3 E;  2V87 A;  2ZBK B;  1XNR I;  4BS9 A;  2DMY A;  2LUQ A;  2IHR 1;  4PU9 A;  1HNZ E;  1HR0 E;  2NPF A;  1ZBQ A;  2L2N A;  1Z5C A;  4LF4 I;  2Z5C B;  5A2Q C;  2K4V A;  5IWA I;  4USM A;  2E1M A;  4DV7 E;  3F6H A;  4DR1 I;  3ADG A;  2EFG A;  2CG9 A;  2HK2 A;  1N36 I;  5LMN E;  4R8O A;  4DV3 E;  2BV3 A;  4JV5 E;  1XNQ E;  3B8H A;  2Z5C A;  4YHH I;  4F9A B;  4DR7 E;  2WW4 A;  2ODR C;  4X62 E;  3J7Y p;  4LFA E;  3T1Y I;  3PYF A;  3T1H I;  1EA6 A;  1XMO E;  4KHP E;  2RSM A;  2A2C A;  2DEJ A;  1VIS A;  4DUZ I;  2X36 A;  4FWH A;  2MC5 A;  2L8T A;  1FI4 A;  1ZM4 A;  4WUB A;  4RPF A;  4DR3 I;  5DNY A;  1MU5 A;  1H7S A;  2GS8 A;  1BKN A;  3F0N A;  3K17 A;  1IBM E;  4LFB E;  2BM1 A;  5BR8 E;  4HYM A;  2UUC E;  4B3M E;  4GKK E;  4PRX A;  2RTX A;  4DPY A;  3J80 Q;  4DV1 I;  3ZOQ B;  4GKJ E;  4K0K E;  4JI2 E;  2RS6 A;  3ADI A;  4JI0 I;  1ELO A;  1HNX I;  4NXN E;  2N3G A;  4ED4 A;  2R42 A;  4MYT A;  4JI6 I;  2Q2E B;  2CPN A;  2JOX A;  3J81 Q;  3K6Q A;  2L6M A;  5AE3 A;  4X65 E;  3VYX A;  3M6A A;  3P06 A;  2R3V A;  2JR1 A;  2DEI A;  4P7D A;  4UT4 A;  4BMJ A;  1WUU A;  1FWL A;  3LTO A;  4B3R E;  4LF5 E;  5LMU E;  1KTV A;  4BC7 A;  4I3H A;  4DV2 I;  4DV4 E;  1USV A;  4DPW A;  4JI4 E;  1XHK A;  2BM0 A;  1H72 C;  1FKA E;  1N34 E;  5AE1 A;  3IWB A;  2L2K B;  2V2Z A;  3DJW A;  2O1W A;  4JI1 E;  4BCA A;  2DB2 A;  2FTX B;  4DV6 E;  1ZM9 A;  5LL6 R;  3QT6 A;  2LMZ A;  2V2V A;  1Z0T A;  4DV0 I;  5T6J A;  2UXD E;  3PRY A;  2VE7 C;  3B78 A;  1UHZ A;  4WPY A;  4M2Z A;  2LTS A;  2FV4 B;  2L92 A;  4IZJ D;  3WU5 A;  3H09 A;  1J26 A;  4LF8 I;  3OTO I;  2UUA I;  3J7A M;  1YYK A;  2KHX A;  4JYA E;  4DU7 A;  4P52 A;  2NUF A;  3P1X A;  3JAM Q;  3LNU A;  3KWR A;  1YYW A;  4DUY I;  2E5L I;  4L8N A;  4R03 A;  2UU9 I;  1K47 A;  1X48 A;  2XEX A;  4LF6 I;  1Y4S A;  1GZ6 A;  2ODR D;  4TUG A;  4LFC E;  1FJG E;  2O1U A;  4BC9 A;  1IBK E;  4LF9 E;  3ZZT A;  1J5E I;  1B62 A;  1S4E A;  5AE2 A;  5FLX Q;  1RRE A;  1N0V C;  1Z5B A;  1NZ0 A;  1HNW I;  3VYY A;  2V83 A;  4OOG C;  2B3T B;  2VQF I;  4KHP I;  4DR2 I;  4LF7 I;  2UXB E;  2Z5E A;  3ZZU A;  2E1R A;  4JG4 A;  4PRV A;  4DR5 E;  2UUB I;  1Z59 A;  4DV5 I;  4B3S I;  1IBL I;  2VQE E;  2IOQ A;  4DR6 I;  4JI7 E;  5AAS A;  2WZO A;  2DIX A;  4DPX A;  1XNR E;  3WU6 A;  1H7U A;  4WUC A;  4JI8 I;  2EWL A;  4DMI A;  4WUD A;  1S16 A;  2MDR A;  2HHH I;  2Z5B A;  2ZM6 I;  4DKK A;  2JWO A;  3IWC A;  4LF4 E;  3ZM7 A;  1XMQ I;  1U2R A;  4JI3 I;  5IWA E;  2NUG A;  1A6F A;  3CWV A;  4NXM I;  4AQY I;  4DR1 E;  1N36 E;  4IZJ A;  4M0V A;  1N32 I;  2A2D A;  2IOP A;  3PYD A;  1FNM A;  2RS7 A;  3QT8 A;  2HK3 A;  2UXC I;  4M30 A;  4YHH E;  2GQ0 A;  1X47 A;  4X64 I;  5IT9 Q;  3J80 C;  2PNL A;  2H36 X;  3T1Y E;  3T1H E;  3PYG A;  4F54 A;  4DPT A;  2F4V I;  1NHI A;  1Y4U A;  3GON A;  4DUZ E;  3J81 C;  4B3T I;  3C4T A;  4WFT A;  3V2U C;  2KON A;  2L2M A;  1N33 I;  1QU6 A;  3K85 A;  2LE2 A;  1WHN A;  4DR3 E;  1FWK A;  1X49 A;  1YYO A;  5GME A;  4FN5 A;  2L3J A;  4DV1 E;  4OX9 I;  3ZKD A;  1I94 I;  1DI2 A;  4JI0 E;  1HNX E;  3Q1Q A;  4MYU A;  4X66 I;  3MSW A;  4JI6 E;  4DR4 I;  1H74 A;  3V5R A;  1Z0W A;  4XTJ A;  3ZZ0 A;  3PYE A;  3D4J A;  4ZVI A;  3HQ1 A;  4JI5 I;  3HUL A;  2LRS A;  4YY3 I;  4DV2 E;  3QT5 A;  4LFC I;  1NHH A;  2NUE A;  1H73 A;  3ADL A;  1HNZ I;  1HR0 I;  2M4I A;  4DXL A;  4F9B B;  4GEQ B;  1YZ9 A;  2B7T A;  3J7A G;  4EMD A;  2HKJ A;  1UEK A;  3WU4 A;  2JY9 A;  1ZXM A;  3HPS A;  5GMD A;  4BBY A;  3JAM C;  4DV7 I;  2L33 A;  3LPS A;  3IWD A;  4HY1 A;  2LTR A;  5LMN I;  1Z0G A;  4DV0 E;  4DV3 I;  4JV5 I;  1XNQ I;  1N0U A;  1ZM3 A;  4R1F A;  4DR7 I;  3AUZ A;  2HFU A;  4LF8 E;  3OTO E;  3DF6 A;  2UUA E;  4X62 I;  1EKZ A;  3C4B A;  4FW9 A;  4LFA I;  4Z7C A;  1XMO I;  4HAC A;  3HJC A;  2M1S A;  2V88 A;  5FLX C;  4X8W A;  1Z0V A;  4IZK A;  4DUY E;  2V8Q B;  5ADZ A;  2E5L E;  1ZXN A;  4I8O A;  2Z5B B;  1USU A;  2V8P A;  2UU9 E;  4P7A A;  2VF1 A;  4DU8 A;  1WHQ A;  2MC6 A;  4LF6 E;  1IBM I;  4LFB I;  2N3H A;  5BR8 I;  2UUC I;  4B3M I;  4GKK I;  4GKJ I;  4K0K I;  4JI2 I;  4LU9 A;  1J5E E;  4IZJ B;  4P78 A;  4NXN I;  1MX0 A;  4F9C B;  1RR9 A;  4URL A;  1NHJ A;  2V34 A;  4X65 I;  1HNW E;  2JOB A;  1O0W A;  4L5N C;  4B3R I;  4LTY A;  2LUP B;  4LF5 I;  3Q6N A;  2VQF E;  4DR2 E;  5LMU I;  2PNM A;  2YZT A;  1GQE A;  1KVK A;  4DPU A;  2DSY A;  4LF7 E;  2B7V A;  2EZ6 A;  4DV4 I;  1MG7 A;  1ZM2 A;  4JI4 I;  1N34 I;  2UUB E;  4DV5 E;  4B3S E;  4KZS A;  1IBL E;  2JVA A;  1OJ4 A;  1T4O A;  4DR6 E;  2V86 A;  3JU0 A;  2V2Q A;  4JI1 I;  4Q28 A;  2HKE A;  4DV6 I;  4USK A;  4JI8 E;  2HHH E;  2YT4 A;  5IT9 C;  1KKH A;  4WSP A;  4N3O A;  1T4N A;  2ZM6 E;  2CZ9 A;  4UTG A;  3RMP A;  2UXD I;  1B63 A;  1QZR A;  2LBS B;  1XMQ E;  4JI3 E;  1HK7 A;  3VK6 A;  4NXM E;  1DAR A;  1DQ3 A;  4AQY E;  3HPZ A;  4JYA I;  2X7I A;  2M7Q A;  3HXL A;  3AV0 A;  1N32 E;  2CGE A;  4FWD A;  2UXC E;  1Z0E A;  2J7K A;  3FIG A;  1PIE A;  1Z5A A;  4J8Z A;  2LJH A;  4X64 E;  4TUI A;  2OI2 A;  3ZKB A;  2F8B A;  3H4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...