4GKKE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4gkkE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkkE02
2ZM6E 2A2DA 2UUBE 2EFGA 3V5RA 1H73A 4B3RI 2WW4A 4DPTA 2LUPB 2DB2A 4LF7I 2UUCE 2RS6A 2A2CA 4JI5E 4YHHE 2Q2EB 1A6FA 1S4EA 4JG4A 1HR0E 1Z0GA 1Z5AA 2UU9E 4DR7E 4DR6E 1ZM4A 2HK2A 4LFCI 1Z59A 2F4VE 4NXMI 1YYOA 2UXDI 3H4LA 4DV2I 4P7AA 4LF5I 4KHPE 2XEXA 2CPNA 1N33E 1IBLI 2NUGA 2HKJA 1B62A 1IBKI 4M30A 4OX9E 4DR2I 4X66I 1XNQE 1XMOI 2LUQA 3LPSA 4PRVA 2RSMA 5LMUE 4HYMA 4NXNI 3ADJA 4JI1I 4JV5E 4B3SI 4JI0I 3ADIA 2F4VI 3WU6A 1RQ0A 4URLA 1PVGA 1T4OA 5LL6R 4KHPI 2BM1A 3B8HA 2L2NA 4WUDA 4LF6E 1B63A 1GQEA 4DPWA 3ZZTA 3ZZ0A 3PYDA 4ZVIA 1ZM9A 4JI7E 2E1RA 3PYGA 5LMUI 1STUA 1D6TA 5A2QQ 1N32E 5A2QC 1NHHA 3J7Yp 1YYKA 1I94I 4HACB 4JV5I 2NPFA 4DV7E 1X48A 2NA2A 1N0UA 3B78A 4X62I 2BM0A 2UXCE 2ZBKB 4I3HA 2E5LI 2DMYA 1FKAE 4DV6E 2DIXA 4YY3E 1J5EI 4UTGA 4DR5I 4B3RE 1FNMA 1WHNA 3M6AA 3ZKBA 4LF7E 2LBSB 1FJGI 4LF4I 3C4BA 4GKJE 1HNZI 2BV3A 4WFTA 4XTJA 2VQFI 4NXME 2UXDE 2LJPA 4B3TI 1OJ4A 4DV2E 2VF3A 1WUUA 4LF5E 4LFBI 4DV1E 1KIJA 4UT4A 2HFUA 2B7TA 1IBLE 4DR3I 1IBKE 2MDRA 4DR2E 1X49A 1N36E 4X66E 5BR8I 1XMOE 3HTXA 3J80Q 2J7KA 2EZ6A 5FLXQ 4JI3I 5FLXC 2V2QA 4NXNE 4GKJI 1U2RA 1HNWI 4DV0I 4B3SE 4JI1E 3HULA 2RS7A 4JI0E 1YYWA 3OTOI 1UILA 2R3VA 5LMNI 2X36A 2L3JA 4DV1I 1H74A 1H7UA 1N36I 1RREA 4HACA 4X65I 3VYYA 1KTVA 4X64I 1XNRI 3ZKDA 5IWAI 2L33A 1I94E 1S16A 2CZ9A 4AQYI 4DU8A 1FI4A 3ADGA 5CFFE 4X62E 4DPUA 4DV4I 2E5LE 4M2ZA 4WUBA 4M1KA 4MYTA 4FN5A 1UEKA 2DEJA 4DUYI 3VYXA 1PIEA 2V34A 4JI6I 1J5EE 4DR5E 1QU6A 1FJGE 3ZM7A 3PYFA 4KQVA 1T4LB 4LF4E 4X8WA 1N34E 1HNZE 3P1XA 3K17A 2LTSA 1J26A 2VQFE 2V2VA 4FWGA 1N0VC 2L2KB 4B3TE 2HHHI 4LFBE 1MX0A 3ZZUA 4DR3E 5GMEA 2JY9A 4HY1A 4RPFA 1ZM3A 1K47A 4MYUA 5BR8E 1XMQE 2B7VA 4JI3E 3LLHA 3J81Q 1RC7A 3J81C 1N34I 4LFAI 4USMA 1HNWE 4DV0E 4JI2I 1PKPA 4DR4I 1DARA 4PRXA 3OTOE 2V8PA 1H7SA 5LMNE 1ZBTA 3K1JA 4EMDA 4DV5E 4DV3I 2UUAI 1NHJA 1EKZA 4Z7CA 3JAMQ 3JAMC 2OI2A 1UHZA 1BKNA 2B3TB 4X65E 1XMQI 1HNXI 3PYEA 2LJHA 3J80C 4FWHA 4X64E 1XNRE 3T1YE 1FWLA 5IWAE 2VQEI 4AQYE 4FWDA 3WU4A 4LF8I 4JI4I 3D4JA 2RTXA 1YZ9A 3T1HI 4DKKA 1Z0WA 4WUCA 4DV5I 4DV4E 1EA6A 5GMDA 3ADLA 2NUEA 4DPYA 4K0KE 1FWKA 1KVKA 1WHQA 1Z0VA 4OOGC 1NHIA 1QZRA 4GKKI 4DUZI 4DUYE 1Z5CA 4LF9E 4JI6E 1Z0TA 2UXBI 3T1YI 4DU7A 5L3JA 4JYAI 4B3MI 1NZ0A 2HKEA 4R1FA 4PU9A 2ZM6I 2UUBI 3GONA 2LTRA 1T4NA 2UUCI 4JI5I 4YHHI 4DR1E 4K0KI 4DXLA 4FW9A 5IT9Q 2DEIA 1HR0I 2HHHE 5IT9C 1MG7A 2UU9I 4DR7I 4DR6I 4LF9I 1ZM2A 3V2UC 1H72C 1Z0CA 4JI8E 1ZXMA 2N3HA 2L2MA 2YT4A 2JVAA 1N33I 1KKHA 2GS8A 4OX9I 2NUFA 4Z7YA 4LFAE 4DPXA 1XNQI 4JI2E 4DR4E 4HXZA 4DR1I 4ED4A 1ZXNA 3CWVA 1EI1A 4DV3E 2UUAE 4P52A 3B82A 1MU5A 4WYQB 3QT7A 4JI8I 3C4TA 1HNXE 2R42A 4LF6I 3J7AM 2X7IA 2IHR1 1RR9A 1Z5BA 1XHKA 2AJ4A 2VQEE 4LF8E 3QT6A 4JI4E 4USKA 1IBME 3F0NA 3T1HE 4JI7I 3QT8A 1N32I 1IBMI 3LTOA 2V2ZA 3WU5A 4DV7I 1DI2A 2HK3A 3LNUA 3QT5A 3Q1QA 3WU3A 1ELOA 2HFSA 4GKKE 4DUZE 2KHXA 2UXCI 1Z0BA 4LFCE 3J7AG 2ZITA 2LRSA 2UXBE 1VISA 1X47A 4DV6I 1O0WA 4JYAE 4B3ME 4YY3I 2N3GA 2L3CA 1Z0EA
chains in the Genus database with same CATH superfamily
2ZM6E 2A2DA 3L00A 2UUBE 2EFGA 4LCFA 3V5RA 2EPAA 1H73A 1USUA 4B3RI 2V8QB 4BC9A 2WW4A 4DPTA 2LUPB 2DB2A 4LF7I 2UUCE 2RS6A 2A2CA 2EN4A 2N8XA 4R2QA 4JI5E 2PNZA 4YHHE 4OO1E 1UDOA 2Q2EB 2LCEA 2YTOA 3Q6MA 1A6FA 3KZZA 2V83A 1S4EA 4JG4A 4F6MA 2EOMA 2NN6F 2HJJA 1HR0E 3K85A 1Z0GA 1Z5AA 4J8ZA 2PO0B 2UU9E 3JTZA 4DR7E 3HKMA 1AH5A 5DNYA 4DR6E 1ZM4A 5AE1A 2HK2A 4LFCI 2YTGA 1Z59A 3KZYA 5A6BD 2F4VE 2EM9A 4F2JC 4NXMI 1YYOA 1F2IG 2EOQA 2UXDI 1T39A 4BHCA 3H4LA 4DV2I 4P7AA 5T6JA 2AE8A 4LF5I 2VRDA 4KHPE 1A1HA 2XEXA 3PRYA 4OZEA 2EOYA 2CPNA 1N33E 2WP8B 1IBLI 4BA2A 2NUGA 2HKJA 1B62A 2V86A 1IBKI 4M30A 4OX9E 2JEBB 4DR2I 4IS1C 2NABA 2EM0A 2JT2A 2O1WA 4X66I 1JK2A 1XNQE 2K7IA 5KL2A 1XMOI 3THOB 1YHCA 3DD6A 2LUQA 3LPSA 5A6AA 4PRVA 2EPLX 2RSMA 5LMUE 4HYMA 4ZYDA 4NXNI 3ADJA 2BA0G 1OYSA 1P42A 2L8TA 4JI1I 2L92A 4JV5E 4B3SI 4JI0I 2PO2B 3F6GA 3ADIA 1UDQA 3WU6A 2F4VI 4R03A 1RQ0A 2DSYA 4URLA 4RH8A 3UHMA 2YRKA 1PVGA 2JOXA 4O43A 1T4OA 5LL6R 4IZJB 4IFDD 4KHPI 4WXDA 2BA0D 2BM1A 2KONA 2JOBA 4ZYEA 1L4SA 3B8HA 2L2NA 4NHRA 1UDNA 4WUDA 2EL5A 2EMKA 4LF6E 1B63A 2JWOA 4L8NA 1GQEA 2BA1G 2BR2A 2NN6E 2IESA 4DPWA 2EM8A 4BHBA 5LLQA 3VK6A 1UDSA 3ZZTA 3ZZ0A 5JEAB 2IERA 2G7HA 5AASA 3PYDA 2CSHA 2EPNA 2LO3A 4ZVIA 2JPAA 1ZM9A 5KL3A 2FGGA 2VF1A 4JI7E 2E1RA 3PYGA 2YTPA 3EPJA 5LMUI 1STUA 1KJKA 5A2QQ 1N32E 1D6TA 5KL4A 5A2QC 5DNXA 1A1LA 1NHHA 3J7Yp 1YYKA 1IMUA 3MHSC 2ODRD 2BA1D 4HACB 1I94I 4JV5I 3LMLA 2NPFA 4DV7E 1X48A 2EMLA 2PO1A 2NA2A 2EMAA 1N0UA 3B78A 5KL6A 4X62I 2EN1A 1Z1BA 3JU0A 2JE6B 2EE8A 2EN7A 2EOOA 2BM0A 2UXCE 4N4RB 4Q28A 2ZBKB 1A1KA 4I3HA 2E5LI 2DMYA 1FKAE 2EPOA 3OMLA 3UK3C 4DV6E 2R76A 5K36E 2EMXA 4FW3A 2GO3A 2C39B 2DIXA 4YY3E 1EH7A 1J5EI 1OYRA 4UTGA 5AE2A 4DR5I 4R2CA 1SFEA 5IV8B 4B3RE 1FNMA 1WHNA 2YSOA 3M6AA 3ZKBA 1ZBQA 4LF7E 2PO0A 2LBSB 1A1GA 1YSAC 1FJGI 3U1KA 4MLVA 3GMEA 2WZOA 3RMPA 2KOUA 2MC6A 4R2SA 2LE2A 2V87A 2JXPA 3THNA 4BMJA 4LF4I 3C4BA 2ENHA 4R2EA 2CT1A 4GKJE 2CVEA 1HNZI 5K36D 2F8BA 2BV3A 4IFDA 2V89A 4WFTA 4XTJA 2YTIA 2PO1B 4MDTA 2VQFI 4NXME 3C6KA 2WP8A 2M9AA 4F54A 2YSPA 3QG5C 4M9VC 2UXDE 2LJPA 2YWQA 2EM2A 1OJ4A 4B3TI 4DV2E 2JEBA 2VF3A 3DF6A 1WUUA 4LF5E 4LFBI 4DV1E 4IFDC 1KIJA 1RMDA 1TF3A 2PNLA 4UT4A 2EM6A 2LV2A 2HFUA 2B7TA 1IBLE 2I13A 2EPUA 4DR3I 1IBKE 1NEIA 2MDRA 1LLMC 2C38B 3IWCA 4DR2E 1QNTA 2YTFA 1X49A 4WXCA 1N36E 4X66E 3L7ZB 4ISAA 4LPFA 2EMBA 5BR8I 1MGTA 1XMOE 3HTXA 2FV4B 2EOSA 3IWDA 2J7KA 2EZ6A 5TSEA 3P3GA 5FLXQ 4JI3I 3ZOQB 2WBSA 2PO2A 5FLXC 3HQ1A 1ZU1A 2V2QA 1BB8A 3MHHC 4NXNE 4F6NA 4GKJI 1U2RA 2ODRC 1HNWI 4HTGA 4B3SE 4JI1E 2RQLA 3HULA 4DV0I 4IZJA 2RS7A 2EOIA 2EPMX 4JI0E 5DROA 1X6EA 1YYWA 5C0XE 3OTOI 1UILA 2Z5CB 2R3VA 1DQ3A 5LMNI 1WRJA 3TQMA 2X36A 5JEAA 4IFDB 2EM3A 1T38A 2L3JA 4DV1I 4MU0A 2EPZA 3Q6NA 4M0VA 5DRRA 4OO1D 2EM7A 1H74A 1USVA 2C37A 2L6MA 1H7UA 2EOXA 4TUGA 2M4IA 4WSGA 2WNRB 1N36I 4F9CB 4R2AA 1JK1A 5JEAC 1E3HA 1RREA 4HACA 4X65I 4FW7A 3VYYA 1KTVA 3CDJA 2EM4A 4F9BB 4X64I 5C0XD 1XNRI 2DLQA 3ZKDA 2F1DA 2JE6A 1XXEA 4TUIA 5IWAI 2L33A 3BF2A 1I94E 5JEAF 3AUZA 1S16A 2CZ9A 2EOFA 4AQYI 2YRHA 1ZAAC 4DU8A 4LU9A 1FI4A 3ADGA 2VESA 1G2DC 5CFFE 4X62E 4N3OA 3EPLA 4DPUA 2YTQA 3KWRA 4DV4I 3KRNA 2C39A 2E5LE 4M2ZA 1YFHA 1YPNA 2EMIA 4WUBA 4M1KA 4MYTA 3PS3A 4FN5A 4FW6A 1WJPA 3U1YA 1UEKA 2DEJA 4DUYI 4F9AB 4WSPA 3VYXA 1PIEA 2V34A 4JI6I 1J5EE 2C37B 4DR5E 5ELWA 4ZYHA 1EH6A 2EPCA 1KYQA 2PNMA 4O4KA 3BIDA 1B69A 1QU6A 1IQSA 2I9IA 1FJGE 2O1TA 2EPXA 3CDIA 3ZM7A 5A6BA 2A25A 3PYFA 2EPRA 4KQVA 3GLLA 1T4LB 2EPPA 2Z5BB 2VE7C 5AE3A 2MDGA 4LF4E 2NN6D 4X8WA 5IXMB 1N34E 5K36B 1HNZE 1PJSA 4QNJA 2O3ZA 1PDAA 3P1XA 1P47A 2CGEA 3K17A 2LMZA 2LTSA 1J26A 4MU1A 4OO1A 2VQFE 1TF6A 2V2VA 2CTDA 4FWGA 1N0VC 2L2KB 1ZR9A 2EMFA 2C38A 2EQ1A 4B3TE 2HHHI 3HPZA 1R6LA 2MKDA 2M1SA 4MU3A 4LFBE 4FW5A 3L7ZA 1MX0A 4R2RA 4OO1C 3ZZUA 3J80Q 4R2PA 4DR3E 5GMEA 2B9DA 2M7QA 4IS9A 2EMZA 2JY9A 2YZTA 3ECRA 2EMCA 4KWYA 4O5GA 4GZNC 5F3WA 1Y4SA 1ZM3A 4HY1A 1K47A 4MYUA 5BR8E 4OKGA 1XMQE 4RPFA 5KL5A 1PJQA 1AAYA 2B7VA 4JI3E 2DMIA 3LLHA 3J81Q 2YRMA 1RC7A 4GQUA 2Z5CA 3GCMA 3J81C 1N34I 1OYPA 2K4VA 4LFAI 4USMA 4BS9A 4DV0E 1HNWE 2EN3A 4JI2I 4FK5C 1PKPA 2BB8A 2EMGA 1DARA 4DR4I 4PRXA 3OTOE 4BCAA 2DRPA 2V8PA 2EL6A 1H7SA 5LMNE 1ZBTA 3K1JA 4MQYA 4EMDA 4DV5E 2WNRA 3C6MA 2ENCA 4DV3I 1Y60A 2RPCA 4OO1B 2UUAI 3H09A 1NHJA 1EKZA 4Z7CA 3P06A 3JAMQ 5DRPA 1X6FA 2O1UA 5KL7A 3JAMC 2OI2A 4J3DA 1R6MA 1UHZA 1G2FC 5DRQA 2Q8UA 1BKNA 5EKWA 2B3TB 4X65E 4RHBB 3F6HA 1XMQI 1HNXI 1X5WA 2LJHA 3B4TA 3J80C 3PYEA 4LCGA 2JEAB 2JP9A 5C0XB 4FWHA 4X64E 1XNRE 2NN6A 2WBUA 3T1YE 3HXLA 1FWLA 5IWAE 2D9HA 2EN8A 3VHTB 4MU4A 5AC4A 4IZKB 2VQEI 4AQYE 4FWDA 3WU4A 5A69A 4LF8I 4JI4I 3D4JA 2RTXA 1YZ9A 3T1HI 3HPSA 2EPKX 2NN6C 2O1VA 4DKKA 5FWKA 2EN2A 1Z0WA 4WUCA 4DV5I 4DV4E 2DGCA 1EA6A 5A6KA 3P76A 1A1JA 5GMDA 3ADLA 2NUEA 2YU8A 1RHYA 4DPYA 2YTNA 4DMIA 4K0KE 2YU5A 1FWKA 1WHQA 1KVKA 1Z0VA 4LTYA 4OOGC 1A1IA 1NHIA 4MLQA 1QZRA 4GKKI 4DUZI 4DUYE 1Z5CA 4LF9E 4JI6E 1GTKA 1HK7A 1Z0TA 2IOQA 2JR1A 2UXBI 3M85G 3T1YI 4HEIA 4DU7A 5K36A 5L3JA 4JYAI 1BBOA 4QNKA 4B3MI 1NZ0A 2HKEA 2EJ4A 4R1FA 4O24A 3EPHA 4PU9A 2HGHA 2NN6B 5EL9A 2ZM6I 2UUBI 1DGCA 2GQ0A 3GONA 2EQ3A 2LT7A 4BC7A 2LTRA 5K36C 1T4NA 2FTXB 3M85D 4IFDE 2UUCI 2YTEA 1EH8A 4JI5I 4YHHI 5DNLA 1Y5YA 2LJUA 4BBYA 4DR1E 4K0KI 4DXLA 4FW9A 5IT9Q 2V88A 4AIMA 2DEIA 1HR0I 2HHHE 5IT9C 2Z5BA 2E1MA 1MG7A 5K36F 4P7DA 2UU9I 4DR7I 3P3EA 2PNZB 3M99B 4R2DA 4DR6I 4LF9I 2GHFA 4X9JA 2Z5EA 2H36X 4I8OA 2CG9A 2EWLA 1ZM2A 1SR9A 3V2UC 3AV0A 2YPNA 4NBQA 4R8OA 1H72C 1Z0CA 4JI8E 2MKNA 1ZXMA 1Y4UA 2N3HA 2MC5A 2L2MA 2YT4A 4GEQB 3M7NG 2JVAA 1N33I 1KKHA 2GS8A 1E3PA 4WPYA 4OX9I 2NUFA 4Z7YA 1X6HA 2RSIA 2WBTA 2EM5A 3IWBA 4KZSA 4LFAE 4P78A 1PJTA 4DPXA 1XNQI 4JI2E 4U3BA 4BA2B 2BBGA 4DR4E 4HXZA 4DR1I 4ED4A 1ZXNA 3K6QA 4U3DA 4NZVA 4BA1A 3CWVA 3M7ND 1EI1A 5JEAE 2LVHA 4DV3E 1BBGA 1YUJA 2UUAE 4P52A 2IOPA 4FW4A 2EMYA 1TN9A 3B82A 1VI7A 1MU5A 2EMWA 2JEAA 4WYQB 2HC5A 5C0XA 3QT7A 3H1CA 4LCHA 4WX9A 5AC5A 2YTJA 1X3CA 2WCC3 1MEYC 1Y6ZA 3HJCA 4JI8I 2ENAA 3C4TA 4LOMA 1YUIA 1HNXE 1UBDC 4Q35B 4IZKA 4IZJD 4OO1F 2YTDA 2EQ0A 3DJWA 1A1FA 2GLIA 5C0XC 1WXRA 1NCSA 2R42A 4LF6I 3J7AM 2X7IA 3PS1A 3EPKA 2IHR1 1RR9A 1UN6B 1Z5BA 1XHKA 2AJ4A 5JEAD 2VQEE 2EMHA 1IQOA 4LF8E 4L5NC 3QT6A 4JI4E 4USKA 1IBME 3F0NA 3T1HE 2BR2B 3P3CA 2EOHA 4JI7I 3QT8A 2JYAA 5C0XF 1N32I 2R1FA 2J65A 2ELZA 1IBMI 2DLKA 3LTOA 2V2ZA 2ADRA 3PS2A 2EOZA 4IJDA 3WU5A 2EORA 4DV7I 1DI2A 2HK3A 2EOJA 3LNUA 1N3GA 3QT5A 5ADZA 4BA1B 3Q1QA 3WU3A 2J7JA 2GPIA 3BGHA 1ELOA 2HFSA 3FIGA 4GKKE 3NZKA 4DUZE 4AIDA 2KHXA 3EQ1A 4ZYGA 1Z0BA 2UXCI 5A6JA 4AM3A 4LFCE 2PRTA 3J7AG 2ZITA 2EN6A 2LRSA 2UXBE 1VISA 1X47A 4DV6I 1O0WA 2EL4A 1YH8A 4JYAE 2E72A 2EOEA 2EP3A 4B3ME 2GO4A 4IFDF 2ELYA 2N3GA 3BBGA 1GZ6A 2V85A 3MSWA 4YY3I 2L3CA 1Z0EA
chains in the Genus database with same CATH topology
2ZM6E 2A2DA 2UUBE 2EFGA 3V5RA 1H73A 1USUA 4B3RI 2V8QB 4BC9A 2WW4A 4DPTA 2LUPB 2DB2A 4LF7I 2UUCE 2RS6A 2A2CA 4JI5E 4YHHE 2Q2EB 3Q6MA 1A6FA 2V83A 1S4EA 4JG4A 3K85A 1HR0E 1Z0GA 1Z5AA 4J8ZA 2UU9E 3JTZA 4DR7E 5DNYA 4DR6E 1ZM4A 5AE1A 2HK2A 4LFCI 1Z59A 2F4VE 4NXMI 1YYOA 2UXDI 3H4LA 4DV2I 4P7AA 5T6JA 4LF5I 4KHPE 2XEXA 3PRYA 2CPNA 1N33E 1IBLI 2NUGA 2HKJA 1B62A 2V86A 1IBKI 4M30A 4OX9E 4DR2I 2O1WA 4X66I 1XNQE 1XMOI 2LUQA 3LPSA 4PRVA 2RSMA 5LMUE 4HYMA 4NXNI 3ADJA 2L8TA 4JI1I 2L92A 4JV5E 4B3SI 4JI0I 3F6GA 3ADIA 2F4VI 3WU6A 4R03A 1RQ0A 2DSYA 4URLA 1PVGA 2JOXA 1T4OA 5LL6R 4IZJB 4KHPI 2BM1A 2KONA 2JOBA 3B8HA 2L2NA 4WUDA 4LF6E 1B63A 2JWOA 4L8NA 1GQEA 4DPWA 3ZZTA 3VK6A 3ZZ0A 2G7HA 5AASA 3PYDA 4ZVIA 1ZM9A 2FGGA 2VF1A 4JI7E 2E1RA 3PYGA 5LMUI 1STUA 1D6TA 5A2QQ 1N32E 5A2QC 1NHHA 3J7Yp 1YYKA 1I94I 2ODRD 4HACB 4JV5I 3LMLA 2NPFA 4DV7E 1X48A 2NA2A 1N0UA 3B78A 4X62I 3JU0A 2BM0A 2UXCE 4Q28A 2ZBKB 4I3HA 2E5LI 2DMYA 1FKAE 3OMLA 4DV6E 2DIXA 4YY3E 1J5EI 4UTGA 5AE2A 4DR5I 4B3RE 1FNMA 1WHNA 3M6AA 3ZKBA 1ZBQA 4LF7E 2LBSB 1FJGI 2WZOA 3RMPA 2KOUA 2MC6A 2LE2A 2V87A 4BMJA 4LF4I 3C4BA 4GKJE 1HNZI 2F8BA 2BV3A 2V89A 4WFTA 4XTJA 2VQFI 4NXME 4F54A 2UXDE 2LJPA 4B3TI 1OJ4A 4DV2E 2VF3A 3DF6A 1WUUA 4LF5E 4LFBI 4DV1E 1KIJA 2PNLA 4UT4A 2HFUA 2B7TA 1IBLE 4DR3I 1IBKE 2MDRA 3IWCA 4DR2E 1X49A 1N36E 4X66E 5BR8I 1XMOE 3HTXA 3J80Q 2FV4B 2J7KA 3IWDA 2EZ6A 5FLXQ 4JI3I 3ZOQB 5FLXC 3HQ1A 2V2QA 4NXNE 4GKJI 1U2RA 2ODRC 1HNWI 4DV0I 4B3SE 4JI1E 3HULA 4IZJA 2RS7A 4JI0E 1YYWA 3OTOI 1UILA 2Z5CB 2R3VA 1DQ3A 5LMNI 2X36A 2L3JA 4DV1I 3Q6NA 4M0VA 1H74A 1USVA 2L6MA 1H7UA 4TUGA 2M4IA 1N36I 4F9CB 1RREA 4HACA 4X65I 3VYYA 1KTVA 4F9BB 4X64I 1XNRI 3ZKDA 4TUIA 5IWAI 2L33A 1I94E 3AUZA 1S16A 2CZ9A 4AQYI 4DU8A 4LU9A 1FI4A 3ADGA 4N3OA 5CFFE 4X62E 4DPUA 3KWRA 4DV4I 2E5LE 4M2ZA 4WUBA 4M1KA 4MYTA 4FN5A 1UEKA 2DEJA 4DUYI 4F9AB 4WSPA 3VYXA 1PIEA 2V34A 4JI6I 1J5EE 4DR5E 2PNMA 1QU6A 1FJGE 2O1TA 3ZM7A 3PYFA 4KQVA 1T4LB 2VE7C 5AE3A 4LF4E 4X8WA 1N34E 1HNZE 3P1XA 2CGEA 3K17A 2LMZA 2LTSA 1J26A 2VQFE 2V2VA 4FWGA 1N0VC 2L2KB 4B3TE 2HHHI 3HPZA 2M1SA 4LFBE 1MX0A 3ZZUA 4DR3E 5GMEA 2B9DA 2M7QA 2Z5BB 2JY9A 2YZTA 4HY1A 4RPFA 5F3WA 1Y4SA 1ZM3A 1K47A 4MYUA 5BR8E 1XMQE 2B7VA 4JI3E 3LLHA 3J81Q 1RC7A 2Z5CA 3J81C 1N34I 2K4VA 4LFAI 4USMA 4BS9A 4DV0E 1HNWE 4JI2I 1PKPA 4DR4I 1DARA 4PRXA 3OTOE 4BCAA 2V8PA 1H7SA 5LMNE 1ZBTA 3K1JA 4EMDA 4DV5E 4DV3I 2UUAI 3H09A 1NHJA 1EKZA 4Z7CA 3P06A 3JAMQ 2O1UA 3JAMC 2OI2A 1UHZA 1BKNA 2B3TB 4X65E 1XMQI 3F6HA 1HNXI 3PYEA 2LJHA 3J80C 4FWHA 4X64E 1XNRE 3T1YE 3HXLA 1FWLA 5IWAE 4IZKB 2VQEI 4AQYE 4FWDA 3WU4A 4LF8I 4JI4I 3D4JA 2RTXA 1YZ9A 3T1HI 3HPSA 2O1VA 4DKKA 5FWKA 1Z0WA 4WUCA 4DV5I 4DV4E 1EA6A 5GMDA 3ADLA 2NUEA 4DPYA 4DMIA 4K0KE 1FWKA 1KVKA 1WHQA 1Z0VA 4LTYA 4OOGC 1NHIA 1QZRA 4GKKI 4DUZI 4DUYE 1Z5CA 4LF9E 4JI6E 1HK7A 1Z0TA 2IOQA 2JR1A 2UXBI 3T1YI 4DU7A 5L3JA 4JYAI 4B3MI 1NZ0A 2HKEA 4R1FA 4PU9A 2ZM6I 2UUBI 2GQ0A 3GONA 4BC7A 2LTRA 1T4NA 2FTXB 2UUCI 4JI5I 4YHHI 4BBYA 4DR1E 4K0KI 4DXLA 4FW9A 5IT9Q 2V88A 2DEIA 1HR0I 2HHHE 5IT9C 2Z5BA 2E1MA 1MG7A 4P7DA 2UU9I 4DR7I 4DR6I 4LF9I 2Z5EA 2H36X 4I8OA 2CG9A 2EWLA 1ZM2A 1SR9A 3V2UC 3AV0A 4R8OA 1H72C 1Z0CA 4JI8E 1ZXMA 1Y4UA 2N3HA 2MC5A 2L2MA 2YT4A 4GEQB 2JVAA 1N33I 1KKHA 2GS8A 4WPYA 4OX9I 2NUFA 4Z7YA 4LFAE 3IWBA 4KZSA 4P78A 4DPXA 1XNQI 4JI2E 4DR4E 4HXZA 4DR1I 4ED4A 1ZXNA 3K6QA 3CWVA 1EI1A 4DV3E 2UUAE 4P52A 2IOPA 3B82A 1MU5A 4WYQB 3QT7A 3HJCA 1Y6ZA 4JI8I 3C4TA 1HNXE 4IZKA 4IZJD 3DJWA 1WXRA 2R42A 4LF6I 3J7AM 2X7IA 2IHR1 1RR9A 1Z5BA 1XHKA 2AJ4A 2VQEE 4LF8E 4L5NC 3QT6A 4JI4E 4USKA 1IBME 3F0NA 3T1HE 4JI7I 3QT8A 1N32I 1IBMI 3LTOA 2V2ZA 3WU5A 4DV7I 1DI2A 2HK3A 3LNUA 3QT5A 5ADZA 3Q1QA 3WU3A 1ELOA 2HFSA 3FIGA 4GKKE 4DUZE 2KHXA 2UXCI 1Z0BA 4LFCE 3J7AG 2ZITA 2LRSA 2UXBE 1VISA 1X47A 4DV6I 1O0WA 4JYAE 4B3ME 3MSWA 2N3GA 4YY3I 1GZ6A 2V85A 2L3CA 1Z0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 E;  2A2D A;  2UUB E;  2EFG A;  3V5R A;  1H73 A;  4B3R I;  2WW4 A;  4DPT A;  2LUP B;  2DB2 A;  4LF7 I;  2UUC E;  2RS6 A;  2A2C A;  4JI5 E;  4YHH E;  2Q2E B;  1A6F A;  1S4E A;  4JG4 A;  1HR0 E;  1Z0G A;  1Z5A A;  2UU9 E;  4DR7 E;  4DR6 E;  1ZM4 A;  2HK2 A;  4LFC I;  1Z59 A;  2F4V E;  4NXM I;  1YYO A;  2UXD I;  3H4L A;  4DV2 I;  4P7A A;  4LF5 I;  4KHP E;  2XEX A;  2CPN A;  1N33 E;  1IBL I;  2NUG A;  2HKJ A;  1B62 A;  1IBK I;  4M30 A;  4OX9 E;  4DR2 I;  4X66 I;  1XNQ E;  1XMO I;  2LUQ A;  3LPS A;  4PRV A;  2RSM A;  5LMU E;  4HYM A;  4NXN I;  3ADJ A;  4JI1 I;  4JV5 E;  4B3S I;  4JI0 I;  3ADI A;  2F4V I;  3WU6 A;  1RQ0 A;  4URL A;  1PVG A;  1T4O A;  5LL6 R;  4KHP I;  2BM1 A;  3B8H A;  2L2N A;  4WUD A;  4LF6 E;  1B63 A;  1GQE A;  4DPW A;  3ZZT A;  3ZZ0 A;  3PYD A;  4ZVI A;  1ZM9 A;  4JI7 E;  2E1R A;  3PYG A;  5LMU I;  1STU A;  1D6T A;  5A2Q Q;  1N32 E;  5A2Q C;  1NHH A;  3J7Y p;  1YYK A;  1I94 I;  4HAC B;  4JV5 I;  2NPF A;  4DV7 E;  1X48 A;  2NA2 A;  1N0U A;  3B78 A;  4X62 I;  2BM0 A;  2UXC E;  2ZBK B;  4I3H A;  2E5L I;  2DMY A;  1FKA E;  4DV6 E;  2DIX A;  4YY3 E;  1J5E I;  4UTG A;  4DR5 I;  4B3R E;  1FNM A;  1WHN A;  3M6A A;  3ZKB A;  4LF7 E;  2LBS B;  1FJG I;  4LF4 I;  3C4B A;  4GKJ E;  1HNZ I;  2BV3 A;  4WFT A;  4XTJ A;  2VQF I;  4NXM E;  2UXD E;  2LJP A;  4B3T I;  1OJ4 A;  4DV2 E;  2VF3 A;  1WUU A;  4LF5 E;  4LFB I;  4DV1 E;  1KIJ A;  4UT4 A;  2HFU A;  2B7T A;  1IBL E;  4DR3 I;  1IBK E;  2MDR A;  4DR2 E;  1X49 A;  1N36 E;  4X66 E;  5BR8 I;  1XMO E;  3HTX A;  3J80 Q;  2J7K A;  2EZ6 A;  5FLX Q;  4JI3 I;  5FLX C;  2V2Q A;  4NXN E;  4GKJ I;  1U2R A;  1HNW I;  4DV0 I;  4B3S E;  4JI1 E;  3HUL A;  2RS7 A;  4JI0 E;  1YYW A;  3OTO I;  1UIL A;  2R3V A;  5LMN I;  2X36 A;  2L3J A;  4DV1 I;  1H74 A;  1H7U A;  1N36 I;  1RRE A;  4HAC A;  4X65 I;  3VYY A;  1KTV A;  4X64 I;  1XNR I;  3ZKD A;  5IWA I;  2L33 A;  1I94 E;  1S16 A;  2CZ9 A;  4AQY I;  4DU8 A;  1FI4 A;  3ADG A;  5CFF E;  4X62 E;  4DPU A;  4DV4 I;  2E5L E;  4M2Z A;  4WUB A;  4M1K A;  4MYT A;  4FN5 A;  1UEK A;  2DEJ A;  4DUY I;  3VYX A;  1PIE A;  2V34 A;  4JI6 I;  1J5E E;  4DR5 E;  1QU6 A;  1FJG E;  3ZM7 A;  3PYF A;  4KQV A;  1T4L B;  4LF4 E;  4X8W A;  1N34 E;  1HNZ E;  3P1X A;  3K17 A;  2LTS A;  1J26 A;  2VQF E;  2V2V A;  4FWG A;  1N0V C;  2L2K B;  4B3T E;  2HHH I;  4LFB E;  1MX0 A;  3ZZU A;  4DR3 E;  5GME A;  2JY9 A;  4HY1 A;  4RPF A;  1ZM3 A;  1K47 A;  4MYU A;  5BR8 E;  1XMQ E;  2B7V A;  4JI3 E;  3LLH A;  3J81 Q;  1RC7 A;  3J81 C;  1N34 I;  4LFA I;  4USM A;  1HNW E;  4DV0 E;  4JI2 I;  1PKP A;  4DR4 I;  1DAR A;  4PRX A;  3OTO E;  2V8P A;  1H7S A;  5LMN E;  1ZBT A;  3K1J A;  4EMD A;  4DV5 E;  4DV3 I;  2UUA I;  1NHJ A;  1EKZ A;  4Z7C A;  3JAM Q;  3JAM C;  2OI2 A;  1UHZ A;  1BKN A;  2B3T B;  4X65 E;  1XMQ I;  1HNX I;  3PYE A;  2LJH A;  3J80 C;  4FWH A;  4X64 E;  1XNR E;  3T1Y E;  1FWL A;  5IWA E;  2VQE I;  4AQY E;  4FWD A;  3WU4 A;  4LF8 I;  4JI4 I;  3D4J A;  2RTX A;  1YZ9 A;  3T1H I;  4DKK A;  1Z0W A;  4WUC A;  4DV5 I;  4DV4 E;  1EA6 A;  5GMD A;  3ADL A;  2NUE A;  4DPY A;  4K0K E;  1FWK A;  1KVK A;  1WHQ A;  1Z0V A;  4OOG C;  1NHI A;  1QZR A;  4GKK I;  4DUZ I;  4DUY E;  1Z5C A;  4LF9 E;  4JI6 E;  1Z0T A;  2UXB I;  3T1Y I;  4DU7 A;  5L3J A;  4JYA I;  4B3M I;  1NZ0 A;  2HKE A;  4R1F A;  4PU9 A;  2ZM6 I;  2UUB I;  3GON A;  2LTR A;  1T4N A;  2UUC I;  4JI5 I;  4YHH I;  4DR1 E;  4K0K I;  4DXL A;  4FW9 A;  5IT9 Q;  2DEI A;  1HR0 I;  2HHH E;  5IT9 C;  1MG7 A;  2UU9 I;  4DR7 I;  4DR6 I;  4LF9 I;  1ZM2 A;  3V2U C;  1H72 C;  1Z0C A;  4JI8 E;  1ZXM A;  2N3H A;  2L2M A;  2YT4 A;  2JVA A;  1N33 I;  1KKH A;  2GS8 A;  4OX9 I;  2NUF A;  4Z7Y A;  4LFA E;  4DPX A;  1XNQ I;  4JI2 E;  4DR4 E;  4HXZ A;  4DR1 I;  4ED4 A;  1ZXN A;  3CWV A;  1EI1 A;  4DV3 E;  2UUA E;  4P52 A;  3B82 A;  1MU5 A;  4WYQ B;  3QT7 A;  4JI8 I;  3C4T A;  1HNX E;  2R42 A;  4LF6 I;  3J7A M;  2X7I A;  2IHR 1;  1RR9 A;  1Z5B A;  1XHK A;  2AJ4 A;  2VQE E;  4LF8 E;  3QT6 A;  4JI4 E;  4USK A;  1IBM E;  3F0N A;  3T1H E;  4JI7 I;  3QT8 A;  1N32 I;  1IBM I;  3LTO A;  2V2Z A;  3WU5 A;  4DV7 I;  1DI2 A;  2HK3 A;  3LNU A;  3QT5 A;  3Q1Q A;  3WU3 A;  1ELO A;  2HFS A;  4GKK E;  4DUZ E;  2KHX A;  2UXC I;  1Z0B A;  4LFC E;  3J7A G;  2ZIT A;  2LRS A;  2UXB E;  1VIS A;  1X47 A;  4DV6 I;  1O0W A;  4JYA E;  4B3M E;  4YY3 I;  2N3G A;  2L3C A;  1Z0E A; 
#chains in the Genus database with same CATH topology
 2ZM6 E;  2A2D A;  3L00 A;  2UUB E;  2EFG A;  4LCF A;  3V5R A;  2EPA A;  1H73 A;  1USU A;  4B3R I;  2V8Q B;  4BC9 A;  2WW4 A;  4DPT A;  2LUP B;  2DB2 A;  4LF7 I;  2UUC E;  2RS6 A;  2A2C A;  2EN4 A;  2N8X A;  4R2Q A;  4JI5 E;  2PNZ A;  4YHH E;  4OO1 E;  1UDO A;  2Q2E B;  2LCE A;  2YTO A;  3Q6M A;  1A6F A;  3KZZ A;  2V83 A;  1S4E A;  4JG4 A;  4F6M A;  2EOM A;  2NN6 F;  2HJJ A;  1HR0 E;  3K85 A;  1Z0G A;  1Z5A A;  4J8Z A;  2PO0 B;  2UU9 E;  3JTZ A;  4DR7 E;  3HKM A;  1AH5 A;  5DNY A;  4DR6 E;  1ZM4 A;  5AE1 A;  2HK2 A;  4LFC I;  2YTG A;  1Z59 A;  3KZY A;  5A6B D;  2F4V E;  2EM9 A;  4F2J C;  4NXM I;  1YYO A;  1F2I G;  2EOQ A;  2UXD I;  1T39 A;  4BHC A;  3H4L A;  4DV2 I;  4P7A A;  5T6J A;  2AE8 A;  4LF5 I;  2VRD A;  4KHP E;  1A1H A;  2XEX A;  3PRY A;  4OZE A;  2EOY A;  2CPN A;  1N33 E;  2WP8 B;  1IBL I;  4BA2 A;  2NUG A;  2HKJ A;  1B62 A;  2V86 A;  1IBK I;  4M30 A;  4OX9 E;  2JEB B;  4DR2 I;  4IS1 C;  2NAB A;  2EM0 A;  2JT2 A;  2O1W A;  4X66 I;  1JK2 A;  1XNQ E;  2K7I A;  5KL2 A;  1XMO I;  3THO B;  1YHC A;  3DD6 A;  2LUQ A;  3LPS A;  5A6A A;  4PRV A;  2EPL X;  2RSM A;  5LMU E;  4HYM A;  4ZYD A;  4NXN I;  3ADJ A;  2BA0 G;  1OYS A;  1P42 A;  2L8T A;  4JI1 I;  2L92 A;  4JV5 E;  4B3S I;  4JI0 I;  2PO2 B;  3F6G A;  3ADI A;  1UDQ A;  3WU6 A;  2F4V I;  4R03 A;  1RQ0 A;  2DSY A;  4URL A;  4RH8 A;  3UHM A;  2YRK A;  1PVG A;  2JOX A;  4O43 A;  1T4O A;  5LL6 R;  4IZJ B;  4IFD D;  4KHP I;  4WXD A;  2BA0 D;  2BM1 A;  2KON A;  2JOB A;  4ZYE A;  1L4S A;  3B8H A;  2L2N A;  4NHR A;  1UDN A;  4WUD A;  2EL5 A;  2EMK A;  4LF6 E;  1B63 A;  2JWO A;  4L8N A;  1GQE A;  2BA1 G;  2BR2 A;  2NN6 E;  2IES A;  4DPW A;  2EM8 A;  4BHB A;  5LLQ A;  3VK6 A;  1UDS A;  3ZZT A;  3ZZ0 A;  5JEA B;  2IER A;  2G7H A;  5AAS A;  3PYD A;  2CSH A;  2EPN A;  2LO3 A;  4ZVI A;  2JPA A;  1ZM9 A;  5KL3 A;  2FGG A;  2VF1 A;  4JI7 E;  2E1R A;  3PYG A;  2YTP A;  3EPJ A;  5LMU I;  1STU A;  1KJK A;  5A2Q Q;  1N32 E;  1D6T A;  5KL4 A;  5A2Q C;  5DNX A;  1A1L A;  1NHH A;  3J7Y p;  1YYK A;  1IMU A;  3MHS C;  2ODR D;  2BA1 D;  4HAC B;  1I94 I;  4JV5 I;  3LML A;  2NPF A;  4DV7 E;  1X48 A;  2EML A;  2PO1 A;  2NA2 A;  2EMA A;  1N0U A;  3B78 A;  5KL6 A;  4X62 I;  2EN1 A;  1Z1B A;  3JU0 A;  2JE6 B;  2EE8 A;  2EN7 A;  2EOO A;  2BM0 A;  2UXC E;  4N4R B;  4Q28 A;  2ZBK B;  1A1K A;  4I3H A;  2E5L I;  2DMY A;  1FKA E;  2EPO A;  3OML A;  3UK3 C;  4DV6 E;  2R76 A;  5K36 E;  2EMX A;  4FW3 A;  2GO3 A;  2C39 B;  2DIX A;  4YY3 E;  1EH7 A;  1J5E I;  1OYR A;  4UTG A;  5AE2 A;  4DR5 I;  4R2C A;  1SFE A;  5IV8 B;  4B3R E;  1FNM A;  1WHN A;  2YSO A;  3M6A A;  3ZKB A;  1ZBQ A;  4LF7 E;  2PO0 A;  2LBS B;  1A1G A;  1YSA C;  1FJG I;  3U1K A;  4MLV A;  3GME A;  2WZO A;  3RMP A;  2KOU A;  2MC6 A;  4R2S A;  2LE2 A;  2V87 A;  2JXP A;  3THN A;  4BMJ A;  4LF4 I;  3C4B A;  2ENH A;  4R2E A;  2CT1 A;  4GKJ E;  2CVE A;  1HNZ I;  5K36 D;  2F8B A;  2BV3 A;  4IFD A;  2V89 A;  4WFT A;  4XTJ A;  2YTI A;  2PO1 B;  4MDT A;  2VQF I;  4NXM E;  3C6K A;  2WP8 A;  2M9A A;  4F54 A;  2YSP A;  3QG5 C;  4M9V C;  2UXD E;  2LJP A;  2YWQ A;  2EM2 A;  1OJ4 A;  4B3T I;  4DV2 E;  2JEB A;  2VF3 A;  3DF6 A;  1WUU A;  4LF5 E;  4LFB I;  4DV1 E;  4IFD C;  1KIJ A;  1RMD A;  1TF3 A;  2PNL A;  4UT4 A;  2EM6 A;  2LV2 A;  2HFU A;  2B7T A;  1IBL E;  2I13 A;  2EPU A;  4DR3 I;  1IBK E;  1NEI A;  2MDR A;  1LLM C;  2C38 B;  3IWC A;  4DR2 E;  1QNT A;  2YTF A;  1X49 A;  4WXC A;  1N36 E;  4X66 E;  3L7Z B;  4ISA A;  4LPF A;  2EMB A;  5BR8 I;  1MGT A;  1XMO E;  3HTX A;  2FV4 B;  2EOS A;  3IWD A;  2J7K A;  2EZ6 A;  5TSE A;  3P3G A;  5FLX Q;  4JI3 I;  3ZOQ B;  2WBS A;  2PO2 A;  5FLX C;  3HQ1 A;  1ZU1 A;  2V2Q A;  1BB8 A;  3MHH C;  4NXN E;  4F6N A;  4GKJ I;  1U2R A;  2ODR C;  1HNW I;  4HTG A;  4B3S E;  4JI1 E;  2RQL A;  3HUL A;  4DV0 I;  4IZJ A;  2RS7 A;  2EOI A;  2EPM X;  4JI0 E;  5DRO A;  1X6E A;  1YYW A;  5C0X E;  3OTO I;  1UIL A;  2Z5C B;  2R3V A;  1DQ3 A;  5LMN I;  1WRJ A;  3TQM A;  2X36 A;  5JEA A;  4IFD B;  2EM3 A;  1T38 A;  2L3J A;  4DV1 I;  4MU0 A;  2EPZ A;  3Q6N A;  4M0V A;  5DRR A;  4OO1 D;  2EM7 A;  1H74 A;  1USV A;  2C37 A;  2L6M A;  1H7U A;  2EOX A;  4TUG A;  2M4I A;  4WSG A;  2WNR B;  1N36 I;  4F9C B;  4R2A A;  1JK1 A;  5JEA C;  1E3H A;  1RRE A;  4HAC A;  4X65 I;  4FW7 A;  3VYY A;  1KTV A;  3CDJ A;  2EM4 A;  4F9B B;  4X64 I;  5C0X D;  1XNR I;  2DLQ A;  3ZKD A;  2F1D A;  2JE6 A;  1XXE A;  4TUI A;  5IWA I;  2L33 A;  3BF2 A;  1I94 E;  5JEA F;  3AUZ A;  1S16 A;  2CZ9 A;  2EOF A;  4AQY I;  2YRH A;  1ZAA C;  4DU8 A;  4LU9 A;  1FI4 A;  3ADG A;  2VES A;  1G2D C;  5CFF E;  4X62 E;  4N3O A;  3EPL A;  4DPU A;  2YTQ A;  3KWR A;  4DV4 I;  3KRN A;  2C39 A;  2E5L E;  4M2Z A;  1YFH A;  1YPN A;  2EMI A;  4WUB A;  4M1K A;  4MYT A;  3PS3 A;  4FN5 A;  4FW6 A;  1WJP A;  3U1Y A;  1UEK A;  2DEJ A;  4DUY I;  4F9A B;  4WSP A;  3VYX A;  1PIE A;  2V34 A;  4JI6 I;  1J5E E;  2C37 B;  4DR5 E;  5ELW A;  4ZYH A;  1EH6 A;  2EPC A;  1KYQ A;  2PNM A;  4O4K A;  3BID A;  1B69 A;  1QU6 A;  1IQS A;  2I9I A;  1FJG E;  2O1T A;  2EPX A;  3CDI A;  3ZM7 A;  5A6B A;  2A25 A;  3PYF A;  2EPR A;  4KQV A;  3GLL A;  1T4L B;  2EPP A;  2Z5B B;  2VE7 C;  5AE3 A;  2MDG A;  4LF4 E;  2NN6 D;  4X8W A;  5IXM B;  1N34 E;  5K36 B;  1HNZ E;  1PJS A;  4QNJ A;  2O3Z A;  1PDA A;  3P1X A;  1P47 A;  2CGE A;  3K17 A;  2LMZ A;  2LTS A;  1J26 A;  4MU1 A;  4OO1 A;  2VQF E;  1TF6 A;  2V2V A;  2CTD A;  4FWG A;  1N0V C;  2L2K B;  1ZR9 A;  2EMF A;  2C38 A;  2EQ1 A;  4B3T E;  2HHH I;  3HPZ A;  1R6L A;  2MKD A;  2M1S A;  4MU3 A;  4LFB E;  4FW5 A;  3L7Z A;  1MX0 A;  4R2R A;  4OO1 C;  3ZZU A;  3J80 Q;  4R2P A;  4DR3 E;  5GME A;  2B9D A;  2M7Q A;  4IS9 A;  2EMZ A;  2JY9 A;  2YZT A;  3ECR A;  2EMC A;  4KWY A;  4O5G A;  4GZN C;  5F3W A;  1Y4S A;  1ZM3 A;  4HY1 A;  1K47 A;  4MYU A;  5BR8 E;  4OKG A;  1XMQ E;  4RPF A;  5KL5 A;  1PJQ A;  1AAY A;  2B7V A;  4JI3 E;  2DMI A;  3LLH A;  3J81 Q;  2YRM A;  1RC7 A;  4GQU A;  2Z5C A;  3GCM A;  3J81 C;  1N34 I;  1OYP A;  2K4V A;  4LFA I;  4USM A;  4BS9 A;  4DV0 E;  1HNW E;  2EN3 A;  4JI2 I;  4FK5 C;  1PKP A;  2BB8 A;  2EMG A;  1DAR A;  4DR4 I;  4PRX A;  3OTO E;  4BCA A;  2DRP A;  2V8P A;  2EL6 A;  1H7S A;  5LMN E;  1ZBT A;  3K1J A;  4MQY A;  4EMD A;  4DV5 E;  2WNR A;  3C6M A;  2ENC A;  4DV3 I;  1Y60 A;  2RPC A;  4OO1 B;  2UUA I;  3H09 A;  1NHJ A;  1EKZ A;  4Z7C A;  3P06 A;  3JAM Q;  5DRP A;  1X6F A;  2O1U A;  5KL7 A;  3JAM C;  2OI2 A;  4J3D A;  1R6M A;  1UHZ A;  1G2F C;  5DRQ A;  2Q8U A;  1BKN A;  5EKW A;  2B3T B;  4X65 E;  4RHB B;  3F6H A;  1XMQ I;  1HNX I;  1X5W A;  2LJH A;  3B4T A;  3J80 C;  3PYE A;  4LCG A;  2JEA B;  2JP9 A;  5C0X B;  4FWH A;  4X64 E;  1XNR E;  2NN6 A;  2WBU A;  3T1Y E;  3HXL A;  1FWL A;  5IWA E;  2D9H A;  2EN8 A;  3VHT B;  4MU4 A;  5AC4 A;  4IZK B;  2VQE I;  4AQY E;  4FWD A;  3WU4 A;  5A69 A;  4LF8 I;  4JI4 I;  3D4J A;  2RTX A;  1YZ9 A;  3T1H I;  3HPS A;  2EPK X;  2NN6 C;  2O1V A;  4DKK A;  5FWK A;  2EN2 A;  1Z0W A;  4WUC A;  4DV5 I;  4DV4 E;  2DGC A;  1EA6 A;  5A6K A;  3P76 A;  1A1J A;  5GMD A;  3ADL A;  2NUE A;  2YU8 A;  1RHY A;  4DPY A;  2YTN A;  4DMI A;  4K0K E;  2YU5 A;  1FWK A;  1WHQ A;  1KVK A;  1Z0V A;  4LTY A;  4OOG C;  1A1I A;  1NHI A;  4MLQ A;  1QZR A;  4GKK I;  4DUZ I;  4DUY E;  1Z5C A;  4LF9 E;  4JI6 E;  1GTK A;  1HK7 A;  1Z0T A;  2IOQ A;  2JR1 A;  2UXB I;  3M85 G;  3T1Y I;  4HEI A;  4DU7 A;  5K36 A;  5L3J A;  4JYA I;  1BBO A;  4QNK A;  4B3M I;  1NZ0 A;  2HKE A;  2EJ4 A;  4R1F A;  4O24 A;  3EPH A;  4PU9 A;  2HGH A;  2NN6 B;  5EL9 A;  2ZM6 I;  2UUB I;  1DGC A;  2GQ0 A;  3GON A;  2EQ3 A;  2LT7 A;  4BC7 A;  2LTR A;  5K36 C;  1T4N A;  2FTX B;  3M85 D;  4IFD E;  2UUC I;  2YTE A;  1EH8 A;  4JI5 I;  4YHH I;  5DNL A;  1Y5Y A;  2LJU A;  4BBY A;  4DR1 E;  4K0K I;  4DXL A;  4FW9 A;  5IT9 Q;  2V88 A;  4AIM A;  2DEI A;  1HR0 I;  2HHH E;  5IT9 C;  2Z5B A;  2E1M A;  1MG7 A;  5K36 F;  4P7D A;  2UU9 I;  4DR7 I;  3P3E A;  2PNZ B;  3M99 B;  4R2D A;  4DR6 I;  4LF9 I;  2GHF A;  4X9J A;  2Z5E A;  2H36 X;  4I8O A;  2CG9 A;  2EWL A;  1ZM2 A;  1SR9 A;  3V2U C;  3AV0 A;  2YPN A;  4NBQ A;  4R8O A;  1H72 C;  1Z0C A;  4JI8 E;  2MKN A;  1ZXM A;  1Y4U A;  2N3H A;  2MC5 A;  2L2M A;  2YT4 A;  4GEQ B;  3M7N G;  2JVA A;  1N33 I;  1KKH A;  2GS8 A;  1E3P A;  4WPY A;  4OX9 I;  2NUF A;  4Z7Y A;  1X6H A;  2RSI A;  2WBT A;  2EM5 A;  3IWB A;  4KZS A;  4LFA E;  4P78 A;  1PJT A;  4DPX A;  1XNQ I;  4JI2 E;  4U3B A;  4BA2 B;  2BBG A;  4DR4 E;  4HXZ A;  4DR1 I;  4ED4 A;  1ZXN A;  3K6Q A;  4U3D A;  4NZV A;  4BA1 A;  3CWV A;  3M7N D;  1EI1 A;  5JEA E;  2LVH A;  4DV3 E;  1BBG A;  1YUJ A;  2UUA E;  4P52 A;  2IOP A;  4FW4 A;  2EMY A;  1TN9 A;  3B82 A;  1VI7 A;  1MU5 A;  2EMW A;  2JEA A;  4WYQ B;  2HC5 A;  5C0X A;  3QT7 A;  3H1C A;  4LCH A;  4WX9 A;  5AC5 A;  2YTJ A;  1X3C A;  2WCC 3;  1MEY C;  1Y6Z A;  3HJC A;  4JI8 I;  2ENA A;  3C4T A;  4LOM A;  1YUI A;  1HNX E;  1UBD C;  4Q35 B;  4IZK A;  4IZJ D;  4OO1 F;  2YTD A;  2EQ0 A;  3DJW A;  1A1F A;  2GLI A;  5C0X C;  1WXR A;  1NCS A;  2R42 A;  4LF6 I;  3J7A M;  2X7I A;  3PS1 A;  3EPK A;  2IHR 1;  1RR9 A;  1UN6 B;  1Z5B A;  1XHK A;  2AJ4 A;  5JEA D;  2VQE E;  2EMH A;  1IQO A;  4LF8 E;  4L5N C;  3QT6 A;  4JI4 E;  4USK A;  1IBM E;  3F0N A;  3T1H E;  2BR2 B;  3P3C A;  2EOH A;  4JI7 I;  3QT8 A;  2JYA A;  5C0X F;  1N32 I;  2R1F A;  2J65 A;  2ELZ A;  1IBM I;  2DLK A;  3LTO A;  2V2Z A;  2ADR A;  3PS2 A;  2EOZ A;  4IJD A;  3WU5 A;  2EOR A;  4DV7 I;  1DI2 A;  2HK3 A;  2EOJ A;  3LNU A;  1N3G A;  3QT5 A;  5ADZ A;  4BA1 B;  3Q1Q A;  3WU3 A;  2J7J A;  2GPI A;  3BGH A;  1ELO A;  2HFS A;  3FIG A;  4GKK E;  3NZK A;  4DUZ E;  4AID A;  2KHX A;  3EQ1 A;  4ZYG A;  1Z0B A;  2UXC I;  5A6J A;  4AM3 A;  4LFC E;  2PRT A;  3J7A G;  2ZIT A;  2EN6 A;  2LRS A;  2UXB E;  1VIS A;  1X47 A;  4DV6 I;  1O0W A;  2EL4 A;  1YH8 A;  4JYA E;  2E72 A;  2EOE A;  2EP3 A;  4B3M E;  2GO4 A;  4IFD F;  2ELY A;  2N3G A;  3BBG A;  1GZ6 A;  2V85 A;  3MSW A;  4YY3 I;  2L3C A;  1Z0E A; 
#chains in the Genus database with same CATH homology
 2ZM6 E;  2A2D A;  2UUB E;  2EFG A;  3V5R A;  1H73 A;  1USU A;  4B3R I;  2V8Q B;  4BC9 A;  2WW4 A;  4DPT A;  2LUP B;  2DB2 A;  4LF7 I;  2UUC E;  2RS6 A;  2A2C A;  4JI5 E;  4YHH E;  2Q2E B;  3Q6M A;  1A6F A;  2V83 A;  1S4E A;  4JG4 A;  3K85 A;  1HR0 E;  1Z0G A;  1Z5A A;  4J8Z A;  2UU9 E;  3JTZ A;  4DR7 E;  5DNY A;  4DR6 E;  1ZM4 A;  5AE1 A;  2HK2 A;  4LFC I;  1Z59 A;  2F4V E;  4NXM I;  1YYO A;  2UXD I;  3H4L A;  4DV2 I;  4P7A A;  5T6J A;  4LF5 I;  4KHP E;  2XEX A;  3PRY A;  2CPN A;  1N33 E;  1IBL I;  2NUG A;  2HKJ A;  1B62 A;  2V86 A;  1IBK I;  4M30 A;  4OX9 E;  4DR2 I;  2O1W A;  4X66 I;  1XNQ E;  1XMO I;  2LUQ A;  3LPS A;  4PRV A;  2RSM A;  5LMU E;  4HYM A;  4NXN I;  3ADJ A;  2L8T A;  4JI1 I;  2L92 A;  4JV5 E;  4B3S I;  4JI0 I;  3F6G A;  3ADI A;  2F4V I;  3WU6 A;  4R03 A;  1RQ0 A;  2DSY A;  4URL A;  1PVG A;  2JOX A;  1T4O A;  5LL6 R;  4IZJ B;  4KHP I;  2BM1 A;  2KON A;  2JOB A;  3B8H A;  2L2N A;  4WUD A;  4LF6 E;  1B63 A;  2JWO A;  4L8N A;  1GQE A;  4DPW A;  3ZZT A;  3VK6 A;  3ZZ0 A;  2G7H A;  5AAS A;  3PYD A;  4ZVI A;  1ZM9 A;  2FGG A;  2VF1 A;  4JI7 E;  2E1R A;  3PYG A;  5LMU I;  1STU A;  1D6T A;  5A2Q Q;  1N32 E;  5A2Q C;  1NHH A;  3J7Y p;  1YYK A;  1I94 I;  2ODR D;  4HAC B;  4JV5 I;  3LML A;  2NPF A;  4DV7 E;  1X48 A;  2NA2 A;  1N0U A;  3B78 A;  4X62 I;  3JU0 A;  2BM0 A;  2UXC E;  4Q28 A;  2ZBK B;  4I3H A;  2E5L I;  2DMY A;  1FKA E;  3OML A;  4DV6 E;  2DIX A;  4YY3 E;  1J5E I;  4UTG A;  5AE2 A;  4DR5 I;  4B3R E;  1FNM A;  1WHN A;  3M6A A;  3ZKB A;  1ZBQ A;  4LF7 E;  2LBS B;  1FJG I;  2WZO A;  3RMP A;  2KOU A;  2MC6 A;  2LE2 A;  2V87 A;  4BMJ A;  4LF4 I;  3C4B A;  4GKJ E;  1HNZ I;  2F8B A;  2BV3 A;  2V89 A;  4WFT A;  4XTJ A;  2VQF I;  4NXM E;  4F54 A;  2UXD E;  2LJP A;  4B3T I;  1OJ4 A;  4DV2 E;  2VF3 A;  3DF6 A;  1WUU A;  4LF5 E;  4LFB I;  4DV1 E;  1KIJ A;  2PNL A;  4UT4 A;  2HFU A;  2B7T A;  1IBL E;  4DR3 I;  1IBK E;  2MDR A;  3IWC A;  4DR2 E;  1X49 A;  1N36 E;  4X66 E;  5BR8 I;  1XMO E;  3HTX A;  3J80 Q;  2FV4 B;  2J7K A;  3IWD A;  2EZ6 A;  5FLX Q;  4JI3 I;  3ZOQ B;  5FLX C;  3HQ1 A;  2V2Q A;  4NXN E;  4GKJ I;  1U2R A;  2ODR C;  1HNW I;  4DV0 I;  4B3S E;  4JI1 E;  3HUL A;  4IZJ A;  2RS7 A;  4JI0 E;  1YYW A;  3OTO I;  1UIL A;  2Z5C B;  2R3V A;  1DQ3 A;  5LMN I;  2X36 A;  2L3J A;  4DV1 I;  3Q6N A;  4M0V A;  1H74 A;  1USV A;  2L6M A;  1H7U A;  4TUG A;  2M4I A;  1N36 I;  4F9C B;  1RRE A;  4HAC A;  4X65 I;  3VYY A;  1KTV A;  4F9B B;  4X64 I;  1XNR I;  3ZKD A;  4TUI A;  5IWA I;  2L33 A;  1I94 E;  3AUZ A;  1S16 A;  2CZ9 A;  4AQY I;  4DU8 A;  4LU9 A;  1FI4 A;  3ADG A;  4N3O A;  5CFF E;  4X62 E;  4DPU A;  3KWR A;  4DV4 I;  2E5L E;  4M2Z A;  4WUB A;  4M1K A;  4MYT A;  4FN5 A;  1UEK A;  2DEJ A;  4DUY I;  4F9A B;  4WSP A;  3VYX A;  1PIE A;  2V34 A;  4JI6 I;  1J5E E;  4DR5 E;  2PNM A;  1QU6 A;  1FJG E;  2O1T A;  3ZM7 A;  3PYF A;  4KQV A;  1T4L B;  2VE7 C;  5AE3 A;  4LF4 E;  4X8W A;  1N34 E;  1HNZ E;  3P1X A;  2CGE A;  3K17 A;  2LMZ A;  2LTS A;  1J26 A;  2VQF E;  2V2V A;  4FWG A;  1N0V C;  2L2K B;  4B3T E;  2HHH I;  3HPZ A;  2M1S A;  4LFB E;  1MX0 A;  3ZZU A;  4DR3 E;  5GME A;  2B9D A;  2M7Q A;  2Z5B B;  2JY9 A;  2YZT A;  4HY1 A;  4RPF A;  5F3W A;  1Y4S A;  1ZM3 A;  1K47 A;  4MYU A;  5BR8 E;  1XMQ E;  2B7V A;  4JI3 E;  3LLH A;  3J81 Q;  1RC7 A;  2Z5C A;  3J81 C;  1N34 I;  2K4V A;  4LFA I;  4USM A;  4BS9 A;  4DV0 E;  1HNW E;  4JI2 I;  1PKP A;  4DR4 I;  1DAR A;  4PRX A;  3OTO E;  4BCA A;  2V8P A;  1H7S A;  5LMN E;  1ZBT A;  3K1J A;  4EMD A;  4DV5 E;  4DV3 I;  2UUA I;  3H09 A;  1NHJ A;  1EKZ A;  4Z7C A;  3P06 A;  3JAM Q;  2O1U A;  3JAM C;  2OI2 A;  1UHZ A;  1BKN A;  2B3T B;  4X65 E;  1XMQ I;  3F6H A;  1HNX I;  3PYE A;  2LJH A;  3J80 C;  4FWH A;  4X64 E;  1XNR E;  3T1Y E;  3HXL A;  1FWL A;  5IWA E;  4IZK B;  2VQE I;  4AQY E;  4FWD A;  3WU4 A;  4LF8 I;  4JI4 I;  3D4J A;  2RTX A;  1YZ9 A;  3T1H I;  3HPS A;  2O1V A;  4DKK A;  5FWK A;  1Z0W A;  4WUC A;  4DV5 I;  4DV4 E;  1EA6 A;  5GMD A;  3ADL A;  2NUE A;  4DPY A;  4DMI A;  4K0K E;  1FWK A;  1KVK A;  1WHQ A;  1Z0V A;  4LTY A;  4OOG C;  1NHI A;  1QZR A;  4GKK I;  4DUZ I;  4DUY E;  1Z5C A;  4LF9 E;  4JI6 E;  1HK7 A;  1Z0T A;  2IOQ A;  2JR1 A;  2UXB I;  3T1Y I;  4DU7 A;  5L3J A;  4JYA I;  4B3M I;  1NZ0 A;  2HKE A;  4R1F A;  4PU9 A;  2ZM6 I;  2UUB I;  2GQ0 A;  3GON A;  4BC7 A;  2LTR A;  1T4N A;  2FTX B;  2UUC I;  4JI5 I;  4YHH I;  4BBY A;  4DR1 E;  4K0K I;  4DXL A;  4FW9 A;  5IT9 Q;  2V88 A;  2DEI A;  1HR0 I;  2HHH E;  5IT9 C;  2Z5B A;  2E1M A;  1MG7 A;  4P7D A;  2UU9 I;  4DR7 I;  4DR6 I;  4LF9 I;  2Z5E A;  2H36 X;  4I8O A;  2CG9 A;  2EWL A;  1ZM2 A;  1SR9 A;  3V2U C;  3AV0 A;  4R8O A;  1H72 C;  1Z0C A;  4JI8 E;  1ZXM A;  1Y4U A;  2N3H A;  2MC5 A;  2L2M A;  2YT4 A;  4GEQ B;  2JVA A;  1N33 I;  1KKH A;  2GS8 A;  4WPY A;  4OX9 I;  2NUF A;  4Z7Y A;  4LFA E;  3IWB A;  4KZS A;  4P78 A;  4DPX A;  1XNQ I;  4JI2 E;  4DR4 E;  4HXZ A;  4DR1 I;  4ED4 A;  1ZXN A;  3K6Q A;  3CWV A;  1EI1 A;  4DV3 E;  2UUA E;  4P52 A;  2IOP A;  3B82 A;  1MU5 A;  4WYQ B;  3QT7 A;  3HJC A;  1Y6Z A;  4JI8 I;  3C4T A;  1HNX E;  4IZK A;  4IZJ D;  3DJW A;  1WXR A;  2R42 A;  4LF6 I;  3J7A M;  2X7I A;  2IHR 1;  1RR9 A;  1Z5B A;  1XHK A;  2AJ4 A;  2VQE E;  4LF8 E;  4L5N C;  3QT6 A;  4JI4 E;  4USK A;  1IBM E;  3F0N A;  3T1H E;  4JI7 I;  3QT8 A;  1N32 I;  1IBM I;  3LTO A;  2V2Z A;  3WU5 A;  4DV7 I;  1DI2 A;  2HK3 A;  3LNU A;  3QT5 A;  5ADZ A;  3Q1Q A;  3WU3 A;  1ELO A;  2HFS A;  3FIG A;  4GKK E;  4DUZ E;  2KHX A;  2UXC I;  1Z0B A;  4LFC E;  3J7A G;  2ZIT A;  2LRS A;  2UXB E;  1VIS A;  1X47 A;  4DV6 I;  1O0W A;  4JYA E;  4B3M E;  3MSW A;  2N3G A;  4YY3 I;  1GZ6 A;  2V85 A;  2L3C A;  1Z0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...