4GKKE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4gkkE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkkE02
2VQFE 1IBKE 4LFAI 1RC7A 2YT4A 2JY9A 1ZM4A 4DPYA 3WU3A 4FW9A 4DR4I 1N36I 2MDRA 2HK3A 3M6AA 2VF3A 1HNWE 2F4VE 3T1YE 2DMYA 4JI0I 4DV3E 2NUEA 4JI3I 4KHPI 4LFCI 2L2KB 4RPFA 4M1KA 4DV6I 4DR6I 3ZZUA 4DUYI 2JVAA 2LJHA 1J5EE 4JI2E 4OX9E 1I94I 3PYFA 3K17A 4MYUA 4DV4I 3J7AG 1RR9A 3WU6A 1FKAE 2LTSA 4DV1E 4LF6E 3VYYA 3VYXA 4LFBI 4NXNE 4WUCA 4LF9E 4Z7CA 1YYKA 1UEKA 4DV1I 4JG4A 4MYTA 1WHNA 2LTRA 2RTXA 4I3HA 5A2QQ 3ADIA 1XNQE 2UXBE 4LF7I 1I94E 4PU9A 2LJPA 1N33E 3LNUA 4JI3E 4KHPE 1X49A 4DV3I 1U2RA 4FWHA 3T1HI 3HULA 5BR8I 4JI2I 4OX9I 4DUYE 3D4JA 1IBLE 4WUDA 2HKEA 4LF5E 2V34A 4DKKA 2EFGA 1FJGI 4DXLA 4AQYI 1Z5AA 4URLA 1IBLI 2R3VA 4JI0E 4JI1E 5BR8E 1J26A 4DV7I 4JYAI 1S4EA 3P1XA 5IWAE 3QT7A 4DU7A 4GKJI 1X48A 2HK2A 1A6FA 3H4LA 4K0KE 4B3TE 2NPFA 4DV4E 1EI1A 2R42A 2UXDE 3J7AM 4USMA 1XMOI 1EA6A 1UHZA 1EKZA 2B3TB 1YZ9A 1MX0A 1HNXE 4OOGC 2V2ZA 4DV0I 1QZRA 3OTOI 2B7VA 4LF4E 1MG7A 2RS7A 5LL6R 4FN5A 1Z0VA 1ZM3A 4DR3I 4HACB 2UU9E 1N34E 4P52A 2B7TA 1WUUA 3B82A 2NUGA 1N34I 2KHXA 3J80C 1ZBTA 2DB2A 1PVGA 3B78A 2BV3A 3F0NA 3ADGA 5GMEA 1DI2A 1PIEA 2E1RA 3C4TA 3PYDA 4LF4I 2RS6A 4K0KI 1KKHA 1N33I 4XTJA 4JI5I 3ZKBA 3K1JA 1QU6A 4DR7I 1N0VC 1T4NA 4JI6I 1N36E 3J81Q 1XMOE 2UUCE 1MU5A 1XNRI 2ZM6E 3CWVA 1ZM2A 4JI7I 2V2QA 2VQEI 2DEIA 4X8WA 4UTGA 3C4BA 1Z0EA 4LF8I 3JAMQ 2UUCI 2UU9I 1ZXMA 3ZM7A 3ZKDA 4LF5I 3J80Q 3QT6A 1HNZE 1Z59A 4DR1I 4KQVA 4JI4I 1HR0E 1S16A 2HFUA 1T4OA 4ED4A 1WHQA 3LLHA 4JI4E 4LFBE 1O0WA 1KVKA 4X62E 1YYWA 1X47A 4DR1E 4DR5I 1Z0TA 2LRSA 4X64E 4DV6E 4DR4E 4DU8A 4LF9I 1H7SA 2VQEE 1FWKA 4P7AA 1IBMI 1Z5BA 4YY3I 4DUZI 1BKNA 2L2MA 2L3JA 2CZ9A 3V2UC 3LPSA 3T1HE 2BM1A 1UILA 4DR3E 4WFTA 5IWAI 1XNRE 3ADJA 5LMUI 1RREA 2A2DA 4X65I 3ADLA 4PRXA 4LFCE 4DV0E 4JI8I 2Q2EB 1Z0CA 2ZBKB 3T1YI 4DR5E 3J81C 3QT8A 4LF6I 4DR2E 2N3GA 4X66E 4DV5E 2HHHE 1KTVA 1STUA 2UXDI 4DV2I 3JAMC 1ZM9A 4HYMA 2BM0A 1Z0WA 4JI6E 5LMNE 2CPNA 2ZITA 4NXNI 4JI5E 1Z0GA 2UUAI 4WYQB 2IHR1 2J7KA 4DUZE 4LFAE 2DIXA 1IBME 1RQ0A 1B62A 4FWDA 1XHKA 4B3RI 1YYOA 1XMQE 2N3HA 1H73A 2AJ4A 4GKJE 2L3CA 1B63A 2WW4A 4M30A 4B3TI 1FNMA 5FLXQ 1HR0I 4JI8E 4LF7E 1XNQI 5L3JA 2UXBI 2L2NA 4JI1I 2XEXA 4DR6E 3ZZ0A 2E5LI 4AQYE 5LMUE 3B8HA 1T4LB 4Z7YA 1N0UA 1K47A 1FWLA 4YY3E 4DV2E 1Z5CA 1KIJA 5LMNI 5IT9Q 2A2CA 4EMDA 3QT5A 4X64I 1DARA 4WUBA 1NHIA 4USKA 4B3ME 5GMDA 3OTOE 2LUQA 1PKPA 3V5RA 2UXCE 1N32E 2NUFA 1IBKI 2V2VA 4JYAE 4B3RE 1NZ0A 1GQEA 5CFFE 1N32I 2GS8A 4M2ZA 2X7IA 2X36A 4DR2I 2HKJA 1NHJA 4DPTA 4NXME 4HXZA 2DEJA 4DV7E 4YHHE 1H7UA 4DPXA 3PYEA 1FI4A 2UUBI 4GKKE 4NXMI 2VQFI 2HFSA 4HACA 2UUBE 4YHHI 2LUPB 4FWGA 4R1FA 1NHHA 4X62I 4JV5E 4GKKI 1FJGE 1ELOA 1J5EI 4UT4A 2RSMA 3Q1QA 4B3MI 4DR7E 4DPUA 2V8PA 1XMQI 1Z0BA 3J7Yp 1VISA 3LTOA 4LF8E 4HY1A 5FLXC 1HNWI 1D6TA 4B3SE 3HTXA 4X65E 1H74A 2ZM6I 4DPWA 2LBSB 2E5LE 2OI2A 1H72C 4JI7E 3ZZTA 4B3SI 1HNXI 4ZVIA 2UUAE 2HHHI 4PRVA 4X66I 4DV5I 1OJ4A 2F4VI 2NA2A 5IT9C 3WU4A 4JV5I 3GONA 5A2QC 1HNZI 2L33A 2UXCI 3WU5A 3PYGA 2EZ6A 1ZXNA
chains in the Genus database with same CATH superfamily
3RMPA 1USVA 4R2DA 2EPCA 2EJ4A 4OO1D 2L8TA 2EOXA 2VQFE 1UN6B 2ENHA 1IBKE 2IERA 4LFAI 1RC7A 2VE7C 4WSPA 2YT4A 2BR2A 3U1YA 2JY9A 1ZM4A 1SR9A 4DPYA 3WU3A 4FW9A 1ZAAC 2F1DA 4OO1C 1EH8A 2L6MA 3GMEA 4WSGA 4DR4I 1N36I 2PNZB 4MLVA 3L00A 2MDRA 2HK3A 2EM3A 3KZYA 3M6AA 2YU8A 2VF3A 1HNWE 2LJUA 2F4VE 1RHYA 3T1YE 1Y5YA 2JE6B 2DMYA 4LCFA 1A1KA 1BBOA 4JI0I 2EOEA 5AASA 4DV3E 2DGCA 2DRPA 2NUEA 4JI3I 2ELYA 2EN3A 4KHPI 4LFCI 2L2KB 3GLLA 4RPFA 2EOFA 1A1JA 4MU3A 3FIGA 4M1KA 4DV6I 3Q6NA 4DR6I 3ZZUA 4DUYI 2JVAA 2LJHA 1J5EE 4IZJB 1PJTA 4JI2E 2M4IA 4OX9E 1I94I 3PYFA 3K17A 3M7ND 2YRHA 2BA0D 4MYUA 3DF6A 3J7AG 3VHTB 1RR9A 4DV4I 3WU6A 2PO1A 1FKAE 5A69A 2WCC3 5JEAA 2LTSA 2EPMX 2MKDA 4DV1E 2B9DA 1GZ6A 2EPKX 3VYYA 4LF6E 3VYXA 2C37A 4LFBI 2EMYA 1P47A 4NXNE 4WUCA 4BHBA 4HEIA 1XXEA 3P06A 4LF9E 2EMFA 5ADZA 5KL4A 4Z7CA 2ENAA 2MC5A 1YYKA 1UEKA 4OO1E 1WJPA 4DV1I 2LT7A 1YFHA 5A6BA 3HPSA 5A6BD 3B4TA 4JG4A 4MYTA 1A1LA 4IFDF 1WHNA 4R2EA 1JK1A 2WNRB 2LTRA 2RTXA 4I3HA 1DQ3A 2LVHA 3ADIA 3U1KA 5A2QQ 4NZVA 2V83A 1XNQE 4RHBB 2UXBE 4LF7I 5K36A 1MGTA 3ECRA 4QNKA 1I94E 4IFDD 4PU9A 2LJPA 4ZYEA 5DRPA 3UK3C 1OYSA 1EH6A 2FV4B 2EM5A 2EM0A 3JTZA 4OO1B 1N33E 3LNUA 2JOXA 3AV0A 4IS1C 5JEAD 4JI3E 4KHPE 1X49A 4DV3I 4TUGA 1U2RA 4FWHA 2EPAA 3T1HI 3L7ZA 3AUZA 2V86A 3HULA 3Q6MA 4J3DA 3EPKA 4LOMA 5K36C 1R6LA 4R2PA 2C37B 5BR8I 4JI2I 4OX9I 2EOOA 4DUYE 3D4JA 1IBLE 4WUDA 2HKEA 4LF5E 3NZKA 2V34A 2JP9A 4DKKA 2NN6A 2EFGA 4DMIA 2BB8A 2YRMA 4DXLA 4AQYI 1FJGI 1Z5AA 2YTQA 4URLA 1IBLI 2WBTA 2R3VA 2G7HA 4JI0E 1IMUA 2JPAA 2JEBB 4JI1E 5C0XA 5BR8E 5C0XB 4U3DA 1J26A 4BHCA 2YTOA 3IWCA 4DV7I 1TF6A 2EMCA 2EN2A 1S4EA 4JYAI 1TN9A 3P1XA 5IWAE 3C6MA 2PO2B 1GTKA 2DLQA 3QT7A 4DU7A 4GKJI 1X48A 2EPNA 2HK2A 4FW5A 2R76A 1A6FA 4K0KE 3H4LA 4MU1A 3M99B 4R2RA 4B3TE 4TUIA 4BCAA 1B69A 2NPFA 2RQLA 4DV4E 1EI1A 2CG9A 2JEAA 2ADRA 2R42A 2UXDE 2ODRC 1MEYC 3DJWA 1A1FA 4USMA 3J7AM 2EQ0A 4GEQB 1IQOA 4BA2B 1XMOI 2PNZA 4IZJD 1EA6A 2NN6E 2WZOA 1UHZA 2EOYA 2HC5A 1EKZA 2B3TB 1YZ9A 1MX0A 1HNXE 2EM9A 4OOGC 2V2ZA 1OYPA 4J8ZA 5A6KA 4DV0I 1QZRA 4F6NA 2EN8A 4FN5A 3OTOI 1JK2A 1YH8A 4KZSA 3HQ1A 2B7VA 4LF4E 1MG7A 2RS7A 5LL6R 2O1UA 4X9JA 1KJKA 5DNYA 4IJDA 1Z0VA 1AAYA 1ZM3A 5KL5A 2YSPA 4HACB 4DR3I 2UU9E 2C38B 1N34E 2MC6A 3F6GA 5TSEA 4IZKA 2B7TA 4P52A 1WUUA 3B82A 2V8QB 2NUGA 1N34I 2YRKA 2DSYA 2LMZA 3KRNA 2KHXA 3J80C 4BMJA 1ZBTA 2K7IA 2DB2A 2KONA 4BA2A 1X6FA 4M0VA 4WXCA 1PVGA 4P78A 3B78A 1UDOA 3MHSC 2BV3A 3F0NA 4U3BA 2YTIA 2EMXA 3ADGA 1F2IG 1TF3A 2GO3A 5GMEA 1X3CA 2O1WA 2EQ1A 5JEAB 2EMBA 5C0XE 1VI7A 1UDSA 2WP8A 2F8BA 1WXRA 2EPPA 4IZKB 2RSIA 1DI2A 1PIEA 2E1RA 1YUJA 2EPRA 3C4TA 2CVEA 3PYDA 4LF4I 3THNA 2RS6A 4K0KI 1KKHA 2VESA 4LCHA 3EPJA 4XTJA 4JI5I 1N33I 1E3HA 2M7QA 2EOQA 3ZKBA 2IOQA 3K1JA 1QU6A 4DR7I 1N0VC 1T4NA 2EOIA 2V85A 1N36E 3J81Q 2EN4A 4JI6I 1Z1BA 4ZYHA 1XMOE 2UUCE 2JWOA 1P42A 1N3GA 1MU5A 1XNRI 2JEAB 2YTJA 4IFDE 2ZM6E 4F2JC 3CWVA 2EL4A 2EOSA 1ZM2A 4FW3A 4GQUA 4JI7I 2V2QA 2VQEI 2DEIA 4X8WA 2EOZA 2EPLX 4MQYA 2Z5BA 4UTGA 4BA1A 3C4BA 4AIMA 1Z0EA 4LF8I 4P7DA 3JAMQ 2UUCI 1ZU1A 2UU9I 4LTYA 1ZXMA 3ZKDA 3ZM7A 3IWBA 2VRDA 2EOMA 4OO1A 4LF5I 3J80Q 3QT6A 1HNZE 2YTFA 1E3PA 1Z59A 4FW6A 5FWKA 2EMAA 4WX9A 4KQVA 4DR1I 2PO0B 3H1CA 3MHHC 4JI4I 3PS2A 1HR0E 2KOUA 1R6MA 2EN6A 1S16A 5A6JA 2HFUA 1T4OA 2EOHA 2N8XA 4ED4A 1Y6ZA 4IFDA 1WHQA 3LLHA 2WBUA 4JI4E 2EWLA 4LFBE 1T39A 1O0WA 1KVKA 4X62E 2VF1A 1YYWA 5JEAE 1X47A 4DR1E 4DR5I 3THOB 4F9AB 2LRSA 4X64E 1Z0TA 2C39A 4DV6E 3HKMA 2EORA 5ELWA 4DR4E 4DU8A 4R2SA 4ZYGA 4LF9I 1H7SA 2VQEE 5KL3A 1FWKA 3K85A 4IFDC 5DRQA 4P7AA 1IBMI 1Z5BA 4YY3I 4DUZI 1BKNA 5DRRA 2L2MA 2L3JA 2CZ9A 3V2UC 1QNTA 3T1HE 1Y60A 2BM1A 3LPSA 1PJQA 1UILA 4DR3E 2EPOA 2Z5EA 5JEAC 1RMDA 4QNJA 2JXPA 2LO3A 4L5NC 4WFTA 5IWAI 1XNRE 3ADJA 3M7NG 5LMUI 3BBGA 2EOJA 2EPZA 1RREA 2A2DA 4IS9A 4X65I 2BBGA 2GPIA 3ADLA 1UDQA 3P3GA 4PRXA 4LFCE 1YUIA 2A25A 2EMGA 1UBDC 3P3CA 4DV0E 1T38A 2IESA 4JI8I 3EQ1A 3M85D 2Q2EB 1Z0CA 4N4RB 2ZBKB 3F6HA 3GCMA 4R2QA 4DR5E 3T1YI 4F6MA 4F9CB 3J81C 2EP3A 3QT8A 2JR1A 3BIDA 2Q8UA 4LF6I 4DR2E 3KZZA 2GO4A 2PNLA 1X6EA 1UDNA 5KL6A 2N3GA 4R8OA 4X66E 4DV5E 2M9AA 4MU4A 4IFDB 1SFEA 2EM8A 2HHHE 2PO2A 1KTVA 1A1IA 3PS1A 5EKWA 1STUA 2C39B 2UXDI 4I8OA 5LLQA 4AM3A 2V89A 4DV2I 2EMLA 5T6JA 3JAMC 1HK7A 1ZM9A 4HYMA 2JEBA 1ZXNA 2BM0A 1Z0WA 5DNXA 4JI6E 5LMNE 2CPNA 2E1MA 2ZITA 4RH8A 4NXNI 2LV2A 4JI5E 1Z0GA 4R2CA 2UUAI 4WYQB 2IHR1 4KWYA 4MLQA 2GQ0A 2J7KA 2EM7A 2NN6C 4FW7A 4DUZE 4LFAE 2DIXA 5EL9A 2EQ3A 1IBME 5F3WA 1RQ0A 4F9BB 2YU5A 2YWQA 1A1HA 5C0XC 1B62A 4FWDA 1XHKA 4B3RI 1YYOA 1XMQE 2I13A 2Z5CA 2N3HA 1AH5A 2WBSA 1H73A 3MSWA 2ENCA 4R2AA 1LLMC 2JYAA 2HGHA 4GKJE 2AJ4A 2L3CA 1B63A 2WW4A 5K36F 2LE2A 2YZTA 4M30A 4B3TI 1FNMA 5KL7A 3HXLA 1NCSA 5FLXQ 1YSAC 3CDIA 1HR0I 2FGGA 4JI8E 1USUA 4LF7E 1XNQI 4ZYDA 5L3JA 2UXBI 4F54A 2NABA 4OZEA 2L2NA 2RPCA 2V87A 1EH7A 5IXMB 2NN6F 2XEXA 4JI1I 4NBQA 2EL5A 3PRYA 4DR6E 3ZZ0A 2E5LI 4AQYE 3OMLA 5LMUE 3PS3A 1ZR9A 3BGHA 3B8HA 2V88A 3C6KA 2YTNA 1T4LB 4R03A 4Z7YA 1WRJA 2LCEA 4Q35B 1N0UA 2MKNA 1K47A 5K36D 2EN1A 5IV8B 3KWRA 1FWLA 2EM6A 2AE8A 4OKGA 2EMHA 3H09A 2JE6A 2EMZA 2L92A 4YY3E 4DV2E 4O4KA 1Z5CA 4LPFA 2BA0G 2PO1B 1NEIA 2DMIA 1KIJA 5LMNI 5IT9Q 2CTDA 3HJCA 2A2CA 4EMDA 2C38A 2I9IA 1Y4UA 2IOPA 4WXDA 3QT5A 2D9HA 2GLIA 3P3EA 4X64I 1DARA 4WUBA 1NHIA 4O24A 4MU0A 4B3ME 4USKA 3OTOE 2YTEA 2LUQA 5GMDA 1PKPA 2BR2B 2UXCE 3V5RA 1N32E 2EM4A 1G2DC 1IQSA 2NUFA 1IBKI 4BC9A 2PNMA 3UHMA 2V2VA 5K36B 4OO1F 4JYAE 5JEAF 4B3RE 1NZ0A 1GQEA 2NN6B 5CFFE 1N32I 2WNRA 2GS8A 3CDJA 4M2ZA 4WPYA 1YHCA 2X7IA 3LMLA 4O5GA 2X36A 4DR2I 2HKJA 1NHJA 2ODRD 3BF2A 5AE1A 4DPTA 1G2FC 5C0XD 4NXME 4HXZA 3HPZA 2DEJA 2EMIA 4DV7E 2BA1G 4YHHE 1H7UA 1X5WA 3PYEA 1FI4A 4DPXA 2UUBI 2H36X 2M1SA 4GKKE 2YTPA 5DROA 4NXMI 1DGCA 2VQFI 2HFSA 4HACA 2EMWA 2UUBE 4YHHI 1BBGA 2EL6A 1PJSA 3K6QA 4NHRA 2LUPB 4FWGA 4HTGA 4FW4A 2R1FA 3IWDA 4MDTA 4R1FA 4BS9A 3QG5C 4ISAA 4LU9A 1NHHA 1X6HA 2YSOA 4N3OA 2HJJA 4IZJA 4JV5E 4X62I 4GKKI 3VK6A 1FJGE 2O1TA 1ELOA 1J5EI 2Z5CB 5AC5A 5DNLA 4UT4A 1YPNA 3L7ZB 2O3ZA 3JU0A 1BB8A 3ZOQB 2J7JA 2RSMA 3EPLA 2EE8A 4LCGA 3Q1QA 1PDAA 5AC4A 2JT2A 2Z5BB 4BA1B 4GZNC 4B3MI 4DR7E 4DPUA 2V8PA 4Q28A 4BC7A 1Z0BA 3J7Yp 1XMQI 2ELZA 5KL2A 2YTGA 2J65A 1VISA 3LTOA 5C0XF 2EPXA 4O43A 4LF8E 4HY1A 2PO0A 2EN7A 2CSHA 1L4SA 3M85G 2CT1A 5FLXC 1HNWI 1D6TA 4B3SE 3HTXA 5AE3A 4X65E 1H74A 2EPUA 2ZM6I 2EMKA 5AE2A 2YPNA 2PRTA 3TQMA 4DPWA 2LBSB 2CGEA 2O1VA 2EM2A 4BBYA 2E5LE 2OI2A 2MDGA 4AIDA 2JOBA 1H72C 4JI7E 2WP8B 3ZZTA 4B3SI 1ZBQA 1HNXI 3P76A 4ZVIA 2UUAE 2GHFA 4FK5C 4M9VC 2HHHI 4PRVA 4X66I 1KYQA 4DV5I 1OJ4A 1OYRA 3DD6A 2F4VI 5K36E 4L8NA 5A6AA 2DLKA 3EPHA 2YTDA 2K4VA 2NA2A 5IT9C 3WU4A 1Y4SA 2E72A 4JV5I 2FTXB 2NN6D 3GONA 5A2QC 1HNZI 2L33A 2UXCI 2BA1D 3WU5A 3PYGA 2EZ6A 1A1GA
chains in the Genus database with same CATH topology
3RMPA 1USVA 2L8TA 2VQFE 1IBKE 4LFAI 1RC7A 2VE7C 4WSPA 2YT4A 2JY9A 1ZM4A 1SR9A 4DPYA 3WU3A 4FW9A 2L6MA 4DR4I 1N36I 2MDRA 2HK3A 3M6AA 2VF3A 1HNWE 2F4VE 3T1YE 2DMYA 4JI0I 5AASA 4DV3E 2NUEA 4JI3I 4KHPI 4LFCI 2L2KB 4RPFA 3FIGA 4M1KA 4DV6I 3Q6NA 4DR6I 3ZZUA 4DUYI 2JVAA 2LJHA 1J5EE 4IZJB 4JI2E 2M4IA 4OX9E 1I94I 3PYFA 3K17A 4MYUA 3DF6A 3J7AG 4DV4I 1RR9A 3WU6A 1FKAE 2LTSA 4DV1E 2B9DA 1GZ6A 3VYYA 4LF6E 3VYXA 4LFBI 4NXNE 4WUCA 3P06A 4LF9E 5ADZA 4Z7CA 2MC5A 1YYKA 1UEKA 4DV1I 3HPSA 4JG4A 4MYTA 1WHNA 2LTRA 2RTXA 4I3HA 1DQ3A 3ADIA 5A2QQ 2V83A 1XNQE 2UXBE 4LF7I 1I94E 4PU9A 2LJPA 2FV4B 3JTZA 1N33E 3LNUA 2JOXA 3AV0A 4JI3E 4KHPE 1X49A 4DV3I 4TUGA 1U2RA 4FWHA 3T1HI 3Q6MA 3AUZA 2V86A 3HULA 5BR8I 4JI2I 4OX9I 4DUYE 3D4JA 1IBLE 4WUDA 2HKEA 4LF5E 2V34A 4DKKA 2EFGA 4DMIA 1FJGI 4DXLA 4AQYI 1Z5AA 4URLA 1IBLI 2R3VA 2G7HA 4JI0E 4JI1E 5BR8E 1J26A 3IWCA 4DV7I 4JYAI 1S4EA 3P1XA 5IWAE 3QT7A 4DU7A 4GKJI 1X48A 2HK2A 1A6FA 3H4LA 4K0KE 4B3TE 4TUIA 4BCAA 2NPFA 4DV4E 1EI1A 2CG9A 2R42A 2UXDE 2ODRC 3DJWA 3J7AM 4USMA 4GEQB 1XMOI 4IZJD 1EA6A 2WZOA 1UHZA 1EKZA 2B3TB 1YZ9A 1MX0A 1HNXE 4OOGC 2V2ZA 4J8ZA 4DV0I 1QZRA 3OTOI 4KZSA 3HQ1A 2B7VA 4LF4E 1MG7A 2RS7A 5LL6R 2O1UA 4FN5A 1Z0VA 5DNYA 1ZM3A 4DR3I 4HACB 2UU9E 1N34E 2MC6A 3F6GA 4IZKA 2B7TA 4P52A 1WUUA 3B82A 2V8QB 2NUGA 1N34I 2DSYA 2LMZA 2KHXA 3J80C 4BMJA 1ZBTA 2DB2A 2KONA 4M0VA 1PVGA 4P78A 3B78A 2BV3A 3F0NA 3ADGA 5GMEA 2O1WA 2F8BA 1WXRA 4IZKB 1DI2A 1PIEA 2E1RA 3C4TA 3PYDA 4LF4I 2RS6A 4K0KI 1KKHA 1N33I 4XTJA 4JI5I 2M7QA 3ZKBA 2IOQA 3K1JA 1QU6A 4DR7I 1N0VC 1T4NA 4JI6I 2V85A 1N36E 3J81Q 1XMOE 2UUCE 2JWOA 1MU5A 1XNRI 2ZM6E 3CWVA 1ZM2A 4JI7I 2V2QA 2VQEI 2DEIA 4X8WA 2Z5BA 4UTGA 3C4BA 1Z0EA 4LF8I 4P7DA 3JAMQ 2UUCI 2UU9I 4LTYA 1ZXMA 3ZKDA 3ZM7A 3IWBA 4LF5I 3J80Q 3QT6A 1HNZE 1Z59A 5FWKA 4DR1I 4KQVA 4JI4I 1HR0E 2KOUA 1S16A 2HFUA 1T4OA 4ED4A 1Y6ZA 1WHQA 3LLHA 4JI4E 2EWLA 4LFBE 1O0WA 1KVKA 4X62E 2VF1A 1YYWA 1X47A 4DR1E 4DR5I 4F9AB 2LRSA 4X64E 1Z0TA 4DV6E 4DR4E 4DU8A 4LF9I 1H7SA 2VQEE 3K85A 1FWKA 4P7AA 1IBMI 1Z5BA 4YY3I 4DUZI 1BKNA 2L2MA 2L3JA 2CZ9A 3V2UC 3LPSA 3T1HE 2BM1A 1UILA 4DR3E 2Z5EA 4L5NC 4WFTA 5IWAI 1XNRE 3ADJA 5LMUI 1RREA 2A2DA 4X65I 3ADLA 4PRXA 4LFCE 4DV0E 4JI8I 2Q2EB 1Z0CA 2ZBKB 3T1YI 3F6HA 4DR5E 4F9CB 3J81C 3QT8A 2JR1A 4LF6I 4DR2E 2PNLA 2N3GA 4R8OA 4X66E 4DV5E 2HHHE 1KTVA 1STUA 2UXDI 4I8OA 2V89A 4DV2I 5T6JA 1HK7A 3JAMC 1ZM9A 4HYMA 2BM0A 1Z0WA 4JI6E 5LMNE 2CPNA 2E1MA 2ZITA 4NXNI 4JI5E 1Z0GA 2UUAI 4WYQB 2IHR1 2GQ0A 2J7KA 4DUZE 4LFAE 2DIXA 1IBME 5F3WA 1RQ0A 4F9BB 1B62A 4FWDA 1XHKA 4B3RI 1YYOA 1XMQE 2Z5CA 2N3HA 1H73A 3MSWA 2AJ4A 4GKJE 2L3CA 1B63A 2WW4A 2LE2A 2YZTA 4M30A 4B3TI 1FNMA 3HXLA 5FLXQ 1HR0I 2FGGA 4JI8E 1USUA 4LF7E 1XNQI 5L3JA 2UXBI 4F54A 2L2NA 2V87A 4JI1I 2XEXA 3PRYA 4DR6E 3ZZ0A 2E5LI 4AQYE 3OMLA 5LMUE 3B8HA 2V88A 1T4LB 4R03A 4Z7YA 1N0UA 1K47A 3KWRA 1FWLA 3H09A 2L92A 4YY3E 4DV2E 1Z5CA 1KIJA 5LMNI 5IT9Q 3HJCA 2A2CA 4EMDA 2IOPA 1Y4UA 3QT5A 4X64I 1DARA 4WUBA 1NHIA 4USKA 4B3ME 5GMDA 3OTOE 2LUQA 1PKPA 3V5RA 2UXCE 1N32E 2NUFA 1IBKI 4BC9A 2PNMA 2V2VA 4JYAE 4B3RE 1NZ0A 1GQEA 5CFFE 1N32I 2GS8A 4M2ZA 4WPYA 2X7IA 3LMLA 2X36A 4DR2I 2HKJA 1NHJA 2ODRD 5AE1A 4DPTA 4NXME 4HXZA 3HPZA 2DEJA 4DV7E 4YHHE 1H7UA 4DPXA 3PYEA 1FI4A 2UUBI 2H36X 2M1SA 4GKKE 4NXMI 2VQFI 2HFSA 4HACA 2UUBE 4YHHI 3K6QA 2LUPB 4FWGA 3IWDA 4R1FA 4BS9A 4LU9A 1NHHA 4N3OA 4IZJA 4JV5E 4X62I 4GKKI 3VK6A 1FJGE 2O1TA 1ELOA 1J5EI 2Z5CB 4UT4A 3JU0A 3ZOQB 2RSMA 3Q1QA 2Z5BB 4B3MI 4DR7E 4DPUA 2V8PA 4Q28A 4BC7A 1Z0BA 3J7Yp 1XMQI 1VISA 3LTOA 4LF8E 4HY1A 5FLXC 1HNWI 1D6TA 4B3SE 3HTXA 5AE3A 4X65E 1H74A 2ZM6I 5AE2A 4DPWA 2LBSB 2CGEA 2O1VA 4BBYA 2E5LE 2OI2A 2JOBA 1H72C 4JI7E 3ZZTA 4B3SI 1ZBQA 1HNXI 4ZVIA 2UUAE 2HHHI 4PRVA 4X66I 4DV5I 1OJ4A 2F4VI 4L8NA 2K4VA 2NA2A 5IT9C 3WU4A 1Y4SA 4JV5I 2FTXB 3GONA 5A2QC 1HNZI 2L33A 2UXCI 3WU5A 3PYGA 2EZ6A 1ZXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF E;  1IBK E;  4LFA I;  1RC7 A;  2YT4 A;  2JY9 A;  1ZM4 A;  4DPY A;  3WU3 A;  4FW9 A;  4DR4 I;  1N36 I;  2MDR A;  2HK3 A;  3M6A A;  2VF3 A;  1HNW E;  2F4V E;  3T1Y E;  2DMY A;  4JI0 I;  4DV3 E;  2NUE A;  4JI3 I;  4KHP I;  4LFC I;  2L2K B;  4RPF A;  4M1K A;  4DV6 I;  4DR6 I;  3ZZU A;  4DUY I;  2JVA A;  2LJH A;  1J5E E;  4JI2 E;  4OX9 E;  1I94 I;  3PYF A;  3K17 A;  4MYU A;  4DV4 I;  3J7A G;  1RR9 A;  3WU6 A;  1FKA E;  2LTS A;  4DV1 E;  4LF6 E;  3VYY A;  3VYX A;  4LFB I;  4NXN E;  4WUC A;  4LF9 E;  4Z7C A;  1YYK A;  1UEK A;  4DV1 I;  4JG4 A;  4MYT A;  1WHN A;  2LTR A;  2RTX A;  4I3H A;  5A2Q Q;  3ADI A;  1XNQ E;  2UXB E;  4LF7 I;  1I94 E;  4PU9 A;  2LJP A;  1N33 E;  3LNU A;  4JI3 E;  4KHP E;  1X49 A;  4DV3 I;  1U2R A;  4FWH A;  3T1H I;  3HUL A;  5BR8 I;  4JI2 I;  4OX9 I;  4DUY E;  3D4J A;  1IBL E;  4WUD A;  2HKE A;  4LF5 E;  2V34 A;  4DKK A;  2EFG A;  1FJG I;  4DXL A;  4AQY I;  1Z5A A;  4URL A;  1IBL I;  2R3V A;  4JI0 E;  4JI1 E;  5BR8 E;  1J26 A;  4DV7 I;  4JYA I;  1S4E A;  3P1X A;  5IWA E;  3QT7 A;  4DU7 A;  4GKJ I;  1X48 A;  2HK2 A;  1A6F A;  3H4L A;  4K0K E;  4B3T E;  2NPF A;  4DV4 E;  1EI1 A;  2R42 A;  2UXD E;  3J7A M;  4USM A;  1XMO I;  1EA6 A;  1UHZ A;  1EKZ A;  2B3T B;  1YZ9 A;  1MX0 A;  1HNX E;  4OOG C;  2V2Z A;  4DV0 I;  1QZR A;  3OTO I;  2B7V A;  4LF4 E;  1MG7 A;  2RS7 A;  5LL6 R;  4FN5 A;  1Z0V A;  1ZM3 A;  4DR3 I;  4HAC B;  2UU9 E;  1N34 E;  4P52 A;  2B7T A;  1WUU A;  3B82 A;  2NUG A;  1N34 I;  2KHX A;  3J80 C;  1ZBT A;  2DB2 A;  1PVG A;  3B78 A;  2BV3 A;  3F0N A;  3ADG A;  5GME A;  1DI2 A;  1PIE A;  2E1R A;  3C4T A;  3PYD A;  4LF4 I;  2RS6 A;  4K0K I;  1KKH A;  1N33 I;  4XTJ A;  4JI5 I;  3ZKB A;  3K1J A;  1QU6 A;  4DR7 I;  1N0V C;  1T4N A;  4JI6 I;  1N36 E;  3J81 Q;  1XMO E;  2UUC E;  1MU5 A;  1XNR I;  2ZM6 E;  3CWV A;  1ZM2 A;  4JI7 I;  2V2Q A;  2VQE I;  2DEI A;  4X8W A;  4UTG A;  3C4B A;  1Z0E A;  4LF8 I;  3JAM Q;  2UUC I;  2UU9 I;  1ZXM A;  3ZM7 A;  3ZKD A;  4LF5 I;  3J80 Q;  3QT6 A;  1HNZ E;  1Z59 A;  4DR1 I;  4KQV A;  4JI4 I;  1HR0 E;  1S16 A;  2HFU A;  1T4O A;  4ED4 A;  1WHQ A;  3LLH A;  4JI4 E;  4LFB E;  1O0W A;  1KVK A;  4X62 E;  1YYW A;  1X47 A;  4DR1 E;  4DR5 I;  1Z0T A;  2LRS A;  4X64 E;  4DV6 E;  4DR4 E;  4DU8 A;  4LF9 I;  1H7S A;  2VQE E;  1FWK A;  4P7A A;  1IBM I;  1Z5B A;  4YY3 I;  4DUZ I;  1BKN A;  2L2M A;  2L3J A;  2CZ9 A;  3V2U C;  3LPS A;  3T1H E;  2BM1 A;  1UIL A;  4DR3 E;  4WFT A;  5IWA I;  1XNR E;  3ADJ A;  5LMU I;  1RRE A;  2A2D A;  4X65 I;  3ADL A;  4PRX A;  4LFC E;  4DV0 E;  4JI8 I;  2Q2E B;  1Z0C A;  2ZBK B;  3T1Y I;  4DR5 E;  3J81 C;  3QT8 A;  4LF6 I;  4DR2 E;  2N3G A;  4X66 E;  4DV5 E;  2HHH E;  1KTV A;  1STU A;  2UXD I;  4DV2 I;  3JAM C;  1ZM9 A;  4HYM A;  2BM0 A;  1Z0W A;  4JI6 E;  5LMN E;  2CPN A;  2ZIT A;  4NXN I;  4JI5 E;  1Z0G A;  2UUA I;  4WYQ B;  2IHR 1;  2J7K A;  4DUZ E;  4LFA E;  2DIX A;  1IBM E;  1RQ0 A;  1B62 A;  4FWD A;  1XHK A;  4B3R I;  1YYO A;  1XMQ E;  2N3H A;  1H73 A;  2AJ4 A;  4GKJ E;  2L3C A;  1B63 A;  2WW4 A;  4M30 A;  4B3T I;  1FNM A;  5FLX Q;  1HR0 I;  4JI8 E;  4LF7 E;  1XNQ I;  5L3J A;  2UXB I;  2L2N A;  4JI1 I;  2XEX A;  4DR6 E;  3ZZ0 A;  2E5L I;  4AQY E;  5LMU E;  3B8H A;  1T4L B;  4Z7Y A;  1N0U A;  1K47 A;  1FWL A;  4YY3 E;  4DV2 E;  1Z5C A;  1KIJ A;  5LMN I;  5IT9 Q;  2A2C A;  4EMD A;  3QT5 A;  4X64 I;  1DAR A;  4WUB A;  1NHI A;  4USK A;  4B3M E;  5GMD A;  3OTO E;  2LUQ A;  1PKP A;  3V5R A;  2UXC E;  1N32 E;  2NUF A;  1IBK I;  2V2V A;  4JYA E;  4B3R E;  1NZ0 A;  1GQE A;  5CFF E;  1N32 I;  2GS8 A;  4M2Z A;  2X7I A;  2X36 A;  4DR2 I;  2HKJ A;  1NHJ A;  4DPT A;  4NXM E;  4HXZ A;  2DEJ A;  4DV7 E;  4YHH E;  1H7U A;  4DPX A;  3PYE A;  1FI4 A;  2UUB I;  4GKK E;  4NXM I;  2VQF I;  2HFS A;  4HAC A;  2UUB E;  4YHH I;  2LUP B;  4FWG A;  4R1F A;  1NHH A;  4X62 I;  4JV5 E;  4GKK I;  1FJG E;  1ELO A;  1J5E I;  4UT4 A;  2RSM A;  3Q1Q A;  4B3M I;  4DR7 E;  4DPU A;  2V8P A;  1XMQ I;  1Z0B A;  3J7Y p;  1VIS A;  3LTO A;  4LF8 E;  4HY1 A;  5FLX C;  1HNW I;  1D6T A;  4B3S E;  3HTX A;  4X65 E;  1H74 A;  2ZM6 I;  4DPW A;  2LBS B;  2E5L E;  2OI2 A;  1H72 C;  4JI7 E;  3ZZT A;  4B3S I;  1HNX I;  4ZVI A;  2UUA E;  2HHH I;  4PRV A;  4X66 I;  4DV5 I;  1OJ4 A;  2F4V I;  2NA2 A;  5IT9 C;  3WU4 A;  4JV5 I;  3GON A;  5A2Q C;  1HNZ I;  2L33 A;  2UXC I;  3WU5 A;  3PYG A;  2EZ6 A;  1ZXN A; 
#chains in the Genus database with same CATH topology
 3RMP A;  1USV A;  4R2D A;  2EPC A;  2EJ4 A;  4OO1 D;  2L8T A;  2EOX A;  2VQF E;  1UN6 B;  2ENH A;  1IBK E;  2IER A;  4LFA I;  1RC7 A;  2VE7 C;  4WSP A;  2YT4 A;  2BR2 A;  3U1Y A;  2JY9 A;  1ZM4 A;  1SR9 A;  4DPY A;  3WU3 A;  4FW9 A;  1ZAA C;  2F1D A;  4OO1 C;  1EH8 A;  2L6M A;  3GME A;  4WSG A;  4DR4 I;  1N36 I;  2PNZ B;  4MLV A;  3L00 A;  2MDR A;  2HK3 A;  2EM3 A;  3KZY A;  3M6A A;  2YU8 A;  2VF3 A;  1HNW E;  2LJU A;  2F4V E;  1RHY A;  3T1Y E;  1Y5Y A;  2JE6 B;  2DMY A;  4LCF A;  1A1K A;  1BBO A;  4JI0 I;  2EOE A;  5AAS A;  4DV3 E;  2DGC A;  2DRP A;  2NUE A;  4JI3 I;  2ELY A;  2EN3 A;  4KHP I;  4LFC I;  2L2K B;  3GLL A;  4RPF A;  2EOF A;  1A1J A;  4MU3 A;  3FIG A;  4M1K A;  4DV6 I;  3Q6N A;  4DR6 I;  3ZZU A;  4DUY I;  2JVA A;  2LJH A;  1J5E E;  4IZJ B;  1PJT A;  4JI2 E;  2M4I A;  4OX9 E;  1I94 I;  3PYF A;  3K17 A;  3M7N D;  2YRH A;  2BA0 D;  4MYU A;  3DF6 A;  3J7A G;  3VHT B;  1RR9 A;  4DV4 I;  3WU6 A;  2PO1 A;  1FKA E;  5A69 A;  2WCC 3;  5JEA A;  2LTS A;  2EPM X;  2MKD A;  4DV1 E;  2B9D A;  1GZ6 A;  2EPK X;  3VYY A;  4LF6 E;  3VYX A;  2C37 A;  4LFB I;  2EMY A;  1P47 A;  4NXN E;  4WUC A;  4BHB A;  4HEI A;  1XXE A;  3P06 A;  4LF9 E;  2EMF A;  5ADZ A;  5KL4 A;  4Z7C A;  2ENA A;  2MC5 A;  1YYK A;  1UEK A;  4OO1 E;  1WJP A;  4DV1 I;  2LT7 A;  1YFH A;  5A6B A;  3HPS A;  5A6B D;  3B4T A;  4JG4 A;  4MYT A;  1A1L A;  4IFD F;  1WHN A;  4R2E A;  1JK1 A;  2WNR B;  2LTR A;  2RTX A;  4I3H A;  1DQ3 A;  2LVH A;  3ADI A;  3U1K A;  5A2Q Q;  4NZV A;  2V83 A;  1XNQ E;  4RHB B;  2UXB E;  4LF7 I;  5K36 A;  1MGT A;  3ECR A;  4QNK A;  1I94 E;  4IFD D;  4PU9 A;  2LJP A;  4ZYE A;  5DRP A;  3UK3 C;  1OYS A;  1EH6 A;  2FV4 B;  2EM5 A;  2EM0 A;  3JTZ A;  4OO1 B;  1N33 E;  3LNU A;  2JOX A;  3AV0 A;  4IS1 C;  5JEA D;  4JI3 E;  4KHP E;  1X49 A;  4DV3 I;  4TUG A;  1U2R A;  4FWH A;  2EPA A;  3T1H I;  3L7Z A;  3AUZ A;  2V86 A;  3HUL A;  3Q6M A;  4J3D A;  3EPK A;  4LOM A;  5K36 C;  1R6L A;  4R2P A;  2C37 B;  5BR8 I;  4JI2 I;  4OX9 I;  2EOO A;  4DUY E;  3D4J A;  1IBL E;  4WUD A;  2HKE A;  4LF5 E;  3NZK A;  2V34 A;  2JP9 A;  4DKK A;  2NN6 A;  2EFG A;  4DMI A;  2BB8 A;  2YRM A;  4DXL A;  4AQY I;  1FJG I;  1Z5A A;  2YTQ A;  4URL A;  1IBL I;  2WBT A;  2R3V A;  2G7H A;  4JI0 E;  1IMU A;  2JPA A;  2JEB B;  4JI1 E;  5C0X A;  5BR8 E;  5C0X B;  4U3D A;  1J26 A;  4BHC A;  2YTO A;  3IWC A;  4DV7 I;  1TF6 A;  2EMC A;  2EN2 A;  1S4E A;  4JYA I;  1TN9 A;  3P1X A;  5IWA E;  3C6M A;  2PO2 B;  1GTK A;  2DLQ A;  3QT7 A;  4DU7 A;  4GKJ I;  1X48 A;  2EPN A;  2HK2 A;  4FW5 A;  2R76 A;  1A6F A;  4K0K E;  3H4L A;  4MU1 A;  3M99 B;  4R2R A;  4B3T E;  4TUI A;  4BCA A;  1B69 A;  2NPF A;  2RQL A;  4DV4 E;  1EI1 A;  2CG9 A;  2JEA A;  2ADR A;  2R42 A;  2UXD E;  2ODR C;  1MEY C;  3DJW A;  1A1F A;  4USM A;  3J7A M;  2EQ0 A;  4GEQ B;  1IQO A;  4BA2 B;  1XMO I;  2PNZ A;  4IZJ D;  1EA6 A;  2NN6 E;  2WZO A;  1UHZ A;  2EOY A;  2HC5 A;  1EKZ A;  2B3T B;  1YZ9 A;  1MX0 A;  1HNX E;  2EM9 A;  4OOG C;  2V2Z A;  1OYP A;  4J8Z A;  5A6K A;  4DV0 I;  1QZR A;  4F6N A;  2EN8 A;  4FN5 A;  3OTO I;  1JK2 A;  1YH8 A;  4KZS A;  3HQ1 A;  2B7V A;  4LF4 E;  1MG7 A;  2RS7 A;  5LL6 R;  2O1U A;  4X9J A;  1KJK A;  5DNY A;  4IJD A;  1Z0V A;  1AAY A;  1ZM3 A;  5KL5 A;  2YSP A;  4HAC B;  4DR3 I;  2UU9 E;  2C38 B;  1N34 E;  2MC6 A;  3F6G A;  5TSE A;  4IZK A;  2B7T A;  4P52 A;  1WUU A;  3B82 A;  2V8Q B;  2NUG A;  1N34 I;  2YRK A;  2DSY A;  2LMZ A;  3KRN A;  2KHX A;  3J80 C;  4BMJ A;  1ZBT A;  2K7I A;  2DB2 A;  2KON A;  4BA2 A;  1X6F A;  4M0V A;  4WXC A;  1PVG A;  4P78 A;  3B78 A;  1UDO A;  3MHS C;  2BV3 A;  3F0N A;  4U3B A;  2YTI A;  2EMX A;  3ADG A;  1F2I G;  1TF3 A;  2GO3 A;  5GME A;  1X3C A;  2O1W A;  2EQ1 A;  5JEA B;  2EMB A;  5C0X E;  1VI7 A;  1UDS A;  2WP8 A;  2F8B A;  1WXR A;  2EPP A;  4IZK B;  2RSI A;  1DI2 A;  1PIE A;  2E1R A;  1YUJ A;  2EPR A;  3C4T A;  2CVE A;  3PYD A;  4LF4 I;  3THN A;  2RS6 A;  4K0K I;  1KKH A;  2VES A;  4LCH A;  3EPJ A;  4XTJ A;  4JI5 I;  1N33 I;  1E3H A;  2M7Q A;  2EOQ A;  3ZKB A;  2IOQ A;  3K1J A;  1QU6 A;  4DR7 I;  1N0V C;  1T4N A;  2EOI A;  2V85 A;  1N36 E;  3J81 Q;  2EN4 A;  4JI6 I;  1Z1B A;  4ZYH A;  1XMO E;  2UUC E;  2JWO A;  1P42 A;  1N3G A;  1MU5 A;  1XNR I;  2JEA B;  2YTJ A;  4IFD E;  2ZM6 E;  4F2J C;  3CWV A;  2EL4 A;  2EOS A;  1ZM2 A;  4FW3 A;  4GQU A;  4JI7 I;  2V2Q A;  2VQE I;  2DEI A;  4X8W A;  2EOZ A;  2EPL X;  4MQY A;  2Z5B A;  4UTG A;  4BA1 A;  3C4B A;  4AIM A;  1Z0E A;  4LF8 I;  4P7D A;  3JAM Q;  2UUC I;  1ZU1 A;  2UU9 I;  4LTY A;  1ZXM A;  3ZKD A;  3ZM7 A;  3IWB A;  2VRD A;  2EOM A;  4OO1 A;  4LF5 I;  3J80 Q;  3QT6 A;  1HNZ E;  2YTF A;  1E3P A;  1Z59 A;  4FW6 A;  5FWK A;  2EMA A;  4WX9 A;  4KQV A;  4DR1 I;  2PO0 B;  3H1C A;  3MHH C;  4JI4 I;  3PS2 A;  1HR0 E;  2KOU A;  1R6M A;  2EN6 A;  1S16 A;  5A6J A;  2HFU A;  1T4O A;  2EOH A;  2N8X A;  4ED4 A;  1Y6Z A;  4IFD A;  1WHQ A;  3LLH A;  2WBU A;  4JI4 E;  2EWL A;  4LFB E;  1T39 A;  1O0W A;  1KVK A;  4X62 E;  2VF1 A;  1YYW A;  5JEA E;  1X47 A;  4DR1 E;  4DR5 I;  3THO B;  4F9A B;  2LRS A;  4X64 E;  1Z0T A;  2C39 A;  4DV6 E;  3HKM A;  2EOR A;  5ELW A;  4DR4 E;  4DU8 A;  4R2S A;  4ZYG A;  4LF9 I;  1H7S A;  2VQE E;  5KL3 A;  1FWK A;  3K85 A;  4IFD C;  5DRQ A;  4P7A A;  1IBM I;  1Z5B A;  4YY3 I;  4DUZ I;  1BKN A;  5DRR A;  2L2M A;  2L3J A;  2CZ9 A;  3V2U C;  1QNT A;  3T1H E;  1Y60 A;  2BM1 A;  3LPS A;  1PJQ A;  1UIL A;  4DR3 E;  2EPO A;  2Z5E A;  5JEA C;  1RMD A;  4QNJ A;  2JXP A;  2LO3 A;  4L5N C;  4WFT A;  5IWA I;  1XNR E;  3ADJ A;  3M7N G;  5LMU I;  3BBG A;  2EOJ A;  2EPZ A;  1RRE A;  2A2D A;  4IS9 A;  4X65 I;  2BBG A;  2GPI A;  3ADL A;  1UDQ A;  3P3G A;  4PRX A;  4LFC E;  1YUI A;  2A25 A;  2EMG A;  1UBD C;  3P3C A;  4DV0 E;  1T38 A;  2IES A;  4JI8 I;  3EQ1 A;  3M85 D;  2Q2E B;  1Z0C A;  4N4R B;  2ZBK B;  3F6H A;  3GCM A;  4R2Q A;  4DR5 E;  3T1Y I;  4F6M A;  4F9C B;  3J81 C;  2EP3 A;  3QT8 A;  2JR1 A;  3BID A;  2Q8U A;  4LF6 I;  4DR2 E;  3KZZ A;  2GO4 A;  2PNL A;  1X6E A;  1UDN A;  5KL6 A;  2N3G A;  4R8O A;  4X66 E;  4DV5 E;  2M9A A;  4MU4 A;  4IFD B;  1SFE A;  2EM8 A;  2HHH E;  2PO2 A;  1KTV A;  1A1I A;  3PS1 A;  5EKW A;  1STU A;  2C39 B;  2UXD I;  4I8O A;  5LLQ A;  4AM3 A;  2V89 A;  4DV2 I;  2EML A;  5T6J A;  3JAM C;  1HK7 A;  1ZM9 A;  4HYM A;  2JEB A;  1ZXN A;  2BM0 A;  1Z0W A;  5DNX A;  4JI6 E;  5LMN E;  2CPN A;  2E1M A;  2ZIT A;  4RH8 A;  4NXN I;  2LV2 A;  4JI5 E;  1Z0G A;  4R2C A;  2UUA I;  4WYQ B;  2IHR 1;  4KWY A;  4MLQ A;  2GQ0 A;  2J7K A;  2EM7 A;  2NN6 C;  4FW7 A;  4DUZ E;  4LFA E;  2DIX A;  5EL9 A;  2EQ3 A;  1IBM E;  5F3W A;  1RQ0 A;  4F9B B;  2YU5 A;  2YWQ A;  1A1H A;  5C0X C;  1B62 A;  4FWD A;  1XHK A;  4B3R I;  1YYO A;  1XMQ E;  2I13 A;  2Z5C A;  2N3H A;  1AH5 A;  2WBS A;  1H73 A;  3MSW A;  2ENC A;  4R2A A;  1LLM C;  2JYA A;  2HGH A;  4GKJ E;  2AJ4 A;  2L3C A;  1B63 A;  2WW4 A;  5K36 F;  2LE2 A;  2YZT A;  4M30 A;  4B3T I;  1FNM A;  5KL7 A;  3HXL A;  1NCS A;  5FLX Q;  1YSA C;  3CDI A;  1HR0 I;  2FGG A;  4JI8 E;  1USU A;  4LF7 E;  1XNQ I;  4ZYD A;  5L3J A;  2UXB I;  4F54 A;  2NAB A;  4OZE A;  2L2N A;  2RPC A;  2V87 A;  1EH7 A;  5IXM B;  2NN6 F;  2XEX A;  4JI1 I;  4NBQ A;  2EL5 A;  3PRY A;  4DR6 E;  3ZZ0 A;  2E5L I;  4AQY E;  3OML A;  5LMU E;  3PS3 A;  1ZR9 A;  3BGH A;  3B8H A;  2V88 A;  3C6K A;  2YTN A;  1T4L B;  4R03 A;  4Z7Y A;  1WRJ A;  2LCE A;  4Q35 B;  1N0U A;  2MKN A;  1K47 A;  5K36 D;  2EN1 A;  5IV8 B;  3KWR A;  1FWL A;  2EM6 A;  2AE8 A;  4OKG A;  2EMH A;  3H09 A;  2JE6 A;  2EMZ A;  2L92 A;  4YY3 E;  4DV2 E;  4O4K A;  1Z5C A;  4LPF A;  2BA0 G;  2PO1 B;  1NEI A;  2DMI A;  1KIJ A;  5LMN I;  5IT9 Q;  2CTD A;  3HJC A;  2A2C A;  4EMD A;  2C38 A;  2I9I A;  1Y4U A;  2IOP A;  4WXD A;  3QT5 A;  2D9H A;  2GLI A;  3P3E A;  4X64 I;  1DAR A;  4WUB A;  1NHI A;  4O24 A;  4MU0 A;  4B3M E;  4USK A;  3OTO E;  2YTE A;  2LUQ A;  5GMD A;  1PKP A;  2BR2 B;  2UXC E;  3V5R A;  1N32 E;  2EM4 A;  1G2D C;  1IQS A;  2NUF A;  1IBK I;  4BC9 A;  2PNM A;  3UHM A;  2V2V A;  5K36 B;  4OO1 F;  4JYA E;  5JEA F;  4B3R E;  1NZ0 A;  1GQE A;  2NN6 B;  5CFF E;  1N32 I;  2WNR A;  2GS8 A;  3CDJ A;  4M2Z A;  4WPY A;  1YHC A;  2X7I A;  3LML A;  4O5G A;  2X36 A;  4DR2 I;  2HKJ A;  1NHJ A;  2ODR D;  3BF2 A;  5AE1 A;  4DPT A;  1G2F C;  5C0X D;  4NXM E;  4HXZ A;  3HPZ A;  2DEJ A;  2EMI A;  4DV7 E;  2BA1 G;  4YHH E;  1H7U A;  1X5W A;  3PYE A;  1FI4 A;  4DPX A;  2UUB I;  2H36 X;  2M1S A;  4GKK E;  2YTP A;  5DRO A;  4NXM I;  1DGC A;  2VQF I;  2HFS A;  4HAC A;  2EMW A;  2UUB E;  4YHH I;  1BBG A;  2EL6 A;  1PJS A;  3K6Q A;  4NHR A;  2LUP B;  4FWG A;  4HTG A;  4FW4 A;  2R1F A;  3IWD A;  4MDT A;  4R1F A;  4BS9 A;  3QG5 C;  4ISA A;  4LU9 A;  1NHH A;  1X6H A;  2YSO A;  4N3O A;  2HJJ A;  4IZJ A;  4JV5 E;  4X62 I;  4GKK I;  3VK6 A;  1FJG E;  2O1T A;  1ELO A;  1J5E I;  2Z5C B;  5AC5 A;  5DNL A;  4UT4 A;  1YPN A;  3L7Z B;  2O3Z A;  3JU0 A;  1BB8 A;  3ZOQ B;  2J7J A;  2RSM A;  3EPL A;  2EE8 A;  4LCG A;  3Q1Q A;  1PDA A;  5AC4 A;  2JT2 A;  2Z5B B;  4BA1 B;  4GZN C;  4B3M I;  4DR7 E;  4DPU A;  2V8P A;  4Q28 A;  4BC7 A;  1Z0B A;  3J7Y p;  1XMQ I;  2ELZ A;  5KL2 A;  2YTG A;  2J65 A;  1VIS A;  3LTO A;  5C0X F;  2EPX A;  4O43 A;  4LF8 E;  4HY1 A;  2PO0 A;  2EN7 A;  2CSH A;  1L4S A;  3M85 G;  2CT1 A;  5FLX C;  1HNW I;  1D6T A;  4B3S E;  3HTX A;  5AE3 A;  4X65 E;  1H74 A;  2EPU A;  2ZM6 I;  2EMK A;  5AE2 A;  2YPN A;  2PRT A;  3TQM A;  4DPW A;  2LBS B;  2CGE A;  2O1V A;  2EM2 A;  4BBY A;  2E5L E;  2OI2 A;  2MDG A;  4AID A;  2JOB A;  1H72 C;  4JI7 E;  2WP8 B;  3ZZT A;  4B3S I;  1ZBQ A;  1HNX I;  3P76 A;  4ZVI A;  2UUA E;  2GHF A;  4FK5 C;  4M9V C;  2HHH I;  4PRV A;  4X66 I;  1KYQ A;  4DV5 I;  1OJ4 A;  1OYR A;  3DD6 A;  2F4V I;  5K36 E;  4L8N A;  5A6A A;  2DLK A;  3EPH A;  2YTD A;  2K4V A;  2NA2 A;  5IT9 C;  3WU4 A;  1Y4S A;  2E72 A;  4JV5 I;  2FTX B;  2NN6 D;  3GON A;  5A2Q C;  1HNZ I;  2L33 A;  2UXC I;  2BA1 D;  3WU5 A;  3PYG A;  2EZ6 A;  1A1G A; 
#chains in the Genus database with same CATH homology
 3RMP A;  1USV A;  2L8T A;  2VQF E;  1IBK E;  4LFA I;  1RC7 A;  2VE7 C;  4WSP A;  2YT4 A;  2JY9 A;  1ZM4 A;  1SR9 A;  4DPY A;  3WU3 A;  4FW9 A;  2L6M A;  4DR4 I;  1N36 I;  2MDR A;  2HK3 A;  3M6A A;  2VF3 A;  1HNW E;  2F4V E;  3T1Y E;  2DMY A;  4JI0 I;  5AAS A;  4DV3 E;  2NUE A;  4JI3 I;  4KHP I;  4LFC I;  2L2K B;  4RPF A;  3FIG A;  4M1K A;  4DV6 I;  3Q6N A;  4DR6 I;  3ZZU A;  4DUY I;  2JVA A;  2LJH A;  1J5E E;  4IZJ B;  4JI2 E;  2M4I A;  4OX9 E;  1I94 I;  3PYF A;  3K17 A;  4MYU A;  3DF6 A;  3J7A G;  4DV4 I;  1RR9 A;  3WU6 A;  1FKA E;  2LTS A;  4DV1 E;  2B9D A;  1GZ6 A;  3VYY A;  4LF6 E;  3VYX A;  4LFB I;  4NXN E;  4WUC A;  3P06 A;  4LF9 E;  5ADZ A;  4Z7C A;  2MC5 A;  1YYK A;  1UEK A;  4DV1 I;  3HPS A;  4JG4 A;  4MYT A;  1WHN A;  2LTR A;  2RTX A;  4I3H A;  1DQ3 A;  3ADI A;  5A2Q Q;  2V83 A;  1XNQ E;  2UXB E;  4LF7 I;  1I94 E;  4PU9 A;  2LJP A;  2FV4 B;  3JTZ A;  1N33 E;  3LNU A;  2JOX A;  3AV0 A;  4JI3 E;  4KHP E;  1X49 A;  4DV3 I;  4TUG A;  1U2R A;  4FWH A;  3T1H I;  3Q6M A;  3AUZ A;  2V86 A;  3HUL A;  5BR8 I;  4JI2 I;  4OX9 I;  4DUY E;  3D4J A;  1IBL E;  4WUD A;  2HKE A;  4LF5 E;  2V34 A;  4DKK A;  2EFG A;  4DMI A;  1FJG I;  4DXL A;  4AQY I;  1Z5A A;  4URL A;  1IBL I;  2R3V A;  2G7H A;  4JI0 E;  4JI1 E;  5BR8 E;  1J26 A;  3IWC A;  4DV7 I;  4JYA I;  1S4E A;  3P1X A;  5IWA E;  3QT7 A;  4DU7 A;  4GKJ I;  1X48 A;  2HK2 A;  1A6F A;  3H4L A;  4K0K E;  4B3T E;  4TUI A;  4BCA A;  2NPF A;  4DV4 E;  1EI1 A;  2CG9 A;  2R42 A;  2UXD E;  2ODR C;  3DJW A;  3J7A M;  4USM A;  4GEQ B;  1XMO I;  4IZJ D;  1EA6 A;  2WZO A;  1UHZ A;  1EKZ A;  2B3T B;  1YZ9 A;  1MX0 A;  1HNX E;  4OOG C;  2V2Z A;  4J8Z A;  4DV0 I;  1QZR A;  3OTO I;  4KZS A;  3HQ1 A;  2B7V A;  4LF4 E;  1MG7 A;  2RS7 A;  5LL6 R;  2O1U A;  4FN5 A;  1Z0V A;  5DNY A;  1ZM3 A;  4DR3 I;  4HAC B;  2UU9 E;  1N34 E;  2MC6 A;  3F6G A;  4IZK A;  2B7T A;  4P52 A;  1WUU A;  3B82 A;  2V8Q B;  2NUG A;  1N34 I;  2DSY A;  2LMZ A;  2KHX A;  3J80 C;  4BMJ A;  1ZBT A;  2DB2 A;  2KON A;  4M0V A;  1PVG A;  4P78 A;  3B78 A;  2BV3 A;  3F0N A;  3ADG A;  5GME A;  2O1W A;  2F8B A;  1WXR A;  4IZK B;  1DI2 A;  1PIE A;  2E1R A;  3C4T A;  3PYD A;  4LF4 I;  2RS6 A;  4K0K I;  1KKH A;  1N33 I;  4XTJ A;  4JI5 I;  2M7Q A;  3ZKB A;  2IOQ A;  3K1J A;  1QU6 A;  4DR7 I;  1N0V C;  1T4N A;  4JI6 I;  2V85 A;  1N36 E;  3J81 Q;  1XMO E;  2UUC E;  2JWO A;  1MU5 A;  1XNR I;  2ZM6 E;  3CWV A;  1ZM2 A;  4JI7 I;  2V2Q A;  2VQE I;  2DEI A;  4X8W A;  2Z5B A;  4UTG A;  3C4B A;  1Z0E A;  4LF8 I;  4P7D A;  3JAM Q;  2UUC I;  2UU9 I;  4LTY A;  1ZXM A;  3ZKD A;  3ZM7 A;  3IWB A;  4LF5 I;  3J80 Q;  3QT6 A;  1HNZ E;  1Z59 A;  5FWK A;  4DR1 I;  4KQV A;  4JI4 I;  1HR0 E;  2KOU A;  1S16 A;  2HFU A;  1T4O A;  4ED4 A;  1Y6Z A;  1WHQ A;  3LLH A;  4JI4 E;  2EWL A;  4LFB E;  1O0W A;  1KVK A;  4X62 E;  2VF1 A;  1YYW A;  1X47 A;  4DR1 E;  4DR5 I;  4F9A B;  2LRS A;  4X64 E;  1Z0T A;  4DV6 E;  4DR4 E;  4DU8 A;  4LF9 I;  1H7S A;  2VQE E;  3K85 A;  1FWK A;  4P7A A;  1IBM I;  1Z5B A;  4YY3 I;  4DUZ I;  1BKN A;  2L2M A;  2L3J A;  2CZ9 A;  3V2U C;  3LPS A;  3T1H E;  2BM1 A;  1UIL A;  4DR3 E;  2Z5E A;  4L5N C;  4WFT A;  5IWA I;  1XNR E;  3ADJ A;  5LMU I;  1RRE A;  2A2D A;  4X65 I;  3ADL A;  4PRX A;  4LFC E;  4DV0 E;  4JI8 I;  2Q2E B;  1Z0C A;  2ZBK B;  3T1Y I;  3F6H A;  4DR5 E;  4F9C B;  3J81 C;  3QT8 A;  2JR1 A;  4LF6 I;  4DR2 E;  2PNL A;  2N3G A;  4R8O A;  4X66 E;  4DV5 E;  2HHH E;  1KTV A;  1STU A;  2UXD I;  4I8O A;  2V89 A;  4DV2 I;  5T6J A;  1HK7 A;  3JAM C;  1ZM9 A;  4HYM A;  2BM0 A;  1Z0W A;  4JI6 E;  5LMN E;  2CPN A;  2E1M A;  2ZIT A;  4NXN I;  4JI5 E;  1Z0G A;  2UUA I;  4WYQ B;  2IHR 1;  2GQ0 A;  2J7K A;  4DUZ E;  4LFA E;  2DIX A;  1IBM E;  5F3W A;  1RQ0 A;  4F9B B;  1B62 A;  4FWD A;  1XHK A;  4B3R I;  1YYO A;  1XMQ E;  2Z5C A;  2N3H A;  1H73 A;  3MSW A;  2AJ4 A;  4GKJ E;  2L3C A;  1B63 A;  2WW4 A;  2LE2 A;  2YZT A;  4M30 A;  4B3T I;  1FNM A;  3HXL A;  5FLX Q;  1HR0 I;  2FGG A;  4JI8 E;  1USU A;  4LF7 E;  1XNQ I;  5L3J A;  2UXB I;  4F54 A;  2L2N A;  2V87 A;  4JI1 I;  2XEX A;  3PRY A;  4DR6 E;  3ZZ0 A;  2E5L I;  4AQY E;  3OML A;  5LMU E;  3B8H A;  2V88 A;  1T4L B;  4R03 A;  4Z7Y A;  1N0U A;  1K47 A;  3KWR A;  1FWL A;  3H09 A;  2L92 A;  4YY3 E;  4DV2 E;  1Z5C A;  1KIJ A;  5LMN I;  5IT9 Q;  3HJC A;  2A2C A;  4EMD A;  2IOP A;  1Y4U A;  3QT5 A;  4X64 I;  1DAR A;  4WUB A;  1NHI A;  4USK A;  4B3M E;  5GMD A;  3OTO E;  2LUQ A;  1PKP A;  3V5R A;  2UXC E;  1N32 E;  2NUF A;  1IBK I;  4BC9 A;  2PNM A;  2V2V A;  4JYA E;  4B3R E;  1NZ0 A;  1GQE A;  5CFF E;  1N32 I;  2GS8 A;  4M2Z A;  4WPY A;  2X7I A;  3LML A;  2X36 A;  4DR2 I;  2HKJ A;  1NHJ A;  2ODR D;  5AE1 A;  4DPT A;  4NXM E;  4HXZ A;  3HPZ A;  2DEJ A;  4DV7 E;  4YHH E;  1H7U A;  4DPX A;  3PYE A;  1FI4 A;  2UUB I;  2H36 X;  2M1S A;  4GKK E;  4NXM I;  2VQF I;  2HFS A;  4HAC A;  2UUB E;  4YHH I;  3K6Q A;  2LUP B;  4FWG A;  3IWD A;  4R1F A;  4BS9 A;  4LU9 A;  1NHH A;  4N3O A;  4IZJ A;  4JV5 E;  4X62 I;  4GKK I;  3VK6 A;  1FJG E;  2O1T A;  1ELO A;  1J5E I;  2Z5C B;  4UT4 A;  3JU0 A;  3ZOQ B;  2RSM A;  3Q1Q A;  2Z5B B;  4B3M I;  4DR7 E;  4DPU A;  2V8P A;  4Q28 A;  4BC7 A;  1Z0B A;  3J7Y p;  1XMQ I;  1VIS A;  3LTO A;  4LF8 E;  4HY1 A;  5FLX C;  1HNW I;  1D6T A;  4B3S E;  3HTX A;  5AE3 A;  4X65 E;  1H74 A;  2ZM6 I;  5AE2 A;  4DPW A;  2LBS B;  2CGE A;  2O1V A;  4BBY A;  2E5L E;  2OI2 A;  2JOB A;  1H72 C;  4JI7 E;  3ZZT A;  4B3S I;  1ZBQ A;  1HNX I;  4ZVI A;  2UUA E;  2HHH I;  4PRV A;  4X66 I;  4DV5 I;  1OJ4 A;  2F4V I;  4L8N A;  2K4V A;  2NA2 A;  5IT9 C;  3WU4 A;  1Y4S A;  4JV5 I;  2FTX B;  3GON A;  5A2Q C;  1HNZ I;  2L33 A;  2UXC I;  3WU5 A;  3PYG A;  2EZ6 A;  1ZXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...