4GKKE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4gkkE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkkE02
3QT5A 1Z5AA 2UXCI 1RQ0A 3VYXA 2YT4A 4MYTA 3T1HE 5LL6R 3ADGA 4DV3I 4DPTA 4LF5I 4JI5E 4LF4I 2HFUA 1XHKA 1Z0GA 1MX0A 2DEJA 3LLHA 4DV0E 3B8HA 3PYGA 4JYAE 4JI2I 1ZM2A 1QU6A 4USMA 5GMDA 3ZKDA 2Q2EB 4B3RI 4LFCE 1FJGE 4FW9A 2LJHA 1KTVA 4B3TI 2L3JA 2NUFA 3CWVA 1DARA 2UXBI 4OX9E 5CFFE 4X66E 3QT6A 4WUDA 4YHHI 4X65E 3ADLA 4LFBE 5IWAI 3ZKBA 4NXME 4NXNE 4DV2E 2WW4A 4KHPE 4DR7E 5A2QC 4DV7I 1B62A 4P52A 2V34A 1N36E 2UXDE 3LNUA 2R42A 4DR3E 1XNQE 2EZ6A 2HK2A 4HACA 4DR4I 1FI4A 4GKJE 5FLXQ 1I94E 4DV6E 4DU8A 2LJPA 2N3GA 2L2KB 1A6FA 4LF6E 1PVGA 4EMDA 3ZM7A 4DV4I 1RC7A 1XMOI 2BM1A 3HTXA 4JI3I 5BR8E 3WU6A 5LMNE 1HNZI 4P7AA 3PYEA 4ZVIA 4GKKI 1EI1A 4JI6I 4FWDA 1H7UA 4JI8I 4DR1I 4JI4I 2V8PA 1UHZA 1FNMA 3V5RA 5IT9C 2E1RA 4K0KI 4M1KA 2RSMA 3T1YI 4X64I 3VYYA 3ZZ0A 1J26A 4B3SI 2VQFE 3K1JA 1N0UA 4WUBA 2UUCE 2E5LI 4JI0I 3WU3A 4FWGA 1Z0BA 1X48A 1ZXNA 1PKPA 4DUZI 1HNXI 1ZM4A 4YY3E 1IBLI 1H73A 2UUAE 2X7IA 2LUPB 1IBKE 4JI7E 1N34E 1NZ0A 3T1HI 4M2ZA 1N33I 1IBME 5FLXC 4USKA 4OOGC 4PU9A 4DPYA 3ZZUA 4JI5I 1RR9A 2A2DA 2BV3A 2DIXA 1DI2A 1XNRE 5IT9Q 4LFAE 4DV0I 1Z0VA 3K17A 2V2QA 2NA2A 4JYAI 2ZITA 1YYKA 4DPXA 4DV5E 2A2CA 3JAMC 3C4BA 1H7SA 3V2UC 1ZBTA 1NHHA 4JV5E 3B82A 4LFCI 1FJGI 3ADIA 4X62E 1RREA 2HHHE 4PRVA 3J7Yp 1Z0CA 4LF8E 1HR0I 4OX9I 2F4VE 2N3HA 4X66I 4DV1E 3D4JA 2DMYA 4LFBI 3QT7A 4KQVA 4NXNI 4DV2I 4DR7I 4LF9E 1KIJA 2VF3A 3LTOA 4RPFA 4JI1I 1N36I 1N32I 2CPNA 3C4TA 2UXDI 2UUBE 1OJ4A 3HULA 4DR3I 2UU9E 4GKJI 4HYMA 1I94I 4UT4A 5GMEA 2NUGA 4DV6I 1U2RA 2CZ9A 2HFSA 1HNWE 1H74A 4DR4E 2LBSB 2EFGA 2NPFA 1ELOA 1S16A 4ED4A 4LF6I 2L3CA 3JAMQ 3OTOI 2MDRA 4UTGA 2NUEA 2DB2A 4LF7I 1GQEA 1T4NA 1Z0EA 4HACB 3J80Q 4FWHA 4AQYE 4DR5E 2V2VA 2HKJA 4DR6E 4DPUA 5LMNI 3P1XA 4DUYE 4Z7CA 1T4LB 3ZZTA 1XMOE 4JI3E 4WFTA 1HNZE 2J7KA 1EKZA 4JI6E 1WHQA 2B7VA 3F0NA 4JI4E 4DR2E 2X36A 1H72C 5LMUI 1ZM3A 1N0VC 2VQFI 2L2NA 2UUCI 1Z5CA 2VQEE 1BKNA 4URLA 1NHJA 4B3SE 1X49A 4B3ME 4FN5A 2BM0A 2L2MA 4YY3I 1Z5BA 2RS7A 1WUUA 1J5EE 2LUQA 3PYDA 4JI7I 1XMQE 1N34I 2JY9A 3J7AG 2ZM6E 1FKAE 1Z59A 1IBMI 2UXCE 4WYQB 4DV3E 1X47A 4LF5E 4LF4E 1XNRI 4LFAI 3ADJA 1N33E 4DV5I 2GS8A 3Q1QA 4JV5I 4JI2E 3J80C 2ZBKB 4X62I 2HHHI 2HK3A 4B3RE 2OI2A 1NHIA 4X65I 4LF8I 4R1FA 2F4VI 4NXMI 4DV1I 4B3TE 4KHPI 4M30A 4DXLA 2AJ4A 2UXBE 1K47A 2B3TB 4MYUA 1ZM9A 4LF9I 2HKEA 4YHHE 1KVKA 1XNQI 1HR0E 4X8WA 5IWAE 1YZ9A 2UUBI 2XEXA 4DV7E 3LPSA 2LTSA 2UU9I 4DU7A 4Z7YA 2LTRA 1FWLA 1PIEA 2RS6A 1S4EA 4JI1E 1N32E 4PRXA 1WHNA 3J81C 1HNWI 2DEIA 3GONA 1UEKA 2B7TA 2R3VA 1STUA 3H4LA 3WU4A 3M6AA 2RTXA 4I3HA 3PYFA 3B78A 2LRSA 4JG4A 5BR8I 4AQYI 3OTOE 4DR5I 4DPWA 3QT8A 4DR6I 4DV4E 2IHR1 2L33A 4LF7E 4DUYI 1O0WA 2JVAA 4DKKA 1FWKA 1B63A 4WUCA 2V2ZA 3J7AM 4GKKE 1MG7A 1ZXMA 4JI8E 5L3JA 4DR1E 4HXZA 4HY1A 5A2QQ 1UILA 1VISA 1T4OA 3J81Q 4DR2I 1EA6A 1D6TA 4XTJA 4K0KE 3T1YE 3WU5A 4X64E 2VQEI 1Z0TA 1YYWA 1Z0WA 1MU5A 5LMUE 2E5LE 4JI0E 2UUAI 4B3MI 1IBKI 4DUZE 1HNXE 1J5EI 1IBLE 2KHXA 1KKHA 1XMQI 1YYOA 1QZRA 2ZM6I
chains in the Genus database with same CATH superfamily
1B69A 4MU0A 3QT5A 4IS1C 4NBQA 1Z5AA 2UXCI 2PO2B 1RQ0A 3BIDA 1KYQA 3VYXA 1WRJA 4F9BB 1Y4SA 2EOSA 3L7ZB 2YT4A 4MYTA 3T1HE 4QNJA 5LL6R 5A6KA 2EQ0A 3P3CA 3ADGA 5K36C 2EPUA 4DV3I 2JPAA 4DPTA 4JI5E 3M85G 2EMGA 3IWDA 4LF4I 4LF5I 2HFUA 1XHKA 4F2JC 3M7ND 5T6JA 2YRMA 1Z0GA 1MX0A 4WSGA 2D9HA 3H1CA 2DEJA 3LMLA 3LLHA 2YTPA 2IOPA 4DV0E 3B8HA 2GO3A 1F2IG 1G2FC 2V86A 1KJKA 3PYGA 4JYAE 1YUJA 4JI2I 2M7QA 1ZM2A 1HK7A 2ENCA 1ZBQA 2JYAA 1SFEA 1QU6A 5JEAD 4USMA 5GMDA 3ZKDA 2Q2EB 4B3RI 1GZ6A 2GPIA 2R76A 4BA2B 4LFCE 1FJGE 3MSWA 3P06A 4FW9A 2EN8A 2LJHA 2WP8A 1KTVA 5EKWA 4B3TI 4BC9A 1RHYA 5C0XF 2L3JA 2NUFA 3CWVA 1SR9A 1DARA 2UXBI 2YTGA 4OX9E 5CFFE 4X66E 3QT6A 2JOBA 4WUDA 2BA0G 4YHHI 4X65E 3ADLA 4LFBE 4BS9A 5IWAI 3M85D 3ZKBA 5K36A 1E3HA 4NXME 2ELYA 4NXNE 4DV2E 3MHSC 1UDSA 4KHPE 2WW4A 3C6MA 5A2QC 5A69A 4DR7E 4QNKA 4DV7I 2YU8A 2CG9A 1ZU1A 1B62A 4P52A 2V34A 1N36E 5DRQA 2UXDE 3LNUA 2YTFA 4RHBB 5A6AA 2R42A 2J7JA 3BGHA 4DR3E 1XNQE 2EZ6A 2HK2A 3HKMA 4HACA 3TQMA 4DR4I 5K36E 2M9AA 4X9JA 2MDGA 1FI4A 4GKJE 4FW5A 1X6EA 1XXEA 2C38A 1I94E 5FLXQ 2E72A 4DV6E 4R2EA 4DU8A 1MEYC 4OO1C 3B4TA 4MU3A 1X6FA 4RH8A 2LJPA 3IWCA 2E1MA 2EM7A 2N3GA 2ODRC 2EOFA 4ZYEA 2L2KB 4IZKA 4AIDA 2YTOA 2KONA 1A6FA 4ZYHA 4L8NA 2M1SA 4O43A 4LF6E 5A6BD 5IXMB 1PVGA 3Q6NA 4EMDA 1DQ3A 1R6LA 1LLMC 4IFDE 4MLVA 2C39A 2CVEA 3ZM7A 5EL9A 3C6KA 2HGHA 4DV4I 1RC7A 2ADRA 2EN3A 3MHHC 3THOB 2JP9A 1XMOI 2BM1A 1R6MA 1UBDC 2YTNA 1USVA 3HTXA 4F6NA 1E3PA 5BR8E 2L8TA 3KWRA 3WU6A 4JI3I 5LMNE 1HNZI 4P7AA 3PYEA 4ZVIA 4GKKI 1EI1A 2EN4A 2WZOA 4JI6I 2PO0A 4R2AA 4FWDA 4BHBA 1PDAA 2L92A 4BCAA 4WXDA 1H7UA 2EM3A 2O1WA 4OZEA 3QG5C 4JI8I 2EM0A 2J65A 4DR1I 4JI4I 4OO1A 1A1JA 2V8PA 1UHZA 5JEAF 1FNMA 3V5RA 2WBUA 5IT9C 3HXLA 2E1RA 4M1KA 4MQYA 4K0KI 2RSMA 3T1YI 4R2QA 2EPZA 4R2RA 2EPAA 2O1VA 2EM6A 4X64I 5DNYA 3VYYA 4M9VC 5TSEA 4BA1A 3ZZ0A 5KL4A 3AV0A 1J26A 2WNRA 4AIMA 2EM5A 4B3SI 2VQFE 3K1JA 1N0UA 4WUBA 2LJUA 2UUCE 3UHMA 2E5LI 2RPCA 2BR2A 4JI0I 3WU3A 3P3GA 3VHTB 3EQ1A 4FWGA 2EORA 1X48A 2YWQA 1Z0BA 4OKGA 1PJTA 5C0XC 1ZXNA 2PNLA 1PKPA 2EM9A 2EM8A 4DUZI 1HNXI 2FTXB 1ZM4A 4OO1B 2YZTA 4YY3E 1IBLI 1H73A 2UUAE 2X7IA 2LE2A 2VE7C 4R8OA 1OYPA 4LCGA 5AE3A 2LUPB 1IBKE 2DLKA 3F6HA 4JI7E 4ZYDA 1N34E 2JEAA 2L6MA 2I9IA 1NZ0A 3T1HI 2MC5A 5KL7A 4FK5C 4M2ZA 2V89A 1N33I 4LTYA 1IBME 5FLXC 2Z5EA 4USKA 2V83A 4OOGC 4ZYGA 1A1HA 4PU9A 1PJSA 3ZZUA 4DPYA 4JI5I 2LT7A 2HJJA 4MU1A 4U3DA 1EH8A 2NN6C 1RR9A 2A2DA 2BV3A 3GCMA 2DIXA 2GO4A 1Y4UA 2RQLA 1DI2A 2BR2B 2EJ4A 2EPKX 1XNRE 5IT9Q 4LFAE 1A1IA 2JEBB 4DV0I 4O24A 3RMPA 1Z0VA 1YFHA 1UN6B 3K17A 3DJWA 4IFDC 5DNLA 2V2QA 2NA2A 4JYAI 2ZITA 1YYKA 2A25A 2EL4A 5C0XA 2WBTA 5DRRA 2F8BA 2R1FA 3JAMC 3C4BA 4DV5E 3F6GA 1H7SA 2A2CA 1JK2A 3NZKA 3V2UC 1ZBTA 1Y5YA 1NHHA 1VI7A 4JV5E 3B82A 4KZSA 2YTEA 4LFCI 1FJGI 2IOQA 2YTDA 3HPSA 2BA1G 4R2CA 3ADIA 4X62E 2EWLA 4P7DA 1RREA 2HHHE 5AE1A 3PS2A 4PRVA 2K7IA 3J7Yp 2EOEA 5C0XE 4DPXA 3EPKA 2EMYA 4LF8E 1Z0CA 4NHRA 1HR0I 4HTGA 4OX9I 2F4VE 2N3HA 4R2PA 2EMXA 4DV1E 4X66I 2ENHA 2EP3A 5KL5A 3D4JA 2DMYA 4LFBI 3QT7A 4KQVA 4OO1D 3BF2A 1USUA 4NXNI 4DV2I 2JR1A 2Z5CA 2NN6A 4LF9E 2PO1A 2VRDA 2EPMX 2G7HA 2ODRD 1KIJA 4DR7I 2EN6A 2PRTA 2VF3A 3H09A 3LTOA 4RPFA 4JI1I 1N36I 1N32I 2CPNA 3C4TA 2EPPA 4TUGA 2UUBE 2CGEA 2UXDI 1OJ4A 4NZVA 3HULA 1BBGA 4ISAA 4DR3I 2C37A 2UU9E 4GKJI 2NN6E 2H36X 5AASA 4HYMA 1I94I 4UT4A 4IFDA 2WP8B 5GMEA 2NUGA 4DV6I 2WBSA 2WCC3 4MLQA 1U2RA 2CZ9A 1X6HA 1WJPA 2DLQA 2EL6A 2HFSA 4IZJA 5LLQA 2JT2A 5FWKA 1HNWE 1H74A 1UDNA 4LCFA 5K36F 4Q28A 2LBSB 4DR4E 2MKDA 2BA1D 2EFGA 2V88A 1TN9A 2NPFA 3AUZA 1ELOA 1GTKA 1S16A 2LCEA 2L3CA 4MDTA 4ED4A 3JAMQ 3OTOI 2MDRA 4LF6I 4IFDB 4FW4A 5K36B 2BA0D 4UTGA 1N3GA 2NUEA 1YHCA 5IV8B 2PNMA 2DB2A 4LF7I 1GQEA 5AE2A 2PO1B 1A1GA 1T4NA 4GZNC 1Z0EA 4HACB 3J80Q 4FWHA 2YRKA 4P78A 2YTIA 4AQYE 4DR5E 3KZZA 1Y6ZA 2C38B 2VESA 2V2VA 2EOXA 2HKJA 4DR6E 4DPUA 2IESA 2F1DA 5LMNI 3P1XA 4DUYE 2JOXA 1DGCA 3CDJA 3PS3A 2LVHA 4Z7CA 2EM2A 1T4LB 4IZKB 3ZZTA 1XMOE 4BHCA 4MU4A 2LMZA 3U1KA 4IZJB 1ZAAC 4JI3E 2KOUA 4WFTA 1HNZE 3GLLA 1X3CA 2J7KA 2EMZA 1EKZA 3PRYA 2M4IA 4JI6E 1IQOA 2C39B 1WHQA 1IQSA 2B7VA 3GMEA 2EOJA 2EL5A 2EMAA 2FGGA 2NABA 3UK3C 4TUIA 4JI4E 1Y60A 3F0NA 4DR2E 2EMHA 2X36A 1H72C 5LMUI 1ZM3A 1A1LA 2LO3A 1N0VC 2VQFI 2L2NA 2PO0B 2CSHA 3P3EA 4I8OA 2UUCI 1Z5CA 4OO1F 3L7ZA 2YRHA 4N4RB 2VQEE 1BKNA 5F3WA 5K36D 2PNZA 1QNTA 2EMFA 4URLA 2JE6A 3Q6MA 3PS1A 5ELWA 2EOYA 1NHJA 2EQ3A 3THNA 4B3SE 1X49A 4B3ME 4FN5A 2BM0A 2O3ZA 2L2MA 5DROA 2EMWA 2CTDA 1Z5BA 2RS7A 3K85A 4YY3I 2NN6D 3K6QA 4BBYA 5AC4A 1WUUA 2EN1A 2LUQA 4F9CB 5A6BA 1J5EE 1JK1A 3PYDA 4JI7I 1XMQE 4DMIA 1N34I 2JY9A 3J7AG 5A6JA 4O5GA 3EPLA 2V8QB 1OYSA 2ZM6E 1FKAE 4BA1B 4F6MA 1L4SA 2WNRB 4IFDD 2I13A 1Z59A 4U3BA 1IBMI 2UXCE 1A1FA 1AH5A 4HEIA 2ELZA 4BA2A 2MC6A 4IZJD 4WYQB 2RSIA 2JXPA 2N8XA 4IJDA 4DV3E 1X47A 4LF5E 4LF4E 1XNRI 3U1YA 5DNXA 2EMKA 2VF1A 2EPNA 3ADJA 4LFAI 1G2DC 1N33E 2EMLA 2PNZB 2JE6B 1AAYA 3P76A 2CT1A 2YSOA 2EN7A 1BBOA 1TF6A 5DRPA 2BBGA 3KRNA 1P42A 3IWBA 4DV5I 2JEAB 1PJQA 2GS8A 3DF6A 3HJCA 3Q1QA 4JV5I 4JI2E 3J80C 2ZBKB 2EOMA 2ZM6I 4X62I 4LPFA 2HK3A 1IMUA 2HHHI 5AC5A 4WX9A 4B3RE 1UDOA 2OI2A 1NHIA 2FV4B 3HPZA 4X65I 4LF8I 4R1FA 3ZOQB 2F4VI 4NXMI 4DV1I 2AE8A 4B3TE 2YTJA 3OMLA 2EOZA 4M30A 4DXLA 4KHPI 2AJ4A 3EPHA 2EPLX 2UXBE 1K47A 1T38A 2B3TB 4MYUA 1ZM9A 4LF9I 2HKEA 2EQ1A 4YHHE 2LV2A 1KVKA 1XNQI 4Q35B 4R03A 4X8WA 5IWAE 1HR0E 1YZ9A 5JEAC 3M99B 5C0XB 2UUBI 2DSYA 3JU0A 4R2DA 4DV7E 2GQ0A 2XEXA 3LPSA 2LTSA 2O1TA 5KL2A 2UU9I 4IS9A 4DU7A 4Z7YA 2LTRA 1FWLA 1PIEA 4BC7A 5ADZA 2RS6A 1S4EA 4JI1E 1N32E 2EOIA 4PRXA 1WHNA 2EPCA 3J81C 1HNWI 4WPYA 4F9AB 2DEIA 3GONA 2EE8A 2YPNA 1UEKA 4LOMA 2YTQA 1BB8A 2NN6F 2B7TA 2EPRA 2R3VA 3DD6A 2YSPA 2Z5CB 2GHFA 1STUA 2NN6B 3H4LA 2V87A 1NCSA 2EPXA 3M6AA 3WU4A 2RTXA 2ENAA 4FW3A 4I3HA 3PYFA 4LU9A 4IFDF 3B78A 2LRSA 4JG4A 5BR8I 2GLIA 2C37B 4AQYI 3OTOE 4DR5I 4DPWA 3QT8A 4DR6I 3VK6A 4DV4E 2IHR1 1NEIA 5JEAA 4O4KA 2L33A 4LCHA 4LF7E 4DUYI 1O0WA 1YUIA 2JVAA 2JWOA 4DKKA 4R2SA 1Z1BA 1UDQA 1FWKA 1EH7A 2EMCA 3EPJA 2EM4A 1B63A 4WUCA 4AM3A 1X5WA 4WXCA 2V2ZA 1WXRA 4GKKE 3J7AM 2EMBA 2Z5BA 5JEAE 2YU5A 1MG7A 1YSAC 4KWYA 1ZXMA 2EOQA 2B9DA 4JI8E 5L3JA 4DR1E 4HXZA 2DMIA 4HY1A 5A2QQ 5C0XD 1YH8A 1ZR9A 1UILA 1VISA 1T4OA 2EPOA 2EOHA 2Q8UA 3J81Q 4DR2I 1EA6A 1D6TA 4XTJA 1OYRA 2PO2A 4K0KE 5KL6A 4GQUA 3T1YE 2BB8A 3ECRA 4BMJA 4WSPA 3WU5A 4X64E 5JEAB 4OO1E 2K4VA 2DGCA 1T39A 4FW7A 2EMIA 3M7NG 3BBGA 2VQEI 4F54A 1Z0TA 3JTZA 1YYWA 1Z0WA 1MU5A 5LMUE 2IERA 2MKNA 4M0VA 2E5LE 4JI0E 2UUAI 5KL3A 1TF3A 4B3MI 2Z5BB 1P47A 3CDIA 3KZYA 4J3DA 2V85A 1IBKI 1RMDA 3HQ1A 2JEBA 4DUZE 2EN2A 3L00A 1HNXE 2HC5A 2O1UA 1J5EI 1MGTA 1A1KA 1EH6A 4FW6A 1IBLE 2DRPA 2EOOA 4L5NC 2KHXA 1KKHA 4GEQB 1YYOA 1YPNA 1QZRA 4J8ZA 1XMQI 3FIGA 4N3OA
chains in the Genus database with same CATH topology
3QT5A 1Z5AA 2UXCI 1RQ0A 3VYXA 4F9BB 1Y4SA 2YT4A 4MYTA 3T1HE 5LL6R 3ADGA 4DV3I 4DPTA 4LF5I 4JI5E 4LF4I 3IWDA 2HFUA 1XHKA 5T6JA 1Z0GA 1MX0A 2DEJA 3LMLA 3LLHA 2IOPA 4DV0E 3B8HA 2V86A 3PYGA 4JYAE 4JI2I 2M7QA 1ZM2A 1HK7A 1ZBQA 1QU6A 4USMA 5GMDA 3ZKDA 2Q2EB 4B3RI 1GZ6A 4LFCE 1FJGE 3MSWA 3P06A 4FW9A 2LJHA 1KTVA 4B3TI 4BC9A 2L3JA 2NUFA 3CWVA 1SR9A 1DARA 2UXBI 4OX9E 5CFFE 4X66E 3QT6A 2JOBA 4WUDA 4YHHI 4X65E 3ADLA 4LFBE 4BS9A 5IWAI 3ZKBA 4NXME 4NXNE 4DV2E 2WW4A 4KHPE 4DR7E 5A2QC 4DV7I 2CG9A 1B62A 4P52A 2V34A 1N36E 2UXDE 3LNUA 2R42A 4DR3E 1XNQE 2EZ6A 2HK2A 4HACA 4DR4I 1FI4A 4GKJE 5FLXQ 1I94E 4DV6E 4DU8A 2LJPA 3IWCA 2E1MA 2N3GA 2ODRC 2L2KB 4IZKA 2KONA 1A6FA 4L8NA 2M1SA 4LF6E 1PVGA 4EMDA 3Q6NA 1DQ3A 3ZM7A 4DV4I 1RC7A 1XMOI 2BM1A 1USVA 3HTXA 4JI3I 5BR8E 2L8TA 3KWRA 3WU6A 5LMNE 1HNZI 4P7AA 3PYEA 4ZVIA 4GKKI 1EI1A 2WZOA 4JI6I 4FWDA 2O1WA 2L92A 4BCAA 1H7UA 4JI8I 4DR1I 4JI4I 2V8PA 1UHZA 1FNMA 3V5RA 5IT9C 3HXLA 2E1RA 4M1KA 4K0KI 2RSMA 3T1YI 2O1VA 4X64I 5DNYA 3VYYA 3ZZ0A 1J26A 3AV0A 4B3SI 2VQFE 3K1JA 1N0UA 4WUBA 2UUCE 2E5LI 4JI0I 3WU3A 4FWGA 1Z0BA 1X48A 1ZXNA 2PNLA 1PKPA 4DUZI 1HNXI 2FTXB 1ZM4A 2YZTA 4YY3E 1IBLI 1H73A 2UUAE 2X7IA 2LE2A 2VE7C 4R8OA 5AE3A 2LUPB 1IBKE 4JI7E 3F6HA 1N34E 2L6MA 1NZ0A 3T1HI 2MC5A 4M2ZA 2V89A 1N33I 4LTYA 1IBME 5FLXC 2Z5EA 4USKA 2V83A 4OOGC 4PU9A 3ZZUA 4DPYA 4JI5I 1RR9A 2A2DA 2BV3A 2DIXA 1Y4UA 1DI2A 1XNRE 5IT9Q 4LFAE 4DV0I 3RMPA 1Z0VA 3K17A 3DJWA 2V2QA 2NA2A 4JYAI 2ZITA 1YYKA 4DPXA 2F8BA 3JAMC 4DV5E 3C4BA 2A2CA 3F6GA 1H7SA 3V2UC 1ZBTA 1NHHA 4JV5E 3B82A 4KZSA 4LFCI 1FJGI 2IOQA 3HPSA 3ADIA 4X62E 2EWLA 4P7DA 1RREA 2HHHE 5AE1A 4PRVA 3J7Yp 1Z0CA 4LF8E 1HR0I 4OX9I 2F4VE 2N3HA 4X66I 4DV1E 3D4JA 2DMYA 4LFBI 3QT7A 4KQVA 1USUA 4NXNI 4DV2I 2JR1A 2Z5CA 4DR7I 4LF9E 2G7HA 2ODRD 1KIJA 2VF3A 3H09A 3LTOA 4RPFA 4JI1I 1N36I 1N32I 2CPNA 3C4TA 4TUGA 2CGEA 2UUBE 2UXDI 1OJ4A 3HULA 4DR3I 2UU9E 4GKJI 4HYMA 2H36X 5AASA 1I94I 4UT4A 5GMEA 2NUGA 4DV6I 1U2RA 2CZ9A 2HFSA 4IZJA 5FWKA 1HNWE 1H74A 4Q28A 2LBSB 4DR4E 2EFGA 2V88A 2NPFA 3AUZA 1ELOA 1S16A 4ED4A 4LF6I 2L3CA 3JAMQ 3OTOI 2MDRA 4UTGA 2NUEA 2PNMA 2DB2A 4LF7I 1GQEA 5AE2A 1T4NA 1Z0EA 4HACB 3J80Q 4FWHA 4P78A 4AQYE 4DR5E 1Y6ZA 2V2VA 2HKJA 4DR6E 4DPUA 5LMNI 3P1XA 4DUYE 2JOXA 4Z7CA 1T4LB 4IZKB 3ZZTA 1XMOE 2LMZA 4IZJB 4JI3E 2KOUA 4WFTA 1HNZE 2J7KA 1EKZA 3PRYA 2M4IA 4JI6E 1WHQA 2B7VA 2FGGA 3F0NA 4TUIA 4JI4E 4DR2E 2X36A 1H72C 5LMUI 1ZM3A 1N0VC 2VQFI 2L2NA 2UUCI 4I8OA 1Z5CA 2VQEE 1BKNA 5F3WA 4URLA 3Q6MA 1NHJA 4B3SE 1X49A 4B3ME 4FN5A 2BM0A 2L2MA 4YY3I 1Z5BA 2RS7A 3K85A 3K6QA 4BBYA 1WUUA 1J5EE 2LUQA 4F9CB 3PYDA 4JI7I 1XMQE 4DMIA 1N34I 2JY9A 3J7AG 2V8QB 2ZM6E 1FKAE 1Z59A 1IBMI 2UXCE 2MC6A 4IZJD 4WYQB 4DV3E 1X47A 4LF5E 4LF4E 1XNRI 4LFAI 2VF1A 3ADJA 1N33E 3IWBA 4DV5I 2GS8A 3DF6A 3HJCA 3Q1QA 4JV5I 4JI2E 3J80C 2ZBKB 2ZM6I 4X62I 2HHHI 2HK3A 4B3RE 2OI2A 1NHIA 2FV4B 3HPZA 4X65I 4LF8I 4R1FA 3ZOQB 2F4VI 4NXMI 4DV1I 4B3TE 4KHPI 3OMLA 4M30A 4DXLA 2AJ4A 2UXBE 1K47A 2B3TB 4MYUA 1ZM9A 4LF9I 2HKEA 4YHHE 1KVKA 1XNQI 4R03A 4X8WA 5IWAE 1HR0E 1YZ9A 2UUBI 2DSYA 3JU0A 2GQ0A 4DV7E 2XEXA 3LPSA 2LTSA 2O1TA 2UU9I 4DU7A 4Z7YA 2LTRA 1FWLA 1PIEA 4BC7A 5ADZA 2RS6A 1S4EA 4JI1E 1N32E 4PRXA 1WHNA 3J81C 1HNWI 4WPYA 4F9AB 2DEIA 3GONA 1UEKA 2B7TA 2R3VA 2Z5CB 1STUA 3H4LA 2V87A 3WU4A 3M6AA 2RTXA 4I3HA 3PYFA 4LU9A 3B78A 2LRSA 4JG4A 5BR8I 4AQYI 3OTOE 4DR5I 4DPWA 3QT8A 4DR6I 3VK6A 4DV4E 2IHR1 2L33A 4LF7E 4DUYI 1O0WA 2JVAA 2JWOA 4DKKA 1FWKA 1B63A 4WUCA 2V2ZA 3J7AM 1WXRA 4GKKE 2Z5BA 1MG7A 1ZXMA 2B9DA 4JI8E 5L3JA 4DR1E 4HXZA 4HY1A 5A2QQ 1UILA 1VISA 1T4OA 3J81Q 4DR2I 1EA6A 1D6TA 4XTJA 4K0KE 3T1YE 4BMJA 4WSPA 3WU5A 4X64E 2K4VA 2VQEI 4F54A 1Z0TA 3JTZA 1YYWA 1Z0WA 1MU5A 5LMUE 4M0VA 2E5LE 4JI0E 2UUAI 4B3MI 2Z5BB 2V85A 1IBKI 3HQ1A 4DUZE 1HNXE 2O1UA 1J5EI 1IBLE 4L5NC 2KHXA 1KKHA 4GEQB 1YYOA 1QZRA 1XMQI 4J8ZA 3FIGA 4N3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT5 A;  1Z5A A;  2UXC I;  1RQ0 A;  3VYX A;  2YT4 A;  4MYT A;  3T1H E;  5LL6 R;  3ADG A;  4DV3 I;  4DPT A;  4LF5 I;  4JI5 E;  4LF4 I;  2HFU A;  1XHK A;  1Z0G A;  1MX0 A;  2DEJ A;  3LLH A;  4DV0 E;  3B8H A;  3PYG A;  4JYA E;  4JI2 I;  1ZM2 A;  1QU6 A;  4USM A;  5GMD A;  3ZKD A;  2Q2E B;  4B3R I;  4LFC E;  1FJG E;  4FW9 A;  2LJH A;  1KTV A;  4B3T I;  2L3J A;  2NUF A;  3CWV A;  1DAR A;  2UXB I;  4OX9 E;  5CFF E;  4X66 E;  3QT6 A;  4WUD A;  4YHH I;  4X65 E;  3ADL A;  4LFB E;  5IWA I;  3ZKB A;  4NXM E;  4NXN E;  4DV2 E;  2WW4 A;  4KHP E;  4DR7 E;  5A2Q C;  4DV7 I;  1B62 A;  4P52 A;  2V34 A;  1N36 E;  2UXD E;  3LNU A;  2R42 A;  4DR3 E;  1XNQ E;  2EZ6 A;  2HK2 A;  4HAC A;  4DR4 I;  1FI4 A;  4GKJ E;  5FLX Q;  1I94 E;  4DV6 E;  4DU8 A;  2LJP A;  2N3G A;  2L2K B;  1A6F A;  4LF6 E;  1PVG A;  4EMD A;  3ZM7 A;  4DV4 I;  1RC7 A;  1XMO I;  2BM1 A;  3HTX A;  4JI3 I;  5BR8 E;  3WU6 A;  5LMN E;  1HNZ I;  4P7A A;  3PYE A;  4ZVI A;  4GKK I;  1EI1 A;  4JI6 I;  4FWD A;  1H7U A;  4JI8 I;  4DR1 I;  4JI4 I;  2V8P A;  1UHZ A;  1FNM A;  3V5R A;  5IT9 C;  2E1R A;  4K0K I;  4M1K A;  2RSM A;  3T1Y I;  4X64 I;  3VYY A;  3ZZ0 A;  1J26 A;  4B3S I;  2VQF E;  3K1J A;  1N0U A;  4WUB A;  2UUC E;  2E5L I;  4JI0 I;  3WU3 A;  4FWG A;  1Z0B A;  1X48 A;  1ZXN A;  1PKP A;  4DUZ I;  1HNX I;  1ZM4 A;  4YY3 E;  1IBL I;  1H73 A;  2UUA E;  2X7I A;  2LUP B;  1IBK E;  4JI7 E;  1N34 E;  1NZ0 A;  3T1H I;  4M2Z A;  1N33 I;  1IBM E;  5FLX C;  4USK A;  4OOG C;  4PU9 A;  4DPY A;  3ZZU A;  4JI5 I;  1RR9 A;  2A2D A;  2BV3 A;  2DIX A;  1DI2 A;  1XNR E;  5IT9 Q;  4LFA E;  4DV0 I;  1Z0V A;  3K17 A;  2V2Q A;  2NA2 A;  4JYA I;  2ZIT A;  1YYK A;  4DPX A;  4DV5 E;  2A2C A;  3JAM C;  3C4B A;  1H7S A;  3V2U C;  1ZBT A;  1NHH A;  4JV5 E;  3B82 A;  4LFC I;  1FJG I;  3ADI A;  4X62 E;  1RRE A;  2HHH E;  4PRV A;  3J7Y p;  1Z0C A;  4LF8 E;  1HR0 I;  4OX9 I;  2F4V E;  2N3H A;  4X66 I;  4DV1 E;  3D4J A;  2DMY A;  4LFB I;  3QT7 A;  4KQV A;  4NXN I;  4DV2 I;  4DR7 I;  4LF9 E;  1KIJ A;  2VF3 A;  3LTO A;  4RPF A;  4JI1 I;  1N36 I;  1N32 I;  2CPN A;  3C4T A;  2UXD I;  2UUB E;  1OJ4 A;  3HUL A;  4DR3 I;  2UU9 E;  4GKJ I;  4HYM A;  1I94 I;  4UT4 A;  5GME A;  2NUG A;  4DV6 I;  1U2R A;  2CZ9 A;  2HFS A;  1HNW E;  1H74 A;  4DR4 E;  2LBS B;  2EFG A;  2NPF A;  1ELO A;  1S16 A;  4ED4 A;  4LF6 I;  2L3C A;  3JAM Q;  3OTO I;  2MDR A;  4UTG A;  2NUE A;  2DB2 A;  4LF7 I;  1GQE A;  1T4N A;  1Z0E A;  4HAC B;  3J80 Q;  4FWH A;  4AQY E;  4DR5 E;  2V2V A;  2HKJ A;  4DR6 E;  4DPU A;  5LMN I;  3P1X A;  4DUY E;  4Z7C A;  1T4L B;  3ZZT A;  1XMO E;  4JI3 E;  4WFT A;  1HNZ E;  2J7K A;  1EKZ A;  4JI6 E;  1WHQ A;  2B7V A;  3F0N A;  4JI4 E;  4DR2 E;  2X36 A;  1H72 C;  5LMU I;  1ZM3 A;  1N0V C;  2VQF I;  2L2N A;  2UUC I;  1Z5C A;  2VQE E;  1BKN A;  4URL A;  1NHJ A;  4B3S E;  1X49 A;  4B3M E;  4FN5 A;  2BM0 A;  2L2M A;  4YY3 I;  1Z5B A;  2RS7 A;  1WUU A;  1J5E E;  2LUQ A;  3PYD A;  4JI7 I;  1XMQ E;  1N34 I;  2JY9 A;  3J7A G;  2ZM6 E;  1FKA E;  1Z59 A;  1IBM I;  2UXC E;  4WYQ B;  4DV3 E;  1X47 A;  4LF5 E;  4LF4 E;  1XNR I;  4LFA I;  3ADJ A;  1N33 E;  4DV5 I;  2GS8 A;  3Q1Q A;  4JV5 I;  4JI2 E;  3J80 C;  2ZBK B;  4X62 I;  2HHH I;  2HK3 A;  4B3R E;  2OI2 A;  1NHI A;  4X65 I;  4LF8 I;  4R1F A;  2F4V I;  4NXM I;  4DV1 I;  4B3T E;  4KHP I;  4M30 A;  4DXL A;  2AJ4 A;  2UXB E;  1K47 A;  2B3T B;  4MYU A;  1ZM9 A;  4LF9 I;  2HKE A;  4YHH E;  1KVK A;  1XNQ I;  1HR0 E;  4X8W A;  5IWA E;  1YZ9 A;  2UUB I;  2XEX A;  4DV7 E;  3LPS A;  2LTS A;  2UU9 I;  4DU7 A;  4Z7Y A;  2LTR A;  1FWL A;  1PIE A;  2RS6 A;  1S4E A;  4JI1 E;  1N32 E;  4PRX A;  1WHN A;  3J81 C;  1HNW I;  2DEI A;  3GON A;  1UEK A;  2B7T A;  2R3V A;  1STU A;  3H4L A;  3WU4 A;  3M6A A;  2RTX A;  4I3H A;  3PYF A;  3B78 A;  2LRS A;  4JG4 A;  5BR8 I;  4AQY I;  3OTO E;  4DR5 I;  4DPW A;  3QT8 A;  4DR6 I;  4DV4 E;  2IHR 1;  2L33 A;  4LF7 E;  4DUY I;  1O0W A;  2JVA A;  4DKK A;  1FWK A;  1B63 A;  4WUC A;  2V2Z A;  3J7A M;  4GKK E;  1MG7 A;  1ZXM A;  4JI8 E;  5L3J A;  4DR1 E;  4HXZ A;  4HY1 A;  5A2Q Q;  1UIL A;  1VIS A;  1T4O A;  3J81 Q;  4DR2 I;  1EA6 A;  1D6T A;  4XTJ A;  4K0K E;  3T1Y E;  3WU5 A;  4X64 E;  2VQE I;  1Z0T A;  1YYW A;  1Z0W A;  1MU5 A;  5LMU E;  2E5L E;  4JI0 E;  2UUA I;  4B3M I;  1IBK I;  4DUZ E;  1HNX E;  1J5E I;  1IBL E;  2KHX A;  1KKH A;  1XMQ I;  1YYO A;  1QZR A;  2ZM6 I; 
#chains in the Genus database with same CATH topology
 1B69 A;  4MU0 A;  3QT5 A;  4IS1 C;  4NBQ A;  1Z5A A;  2UXC I;  2PO2 B;  1RQ0 A;  3BID A;  1KYQ A;  3VYX A;  1WRJ A;  4F9B B;  1Y4S A;  2EOS A;  3L7Z B;  2YT4 A;  4MYT A;  3T1H E;  4QNJ A;  5LL6 R;  5A6K A;  2EQ0 A;  3P3C A;  3ADG A;  5K36 C;  2EPU A;  4DV3 I;  2JPA A;  4DPT A;  4JI5 E;  3M85 G;  2EMG A;  3IWD A;  4LF4 I;  4LF5 I;  2HFU A;  1XHK A;  4F2J C;  3M7N D;  5T6J A;  2YRM A;  1Z0G A;  1MX0 A;  4WSG A;  2D9H A;  3H1C A;  2DEJ A;  3LML A;  3LLH A;  2YTP A;  2IOP A;  4DV0 E;  3B8H A;  2GO3 A;  1F2I G;  1G2F C;  2V86 A;  1KJK A;  3PYG A;  4JYA E;  1YUJ A;  4JI2 I;  2M7Q A;  1ZM2 A;  1HK7 A;  2ENC A;  1ZBQ A;  2JYA A;  1SFE A;  1QU6 A;  5JEA D;  4USM A;  5GMD A;  3ZKD A;  2Q2E B;  4B3R I;  1GZ6 A;  2GPI A;  2R76 A;  4BA2 B;  4LFC E;  1FJG E;  3MSW A;  3P06 A;  4FW9 A;  2EN8 A;  2LJH A;  2WP8 A;  1KTV A;  5EKW A;  4B3T I;  4BC9 A;  1RHY A;  5C0X F;  2L3J A;  2NUF A;  3CWV A;  1SR9 A;  1DAR A;  2UXB I;  2YTG A;  4OX9 E;  5CFF E;  4X66 E;  3QT6 A;  2JOB A;  4WUD A;  2BA0 G;  4YHH I;  4X65 E;  3ADL A;  4LFB E;  4BS9 A;  5IWA I;  3M85 D;  3ZKB A;  5K36 A;  1E3H A;  4NXM E;  2ELY A;  4NXN E;  4DV2 E;  3MHS C;  1UDS A;  4KHP E;  2WW4 A;  3C6M A;  5A2Q C;  5A69 A;  4DR7 E;  4QNK A;  4DV7 I;  2YU8 A;  2CG9 A;  1ZU1 A;  1B62 A;  4P52 A;  2V34 A;  1N36 E;  5DRQ A;  2UXD E;  3LNU A;  2YTF A;  4RHB B;  5A6A A;  2R42 A;  2J7J A;  3BGH A;  4DR3 E;  1XNQ E;  2EZ6 A;  2HK2 A;  3HKM A;  4HAC A;  3TQM A;  4DR4 I;  5K36 E;  2M9A A;  4X9J A;  2MDG A;  1FI4 A;  4GKJ E;  4FW5 A;  1X6E A;  1XXE A;  2C38 A;  1I94 E;  5FLX Q;  2E72 A;  4DV6 E;  4R2E A;  4DU8 A;  1MEY C;  4OO1 C;  3B4T A;  4MU3 A;  1X6F A;  4RH8 A;  2LJP A;  3IWC A;  2E1M A;  2EM7 A;  2N3G A;  2ODR C;  2EOF A;  4ZYE A;  2L2K B;  4IZK A;  4AID A;  2YTO A;  2KON A;  1A6F A;  4ZYH A;  4L8N A;  2M1S A;  4O43 A;  4LF6 E;  5A6B D;  5IXM B;  1PVG A;  3Q6N A;  4EMD A;  1DQ3 A;  1R6L A;  1LLM C;  4IFD E;  4MLV A;  2C39 A;  2CVE A;  3ZM7 A;  5EL9 A;  3C6K A;  2HGH A;  4DV4 I;  1RC7 A;  2ADR A;  2EN3 A;  3MHH C;  3THO B;  2JP9 A;  1XMO I;  2BM1 A;  1R6M A;  1UBD C;  2YTN A;  1USV A;  3HTX A;  4F6N A;  1E3P A;  5BR8 E;  2L8T A;  3KWR A;  3WU6 A;  4JI3 I;  5LMN E;  1HNZ I;  4P7A A;  3PYE A;  4ZVI A;  4GKK I;  1EI1 A;  2EN4 A;  2WZO A;  4JI6 I;  2PO0 A;  4R2A A;  4FWD A;  4BHB A;  1PDA A;  2L92 A;  4BCA A;  4WXD A;  1H7U A;  2EM3 A;  2O1W A;  4OZE A;  3QG5 C;  4JI8 I;  2EM0 A;  2J65 A;  4DR1 I;  4JI4 I;  4OO1 A;  1A1J A;  2V8P A;  1UHZ A;  5JEA F;  1FNM A;  3V5R A;  2WBU A;  5IT9 C;  3HXL A;  2E1R A;  4M1K A;  4MQY A;  4K0K I;  2RSM A;  3T1Y I;  4R2Q A;  2EPZ A;  4R2R A;  2EPA A;  2O1V A;  2EM6 A;  4X64 I;  5DNY A;  3VYY A;  4M9V C;  5TSE A;  4BA1 A;  3ZZ0 A;  5KL4 A;  3AV0 A;  1J26 A;  2WNR A;  4AIM A;  2EM5 A;  4B3S I;  2VQF E;  3K1J A;  1N0U A;  4WUB A;  2LJU A;  2UUC E;  3UHM A;  2E5L I;  2RPC A;  2BR2 A;  4JI0 I;  3WU3 A;  3P3G A;  3VHT B;  3EQ1 A;  4FWG A;  2EOR A;  1X48 A;  2YWQ A;  1Z0B A;  4OKG A;  1PJT A;  5C0X C;  1ZXN A;  2PNL A;  1PKP A;  2EM9 A;  2EM8 A;  4DUZ I;  1HNX I;  2FTX B;  1ZM4 A;  4OO1 B;  2YZT A;  4YY3 E;  1IBL I;  1H73 A;  2UUA E;  2X7I A;  2LE2 A;  2VE7 C;  4R8O A;  1OYP A;  4LCG A;  5AE3 A;  2LUP B;  1IBK E;  2DLK A;  3F6H A;  4JI7 E;  4ZYD A;  1N34 E;  2JEA A;  2L6M A;  2I9I A;  1NZ0 A;  3T1H I;  2MC5 A;  5KL7 A;  4FK5 C;  4M2Z A;  2V89 A;  1N33 I;  4LTY A;  1IBM E;  5FLX C;  2Z5E A;  4USK A;  2V83 A;  4OOG C;  4ZYG A;  1A1H A;  4PU9 A;  1PJS A;  3ZZU A;  4DPY A;  4JI5 I;  2LT7 A;  2HJJ A;  4MU1 A;  4U3D A;  1EH8 A;  2NN6 C;  1RR9 A;  2A2D A;  2BV3 A;  3GCM A;  2DIX A;  2GO4 A;  1Y4U A;  2RQL A;  1DI2 A;  2BR2 B;  2EJ4 A;  2EPK X;  1XNR E;  5IT9 Q;  4LFA E;  1A1I A;  2JEB B;  4DV0 I;  4O24 A;  3RMP A;  1Z0V A;  1YFH A;  1UN6 B;  3K17 A;  3DJW A;  4IFD C;  5DNL A;  2V2Q A;  2NA2 A;  4JYA I;  2ZIT A;  1YYK A;  2A25 A;  2EL4 A;  5C0X A;  2WBT A;  5DRR A;  2F8B A;  2R1F A;  3JAM C;  3C4B A;  4DV5 E;  3F6G A;  1H7S A;  2A2C A;  1JK2 A;  3NZK A;  3V2U C;  1ZBT A;  1Y5Y A;  1NHH A;  1VI7 A;  4JV5 E;  3B82 A;  4KZS A;  2YTE A;  4LFC I;  1FJG I;  2IOQ A;  2YTD A;  3HPS A;  2BA1 G;  4R2C A;  3ADI A;  4X62 E;  2EWL A;  4P7D A;  1RRE A;  2HHH E;  5AE1 A;  3PS2 A;  4PRV A;  2K7I A;  3J7Y p;  2EOE A;  5C0X E;  4DPX A;  3EPK A;  2EMY A;  4LF8 E;  1Z0C A;  4NHR A;  1HR0 I;  4HTG A;  4OX9 I;  2F4V E;  2N3H A;  4R2P A;  2EMX A;  4DV1 E;  4X66 I;  2ENH A;  2EP3 A;  5KL5 A;  3D4J A;  2DMY A;  4LFB I;  3QT7 A;  4KQV A;  4OO1 D;  3BF2 A;  1USU A;  4NXN I;  4DV2 I;  2JR1 A;  2Z5C A;  2NN6 A;  4LF9 E;  2PO1 A;  2VRD A;  2EPM X;  2G7H A;  2ODR D;  1KIJ A;  4DR7 I;  2EN6 A;  2PRT A;  2VF3 A;  3H09 A;  3LTO A;  4RPF A;  4JI1 I;  1N36 I;  1N32 I;  2CPN A;  3C4T A;  2EPP A;  4TUG A;  2UUB E;  2CGE A;  2UXD I;  1OJ4 A;  4NZV A;  3HUL A;  1BBG A;  4ISA A;  4DR3 I;  2C37 A;  2UU9 E;  4GKJ I;  2NN6 E;  2H36 X;  5AAS A;  4HYM A;  1I94 I;  4UT4 A;  4IFD A;  2WP8 B;  5GME A;  2NUG A;  4DV6 I;  2WBS A;  2WCC 3;  4MLQ A;  1U2R A;  2CZ9 A;  1X6H A;  1WJP A;  2DLQ A;  2EL6 A;  2HFS A;  4IZJ A;  5LLQ A;  2JT2 A;  5FWK A;  1HNW E;  1H74 A;  1UDN A;  4LCF A;  5K36 F;  4Q28 A;  2LBS B;  4DR4 E;  2MKD A;  2BA1 D;  2EFG A;  2V88 A;  1TN9 A;  2NPF A;  3AUZ A;  1ELO A;  1GTK A;  1S16 A;  2LCE A;  2L3C A;  4MDT A;  4ED4 A;  3JAM Q;  3OTO I;  2MDR A;  4LF6 I;  4IFD B;  4FW4 A;  5K36 B;  2BA0 D;  4UTG A;  1N3G A;  2NUE A;  1YHC A;  5IV8 B;  2PNM A;  2DB2 A;  4LF7 I;  1GQE A;  5AE2 A;  2PO1 B;  1A1G A;  1T4N A;  4GZN C;  1Z0E A;  4HAC B;  3J80 Q;  4FWH A;  2YRK A;  4P78 A;  2YTI A;  4AQY E;  4DR5 E;  3KZZ A;  1Y6Z A;  2C38 B;  2VES A;  2V2V A;  2EOX A;  2HKJ A;  4DR6 E;  4DPU A;  2IES A;  2F1D A;  5LMN I;  3P1X A;  4DUY E;  2JOX A;  1DGC A;  3CDJ A;  3PS3 A;  2LVH A;  4Z7C A;  2EM2 A;  1T4L B;  4IZK B;  3ZZT A;  1XMO E;  4BHC A;  4MU4 A;  2LMZ A;  3U1K A;  4IZJ B;  1ZAA C;  4JI3 E;  2KOU A;  4WFT A;  1HNZ E;  3GLL A;  1X3C A;  2J7K A;  2EMZ A;  1EKZ A;  3PRY A;  2M4I A;  4JI6 E;  1IQO A;  2C39 B;  1WHQ A;  1IQS A;  2B7V A;  3GME A;  2EOJ A;  2EL5 A;  2EMA A;  2FGG A;  2NAB A;  3UK3 C;  4TUI A;  4JI4 E;  1Y60 A;  3F0N A;  4DR2 E;  2EMH A;  2X36 A;  1H72 C;  5LMU I;  1ZM3 A;  1A1L A;  2LO3 A;  1N0V C;  2VQF I;  2L2N A;  2PO0 B;  2CSH A;  3P3E A;  4I8O A;  2UUC I;  1Z5C A;  4OO1 F;  3L7Z A;  2YRH A;  4N4R B;  2VQE E;  1BKN A;  5F3W A;  5K36 D;  2PNZ A;  1QNT A;  2EMF A;  4URL A;  2JE6 A;  3Q6M A;  3PS1 A;  5ELW A;  2EOY A;  1NHJ A;  2EQ3 A;  3THN A;  4B3S E;  1X49 A;  4B3M E;  4FN5 A;  2BM0 A;  2O3Z A;  2L2M A;  5DRO A;  2EMW A;  2CTD A;  1Z5B A;  2RS7 A;  3K85 A;  4YY3 I;  2NN6 D;  3K6Q A;  4BBY A;  5AC4 A;  1WUU A;  2EN1 A;  2LUQ A;  4F9C B;  5A6B A;  1J5E E;  1JK1 A;  3PYD A;  4JI7 I;  1XMQ E;  4DMI A;  1N34 I;  2JY9 A;  3J7A G;  5A6J A;  4O5G A;  3EPL A;  2V8Q B;  1OYS A;  2ZM6 E;  1FKA E;  4BA1 B;  4F6M A;  1L4S A;  2WNR B;  4IFD D;  2I13 A;  1Z59 A;  4U3B A;  1IBM I;  2UXC E;  1A1F A;  1AH5 A;  4HEI A;  2ELZ A;  4BA2 A;  2MC6 A;  4IZJ D;  4WYQ B;  2RSI A;  2JXP A;  2N8X A;  4IJD A;  4DV3 E;  1X47 A;  4LF5 E;  4LF4 E;  1XNR I;  3U1Y A;  5DNX A;  2EMK A;  2VF1 A;  2EPN A;  3ADJ A;  4LFA I;  1G2D C;  1N33 E;  2EML A;  2PNZ B;  2JE6 B;  1AAY A;  3P76 A;  2CT1 A;  2YSO A;  2EN7 A;  1BBO A;  1TF6 A;  5DRP A;  2BBG A;  3KRN A;  1P42 A;  3IWB A;  4DV5 I;  2JEA B;  1PJQ A;  2GS8 A;  3DF6 A;  3HJC A;  3Q1Q A;  4JV5 I;  4JI2 E;  3J80 C;  2ZBK B;  2EOM A;  2ZM6 I;  4X62 I;  4LPF A;  2HK3 A;  1IMU A;  2HHH I;  5AC5 A;  4WX9 A;  4B3R E;  1UDO A;  2OI2 A;  1NHI A;  2FV4 B;  3HPZ A;  4X65 I;  4LF8 I;  4R1F A;  3ZOQ B;  2F4V I;  4NXM I;  4DV1 I;  2AE8 A;  4B3T E;  2YTJ A;  3OML A;  2EOZ A;  4M30 A;  4DXL A;  4KHP I;  2AJ4 A;  3EPH A;  2EPL X;  2UXB E;  1K47 A;  1T38 A;  2B3T B;  4MYU A;  1ZM9 A;  4LF9 I;  2HKE A;  2EQ1 A;  4YHH E;  2LV2 A;  1KVK A;  1XNQ I;  4Q35 B;  4R03 A;  4X8W A;  5IWA E;  1HR0 E;  1YZ9 A;  5JEA C;  3M99 B;  5C0X B;  2UUB I;  2DSY A;  3JU0 A;  4R2D A;  4DV7 E;  2GQ0 A;  2XEX A;  3LPS A;  2LTS A;  2O1T A;  5KL2 A;  2UU9 I;  4IS9 A;  4DU7 A;  4Z7Y A;  2LTR A;  1FWL A;  1PIE A;  4BC7 A;  5ADZ A;  2RS6 A;  1S4E A;  4JI1 E;  1N32 E;  2EOI A;  4PRX A;  1WHN A;  2EPC A;  3J81 C;  1HNW I;  4WPY A;  4F9A B;  2DEI A;  3GON A;  2EE8 A;  2YPN A;  1UEK A;  4LOM A;  2YTQ A;  1BB8 A;  2NN6 F;  2B7T A;  2EPR A;  2R3V A;  3DD6 A;  2YSP A;  2Z5C B;  2GHF A;  1STU A;  2NN6 B;  3H4L A;  2V87 A;  1NCS A;  2EPX A;  3M6A A;  3WU4 A;  2RTX A;  2ENA A;  4FW3 A;  4I3H A;  3PYF A;  4LU9 A;  4IFD F;  3B78 A;  2LRS A;  4JG4 A;  5BR8 I;  2GLI A;  2C37 B;  4AQY I;  3OTO E;  4DR5 I;  4DPW A;  3QT8 A;  4DR6 I;  3VK6 A;  4DV4 E;  2IHR 1;  1NEI A;  5JEA A;  4O4K A;  2L33 A;  4LCH A;  4LF7 E;  4DUY I;  1O0W A;  1YUI A;  2JVA A;  2JWO A;  4DKK A;  4R2S A;  1Z1B A;  1UDQ A;  1FWK A;  1EH7 A;  2EMC A;  3EPJ A;  2EM4 A;  1B63 A;  4WUC A;  4AM3 A;  1X5W A;  4WXC A;  2V2Z A;  1WXR A;  4GKK E;  3J7A M;  2EMB A;  2Z5B A;  5JEA E;  2YU5 A;  1MG7 A;  1YSA C;  4KWY A;  1ZXM A;  2EOQ A;  2B9D A;  4JI8 E;  5L3J A;  4DR1 E;  4HXZ A;  2DMI A;  4HY1 A;  5A2Q Q;  5C0X D;  1YH8 A;  1ZR9 A;  1UIL A;  1VIS A;  1T4O A;  2EPO A;  2EOH A;  2Q8U A;  3J81 Q;  4DR2 I;  1EA6 A;  1D6T A;  4XTJ A;  1OYR A;  2PO2 A;  4K0K E;  5KL6 A;  4GQU A;  3T1Y E;  2BB8 A;  3ECR A;  4BMJ A;  4WSP A;  3WU5 A;  4X64 E;  5JEA B;  4OO1 E;  2K4V A;  2DGC A;  1T39 A;  4FW7 A;  2EMI A;  3M7N G;  3BBG A;  2VQE I;  4F54 A;  1Z0T A;  3JTZ A;  1YYW A;  1Z0W A;  1MU5 A;  5LMU E;  2IER A;  2MKN A;  4M0V A;  2E5L E;  4JI0 E;  2UUA I;  5KL3 A;  1TF3 A;  4B3M I;  2Z5B B;  1P47 A;  3CDI A;  3KZY A;  4J3D A;  2V85 A;  1IBK I;  1RMD A;  3HQ1 A;  2JEB A;  4DUZ E;  2EN2 A;  3L00 A;  1HNX E;  2HC5 A;  2O1U A;  1J5E I;  1MGT A;  1A1K A;  1EH6 A;  4FW6 A;  1IBL E;  2DRP A;  2EOO A;  4L5N C;  2KHX A;  1KKH A;  4GEQ B;  1YYO A;  1YPN A;  1QZR A;  4J8Z A;  1XMQ I;  3FIG A;  4N3O A; 
#chains in the Genus database with same CATH homology
 3QT5 A;  1Z5A A;  2UXC I;  1RQ0 A;  3VYX A;  4F9B B;  1Y4S A;  2YT4 A;  4MYT A;  3T1H E;  5LL6 R;  3ADG A;  4DV3 I;  4DPT A;  4LF5 I;  4JI5 E;  4LF4 I;  3IWD A;  2HFU A;  1XHK A;  5T6J A;  1Z0G A;  1MX0 A;  2DEJ A;  3LML A;  3LLH A;  2IOP A;  4DV0 E;  3B8H A;  2V86 A;  3PYG A;  4JYA E;  4JI2 I;  2M7Q A;  1ZM2 A;  1HK7 A;  1ZBQ A;  1QU6 A;  4USM A;  5GMD A;  3ZKD A;  2Q2E B;  4B3R I;  1GZ6 A;  4LFC E;  1FJG E;  3MSW A;  3P06 A;  4FW9 A;  2LJH A;  1KTV A;  4B3T I;  4BC9 A;  2L3J A;  2NUF A;  3CWV A;  1SR9 A;  1DAR A;  2UXB I;  4OX9 E;  5CFF E;  4X66 E;  3QT6 A;  2JOB A;  4WUD A;  4YHH I;  4X65 E;  3ADL A;  4LFB E;  4BS9 A;  5IWA I;  3ZKB A;  4NXM E;  4NXN E;  4DV2 E;  2WW4 A;  4KHP E;  4DR7 E;  5A2Q C;  4DV7 I;  2CG9 A;  1B62 A;  4P52 A;  2V34 A;  1N36 E;  2UXD E;  3LNU A;  2R42 A;  4DR3 E;  1XNQ E;  2EZ6 A;  2HK2 A;  4HAC A;  4DR4 I;  1FI4 A;  4GKJ E;  5FLX Q;  1I94 E;  4DV6 E;  4DU8 A;  2LJP A;  3IWC A;  2E1M A;  2N3G A;  2ODR C;  2L2K B;  4IZK A;  2KON A;  1A6F A;  4L8N A;  2M1S A;  4LF6 E;  1PVG A;  4EMD A;  3Q6N A;  1DQ3 A;  3ZM7 A;  4DV4 I;  1RC7 A;  1XMO I;  2BM1 A;  1USV A;  3HTX A;  4JI3 I;  5BR8 E;  2L8T A;  3KWR A;  3WU6 A;  5LMN E;  1HNZ I;  4P7A A;  3PYE A;  4ZVI A;  4GKK I;  1EI1 A;  2WZO A;  4JI6 I;  4FWD A;  2O1W A;  2L92 A;  4BCA A;  1H7U A;  4JI8 I;  4DR1 I;  4JI4 I;  2V8P A;  1UHZ A;  1FNM A;  3V5R A;  5IT9 C;  3HXL A;  2E1R A;  4M1K A;  4K0K I;  2RSM A;  3T1Y I;  2O1V A;  4X64 I;  5DNY A;  3VYY A;  3ZZ0 A;  1J26 A;  3AV0 A;  4B3S I;  2VQF E;  3K1J A;  1N0U A;  4WUB A;  2UUC E;  2E5L I;  4JI0 I;  3WU3 A;  4FWG A;  1Z0B A;  1X48 A;  1ZXN A;  2PNL A;  1PKP A;  4DUZ I;  1HNX I;  2FTX B;  1ZM4 A;  2YZT A;  4YY3 E;  1IBL I;  1H73 A;  2UUA E;  2X7I A;  2LE2 A;  2VE7 C;  4R8O A;  5AE3 A;  2LUP B;  1IBK E;  4JI7 E;  3F6H A;  1N34 E;  2L6M A;  1NZ0 A;  3T1H I;  2MC5 A;  4M2Z A;  2V89 A;  1N33 I;  4LTY A;  1IBM E;  5FLX C;  2Z5E A;  4USK A;  2V83 A;  4OOG C;  4PU9 A;  3ZZU A;  4DPY A;  4JI5 I;  1RR9 A;  2A2D A;  2BV3 A;  2DIX A;  1Y4U A;  1DI2 A;  1XNR E;  5IT9 Q;  4LFA E;  4DV0 I;  3RMP A;  1Z0V A;  3K17 A;  3DJW A;  2V2Q A;  2NA2 A;  4JYA I;  2ZIT A;  1YYK A;  4DPX A;  2F8B A;  3JAM C;  4DV5 E;  3C4B A;  2A2C A;  3F6G A;  1H7S A;  3V2U C;  1ZBT A;  1NHH A;  4JV5 E;  3B82 A;  4KZS A;  4LFC I;  1FJG I;  2IOQ A;  3HPS A;  3ADI A;  4X62 E;  2EWL A;  4P7D A;  1RRE A;  2HHH E;  5AE1 A;  4PRV A;  3J7Y p;  1Z0C A;  4LF8 E;  1HR0 I;  4OX9 I;  2F4V E;  2N3H A;  4X66 I;  4DV1 E;  3D4J A;  2DMY A;  4LFB I;  3QT7 A;  4KQV A;  1USU A;  4NXN I;  4DV2 I;  2JR1 A;  2Z5C A;  4DR7 I;  4LF9 E;  2G7H A;  2ODR D;  1KIJ A;  2VF3 A;  3H09 A;  3LTO A;  4RPF A;  4JI1 I;  1N36 I;  1N32 I;  2CPN A;  3C4T A;  4TUG A;  2CGE A;  2UUB E;  2UXD I;  1OJ4 A;  3HUL A;  4DR3 I;  2UU9 E;  4GKJ I;  4HYM A;  2H36 X;  5AAS A;  1I94 I;  4UT4 A;  5GME A;  2NUG A;  4DV6 I;  1U2R A;  2CZ9 A;  2HFS A;  4IZJ A;  5FWK A;  1HNW E;  1H74 A;  4Q28 A;  2LBS B;  4DR4 E;  2EFG A;  2V88 A;  2NPF A;  3AUZ A;  1ELO A;  1S16 A;  4ED4 A;  4LF6 I;  2L3C A;  3JAM Q;  3OTO I;  2MDR A;  4UTG A;  2NUE A;  2PNM A;  2DB2 A;  4LF7 I;  1GQE A;  5AE2 A;  1T4N A;  1Z0E A;  4HAC B;  3J80 Q;  4FWH A;  4P78 A;  4AQY E;  4DR5 E;  1Y6Z A;  2V2V A;  2HKJ A;  4DR6 E;  4DPU A;  5LMN I;  3P1X A;  4DUY E;  2JOX A;  4Z7C A;  1T4L B;  4IZK B;  3ZZT A;  1XMO E;  2LMZ A;  4IZJ B;  4JI3 E;  2KOU A;  4WFT A;  1HNZ E;  2J7K A;  1EKZ A;  3PRY A;  2M4I A;  4JI6 E;  1WHQ A;  2B7V A;  2FGG A;  3F0N A;  4TUI A;  4JI4 E;  4DR2 E;  2X36 A;  1H72 C;  5LMU I;  1ZM3 A;  1N0V C;  2VQF I;  2L2N A;  2UUC I;  4I8O A;  1Z5C A;  2VQE E;  1BKN A;  5F3W A;  4URL A;  3Q6M A;  1NHJ A;  4B3S E;  1X49 A;  4B3M E;  4FN5 A;  2BM0 A;  2L2M A;  4YY3 I;  1Z5B A;  2RS7 A;  3K85 A;  3K6Q A;  4BBY A;  1WUU A;  1J5E E;  2LUQ A;  4F9C B;  3PYD A;  4JI7 I;  1XMQ E;  4DMI A;  1N34 I;  2JY9 A;  3J7A G;  2V8Q B;  2ZM6 E;  1FKA E;  1Z59 A;  1IBM I;  2UXC E;  2MC6 A;  4IZJ D;  4WYQ B;  4DV3 E;  1X47 A;  4LF5 E;  4LF4 E;  1XNR I;  4LFA I;  2VF1 A;  3ADJ A;  1N33 E;  3IWB A;  4DV5 I;  2GS8 A;  3DF6 A;  3HJC A;  3Q1Q A;  4JV5 I;  4JI2 E;  3J80 C;  2ZBK B;  2ZM6 I;  4X62 I;  2HHH I;  2HK3 A;  4B3R E;  2OI2 A;  1NHI A;  2FV4 B;  3HPZ A;  4X65 I;  4LF8 I;  4R1F A;  3ZOQ B;  2F4V I;  4NXM I;  4DV1 I;  4B3T E;  4KHP I;  3OML A;  4M30 A;  4DXL A;  2AJ4 A;  2UXB E;  1K47 A;  2B3T B;  4MYU A;  1ZM9 A;  4LF9 I;  2HKE A;  4YHH E;  1KVK A;  1XNQ I;  4R03 A;  4X8W A;  5IWA E;  1HR0 E;  1YZ9 A;  2UUB I;  2DSY A;  3JU0 A;  2GQ0 A;  4DV7 E;  2XEX A;  3LPS A;  2LTS A;  2O1T A;  2UU9 I;  4DU7 A;  4Z7Y A;  2LTR A;  1FWL A;  1PIE A;  4BC7 A;  5ADZ A;  2RS6 A;  1S4E A;  4JI1 E;  1N32 E;  4PRX A;  1WHN A;  3J81 C;  1HNW I;  4WPY A;  4F9A B;  2DEI A;  3GON A;  1UEK A;  2B7T A;  2R3V A;  2Z5C B;  1STU A;  3H4L A;  2V87 A;  3WU4 A;  3M6A A;  2RTX A;  4I3H A;  3PYF A;  4LU9 A;  3B78 A;  2LRS A;  4JG4 A;  5BR8 I;  4AQY I;  3OTO E;  4DR5 I;  4DPW A;  3QT8 A;  4DR6 I;  3VK6 A;  4DV4 E;  2IHR 1;  2L33 A;  4LF7 E;  4DUY I;  1O0W A;  2JVA A;  2JWO A;  4DKK A;  1FWK A;  1B63 A;  4WUC A;  2V2Z A;  3J7A M;  1WXR A;  4GKK E;  2Z5B A;  1MG7 A;  1ZXM A;  2B9D A;  4JI8 E;  5L3J A;  4DR1 E;  4HXZ A;  4HY1 A;  5A2Q Q;  1UIL A;  1VIS A;  1T4O A;  3J81 Q;  4DR2 I;  1EA6 A;  1D6T A;  4XTJ A;  4K0K E;  3T1Y E;  4BMJ A;  4WSP A;  3WU5 A;  4X64 E;  2K4V A;  2VQE I;  4F54 A;  1Z0T A;  3JTZ A;  1YYW A;  1Z0W A;  1MU5 A;  5LMU E;  4M0V A;  2E5L E;  4JI0 E;  2UUA I;  4B3M I;  2Z5B B;  2V85 A;  1IBK I;  3HQ1 A;  4DUZ E;  1HNX E;  2O1U A;  1J5E I;  1IBL E;  4L5N C;  2KHX A;  1KKH A;  4GEQ B;  1YYO A;  1QZR A;  1XMQ I;  4J8Z A;  3FIG A;  4N3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...