4JI4I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji4I00
2GS8A 1HNWI 4GKKE 2UXCE 3PYEA 1N33E 2UUCI 4JI1E 5BR8E 1PIEA 1OJ4A 3PYDA 1IBKI 1N34I 4PU9A 4HACB 2HHHE 3PYFA 1IBME 4DV7E 1Z5CA 1H7SA 4DPTA 3J7AG 2F4VE 3WU4A 1N36I 1I94E 2UUAE 1XNQE 3J81Q 4JI6I 4LF9I 2V2QA 3GONA 4LFAI 2HK2A 3ZZTA 4B3RI 1N32I 2CZ9A 5LMNE 1H7UA 4KQVA 4DR3I 4DV5I 2V2ZA 4JV5E 1KKHA 1D6TA 4UTGA 4X62E 4X66I 4X64E 3WU5A 4AQYE 4B3TI 4P52A 3WU3A 4LF8E 4DR1I 5A2QC 1ZXMA 4MYUA 4FWGA 2V34A 4USKA 4UT4A 4DV2E 4GKJE 2HK3A 4OX9I 4DV1E 4DPXA 1UEKA 4DR4E 4HYMA 1ZM3A 1XMOE 4LFCI 4DR6E 1PKPA 4LF5E 1H74A 4GKKI 4JYAE 2UXCI 1N33I 2ZM6E 4JI2E 4JI1I 2HKEA 4DV4E 1KTVA 1Z0EA 5BR8I 4X65I 2HHHI 1IBMI 4DV7I 1H72C 4DPUA 3B82A 1FWLA 2UUBE 2F4VI 2V2VA 5FLXQ 2XEXA 4LFBE 4DV3E 4JI5E 1I94I 3V2UC 3F0NA 1XNQI 2AJ4A 1WUUA 4YY3E 1FJGE 3LTOA 1FWKA 3QT8A 5A2QQ 1N0UA 4ED4A 1S4EA 1HNXE 5LMNI 2E5LE 4LF6E 1DARA 4JI3E 4K0KE 4P7AA 4DXLA 2BM0A 3OTOE 1FKAE 2J7KA 4X62I 2UU9E 4X64I 4AQYI 4I3HA 4DR7E 4YHHE 4LF8I 2ZBKB 1Z0BA 4JI0E 1ZXNA 4WUBA 4DR2E 3B78A 4DUZE 4DV2I 4GKJI 4DV1I 4USMA 4FN5A 4DR4I 4ZVIA 4DV6E 3B8HA 1HR0E 1EI1A 1XMOI 1RR9A 4DR6I 2A2CA 4LF5I 2ZITA 1Z5BA 4JYAI 5FLXC 1A6FA 4JI2I 3PYGA 4DV4I 1VISA 2UXBE 4HXZA 1HNZE 2VQEE 4Z7CA 4DR5E 4NXNI 4FW9A 4URLA 2UUBI 1ZM9A 4M1KA 4LF4E 4LFBI 4DV3I 4JI5I 4DU8A 4JI7E 5LMUE 2VQFI 2A2DA 4HACA 4XTJA 2R3VA 4DU7A 4YY3I 1FJGI 3JAMQ 4B3ME 3HULA 3T1HE 3K1JA 4B3SE 4WUDA 1HNXI 2E5LI 4LF6I 1XHKA 3LNUA 3ZKDA 4K0KI 5L3JA 3T1YE 3M6AA 3OTOI 5LL6R 2BM1A 3V5RA 2EFGA 2UU9I 4PRXA 1J5EE 4PRVA 1MU5A 4DR7I 1KVKA 4YHHI 4JI0I 2UUAI 1IBLE 1XMQE 4DR2I 5IT9Q 1N0VC 1Z0TA 1Z0CA 4DUZI 3ZZ0A 1XNRE 1B63A 1FNMA 1Z5AA 5IWAE 2HFUA 4R1FA 4DPWA 4JI8E 3WU6A 2V8PA 4DV6I 1RREA 1HR0I 4HY1A 1ZM2A 4OX9E 3J80C 4JV5I 2LJPA 1PVGA 4DUYE 1Z0VA 2HFSA 1FI4A 4DV0E 2UXBI 3JAMC 1HNZI 2VQEI 4DR5I 3J7AM 3Q1QA 1NHIA 4X65E 3ZZUA 1B62A 4LF4I 4KHPE 4LF7E 1MX0A 3QT6A 1KIJA 2DEIA 4JI7I 5LMUI 4JG4A 4FWHA 2UXDE 2Q2EB 4NXME 2OI2A 1EA6A 2NPFA 4B3MI 4Z7YA 3T1HI 4JI4E 4B3SI 1Z0WA 2ZM6I 2DEJA 1H73A 4EMDA 5IT9C 3T1YI 1QZRA 1HNWE 3CWVA 2UUCE 3QT5A 2WW4A 4WUCA 4DPYA 1BKNA 1IBKE 1J5EI 3J80Q 1N34E 3D4JA 1Z59A 1NZ0A 5GMEA 2VF3A 1IBLI 1XMQI 2HKJA 1N36E 1XNRI 5IWAI 3ZKBA 3LPSA 1K47A 4JI8I 4JI6E 4LF9E 1S16A 3H4LA 4JI3I 4LFAE 4B3RE 1N32E 4DUYI 4DR3E 3QT7A 4DV5E 1U2RA 4MYTA 1NHJA 4DV0I 4RPFA 2E1RA 1ZM4A 4X66E 1ELOA 3J81C 2R42A 4KHPI 4B3TE 4FWDA 4DR1E 4LF7I 3K17A 2X36A 4NXNE 3ZM7A 2X7IA 2UXDI 4NXMI 1Z0GA 5GMDA 2BV3A 1NHHA 4JI4I 2VQFE 1MG7A 4LFCE
chains in the Genus database with same CATH superfamily
2C39A 2GS8A 1HNWI 4GKKE 3K85A 4MQYA 2UXCE 3PYEA 1N33E 2UUCI 2IESA 4JI1E 5BR8E 1PIEA 1OJ4A 3PYDA 1IBKI 1N34I 4PU9A 2JE6B 4HACB 2HHHE 3PYFA 2Z5EA 1IBME 4DV7E 3NZKA 1Z5CA 4GQUA 1H7SA 4DPTA 5EL9A 3J7AG 2F4VE 3HKMA 3WU4A 1N36I 4IZJD 1I94E 2UUAE 1XNQE 3UHMA 3J81Q 4JI6I 4LF9I 2V2QA 3GONA 4LFAI 2HK2A 3ZZTA 4B3RI 5JEAB 1N32I 2CZ9A 5LMNE 5DRQA 4MU0A 4N3OA 1H7UA 2IERA 2PNZB 1OYPA 2O1VA 4KQVA 4DR3I 4DV5I 4IFDF 4LPFA 2V2ZA 4JV5E 2WP8B 1KKHA 1D6TA 2Z5BB 4UTGA 1UDOA 4X62E 4X66I 3PRYA 4X64E 2GO3A 3WU5A 2F1DA 4AQYE 2BR2B 4B3TI 4P52A 3WU3A 4LF8E 4DR1I 5A2QC 1ZXMA 4AIDA 4MYUA 4OO1E 2GQ0A 4FWGA 2V34A 4USKA 4UT4A 4DV2E 4GKJE 2HK3A 2BA1D 4OX9I 4DV1E 4DPXA 1UEKA 2Z5CB 4DR4E 4HYMA 1ZM3A 1VI7A 2O1TA 1XMOE 4LFCI 4DR6E 1PKPA 4LF5E 1H74A 3PS2A 4GKKI 1R6LA 4JYAE 5FWKA 2UXCI 1N33I 2ZM6E 4JI2E 4JI1I 2HKEA 4DV4E 1KTVA 1Z0EA 2PNMA 5BR8I 2C37A 1RHYA 4X65I 3PS3A 2HHHI 5JEAF 4IZJB 1IBMI 3B4TA 4DV7I 1H72C 4DPUA 2CGEA 3L7ZA 2NN6D 3B82A 1FWLA 2UUBE 2F4VI 2V2VA 5FLXQ 2XEXA 4LFBE 4DV3E 4JI5E 4IFDE 5DRRA 1I94I 3V2UC 3F0NA 1XNQI 2AJ4A 1WUUA 5C0XA 2PO2A 4YY3E 5C0XD 3LTOA 1FJGE 1FWKA 3QT8A 3KRNA 5A2QQ 2NN6C 1N0UA 2NN6F 2BA0G 4ED4A 1S4EA 1HNXE 5LMNI 2E5LE 4LF6E 1YH8A 4OO1A 1DARA 4FW4A 2O1UA 2PO1A 4JI3E 4K0KE 4P7AA 4DXLA 3M7NG 2BM0A 3OTOE 5C0XC 1FKAE 5C0XF 4LCHA 2J7KA 5K36E 3U1KA 4X62I 2UU9E 4X64I 4AQYI 1USVA 4I3HA 4DR7E 2JEAA 4YHHE 1R6MA 4LF8I 2ZBKB 1Z0BA 4AIMA 4JI0E 1ZXNA 1Y5YA 4WUBA 4DR2E 3B78A 2O1WA 2C38A 4DUZE 4DV2I 4GKJI 3DD6A 4DV1I 4USMA 4FN5A 3CDIA 5JEAE 4DR4I 3M85G 2WNRA 4ZVIA 4DV6E 3B8HA 4OKGA 1HR0E 1EI1A 1XMOI 1RR9A 1HK7A 4DR6I 2A2CA 4LF5I 2C37B 2ZITA 1Z5BA 4JYAI 5FLXC 1A6FA 4JI2I 3PYGA 4DV4I 1VISA 2NN6B 3L7ZB 2UXBE 4HXZA 1HNZE 2VQEE 4Z7CA 4DR5E 4NXNI 4FW9A 4LCFA 4URLA 1ZM9A 4M1KA 2UUBI 4LF4E 5C0XB 4LFBI 4DV3I 4JI5I 4BA2B 5K36A 4DU8A 1UDSA 4JI7E 5K36D 2C39B 5LMUE 2VQFI 2JE6A 2A2DA 4HACA 4XTJA 3GCMA 2CVEA 2R3VA 4DU7A 4IZKA 4YY3I 1FJGI 3JAMQ 1Y4SA 2JEBA 4B3ME 3HULA 3T1HE 3K1JA 4B3SE 2JT2A 2PO0A 4WUDA 1HNXI 2E5LI 4LF6I 2CG9A 1XHKA 3LNUA 3ZKDA 4K0KI 5K36C 5L3JA 3T1YE 3M6AA 3OTOI 5LL6R 5EKWA 3U1YA 2BM1A 3V5RA 2EFGA 4BA1A 2UU9I 1P42A 4PRXA 1J5EE 4AM3A 4PRVA 2PNZA 1Y6ZA 1MU5A 4DR7I 1KVKA 4YHHI 2C38B 2PNLA 3PS1A 4JI0I 2UUAI 1IBLE 1XMQE 2WP8A 2O3ZA 4DR2I 5IT9Q 1N0VC 1Z0TA 1Z0CA 3GLLA 4MU3A 4DUZI 3ZZ0A 1XNRE 1B63A 1FNMA 1Z5AA 5IWAE 2HFUA 4R1FA 4DPWA 4U3BA 4JI8E 3WU6A 2V8PA 4DV6I 1RREA 2J65A 1HR0I 4HY1A 4OO1D 1ZM2A 4OX9E 3J80C 4JV5I 2LJPA 1PVGA 4DUYE 1Z0VA 2HFSA 1FI4A 2Z5CA 3Q6NA 2BA1G 4QNKA 4DV0E 4OZEA 5DNLA 4OO1C 4OO1F 2UXBI 3JAMC 1HNZI 2VQEI 4NBQA 4DR5I 3J7AM 3Q1QA 4MU1A 5K36B 1NHIA 4X65E 3ZZUA 1B62A 4LF4I 4KHPE 3P76A 4LF7E 1MX0A 4IZKB 3QT6A 5ELWA 2JEBB 1KIJA 2DEIA 4JI7I 5LMUI 4JG4A 4FWHA 1XXEA 2PO0B 2UXDE 2IOPA 1E3PA 4IZJA 2Q2EB 3CDJA 4NXME 2IOQA 1EA6A 2OI2A 2NPFA 4LOMA 4Z7YA 4B3MI 1Y4UA 3T1HI 5DNXA 4JI4E 4IFDA 4B3SI 4IFDD 1Z0WA 2ZM6I 1OYSA 1E3HA 2DEJA 4BA1B 1H73A 4EMDA 5IT9C 3T1YI 1QZRA 3Q6MA 1HNWE 3CWVA 2UUCE 2NN6E 1YHCA 3QT5A 2WW4A 4IFDC 4WUCA 4DPYA 1BKNA 1IBKE 1J5EI 3J80Q 1N34E 3D4JA 2BA0D 2PO2B 3H1CA 1Z59A 1NZ0A 5GMEA 2VF3A 5C0XE 1IBLI 1XMQI 3P3EA 2HKJA 3M7ND 4OO1B 3P3CA 1UDNA 4FW7A 1N36E 1XNRI 2PO1B 5IWAI 3ZKBA 1USUA 3LPSA 1K47A 4JI8I 4JI6E 4J3DA 4LF9E 1S16A 3H4LA 4IS9A 4JI3I 4MDTA 4LFAE 5K36F 4B3RE 1N32E 4ISAA 4DUYI 4QNJA 5DROA 2JEAB 4DR3E 3QT7A 4LCGA 5JEAA 4DV5E 2GO4A 4FW5A 5JEAD 1U2RA 1Y60A 4MYTA 1NHJA 4DV0I 4MU4A 4RPFA 2E1RA 1ZM4A 4X66E 1ELOA 3M85D 2Z5BA 3HJCA 3J81C 2R42A 4KHPI 4B3TE 2WNRB 4FWDA 5JEAC 4DR1E 4LF7I 3K17A 2X36A 4FW6A 4NXNE 1OYRA 2NN6A 3P06A 3ZM7A 2BR2A 4IFDB 2VESA 2X7IA 3GMEA 2UXDI 4U3DA 5DRPA 4NXMI 1Z0GA 2AE8A 5GMDA 1UDQA 2BV3A 1NHHA 4JI4I 3P3GA 2VQFE 4FW3A 4BA2A 1MG7A 4LFCE
chains in the Genus database with same CATH topology
2GS8A 1HNWI 4GKKE 3K85A 2UXCE 3PYEA 1N33E 2UUCI 4JI1E 5BR8E 1PIEA 1OJ4A 3PYDA 1IBKI 1N34I 4PU9A 4HACB 2HHHE 3PYFA 2Z5EA 1IBME 4DV7E 1Z5CA 1H7SA 4DPTA 3J7AG 2F4VE 3WU4A 1N36I 4IZJD 1I94E 2UUAE 1XNQE 3J81Q 4JI6I 4LF9I 2V2QA 3GONA 4LFAI 2HK2A 3ZZTA 4B3RI 1N32I 2CZ9A 5LMNE 4N3OA 1H7UA 2O1VA 4KQVA 4DR3I 4DV5I 2V2ZA 4JV5E 1KKHA 1D6TA 2Z5BB 4UTGA 4X62E 4X66I 3PRYA 4X64E 3WU5A 4AQYE 4B3TI 4P52A 3WU3A 4LF8E 4DR1I 5A2QC 1ZXMA 4MYUA 2GQ0A 4FWGA 2V34A 4USKA 4UT4A 4DV2E 4GKJE 2HK3A 4OX9I 4DV1E 4DPXA 1UEKA 2Z5CB 4DR4E 4HYMA 1ZM3A 2O1TA 1XMOE 4LFCI 4DR6E 1PKPA 4LF5E 1H74A 4GKKI 4JYAE 5FWKA 2UXCI 1N33I 2ZM6E 4JI2E 4JI1I 2HKEA 4DV4E 1KTVA 1Z0EA 2PNMA 5BR8I 4X65I 2HHHI 4IZJB 1IBMI 4DV7I 1H72C 4DPUA 2CGEA 3B82A 1FWLA 2UUBE 2F4VI 2V2VA 5FLXQ 2XEXA 4LFBE 4DV3E 4JI5E 1I94I 3V2UC 3F0NA 1XNQI 2AJ4A 1WUUA 4YY3E 1FJGE 3LTOA 1FWKA 3QT8A 5A2QQ 1N0UA 4ED4A 1S4EA 1HNXE 5LMNI 2E5LE 4LF6E 1DARA 2O1UA 4JI3E 4K0KE 4P7AA 4DXLA 2BM0A 3OTOE 1FKAE 2J7KA 4X62I 2UU9E 4X64I 4AQYI 1USVA 4I3HA 4DR7E 4YHHE 4LF8I 2ZBKB 1Z0BA 4JI0E 1ZXNA 4WUBA 4DR2E 3B78A 2O1WA 4DUZE 4DV2I 4GKJI 4DV1I 4USMA 4FN5A 4DR4I 4ZVIA 4DV6E 3B8HA 1HR0E 1EI1A 1XMOI 1RR9A 1HK7A 4DR6I 2A2CA 4LF5I 2ZITA 1Z5BA 4JYAI 5FLXC 1A6FA 4JI2I 3PYGA 4DV4I 1VISA 2UXBE 4HXZA 1HNZE 2VQEE 4Z7CA 4DR5E 4NXNI 4FW9A 4URLA 1ZM9A 4M1KA 2UUBI 4LF4E 4LFBI 4DV3I 4JI5I 4DU8A 4JI7E 5LMUE 2VQFI 2A2DA 4HACA 4XTJA 2R3VA 4DU7A 4IZKA 4YY3I 1FJGI 3JAMQ 1Y4SA 4B3ME 3HULA 3T1HE 3K1JA 4B3SE 4WUDA 1HNXI 2E5LI 4LF6I 2CG9A 1XHKA 3LNUA 3ZKDA 4K0KI 5L3JA 3T1YE 3M6AA 3OTOI 5LL6R 2BM1A 3V5RA 2EFGA 2UU9I 4PRXA 1J5EE 4PRVA 1Y6ZA 1MU5A 4DR7I 1KVKA 4YHHI 2PNLA 4JI0I 2UUAI 1IBLE 1XMQE 4DR2I 5IT9Q 1N0VC 1Z0TA 1Z0CA 4DUZI 3ZZ0A 1XNRE 1B63A 1FNMA 1Z5AA 5IWAE 2HFUA 4R1FA 4DPWA 4JI8E 3WU6A 2V8PA 4DV6I 1RREA 1HR0I 4HY1A 1ZM2A 4OX9E 3J80C 4JV5I 2LJPA 1PVGA 4DUYE 1Z0VA 2HFSA 1FI4A 2Z5CA 3Q6NA 4DV0E 2UXBI 3JAMC 1HNZI 2VQEI 4DR5I 3J7AM 3Q1QA 1NHIA 4X65E 3ZZUA 1B62A 4LF4I 4KHPE 4LF7E 1MX0A 4IZKB 3QT6A 1KIJA 2DEIA 4JI7I 5LMUI 4JG4A 4FWHA 2UXDE 2IOPA 4IZJA 2Q2EB 4NXME 2IOQA 1EA6A 2OI2A 2NPFA 4B3MI 4Z7YA 1Y4UA 3T1HI 4JI4E 4B3SI 1Z0WA 2ZM6I 2DEJA 1H73A 4EMDA 5IT9C 3T1YI 1QZRA 3Q6MA 1HNWE 3CWVA 2UUCE 3QT5A 2WW4A 4WUCA 4DPYA 1BKNA 1IBKE 1J5EI 3J80Q 1N34E 3D4JA 1Z59A 1NZ0A 5GMEA 2VF3A 1IBLI 1XMQI 2HKJA 1N36E 1XNRI 5IWAI 3ZKBA 1USUA 3LPSA 1K47A 4JI8I 4JI6E 4LF9E 1S16A 3H4LA 4JI3I 4LFAE 4B3RE 1N32E 4DUYI 4DR3E 3QT7A 4DV5E 1U2RA 4MYTA 1NHJA 4DV0I 4RPFA 2E1RA 1ZM4A 4X66E 1ELOA 2Z5BA 3HJCA 3J81C 2R42A 4KHPI 4B3TE 4FWDA 4DR1E 4LF7I 3K17A 2X36A 4NXNE 3P06A 3ZM7A 2X7IA 2UXDI 4NXMI 1Z0GA 5GMDA 2BV3A 1NHHA 4JI4I 2VQFE 1MG7A 4LFCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GS8 A;  1HNW I;  4GKK E;  2UXC E;  3PYE A;  1N33 E;  2UUC I;  4JI1 E;  5BR8 E;  1PIE A;  1OJ4 A;  3PYD A;  1IBK I;  1N34 I;  4PU9 A;  4HAC B;  2HHH E;  3PYF A;  1IBM E;  4DV7 E;  1Z5C A;  1H7S A;  4DPT A;  3J7A G;  2F4V E;  3WU4 A;  1N36 I;  1I94 E;  2UUA E;  1XNQ E;  3J81 Q;  4JI6 I;  4LF9 I;  2V2Q A;  3GON A;  4LFA I;  2HK2 A;  3ZZT A;  4B3R I;  1N32 I;  2CZ9 A;  5LMN E;  1H7U A;  4KQV A;  4DR3 I;  4DV5 I;  2V2Z A;  4JV5 E;  1KKH A;  1D6T A;  4UTG A;  4X62 E;  4X66 I;  4X64 E;  3WU5 A;  4AQY E;  4B3T I;  4P52 A;  3WU3 A;  4LF8 E;  4DR1 I;  5A2Q C;  1ZXM A;  4MYU A;  4FWG A;  2V34 A;  4USK A;  4UT4 A;  4DV2 E;  4GKJ E;  2HK3 A;  4OX9 I;  4DV1 E;  4DPX A;  1UEK A;  4DR4 E;  4HYM A;  1ZM3 A;  1XMO E;  4LFC I;  4DR6 E;  1PKP A;  4LF5 E;  1H74 A;  4GKK I;  4JYA E;  2UXC I;  1N33 I;  2ZM6 E;  4JI2 E;  4JI1 I;  2HKE A;  4DV4 E;  1KTV A;  1Z0E A;  5BR8 I;  4X65 I;  2HHH I;  1IBM I;  4DV7 I;  1H72 C;  4DPU A;  3B82 A;  1FWL A;  2UUB E;  2F4V I;  2V2V A;  5FLX Q;  2XEX A;  4LFB E;  4DV3 E;  4JI5 E;  1I94 I;  3V2U C;  3F0N A;  1XNQ I;  2AJ4 A;  1WUU A;  4YY3 E;  1FJG E;  3LTO A;  1FWK A;  3QT8 A;  5A2Q Q;  1N0U A;  4ED4 A;  1S4E A;  1HNX E;  5LMN I;  2E5L E;  4LF6 E;  1DAR A;  4JI3 E;  4K0K E;  4P7A A;  4DXL A;  2BM0 A;  3OTO E;  1FKA E;  2J7K A;  4X62 I;  2UU9 E;  4X64 I;  4AQY I;  4I3H A;  4DR7 E;  4YHH E;  4LF8 I;  2ZBK B;  1Z0B A;  4JI0 E;  1ZXN A;  4WUB A;  4DR2 E;  3B78 A;  4DUZ E;  4DV2 I;  4GKJ I;  4DV1 I;  4USM A;  4FN5 A;  4DR4 I;  4ZVI A;  4DV6 E;  3B8H A;  1HR0 E;  1EI1 A;  1XMO I;  1RR9 A;  4DR6 I;  2A2C A;  4LF5 I;  2ZIT A;  1Z5B A;  4JYA I;  5FLX C;  1A6F A;  4JI2 I;  3PYG A;  4DV4 I;  1VIS A;  2UXB E;  4HXZ A;  1HNZ E;  2VQE E;  4Z7C A;  4DR5 E;  4NXN I;  4FW9 A;  4URL A;  2UUB I;  1ZM9 A;  4M1K A;  4LF4 E;  4LFB I;  4DV3 I;  4JI5 I;  4DU8 A;  4JI7 E;  5LMU E;  2VQF I;  2A2D A;  4HAC A;  4XTJ A;  2R3V A;  4DU7 A;  4YY3 I;  1FJG I;  3JAM Q;  4B3M E;  3HUL A;  3T1H E;  3K1J A;  4B3S E;  4WUD A;  1HNX I;  2E5L I;  4LF6 I;  1XHK A;  3LNU A;  3ZKD A;  4K0K I;  5L3J A;  3T1Y E;  3M6A A;  3OTO I;  5LL6 R;  2BM1 A;  3V5R A;  2EFG A;  2UU9 I;  4PRX A;  1J5E E;  4PRV A;  1MU5 A;  4DR7 I;  1KVK A;  4YHH I;  4JI0 I;  2UUA I;  1IBL E;  1XMQ E;  4DR2 I;  5IT9 Q;  1N0V C;  1Z0T A;  1Z0C A;  4DUZ I;  3ZZ0 A;  1XNR E;  1B63 A;  1FNM A;  1Z5A A;  5IWA E;  2HFU A;  4R1F A;  4DPW A;  4JI8 E;  3WU6 A;  2V8P A;  4DV6 I;  1RRE A;  1HR0 I;  4HY1 A;  1ZM2 A;  4OX9 E;  3J80 C;  4JV5 I;  2LJP A;  1PVG A;  4DUY E;  1Z0V A;  2HFS A;  1FI4 A;  4DV0 E;  2UXB I;  3JAM C;  1HNZ I;  2VQE I;  4DR5 I;  3J7A M;  3Q1Q A;  1NHI A;  4X65 E;  3ZZU A;  1B62 A;  4LF4 I;  4KHP E;  4LF7 E;  1MX0 A;  3QT6 A;  1KIJ A;  2DEI A;  4JI7 I;  5LMU I;  4JG4 A;  4FWH A;  2UXD E;  2Q2E B;  4NXM E;  2OI2 A;  1EA6 A;  2NPF A;  4B3M I;  4Z7Y A;  3T1H I;  4JI4 E;  4B3S I;  1Z0W A;  2ZM6 I;  2DEJ A;  1H73 A;  4EMD A;  5IT9 C;  3T1Y I;  1QZR A;  1HNW E;  3CWV A;  2UUC E;  3QT5 A;  2WW4 A;  4WUC A;  4DPY A;  1BKN A;  1IBK E;  1J5E I;  3J80 Q;  1N34 E;  3D4J A;  1Z59 A;  1NZ0 A;  5GME A;  2VF3 A;  1IBL I;  1XMQ I;  2HKJ A;  1N36 E;  1XNR I;  5IWA I;  3ZKB A;  3LPS A;  1K47 A;  4JI8 I;  4JI6 E;  4LF9 E;  1S16 A;  3H4L A;  4JI3 I;  4LFA E;  4B3R E;  1N32 E;  4DUY I;  4DR3 E;  3QT7 A;  4DV5 E;  1U2R A;  4MYT A;  1NHJ A;  4DV0 I;  4RPF A;  2E1R A;  1ZM4 A;  4X66 E;  1ELO A;  3J81 C;  2R42 A;  4KHP I;  4B3T E;  4FWD A;  4DR1 E;  4LF7 I;  3K17 A;  2X36 A;  4NXN E;  3ZM7 A;  2X7I A;  2UXD I;  4NXM I;  1Z0G A;  5GMD A;  2BV3 A;  1NHH A;  4JI4 I;  2VQF E;  1MG7 A;  4LFC E; 
#chains in the Genus database with same CATH topology
 2C39 A;  2GS8 A;  1HNW I;  4GKK E;  3K85 A;  4MQY A;  2UXC E;  3PYE A;  1N33 E;  2UUC I;  2IES A;  4JI1 E;  5BR8 E;  1PIE A;  1OJ4 A;  3PYD A;  1IBK I;  1N34 I;  4PU9 A;  2JE6 B;  4HAC B;  2HHH E;  3PYF A;  2Z5E A;  1IBM E;  4DV7 E;  3NZK A;  1Z5C A;  4GQU A;  1H7S A;  4DPT A;  5EL9 A;  3J7A G;  2F4V E;  3HKM A;  3WU4 A;  1N36 I;  4IZJ D;  1I94 E;  2UUA E;  1XNQ E;  3UHM A;  3J81 Q;  4JI6 I;  4LF9 I;  2V2Q A;  3GON A;  4LFA I;  2HK2 A;  3ZZT A;  4B3R I;  5JEA B;  1N32 I;  2CZ9 A;  5LMN E;  5DRQ A;  4MU0 A;  4N3O A;  1H7U A;  2IER A;  2PNZ B;  1OYP A;  2O1V A;  4KQV A;  4DR3 I;  4DV5 I;  4IFD F;  4LPF A;  2V2Z A;  4JV5 E;  2WP8 B;  1KKH A;  1D6T A;  2Z5B B;  4UTG A;  1UDO A;  4X62 E;  4X66 I;  3PRY A;  4X64 E;  2GO3 A;  3WU5 A;  2F1D A;  4AQY E;  2BR2 B;  4B3T I;  4P52 A;  3WU3 A;  4LF8 E;  4DR1 I;  5A2Q C;  1ZXM A;  4AID A;  4MYU A;  4OO1 E;  2GQ0 A;  4FWG A;  2V34 A;  4USK A;  4UT4 A;  4DV2 E;  4GKJ E;  2HK3 A;  2BA1 D;  4OX9 I;  4DV1 E;  4DPX A;  1UEK A;  2Z5C B;  4DR4 E;  4HYM A;  1ZM3 A;  1VI7 A;  2O1T A;  1XMO E;  4LFC I;  4DR6 E;  1PKP A;  4LF5 E;  1H74 A;  3PS2 A;  4GKK I;  1R6L A;  4JYA E;  5FWK A;  2UXC I;  1N33 I;  2ZM6 E;  4JI2 E;  4JI1 I;  2HKE A;  4DV4 E;  1KTV A;  1Z0E A;  2PNM A;  5BR8 I;  2C37 A;  1RHY A;  4X65 I;  3PS3 A;  2HHH I;  5JEA F;  4IZJ B;  1IBM I;  3B4T A;  4DV7 I;  1H72 C;  4DPU A;  2CGE A;  3L7Z A;  2NN6 D;  3B82 A;  1FWL A;  2UUB E;  2F4V I;  2V2V A;  5FLX Q;  2XEX A;  4LFB E;  4DV3 E;  4JI5 E;  4IFD E;  5DRR A;  1I94 I;  3V2U C;  3F0N A;  1XNQ I;  2AJ4 A;  1WUU A;  5C0X A;  2PO2 A;  4YY3 E;  5C0X D;  3LTO A;  1FJG E;  1FWK A;  3QT8 A;  3KRN A;  5A2Q Q;  2NN6 C;  1N0U A;  2NN6 F;  2BA0 G;  4ED4 A;  1S4E A;  1HNX E;  5LMN I;  2E5L E;  4LF6 E;  1YH8 A;  4OO1 A;  1DAR A;  4FW4 A;  2O1U A;  2PO1 A;  4JI3 E;  4K0K E;  4P7A A;  4DXL A;  3M7N G;  2BM0 A;  3OTO E;  5C0X C;  1FKA E;  5C0X F;  4LCH A;  2J7K A;  5K36 E;  3U1K A;  4X62 I;  2UU9 E;  4X64 I;  4AQY I;  1USV A;  4I3H A;  4DR7 E;  2JEA A;  4YHH E;  1R6M A;  4LF8 I;  2ZBK B;  1Z0B A;  4AIM A;  4JI0 E;  1ZXN A;  1Y5Y A;  4WUB A;  4DR2 E;  3B78 A;  2O1W A;  2C38 A;  4DUZ E;  4DV2 I;  4GKJ I;  3DD6 A;  4DV1 I;  4USM A;  4FN5 A;  3CDI A;  5JEA E;  4DR4 I;  3M85 G;  2WNR A;  4ZVI A;  4DV6 E;  3B8H A;  4OKG A;  1HR0 E;  1EI1 A;  1XMO I;  1RR9 A;  1HK7 A;  4DR6 I;  2A2C A;  4LF5 I;  2C37 B;  2ZIT A;  1Z5B A;  4JYA I;  5FLX C;  1A6F A;  4JI2 I;  3PYG A;  4DV4 I;  1VIS A;  2NN6 B;  3L7Z B;  2UXB E;  4HXZ A;  1HNZ E;  2VQE E;  4Z7C A;  4DR5 E;  4NXN I;  4FW9 A;  4LCF A;  4URL A;  1ZM9 A;  4M1K A;  2UUB I;  4LF4 E;  5C0X B;  4LFB I;  4DV3 I;  4JI5 I;  4BA2 B;  5K36 A;  4DU8 A;  1UDS A;  4JI7 E;  5K36 D;  2C39 B;  5LMU E;  2VQF I;  2JE6 A;  2A2D A;  4HAC A;  4XTJ A;  3GCM A;  2CVE A;  2R3V A;  4DU7 A;  4IZK A;  4YY3 I;  1FJG I;  3JAM Q;  1Y4S A;  2JEB A;  4B3M E;  3HUL A;  3T1H E;  3K1J A;  4B3S E;  2JT2 A;  2PO0 A;  4WUD A;  1HNX I;  2E5L I;  4LF6 I;  2CG9 A;  1XHK A;  3LNU A;  3ZKD A;  4K0K I;  5K36 C;  5L3J A;  3T1Y E;  3M6A A;  3OTO I;  5LL6 R;  5EKW A;  3U1Y A;  2BM1 A;  3V5R A;  2EFG A;  4BA1 A;  2UU9 I;  1P42 A;  4PRX A;  1J5E E;  4AM3 A;  4PRV A;  2PNZ A;  1Y6Z A;  1MU5 A;  4DR7 I;  1KVK A;  4YHH I;  2C38 B;  2PNL A;  3PS1 A;  4JI0 I;  2UUA I;  1IBL E;  1XMQ E;  2WP8 A;  2O3Z A;  4DR2 I;  5IT9 Q;  1N0V C;  1Z0T A;  1Z0C A;  3GLL A;  4MU3 A;  4DUZ I;  3ZZ0 A;  1XNR E;  1B63 A;  1FNM A;  1Z5A A;  5IWA E;  2HFU A;  4R1F A;  4DPW A;  4U3B A;  4JI8 E;  3WU6 A;  2V8P A;  4DV6 I;  1RRE A;  2J65 A;  1HR0 I;  4HY1 A;  4OO1 D;  1ZM2 A;  4OX9 E;  3J80 C;  4JV5 I;  2LJP A;  1PVG A;  4DUY E;  1Z0V A;  2HFS A;  1FI4 A;  2Z5C A;  3Q6N A;  2BA1 G;  4QNK A;  4DV0 E;  4OZE A;  5DNL A;  4OO1 C;  4OO1 F;  2UXB I;  3JAM C;  1HNZ I;  2VQE I;  4NBQ A;  4DR5 I;  3J7A M;  3Q1Q A;  4MU1 A;  5K36 B;  1NHI A;  4X65 E;  3ZZU A;  1B62 A;  4LF4 I;  4KHP E;  3P76 A;  4LF7 E;  1MX0 A;  4IZK B;  3QT6 A;  5ELW A;  2JEB B;  1KIJ A;  2DEI A;  4JI7 I;  5LMU I;  4JG4 A;  4FWH A;  1XXE A;  2PO0 B;  2UXD E;  2IOP A;  1E3P A;  4IZJ A;  2Q2E B;  3CDJ A;  4NXM E;  2IOQ A;  1EA6 A;  2OI2 A;  2NPF A;  4LOM A;  4Z7Y A;  4B3M I;  1Y4U A;  3T1H I;  5DNX A;  4JI4 E;  4IFD A;  4B3S I;  4IFD D;  1Z0W A;  2ZM6 I;  1OYS A;  1E3H A;  2DEJ A;  4BA1 B;  1H73 A;  4EMD A;  5IT9 C;  3T1Y I;  1QZR A;  3Q6M A;  1HNW E;  3CWV A;  2UUC E;  2NN6 E;  1YHC A;  3QT5 A;  2WW4 A;  4IFD C;  4WUC A;  4DPY A;  1BKN A;  1IBK E;  1J5E I;  3J80 Q;  1N34 E;  3D4J A;  2BA0 D;  2PO2 B;  3H1C A;  1Z59 A;  1NZ0 A;  5GME A;  2VF3 A;  5C0X E;  1IBL I;  1XMQ I;  3P3E A;  2HKJ A;  3M7N D;  4OO1 B;  3P3C A;  1UDN A;  4FW7 A;  1N36 E;  1XNR I;  2PO1 B;  5IWA I;  3ZKB A;  1USU A;  3LPS A;  1K47 A;  4JI8 I;  4JI6 E;  4J3D A;  4LF9 E;  1S16 A;  3H4L A;  4IS9 A;  4JI3 I;  4MDT A;  4LFA E;  5K36 F;  4B3R E;  1N32 E;  4ISA A;  4DUY I;  4QNJ A;  5DRO A;  2JEA B;  4DR3 E;  3QT7 A;  4LCG A;  5JEA A;  4DV5 E;  2GO4 A;  4FW5 A;  5JEA D;  1U2R A;  1Y60 A;  4MYT A;  1NHJ A;  4DV0 I;  4MU4 A;  4RPF A;  2E1R A;  1ZM4 A;  4X66 E;  1ELO A;  3M85 D;  2Z5B A;  3HJC A;  3J81 C;  2R42 A;  4KHP I;  4B3T E;  2WNR B;  4FWD A;  5JEA C;  4DR1 E;  4LF7 I;  3K17 A;  2X36 A;  4FW6 A;  4NXN E;  1OYR A;  2NN6 A;  3P06 A;  3ZM7 A;  2BR2 A;  4IFD B;  2VES A;  2X7I A;  3GME A;  2UXD I;  4U3D A;  5DRP A;  4NXM I;  1Z0G A;  2AE8 A;  5GMD A;  1UDQ A;  2BV3 A;  1NHH A;  4JI4 I;  3P3G A;  2VQF E;  4FW3 A;  4BA2 A;  1MG7 A;  4LFC E; 
#chains in the Genus database with same CATH homology
 2GS8 A;  1HNW I;  4GKK E;  3K85 A;  2UXC E;  3PYE A;  1N33 E;  2UUC I;  4JI1 E;  5BR8 E;  1PIE A;  1OJ4 A;  3PYD A;  1IBK I;  1N34 I;  4PU9 A;  4HAC B;  2HHH E;  3PYF A;  2Z5E A;  1IBM E;  4DV7 E;  1Z5C A;  1H7S A;  4DPT A;  3J7A G;  2F4V E;  3WU4 A;  1N36 I;  4IZJ D;  1I94 E;  2UUA E;  1XNQ E;  3J81 Q;  4JI6 I;  4LF9 I;  2V2Q A;  3GON A;  4LFA I;  2HK2 A;  3ZZT A;  4B3R I;  1N32 I;  2CZ9 A;  5LMN E;  4N3O A;  1H7U A;  2O1V A;  4KQV A;  4DR3 I;  4DV5 I;  2V2Z A;  4JV5 E;  1KKH A;  1D6T A;  2Z5B B;  4UTG A;  4X62 E;  4X66 I;  3PRY A;  4X64 E;  3WU5 A;  4AQY E;  4B3T I;  4P52 A;  3WU3 A;  4LF8 E;  4DR1 I;  5A2Q C;  1ZXM A;  4MYU A;  2GQ0 A;  4FWG A;  2V34 A;  4USK A;  4UT4 A;  4DV2 E;  4GKJ E;  2HK3 A;  4OX9 I;  4DV1 E;  4DPX A;  1UEK A;  2Z5C B;  4DR4 E;  4HYM A;  1ZM3 A;  2O1T A;  1XMO E;  4LFC I;  4DR6 E;  1PKP A;  4LF5 E;  1H74 A;  4GKK I;  4JYA E;  5FWK A;  2UXC I;  1N33 I;  2ZM6 E;  4JI2 E;  4JI1 I;  2HKE A;  4DV4 E;  1KTV A;  1Z0E A;  2PNM A;  5BR8 I;  4X65 I;  2HHH I;  4IZJ B;  1IBM I;  4DV7 I;  1H72 C;  4DPU A;  2CGE A;  3B82 A;  1FWL A;  2UUB E;  2F4V I;  2V2V A;  5FLX Q;  2XEX A;  4LFB E;  4DV3 E;  4JI5 E;  1I94 I;  3V2U C;  3F0N A;  1XNQ I;  2AJ4 A;  1WUU A;  4YY3 E;  1FJG E;  3LTO A;  1FWK A;  3QT8 A;  5A2Q Q;  1N0U A;  4ED4 A;  1S4E A;  1HNX E;  5LMN I;  2E5L E;  4LF6 E;  1DAR A;  2O1U A;  4JI3 E;  4K0K E;  4P7A A;  4DXL A;  2BM0 A;  3OTO E;  1FKA E;  2J7K A;  4X62 I;  2UU9 E;  4X64 I;  4AQY I;  1USV A;  4I3H A;  4DR7 E;  4YHH E;  4LF8 I;  2ZBK B;  1Z0B A;  4JI0 E;  1ZXN A;  4WUB A;  4DR2 E;  3B78 A;  2O1W A;  4DUZ E;  4DV2 I;  4GKJ I;  4DV1 I;  4USM A;  4FN5 A;  4DR4 I;  4ZVI A;  4DV6 E;  3B8H A;  1HR0 E;  1EI1 A;  1XMO I;  1RR9 A;  1HK7 A;  4DR6 I;  2A2C A;  4LF5 I;  2ZIT A;  1Z5B A;  4JYA I;  5FLX C;  1A6F A;  4JI2 I;  3PYG A;  4DV4 I;  1VIS A;  2UXB E;  4HXZ A;  1HNZ E;  2VQE E;  4Z7C A;  4DR5 E;  4NXN I;  4FW9 A;  4URL A;  1ZM9 A;  4M1K A;  2UUB I;  4LF4 E;  4LFB I;  4DV3 I;  4JI5 I;  4DU8 A;  4JI7 E;  5LMU E;  2VQF I;  2A2D A;  4HAC A;  4XTJ A;  2R3V A;  4DU7 A;  4IZK A;  4YY3 I;  1FJG I;  3JAM Q;  1Y4S A;  4B3M E;  3HUL A;  3T1H E;  3K1J A;  4B3S E;  4WUD A;  1HNX I;  2E5L I;  4LF6 I;  2CG9 A;  1XHK A;  3LNU A;  3ZKD A;  4K0K I;  5L3J A;  3T1Y E;  3M6A A;  3OTO I;  5LL6 R;  2BM1 A;  3V5R A;  2EFG A;  2UU9 I;  4PRX A;  1J5E E;  4PRV A;  1Y6Z A;  1MU5 A;  4DR7 I;  1KVK A;  4YHH I;  2PNL A;  4JI0 I;  2UUA I;  1IBL E;  1XMQ E;  4DR2 I;  5IT9 Q;  1N0V C;  1Z0T A;  1Z0C A;  4DUZ I;  3ZZ0 A;  1XNR E;  1B63 A;  1FNM A;  1Z5A A;  5IWA E;  2HFU A;  4R1F A;  4DPW A;  4JI8 E;  3WU6 A;  2V8P A;  4DV6 I;  1RRE A;  1HR0 I;  4HY1 A;  1ZM2 A;  4OX9 E;  3J80 C;  4JV5 I;  2LJP A;  1PVG A;  4DUY E;  1Z0V A;  2HFS A;  1FI4 A;  2Z5C A;  3Q6N A;  4DV0 E;  2UXB I;  3JAM C;  1HNZ I;  2VQE I;  4DR5 I;  3J7A M;  3Q1Q A;  1NHI A;  4X65 E;  3ZZU A;  1B62 A;  4LF4 I;  4KHP E;  4LF7 E;  1MX0 A;  4IZK B;  3QT6 A;  1KIJ A;  2DEI A;  4JI7 I;  5LMU I;  4JG4 A;  4FWH A;  2UXD E;  2IOP A;  4IZJ A;  2Q2E B;  4NXM E;  2IOQ A;  1EA6 A;  2OI2 A;  2NPF A;  4B3M I;  4Z7Y A;  1Y4U A;  3T1H I;  4JI4 E;  4B3S I;  1Z0W A;  2ZM6 I;  2DEJ A;  1H73 A;  4EMD A;  5IT9 C;  3T1Y I;  1QZR A;  3Q6M A;  1HNW E;  3CWV A;  2UUC E;  3QT5 A;  2WW4 A;  4WUC A;  4DPY A;  1BKN A;  1IBK E;  1J5E I;  3J80 Q;  1N34 E;  3D4J A;  1Z59 A;  1NZ0 A;  5GME A;  2VF3 A;  1IBL I;  1XMQ I;  2HKJ A;  1N36 E;  1XNR I;  5IWA I;  3ZKB A;  1USU A;  3LPS A;  1K47 A;  4JI8 I;  4JI6 E;  4LF9 E;  1S16 A;  3H4L A;  4JI3 I;  4LFA E;  4B3R E;  1N32 E;  4DUY I;  4DR3 E;  3QT7 A;  4DV5 E;  1U2R A;  4MYT A;  1NHJ A;  4DV0 I;  4RPF A;  2E1R A;  1ZM4 A;  4X66 E;  1ELO A;  2Z5B A;  3HJC A;  3J81 C;  2R42 A;  4KHP I;  4B3T E;  4FWD A;  4DR1 E;  4LF7 I;  3K17 A;  2X36 A;  4NXN E;  3P06 A;  3ZM7 A;  2X7I A;  2UXD I;  4NXM I;  1Z0G A;  5GMD A;  2BV3 A;  1NHH A;  4JI4 I;  2VQF E;  1MG7 A;  4LFC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...