4JI4I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji4I00
4AQYE 1XNQI 2E1RA 4HY1A 4JI5E 5IT9C 4WUBA 4DV6I 4DR6I 4NXMI 4LF6E 4B3SE 1XNRI 3PYGA 4YHHI 4X64I 2A2DA 3T1HE 4HACB 2OI2A 3K1JA 3LTOA 4LF7E 5LMNI 1BKNA 1HNWE 1MG7A 3PYDA 1D6TA 4JI4E 4DUYE 2ZITA 1B63A 5L3JA 4GKJE 4JV5E 4DV1I 2X36A 2UXBI 4LF8I 5IWAE 1XMOE 4DR1I 4DR4I 4JI7I 1N33E 4PU9A 1HR0I 3ZZ0A 4RPFA 1MX0A 4KHPE 3OTOI 4FW9A 2VQEI 2UUAI 1FWKA 1NZ0A 1H7UA 3QT8A 2BV3A 2XEXA 1Z5AA 4JI6E 1FWLA 3GONA 4X65I 1PVGA 4DR5I 1RREA 4GKKI 3B82A 1S4EA 4DV4E 4URLA 3H4LA 2J7KA 1IBKI 2UXDE 3QT7A 4AQYI 1QZRA 2UU9E 4DV7I 2HK2A 4I3HA 4X66E 4B3RE 4JI5I 2HK3A 2R3VA 4B3ME 2UXCE 1ZM4A 4JI0E 2HFSA 4LFBI 2F4VE 1Z0WA 1Z0GA 3JAMC 4DV0E 4LF6I 4B3SI 2GS8A 2DEJA 4DPTA 1NHJA 4FWDA 1KTVA 1N32I 4DR7I 5GMEA 1H72C 1HNZE 4PRXA 4DXLA 4USKA 1UEKA 1HNWI 4LF9E 1ELOA 1N36I 4JI4I 1U2RA 3J81Q 4GKJI 1NHHA 4JV5I 2V8PA 2Q2EB 3ZZUA 2UUCE 1Z5BA 1XMOI 4Z7YA 1FNMA 4DU8A 1Z0EA 4JI2I 1N33I 4DV2E 1IBLE 5BR8E 2E5LE 4JI1E 3WU6A 4NXNI 4DPXA 4K0KE 1Z0CA 4JI8I 2A2CA 1MU5A 3J7AM 4DR3I 2HKEA 4DR2E 4M1KA 5LMUE 4USMA 3J80Q 3ZM7A 3T1YE 1IBME 1PKPA 1ZXNA 3QT5A 3HULA 2VQFE 2HHHE 4OX9E 4LFCE 4JI3E 4UTGA 1H74A 1J5EE 4LF5E 4LFAE 2V2ZA 2UXCI 3CWVA 4JI0I 2UUBE 1WUUA 3PYFA 1I94I 4P52A 1XNQE 4HACA 3V5RA 5LL6R 3LNUA 4Z7CA 1Z0BA 1DARA 1HNZI 1N0UA 1XNRE 4ED4A 2AJ4A 1HNXI 4LF9I 4HYMA 4JYAE 3Q1QA 4ZVIA 5IT9Q 4DV3E 2UUCI 1H7SA 5LMNE 1ZM9A 2NPFA 3B78A 4DPUA 4DV5E 1IBLI 5BR8I 3J80C 4DV1E 1KVKA 2UXBE 4LF8E 2X7IA 4MYTA 1FJGE 5FLXQ 4B3TE 4DR4E 2HFUA 4JI7E 3T1HI 4LF4E 1OJ4A 4DR2I 3OTOE 4LF7I 1H73A 2UUAE 1XHKA 1IBMI 4R1FA 4DUYI 2ZBKB 4X65E 4YY3E 4OX9I 5IWAI 4LFCI 4DR5E 4JI3I 4GKKE 1J5EI 1EA6A 4X62E 3V2UC 4LFAI 4KHPI 1A6FA 1K47A 2ZM6E 1N0VC 3D4JA 2EFGA 1KKHA 4DV7E 4JI6I 1ZXMA 2R42A 3LPSA 3WU5A 3ZZTA 4PRVA 4DUZE 4LFBE 4WUCA 4DV4I 4WUDA 2UXDI 4KQVA 3ZKDA 4JYAI 1N32E 4DR7E 1B62A 5FLXC 4DV3I 2UU9I 1PIEA 1FI4A 3WU4A 4X66I 4B3RI 3JAMQ 1EI1A 1N36E 3ZKBA 1N34E 4B3MI 4DV5I 1XMQE 2F4VI 4DV0I 2CZ9A 2V2QA 1FKAE 1FJGI 3J81C 4B3TI 1Z0TA 4JI2E 3QT6A 4DV6E 4DR6E 1Z0VA 1S16A 4LF4I 5A2QQ 4NXME 2BM0A 3K17A 4NXNE 5GMDA 4JI8E 4MYUA 4YHHE 4FN5A 4X64E 1Z5CA 4JG4A 4DR3E 1VISA 4YY3I 2HKJA 2V34A 1RR9A 4XTJA 4DV2I 4DPWA 2E5LI 1Z59A 4X62I 1NHIA 4JI1I 2DEIA 2ZM6I 1KIJA 4K0KI 4DR1E 4DPYA 1HR0E 4HXZA 5LMUI 4DUZI 3PYEA 2BM1A 1ZM2A 2VQEE 4DU7A 3M6AA 3T1YI 4P7AA 2LJPA 1I94E 3F0NA 2VQFI 2HHHI 3B8HA 2V2VA 3WU3A 2VF3A 4LF5I 4EMDA 1HNXE 2WW4A 4FWGA 1IBKE 5A2QC 4FWHA 1N34I 1XMQI 3J7AG 2UUBI 4UT4A 1ZM3A
chains in the Genus database with same CATH superfamily
4AQYE 2Z5CA 2JEBB 1XNQI 3M7ND 1OYPA 2E1RA 4HY1A 4JI5E 5IT9C 2BA1D 2CVEA 4WUBA 4DV6I 4DR6I 5K36B 2JT2A 4IZJA 2BA0G 4NXMI 4LF6E 4B3SE 1XNRI 2CG9A 2IESA 5C0XB 2GO3A 3PYGA 4YHHI 4OKGA 4X64I 2A2DA 3T1HE 4HACB 2C37A 2Z5BA 2PNMA 2OI2A 3K1JA 3LTOA 4LF7E 5LMNI 1BKNA 1HNWE 1MG7A 3PYDA 4LCHA 1D6TA 2NN6D 4JI4E 2J65A 4DUYE 2ZITA 1B63A 5L3JA 4GKJE 4MU0A 4JV5E 4DV1I 2X36A 2UXBI 4LF8I 5IWAE 3CDIA 1XMOE 4DR1I 4DR4I 2PO1A 5K36F 4JI7I 1N33E 4PU9A 1HR0I 3ZZ0A 4OO1A 4RPFA 2BA1G 5C0XF 1MX0A 4KHPE 3OTOI 4FW9A 2BR2A 2VQEI 4ISAA 2UUAI 1FWKA 4N3OA 1NZ0A 1H7UA 4MU3A 3QT8A 2BV3A 2PNZB 2XEXA 1Z5AA 4OO1E 4JI6E 1FWLA 1RHYA 1XXEA 3GONA 4X65I 4MU4A 1UDSA 1PVGA 4DR5I 1RREA 4GKKI 3B82A 1S4EA 4DV4E 1Y6ZA 4URLA 3H4LA 2J7KA 4QNJA 1IBKI 2UXDE 3QT7A 5DRRA 2IOQA 2NN6B 2GQ0A 4FW3A 5K36D 4AQYI 1QZRA 2UU9E 3UHMA 4DV7I 1R6MA 2HK2A 4I3HA 4X66E 4B3RE 1E3PA 4JI5I 2HK3A 2R3VA 3P3EA 4B3ME 2UXCE 1ZM4A 2C39B 4LPFA 2HFSA 4JI0E 4LFBI 2F4VE 1Z0WA 1Z0GA 3JAMC 4DV0E 4LF6I 5FWKA 4B3SI 4MU1A 4BA1B 2GS8A 2DEJA 3U1KA 4DPTA 1NHJA 4FWDA 4FW5A 1KTVA 1N32I 4DR7I 4IS9A 5GMEA 1H72C 1HNZE 4AM3A 4BA2A 4PRXA 5JEAE 4DXLA 5JEAC 4USKA 1UEKA 1HNWI 2WP8A 4MQYA 1UDOA 4LF9E 1ELOA 1UDNA 1N36I 2NN6F 4JI4I 2PNLA 1U2RA 2WNRA 3J81Q 2JEAA 4GKJI 1NHHA 4JV5I 2V8PA 3P06A 2Q2EB 3ZZUA 2UUCE 3L7ZB 3P3CA 1Z5BA 1XMOI 4Z7YA 1FNMA 4DU8A 1YHCA 1Z0EA 4JI2I 4LCGA 1N33I 4DV2E 4J3DA 1IBLE 5BR8E 2E5LE 4IFDA 4JI1E 2JE6B 3WU6A 5DNLA 2PO2A 4LOMA 4NXNI 4FW6A 4DPXA 4K0KE 1Z0CA 4JI8I 2A2CA 4MDTA 1MU5A 4LCFA 3J7AM 4IFDE 1VI7A 4DR3I 2HKEA 4DR2E 4M1KA 3M85D 2C38A 5LMUE 4USMA 3J80Q 4GQUA 3ZM7A 1Y4UA 3T1YE 1IBME 1PKPA 1ZXNA 3QT5A 3HULA 2VQFE 2O1TA 2HHHE 2O1WA 4OX9E 2JEBA 3NZKA 4LFCE 4JI3E 4UTGA 2AE8A 2VESA 1H74A 1J5EE 3M7NG 4LF5E 5K36A 2PO0B 4LFAE 2IERA 2V2ZA 2UXCI 3CWVA 4JI0I 2UUBE 5C0XA 1WUUA 3PYFA 1I94I 5K36E 4P52A 1XNQE 3P3GA 4OO1C 4HACA 3V5RA 4IZJD 3LNUA 4IZKB 5LL6R 3H1CA 1Z0BA 4Z7CA 1DARA 5C0XE 3PS2A 1HNZI 1YH8A 1N0UA 1XNRE 4ED4A 1P42A 2AJ4A 1HNXI 4LF9I 4HYMA 5JEAB 4JYAE 3Q1QA 4ZVIA 4FW7A 5IT9Q 2IOPA 4DV3E 2UUCI 3U1YA 1H7SA 5LMNE 1ZM9A 2NPFA 3B78A 3GMEA 4DPUA 4DV5E 1IBLI 5BR8I 3J80C 4DV1E 1KVKA 2UXBE 4LF8E 2X7IA 2O1UA 2PNZA 4MYTA 1FJGE 5FLXQ 4B3TE 2Z5CB 4DR4E 2HFUA 4OO1D 4JI7E 3PS1A 3T1HI 1Y4SA 4LF4E 1OJ4A 2BA0D 4DR2I 4AIMA 3OTOE 4IZJB 4LF7I 1H73A 3Q6MA 5JEAF 2UUAE 1XHKA 4AIDA 1IBMI 4R1FA 4DUYI 2NN6A 2ZBKB 1USUA 4X65E 2C37B 2Z5BB 4YY3E 5IWAI 4OX9I 4LFCI 4DR5E 4JI3I 4GKKE 3PRYA 1J5EI 2NN6E 1EA6A 4X62E 2C39A 1HK7A 2O1VA 3V2UC 1R6LA 4LFAI 4KHPI 1A6FA 1K47A 2ZM6E 4BA1A 1N0VC 3D4JA 2EFGA 4U3BA 1KKHA 4DV7E 3DD6A 1UDQA 3KRNA 4JI6I 1ZXMA 2R42A 2PO1B 4IFDC 3LPSA 3WU5A 3ZZTA 4PRVA 4DUZE 4IFDF 1Y60A 4OO1B 4LFBE 5JEAD 3K85A 4WUCA 4DV4I 2BR2B 4WUDA 2UXDI 4KQVA 3ZKDA 4JYAI 1N32E 4DR7E 3L7ZA 1B62A 5FLXC 4DV3I 2UU9I 1PIEA 1FI4A 3WU4A 4X66I 4B3RI 3JAMQ 1EI1A 1N36E 3ZKBA 2GO4A 1N34E 4B3MI 2JE6A 4DV5I 1XMQE 1Y5YA 2F4VI 4DV0I 5EL9A 2CZ9A 1USVA 2V2QA 1FKAE 1FJGI 5K36C 3J81C 4B3TI 5ELWA 1Z0TA 4OO1F 4JI2E 3QT6A 4IFDD 4DV6E 4DR6E 1Z0VA 3HJCA 1S16A 5C0XC 4LF4I 5A2QQ 4NXME 3PS3A 2BM0A 3M85G 3CDJA 5DRPA 1OYRA 3K17A 4NXNE 3GLLA 5GMDA 4JI8E 4MYUA 4YHHE 4FN5A 4X64E 2Z5EA 1Z5CA 4JG4A 4DR3E 1VISA 4OZEA 4U3DA 4YY3I 2HKJA 4BA2B 2V34A 5DNXA 1RR9A 3HKMA 3GCMA 2PO0A 4XTJA 4DV2I 4DPWA 2WP8B 2E5LI 1OYSA 1Z59A 4X62I 1NHIA 4JI1I 2WNRB 2JEAB 2DEIA 3P76A 2ZM6I 1KIJA 4K0KI 4DR1E 4DPYA 4IZKA 1HR0E 4QNKA 4HXZA 5C0XD 5LMUI 4DUZI 3PYEA 1ZM2A 2BM1A 2VQEE 4IFDB 4DU7A 3Q6NA 3M6AA 3T1YI 4P7AA 2PO2B 2LJPA 5JEAA 3B4TA 4FW4A 1I94E 3F0NA 5EKWA 4NBQA 2VQFI 2HHHI 2O3ZA 3B8HA 2F1DA 2V2VA 2C38B 3WU3A 2VF3A 4LF5I 4EMDA 2NN6C 2WW4A 1HNXE 4FWGA 1IBKE 5A2QC 4FWHA 1E3HA 5DROA 1N34I 1XMQI 3J7AG 2UUBI 2CGEA 5DRQA 4UT4A 1ZM3A
chains in the Genus database with same CATH topology
4AQYE 2Z5CA 1XNQI 2E1RA 4HY1A 4JI5E 5IT9C 4WUBA 4DV6I 4DR6I 4IZJA 4NXMI 4LF6E 4B3SE 1XNRI 2CG9A 3PYGA 4YHHI 4X64I 2A2DA 3T1HE 4HACB 2Z5BA 2PNMA 2OI2A 3K1JA 3LTOA 4LF7E 5LMNI 1BKNA 1HNWE 1MG7A 3PYDA 1D6TA 4JI4E 4DUYE 2ZITA 1B63A 5L3JA 4GKJE 4JV5E 4DV1I 2X36A 2UXBI 4LF8I 5IWAE 1XMOE 4DR1I 4DR4I 4JI7I 1N33E 4PU9A 1HR0I 3ZZ0A 4RPFA 1MX0A 4KHPE 3OTOI 4FW9A 2VQEI 2UUAI 1FWKA 4N3OA 1NZ0A 1H7UA 3QT8A 2BV3A 2XEXA 1Z5AA 4JI6E 1FWLA 3GONA 4X65I 1PVGA 4DR5I 1RREA 4GKKI 3B82A 1S4EA 4DV4E 1Y6ZA 4URLA 3H4LA 2J7KA 1IBKI 2UXDE 3QT7A 2IOQA 2GQ0A 4AQYI 1QZRA 2UU9E 4DV7I 2HK2A 4I3HA 4X66E 4B3RE 4JI5I 2HK3A 2R3VA 4B3ME 2UXCE 1ZM4A 4JI0E 2HFSA 4LFBI 2F4VE 1Z0WA 1Z0GA 3JAMC 4DV0E 4LF6I 5FWKA 4B3SI 2GS8A 2DEJA 4DPTA 1NHJA 4FWDA 1KTVA 1N32I 4DR7I 5GMEA 1H72C 1HNZE 4PRXA 4DXLA 4USKA 1UEKA 1HNWI 4LF9E 1ELOA 1N36I 4JI4I 2PNLA 1U2RA 3J81Q 4GKJI 1NHHA 4JV5I 2V8PA 3P06A 2Q2EB 3ZZUA 2UUCE 1Z5BA 1XMOI 4Z7YA 1FNMA 4DU8A 1Z0EA 4JI2I 1N33I 4DV2E 1IBLE 5BR8E 2E5LE 4JI1E 3WU6A 4NXNI 4DPXA 4K0KE 1Z0CA 4JI8I 2A2CA 1MU5A 3J7AM 4DR3I 2HKEA 4DR2E 4M1KA 5LMUE 4USMA 3J80Q 3ZM7A 1Y4UA 3T1YE 1IBME 1PKPA 1ZXNA 3QT5A 3HULA 2VQFE 2O1TA 2HHHE 2O1WA 4OX9E 4LFCE 4JI3E 4UTGA 1H74A 1J5EE 4LF5E 4LFAE 2V2ZA 2UXCI 3CWVA 4JI0I 2UUBE 1WUUA 3PYFA 1I94I 4P52A 1XNQE 4HACA 3V5RA 4IZJD 3LNUA 4IZKB 5LL6R 4Z7CA 1Z0BA 1DARA 1HNZI 1N0UA 1XNRE 4ED4A 2AJ4A 1HNXI 4LF9I 4HYMA 4JYAE 3Q1QA 4ZVIA 5IT9Q 2IOPA 4DV3E 2UUCI 1H7SA 5LMNE 1ZM9A 2NPFA 3B78A 4DPUA 4DV5E 1IBLI 5BR8I 3J80C 4DV1E 1KVKA 2UXBE 4LF8E 2X7IA 2O1UA 4MYTA 1FJGE 5FLXQ 4B3TE 2Z5CB 4DR4E 2HFUA 4JI7E 3T1HI 1Y4SA 4LF4E 1OJ4A 4DR2I 3OTOE 4IZJB 4LF7I 1H73A 3Q6MA 2UUAE 1XHKA 1IBMI 4R1FA 4DUYI 2ZBKB 1USUA 4X65E 2Z5BB 4YY3E 5IWAI 4OX9I 4LFCI 4DR5E 4JI3I 4GKKE 3PRYA 1J5EI 1EA6A 4X62E 1HK7A 2O1VA 3V2UC 4LFAI 4KHPI 1A6FA 1K47A 2ZM6E 1N0VC 3D4JA 2EFGA 1KKHA 4DV7E 4JI6I 1ZXMA 2R42A 3LPSA 3WU5A 3ZZTA 4PRVA 4DUZE 4LFBE 3K85A 4WUCA 4DV4I 4WUDA 2UXDI 4KQVA 3ZKDA 4JYAI 1N32E 4DR7E 1B62A 5FLXC 4DV3I 2UU9I 1PIEA 1FI4A 3WU4A 4X66I 4B3RI 3JAMQ 1EI1A 1N36E 3ZKBA 1N34E 4B3MI 4DV5I 1XMQE 2F4VI 4DV0I 2CZ9A 1USVA 2V2QA 1FKAE 1FJGI 3J81C 4B3TI 1Z0TA 4JI2E 3QT6A 4DV6E 4DR6E 1Z0VA 3HJCA 1S16A 4LF4I 5A2QQ 4NXME 2BM0A 3K17A 4NXNE 5GMDA 4JI8E 4MYUA 4YHHE 4FN5A 4X64E 2Z5EA 1Z5CA 4JG4A 4DR3E 1VISA 4YY3I 2HKJA 2V34A 1RR9A 4XTJA 4DV2I 4DPWA 2E5LI 1Z59A 4X62I 1NHIA 4JI1I 2DEIA 2ZM6I 1KIJA 4K0KI 4DR1E 4DPYA 4IZKA 1HR0E 4HXZA 5LMUI 4DUZI 3PYEA 2BM1A 1ZM2A 2VQEE 4DU7A 3Q6NA 3M6AA 3T1YI 4P7AA 2LJPA 1I94E 3F0NA 2VQFI 2HHHI 3B8HA 2V2VA 3WU3A 2VF3A 4LF5I 4EMDA 1HNXE 2WW4A 4FWGA 1IBKE 5A2QC 4FWHA 1N34I 1XMQI 3J7AG 2UUBI 2CGEA 4UT4A 1ZM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY E;  1XNQ I;  2E1R A;  4HY1 A;  4JI5 E;  5IT9 C;  4WUB A;  4DV6 I;  4DR6 I;  4NXM I;  4LF6 E;  4B3S E;  1XNR I;  3PYG A;  4YHH I;  4X64 I;  2A2D A;  3T1H E;  4HAC B;  2OI2 A;  3K1J A;  3LTO A;  4LF7 E;  5LMN I;  1BKN A;  1HNW E;  1MG7 A;  3PYD A;  1D6T A;  4JI4 E;  4DUY E;  2ZIT A;  1B63 A;  5L3J A;  4GKJ E;  4JV5 E;  4DV1 I;  2X36 A;  2UXB I;  4LF8 I;  5IWA E;  1XMO E;  4DR1 I;  4DR4 I;  4JI7 I;  1N33 E;  4PU9 A;  1HR0 I;  3ZZ0 A;  4RPF A;  1MX0 A;  4KHP E;  3OTO I;  4FW9 A;  2VQE I;  2UUA I;  1FWK A;  1NZ0 A;  1H7U A;  3QT8 A;  2BV3 A;  2XEX A;  1Z5A A;  4JI6 E;  1FWL A;  3GON A;  4X65 I;  1PVG A;  4DR5 I;  1RRE A;  4GKK I;  3B82 A;  1S4E A;  4DV4 E;  4URL A;  3H4L A;  2J7K A;  1IBK I;  2UXD E;  3QT7 A;  4AQY I;  1QZR A;  2UU9 E;  4DV7 I;  2HK2 A;  4I3H A;  4X66 E;  4B3R E;  4JI5 I;  2HK3 A;  2R3V A;  4B3M E;  2UXC E;  1ZM4 A;  4JI0 E;  2HFS A;  4LFB I;  2F4V E;  1Z0W A;  1Z0G A;  3JAM C;  4DV0 E;  4LF6 I;  4B3S I;  2GS8 A;  2DEJ A;  4DPT A;  1NHJ A;  4FWD A;  1KTV A;  1N32 I;  4DR7 I;  5GME A;  1H72 C;  1HNZ E;  4PRX A;  4DXL A;  4USK A;  1UEK A;  1HNW I;  4LF9 E;  1ELO A;  1N36 I;  4JI4 I;  1U2R A;  3J81 Q;  4GKJ I;  1NHH A;  4JV5 I;  2V8P A;  2Q2E B;  3ZZU A;  2UUC E;  1Z5B A;  1XMO I;  4Z7Y A;  1FNM A;  4DU8 A;  1Z0E A;  4JI2 I;  1N33 I;  4DV2 E;  1IBL E;  5BR8 E;  2E5L E;  4JI1 E;  3WU6 A;  4NXN I;  4DPX A;  4K0K E;  1Z0C A;  4JI8 I;  2A2C A;  1MU5 A;  3J7A M;  4DR3 I;  2HKE A;  4DR2 E;  4M1K A;  5LMU E;  4USM A;  3J80 Q;  3ZM7 A;  3T1Y E;  1IBM E;  1PKP A;  1ZXN A;  3QT5 A;  3HUL A;  2VQF E;  2HHH E;  4OX9 E;  4LFC E;  4JI3 E;  4UTG A;  1H74 A;  1J5E E;  4LF5 E;  4LFA E;  2V2Z A;  2UXC I;  3CWV A;  4JI0 I;  2UUB E;  1WUU A;  3PYF A;  1I94 I;  4P52 A;  1XNQ E;  4HAC A;  3V5R A;  5LL6 R;  3LNU A;  4Z7C A;  1Z0B A;  1DAR A;  1HNZ I;  1N0U A;  1XNR E;  4ED4 A;  2AJ4 A;  1HNX I;  4LF9 I;  4HYM A;  4JYA E;  3Q1Q A;  4ZVI A;  5IT9 Q;  4DV3 E;  2UUC I;  1H7S A;  5LMN E;  1ZM9 A;  2NPF A;  3B78 A;  4DPU A;  4DV5 E;  1IBL I;  5BR8 I;  3J80 C;  4DV1 E;  1KVK A;  2UXB E;  4LF8 E;  2X7I A;  4MYT A;  1FJG E;  5FLX Q;  4B3T E;  4DR4 E;  2HFU A;  4JI7 E;  3T1H I;  4LF4 E;  1OJ4 A;  4DR2 I;  3OTO E;  4LF7 I;  1H73 A;  2UUA E;  1XHK A;  1IBM I;  4R1F A;  4DUY I;  2ZBK B;  4X65 E;  4YY3 E;  4OX9 I;  5IWA I;  4LFC I;  4DR5 E;  4JI3 I;  4GKK E;  1J5E I;  1EA6 A;  4X62 E;  3V2U C;  4LFA I;  4KHP I;  1A6F A;  1K47 A;  2ZM6 E;  1N0V C;  3D4J A;  2EFG A;  1KKH A;  4DV7 E;  4JI6 I;  1ZXM A;  2R42 A;  3LPS A;  3WU5 A;  3ZZT A;  4PRV A;  4DUZ E;  4LFB E;  4WUC A;  4DV4 I;  4WUD A;  2UXD I;  4KQV A;  3ZKD A;  4JYA I;  1N32 E;  4DR7 E;  1B62 A;  5FLX C;  4DV3 I;  2UU9 I;  1PIE A;  1FI4 A;  3WU4 A;  4X66 I;  4B3R I;  3JAM Q;  1EI1 A;  1N36 E;  3ZKB A;  1N34 E;  4B3M I;  4DV5 I;  1XMQ E;  2F4V I;  4DV0 I;  2CZ9 A;  2V2Q A;  1FKA E;  1FJG I;  3J81 C;  4B3T I;  1Z0T A;  4JI2 E;  3QT6 A;  4DV6 E;  4DR6 E;  1Z0V A;  1S16 A;  4LF4 I;  5A2Q Q;  4NXM E;  2BM0 A;  3K17 A;  4NXN E;  5GMD A;  4JI8 E;  4MYU A;  4YHH E;  4FN5 A;  4X64 E;  1Z5C A;  4JG4 A;  4DR3 E;  1VIS A;  4YY3 I;  2HKJ A;  2V34 A;  1RR9 A;  4XTJ A;  4DV2 I;  4DPW A;  2E5L I;  1Z59 A;  4X62 I;  1NHI A;  4JI1 I;  2DEI A;  2ZM6 I;  1KIJ A;  4K0K I;  4DR1 E;  4DPY A;  1HR0 E;  4HXZ A;  5LMU I;  4DUZ I;  3PYE A;  2BM1 A;  1ZM2 A;  2VQE E;  4DU7 A;  3M6A A;  3T1Y I;  4P7A A;  2LJP A;  1I94 E;  3F0N A;  2VQF I;  2HHH I;  3B8H A;  2V2V A;  3WU3 A;  2VF3 A;  4LF5 I;  4EMD A;  1HNX E;  2WW4 A;  4FWG A;  1IBK E;  5A2Q C;  4FWH A;  1N34 I;  1XMQ I;  3J7A G;  2UUB I;  4UT4 A;  1ZM3 A; 
#chains in the Genus database with same CATH topology
 4AQY E;  2Z5C A;  2JEB B;  1XNQ I;  3M7N D;  1OYP A;  2E1R A;  4HY1 A;  4JI5 E;  5IT9 C;  2BA1 D;  2CVE A;  4WUB A;  4DV6 I;  4DR6 I;  5K36 B;  2JT2 A;  4IZJ A;  2BA0 G;  4NXM I;  4LF6 E;  4B3S E;  1XNR I;  2CG9 A;  2IES A;  5C0X B;  2GO3 A;  3PYG A;  4YHH I;  4OKG A;  4X64 I;  2A2D A;  3T1H E;  4HAC B;  2C37 A;  2Z5B A;  2PNM A;  2OI2 A;  3K1J A;  3LTO A;  4LF7 E;  5LMN I;  1BKN A;  1HNW E;  1MG7 A;  3PYD A;  4LCH A;  1D6T A;  2NN6 D;  4JI4 E;  2J65 A;  4DUY E;  2ZIT A;  1B63 A;  5L3J A;  4GKJ E;  4MU0 A;  4JV5 E;  4DV1 I;  2X36 A;  2UXB I;  4LF8 I;  5IWA E;  3CDI A;  1XMO E;  4DR1 I;  4DR4 I;  2PO1 A;  5K36 F;  4JI7 I;  1N33 E;  4PU9 A;  1HR0 I;  3ZZ0 A;  4OO1 A;  4RPF A;  2BA1 G;  5C0X F;  1MX0 A;  4KHP E;  3OTO I;  4FW9 A;  2BR2 A;  2VQE I;  4ISA A;  2UUA I;  1FWK A;  4N3O A;  1NZ0 A;  1H7U A;  4MU3 A;  3QT8 A;  2BV3 A;  2PNZ B;  2XEX A;  1Z5A A;  4OO1 E;  4JI6 E;  1FWL A;  1RHY A;  1XXE A;  3GON A;  4X65 I;  4MU4 A;  1UDS A;  1PVG A;  4DR5 I;  1RRE A;  4GKK I;  3B82 A;  1S4E A;  4DV4 E;  1Y6Z A;  4URL A;  3H4L A;  2J7K A;  4QNJ A;  1IBK I;  2UXD E;  3QT7 A;  5DRR A;  2IOQ A;  2NN6 B;  2GQ0 A;  4FW3 A;  5K36 D;  4AQY I;  1QZR A;  2UU9 E;  3UHM A;  4DV7 I;  1R6M A;  2HK2 A;  4I3H A;  4X66 E;  4B3R E;  1E3P A;  4JI5 I;  2HK3 A;  2R3V A;  3P3E A;  4B3M E;  2UXC E;  1ZM4 A;  2C39 B;  4LPF A;  2HFS A;  4JI0 E;  4LFB I;  2F4V E;  1Z0W A;  1Z0G A;  3JAM C;  4DV0 E;  4LF6 I;  5FWK A;  4B3S I;  4MU1 A;  4BA1 B;  2GS8 A;  2DEJ A;  3U1K A;  4DPT A;  1NHJ A;  4FWD A;  4FW5 A;  1KTV A;  1N32 I;  4DR7 I;  4IS9 A;  5GME A;  1H72 C;  1HNZ E;  4AM3 A;  4BA2 A;  4PRX A;  5JEA E;  4DXL A;  5JEA C;  4USK A;  1UEK A;  1HNW I;  2WP8 A;  4MQY A;  1UDO A;  4LF9 E;  1ELO A;  1UDN A;  1N36 I;  2NN6 F;  4JI4 I;  2PNL A;  1U2R A;  2WNR A;  3J81 Q;  2JEA A;  4GKJ I;  1NHH A;  4JV5 I;  2V8P A;  3P06 A;  2Q2E B;  3ZZU A;  2UUC E;  3L7Z B;  3P3C A;  1Z5B A;  1XMO I;  4Z7Y A;  1FNM A;  4DU8 A;  1YHC A;  1Z0E A;  4JI2 I;  4LCG A;  1N33 I;  4DV2 E;  4J3D A;  1IBL E;  5BR8 E;  2E5L E;  4IFD A;  4JI1 E;  2JE6 B;  3WU6 A;  5DNL A;  2PO2 A;  4LOM A;  4NXN I;  4FW6 A;  4DPX A;  4K0K E;  1Z0C A;  4JI8 I;  2A2C A;  4MDT A;  1MU5 A;  4LCF A;  3J7A M;  4IFD E;  1VI7 A;  4DR3 I;  2HKE A;  4DR2 E;  4M1K A;  3M85 D;  2C38 A;  5LMU E;  4USM A;  3J80 Q;  4GQU A;  3ZM7 A;  1Y4U A;  3T1Y E;  1IBM E;  1PKP A;  1ZXN A;  3QT5 A;  3HUL A;  2VQF E;  2O1T A;  2HHH E;  2O1W A;  4OX9 E;  2JEB A;  3NZK A;  4LFC E;  4JI3 E;  4UTG A;  2AE8 A;  2VES A;  1H74 A;  1J5E E;  3M7N G;  4LF5 E;  5K36 A;  2PO0 B;  4LFA E;  2IER A;  2V2Z A;  2UXC I;  3CWV A;  4JI0 I;  2UUB E;  5C0X A;  1WUU A;  3PYF A;  1I94 I;  5K36 E;  4P52 A;  1XNQ E;  3P3G A;  4OO1 C;  4HAC A;  3V5R A;  4IZJ D;  3LNU A;  4IZK B;  5LL6 R;  3H1C A;  1Z0B A;  4Z7C A;  1DAR A;  5C0X E;  3PS2 A;  1HNZ I;  1YH8 A;  1N0U A;  1XNR E;  4ED4 A;  1P42 A;  2AJ4 A;  1HNX I;  4LF9 I;  4HYM A;  5JEA B;  4JYA E;  3Q1Q A;  4ZVI A;  4FW7 A;  5IT9 Q;  2IOP A;  4DV3 E;  2UUC I;  3U1Y A;  1H7S A;  5LMN E;  1ZM9 A;  2NPF A;  3B78 A;  3GME A;  4DPU A;  4DV5 E;  1IBL I;  5BR8 I;  3J80 C;  4DV1 E;  1KVK A;  2UXB E;  4LF8 E;  2X7I A;  2O1U A;  2PNZ A;  4MYT A;  1FJG E;  5FLX Q;  4B3T E;  2Z5C B;  4DR4 E;  2HFU A;  4OO1 D;  4JI7 E;  3PS1 A;  3T1H I;  1Y4S A;  4LF4 E;  1OJ4 A;  2BA0 D;  4DR2 I;  4AIM A;  3OTO E;  4IZJ B;  4LF7 I;  1H73 A;  3Q6M A;  5JEA F;  2UUA E;  1XHK A;  4AID A;  1IBM I;  4R1F A;  4DUY I;  2NN6 A;  2ZBK B;  1USU A;  4X65 E;  2C37 B;  2Z5B B;  4YY3 E;  5IWA I;  4OX9 I;  4LFC I;  4DR5 E;  4JI3 I;  4GKK E;  3PRY A;  1J5E I;  2NN6 E;  1EA6 A;  4X62 E;  2C39 A;  1HK7 A;  2O1V A;  3V2U C;  1R6L A;  4LFA I;  4KHP I;  1A6F A;  1K47 A;  2ZM6 E;  4BA1 A;  1N0V C;  3D4J A;  2EFG A;  4U3B A;  1KKH A;  4DV7 E;  3DD6 A;  1UDQ A;  3KRN A;  4JI6 I;  1ZXM A;  2R42 A;  2PO1 B;  4IFD C;  3LPS A;  3WU5 A;  3ZZT A;  4PRV A;  4DUZ E;  4IFD F;  1Y60 A;  4OO1 B;  4LFB E;  5JEA D;  3K85 A;  4WUC A;  4DV4 I;  2BR2 B;  4WUD A;  2UXD I;  4KQV A;  3ZKD A;  4JYA I;  1N32 E;  4DR7 E;  3L7Z A;  1B62 A;  5FLX C;  4DV3 I;  2UU9 I;  1PIE A;  1FI4 A;  3WU4 A;  4X66 I;  4B3R I;  3JAM Q;  1EI1 A;  1N36 E;  3ZKB A;  2GO4 A;  1N34 E;  4B3M I;  2JE6 A;  4DV5 I;  1XMQ E;  1Y5Y A;  2F4V I;  4DV0 I;  5EL9 A;  2CZ9 A;  1USV A;  2V2Q A;  1FKA E;  1FJG I;  5K36 C;  3J81 C;  4B3T I;  5ELW A;  1Z0T A;  4OO1 F;  4JI2 E;  3QT6 A;  4IFD D;  4DV6 E;  4DR6 E;  1Z0V A;  3HJC A;  1S16 A;  5C0X C;  4LF4 I;  5A2Q Q;  4NXM E;  3PS3 A;  2BM0 A;  3M85 G;  3CDJ A;  5DRP A;  1OYR A;  3K17 A;  4NXN E;  3GLL A;  5GMD A;  4JI8 E;  4MYU A;  4YHH E;  4FN5 A;  4X64 E;  2Z5E A;  1Z5C A;  4JG4 A;  4DR3 E;  1VIS A;  4OZE A;  4U3D A;  4YY3 I;  2HKJ A;  4BA2 B;  2V34 A;  5DNX A;  1RR9 A;  3HKM A;  3GCM A;  2PO0 A;  4XTJ A;  4DV2 I;  4DPW A;  2WP8 B;  2E5L I;  1OYS A;  1Z59 A;  4X62 I;  1NHI A;  4JI1 I;  2WNR B;  2JEA B;  2DEI A;  3P76 A;  2ZM6 I;  1KIJ A;  4K0K I;  4DR1 E;  4DPY A;  4IZK A;  1HR0 E;  4QNK A;  4HXZ A;  5C0X D;  5LMU I;  4DUZ I;  3PYE A;  1ZM2 A;  2BM1 A;  2VQE E;  4IFD B;  4DU7 A;  3Q6N A;  3M6A A;  3T1Y I;  4P7A A;  2PO2 B;  2LJP A;  5JEA A;  3B4T A;  4FW4 A;  1I94 E;  3F0N A;  5EKW A;  4NBQ A;  2VQF I;  2HHH I;  2O3Z A;  3B8H A;  2F1D A;  2V2V A;  2C38 B;  3WU3 A;  2VF3 A;  4LF5 I;  4EMD A;  2NN6 C;  2WW4 A;  1HNX E;  4FWG A;  1IBK E;  5A2Q C;  4FWH A;  1E3H A;  5DRO A;  1N34 I;  1XMQ I;  3J7A G;  2UUB I;  2CGE A;  5DRQ A;  4UT4 A;  1ZM3 A; 
#chains in the Genus database with same CATH homology
 4AQY E;  2Z5C A;  1XNQ I;  2E1R A;  4HY1 A;  4JI5 E;  5IT9 C;  4WUB A;  4DV6 I;  4DR6 I;  4IZJ A;  4NXM I;  4LF6 E;  4B3S E;  1XNR I;  2CG9 A;  3PYG A;  4YHH I;  4X64 I;  2A2D A;  3T1H E;  4HAC B;  2Z5B A;  2PNM A;  2OI2 A;  3K1J A;  3LTO A;  4LF7 E;  5LMN I;  1BKN A;  1HNW E;  1MG7 A;  3PYD A;  1D6T A;  4JI4 E;  4DUY E;  2ZIT A;  1B63 A;  5L3J A;  4GKJ E;  4JV5 E;  4DV1 I;  2X36 A;  2UXB I;  4LF8 I;  5IWA E;  1XMO E;  4DR1 I;  4DR4 I;  4JI7 I;  1N33 E;  4PU9 A;  1HR0 I;  3ZZ0 A;  4RPF A;  1MX0 A;  4KHP E;  3OTO I;  4FW9 A;  2VQE I;  2UUA I;  1FWK A;  4N3O A;  1NZ0 A;  1H7U A;  3QT8 A;  2BV3 A;  2XEX A;  1Z5A A;  4JI6 E;  1FWL A;  3GON A;  4X65 I;  1PVG A;  4DR5 I;  1RRE A;  4GKK I;  3B82 A;  1S4E A;  4DV4 E;  1Y6Z A;  4URL A;  3H4L A;  2J7K A;  1IBK I;  2UXD E;  3QT7 A;  2IOQ A;  2GQ0 A;  4AQY I;  1QZR A;  2UU9 E;  4DV7 I;  2HK2 A;  4I3H A;  4X66 E;  4B3R E;  4JI5 I;  2HK3 A;  2R3V A;  4B3M E;  2UXC E;  1ZM4 A;  4JI0 E;  2HFS A;  4LFB I;  2F4V E;  1Z0W A;  1Z0G A;  3JAM C;  4DV0 E;  4LF6 I;  5FWK A;  4B3S I;  2GS8 A;  2DEJ A;  4DPT A;  1NHJ A;  4FWD A;  1KTV A;  1N32 I;  4DR7 I;  5GME A;  1H72 C;  1HNZ E;  4PRX A;  4DXL A;  4USK A;  1UEK A;  1HNW I;  4LF9 E;  1ELO A;  1N36 I;  4JI4 I;  2PNL A;  1U2R A;  3J81 Q;  4GKJ I;  1NHH A;  4JV5 I;  2V8P A;  3P06 A;  2Q2E B;  3ZZU A;  2UUC E;  1Z5B A;  1XMO I;  4Z7Y A;  1FNM A;  4DU8 A;  1Z0E A;  4JI2 I;  1N33 I;  4DV2 E;  1IBL E;  5BR8 E;  2E5L E;  4JI1 E;  3WU6 A;  4NXN I;  4DPX A;  4K0K E;  1Z0C A;  4JI8 I;  2A2C A;  1MU5 A;  3J7A M;  4DR3 I;  2HKE A;  4DR2 E;  4M1K A;  5LMU E;  4USM A;  3J80 Q;  3ZM7 A;  1Y4U A;  3T1Y E;  1IBM E;  1PKP A;  1ZXN A;  3QT5 A;  3HUL A;  2VQF E;  2O1T A;  2HHH E;  2O1W A;  4OX9 E;  4LFC E;  4JI3 E;  4UTG A;  1H74 A;  1J5E E;  4LF5 E;  4LFA E;  2V2Z A;  2UXC I;  3CWV A;  4JI0 I;  2UUB E;  1WUU A;  3PYF A;  1I94 I;  4P52 A;  1XNQ E;  4HAC A;  3V5R A;  4IZJ D;  3LNU A;  4IZK B;  5LL6 R;  4Z7C A;  1Z0B A;  1DAR A;  1HNZ I;  1N0U A;  1XNR E;  4ED4 A;  2AJ4 A;  1HNX I;  4LF9 I;  4HYM A;  4JYA E;  3Q1Q A;  4ZVI A;  5IT9 Q;  2IOP A;  4DV3 E;  2UUC I;  1H7S A;  5LMN E;  1ZM9 A;  2NPF A;  3B78 A;  4DPU A;  4DV5 E;  1IBL I;  5BR8 I;  3J80 C;  4DV1 E;  1KVK A;  2UXB E;  4LF8 E;  2X7I A;  2O1U A;  4MYT A;  1FJG E;  5FLX Q;  4B3T E;  2Z5C B;  4DR4 E;  2HFU A;  4JI7 E;  3T1H I;  1Y4S A;  4LF4 E;  1OJ4 A;  4DR2 I;  3OTO E;  4IZJ B;  4LF7 I;  1H73 A;  3Q6M A;  2UUA E;  1XHK A;  1IBM I;  4R1F A;  4DUY I;  2ZBK B;  1USU A;  4X65 E;  2Z5B B;  4YY3 E;  5IWA I;  4OX9 I;  4LFC I;  4DR5 E;  4JI3 I;  4GKK E;  3PRY A;  1J5E I;  1EA6 A;  4X62 E;  1HK7 A;  2O1V A;  3V2U C;  4LFA I;  4KHP I;  1A6F A;  1K47 A;  2ZM6 E;  1N0V C;  3D4J A;  2EFG A;  1KKH A;  4DV7 E;  4JI6 I;  1ZXM A;  2R42 A;  3LPS A;  3WU5 A;  3ZZT A;  4PRV A;  4DUZ E;  4LFB E;  3K85 A;  4WUC A;  4DV4 I;  4WUD A;  2UXD I;  4KQV A;  3ZKD A;  4JYA I;  1N32 E;  4DR7 E;  1B62 A;  5FLX C;  4DV3 I;  2UU9 I;  1PIE A;  1FI4 A;  3WU4 A;  4X66 I;  4B3R I;  3JAM Q;  1EI1 A;  1N36 E;  3ZKB A;  1N34 E;  4B3M I;  4DV5 I;  1XMQ E;  2F4V I;  4DV0 I;  2CZ9 A;  1USV A;  2V2Q A;  1FKA E;  1FJG I;  3J81 C;  4B3T I;  1Z0T A;  4JI2 E;  3QT6 A;  4DV6 E;  4DR6 E;  1Z0V A;  3HJC A;  1S16 A;  4LF4 I;  5A2Q Q;  4NXM E;  2BM0 A;  3K17 A;  4NXN E;  5GMD A;  4JI8 E;  4MYU A;  4YHH E;  4FN5 A;  4X64 E;  2Z5E A;  1Z5C A;  4JG4 A;  4DR3 E;  1VIS A;  4YY3 I;  2HKJ A;  2V34 A;  1RR9 A;  4XTJ A;  4DV2 I;  4DPW A;  2E5L I;  1Z59 A;  4X62 I;  1NHI A;  4JI1 I;  2DEI A;  2ZM6 I;  1KIJ A;  4K0K I;  4DR1 E;  4DPY A;  4IZK A;  1HR0 E;  4HXZ A;  5LMU I;  4DUZ I;  3PYE A;  2BM1 A;  1ZM2 A;  2VQE E;  4DU7 A;  3Q6N A;  3M6A A;  3T1Y I;  4P7A A;  2LJP A;  1I94 E;  3F0N A;  2VQF I;  2HHH I;  3B8H A;  2V2V A;  3WU3 A;  2VF3 A;  4LF5 I;  4EMD A;  1HNX E;  2WW4 A;  4FWG A;  1IBK E;  5A2Q C;  4FWH A;  1N34 I;  1XMQ I;  3J7A G;  2UUB I;  2CGE A;  4UT4 A;  1ZM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...