4JI4I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji4I00
4DUZI 2UUAI 1XNRI 4UTGA 2UU9E 2UXDE 4HY1A 4X62E 1HR0E 4JI8I 1Z0EA 1IBME 4DV2E 1HNZI 4DV7I 4DXLA 2E5LE 2HKEA 3ZZTA 4DPXA 1Z0TA 5LL6R 4YY3E 4GKJE 2BM1A 2J7KA 1ZXNA 3V5RA 4JI6I 1A6FA 4DPYA 4DUZE 1XMQE 2UUAE 1XNRE 1ELOA 1WUUA 1IBKI 1HNZE 5BR8I 4LFCE 4LF8I 4DV7E 3ZZ0A 4B3RE 4DV0E 2CZ9A 4B3TI 4ED4A 2X36A 4JI5I 4JI7I 1MG7A 2E1RA 4HXZA 4DUYI 1UEKA 3PYFA 3T1HE 4P52A 4LFBI 4PRXA 4X64I 5A2QQ 4UT4A 1D6TA 5IT9Q 4DPWA 1ZM9A 5IWAI 4I3HA 3ZM7A 1H72C 2V2ZA 2BV3A 4DR3I 5BR8E 4LF8E 1H73A 4Z7CA 3J80Q 2HHHI 1EI1A 3QT5A 1H7UA 1MX0A 2V2QA 3D4JA 4JI1I 3QT6A 3J81Q 3QT8A 4JI3E 3OTOI 1FWKA 1KKHA 4DV4I 1H7SA 4FW9A 4DPUA 5IWAE 1EA6A 4LF4E 3ZZUA 2V34A 4FN5A 1FJGI 4DR3E 1N0UA 1N0VC 4RPFA 4JYAI 3PYEA 3WU3A 1HNXI 2HFSA 1ZXMA 1HNWI 2Q2EB 1Z5BA 3B82A 4JI1E 3JAMQ 3T1YI 1I94E 4DV1I 4NXNI 3OTOE 4DPTA 4LFAI 5A2QC 4B3SI 4DV4E 3GONA 2V8PA 3J7AM 5FLXC 4Z7YA 4X66I 2VQFI 2ZITA 1FJGE 2ZM6I 5GMDA 1B63A 1RREA 3J80C 1N33E 4JG4A 1Z0VA 2LJPA 3F0NA 4YHHI 1K47A 3J81C 3ZKDA 1HNXE 1FI4A 2VQEE 4DU7A 3PYGA 3B8HA 4NXNE 4LFAE 4JI8E 3B78A 4EMDA 3PYDA 4HACB 3ZKBA 2VQFE 4PRVA 4MYTA 2HK2A 4JI2I 1KVKA 2DEIA 1J5EI 4YHHE 4X65I 1IBLI 3JAMC 4DR4I 3K1JA 4LF7I 4DV3I 4JI6E 4AQYI 4DR2I 2HKJA 2BM0A 4R1FA 1XMOI 1IBKE 1XNQI 2UUCI 4GKKI 1PVGA 4OX9I 5LMNI 4DV6I 4NXMI 4WUBA 2HK3A 4B3TE 4JV5I 4JI2E 4HYMA 4JI7E 4JI5E 4PU9A 4DR6I 1J5EE 4X65E 4DUYE 4USMA 1IBLE 4LFBE 4MYUA 1RR9A 4DV3E 1NZ0A 4X64E 3CWVA 4DR2E 1Z0GA 4WUDA 1XMOE 2WW4A 2UXDI 4DV5I 1XNQE 1N36I 4X62I 4FWDA 4LF6I 1HR0I 4USKA 4DV2I 2HHHE 4LF5I 1XHKA 1Z5CA 4KHPI 3K17A 4K0KI 1Z0WA 1N32I 4FWHA 1FKAE 1OJ4A 2NPFA 5IT9C 2F4VI 1B62A 4XTJA 3WU5A 2X7IA 5LMUI 2OI2A 1MU5A 1U2RA 3J7AG 1S4EA 1PKPA 4DR7I 4JI0I 4GKJI 2EFGA 1PIEA 3V2UC 3Q1QA 4URLA 4JYAE 1XMQI 2A2CA 4DV5E 1N36E 4FWGA 1NHIA 4LF6E 1NHJA 4LF5E 4LFCI 4ZVIA 1ZM3A 1HNWE 1N34I 4KHPE 4B3RI 4DV0I 4K0KE 5L3JA 3T1YE 1ZM4A 1NHHA 4DV1E 1N32E 4B3SE 2F4VE 4DR1I 3QT7A 5LMUE 4X66E 1Z0BA 1ZM2A 2XEXA 3T1HI 4DR7E 4JI0E 2ZM6E 3M6AA 1BKNA 4M1KA 4KQVA 4DR5I 1N34E 2R42A 2UXCI 3H4LA 2UUBI 3HULA 4DR1E 2HFUA 2V2VA 4JI3I 5GMEA 1VISA 1DARA 2VF3A 4JI4I 2GS8A 4LF9I 4LF4I 2R3VA 5FLXQ 1KIJA 3WU4A 4DR5E 4DR4E 2A2DA 4B3MI 3LNUA 4LF7E 2ZBKB 2UXBI 1FWLA 2UXCE 4AQYE 4HACA 3WU6A 2UUBE 1I94I 2UU9I 1H74A 2UUCE 4GKKE 1Z59A 1QZRA 1IBMI 4OX9E 5LMNE 4JI4E 4DV6E 4NXME 4DU8A 4JV5E 1Z0CA 2E5LI 1FNMA 4LF9E 2DEJA 4DR6E 3LTOA 1N33I 3LPSA 4B3ME 4WUCA 2AJ4A 4YY3I 2UXBE 4P7AA 1S16A 2VQEI 1KTVA 1Z5AA
chains in the Genus database with same CATH superfamily
4DUZI 2UUAI 1XNRI 4UTGA 3B4TA 1Y60A 2UU9E 2UXDE 4HY1A 4X62E 1HK7A 2J65A 1HR0E 3M85G 3P3CA 4JI8I 1Z0EA 1IBME 2NN6E 4DV2E 1HNZI 4DV7I 2NN6F 4DXLA 2E5LE 3HKMA 4IZKB 2GQ0A 2HKEA 4BA2A 4BA1A 4IS9A 5DNLA 3ZZTA 4OO1F 4DPXA 1Z0TA 5LL6R 3UHMA 2C37A 4YY3E 5JEAB 5DRRA 3H1CA 3Q6MA 4GKJE 2BM1A 2J7KA 1ZXNA 3V5RA 4JI6I 1A6FA 4DPYA 4DUZE 1XMQE 2UUAE 1XNRE 4MU3A 5C0XD 2Z5BA 1ELOA 1XXEA 1WUUA 1IBKI 1HNZE 5BR8I 2BR2A 4FW3A 4LFCE 4LF8I 4DV7E 3ZZ0A 4B3RE 4DV0E 2CZ9A 2Z5CA 4B3TI 4ED4A 4IFDA 2NN6B 2X36A 4JI5I 4JI7I 1MG7A 2E1RA 4HXZA 5EL9A 5K36D 4DUYI 1UEKA 4IZJB 3PYFA 3T1HE 2AE8A 4P52A 4OO1B 4LFBI 4AM3A 4PRXA 4X64I 5A2QQ 4UT4A 1D6TA 5IT9Q 4DPWA 1ZM9A 5IWAI 4I3HA 3ZM7A 3M7NG 1H72C 2V2ZA 2BV3A 2GO4A 4DR3I 3U1YA 5BR8E 5DNXA 4LF8E 1OYSA 1H73A 4Z7CA 3J80Q 2HHHI 1EI1A 3QT5A 1H7UA 1MX0A 5C0XC 2V2QA 5JEAA 3D4JA 4JI1I 3QT6A 3J81Q 2NN6D 3QT8A 4JI3E 3GCMA 5DROA 3OTOI 1FWKA 1KKHA 4DV4I 4FW6A 3K85A 1H7SA 1Y6ZA 2PNZA 2WNRA 4FW9A 4OO1D 4DPUA 5IWAE 1EA6A 4LF4E 3ZZUA 2V34A 4FN5A 1FJGI 2BA0D 5K36C 4DR3E 1N0UA 1N0VC 4RPFA 4JYAI 1Y4UA 3PYEA 2PNLA 3PS3A 2F1DA 3WU3A 4MU1A 3L7ZA 2O1UA 1HNXI 3HJCA 2HFSA 2WP8B 1ZXMA 1HNWI 4IZJA 2VESA 2Q2EB 1Z5BA 3B82A 4JI1E 3JAMQ 5C0XB 3T1YI 1I94E 4DV1I 4NXNI 3OTOE 4DPTA 4LFAI 2JEBB 5A2QC 2JT2A 4B3SI 4DV4E 3GONA 2V8PA 3J7AM 5FLXC 4Z7YA 4X66I 4LPFA 2VQFI 2BA1G 1UDSA 2C38B 2ZITA 2NN6C 3M85D 4MU4A 1FJGE 2ZM6I 5GMDA 1B63A 1RREA 3J80C 4NBQA 1N33E 4JG4A 3P76A 1Z0VA 2PO0B 5K36B 2CVEA 2LJPA 3F0NA 1YH8A 4YHHI 4OO1C 2O1TA 2O1VA 1K47A 3J81C 3ZKDA 1HNXE 1FI4A 2VQEE 4DU7A 3PS1A 3PYGA 3B8HA 4NXNE 4LFAE 4JI8E 3B78A 4EMDA 3PYDA 4HACB 3ZKBA 2VQFE 4PRVA 4N3OA 1P42A 4MYTA 4QNKA 2HK2A 4JI2I 2PO2A 1KVKA 2DEIA 1J5EI 4YHHE 3P3GA 4X65I 5C0XA 1VI7A 1IBLI 3JAMC 4DR4I 3K1JA 4LF7I 2JEBA 4DV3I 4JI6E 4AQYI 4DR2I 2HKJA 2BM0A 4MDTA 3Q6NA 4IZKA 2IERA 1UDOA 2C38A 2JE6B 4R1FA 1XMOI 1IBKE 1Y4SA 1XNQI 2UUCI 2PO1B 4GKKI 1UDNA 2C39B 1PVGA 4OX9I 5LMNI 3M7ND 4DV6I 5K36A 5ELWA 4NXMI 4WUBA 2HK3A 4FW4A 4B3TE 4JV5I 4JI2E 4HYMA 4IFDE 4JI7E 2CG9A 5DRQA 4JI5E 4PU9A 4IFDF 4DR6I 1J5EE 4X65E 3P06A 4DUYE 4USMA 1UDQA 1IBLE 4LFBE 4MYUA 4BA2B 1RR9A 4DV3E 1NZ0A 4X64E 3CWVA 1USVA 4DR2E 1USUA 3GMEA 1Z0GA 4U3BA 4WUDA 1XMOE 2WW4A 1RHYA 4DV5I 1XNQE 2UXDI 1N36I 4X62I 3NZKA 4FWDA 4LF6I 4FW5A 2NN6A 1HR0I 4USKA 2BA0G 4DV2I 2HHHE 4LF5I 4J3DA 1XHKA 1Z5CA 4KHPI 2Z5BB 3K17A 4K0KI 5JEAE 4OZEA 4OO1A 1Z0WA 2BR2B 5JEAF 1N32I 4FWHA 2PNMA 1FKAE 1OJ4A 2NPFA 2GO3A 5IT9C 2F4VI 2Z5CB 1B62A 4XTJA 3WU5A 2X7IA 5LMUI 4IFDB 2OI2A 1MU5A 1U2RA 3J7AG 2JE6A 1S4EA 1PKPA 4LCHA 1R6LA 4DR7I 4JI0I 4GKJI 2PO1A 1E3HA 2EFGA 1PIEA 3V2UC 3Q1QA 4URLA 3CDJA 4JYAE 1XMQI 2A2CA 4GQUA 4DV5E 2JEAB 1R6MA 1N36E 2BA1D 4FWGA 1NHIA 4LF6E 1NHJA 4LF5E 4LFCI 4ZVIA 2Z5EA 1ZM3A 1HNWE 1N34I 4KHPE 4B3RI 4DV0I 4K0KE 4ISAA 5L3JA 3T1YE 4LCFA 4MU0A 1ZM4A 1NHHA 4OO1E 4MQYA 4DV1E 1N32E 3U1KA 4B3SE 2F4VE 4DR1I 1Y5YA 3QT7A 4QNJA 4X66E 5LMUE 1Z0BA 1ZM2A 2XEXA 4IFDD 3T1HI 4DR7E 5EKWA 4JI0E 5FWKA 2O3ZA 2ZM6E 3M6AA 2WP8A 1BKNA 4M1KA 2PNZB 2WNRB 4KQVA 1OYRA 4DR5I 4AIDA 2IESA 5DRPA 1N34E 3CDIA 2R42A 2UXCI 4LOMA 3H4LA 2UUBI 3HULA 3L7ZB 4DR1E 2HFUA 2V2VA 4JI3I 5GMEA 1VISA 1DARA 2VF3A 2PO0A 4JI4I 2JEAA 5JEAD 4U3DA 2GS8A 4LF9I 2IOPA 4LF4I 2R3VA 5FLXQ 3PRYA 1KIJA 3KRNA 3WU4A 4DR5E 4IFDC 4DR4E 2A2DA 4B3MI 3LNUA 5C0XE 4LF7E 4LCGA 2ZBKB 5C0XF 2UXBI 4BA1B 1FWLA 2UXCE 4AQYE 2O1WA 4HACA 2C37B 3WU6A 3DD6A 2UUBE 1I94I 2UU9I 1H74A 4FW7A 2UUCE 1E3PA 4GKKE 1Z59A 1QZRA 1OYPA 1IBMI 4OX9E 5LMNE 3GLLA 4JI4E 4DV6E 4NXME 4IZJD 4DU8A 4JV5E 5K36E 1Z0CA 2E5LI 1FNMA 4LF9E 5K36F 2DEJA 4AIMA 4DR6E 3LTOA 3P3EA 1N33I 3LPSA 5JEAC 4B3ME 4WUCA 2AJ4A 4YY3I 2PO2B 2UXBE 4P7AA 1YHCA 2IOQA 1S16A 2CGEA 3PS2A 4OKGA 2VQEI 1KTVA 2C39A 1Z5AA
chains in the Genus database with same CATH topology
4DUZI 2UUAI 1XNRI 4UTGA 2UU9E 2UXDE 4HY1A 4X62E 1HK7A 1HR0E 4JI8I 1Z0EA 1IBME 4DV2E 1HNZI 4DV7I 4DXLA 2E5LE 4IZKB 2GQ0A 2HKEA 3ZZTA 4DPXA 1Z0TA 5LL6R 4YY3E 3Q6MA 4GKJE 2BM1A 2J7KA 1ZXNA 3V5RA 4JI6I 1A6FA 4DPYA 4DUZE 1XMQE 2UUAE 1XNRE 2Z5BA 1ELOA 1WUUA 1IBKI 1HNZE 5BR8I 4LFCE 4LF8I 4DV7E 3ZZ0A 4B3RE 4DV0E 2CZ9A 2Z5CA 4B3TI 4ED4A 2X36A 4JI5I 4JI7I 1MG7A 2E1RA 4HXZA 4DUYI 1UEKA 4IZJB 3PYFA 3T1HE 4P52A 4LFBI 4PRXA 4X64I 5A2QQ 4UT4A 1D6TA 5IT9Q 4DPWA 1ZM9A 5IWAI 4I3HA 3ZM7A 1H72C 2V2ZA 2BV3A 4DR3I 5BR8E 4LF8E 1H73A 4Z7CA 3J80Q 2HHHI 1EI1A 3QT5A 1H7UA 1MX0A 2V2QA 3D4JA 4JI1I 3QT6A 3J81Q 3QT8A 4JI3E 3OTOI 1FWKA 1KKHA 4DV4I 3K85A 1H7SA 1Y6ZA 4FW9A 4DPUA 5IWAE 1EA6A 4LF4E 3ZZUA 2V34A 4FN5A 1FJGI 4DR3E 1N0UA 1N0VC 4RPFA 4JYAI 1Y4UA 3PYEA 2PNLA 3WU3A 2O1UA 1HNXI 3HJCA 2HFSA 1ZXMA 1HNWI 4IZJA 2Q2EB 1Z5BA 3B82A 4JI1E 3JAMQ 3T1YI 1I94E 4DV1I 4NXNI 3OTOE 4DPTA 4LFAI 5A2QC 4B3SI 4DV4E 3GONA 2V8PA 3J7AM 5FLXC 4Z7YA 4X66I 2VQFI 2ZITA 1FJGE 2ZM6I 5GMDA 1B63A 1RREA 3J80C 1N33E 4JG4A 1Z0VA 2LJPA 3F0NA 4YHHI 2O1TA 2O1VA 1K47A 3J81C 3ZKDA 1HNXE 1FI4A 2VQEE 4DU7A 3PYGA 3B8HA 4NXNE 4LFAE 4JI8E 3B78A 4EMDA 3PYDA 4HACB 3ZKBA 2VQFE 4PRVA 4N3OA 4MYTA 2HK2A 4JI2I 1KVKA 2DEIA 1J5EI 4YHHE 4X65I 1IBLI 3JAMC 4DR4I 3K1JA 4LF7I 4DV3I 4JI6E 4AQYI 4DR2I 2HKJA 2BM0A 3Q6NA 4IZKA 4R1FA 1XMOI 1IBKE 1Y4SA 1XNQI 2UUCI 4GKKI 1PVGA 4OX9I 5LMNI 4DV6I 4NXMI 4WUBA 2HK3A 4B3TE 4JV5I 4JI2E 4HYMA 4JI7E 2CG9A 4JI5E 4PU9A 4DR6I 1J5EE 4X65E 3P06A 4DUYE 4USMA 1IBLE 4LFBE 4MYUA 1RR9A 4DV3E 1NZ0A 4X64E 3CWVA 1USVA 4DR2E 1USUA 1Z0GA 4WUDA 1XMOE 2WW4A 2UXDI 4DV5I 1XNQE 1N36I 4X62I 4FWDA 4LF6I 1HR0I 4USKA 4DV2I 2HHHE 4LF5I 1XHKA 1Z5CA 4KHPI 2Z5BB 3K17A 4K0KI 1Z0WA 1N32I 4FWHA 2PNMA 1FKAE 1OJ4A 2NPFA 5IT9C 2F4VI 2Z5CB 1B62A 4XTJA 3WU5A 2X7IA 5LMUI 2OI2A 1MU5A 1U2RA 3J7AG 1S4EA 1PKPA 4DR7I 4JI0I 4GKJI 2EFGA 1PIEA 3V2UC 3Q1QA 4URLA 4JYAE 1XMQI 2A2CA 4DV5E 1N36E 4FWGA 1NHIA 4LF6E 1NHJA 4LF5E 4LFCI 4ZVIA 2Z5EA 1ZM3A 1HNWE 1N34I 4KHPE 4B3RI 4DV0I 4K0KE 5L3JA 3T1YE 1ZM4A 1NHHA 4DV1E 1N32E 4B3SE 2F4VE 4DR1I 3QT7A 5LMUE 4X66E 1Z0BA 1ZM2A 2XEXA 3T1HI 4DR7E 4JI0E 5FWKA 2ZM6E 3M6AA 1BKNA 4M1KA 4KQVA 4DR5I 1N34E 2R42A 2UXCI 3H4LA 2UUBI 3HULA 4DR1E 2HFUA 2V2VA 4JI3I 5GMEA 1VISA 1DARA 2VF3A 4JI4I 2GS8A 4LF9I 2IOPA 4LF4I 2R3VA 5FLXQ 3PRYA 1KIJA 3WU4A 4DR5E 4DR4E 2A2DA 4B3MI 3LNUA 4LF7E 2ZBKB 2UXBI 1FWLA 2UXCE 4AQYE 2O1WA 4HACA 3WU6A 2UUBE 1I94I 2UU9I 1H74A 2UUCE 4GKKE 1Z59A 1QZRA 1IBMI 4OX9E 5LMNE 4JI4E 4DV6E 4NXME 4IZJD 4DU8A 4JV5E 1Z0CA 2E5LI 1FNMA 4LF9E 2DEJA 4DR6E 3LTOA 1N33I 3LPSA 4B3ME 4WUCA 2AJ4A 4YY3I 2UXBE 4P7AA 2IOQA 1S16A 2CGEA 2VQEI 1KTVA 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ I;  2UUA I;  1XNR I;  4UTG A;  2UU9 E;  2UXD E;  4HY1 A;  4X62 E;  1HR0 E;  4JI8 I;  1Z0E A;  1IBM E;  4DV2 E;  1HNZ I;  4DV7 I;  4DXL A;  2E5L E;  2HKE A;  3ZZT A;  4DPX A;  1Z0T A;  5LL6 R;  4YY3 E;  4GKJ E;  2BM1 A;  2J7K A;  1ZXN A;  3V5R A;  4JI6 I;  1A6F A;  4DPY A;  4DUZ E;  1XMQ E;  2UUA E;  1XNR E;  1ELO A;  1WUU A;  1IBK I;  1HNZ E;  5BR8 I;  4LFC E;  4LF8 I;  4DV7 E;  3ZZ0 A;  4B3R E;  4DV0 E;  2CZ9 A;  4B3T I;  4ED4 A;  2X36 A;  4JI5 I;  4JI7 I;  1MG7 A;  2E1R A;  4HXZ A;  4DUY I;  1UEK A;  3PYF A;  3T1H E;  4P52 A;  4LFB I;  4PRX A;  4X64 I;  5A2Q Q;  4UT4 A;  1D6T A;  5IT9 Q;  4DPW A;  1ZM9 A;  5IWA I;  4I3H A;  3ZM7 A;  1H72 C;  2V2Z A;  2BV3 A;  4DR3 I;  5BR8 E;  4LF8 E;  1H73 A;  4Z7C A;  3J80 Q;  2HHH I;  1EI1 A;  3QT5 A;  1H7U A;  1MX0 A;  2V2Q A;  3D4J A;  4JI1 I;  3QT6 A;  3J81 Q;  3QT8 A;  4JI3 E;  3OTO I;  1FWK A;  1KKH A;  4DV4 I;  1H7S A;  4FW9 A;  4DPU A;  5IWA E;  1EA6 A;  4LF4 E;  3ZZU A;  2V34 A;  4FN5 A;  1FJG I;  4DR3 E;  1N0U A;  1N0V C;  4RPF A;  4JYA I;  3PYE A;  3WU3 A;  1HNX I;  2HFS A;  1ZXM A;  1HNW I;  2Q2E B;  1Z5B A;  3B82 A;  4JI1 E;  3JAM Q;  3T1Y I;  1I94 E;  4DV1 I;  4NXN I;  3OTO E;  4DPT A;  4LFA I;  5A2Q C;  4B3S I;  4DV4 E;  3GON A;  2V8P A;  3J7A M;  5FLX C;  4Z7Y A;  4X66 I;  2VQF I;  2ZIT A;  1FJG E;  2ZM6 I;  5GMD A;  1B63 A;  1RRE A;  3J80 C;  1N33 E;  4JG4 A;  1Z0V A;  2LJP A;  3F0N A;  4YHH I;  1K47 A;  3J81 C;  3ZKD A;  1HNX E;  1FI4 A;  2VQE E;  4DU7 A;  3PYG A;  3B8H A;  4NXN E;  4LFA E;  4JI8 E;  3B78 A;  4EMD A;  3PYD A;  4HAC B;  3ZKB A;  2VQF E;  4PRV A;  4MYT A;  2HK2 A;  4JI2 I;  1KVK A;  2DEI A;  1J5E I;  4YHH E;  4X65 I;  1IBL I;  3JAM C;  4DR4 I;  3K1J A;  4LF7 I;  4DV3 I;  4JI6 E;  4AQY I;  4DR2 I;  2HKJ A;  2BM0 A;  4R1F A;  1XMO I;  1IBK E;  1XNQ I;  2UUC I;  4GKK I;  1PVG A;  4OX9 I;  5LMN I;  4DV6 I;  4NXM I;  4WUB A;  2HK3 A;  4B3T E;  4JV5 I;  4JI2 E;  4HYM A;  4JI7 E;  4JI5 E;  4PU9 A;  4DR6 I;  1J5E E;  4X65 E;  4DUY E;  4USM A;  1IBL E;  4LFB E;  4MYU A;  1RR9 A;  4DV3 E;  1NZ0 A;  4X64 E;  3CWV A;  4DR2 E;  1Z0G A;  4WUD A;  1XMO E;  2WW4 A;  2UXD I;  4DV5 I;  1XNQ E;  1N36 I;  4X62 I;  4FWD A;  4LF6 I;  1HR0 I;  4USK A;  4DV2 I;  2HHH E;  4LF5 I;  1XHK A;  1Z5C A;  4KHP I;  3K17 A;  4K0K I;  1Z0W A;  1N32 I;  4FWH A;  1FKA E;  1OJ4 A;  2NPF A;  5IT9 C;  2F4V I;  1B62 A;  4XTJ A;  3WU5 A;  2X7I A;  5LMU I;  2OI2 A;  1MU5 A;  1U2R A;  3J7A G;  1S4E A;  1PKP A;  4DR7 I;  4JI0 I;  4GKJ I;  2EFG A;  1PIE A;  3V2U C;  3Q1Q A;  4URL A;  4JYA E;  1XMQ I;  2A2C A;  4DV5 E;  1N36 E;  4FWG A;  1NHI A;  4LF6 E;  1NHJ A;  4LF5 E;  4LFC I;  4ZVI A;  1ZM3 A;  1HNW E;  1N34 I;  4KHP E;  4B3R I;  4DV0 I;  4K0K E;  5L3J A;  3T1Y E;  1ZM4 A;  1NHH A;  4DV1 E;  1N32 E;  4B3S E;  2F4V E;  4DR1 I;  3QT7 A;  5LMU E;  4X66 E;  1Z0B A;  1ZM2 A;  2XEX A;  3T1H I;  4DR7 E;  4JI0 E;  2ZM6 E;  3M6A A;  1BKN A;  4M1K A;  4KQV A;  4DR5 I;  1N34 E;  2R42 A;  2UXC I;  3H4L A;  2UUB I;  3HUL A;  4DR1 E;  2HFU A;  2V2V A;  4JI3 I;  5GME A;  1VIS A;  1DAR A;  2VF3 A;  4JI4 I;  2GS8 A;  4LF9 I;  4LF4 I;  2R3V A;  5FLX Q;  1KIJ A;  3WU4 A;  4DR5 E;  4DR4 E;  2A2D A;  4B3M I;  3LNU A;  4LF7 E;  2ZBK B;  2UXB I;  1FWL A;  2UXC E;  4AQY E;  4HAC A;  3WU6 A;  2UUB E;  1I94 I;  2UU9 I;  1H74 A;  2UUC E;  4GKK E;  1Z59 A;  1QZR A;  1IBM I;  4OX9 E;  5LMN E;  4JI4 E;  4DV6 E;  4NXM E;  4DU8 A;  4JV5 E;  1Z0C A;  2E5L I;  1FNM A;  4LF9 E;  2DEJ A;  4DR6 E;  3LTO A;  1N33 I;  3LPS A;  4B3M E;  4WUC A;  2AJ4 A;  4YY3 I;  2UXB E;  4P7A A;  1S16 A;  2VQE I;  1KTV A;  1Z5A A; 
#chains in the Genus database with same CATH topology
 4DUZ I;  2UUA I;  1XNR I;  4UTG A;  3B4T A;  1Y60 A;  2UU9 E;  2UXD E;  4HY1 A;  4X62 E;  1HK7 A;  2J65 A;  1HR0 E;  3M85 G;  3P3C A;  4JI8 I;  1Z0E A;  1IBM E;  2NN6 E;  4DV2 E;  1HNZ I;  4DV7 I;  2NN6 F;  4DXL A;  2E5L E;  3HKM A;  4IZK B;  2GQ0 A;  2HKE A;  4BA2 A;  4BA1 A;  4IS9 A;  5DNL A;  3ZZT A;  4OO1 F;  4DPX A;  1Z0T A;  5LL6 R;  3UHM A;  2C37 A;  4YY3 E;  5JEA B;  5DRR A;  3H1C A;  3Q6M A;  4GKJ E;  2BM1 A;  2J7K A;  1ZXN A;  3V5R A;  4JI6 I;  1A6F A;  4DPY A;  4DUZ E;  1XMQ E;  2UUA E;  1XNR E;  4MU3 A;  5C0X D;  2Z5B A;  1ELO A;  1XXE A;  1WUU A;  1IBK I;  1HNZ E;  5BR8 I;  2BR2 A;  4FW3 A;  4LFC E;  4LF8 I;  4DV7 E;  3ZZ0 A;  4B3R E;  4DV0 E;  2CZ9 A;  2Z5C A;  4B3T I;  4ED4 A;  4IFD A;  2NN6 B;  2X36 A;  4JI5 I;  4JI7 I;  1MG7 A;  2E1R A;  4HXZ A;  5EL9 A;  5K36 D;  4DUY I;  1UEK A;  4IZJ B;  3PYF A;  3T1H E;  2AE8 A;  4P52 A;  4OO1 B;  4LFB I;  4AM3 A;  4PRX A;  4X64 I;  5A2Q Q;  4UT4 A;  1D6T A;  5IT9 Q;  4DPW A;  1ZM9 A;  5IWA I;  4I3H A;  3ZM7 A;  3M7N G;  1H72 C;  2V2Z A;  2BV3 A;  2GO4 A;  4DR3 I;  3U1Y A;  5BR8 E;  5DNX A;  4LF8 E;  1OYS A;  1H73 A;  4Z7C A;  3J80 Q;  2HHH I;  1EI1 A;  3QT5 A;  1H7U A;  1MX0 A;  5C0X C;  2V2Q A;  5JEA A;  3D4J A;  4JI1 I;  3QT6 A;  3J81 Q;  2NN6 D;  3QT8 A;  4JI3 E;  3GCM A;  5DRO A;  3OTO I;  1FWK A;  1KKH A;  4DV4 I;  4FW6 A;  3K85 A;  1H7S A;  1Y6Z A;  2PNZ A;  2WNR A;  4FW9 A;  4OO1 D;  4DPU A;  5IWA E;  1EA6 A;  4LF4 E;  3ZZU A;  2V34 A;  4FN5 A;  1FJG I;  2BA0 D;  5K36 C;  4DR3 E;  1N0U A;  1N0V C;  4RPF A;  4JYA I;  1Y4U A;  3PYE A;  2PNL A;  3PS3 A;  2F1D A;  3WU3 A;  4MU1 A;  3L7Z A;  2O1U A;  1HNX I;  3HJC A;  2HFS A;  2WP8 B;  1ZXM A;  1HNW I;  4IZJ A;  2VES A;  2Q2E B;  1Z5B A;  3B82 A;  4JI1 E;  3JAM Q;  5C0X B;  3T1Y I;  1I94 E;  4DV1 I;  4NXN I;  3OTO E;  4DPT A;  4LFA I;  2JEB B;  5A2Q C;  2JT2 A;  4B3S I;  4DV4 E;  3GON A;  2V8P A;  3J7A M;  5FLX C;  4Z7Y A;  4X66 I;  4LPF A;  2VQF I;  2BA1 G;  1UDS A;  2C38 B;  2ZIT A;  2NN6 C;  3M85 D;  4MU4 A;  1FJG E;  2ZM6 I;  5GMD A;  1B63 A;  1RRE A;  3J80 C;  4NBQ A;  1N33 E;  4JG4 A;  3P76 A;  1Z0V A;  2PO0 B;  5K36 B;  2CVE A;  2LJP A;  3F0N A;  1YH8 A;  4YHH I;  4OO1 C;  2O1T A;  2O1V A;  1K47 A;  3J81 C;  3ZKD A;  1HNX E;  1FI4 A;  2VQE E;  4DU7 A;  3PS1 A;  3PYG A;  3B8H A;  4NXN E;  4LFA E;  4JI8 E;  3B78 A;  4EMD A;  3PYD A;  4HAC B;  3ZKB A;  2VQF E;  4PRV A;  4N3O A;  1P42 A;  4MYT A;  4QNK A;  2HK2 A;  4JI2 I;  2PO2 A;  1KVK A;  2DEI A;  1J5E I;  4YHH E;  3P3G A;  4X65 I;  5C0X A;  1VI7 A;  1IBL I;  3JAM C;  4DR4 I;  3K1J A;  4LF7 I;  2JEB A;  4DV3 I;  4JI6 E;  4AQY I;  4DR2 I;  2HKJ A;  2BM0 A;  4MDT A;  3Q6N A;  4IZK A;  2IER A;  1UDO A;  2C38 A;  2JE6 B;  4R1F A;  1XMO I;  1IBK E;  1Y4S A;  1XNQ I;  2UUC I;  2PO1 B;  4GKK I;  1UDN A;  2C39 B;  1PVG A;  4OX9 I;  5LMN I;  3M7N D;  4DV6 I;  5K36 A;  5ELW A;  4NXM I;  4WUB A;  2HK3 A;  4FW4 A;  4B3T E;  4JV5 I;  4JI2 E;  4HYM A;  4IFD E;  4JI7 E;  2CG9 A;  5DRQ A;  4JI5 E;  4PU9 A;  4IFD F;  4DR6 I;  1J5E E;  4X65 E;  3P06 A;  4DUY E;  4USM A;  1UDQ A;  1IBL E;  4LFB E;  4MYU A;  4BA2 B;  1RR9 A;  4DV3 E;  1NZ0 A;  4X64 E;  3CWV A;  1USV A;  4DR2 E;  1USU A;  3GME A;  1Z0G A;  4U3B A;  4WUD A;  1XMO E;  2WW4 A;  1RHY A;  4DV5 I;  1XNQ E;  2UXD I;  1N36 I;  4X62 I;  3NZK A;  4FWD A;  4LF6 I;  4FW5 A;  2NN6 A;  1HR0 I;  4USK A;  2BA0 G;  4DV2 I;  2HHH E;  4LF5 I;  4J3D A;  1XHK A;  1Z5C A;  4KHP I;  2Z5B B;  3K17 A;  4K0K I;  5JEA E;  4OZE A;  4OO1 A;  1Z0W A;  2BR2 B;  5JEA F;  1N32 I;  4FWH A;  2PNM A;  1FKA E;  1OJ4 A;  2NPF A;  2GO3 A;  5IT9 C;  2F4V I;  2Z5C B;  1B62 A;  4XTJ A;  3WU5 A;  2X7I A;  5LMU I;  4IFD B;  2OI2 A;  1MU5 A;  1U2R A;  3J7A G;  2JE6 A;  1S4E A;  1PKP A;  4LCH A;  1R6L A;  4DR7 I;  4JI0 I;  4GKJ I;  2PO1 A;  1E3H A;  2EFG A;  1PIE A;  3V2U C;  3Q1Q A;  4URL A;  3CDJ A;  4JYA E;  1XMQ I;  2A2C A;  4GQU A;  4DV5 E;  2JEA B;  1R6M A;  1N36 E;  2BA1 D;  4FWG A;  1NHI A;  4LF6 E;  1NHJ A;  4LF5 E;  4LFC I;  4ZVI A;  2Z5E A;  1ZM3 A;  1HNW E;  1N34 I;  4KHP E;  4B3R I;  4DV0 I;  4K0K E;  4ISA A;  5L3J A;  3T1Y E;  4LCF A;  4MU0 A;  1ZM4 A;  1NHH A;  4OO1 E;  4MQY A;  4DV1 E;  1N32 E;  3U1K A;  4B3S E;  2F4V E;  4DR1 I;  1Y5Y A;  3QT7 A;  4QNJ A;  4X66 E;  5LMU E;  1Z0B A;  1ZM2 A;  2XEX A;  4IFD D;  3T1H I;  4DR7 E;  5EKW A;  4JI0 E;  5FWK A;  2O3Z A;  2ZM6 E;  3M6A A;  2WP8 A;  1BKN A;  4M1K A;  2PNZ B;  2WNR B;  4KQV A;  1OYR A;  4DR5 I;  4AID A;  2IES A;  5DRP A;  1N34 E;  3CDI A;  2R42 A;  2UXC I;  4LOM A;  3H4L A;  2UUB I;  3HUL A;  3L7Z B;  4DR1 E;  2HFU A;  2V2V A;  4JI3 I;  5GME A;  1VIS A;  1DAR A;  2VF3 A;  2PO0 A;  4JI4 I;  2JEA A;  5JEA D;  4U3D A;  2GS8 A;  4LF9 I;  2IOP A;  4LF4 I;  2R3V A;  5FLX Q;  3PRY A;  1KIJ A;  3KRN A;  3WU4 A;  4DR5 E;  4IFD C;  4DR4 E;  2A2D A;  4B3M I;  3LNU A;  5C0X E;  4LF7 E;  4LCG A;  2ZBK B;  5C0X F;  2UXB I;  4BA1 B;  1FWL A;  2UXC E;  4AQY E;  2O1W A;  4HAC A;  2C37 B;  3WU6 A;  3DD6 A;  2UUB E;  1I94 I;  2UU9 I;  1H74 A;  4FW7 A;  2UUC E;  1E3P A;  4GKK E;  1Z59 A;  1QZR A;  1OYP A;  1IBM I;  4OX9 E;  5LMN E;  3GLL A;  4JI4 E;  4DV6 E;  4NXM E;  4IZJ D;  4DU8 A;  4JV5 E;  5K36 E;  1Z0C A;  2E5L I;  1FNM A;  4LF9 E;  5K36 F;  2DEJ A;  4AIM A;  4DR6 E;  3LTO A;  3P3E A;  1N33 I;  3LPS A;  5JEA C;  4B3M E;  4WUC A;  2AJ4 A;  4YY3 I;  2PO2 B;  2UXB E;  4P7A A;  1YHC A;  2IOQ A;  1S16 A;  2CGE A;  3PS2 A;  4OKG A;  2VQE I;  1KTV A;  2C39 A;  1Z5A A; 
#chains in the Genus database with same CATH homology
 4DUZ I;  2UUA I;  1XNR I;  4UTG A;  2UU9 E;  2UXD E;  4HY1 A;  4X62 E;  1HK7 A;  1HR0 E;  4JI8 I;  1Z0E A;  1IBM E;  4DV2 E;  1HNZ I;  4DV7 I;  4DXL A;  2E5L E;  4IZK B;  2GQ0 A;  2HKE A;  3ZZT A;  4DPX A;  1Z0T A;  5LL6 R;  4YY3 E;  3Q6M A;  4GKJ E;  2BM1 A;  2J7K A;  1ZXN A;  3V5R A;  4JI6 I;  1A6F A;  4DPY A;  4DUZ E;  1XMQ E;  2UUA E;  1XNR E;  2Z5B A;  1ELO A;  1WUU A;  1IBK I;  1HNZ E;  5BR8 I;  4LFC E;  4LF8 I;  4DV7 E;  3ZZ0 A;  4B3R E;  4DV0 E;  2CZ9 A;  2Z5C A;  4B3T I;  4ED4 A;  2X36 A;  4JI5 I;  4JI7 I;  1MG7 A;  2E1R A;  4HXZ A;  4DUY I;  1UEK A;  4IZJ B;  3PYF A;  3T1H E;  4P52 A;  4LFB I;  4PRX A;  4X64 I;  5A2Q Q;  4UT4 A;  1D6T A;  5IT9 Q;  4DPW A;  1ZM9 A;  5IWA I;  4I3H A;  3ZM7 A;  1H72 C;  2V2Z A;  2BV3 A;  4DR3 I;  5BR8 E;  4LF8 E;  1H73 A;  4Z7C A;  3J80 Q;  2HHH I;  1EI1 A;  3QT5 A;  1H7U A;  1MX0 A;  2V2Q A;  3D4J A;  4JI1 I;  3QT6 A;  3J81 Q;  3QT8 A;  4JI3 E;  3OTO I;  1FWK A;  1KKH A;  4DV4 I;  3K85 A;  1H7S A;  1Y6Z A;  4FW9 A;  4DPU A;  5IWA E;  1EA6 A;  4LF4 E;  3ZZU A;  2V34 A;  4FN5 A;  1FJG I;  4DR3 E;  1N0U A;  1N0V C;  4RPF A;  4JYA I;  1Y4U A;  3PYE A;  2PNL A;  3WU3 A;  2O1U A;  1HNX I;  3HJC A;  2HFS A;  1ZXM A;  1HNW I;  4IZJ A;  2Q2E B;  1Z5B A;  3B82 A;  4JI1 E;  3JAM Q;  3T1Y I;  1I94 E;  4DV1 I;  4NXN I;  3OTO E;  4DPT A;  4LFA I;  5A2Q C;  4B3S I;  4DV4 E;  3GON A;  2V8P A;  3J7A M;  5FLX C;  4Z7Y A;  4X66 I;  2VQF I;  2ZIT A;  1FJG E;  2ZM6 I;  5GMD A;  1B63 A;  1RRE A;  3J80 C;  1N33 E;  4JG4 A;  1Z0V A;  2LJP A;  3F0N A;  4YHH I;  2O1T A;  2O1V A;  1K47 A;  3J81 C;  3ZKD A;  1HNX E;  1FI4 A;  2VQE E;  4DU7 A;  3PYG A;  3B8H A;  4NXN E;  4LFA E;  4JI8 E;  3B78 A;  4EMD A;  3PYD A;  4HAC B;  3ZKB A;  2VQF E;  4PRV A;  4N3O A;  4MYT A;  2HK2 A;  4JI2 I;  1KVK A;  2DEI A;  1J5E I;  4YHH E;  4X65 I;  1IBL I;  3JAM C;  4DR4 I;  3K1J A;  4LF7 I;  4DV3 I;  4JI6 E;  4AQY I;  4DR2 I;  2HKJ A;  2BM0 A;  3Q6N A;  4IZK A;  4R1F A;  1XMO I;  1IBK E;  1Y4S A;  1XNQ I;  2UUC I;  4GKK I;  1PVG A;  4OX9 I;  5LMN I;  4DV6 I;  4NXM I;  4WUB A;  2HK3 A;  4B3T E;  4JV5 I;  4JI2 E;  4HYM A;  4JI7 E;  2CG9 A;  4JI5 E;  4PU9 A;  4DR6 I;  1J5E E;  4X65 E;  3P06 A;  4DUY E;  4USM A;  1IBL E;  4LFB E;  4MYU A;  1RR9 A;  4DV3 E;  1NZ0 A;  4X64 E;  3CWV A;  1USV A;  4DR2 E;  1USU A;  1Z0G A;  4WUD A;  1XMO E;  2WW4 A;  2UXD I;  4DV5 I;  1XNQ E;  1N36 I;  4X62 I;  4FWD A;  4LF6 I;  1HR0 I;  4USK A;  4DV2 I;  2HHH E;  4LF5 I;  1XHK A;  1Z5C A;  4KHP I;  2Z5B B;  3K17 A;  4K0K I;  1Z0W A;  1N32 I;  4FWH A;  2PNM A;  1FKA E;  1OJ4 A;  2NPF A;  5IT9 C;  2F4V I;  2Z5C B;  1B62 A;  4XTJ A;  3WU5 A;  2X7I A;  5LMU I;  2OI2 A;  1MU5 A;  1U2R A;  3J7A G;  1S4E A;  1PKP A;  4DR7 I;  4JI0 I;  4GKJ I;  2EFG A;  1PIE A;  3V2U C;  3Q1Q A;  4URL A;  4JYA E;  1XMQ I;  2A2C A;  4DV5 E;  1N36 E;  4FWG A;  1NHI A;  4LF6 E;  1NHJ A;  4LF5 E;  4LFC I;  4ZVI A;  2Z5E A;  1ZM3 A;  1HNW E;  1N34 I;  4KHP E;  4B3R I;  4DV0 I;  4K0K E;  5L3J A;  3T1Y E;  1ZM4 A;  1NHH A;  4DV1 E;  1N32 E;  4B3S E;  2F4V E;  4DR1 I;  3QT7 A;  5LMU E;  4X66 E;  1Z0B A;  1ZM2 A;  2XEX A;  3T1H I;  4DR7 E;  4JI0 E;  5FWK A;  2ZM6 E;  3M6A A;  1BKN A;  4M1K A;  4KQV A;  4DR5 I;  1N34 E;  2R42 A;  2UXC I;  3H4L A;  2UUB I;  3HUL A;  4DR1 E;  2HFU A;  2V2V A;  4JI3 I;  5GME A;  1VIS A;  1DAR A;  2VF3 A;  4JI4 I;  2GS8 A;  4LF9 I;  2IOP A;  4LF4 I;  2R3V A;  5FLX Q;  3PRY A;  1KIJ A;  3WU4 A;  4DR5 E;  4DR4 E;  2A2D A;  4B3M I;  3LNU A;  4LF7 E;  2ZBK B;  2UXB I;  1FWL A;  2UXC E;  4AQY E;  2O1W A;  4HAC A;  3WU6 A;  2UUB E;  1I94 I;  2UU9 I;  1H74 A;  2UUC E;  4GKK E;  1Z59 A;  1QZR A;  1IBM I;  4OX9 E;  5LMN E;  4JI4 E;  4DV6 E;  4NXM E;  4IZJ D;  4DU8 A;  4JV5 E;  1Z0C A;  2E5L I;  1FNM A;  4LF9 E;  2DEJ A;  4DR6 E;  3LTO A;  1N33 I;  3LPS A;  4B3M E;  4WUC A;  2AJ4 A;  4YY3 I;  2UXB E;  4P7A A;  2IOQ A;  1S16 A;  2CGE A;  2VQE I;  1KTV A;  1Z5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...