4DV0E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0E02
1IBME 4DR2E 4DV4I 4JI3I 2NUEA 4B3MI 3PYGA 4KHPI 2DB2A 4PU9A 4LF7E 4DV1I 2HHHE 1NHJA 5LMUE 2LBSB 4DU8A 2E5LE 4DPYA 1T4LB 4JV5E 4HACB 4LF8E 1J26A 2UXBI 2DEIA 1WHNA 3B78A 4HACA 3T1YE 4JI0I 1N33E 3LLHA 4P52A 3HULA 1KKHA 4AQYE 1QU6A 1IBLI 2Q2EB 4JI4I 4DPTA 4DXLA 1YYKA 4LFBE 4GKKI 1X49A 5CFFE 2UU9E 1B63A 1FNMA 1RC7A 5LMNE 1FJGI 4X66E 4DV6E 1EI1A 2L2KB 4RPFA 4DV3I 5FLXQ 2UXCI 1Z0EA 4JI7E 1KVKA 1J5EI 1HNXE 1ZM2A 2WW4A 4Z7YA 2LJPA 3Q1QA 3ZZTA 1FI4A 4B3RE 1IBMI 1KIJA 1XNRE 4DR2I 2BM1A 4LFAE 2NA2A 3M6AA 4JI3E 3OTOE 1I94E 1YYWA 4B3ME 4LF7I 4KHPE 3V5RA 1XNQE 2HHHI 5LMUI 1XMQE 4DV1E 4M2ZA 2HK2A 2E5LI 2V2ZA 4DU7A 4JV5I 2A2CA 1NHHA 1A6FA 1N0UA 2XEXA 4FWDA 3T1YI 2UUBE 5GMEA 1N33I 4DKKA 2RS7A 1O0WA 4WUCA 3J80C 1DI2A 4AQYI 4DR4E 3GONA 5IT9Q 5A2QC 1IBLE 3HTXA 4LFBI 1NHIA 2A2DA 3QT8A 1ZBTA 5LMNI 4X66I 4JG4A 4DV6I 1T4OA 1H74A 1K47A 4ED4A 1FWLA 3J81C 3H4LA 4XTJA 4JI7I 4DUZE 1HNXI 2B7VA 4KQVA 1XMOE 4K0KE 4OOGC 4DV7I 4LF6E 1ELOA 3PYFA 4GKJE 4JI5E 1H72C 3JAMQ 1N34E 1Z0WA 1XNRI 4DPXA 4LFAI 2F4VE 2N3GA 4X8WA 2R42A 3OTOI 1I94I 1Z0BA 1XNQI 4P7AA 1BKNA 4UTGA 1XMQI 2VQFE 4B3SE 4FWHA 5IT9C 1N32E 1ZXNA 2KHXA 1PVGA 2UUBI 2UXDE 2YT4A 1YYOA 1N36E 3V2UC 4DR4I 1H73A 4JI8E 4Z7CA 4USMA 4X62I 1PKPA 4HY1A 3P1XA 4DPUA 1RR9A 5L3JA 4LFCE 2HFUA 1Z0VA 2EFGA 3J80Q 4EMDA 2DMYA 4DR3I 4X65E 4FW9A 3JAMC 4DUZI 5A2QQ 3C4BA 3ZZUA 4LF9E 3J7AG 1XMOI 3LPSA 4K0KI 3QT6A 3VYYA 2UUCE 1D6TA 2LRSA 4LF6I 4DV7E 2HKEA 4GKJI 1HNWE 3J81Q 4JI5I 1N34I 2ZM6E 4DV2E 2V34A 3ZZ0A 1Z0TA 2F4VI 4UT4A 1S16A 3QT5A 2DEJA 1HR0I 2VQFI 4B3SI 4YHHI 4X64E 4WUDA 4DR5E 3PYDA 2E1RA 1N32I 3QT7A 5LL6R 4DR1E 4B3TE 2UXDI 1XHKA 2DIXA 1MG7A 1WUUA 1OJ4A 1H7SA 4YY3I 1N36I 4DV0E 2X36A 2CZ9A 1ZM3A 4JI8I 1RQ0A 3WU6A 2N3HA 3LTOA 4X62E 1H7UA 4LFCI 1MX0A 3ZKDA 1WHQA 3LNUA 4X65I 4DR3E 1FWKA 1PIEA 5GMDA 4JI6I 3ZKBA 4LF9I 2RTXA 4JI1E 4NXME 2UUCI 4M30A 1MU5A 4USKA 1RREA 1HNWI 2ZM6I 3ADLA 4DV2I 4FWGA 4DV5E 1STUA 4WUBA 1EA6A 1KTVA 5IWAE 4DR6E 4NXNE 2EZ6A 2NPFA 2V8PA 2BM0A 1HR0E 4X64I 4DR5I 4YHHE 4DR1I 4B3TI 4DR7E 3WU4A 2L3JA 3CWVA 2HFSA 3J7AM 1X47A 4JI2E 4DV0I 4YY3E 2GS8A 4MYUA 2LUPB 3WU5A 1Z0GA 2X7IA 3ADJA 4LF5E 3T1HE 1VISA 3ZM7A 4WFTA 3B8HA 4MYTA 4OX9I 4DUYE 3ADIA 4JI6E 2OI2A 4LF4E 4JI1I 1FKAE 4NXMI 4HYMA 2L2MA 1IBKE 3D4JA 1Z59A 4R1FA 4M1KA 4FN5A 2RS6A 5BR8E 2VQEE 2ZITA 1X48A 2JVAA 2V2VA 4DV5I 1N0VC 1HNZE 2LJHA 2UUAE 5IWAI 1YZ9A 4DR6I 4NXNI 2BV3A 2L3CA 3C4TA 1T4NA 2NUGA 4PRXA 2LTSA 1ZXMA 2HKJA 1DARA 4DR7I 2AJ4A 2R3VA 1ZM4A 4JYAE 2CPNA 1U2RA 3VYXA 4JI2I 3WU3A 3J7Yp 1Z5CA 3PYEA 4DV4E 1NZ0A 2JY9A 4URLA 2RSMA 1UEKA 3B82A 2HK3A 4LF5I 3T1HI 4LF8I 2L2NA 2LUQA 2VF3A 2UXBE 2V2QA 4I3HA 4JI0E 3K17A 4ZVIA 1B62A 4OX9E 1QZRA 4DUYI 5FLXC 1ZM9A 4LF4I 1EKZA 4HXZA 1IBKI 1GQEA 4JI4E 2UU9I 2J7KA 4GKKE 5BR8I 2VQEI 1Z5AA 2MDRA 1Z5BA 1FJGE 4PRVA 1Z0CA 2LTRA 2B3TB 4DV3E 1HNZI 2UUAI 1UILA 2IHR1 2UXCE 1UHZA 2ZBKB 1J5EE 4DPWA 3F0NA 3K1JA 4WYQB 1S4EA 2L33A 2B7TA 4JYAI 3ADGA 4B3RI 2NUFA
chains in the Genus database with same CATH superfamily
1IBME 4DR2E 2BA1D 1F2IG 1A1LA 4FW7A 2AE8A 2M7QA 1N3GA 2MC6A 3KZYA 2WNRB 2NUEA 4DV4I 4JI3I 2D9HA 4B3MI 5K36E 3PYGA 4KHPI 2DB2A 4PU9A 4LF7E 4IZJD 2V89A 4DV1I 2HHHE 2EQ1A 1NHJA 2GO3A 2EL6A 5LMUE 2LBSB 4DU8A 2E5LE 5JEAC 4DPYA 2FV4B 2PO2A 1T4LB 4JV5E 4HACB 4LF8E 1J26A 2JOXA 2UXBI 2WBSA 2K4VA 2DEIA 4BA1A 1WHNA 2EPZA 3B78A 4HACA 3T1YE 4JI0I 1N33E 4MDTA 3LLHA 1QNTA 2EQ3A 4P52A 3HULA 2EN7A 1KKHA 1UDOA 4AQYE 1T38A 2G7HA 4IS1C 3Q6NA 1QU6A 1GTKA 1IBLI 4LCGA 2Q2EB 1PJQA 4JI4I 4DPTA 4DXLA 2EORA 1YYKA 4LFBE 1X49A 1YHCA 4GKKI 5CFFE 2YWQA 2LE2A 2UU9E 1B63A 2O3ZA 4IFDF 4OO1D 2VESA 2EM3A 1FNMA 4IZKB 1RC7A 4IS9A 5LMNE 1FJGI 4X66E 4DV6E 1EI1A 4BCAA 2L2KB 5TSEA 4RPFA 4DV3I 2ODRC 2L92A 5FLXQ 2UXCI 4LPFA 2YU5A 1Z0EA 5C0XC 4J3DA 4JI7E 1KVKA 3HJCA 1J5EI 2EP3A 5K36D 1HNXE 1PJSA 1XXEA 2NN6C 2O1VA 2YRMA 2WCC3 1HK7A 5EKWA 5DNLA 5JEAB 2ELZA 5C0XE 1ZM2A 1Y6ZA 2DRPA 2WW4A 4RH8A 4DMIA 2BR2A 2LJPA 4Z7YA 3Q1QA 3ZZTA 1A1FA 1LLMC 4BHCA 3GCMA 1FI4A 1X3CA 4B3RE 2LJUA 1IBMI 1KIJA 1XNRE 4DR2I 2BM1A 4LFAE 1USUA 2NA2A 4U3DA 4FK5C 1VI7A 3M6AA 4JI3E 3OTOE 1I94E 1YYWA 2NUFA 4B3ME 4I3HA 4LF7I 2EOHA 4KHPE 2PO0A 3V5RA 2JEBB 1XNQE 2YTEA 2HHHI 5KL6A 5LMUI 1XMQE 2EMFA 4DV1E 1YSAC 1ZAAC 4M2ZA 2HK2A 2MKNA 2JEBA 2V2ZA 4DU7A 2YSPA 5KL5A 3M7NG 4JV5I 2EOSA 2R1FA 2A2CA 1NHHA 1A6FA 3JTZA 1N0UA 2EPRA 2XEXA 2YTJA 3HKMA 2C39B 1UDQA 4FWDA 3T1YI 2EM5A 2UUBE 2MDGA 5GMEA 1N33I 2VE7C 4DKKA 1ZU1A 2C39A 2RS7A 1O0WA 2MC5A 4WUCA 5C0XB 3J80C 2V85A 1DI2A 4AQYI 4F9AB 4BA2B 5C0XA 4DR4E 3MSWA 1B69A 2BA0G 2NN6B 3GONA 5A2QC 5IT9Q 3EPLA 1IBLE 5JEAF 3HTXA 4LFBI 1NHIA 4AIMA 2A2DA 4LU9A 3QT8A 2V88A 2LMZA 2N8XA 3OMLA 2EPOA 1BBOA 1T39A 1Y4SA 1ZBTA 5LMNI 4WX9A 2EMIA 4X66I 4JG4A 4DV6I 1T4OA 4P78A 1H74A 1K47A 2GPIA 3BBGA 2CG9A 1YPNA 4TUIA 4F6MA 3J81C 1WXRA 1FWLA 3KRNA 2O1WA 3H4LA 4XTJA 4JI7I 4DUZE 4O24A 2Z5CB 3L7ZB 3QG5C 4OO1C 2Z5BB 2PNZB 1HNXI 3GMEA 2B7VA 4R8OA 1A1KA 2WP8B 2Z5CA 4KQVA 2EOFA 1XMOE 4K0KE 4OOGC 2CVEA 2Z5BA 4RHBB 3CDIA 2FTXB 2WP8A 4DV7I 1P47A 4MU4A 1KJKA 4LF6E 3M99B 1ELOA 3PYFA 4OZEA 4P7DA 2NABA 4GKJE 4JI5E 1H72C 2Z5EA 3BF2A 3AUZA 2EN8A 1SFEA 3IWBA 1N34E 2V83A 2JPAA 1UN6B 4LCHA 3JAMQ 1Z0WA 2JR1A 4IZJB 4DPXA 1XNRI 5K36C 4LCFA 4LFAI 3LMLA 1X6EA 2N3GA 3IWCA 4KWYA 2F4VE 4X8WA 2R42A 4IZJA 1NEIA 2NN6F 2F1DA 3OTOI 1I94I 4FW6A 1Z0BA 2EPNA 2YTIA 1XNQI 2WBTA 4P7AA 4ED4A 2EN4A 1BKNA 2CGEA 4UTGA 2EMXA 1XMQI 2PO2B 2V8QB 2EMGA 2VQFE 4B3SE 5IT9C 5IV8B 4FWHA 1UDSA 5AE2A 4N3OA 1N32E 2EQ0A 4BA1B 4LTYA 1ZXNA 2KHXA 1PVGA 4QNJA 2UUBI 2O1UA 1OYPA 2UXDE 2KONA 2YT4A 2YTGA 4ZYHA 5AC4A 3P3EA 1DQ3A 1YYOA 1NCSA 1E3PA 3NZKA 1N36E 4OO1B 2JYAA 4IFDD 3V2UC 2KOUA 4R2SA 1Y60A 4DR4I 1H73A 4JI8E 2YTDA 5KL4A 4OO1A 4I8OA 4F9BB 4R2AA 2LT7A 4IJDA 4Z7CA 4USMA 2EPPA 2EWLA 2EMWA 1PKPA 4X62I 2EPUA 4HY1A 3P1XA 4DPUA 1AAYA 1DGCA 5EL9A 1RR9A 2EL4A 5L3JA 4LFCE 2IOQA 2HFUA 1R6MA 1Z0VA 2EFGA 4R2EA 5K36B 3J80Q 4EMDA 2C37B 2DMYA 2IOPA 4X65E 4FW9A 2EPLX 2YPNA 4DR3I 2YTOA 5K36A 1TN9A 4L8NA 3JAMC 1E3HA 5A2QQ 5A6BD 4DUZI 3C4BA 4M0VA 2C37A 1X6FA 2BA1G 2IESA 3ZZUA 4LF9E 5AE3A 3J7AG 1XMOI 3LPSA 4K0KI 3QT6A 3VYYA 2BR2B 2UUCE 2VRDA 1IQOA 4WSPA 2VF1A 1D6TA 3P3GA 2LRSA 2YU8A 4LF6I 4DV7E 1USVA 1RMDA 4NBQA 4MLQA 3ZOQB 2HKEA 4GKJI 3JU0A 1HNWE 4R03A 1Z1BA 3J81Q 4JI5I 3UK3C 1G2FC 1N34I 2ZM6E 2HC5A 4DV2E 2V34A 3ZZ0A 1AH5A 1Z0TA 2F4VI 1IQSA 3TQMA 1ZR9A 2ELYA 3U1YA 4UT4A 4TUGA 2DLQA 2EN6A 2PO0B 1S16A 2EOOA 4ZYDA 2I13A 2ENAA 2E5LI 2Q8UA 4BMJA 2DMIA 2DEJA 4WXDA 3QT5A 5FWKA 1HR0I 2CT1A 2VQFI 3M85D 4B3SI 4BBYA 4YHHI 4X64E 4WUDA 4DR5E 2JP9A 2E1RA 3PYDA 3QT7A 2PO1B 5LL6R 4DR1E 4B3TE 4Q28A 1N32I 4QNKA 5K36F 2PO1A 2UXDI 2EMLA 2EPAA 1XHKA 4MU3A 2DIXA 1MG7A 1WUUA 1OJ4A 5DRPA 4X9JA 1WRJA 1H7SA 3IWDA 4YY3I 1N36I 2ENHA 4O4KA 2YTNA 4DV0E 2X36A 4OKGA 4R2CA 2CZ9A 4R2PA 1ZM3A 4JI8I 2FGGA 1RQ0A 2PRTA 3WU6A 2N3HA 3THOB 2EOQA 3LTOA 1ZBQA 2GLIA 2RQLA 4X62E 1H7UA 2BB8A 2EN3A 2L8TA 2R76A 3PS2A 4LFCI 4FW3A 2JEAB 3H1CA 1MX0A 3EPHA 3ZKDA 1GZ6A 2EN2A 1WHQA 2JEAA 2O1TA 2LVHA 3LNUA 3UHMA 4X65I 4MQYA 3MHHC 4GZNC 4DR3E 3H09A 4IFDE 1FWKA 1PIEA 5GMDA 4JI6I 2C38A 3ZKBA 3KWRA 4LF9I 1YUIA 2ODRD 3VK6A 2EOJA 2RTXA 4BC7A 2HJJA 2WZOA 1YUJA 4JI1E 4M30A 4NXME 4FW4A 2UUCI 2A25A 1MU5A 3DD6A 3HXLA 1EH8A 1WJPA 1A1HA 1RREA 4USKA 1HNWI 2ZM6I 2PNMA 3Q6MA 3ADLA 1BBGA 4DV2I 4FWGA 1MGTA 5A69A 4DV5E 2ENCA 3PRYA 1STUA 1PDAA 4WUBA 5C0XF 3L00A 4HEIA 1EA6A 3P3CA 1TF3A 4J8ZA 1KTVA 4BHBA 2EPKX 5IWAE 4DR6E 2EM6A 4NXNE 4DR7I 2EZ6A 2EM0A 2NPFA 2V8PA 1JK1A 2BM0A 1HR0E 1OYRA 2EM2A 2V87A 1PJTA 1UBDC 4X64I 4DR5I 5ADZA 2B9DA 4YHHE 4DR1I 4B3TI 2EJ4A 2EOIA 4Q35B 4IFDB 1A1GA 2EMYA 4HTGA 4BC9A 4DR7E 2L3JA 2PNLA 2EMKA 5A6AA 3CWVA 3WU4A 4IFDA 2V86A 2HFSA 3J7AM 1X47A 2EOYA 5T6JA 2M1SA 4F6NA 4JI2E 4DV0I 3EPJA 4YY3E 2GS8A 4MYUA 2LUPB 2EOMA 4N4RB 2EM9A 5A6JA 4R2RA 1R6LA 3P06A 5DNXA 3WU5A 4ZYEA 2EM4A 3FIGA 3U1KA 3THNA 4R2QA 1Z0GA 2WNRA 4MU0A 2X7IA 2CSHA 3ADJA 4LF5E 1A1IA 1IMUA 2EL5A 2EOEA 3T1HE 1VISA 2EPCA 2EM7A 2YTQA 5A6BA 2JWOA 2LV2A 2LCEA 4NZVA 3RMPA 5JEAE 2CTDA 1EH6A 3C6MA 3ZM7A 3HPZA 4WFTA 5AE1A 3B8HA 4MYTA 4OX9I 3EPKA 2WBUA 4FW5A 5KL2A 4DUYE 5F3WA 4JI6E 3ADIA 2J7JA 2I9IA 2MKDA 4LF4E 2IERA 2OI2A 1FKAE 4JI1I 1MEYC 4NXMI 4HYMA 2L2MA 1IBKE 3B4TA 3D4JA 1Z59A 2RSIA 4R1FA 3M7ND 2YRHA 4M1KA 4FN5A 2EPXA 2RS6A 5BR8E 5IXMB 2EOZA 2EM8A 2VQEE 4WXCA 4ZYGA 2ZITA 1X48A 2JVAA 2V2VA 2GQ0A 4DV5I 2EN1A 4IZKA 3K85A 1N0VC 1HNZE 2LJHA 3HQ1A 2UUAE 4OO1F 3BGHA 5IWAI 1YZ9A 4DR6I 4NXNI 2BA0D 4WPYA 1YH8A 2BV3A 2L3CA 3C4TA 1T4NA 5LLQA 2NUGA 4PRXA 2LTSA 2YZTA 1ZXMA 1X5WA 3F6GA 2YTFA 2JXPA 2M9AA 2HKJA 4MU1A 1DARA 5JEAA 2NN6E 3K6QA 2RPCA 3C6KA 2AJ4A 1SR9A 1ZM4A 2EE8A 4JYAE 1KYQA 2R3VA 4ISAA 2H36X 2CPNA 2F8BA 1U2RA 2YTPA 3VYXA 5JEAD 3MHSC 4JI2I 3WU3A 4U3BA 2DLKA 3ECRA 3J7Yp 2ADRA 5KL7A 1Z5CA 4DV4E 1NZ0A 3PYEA 1G2DC 2JY9A 4URLA 2RSMA 1BB8A 1Y5YA 4LOMA 1UEKA 3B82A 4NHRA 2DSYA 2HK3A 4LF5I 3PS1A 4BS9A 3GLLA 4F9CB 3T1HI 4LF8I 2L2NA 3VHTB 4IFDC 2LUQA 2JT2A 3P76A 4WSGA 5AC5A 2VF3A 2UXBE 2JE6B 4GQUA 4O43A 4R2DA 5A6KA 1OYSA 2YSOA 4F2JC 4JI0E 2V2QA 3KZZA 3AV0A 4F54A 3K17A 2C38B 3DJWA 2JE6A 4ZVIA 1B62A 2EMBA 4OX9E 2GHFA 1QZRA 2J65A 4DUYI 5DRQA 2EMHA 3F6HA 5FLXC 1X6HA 1ZM9A 4LF4I 3EQ1A 1EKZA 4HXZA 4AM3A 1IBKI 4GEQB 1GQEA 1Y4UA 2GO4A 4BA2A 2NN6A 4JI4E 2UU9I 2E1MA 3PS3A 2J7KA 4GKKE 5C0XD 2BBGA 5BR8I 2VQEI 1Z5AA 5DROA 3M85G 2DGCA 2EPMX 5ELWA 2M4IA 2MDRA 1L4SA 1Z5BA 2NN6D 1P42A 1FJGE 4KZSA 4MLVA 4PRVA 4AIDA 1Z0CA 2LO3A 5DNYA 2JOBA 2L6MA 2LTRA 2B3TB 2K7IA 4DV3E 3CDJA 1HNZI 1UILA 4L5NC 2UUAI 2IHR1 1YFHA 2UXCE 2YRKA 3HPSA 2HGHA 1A1JA 1UHZA 2E72A 1JK2A 1RHYA 1UDNA 5AASA 2ZBKB 3L7ZA 1J5EE 2EOXA 2PNZA 4DPWA 3F0NA 3K1JA 4WYQB 1S4EA 4OO1E 2L33A 5DRRA 1TF6A 4M9VC 2EMAA 2B7TA 1EH7A 3BIDA 4JYAI 3ADGA 3DF6A 4B3RI 5KL3A 4O5GA 2EMZA 2EMCA
chains in the Genus database with same CATH topology
1IBME 4DR2E 2M7QA 2MC6A 4DV4I 4JI3I 2NUEA 4B3MI 3PYGA 4KHPI 2DB2A 4PU9A 4LF7E 4IZJD 2V89A 4DV1I 2HHHE 1NHJA 5LMUE 2LBSB 4DU8A 2E5LE 4DPYA 2FV4B 1T4LB 4JV5E 4HACB 4LF8E 1J26A 2JOXA 2UXBI 2K4VA 2DEIA 1WHNA 3B78A 4HACA 3T1YE 4JI0I 1N33E 3LLHA 4P52A 3HULA 1KKHA 4AQYE 2G7HA 3Q6NA 1QU6A 1IBLI 2Q2EB 4JI4I 4DPTA 4DXLA 1YYKA 4LFBE 4GKKI 1X49A 5CFFE 2UU9E 2LE2A 1B63A 1FNMA 4IZKB 1RC7A 5LMNE 1FJGI 4X66E 4DV6E 1EI1A 4BCAA 2L2KB 4RPFA 4DV3I 2ODRC 2L92A 5FLXQ 2UXCI 1Z0EA 4JI7E 1KVKA 3HJCA 1J5EI 1HNXE 2O1VA 1HK7A 1ZM2A 1Y6ZA 2WW4A 4Z7YA 4DMIA 2LJPA 3Q1QA 3ZZTA 1FI4A 4B3RE 1IBMI 1KIJA 1XNRE 4DR2I 2BM1A 4LFAE 1USUA 2NA2A 3M6AA 4JI3E 3OTOE 1I94E 1YYWA 4B3ME 4LF7I 4KHPE 3V5RA 1XNQE 2HHHI 5LMUI 1XMQE 4DV1E 4M2ZA 2HK2A 2E5LI 2V2ZA 4DU7A 4JV5I 2A2CA 1NHHA 1A6FA 3JTZA 1N0UA 2XEXA 4FWDA 3T1YI 2UUBE 5GMEA 1N33I 2VE7C 4DKKA 2RS7A 1O0WA 2MC5A 4WUCA 3J80C 2V85A 1DI2A 4AQYI 4F9AB 4DR4E 3MSWA 3GONA 5IT9Q 5A2QC 1IBLE 3HTXA 4LFBI 1NHIA 2A2DA 4LU9A 3QT8A 2V88A 2LMZA 3OMLA 1Y4SA 1ZBTA 5LMNI 4X66I 4JG4A 4DV6I 1T4OA 4P78A 1H74A 1K47A 2CG9A 4ED4A 4TUIA 1FWLA 3J81C 1WXRA 2O1WA 3H4LA 4XTJA 4JI7I 4DUZE 2Z5CB 2Z5BB 1HNXI 2B7VA 4R8OA 2Z5CA 4KQVA 1XMOE 4K0KE 4OOGC 2Z5BA 2FTXB 4DV7I 4LF6E 1ELOA 3PYFA 4P7DA 4GKJE 4JI5E 1H72C 2Z5EA 3AUZA 3JAMQ 3IWBA 1N34E 2V83A 1Z0WA 2JR1A 4IZJB 4DPXA 1XNRI 4LFAI 3LMLA 2F4VE 2N3GA 3IWCA 4X8WA 2R42A 4IZJA 3OTOI 1I94I 1Z0BA 1XNQI 4P7AA 1BKNA 2CGEA 4UTGA 1XMQI 2V8QB 2VQFE 4B3SE 5IT9C 4FWHA 5AE2A 4N3OA 1N32E 4LTYA 1ZXNA 2KHXA 1PVGA 2UUBI 2O1UA 2UXDE 2KONA 2YT4A 1DQ3A 1YYOA 1N36E 3V2UC 2KOUA 4DR4I 1H73A 4JI8E 4I8OA 4F9BB 4Z7CA 4USMA 2EWLA 4X62I 1PKPA 4HY1A 3P1XA 4DPUA 1RR9A 5L3JA 4LFCE 2IOQA 2HFUA 1Z0VA 2EFGA 3J80Q 4EMDA 2DMYA 2IOPA 4X65E 4FW9A 4DR3I 4L8NA 3JAMC 5A2QQ 4DUZI 3C4BA 4M0VA 3ZZUA 4LF9E 5AE3A 3J7AG 1XMOI 3LPSA 4K0KI 3QT6A 3VYYA 2UUCE 4WSPA 2VF1A 1D6TA 2LRSA 4LF6I 4DV7E 1USVA 3ZOQB 2HKEA 4GKJI 3JU0A 1HNWE 4R03A 3J81Q 4JI5I 1N34I 2ZM6E 4DV2E 2V34A 3ZZ0A 1Z0TA 2F4VI 4UT4A 4TUGA 1S16A 3QT5A 4BMJA 2DEJA 1HR0I 5FWKA 2VQFI 4B3SI 4BBYA 4YHHI 4X64E 4WUDA 4DR5E 3PYDA 2E1RA 1N32I 3QT7A 5LL6R 4DR1E 4B3TE 4Q28A 2UXDI 1XHKA 2DIXA 1MG7A 1WUUA 1OJ4A 1H7SA 3IWDA 4YY3I 1N36I 4DV0E 2X36A 2CZ9A 1ZM3A 4JI8I 2FGGA 1RQ0A 3WU6A 2N3HA 3LTOA 1ZBQA 4X62E 1H7UA 2L8TA 4LFCI 1MX0A 3ZKDA 1GZ6A 1WHQA 2O1TA 3LNUA 4X65I 4DR3E 3H09A 1FWKA 1PIEA 5GMDA 4JI6I 3ZKBA 3KWRA 4LF9I 2ODRD 3VK6A 2RTXA 4BC7A 4JI1E 2WZOA 4NXME 2UUCI 4M30A 1MU5A 3HXLA 4USKA 1RREA 1HNWI 2ZM6I 2PNMA 3Q6MA 3ADLA 4DV2I 4FWGA 4DV5E 3PRYA 1STUA 4WUBA 1EA6A 4J8ZA 1KTVA 5IWAE 4DR6E 4NXNE 2EZ6A 2NPFA 2V8PA 2BM0A 1HR0E 2V87A 4X64I 4DR5I 5ADZA 2B9DA 4YHHE 4DR1I 4B3TI 4BC9A 4DR7E 3WU4A 2L3JA 2PNLA 3CWVA 2V86A 2HFSA 3J7AM 1X47A 5T6JA 2M1SA 4JI2E 4DV0I 4YY3E 2GS8A 4MYUA 2LUPB 3WU5A 3P06A 3FIGA 1Z0GA 2X7IA 3ADJA 4LF5E 3T1HE 1VISA 2JWOA 3RMPA 3ZM7A 3HPZA 4WFTA 5AE1A 3B8HA 4MYTA 4OX9I 4DUYE 5F3WA 3ADIA 4JI6E 2OI2A 4LF4E 4JI1I 1FKAE 4NXMI 4HYMA 2L2MA 1IBKE 3D4JA 1Z59A 4R1FA 4M1KA 4FN5A 2RS6A 5BR8E 2VQEE 2ZITA 1X48A 2JVAA 2V2VA 2GQ0A 4DV5I 4IZKA 3K85A 1N0VC 1HNZE 2LJHA 3HQ1A 2UUAE 5IWAI 1YZ9A 4DR6I 4NXNI 4WPYA 2BV3A 2L3CA 3C4TA 1T4NA 2NUGA 4PRXA 2LTSA 2YZTA 1ZXMA 3F6GA 2HKJA 1DARA 3K6QA 4DR7I 2AJ4A 1SR9A 1ZM4A 2R3VA 4JYAE 2H36X 2CPNA 2F8BA 1U2RA 3VYXA 4JI2I 3WU3A 3J7Yp 1Z5CA 3PYEA 4DV4E 1NZ0A 2JY9A 4URLA 2RSMA 1UEKA 3B82A 2DSYA 2HK3A 4LF5I 4BS9A 4F9CB 3T1HI 4LF8I 2L2NA 2LUQA 2VF3A 2UXBE 2V2QA 4I3HA 4JI0E 3K17A 3AV0A 4F54A 4ZVIA 3DJWA 1B62A 4OX9E 1QZRA 4DUYI 3F6HA 5FLXC 1ZM9A 4LF4I 1EKZA 4HXZA 1IBKI 4GEQB 1GQEA 1Y4UA 4JI4E 2UU9I 2E1MA 2J7KA 4GKKE 5BR8I 2VQEI 1Z5AA 2M4IA 2MDRA 1Z5BA 1FJGE 4KZSA 4PRVA 1Z0CA 5DNYA 2JOBA 2L6MA 2LTRA 2B3TB 4DV3E 1HNZI 2UUAI 1UILA 4L5NC 2IHR1 2UXCE 3HPSA 1UHZA 5AASA 2ZBKB 1J5EE 4DPWA 3F0NA 3K1JA 4WYQB 1S4EA 2L33A 2B7TA 4JYAI 3ADGA 3DF6A 4B3RI 2NUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM E;  4DR2 E;  4DV4 I;  4JI3 I;  2NUE A;  4B3M I;  3PYG A;  4KHP I;  2DB2 A;  4PU9 A;  4LF7 E;  4DV1 I;  2HHH E;  1NHJ A;  5LMU E;  2LBS B;  4DU8 A;  2E5L E;  4DPY A;  1T4L B;  4JV5 E;  4HAC B;  4LF8 E;  1J26 A;  2UXB I;  2DEI A;  1WHN A;  3B78 A;  4HAC A;  3T1Y E;  4JI0 I;  1N33 E;  3LLH A;  4P52 A;  3HUL A;  1KKH A;  4AQY E;  1QU6 A;  1IBL I;  2Q2E B;  4JI4 I;  4DPT A;  4DXL A;  1YYK A;  4LFB E;  4GKK I;  1X49 A;  5CFF E;  2UU9 E;  1B63 A;  1FNM A;  1RC7 A;  5LMN E;  1FJG I;  4X66 E;  4DV6 E;  1EI1 A;  2L2K B;  4RPF A;  4DV3 I;  5FLX Q;  2UXC I;  1Z0E A;  4JI7 E;  1KVK A;  1J5E I;  1HNX E;  1ZM2 A;  2WW4 A;  4Z7Y A;  2LJP A;  3Q1Q A;  3ZZT A;  1FI4 A;  4B3R E;  1IBM I;  1KIJ A;  1XNR E;  4DR2 I;  2BM1 A;  4LFA E;  2NA2 A;  3M6A A;  4JI3 E;  3OTO E;  1I94 E;  1YYW A;  4B3M E;  4LF7 I;  4KHP E;  3V5R A;  1XNQ E;  2HHH I;  5LMU I;  1XMQ E;  4DV1 E;  4M2Z A;  2HK2 A;  2E5L I;  2V2Z A;  4DU7 A;  4JV5 I;  2A2C A;  1NHH A;  1A6F A;  1N0U A;  2XEX A;  4FWD A;  3T1Y I;  2UUB E;  5GME A;  1N33 I;  4DKK A;  2RS7 A;  1O0W A;  4WUC A;  3J80 C;  1DI2 A;  4AQY I;  4DR4 E;  3GON A;  5IT9 Q;  5A2Q C;  1IBL E;  3HTX A;  4LFB I;  1NHI A;  2A2D A;  3QT8 A;  1ZBT A;  5LMN I;  4X66 I;  4JG4 A;  4DV6 I;  1T4O A;  1H74 A;  1K47 A;  4ED4 A;  1FWL A;  3J81 C;  3H4L A;  4XTJ A;  4JI7 I;  4DUZ E;  1HNX I;  2B7V A;  4KQV A;  1XMO E;  4K0K E;  4OOG C;  4DV7 I;  4LF6 E;  1ELO A;  3PYF A;  4GKJ E;  4JI5 E;  1H72 C;  3JAM Q;  1N34 E;  1Z0W A;  1XNR I;  4DPX A;  4LFA I;  2F4V E;  2N3G A;  4X8W A;  2R42 A;  3OTO I;  1I94 I;  1Z0B A;  1XNQ I;  4P7A A;  1BKN A;  4UTG A;  1XMQ I;  2VQF E;  4B3S E;  4FWH A;  5IT9 C;  1N32 E;  1ZXN A;  2KHX A;  1PVG A;  2UUB I;  2UXD E;  2YT4 A;  1YYO A;  1N36 E;  3V2U C;  4DR4 I;  1H73 A;  4JI8 E;  4Z7C A;  4USM A;  4X62 I;  1PKP A;  4HY1 A;  3P1X A;  4DPU A;  1RR9 A;  5L3J A;  4LFC E;  2HFU A;  1Z0V A;  2EFG A;  3J80 Q;  4EMD A;  2DMY A;  4DR3 I;  4X65 E;  4FW9 A;  3JAM C;  4DUZ I;  5A2Q Q;  3C4B A;  3ZZU A;  4LF9 E;  3J7A G;  1XMO I;  3LPS A;  4K0K I;  3QT6 A;  3VYY A;  2UUC E;  1D6T A;  2LRS A;  4LF6 I;  4DV7 E;  2HKE A;  4GKJ I;  1HNW E;  3J81 Q;  4JI5 I;  1N34 I;  2ZM6 E;  4DV2 E;  2V34 A;  3ZZ0 A;  1Z0T A;  2F4V I;  4UT4 A;  1S16 A;  3QT5 A;  2DEJ A;  1HR0 I;  2VQF I;  4B3S I;  4YHH I;  4X64 E;  4WUD A;  4DR5 E;  3PYD A;  2E1R A;  1N32 I;  3QT7 A;  5LL6 R;  4DR1 E;  4B3T E;  2UXD I;  1XHK A;  2DIX A;  1MG7 A;  1WUU A;  1OJ4 A;  1H7S A;  4YY3 I;  1N36 I;  4DV0 E;  2X36 A;  2CZ9 A;  1ZM3 A;  4JI8 I;  1RQ0 A;  3WU6 A;  2N3H A;  3LTO A;  4X62 E;  1H7U A;  4LFC I;  1MX0 A;  3ZKD A;  1WHQ A;  3LNU A;  4X65 I;  4DR3 E;  1FWK A;  1PIE A;  5GMD A;  4JI6 I;  3ZKB A;  4LF9 I;  2RTX A;  4JI1 E;  4NXM E;  2UUC I;  4M30 A;  1MU5 A;  4USK A;  1RRE A;  1HNW I;  2ZM6 I;  3ADL A;  4DV2 I;  4FWG A;  4DV5 E;  1STU A;  4WUB A;  1EA6 A;  1KTV A;  5IWA E;  4DR6 E;  4NXN E;  2EZ6 A;  2NPF A;  2V8P A;  2BM0 A;  1HR0 E;  4X64 I;  4DR5 I;  4YHH E;  4DR1 I;  4B3T I;  4DR7 E;  3WU4 A;  2L3J A;  3CWV A;  2HFS A;  3J7A M;  1X47 A;  4JI2 E;  4DV0 I;  4YY3 E;  2GS8 A;  4MYU A;  2LUP B;  3WU5 A;  1Z0G A;  2X7I A;  3ADJ A;  4LF5 E;  3T1H E;  1VIS A;  3ZM7 A;  4WFT A;  3B8H A;  4MYT A;  4OX9 I;  4DUY E;  3ADI A;  4JI6 E;  2OI2 A;  4LF4 E;  4JI1 I;  1FKA E;  4NXM I;  4HYM A;  2L2M A;  1IBK E;  3D4J A;  1Z59 A;  4R1F A;  4M1K A;  4FN5 A;  2RS6 A;  5BR8 E;  2VQE E;  2ZIT A;  1X48 A;  2JVA A;  2V2V A;  4DV5 I;  1N0V C;  1HNZ E;  2LJH A;  2UUA E;  5IWA I;  1YZ9 A;  4DR6 I;  4NXN I;  2BV3 A;  2L3C A;  3C4T A;  1T4N A;  2NUG A;  4PRX A;  2LTS A;  1ZXM A;  2HKJ A;  1DAR A;  4DR7 I;  2AJ4 A;  2R3V A;  1ZM4 A;  4JYA E;  2CPN A;  1U2R A;  3VYX A;  4JI2 I;  3WU3 A;  3J7Y p;  1Z5C A;  3PYE A;  4DV4 E;  1NZ0 A;  2JY9 A;  4URL A;  2RSM A;  1UEK A;  3B82 A;  2HK3 A;  4LF5 I;  3T1H I;  4LF8 I;  2L2N A;  2LUQ A;  2VF3 A;  2UXB E;  2V2Q A;  4I3H A;  4JI0 E;  3K17 A;  4ZVI A;  1B62 A;  4OX9 E;  1QZR A;  4DUY I;  5FLX C;  1ZM9 A;  4LF4 I;  1EKZ A;  4HXZ A;  1IBK I;  1GQE A;  4JI4 E;  2UU9 I;  2J7K A;  4GKK E;  5BR8 I;  2VQE I;  1Z5A A;  2MDR A;  1Z5B A;  1FJG E;  4PRV A;  1Z0C A;  2LTR A;  2B3T B;  4DV3 E;  1HNZ I;  2UUA I;  1UIL A;  2IHR 1;  2UXC E;  1UHZ A;  2ZBK B;  1J5E E;  4DPW A;  3F0N A;  3K1J A;  4WYQ B;  1S4E A;  2L33 A;  2B7T A;  4JYA I;  3ADG A;  4B3R I;  2NUF A; 
#chains in the Genus database with same CATH topology
 1IBM E;  4DR2 E;  2BA1 D;  1F2I G;  1A1L A;  4FW7 A;  2AE8 A;  2M7Q A;  1N3G A;  2MC6 A;  3KZY A;  2WNR B;  2NUE A;  4DV4 I;  4JI3 I;  2D9H A;  4B3M I;  5K36 E;  3PYG A;  4KHP I;  2DB2 A;  4PU9 A;  4LF7 E;  4IZJ D;  2V89 A;  4DV1 I;  2HHH E;  2EQ1 A;  1NHJ A;  2GO3 A;  2EL6 A;  5LMU E;  2LBS B;  4DU8 A;  2E5L E;  5JEA C;  4DPY A;  2FV4 B;  2PO2 A;  1T4L B;  4JV5 E;  4HAC B;  4LF8 E;  1J26 A;  2JOX A;  2UXB I;  2WBS A;  2K4V A;  2DEI A;  4BA1 A;  1WHN A;  2EPZ A;  3B78 A;  4HAC A;  3T1Y E;  4JI0 I;  1N33 E;  4MDT A;  3LLH A;  1QNT A;  2EQ3 A;  4P52 A;  3HUL A;  2EN7 A;  1KKH A;  1UDO A;  4AQY E;  1T38 A;  2G7H A;  4IS1 C;  3Q6N A;  1QU6 A;  1GTK A;  1IBL I;  4LCG A;  2Q2E B;  1PJQ A;  4JI4 I;  4DPT A;  4DXL A;  2EOR A;  1YYK A;  4LFB E;  1X49 A;  1YHC A;  4GKK I;  5CFF E;  2YWQ A;  2LE2 A;  2UU9 E;  1B63 A;  2O3Z A;  4IFD F;  4OO1 D;  2VES A;  2EM3 A;  1FNM A;  4IZK B;  1RC7 A;  4IS9 A;  5LMN E;  1FJG I;  4X66 E;  4DV6 E;  1EI1 A;  4BCA A;  2L2K B;  5TSE A;  4RPF A;  4DV3 I;  2ODR C;  2L92 A;  5FLX Q;  2UXC I;  4LPF A;  2YU5 A;  1Z0E A;  5C0X C;  4J3D A;  4JI7 E;  1KVK A;  3HJC A;  1J5E I;  2EP3 A;  5K36 D;  1HNX E;  1PJS A;  1XXE A;  2NN6 C;  2O1V A;  2YRM A;  2WCC 3;  1HK7 A;  5EKW A;  5DNL A;  5JEA B;  2ELZ A;  5C0X E;  1ZM2 A;  1Y6Z A;  2DRP A;  2WW4 A;  4RH8 A;  4DMI A;  2BR2 A;  2LJP A;  4Z7Y A;  3Q1Q A;  3ZZT A;  1A1F A;  1LLM C;  4BHC A;  3GCM A;  1FI4 A;  1X3C A;  4B3R E;  2LJU A;  1IBM I;  1KIJ A;  1XNR E;  4DR2 I;  2BM1 A;  4LFA E;  1USU A;  2NA2 A;  4U3D A;  4FK5 C;  1VI7 A;  3M6A A;  4JI3 E;  3OTO E;  1I94 E;  1YYW A;  2NUF A;  4B3M E;  4I3H A;  4LF7 I;  2EOH A;  4KHP E;  2PO0 A;  3V5R A;  2JEB B;  1XNQ E;  2YTE A;  2HHH I;  5KL6 A;  5LMU I;  1XMQ E;  2EMF A;  4DV1 E;  1YSA C;  1ZAA C;  4M2Z A;  2HK2 A;  2MKN A;  2JEB A;  2V2Z A;  4DU7 A;  2YSP A;  5KL5 A;  3M7N G;  4JV5 I;  2EOS A;  2R1F A;  2A2C A;  1NHH A;  1A6F A;  3JTZ A;  1N0U A;  2EPR A;  2XEX A;  2YTJ A;  3HKM A;  2C39 B;  1UDQ A;  4FWD A;  3T1Y I;  2EM5 A;  2UUB E;  2MDG A;  5GME A;  1N33 I;  2VE7 C;  4DKK A;  1ZU1 A;  2C39 A;  2RS7 A;  1O0W A;  2MC5 A;  4WUC A;  5C0X B;  3J80 C;  2V85 A;  1DI2 A;  4AQY I;  4F9A B;  4BA2 B;  5C0X A;  4DR4 E;  3MSW A;  1B69 A;  2BA0 G;  2NN6 B;  3GON A;  5A2Q C;  5IT9 Q;  3EPL A;  1IBL E;  5JEA F;  3HTX A;  4LFB I;  1NHI A;  4AIM A;  2A2D A;  4LU9 A;  3QT8 A;  2V88 A;  2LMZ A;  2N8X A;  3OML A;  2EPO A;  1BBO A;  1T39 A;  1Y4S A;  1ZBT A;  5LMN I;  4WX9 A;  2EMI A;  4X66 I;  4JG4 A;  4DV6 I;  1T4O A;  4P78 A;  1H74 A;  1K47 A;  2GPI A;  3BBG A;  2CG9 A;  1YPN A;  4TUI A;  4F6M A;  3J81 C;  1WXR A;  1FWL A;  3KRN A;  2O1W A;  3H4L A;  4XTJ A;  4JI7 I;  4DUZ E;  4O24 A;  2Z5C B;  3L7Z B;  3QG5 C;  4OO1 C;  2Z5B B;  2PNZ B;  1HNX I;  3GME A;  2B7V A;  4R8O A;  1A1K A;  2WP8 B;  2Z5C A;  4KQV A;  2EOF A;  1XMO E;  4K0K E;  4OOG C;  2CVE A;  2Z5B A;  4RHB B;  3CDI A;  2FTX B;  2WP8 A;  4DV7 I;  1P47 A;  4MU4 A;  1KJK A;  4LF6 E;  3M99 B;  1ELO A;  3PYF A;  4OZE A;  4P7D A;  2NAB A;  4GKJ E;  4JI5 E;  1H72 C;  2Z5E A;  3BF2 A;  3AUZ A;  2EN8 A;  1SFE A;  3IWB A;  1N34 E;  2V83 A;  2JPA A;  1UN6 B;  4LCH A;  3JAM Q;  1Z0W A;  2JR1 A;  4IZJ B;  4DPX A;  1XNR I;  5K36 C;  4LCF A;  4LFA I;  3LML A;  1X6E A;  2N3G A;  3IWC A;  4KWY A;  2F4V E;  4X8W A;  2R42 A;  4IZJ A;  1NEI A;  2NN6 F;  2F1D A;  3OTO I;  1I94 I;  4FW6 A;  1Z0B A;  2EPN A;  2YTI A;  1XNQ I;  2WBT A;  4P7A A;  4ED4 A;  2EN4 A;  1BKN A;  2CGE A;  4UTG A;  2EMX A;  1XMQ I;  2PO2 B;  2V8Q B;  2EMG A;  2VQF E;  4B3S E;  5IT9 C;  5IV8 B;  4FWH A;  1UDS A;  5AE2 A;  4N3O A;  1N32 E;  2EQ0 A;  4BA1 B;  4LTY A;  1ZXN A;  2KHX A;  1PVG A;  4QNJ A;  2UUB I;  2O1U A;  1OYP A;  2UXD E;  2KON A;  2YT4 A;  2YTG A;  4ZYH A;  5AC4 A;  3P3E A;  1DQ3 A;  1YYO A;  1NCS A;  1E3P A;  3NZK A;  1N36 E;  4OO1 B;  2JYA A;  4IFD D;  3V2U C;  2KOU A;  4R2S A;  1Y60 A;  4DR4 I;  1H73 A;  4JI8 E;  2YTD A;  5KL4 A;  4OO1 A;  4I8O A;  4F9B B;  4R2A A;  2LT7 A;  4IJD A;  4Z7C A;  4USM A;  2EPP A;  2EWL A;  2EMW A;  1PKP A;  4X62 I;  2EPU A;  4HY1 A;  3P1X A;  4DPU A;  1AAY A;  1DGC A;  5EL9 A;  1RR9 A;  2EL4 A;  5L3J A;  4LFC E;  2IOQ A;  2HFU A;  1R6M A;  1Z0V A;  2EFG A;  4R2E A;  5K36 B;  3J80 Q;  4EMD A;  2C37 B;  2DMY A;  2IOP A;  4X65 E;  4FW9 A;  2EPL X;  2YPN A;  4DR3 I;  2YTO A;  5K36 A;  1TN9 A;  4L8N A;  3JAM C;  1E3H A;  5A2Q Q;  5A6B D;  4DUZ I;  3C4B A;  4M0V A;  2C37 A;  1X6F A;  2BA1 G;  2IES A;  3ZZU A;  4LF9 E;  5AE3 A;  3J7A G;  1XMO I;  3LPS A;  4K0K I;  3QT6 A;  3VYY A;  2BR2 B;  2UUC E;  2VRD A;  1IQO A;  4WSP A;  2VF1 A;  1D6T A;  3P3G A;  2LRS A;  2YU8 A;  4LF6 I;  4DV7 E;  1USV A;  1RMD A;  4NBQ A;  4MLQ A;  3ZOQ B;  2HKE A;  4GKJ I;  3JU0 A;  1HNW E;  4R03 A;  1Z1B A;  3J81 Q;  4JI5 I;  3UK3 C;  1G2F C;  1N34 I;  2ZM6 E;  2HC5 A;  4DV2 E;  2V34 A;  3ZZ0 A;  1AH5 A;  1Z0T A;  2F4V I;  1IQS A;  3TQM A;  1ZR9 A;  2ELY A;  3U1Y A;  4UT4 A;  4TUG A;  2DLQ A;  2EN6 A;  2PO0 B;  1S16 A;  2EOO A;  4ZYD A;  2I13 A;  2ENA A;  2E5L I;  2Q8U A;  4BMJ A;  2DMI A;  2DEJ A;  4WXD A;  3QT5 A;  5FWK A;  1HR0 I;  2CT1 A;  2VQF I;  3M85 D;  4B3S I;  4BBY A;  4YHH I;  4X64 E;  4WUD A;  4DR5 E;  2JP9 A;  2E1R A;  3PYD A;  3QT7 A;  2PO1 B;  5LL6 R;  4DR1 E;  4B3T E;  4Q28 A;  1N32 I;  4QNK A;  5K36 F;  2PO1 A;  2UXD I;  2EML A;  2EPA A;  1XHK A;  4MU3 A;  2DIX A;  1MG7 A;  1WUU A;  1OJ4 A;  5DRP A;  4X9J A;  1WRJ A;  1H7S A;  3IWD A;  4YY3 I;  1N36 I;  2ENH A;  4O4K A;  2YTN A;  4DV0 E;  2X36 A;  4OKG A;  4R2C A;  2CZ9 A;  4R2P A;  1ZM3 A;  4JI8 I;  2FGG A;  1RQ0 A;  2PRT A;  3WU6 A;  2N3H A;  3THO B;  2EOQ A;  3LTO A;  1ZBQ A;  2GLI A;  2RQL A;  4X62 E;  1H7U A;  2BB8 A;  2EN3 A;  2L8T A;  2R76 A;  3PS2 A;  4LFC I;  4FW3 A;  2JEA B;  3H1C A;  1MX0 A;  3EPH A;  3ZKD A;  1GZ6 A;  2EN2 A;  1WHQ A;  2JEA A;  2O1T A;  2LVH A;  3LNU A;  3UHM A;  4X65 I;  4MQY A;  3MHH C;  4GZN C;  4DR3 E;  3H09 A;  4IFD E;  1FWK A;  1PIE A;  5GMD A;  4JI6 I;  2C38 A;  3ZKB A;  3KWR A;  4LF9 I;  1YUI A;  2ODR D;  3VK6 A;  2EOJ A;  2RTX A;  4BC7 A;  2HJJ A;  2WZO A;  1YUJ A;  4JI1 E;  4M30 A;  4NXM E;  4FW4 A;  2UUC I;  2A25 A;  1MU5 A;  3DD6 A;  3HXL A;  1EH8 A;  1WJP A;  1A1H A;  1RRE A;  4USK A;  1HNW I;  2ZM6 I;  2PNM A;  3Q6M A;  3ADL A;  1BBG A;  4DV2 I;  4FWG A;  1MGT A;  5A69 A;  4DV5 E;  2ENC A;  3PRY A;  1STU A;  1PDA A;  4WUB A;  5C0X F;  3L00 A;  4HEI A;  1EA6 A;  3P3C A;  1TF3 A;  4J8Z A;  1KTV A;  4BHB A;  2EPK X;  5IWA E;  4DR6 E;  2EM6 A;  4NXN E;  4DR7 I;  2EZ6 A;  2EM0 A;  2NPF A;  2V8P A;  1JK1 A;  2BM0 A;  1HR0 E;  1OYR A;  2EM2 A;  2V87 A;  1PJT A;  1UBD C;  4X64 I;  4DR5 I;  5ADZ A;  2B9D A;  4YHH E;  4DR1 I;  4B3T I;  2EJ4 A;  2EOI A;  4Q35 B;  4IFD B;  1A1G A;  2EMY A;  4HTG A;  4BC9 A;  4DR7 E;  2L3J A;  2PNL A;  2EMK A;  5A6A A;  3CWV A;  3WU4 A;  4IFD A;  2V86 A;  2HFS A;  3J7A M;  1X47 A;  2EOY A;  5T6J A;  2M1S A;  4F6N A;  4JI2 E;  4DV0 I;  3EPJ A;  4YY3 E;  2GS8 A;  4MYU A;  2LUP B;  2EOM A;  4N4R B;  2EM9 A;  5A6J A;  4R2R A;  1R6L A;  3P06 A;  5DNX A;  3WU5 A;  4ZYE A;  2EM4 A;  3FIG A;  3U1K A;  3THN A;  4R2Q A;  1Z0G A;  2WNR A;  4MU0 A;  2X7I A;  2CSH A;  3ADJ A;  4LF5 E;  1A1I A;  1IMU A;  2EL5 A;  2EOE A;  3T1H E;  1VIS A;  2EPC A;  2EM7 A;  2YTQ A;  5A6B A;  2JWO A;  2LV2 A;  2LCE A;  4NZV A;  3RMP A;  5JEA E;  2CTD A;  1EH6 A;  3C6M A;  3ZM7 A;  3HPZ A;  4WFT A;  5AE1 A;  3B8H A;  4MYT A;  4OX9 I;  3EPK A;  2WBU A;  4FW5 A;  5KL2 A;  4DUY E;  5F3W A;  4JI6 E;  3ADI A;  2J7J A;  2I9I A;  2MKD A;  4LF4 E;  2IER A;  2OI2 A;  1FKA E;  4JI1 I;  1MEY C;  4NXM I;  4HYM A;  2L2M A;  1IBK E;  3B4T A;  3D4J A;  1Z59 A;  2RSI A;  4R1F A;  3M7N D;  2YRH A;  4M1K A;  4FN5 A;  2EPX A;  2RS6 A;  5BR8 E;  5IXM B;  2EOZ A;  2EM8 A;  2VQE E;  4WXC A;  4ZYG A;  2ZIT A;  1X48 A;  2JVA A;  2V2V A;  2GQ0 A;  4DV5 I;  2EN1 A;  4IZK A;  3K85 A;  1N0V C;  1HNZ E;  2LJH A;  3HQ1 A;  2UUA E;  4OO1 F;  3BGH A;  5IWA I;  1YZ9 A;  4DR6 I;  4NXN I;  2BA0 D;  4WPY A;  1YH8 A;  2BV3 A;  2L3C A;  3C4T A;  1T4N A;  5LLQ A;  2NUG A;  4PRX A;  2LTS A;  2YZT A;  1ZXM A;  1X5W A;  3F6G A;  2YTF A;  2JXP A;  2M9A A;  2HKJ A;  4MU1 A;  1DAR A;  5JEA A;  2NN6 E;  3K6Q A;  2RPC A;  3C6K A;  2AJ4 A;  1SR9 A;  1ZM4 A;  2EE8 A;  4JYA E;  1KYQ A;  2R3V A;  4ISA A;  2H36 X;  2CPN A;  2F8B A;  1U2R A;  2YTP A;  3VYX A;  5JEA D;  3MHS C;  4JI2 I;  3WU3 A;  4U3B A;  2DLK A;  3ECR A;  3J7Y p;  2ADR A;  5KL7 A;  1Z5C A;  4DV4 E;  1NZ0 A;  3PYE A;  1G2D C;  2JY9 A;  4URL A;  2RSM A;  1BB8 A;  1Y5Y A;  4LOM A;  1UEK A;  3B82 A;  4NHR A;  2DSY A;  2HK3 A;  4LF5 I;  3PS1 A;  4BS9 A;  3GLL A;  4F9C B;  3T1H I;  4LF8 I;  2L2N A;  3VHT B;  4IFD C;  2LUQ A;  2JT2 A;  3P76 A;  4WSG A;  5AC5 A;  2VF3 A;  2UXB E;  2JE6 B;  4GQU A;  4O43 A;  4R2D A;  5A6K A;  1OYS A;  2YSO A;  4F2J C;  4JI0 E;  2V2Q A;  3KZZ A;  3AV0 A;  4F54 A;  3K17 A;  2C38 B;  3DJW A;  2JE6 A;  4ZVI A;  1B62 A;  2EMB A;  4OX9 E;  2GHF A;  1QZR A;  2J65 A;  4DUY I;  5DRQ A;  2EMH A;  3F6H A;  5FLX C;  1X6H A;  1ZM9 A;  4LF4 I;  3EQ1 A;  1EKZ A;  4HXZ A;  4AM3 A;  1IBK I;  4GEQ B;  1GQE A;  1Y4U A;  2GO4 A;  4BA2 A;  2NN6 A;  4JI4 E;  2UU9 I;  2E1M A;  3PS3 A;  2J7K A;  4GKK E;  5C0X D;  2BBG A;  5BR8 I;  2VQE I;  1Z5A A;  5DRO A;  3M85 G;  2DGC A;  2EPM X;  5ELW A;  2M4I A;  2MDR A;  1L4S A;  1Z5B A;  2NN6 D;  1P42 A;  1FJG E;  4KZS A;  4MLV A;  4PRV A;  4AID A;  1Z0C A;  2LO3 A;  5DNY A;  2JOB A;  2L6M A;  2LTR A;  2B3T B;  2K7I A;  4DV3 E;  3CDJ A;  1HNZ I;  1UIL A;  4L5N C;  2UUA I;  2IHR 1;  1YFH A;  2UXC E;  2YRK A;  3HPS A;  2HGH A;  1A1J A;  1UHZ A;  2E72 A;  1JK2 A;  1RHY A;  1UDN A;  5AAS A;  2ZBK B;  3L7Z A;  1J5E E;  2EOX A;  2PNZ A;  4DPW A;  3F0N A;  3K1J A;  4WYQ B;  1S4E A;  4OO1 E;  2L33 A;  5DRR A;  1TF6 A;  4M9V C;  2EMA A;  2B7T A;  1EH7 A;  3BID A;  4JYA I;  3ADG A;  3DF6 A;  4B3R I;  5KL3 A;  4O5G A;  2EMZ A;  2EMC A; 
#chains in the Genus database with same CATH homology
 1IBM E;  4DR2 E;  2M7Q A;  2MC6 A;  4DV4 I;  4JI3 I;  2NUE A;  4B3M I;  3PYG A;  4KHP I;  2DB2 A;  4PU9 A;  4LF7 E;  4IZJ D;  2V89 A;  4DV1 I;  2HHH E;  1NHJ A;  5LMU E;  2LBS B;  4DU8 A;  2E5L E;  4DPY A;  2FV4 B;  1T4L B;  4JV5 E;  4HAC B;  4LF8 E;  1J26 A;  2JOX A;  2UXB I;  2K4V A;  2DEI A;  1WHN A;  3B78 A;  4HAC A;  3T1Y E;  4JI0 I;  1N33 E;  3LLH A;  4P52 A;  3HUL A;  1KKH A;  4AQY E;  2G7H A;  3Q6N A;  1QU6 A;  1IBL I;  2Q2E B;  4JI4 I;  4DPT A;  4DXL A;  1YYK A;  4LFB E;  4GKK I;  1X49 A;  5CFF E;  2UU9 E;  2LE2 A;  1B63 A;  1FNM A;  4IZK B;  1RC7 A;  5LMN E;  1FJG I;  4X66 E;  4DV6 E;  1EI1 A;  4BCA A;  2L2K B;  4RPF A;  4DV3 I;  2ODR C;  2L92 A;  5FLX Q;  2UXC I;  1Z0E A;  4JI7 E;  1KVK A;  3HJC A;  1J5E I;  1HNX E;  2O1V A;  1HK7 A;  1ZM2 A;  1Y6Z A;  2WW4 A;  4Z7Y A;  4DMI A;  2LJP A;  3Q1Q A;  3ZZT A;  1FI4 A;  4B3R E;  1IBM I;  1KIJ A;  1XNR E;  4DR2 I;  2BM1 A;  4LFA E;  1USU A;  2NA2 A;  3M6A A;  4JI3 E;  3OTO E;  1I94 E;  1YYW A;  4B3M E;  4LF7 I;  4KHP E;  3V5R A;  1XNQ E;  2HHH I;  5LMU I;  1XMQ E;  4DV1 E;  4M2Z A;  2HK2 A;  2E5L I;  2V2Z A;  4DU7 A;  4JV5 I;  2A2C A;  1NHH A;  1A6F A;  3JTZ A;  1N0U A;  2XEX A;  4FWD A;  3T1Y I;  2UUB E;  5GME A;  1N33 I;  2VE7 C;  4DKK A;  2RS7 A;  1O0W A;  2MC5 A;  4WUC A;  3J80 C;  2V85 A;  1DI2 A;  4AQY I;  4F9A B;  4DR4 E;  3MSW A;  3GON A;  5IT9 Q;  5A2Q C;  1IBL E;  3HTX A;  4LFB I;  1NHI A;  2A2D A;  4LU9 A;  3QT8 A;  2V88 A;  2LMZ A;  3OML A;  1Y4S A;  1ZBT A;  5LMN I;  4X66 I;  4JG4 A;  4DV6 I;  1T4O A;  4P78 A;  1H74 A;  1K47 A;  2CG9 A;  4ED4 A;  4TUI A;  1FWL A;  3J81 C;  1WXR A;  2O1W A;  3H4L A;  4XTJ A;  4JI7 I;  4DUZ E;  2Z5C B;  2Z5B B;  1HNX I;  2B7V A;  4R8O A;  2Z5C A;  4KQV A;  1XMO E;  4K0K E;  4OOG C;  2Z5B A;  2FTX B;  4DV7 I;  4LF6 E;  1ELO A;  3PYF A;  4P7D A;  4GKJ E;  4JI5 E;  1H72 C;  2Z5E A;  3AUZ A;  3JAM Q;  3IWB A;  1N34 E;  2V83 A;  1Z0W A;  2JR1 A;  4IZJ B;  4DPX A;  1XNR I;  4LFA I;  3LML A;  2F4V E;  2N3G A;  3IWC A;  4X8W A;  2R42 A;  4IZJ A;  3OTO I;  1I94 I;  1Z0B A;  1XNQ I;  4P7A A;  1BKN A;  2CGE A;  4UTG A;  1XMQ I;  2V8Q B;  2VQF E;  4B3S E;  5IT9 C;  4FWH A;  5AE2 A;  4N3O A;  1N32 E;  4LTY A;  1ZXN A;  2KHX A;  1PVG A;  2UUB I;  2O1U A;  2UXD E;  2KON A;  2YT4 A;  1DQ3 A;  1YYO A;  1N36 E;  3V2U C;  2KOU A;  4DR4 I;  1H73 A;  4JI8 E;  4I8O A;  4F9B B;  4Z7C A;  4USM A;  2EWL A;  4X62 I;  1PKP A;  4HY1 A;  3P1X A;  4DPU A;  1RR9 A;  5L3J A;  4LFC E;  2IOQ A;  2HFU A;  1Z0V A;  2EFG A;  3J80 Q;  4EMD A;  2DMY A;  2IOP A;  4X65 E;  4FW9 A;  4DR3 I;  4L8N A;  3JAM C;  5A2Q Q;  4DUZ I;  3C4B A;  4M0V A;  3ZZU A;  4LF9 E;  5AE3 A;  3J7A G;  1XMO I;  3LPS A;  4K0K I;  3QT6 A;  3VYY A;  2UUC E;  4WSP A;  2VF1 A;  1D6T A;  2LRS A;  4LF6 I;  4DV7 E;  1USV A;  3ZOQ B;  2HKE A;  4GKJ I;  3JU0 A;  1HNW E;  4R03 A;  3J81 Q;  4JI5 I;  1N34 I;  2ZM6 E;  4DV2 E;  2V34 A;  3ZZ0 A;  1Z0T A;  2F4V I;  4UT4 A;  4TUG A;  1S16 A;  3QT5 A;  4BMJ A;  2DEJ A;  1HR0 I;  5FWK A;  2VQF I;  4B3S I;  4BBY A;  4YHH I;  4X64 E;  4WUD A;  4DR5 E;  3PYD A;  2E1R A;  1N32 I;  3QT7 A;  5LL6 R;  4DR1 E;  4B3T E;  4Q28 A;  2UXD I;  1XHK A;  2DIX A;  1MG7 A;  1WUU A;  1OJ4 A;  1H7S A;  3IWD A;  4YY3 I;  1N36 I;  4DV0 E;  2X36 A;  2CZ9 A;  1ZM3 A;  4JI8 I;  2FGG A;  1RQ0 A;  3WU6 A;  2N3H A;  3LTO A;  1ZBQ A;  4X62 E;  1H7U A;  2L8T A;  4LFC I;  1MX0 A;  3ZKD A;  1GZ6 A;  1WHQ A;  2O1T A;  3LNU A;  4X65 I;  4DR3 E;  3H09 A;  1FWK A;  1PIE A;  5GMD A;  4JI6 I;  3ZKB A;  3KWR A;  4LF9 I;  2ODR D;  3VK6 A;  2RTX A;  4BC7 A;  4JI1 E;  2WZO A;  4NXM E;  2UUC I;  4M30 A;  1MU5 A;  3HXL A;  4USK A;  1RRE A;  1HNW I;  2ZM6 I;  2PNM A;  3Q6M A;  3ADL A;  4DV2 I;  4FWG A;  4DV5 E;  3PRY A;  1STU A;  4WUB A;  1EA6 A;  4J8Z A;  1KTV A;  5IWA E;  4DR6 E;  4NXN E;  2EZ6 A;  2NPF A;  2V8P A;  2BM0 A;  1HR0 E;  2V87 A;  4X64 I;  4DR5 I;  5ADZ A;  2B9D A;  4YHH E;  4DR1 I;  4B3T I;  4BC9 A;  4DR7 E;  3WU4 A;  2L3J A;  2PNL A;  3CWV A;  2V86 A;  2HFS A;  3J7A M;  1X47 A;  5T6J A;  2M1S A;  4JI2 E;  4DV0 I;  4YY3 E;  2GS8 A;  4MYU A;  2LUP B;  3WU5 A;  3P06 A;  3FIG A;  1Z0G A;  2X7I A;  3ADJ A;  4LF5 E;  3T1H E;  1VIS A;  2JWO A;  3RMP A;  3ZM7 A;  3HPZ A;  4WFT A;  5AE1 A;  3B8H A;  4MYT A;  4OX9 I;  4DUY E;  5F3W A;  3ADI A;  4JI6 E;  2OI2 A;  4LF4 E;  4JI1 I;  1FKA E;  4NXM I;  4HYM A;  2L2M A;  1IBK E;  3D4J A;  1Z59 A;  4R1F A;  4M1K A;  4FN5 A;  2RS6 A;  5BR8 E;  2VQE E;  2ZIT A;  1X48 A;  2JVA A;  2V2V A;  2GQ0 A;  4DV5 I;  4IZK A;  3K85 A;  1N0V C;  1HNZ E;  2LJH A;  3HQ1 A;  2UUA E;  5IWA I;  1YZ9 A;  4DR6 I;  4NXN I;  4WPY A;  2BV3 A;  2L3C A;  3C4T A;  1T4N A;  2NUG A;  4PRX A;  2LTS A;  2YZT A;  1ZXM A;  3F6G A;  2HKJ A;  1DAR A;  3K6Q A;  4DR7 I;  2AJ4 A;  1SR9 A;  1ZM4 A;  2R3V A;  4JYA E;  2H36 X;  2CPN A;  2F8B A;  1U2R A;  3VYX A;  4JI2 I;  3WU3 A;  3J7Y p;  1Z5C A;  3PYE A;  4DV4 E;  1NZ0 A;  2JY9 A;  4URL A;  2RSM A;  1UEK A;  3B82 A;  2DSY A;  2HK3 A;  4LF5 I;  4BS9 A;  4F9C B;  3T1H I;  4LF8 I;  2L2N A;  2LUQ A;  2VF3 A;  2UXB E;  2V2Q A;  4I3H A;  4JI0 E;  3K17 A;  3AV0 A;  4F54 A;  4ZVI A;  3DJW A;  1B62 A;  4OX9 E;  1QZR A;  4DUY I;  3F6H A;  5FLX C;  1ZM9 A;  4LF4 I;  1EKZ A;  4HXZ A;  1IBK I;  4GEQ B;  1GQE A;  1Y4U A;  4JI4 E;  2UU9 I;  2E1M A;  2J7K A;  4GKK E;  5BR8 I;  2VQE I;  1Z5A A;  2M4I A;  2MDR A;  1Z5B A;  1FJG E;  4KZS A;  4PRV A;  1Z0C A;  5DNY A;  2JOB A;  2L6M A;  2LTR A;  2B3T B;  4DV3 E;  1HNZ I;  2UUA I;  1UIL A;  4L5N C;  2IHR 1;  2UXC E;  3HPS A;  1UHZ A;  5AAS A;  2ZBK B;  1J5E E;  4DPW A;  3F0N A;  3K1J A;  4WYQ B;  1S4E A;  2L33 A;  2B7T A;  4JYA I;  3ADG A;  3DF6 A;  4B3R I;  2NUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...