4DV0E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0E02
1N0UA 4DV6E 2DIXA 2WW4A 2N3GA 1Z0VA 2HKJA 4X65E 1YYKA 1NZ0A 1A6FA 3QT6A 3J7AG 4YHHI 1J26A 3OTOI 4KHPI 1XNRE 1UHZA 4LF4I 4HY1A 2E5LE 4OOGC 2DMYA 4B3RE 2UUCE 2A2CA 2L33A 2GS8A 4OX9E 2VQFI 1OJ4A 2LUQA 2N3HA 3J80C 4JI1E 1NHHA 1ZM2A 1QU6A 5CFFE 2HHHI 3ZZ0A 1PVGA 2ZITA 4ZVIA 1Z0GA 4DV2I 1XMQI 4B3ME 3LPSA 4JI2I 4X66E 1B62A 4DV4I 4P52A 4JI3E 4B3SE 4LF6E 1XHKA 4NXNE 4DR3I 3C4TA 3J7AM 1H74A 4DU8A 1RREA 1ZXNA 4DUYE 5IWAI 4DV7I 2NUFA 3WU4A 4DPWA 4WFTA 1VISA 4K0KI 1H73A 1N32E 5LMUE 4JI6E 3CWVA 4X62I 1IBLI 3B82A 2V2ZA 4UT4A 4GKJI 2E1RA 2NUEA 1FWKA 3T1YI 1HNXE 1Z5CA 2YT4A 2HFSA 3QT7A 4JI0I 4LF8E 1FJGI 1QZRA 4AQYI 4DR7E 3ADLA 2HFUA 3VYXA 1B63A 2B7TA 3ZM7A 4LF4E 4DPYA 1Z0CA 4JI5I 4DXLA 2R42A 1DI2A 1ZBTA 5IT9Q 4JI8I 3JAMQ 1D6TA 2NA2A 5BR8I 2RSMA 4M1KA 1MG7A 2UUBI 3J81Q 3HULA 1N0VC 1IBME 3PYGA 1XMQE 2VF3A 4DKKA 1T4LB 1ZM4A 2LBSB 2BM1A 1FKAE 4EMDA 4DR5I 3ZKDA 4GKKI 4DR1E 2EFGA 4LFAI 2ZBKB 4WUDA 4URLA 4PRVA 1XNQI 1I94I 5IWAE 2NUGA 4USKA 4KQVA 2UU9I 4JYAI 1MX0A 1N34E 4LF7E 4FWGA 1RR9A 4YY3I 1NHJA 1Z5AA 4JV5I 5LL6R 4MYTA 1RC7A 4X62E 3ADGA 1KTVA 1J5EE 2RTXA 4UTGA 1Z0EA 3T1YE 4LFCE 4Z7YA 4DUZI 3D4JA 1H72C 4DR6E 4M30A 4LF9I 2RS7A 4FN5A 4JI4E 1X48A 2CZ9A 4AQYE 5GMDA 3V2UC 1XMOI 4DR2E 4B3TE 2VQEE 3K17A 1STUA 2F4VE 3HTXA 2L3JA 2UUAI 1MU5A 2Q2EB 4ED4A 1Z0BA 2LJPA 3ZZUA 4DU7A 3WU6A 1N33I 4LFBI 3WU5A 2HK3A 3T1HE 1N36I 4LF5E 1IBKE 5LMNI 2UXCE 2A2DA 4DV0I 1HR0I 1ELOA 1RQ0A 3QT8A 1KVKA 1FNMA 5GMEA 2UXBI 4NXMI 2UXDE 3PYFA 2X7IA 1EI1A 4X8WA 5A2QQ 4X64I 2ZM6I 3K1JA 1XNQE 3WU3A 4DV6I 1PIEA 4FWDA 2L2NA 4YHHE 3OTOE 4WUBA 4KHPE 3VYYA 4Z7CA 1X49A 1Z59A 1XNRI 1KIJA 3J7Yp 2HKEA 4JG4A 1BKNA 1ZXMA 2E5LI 1T4OA 4DUZE 5L3JA 2L3CA 2L2MA 4B3RI 4RPFA 2UUCI 3ZZTA 4XTJA 3LTOA 2VQFE 1FI4A 4OX9I 3ADJA 1EA6A 2J7KA 4JI1I 1Z0WA 2HHHE 4DV1I 2AJ4A 4DV2E 4I3HA 4JI2E 4HYMA 4DV4E 1K47A 4B3MI 2MDRA 4X66I 4DV5I 4HACA 4DR4I 5FLXQ 5IT9C 4JI3I 3PYEA 3JAMC 1HNWI 1UEKA 4DR3E 4B3SI 4LF6I 3GONA 2X36A 2KHXA 3B78A 4NXNI 3J81C 4DV7E 1HR0E 1DARA 4PRXA 4K0KE 2UXBE 3LNUA 4NXME 3M6AA 2XEXA 1N32I 2DEJA 4DV3I 3F0NA 5LMUI 3H4LA 1U2RA 2JY9A 4JI6I 1IBLE 4HACB 4GKJE 1HNZI 3C4BA 4WUCA 4USMA 1HNXI 4JI0E 4LF8I 1FJGE 4MYUA 3J80Q 4WYQB 1YYOA 3ZKBA 1S16A 4DPXA 1H7SA 4DR7I 4JI5E 1X47A 4FWHA 1O0WA 1ZM3A 1YYWA 4JI8E 1T4NA 2B7VA 2RS6A 2V8PA 4R1FA 5BR8E 1WHQA 2UUBE 4DV1E 3QT5A 2LTSA 1IBMI 3P1XA 3LLHA 4P7AA 2CPNA 1ZM9A 4DR5E 4DV5E 4GKKE 1H7UA 1EKZA 4DR4E 4LFAE 3Q1QA 4DR1I 2LRSA 1HNWE 2V2VA 2IHR1 4JI7I 2B3TB 1I94E 2EZ6A 2LJHA 1S4EA 2UU9E 4JYAE 4X65I 3V5RA 4YY3E 2L2KB 1N34I 4LF7I 4JV5E 4DV3E 4M2ZA 1J5EI 5A2QC 2NPFA 1HNZE 2DEIA 1UILA 2V34A 4LFCI 4LF9E 4DR6I 3ADIA 1WUUA 4JI4I 2DB2A 4HXZA 1XMOE 2JVAA 4DR2I 4B3TI 1KKHA 1PKPA 2BV3A 4DPTA 4DPUA 2VQEI 2F4VI 2UUAE 1N33E 4LFBE 2OI2A 1WHNA 3B8HA 1GQEA 1N36E 1YZ9A 1NHIA 2LTRA 3T1HI 5LMNE 4LF5I 1IBKI 4DV0E 2LUPB 2V2QA 4DUYI 1FWLA 2UXCI 2HK2A 4FW9A 1Z0TA 2R3VA 4JI7E 5FLXC 2UXDI 3PYDA 4PU9A 4X64E 2ZM6E 2BM0A 1Z5BA
chains in the Genus database with same CATH superfamily
4WXDA 1N0UA 4DV6E 1Y4SA 5FWKA 4M9VC 2DIXA 5JEAD 2WW4A 2EL4A 2N3GA 2ENCA 3EQ1A 4X65E 1P47A 2BB8A 1YYKA 1Z0VA 1X6FA 2HKJA 2EPPA 1NZ0A 1A6FA 2EOXA 2YRHA 3J7AG 2HC5A 1HK7A 3QT6A 5C0XF 4IFDE 2EMKA 4YHHI 1J26A 3OTOI 5AC4A 2L92A 4KHPI 2PO0B 1TF3A 1NCSA 1XNRE 4AIDA 5K36A 5A6KA 2E1MA 1UHZA 2EN3A 1T38A 5IV8B 4LF4I 4HY1A 2E5LE 3HPSA 2JOBA 4IFDC 4OOGC 2DMYA 4GEQB 4B3RE 2UUCE 2JP9A 5DNLA 2EOHA 4WX9A 1T39A 2A2CA 2L33A 2BA0D 3P3EA 2GS8A 4OX9E 2EMHA 4QNJA 3K6QA 5K36F 2M1SA 2VQFI 1OJ4A 2LUQA 4IZJA 2N3HA 2I13A 3J80C 4JI1E 3U1KA 1X6EA 2EQ3A 1NHHA 4N4RB 3AUZA 1ZM2A 2Q8UA 1QU6A 2HGHA 2EORA 5CFFE 2HHHI 3ZZ0A 2CTDA 1PVGA 2ZITA 4ZVIA 1Z0GA 4DV2I 1XMQI 2CT1A 2YU8A 2B9DA 2ELYA 4B3ME 3LPSA 4JI2I 4X66E 1B62A 3B4TA 4DV4I 4L8NA 4P52A 4NHRA 2M9AA 2EOYA 4JI3E 2EMAA 4B3SE 4LF6E 4OO1D 2G7HA 1R6LA 3L7ZA 1YH8A 2JT2A 1XHKA 2Z5BB 3HKMA 4NXNE 4LPFA 4DR3I 3C4TA 3J7AM 1H74A 4DU8A 1RREA 1ZXNA 2WCC3 1N3GA 4DUYE 4IZJB 1BB8A 2EPZA 1F2IG 5A6BD 5IWAI 4DV7I 4IFDA 2BA1G 3PS2A 2V8QB 2NUFA 3WU4A 5KL3A 2YWQA 3FIGA 4DPWA 4ZYDA 4TUIA 3VK6A 1PJTA 2JXPA 4Q28A 4WFTA 1VISA 4U3DA 4K0KI 1H73A 1N32E 5LMUE 4FW6A 4JI6E 3Q6NA 3CWVA 2RPCA 2WBTA 4X62I 4IFDF 3RMPA 1IBLI 3IWDA 3B82A 4R2AA 2V2ZA 4UT4A 4GKJI 2EL5A 2E1RA 2NUEA 1FWKA 3T1YI 2DMIA 1HNXE 3L7ZB 2JWOA 1Z5CA 4LCGA 2YT4A 2V88A 1UBDC 2HFSA 3QT7A 2YTQA 2EN6A 2H36X 3F6HA 4JI0I 4LF8E 3THNA 4F9BB 1B69A 2Z5EA 3DD6A 1ZBQA 2WNRB 2F8BA 2I9IA 5KL5A 2EL6A 4FW4A 1FJGI 5C0XC 1QZRA 2ENHA 1A1HA 4AQYI 3M85G 4DR7E 3ADLA 2HFUA 3VYXA 1B63A 2DRPA 2B7TA 2GO3A 4IZKA 2JOXA 4LF4E 2HJJA 3PS3A 4TUGA 1RHYA 1Z1BA 1Z0CA 3ZM7A 2K4VA 2ENAA 2JE6B 4DPYA 4JI5I 4AIMA 2EWLA 2L6MA 4BCAA 2R42A 4DXLA 4F54A 1DI2A 1YPNA 2MKDA 1ZBTA 3L00A 2YRMA 3GLLA 5KL7A 5JEAC 5IT9Q 4JI8I 5EKWA 3JAMQ 1D6TA 2FV4B 2NA2A 3M85D 1L4SA 5BR8I 4Q35B 1WJPA 2EPAA 2PNLA 2EJ4A 2RSMA 4M1KA 1MG7A 4J8ZA 5KL2A 2BR2B 2UUBI 2DLQA 3J81Q 2IESA 3HULA 1N0VC 1IBME 3Q6MA 3PYGA 1XMQE 2VF3A 2PO1A 4DKKA 1T4LB 4KZSA 1ZM4A 2LBSB 2V87A 1A1GA 2BA0G 2BM1A 4ISAA 2R1FA 4IZKB 1FKAE 4R2PA 1YSAC 1TN9A 4EMDA 4DR5I 3ZKDA 4GKKI 3UHMA 4DR1E 2EFGA 4LFAI 3M99B 2EN2A 2EPNA 2EMIA 2GQ0A 2ZBKB 2YTOA 4WUDA 5C0XA 2YTNA 4IS9A 1LLMC 3ECRA 2NN6E 2BBGA 4URLA 4PRVA 1XNQI 1I94I 2D9HA 2JEAA 1AH5A 2JR1A 2FTXB 5IWAE 2NUGA 4USKA 4KQVA 3PS1A 2UU9I 4JYAI 2EQ0A 1SFEA 2EOMA 1MEYC 1MX0A 1N34E 4LF7E 1BBGA 4FWGA 1RR9A 2VE7C 5ADZA 5ELWA 2EN4A 2PO1B 4YY3I 2EMBA 4OO1E 5JEAA 1DQ3A 5IXMB 1NHJA 1SR9A 1Y6ZA 2EPUA 1Z5AA 2IERA 5LL6R 4MYTA 1RC7A 4X62E 3ADGA 2ELZA 3HXLA 2YTDA 1J5EE 1KTVA 4P7DA 2DLKA 2RTXA 2LV2A 3H09A 4IS1C 4MU1A 4UTGA 1GTKA 1Z0EA 3T1YE 2EPRA 3F6GA 4OO1C 4LFCE 5C0XB 3MSWA 2WBSA 4Z7YA 4DUZI 5JEAF 3D4JA 4MLVA 1H72C 4DR6E 4M30A 3AV0A 3IWBA 4LF9I 2RS7A 3H1CA 3HPZA 4FN5A 2JEAB 2YTGA 3U1YA 3DF6A 4JI4E 5KL6A 2WP8A 1X48A 1A1LA 2CZ9A 4AQYE 1USUA 4R2DA 5GMDA 1UDNA 4O4KA 3V2UC 1XMOI 4DR2E 2VESA 4O5GA 4B3TE 3C6MA 5KL4A 2VQEE 2A25A 3PRYA 5AE3A 3K17A 1OYSA 1STUA 2EE8A 2F4VE 2R76A 2MC6A 5A2QQ 3HTXA 2NN6D 2NABA 2L3JA 5K36B 3EPJA 2UUAI 2EPXA 1MU5A 2Q2EB 4ED4A 1Z0BA 2LJPA 3ZZUA 4DU7A 3WU6A 1N33I 4LCHA 4LFBI 4O24A 3NZKA 5DROA 3WU5A 3GMEA 2HK3A 3T1HE 1N36I 2EM8A 4LF5E 1XXEA 1IQSA 1IBKE 1A1IA 2WP8B 2EM9A 5LMNI 2UXCE 2A2DA 4BMJA 2O1TA 4DV0I 2C39A 1HR0I 4OO1A 3OMLA 1ELOA 4P78A 2EMGA 1RQ0A 2EPKX 2ODRD 2YPNA 1KVKA 2NN6F 3QT8A 2YTIA 4BC9A 3MHSC 1FNMA 4FK5C 4X9JA 5GMEA 4BHBA 5A6BA 3P3GA 2M7QA 4J3DA 2UXDE 4NXMI 2UXBI 3KWRA 3PYFA 2YZTA 4LU9A 1TF6A 3ZOQB 3UK3C 4OO1F 4I8OA 2X7IA 2V86A 4X8WA 1EI1A 1EH8A 2CSHA 4WPYA 3K1JA 1XNQE 3MHHC 3KZZA 2EOQA 1Y4UA 2YU5A 4LOMA 1PJSA 1E3HA 4FW3A 3WU3A 2LO3A 3HQ1A 4BA2A 1UDSA 4DV6I 1PIEA 2LCEA 1YUIA 3BIDA 2MKNA 4FWDA 4N3OA 2WBUA 1EH7A 2C37A 2L2NA 4YHHE 1JK2A 5DRPA 3OTOE 4WUBA 2VRDA 2PRTA 4IFDB 2N8XA 4KHPE 2FGGA 3VYYA 2C38A 2EPOA 4R03A 4Z7CA 1X49A 1Z59A 1XNRI 3GCMA 1KIJA 3J7Yp 2HKEA 4ZYGA 4JG4A 1BKNA 1ZXMA 2E5LI 3BGHA 4NZVA 1T4OA 5LLQA 2DGCA 1QNTA 4DUZE 5A69A 2AE8A 5L3JA 2L3CA 2L2MA 4B3RI 2EMZA 4RPFA 5DNXA 2E72A 3ZZTA 2UUCI 4F9CB 4XTJA 1YFHA 3EPLA 4RH8A 2LMZA 2VQFE 1A1KA 1FI4A 3LTOA 3ADJA 5EL9A 1PDAA 2EQ1A 4BC7A 4OX9I 1UN6B 2IOQA 1EA6A 4OKGA 3DJWA 2PNZA 2K7IA 2J7KA 4JI1I 1Z0WA 2HHHE 4DV1I 2AJ4A 2EN1A 4DV2E 4MU0A 2Z5CA 4I3HA 4JI2E 4QNKA 4HYMA 2YSPA 3VHTB 2YTFA 4DV4E 1K47A 3IWCA 4B3MI 2MDRA 4X66I 1UDQA 4R2CA 4DV5I 4HACA 4DR4I 5FLXQ 5IT9C 3BBGA 4BA1A 3PYEA 3JAMC 4JI3I 1HNWI 2LVHA 1UEKA 4DR3E 4B3SI 4LF6I 3GONA 2X36A 2KHXA 3B78A 4NXNI 1PJQA 4R2EA 3J81C 4DV7E 1HR0E 2EOIA 1DARA 2PNZB 5A6AA 4PRXA 2PO0A 2YSOA 4F9AB 2NN6C 4K0KE 2Z5CB 1ZAAC 3M7ND 2UXBE 3LNUA 4F6NA 1MGTA 2EOEA 4NXME 3M6AA 2XEXA 1ZR9A 4FW5A 1N32I 2DEJA 2EPMX 3F0NA 5LMUI 3H4LA 3JTZA 2JY9A 1U2RA 4DV3I 4JI6I 1IBLE 4HACB 4GKJE 2EMXA 2JEBA 2EMYA 2EOSA 2KONA 3P76A 4BA1B 1JK1A 1HNZI 3C4BA 5F3WA 4WUCA 4USMA 2EMLA 4HEIA 1HNXI 2KOUA 4JI0E 1R6MA 5K36D 1YUJA 2PNMA 4LF8I 2LE2A 1FJGE 2GLIA 4MYUA 1DGCA 2ODRC 3J80Q 4WYQB 1YYOA 4R2QA 1X5WA 3ZKBA 2VF1A 1S16A 4DPXA 1H7SA 5A6JA 4DR7I 1P42A 4JI5E 1X47A 2M4IA 5JEAB 4WXCA 2LJUA 4FWHA 1BBOA 3JU0A 1OYPA 4NBQA 1EH6A 1G2FC 2J65A 4R8OA 4FW7A 1O0WA 1A1JA 1ZM3A 4IZJD 1YYWA 2YTJA 2JEBB 4JI8E 1NEIA 1T4NA 1USVA 2B7VA 2RS6A 1Y60A 2V8PA 2Z5BA 4RHBB 2EM0A 5BR8E 2NN6A 4R1FA 5DNYA 2F1DA 4HTGA 2EN8A 1WHQA 2UUBE 4WSPA 4DV1E 3KRNA 2LT7A 3QT5A 5TSEA 2LTSA 4OZEA 4BA2B 1IBMI 4AM3A 2CGEA 2CVEA 3P1XA 1YHCA 4MU4A 2EMWA 3LLHA 4P7AA 2CPNA 1ZM9A 3THOB 4BHCA 4DR5E 4GQUA 1KJKA 4DV5E 4GKKE 1H7UA 3CDIA 2RQLA 2ADRA 1EKZA 4LFAE 4DR4E 3Q1QA 4WSGA 4BBYA 2RSIA 2LRSA 1HNWE 2JYAA 4DR1I 2YRKA 2V2VA 2IHR1 2V89A 2B3TB 4JI7I 4IFDD 1Y5YA 2EM2A 5JEAE 1I94E 2EZ6A 2LJHA 4MLQA 4ZYHA 2MDGA 2NN6B 2J7JA 2EOOA 1S4EA 2EN7A 2EM6A 2UU9E 2WNRA 4JYAE 2GHFA 1IQOA 2V83A 2EMCA 5T6JA 4X65I 3V5RA 1G2DC 2GPIA 4YY3E 2L2KB 1A1FA 1N34I 2C39B 4LF7I 1X6HA 4OO1B 4KWYA 1AAYA 4JV5E 2JE6A 4DV3E 5AASA 2V85A 4M2ZA 2EM7A 1OYRA 3QG5C 5DRQA 1J5EI 2GO4A 4BS9A 1IMUA 3EPHA 5A2QC 5C0XE 2NPFA 2EOZA 1HNZE 2DEIA 5DRRA 1UILA 4R2RA 3HJCA 2V34A 2L8TA 2O1UA 4LFCI 4LF9E 1ZU1A 2O3ZA 4X64I 2IOPA 4DR6I 4LTYA 3ADIA 2BR2A 3M7NG 2EMFA 1WUUA 1RMDA 3C6KA 1UDOA 2YTPA 1E3PA 2DB2A 4JI4I 4HXZA 1XMOE 2C37B 2PO2A 2JVAA 1X3CA 4IJDA 3EPKA 4DR2I 2EM3A 4B3TI 2EPLX 4M0VA 5K36E 1KKHA 1PKPA 2BV3A 2C38B 4DPTA 4DPUA 2VQEI 4MQYA 2F4VI 2UUAE 2YTEA 3P3CA 3P06A 5AC5A 3KZYA 1WXRA 2BA1D 4DMIA 4LCFA 2WZOA 4F6MA 1N33E 4LFBE 2MC5A 4R2SA 2OI2A 1WHNA 4L5NC 5K36C 5AE1A 3B8HA 1GQEA 2EOJA 3CDJA 1N36E 1YZ9A 3K85A 4MDTA 2EM5A 4ZYEA 1NHIA 2LTRA 3BF2A 3T1HI 5LMNE 1GZ6A 1WRJA 4LF5I 4GZNC 4U3BA 4DV0E 2LUPB 2V2QA 1IBKI 4DUYI 1FWLA 2EP3A 2UXCI 2PO2B 2HK2A 4O43A 2EM4A 4F2JC 5C0XD 4FW9A 2EPCA 4JV5I 2ZM6I 4MU3A 2CG9A 1Z0TA 1VI7A 2R3VA 2JPAA 2DSYA 3TQMA 2EOFA 1KYQA 2O1VA 4JI7E 5FLXC 2UXDI 3PYDA 4PU9A 4X64E 2ZM6E 3LMLA 2O1WA 2BM0A 1Z5BA 5AE2A
chains in the Genus database with same CATH topology
1N0UA 4DV6E 1Y4SA 5FWKA 2DIXA 2WW4A 2N3GA 1Z0VA 2HKJA 4X65E 1YYKA 1NZ0A 1A6FA 3J7AG 1HK7A 3QT6A 4YHHI 1J26A 3OTOI 2L92A 4KHPI 1XNRE 2E1MA 1UHZA 4LF4I 4HY1A 2E5LE 3HPSA 2JOBA 4OOGC 2DMYA 4GEQB 4B3RE 2UUCE 2A2CA 2L33A 2GS8A 4OX9E 3K6QA 2M1SA 2VQFI 1OJ4A 2LUQA 4IZJA 2N3HA 3J80C 4JI1E 1NHHA 3AUZA 1ZM2A 1QU6A 5CFFE 2HHHI 3ZZ0A 1PVGA 2ZITA 4ZVIA 1Z0GA 4DV2I 1XMQI 2B9DA 4B3ME 3LPSA 4JI2I 4X66E 1B62A 4DV4I 4L8NA 4P52A 4JI3E 4B3SE 4LF6E 2G7HA 1XHKA 2Z5BB 4NXNE 4DR3I 3C4TA 3J7AM 1H74A 4DU8A 1RREA 1ZXNA 4DUYE 4IZJB 5IWAI 4DV7I 2V8QB 2NUFA 3WU4A 3FIGA 4DPWA 4TUIA 3VK6A 4WFTA 4Q28A 1VISA 4K0KI 1H73A 1N32E 5LMUE 4JI6E 3Q6NA 3CWVA 4X62I 3RMPA 1IBLI 3IWDA 3B82A 2V2ZA 4UT4A 4GKJI 2E1RA 2NUEA 1FWKA 3T1YI 1HNXE 2JWOA 1Z5CA 2YT4A 2V88A 2HFSA 3QT7A 2H36X 3F6HA 4JI0I 4LF8E 4F9BB 2Z5EA 1ZBQA 2F8BA 1FJGI 1QZRA 4AQYI 4DR7E 3ADLA 2HFUA 3VYXA 1B63A 2B7TA 4IZKA 3ZM7A 2JOXA 4LF4E 4DPYA 4TUGA 1Z0CA 2K4VA 4JI5I 2EWLA 2L6MA 4BCAA 2R42A 4DXLA 4F54A 1DI2A 1ZBTA 5IT9Q 4JI8I 3JAMQ 1D6TA 2FV4B 2NA2A 5BR8I 2PNLA 2RSMA 4M1KA 1MG7A 4J8ZA 2UUBI 3J81Q 3HULA 1N0VC 1IBME 3Q6MA 3PYGA 1XMQE 2VF3A 4DKKA 1T4LB 4KZSA 1ZM4A 2LBSB 2V87A 2BM1A 4IZKB 1FKAE 4EMDA 4DR5I 3ZKDA 4GKKI 4DR1E 2EFGA 4LFAI 2ZBKB 2GQ0A 4WUDA 4URLA 4PRVA 1XNQI 1I94I 2JR1A 2FTXB 5IWAE 2NUGA 4USKA 4KQVA 2UU9I 4JYAI 1MX0A 1N34E 4LF7E 4FWGA 1RR9A 2VE7C 5ADZA 4YY3I 1DQ3A 1NHJA 1SR9A 1Y6ZA 1Z5AA 4JV5I 5LL6R 4MYTA 1RC7A 4X62E 3ADGA 3HXLA 1KTVA 1J5EE 4P7DA 2RTXA 3H09A 4UTGA 1Z0EA 3T1YE 3F6GA 4LFCE 3MSWA 4Z7YA 4DUZI 3D4JA 1H72C 4DR6E 4M30A 3AV0A 3IWBA 4LF9I 2RS7A 4FN5A 3HPZA 3DF6A 4JI4E 1X48A 2CZ9A 4AQYE 1USUA 5GMDA 3V2UC 1XMOI 4DR2E 4B3TE 2VQEE 3PRYA 5AE3A 3K17A 1STUA 2F4VE 2MC6A 3HTXA 2L3JA 2UUAI 1MU5A 2Q2EB 4ED4A 1Z0BA 2LJPA 3ZZUA 4DU7A 3WU6A 1N33I 4LFBI 3WU5A 2HK3A 3T1HE 1N36I 4LF5E 1IBKE 5LMNI 2UXCE 2A2DA 4BMJA 2O1TA 4DV0I 1HR0I 3OMLA 1ELOA 4P78A 1RQ0A 3QT8A 2ODRD 1KVKA 4BC9A 1FNMA 5GMEA 2UXBI 2M7QA 4NXMI 2UXDE 3KWRA 3PYFA 2YZTA 4LU9A 3ZOQB 4I8OA 2X7IA 1EI1A 2V86A 4X8WA 5A2QQ 4X64I 4WPYA 3K1JA 1XNQE 2ZM6I 1Y4UA 3WU3A 3HQ1A 4DV6I 1PIEA 4FWDA 4N3OA 2L2NA 4YHHE 3OTOE 4WUBA 4KHPE 2FGGA 3VYYA 4R03A 4Z7CA 1X49A 1Z59A 1XNRI 1KIJA 3J7Yp 2HKEA 4JG4A 1BKNA 1ZXMA 2E5LI 1T4OA 4DUZE 5L3JA 2L3CA 2L2MA 4B3RI 4RPFA 2UUCI 3ZZTA 4F9CB 4XTJA 3LTOA 2LMZA 2VQFE 1FI4A 4OX9I 3ADJA 4BC7A 2IOQA 1EA6A 3DJWA 2J7KA 4JI1I 1Z0WA 2HHHE 4DV1I 2AJ4A 4DV2E 2Z5CA 4I3HA 4JI2E 4HYMA 4DV4E 1K47A 3IWCA 4B3MI 2MDRA 4X66I 4DV5I 4HACA 4DR4I 5FLXQ 5IT9C 4JI3I 3PYEA 3JAMC 1HNWI 1UEKA 4DR3E 4B3SI 4LF6I 3GONA 2X36A 2KHXA 3B78A 4NXNI 3J81C 4DV7E 1HR0E 1DARA 4PRXA 4F9AB 2Z5CB 4K0KE 2UXBE 3LNUA 4NXME 3M6AA 2XEXA 1N32I 2DEJA 4DV3I 3F0NA 5LMUI 3H4LA 3JTZA 2JY9A 1U2RA 4JI6I 1IBLE 4HACB 4GKJE 2KONA 1HNZI 3C4BA 5F3WA 4WUCA 4USMA 1HNXI 2KOUA 4JI0E 2PNMA 4LF8I 2LE2A 1FJGE 4MYUA 2ODRC 3J80Q 4WYQB 1YYOA 3ZKBA 2VF1A 1S16A 4DPXA 1H7SA 4DR7I 4JI5E 1X47A 2M4IA 4FWHA 3JU0A 4R8OA 1O0WA 1ZM3A 4IZJD 1YYWA 4JI8E 1T4NA 1USVA 2Z5BA 2B7VA 2RS6A 2V8PA 4R1FA 5BR8E 5DNYA 1WHQA 2UUBE 4WSPA 4DV1E 3QT5A 2LTSA 1IBMI 2CGEA 3P1XA 3LLHA 4P7AA 2CPNA 1ZM9A 4DR5E 4DV5E 4GKKE 1H7UA 1EKZA 4DR4E 4LFAE 3Q1QA 4BBYA 4DR1I 2LRSA 1HNWE 2V2VA 2IHR1 2V89A 2B3TB 4JI7I 1I94E 2EZ6A 2LJHA 1S4EA 2UU9E 4JYAE 2V83A 5T6JA 4X65I 3V5RA 4YY3E 2L2KB 1N34I 4LF7I 4JV5E 4DV3E 5AASA 2V85A 4M2ZA 1J5EI 4BS9A 5A2QC 2NPFA 1HNZE 2DEIA 1UILA 3HJCA 2V34A 2L8TA 2O1UA 4LFCI 4LF9E 2IOPA 4DR6I 4LTYA 3ADIA 1WUUA 4JI4I 2DB2A 4HXZA 1XMOE 2JVAA 4DR2I 4B3TI 4M0VA 1KKHA 1PKPA 2BV3A 4DPTA 4DPUA 2VQEI 2F4VI 2UUAE 3P06A 1WXRA 4DMIA 2WZOA 1N33E 4LFBE 2MC5A 2OI2A 1WHNA 4L5NC 5AE1A 3B8HA 1GQEA 1N36E 1YZ9A 3K85A 1NHIA 2LTRA 3T1HI 5LMNE 1GZ6A 4LF5I 1IBKI 4DV0E 2LUPB 2V2QA 4DUYI 1FWLA 2UXCI 2HK2A 4FW9A 2CG9A 1Z0TA 2R3VA 2DSYA 2O1VA 4JI7E 5FLXC 2UXDI 3PYDA 4PU9A 4X64E 2ZM6E 3LMLA 2O1WA 2BM0A 1Z5BA 5AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0U A;  4DV6 E;  2DIX A;  2WW4 A;  2N3G A;  1Z0V A;  2HKJ A;  4X65 E;  1YYK A;  1NZ0 A;  1A6F A;  3QT6 A;  3J7A G;  4YHH I;  1J26 A;  3OTO I;  4KHP I;  1XNR E;  1UHZ A;  4LF4 I;  4HY1 A;  2E5L E;  4OOG C;  2DMY A;  4B3R E;  2UUC E;  2A2C A;  2L33 A;  2GS8 A;  4OX9 E;  2VQF I;  1OJ4 A;  2LUQ A;  2N3H A;  3J80 C;  4JI1 E;  1NHH A;  1ZM2 A;  1QU6 A;  5CFF E;  2HHH I;  3ZZ0 A;  1PVG A;  2ZIT A;  4ZVI A;  1Z0G A;  4DV2 I;  1XMQ I;  4B3M E;  3LPS A;  4JI2 I;  4X66 E;  1B62 A;  4DV4 I;  4P52 A;  4JI3 E;  4B3S E;  4LF6 E;  1XHK A;  4NXN E;  4DR3 I;  3C4T A;  3J7A M;  1H74 A;  4DU8 A;  1RRE A;  1ZXN A;  4DUY E;  5IWA I;  4DV7 I;  2NUF A;  3WU4 A;  4DPW A;  4WFT A;  1VIS A;  4K0K I;  1H73 A;  1N32 E;  5LMU E;  4JI6 E;  3CWV A;  4X62 I;  1IBL I;  3B82 A;  2V2Z A;  4UT4 A;  4GKJ I;  2E1R A;  2NUE A;  1FWK A;  3T1Y I;  1HNX E;  1Z5C A;  2YT4 A;  2HFS A;  3QT7 A;  4JI0 I;  4LF8 E;  1FJG I;  1QZR A;  4AQY I;  4DR7 E;  3ADL A;  2HFU A;  3VYX A;  1B63 A;  2B7T A;  3ZM7 A;  4LF4 E;  4DPY A;  1Z0C A;  4JI5 I;  4DXL A;  2R42 A;  1DI2 A;  1ZBT A;  5IT9 Q;  4JI8 I;  3JAM Q;  1D6T A;  2NA2 A;  5BR8 I;  2RSM A;  4M1K A;  1MG7 A;  2UUB I;  3J81 Q;  3HUL A;  1N0V C;  1IBM E;  3PYG A;  1XMQ E;  2VF3 A;  4DKK A;  1T4L B;  1ZM4 A;  2LBS B;  2BM1 A;  1FKA E;  4EMD A;  4DR5 I;  3ZKD A;  4GKK I;  4DR1 E;  2EFG A;  4LFA I;  2ZBK B;  4WUD A;  4URL A;  4PRV A;  1XNQ I;  1I94 I;  5IWA E;  2NUG A;  4USK A;  4KQV A;  2UU9 I;  4JYA I;  1MX0 A;  1N34 E;  4LF7 E;  4FWG A;  1RR9 A;  4YY3 I;  1NHJ A;  1Z5A A;  4JV5 I;  5LL6 R;  4MYT A;  1RC7 A;  4X62 E;  3ADG A;  1KTV A;  1J5E E;  2RTX A;  4UTG A;  1Z0E A;  3T1Y E;  4LFC E;  4Z7Y A;  4DUZ I;  3D4J A;  1H72 C;  4DR6 E;  4M30 A;  4LF9 I;  2RS7 A;  4FN5 A;  4JI4 E;  1X48 A;  2CZ9 A;  4AQY E;  5GMD A;  3V2U C;  1XMO I;  4DR2 E;  4B3T E;  2VQE E;  3K17 A;  1STU A;  2F4V E;  3HTX A;  2L3J A;  2UUA I;  1MU5 A;  2Q2E B;  4ED4 A;  1Z0B A;  2LJP A;  3ZZU A;  4DU7 A;  3WU6 A;  1N33 I;  4LFB I;  3WU5 A;  2HK3 A;  3T1H E;  1N36 I;  4LF5 E;  1IBK E;  5LMN I;  2UXC E;  2A2D A;  4DV0 I;  1HR0 I;  1ELO A;  1RQ0 A;  3QT8 A;  1KVK A;  1FNM A;  5GME A;  2UXB I;  4NXM I;  2UXD E;  3PYF A;  2X7I A;  1EI1 A;  4X8W A;  5A2Q Q;  4X64 I;  2ZM6 I;  3K1J A;  1XNQ E;  3WU3 A;  4DV6 I;  1PIE A;  4FWD A;  2L2N A;  4YHH E;  3OTO E;  4WUB A;  4KHP E;  3VYY A;  4Z7C A;  1X49 A;  1Z59 A;  1XNR I;  1KIJ A;  3J7Y p;  2HKE A;  4JG4 A;  1BKN A;  1ZXM A;  2E5L I;  1T4O A;  4DUZ E;  5L3J A;  2L3C A;  2L2M A;  4B3R I;  4RPF A;  2UUC I;  3ZZT A;  4XTJ A;  3LTO A;  2VQF E;  1FI4 A;  4OX9 I;  3ADJ A;  1EA6 A;  2J7K A;  4JI1 I;  1Z0W A;  2HHH E;  4DV1 I;  2AJ4 A;  4DV2 E;  4I3H A;  4JI2 E;  4HYM A;  4DV4 E;  1K47 A;  4B3M I;  2MDR A;  4X66 I;  4DV5 I;  4HAC A;  4DR4 I;  5FLX Q;  5IT9 C;  4JI3 I;  3PYE A;  3JAM C;  1HNW I;  1UEK A;  4DR3 E;  4B3S I;  4LF6 I;  3GON A;  2X36 A;  2KHX A;  3B78 A;  4NXN I;  3J81 C;  4DV7 E;  1HR0 E;  1DAR A;  4PRX A;  4K0K E;  2UXB E;  3LNU A;  4NXM E;  3M6A A;  2XEX A;  1N32 I;  2DEJ A;  4DV3 I;  3F0N A;  5LMU I;  3H4L A;  1U2R A;  2JY9 A;  4JI6 I;  1IBL E;  4HAC B;  4GKJ E;  1HNZ I;  3C4B A;  4WUC A;  4USM A;  1HNX I;  4JI0 E;  4LF8 I;  1FJG E;  4MYU A;  3J80 Q;  4WYQ B;  1YYO A;  3ZKB A;  1S16 A;  4DPX A;  1H7S A;  4DR7 I;  4JI5 E;  1X47 A;  4FWH A;  1O0W A;  1ZM3 A;  1YYW A;  4JI8 E;  1T4N A;  2B7V A;  2RS6 A;  2V8P A;  4R1F A;  5BR8 E;  1WHQ A;  2UUB E;  4DV1 E;  3QT5 A;  2LTS A;  1IBM I;  3P1X A;  3LLH A;  4P7A A;  2CPN A;  1ZM9 A;  4DR5 E;  4DV5 E;  4GKK E;  1H7U A;  1EKZ A;  4DR4 E;  4LFA E;  3Q1Q A;  4DR1 I;  2LRS A;  1HNW E;  2V2V A;  2IHR 1;  4JI7 I;  2B3T B;  1I94 E;  2EZ6 A;  2LJH A;  1S4E A;  2UU9 E;  4JYA E;  4X65 I;  3V5R A;  4YY3 E;  2L2K B;  1N34 I;  4LF7 I;  4JV5 E;  4DV3 E;  4M2Z A;  1J5E I;  5A2Q C;  2NPF A;  1HNZ E;  2DEI A;  1UIL A;  2V34 A;  4LFC I;  4LF9 E;  4DR6 I;  3ADI A;  1WUU A;  4JI4 I;  2DB2 A;  4HXZ A;  1XMO E;  2JVA A;  4DR2 I;  4B3T I;  1KKH A;  1PKP A;  2BV3 A;  4DPT A;  4DPU A;  2VQE I;  2F4V I;  2UUA E;  1N33 E;  4LFB E;  2OI2 A;  1WHN A;  3B8H A;  1GQE A;  1N36 E;  1YZ9 A;  1NHI A;  2LTR A;  3T1H I;  5LMN E;  4LF5 I;  1IBK I;  4DV0 E;  2LUP B;  2V2Q A;  4DUY I;  1FWL A;  2UXC I;  2HK2 A;  4FW9 A;  1Z0T A;  2R3V A;  4JI7 E;  5FLX C;  2UXD I;  3PYD A;  4PU9 A;  4X64 E;  2ZM6 E;  2BM0 A;  1Z5B A; 
#chains in the Genus database with same CATH topology
 4WXD A;  1N0U A;  4DV6 E;  1Y4S A;  5FWK A;  4M9V C;  2DIX A;  5JEA D;  2WW4 A;  2EL4 A;  2N3G A;  2ENC A;  3EQ1 A;  4X65 E;  1P47 A;  2BB8 A;  1YYK A;  1Z0V A;  1X6F A;  2HKJ A;  2EPP A;  1NZ0 A;  1A6F A;  2EOX A;  2YRH A;  3J7A G;  2HC5 A;  1HK7 A;  3QT6 A;  5C0X F;  4IFD E;  2EMK A;  4YHH I;  1J26 A;  3OTO I;  5AC4 A;  2L92 A;  4KHP I;  2PO0 B;  1TF3 A;  1NCS A;  1XNR E;  4AID A;  5K36 A;  5A6K A;  2E1M A;  1UHZ A;  2EN3 A;  1T38 A;  5IV8 B;  4LF4 I;  4HY1 A;  2E5L E;  3HPS A;  2JOB A;  4IFD C;  4OOG C;  2DMY A;  4GEQ B;  4B3R E;  2UUC E;  2JP9 A;  5DNL A;  2EOH A;  4WX9 A;  1T39 A;  2A2C A;  2L33 A;  2BA0 D;  3P3E A;  2GS8 A;  4OX9 E;  2EMH A;  4QNJ A;  3K6Q A;  5K36 F;  2M1S A;  2VQF I;  1OJ4 A;  2LUQ A;  4IZJ A;  2N3H A;  2I13 A;  3J80 C;  4JI1 E;  3U1K A;  1X6E A;  2EQ3 A;  1NHH A;  4N4R B;  3AUZ A;  1ZM2 A;  2Q8U A;  1QU6 A;  2HGH A;  2EOR A;  5CFF E;  2HHH I;  3ZZ0 A;  2CTD A;  1PVG A;  2ZIT A;  4ZVI A;  1Z0G A;  4DV2 I;  1XMQ I;  2CT1 A;  2YU8 A;  2B9D A;  2ELY A;  4B3M E;  3LPS A;  4JI2 I;  4X66 E;  1B62 A;  3B4T A;  4DV4 I;  4L8N A;  4P52 A;  4NHR A;  2M9A A;  2EOY A;  4JI3 E;  2EMA A;  4B3S E;  4LF6 E;  4OO1 D;  2G7H A;  1R6L A;  3L7Z A;  1YH8 A;  2JT2 A;  1XHK A;  2Z5B B;  3HKM A;  4NXN E;  4LPF A;  4DR3 I;  3C4T A;  3J7A M;  1H74 A;  4DU8 A;  1RRE A;  1ZXN A;  2WCC 3;  1N3G A;  4DUY E;  4IZJ B;  1BB8 A;  2EPZ A;  1F2I G;  5A6B D;  5IWA I;  4DV7 I;  4IFD A;  2BA1 G;  3PS2 A;  2V8Q B;  2NUF A;  3WU4 A;  5KL3 A;  2YWQ A;  3FIG A;  4DPW A;  4ZYD A;  4TUI A;  3VK6 A;  1PJT A;  2JXP A;  4Q28 A;  4WFT A;  1VIS A;  4U3D A;  4K0K I;  1H73 A;  1N32 E;  5LMU E;  4FW6 A;  4JI6 E;  3Q6N A;  3CWV A;  2RPC A;  2WBT A;  4X62 I;  4IFD F;  3RMP A;  1IBL I;  3IWD A;  3B82 A;  4R2A A;  2V2Z A;  4UT4 A;  4GKJ I;  2EL5 A;  2E1R A;  2NUE A;  1FWK A;  3T1Y I;  2DMI A;  1HNX E;  3L7Z B;  2JWO A;  1Z5C A;  4LCG A;  2YT4 A;  2V88 A;  1UBD C;  2HFS A;  3QT7 A;  2YTQ A;  2EN6 A;  2H36 X;  3F6H A;  4JI0 I;  4LF8 E;  3THN A;  4F9B B;  1B69 A;  2Z5E A;  3DD6 A;  1ZBQ A;  2WNR B;  2F8B A;  2I9I A;  5KL5 A;  2EL6 A;  4FW4 A;  1FJG I;  5C0X C;  1QZR A;  2ENH A;  1A1H A;  4AQY I;  3M85 G;  4DR7 E;  3ADL A;  2HFU A;  3VYX A;  1B63 A;  2DRP A;  2B7T A;  2GO3 A;  4IZK A;  2JOX A;  4LF4 E;  2HJJ A;  3PS3 A;  4TUG A;  1RHY A;  1Z1B A;  1Z0C A;  3ZM7 A;  2K4V A;  2ENA A;  2JE6 B;  4DPY A;  4JI5 I;  4AIM A;  2EWL A;  2L6M A;  4BCA A;  2R42 A;  4DXL A;  4F54 A;  1DI2 A;  1YPN A;  2MKD A;  1ZBT A;  3L00 A;  2YRM A;  3GLL A;  5KL7 A;  5JEA C;  5IT9 Q;  4JI8 I;  5EKW A;  3JAM Q;  1D6T A;  2FV4 B;  2NA2 A;  3M85 D;  1L4S A;  5BR8 I;  4Q35 B;  1WJP A;  2EPA A;  2PNL A;  2EJ4 A;  2RSM A;  4M1K A;  1MG7 A;  4J8Z A;  5KL2 A;  2BR2 B;  2UUB I;  2DLQ A;  3J81 Q;  2IES A;  3HUL A;  1N0V C;  1IBM E;  3Q6M A;  3PYG A;  1XMQ E;  2VF3 A;  2PO1 A;  4DKK A;  1T4L B;  4KZS A;  1ZM4 A;  2LBS B;  2V87 A;  1A1G A;  2BA0 G;  2BM1 A;  4ISA A;  2R1F A;  4IZK B;  1FKA E;  4R2P A;  1YSA C;  1TN9 A;  4EMD A;  4DR5 I;  3ZKD A;  4GKK I;  3UHM A;  4DR1 E;  2EFG A;  4LFA I;  3M99 B;  2EN2 A;  2EPN A;  2EMI A;  2GQ0 A;  2ZBK B;  2YTO A;  4WUD A;  5C0X A;  2YTN A;  4IS9 A;  1LLM C;  3ECR A;  2NN6 E;  2BBG A;  4URL A;  4PRV A;  1XNQ I;  1I94 I;  2D9H A;  2JEA A;  1AH5 A;  2JR1 A;  2FTX B;  5IWA E;  2NUG A;  4USK A;  4KQV A;  3PS1 A;  2UU9 I;  4JYA I;  2EQ0 A;  1SFE A;  2EOM A;  1MEY C;  1MX0 A;  1N34 E;  4LF7 E;  1BBG A;  4FWG A;  1RR9 A;  2VE7 C;  5ADZ A;  5ELW A;  2EN4 A;  2PO1 B;  4YY3 I;  2EMB A;  4OO1 E;  5JEA A;  1DQ3 A;  5IXM B;  1NHJ A;  1SR9 A;  1Y6Z A;  2EPU A;  1Z5A A;  2IER A;  5LL6 R;  4MYT A;  1RC7 A;  4X62 E;  3ADG A;  2ELZ A;  3HXL A;  2YTD A;  1J5E E;  1KTV A;  4P7D A;  2DLK A;  2RTX A;  2LV2 A;  3H09 A;  4IS1 C;  4MU1 A;  4UTG A;  1GTK A;  1Z0E A;  3T1Y E;  2EPR A;  3F6G A;  4OO1 C;  4LFC E;  5C0X B;  3MSW A;  2WBS A;  4Z7Y A;  4DUZ I;  5JEA F;  3D4J A;  4MLV A;  1H72 C;  4DR6 E;  4M30 A;  3AV0 A;  3IWB A;  4LF9 I;  2RS7 A;  3H1C A;  3HPZ A;  4FN5 A;  2JEA B;  2YTG A;  3U1Y A;  3DF6 A;  4JI4 E;  5KL6 A;  2WP8 A;  1X48 A;  1A1L A;  2CZ9 A;  4AQY E;  1USU A;  4R2D A;  5GMD A;  1UDN A;  4O4K A;  3V2U C;  1XMO I;  4DR2 E;  2VES A;  4O5G A;  4B3T E;  3C6M A;  5KL4 A;  2VQE E;  2A25 A;  3PRY A;  5AE3 A;  3K17 A;  1OYS A;  1STU A;  2EE8 A;  2F4V E;  2R76 A;  2MC6 A;  5A2Q Q;  3HTX A;  2NN6 D;  2NAB A;  2L3J A;  5K36 B;  3EPJ A;  2UUA I;  2EPX A;  1MU5 A;  2Q2E B;  4ED4 A;  1Z0B A;  2LJP A;  3ZZU A;  4DU7 A;  3WU6 A;  1N33 I;  4LCH A;  4LFB I;  4O24 A;  3NZK A;  5DRO A;  3WU5 A;  3GME A;  2HK3 A;  3T1H E;  1N36 I;  2EM8 A;  4LF5 E;  1XXE A;  1IQS A;  1IBK E;  1A1I A;  2WP8 B;  2EM9 A;  5LMN I;  2UXC E;  2A2D A;  4BMJ A;  2O1T A;  4DV0 I;  2C39 A;  1HR0 I;  4OO1 A;  3OML A;  1ELO A;  4P78 A;  2EMG A;  1RQ0 A;  2EPK X;  2ODR D;  2YPN A;  1KVK A;  2NN6 F;  3QT8 A;  2YTI A;  4BC9 A;  3MHS C;  1FNM A;  4FK5 C;  4X9J A;  5GME A;  4BHB A;  5A6B A;  3P3G A;  2M7Q A;  4J3D A;  2UXD E;  4NXM I;  2UXB I;  3KWR A;  3PYF A;  2YZT A;  4LU9 A;  1TF6 A;  3ZOQ B;  3UK3 C;  4OO1 F;  4I8O A;  2X7I A;  2V86 A;  4X8W A;  1EI1 A;  1EH8 A;  2CSH A;  4WPY A;  3K1J A;  1XNQ E;  3MHH C;  3KZZ A;  2EOQ A;  1Y4U A;  2YU5 A;  4LOM A;  1PJS A;  1E3H A;  4FW3 A;  3WU3 A;  2LO3 A;  3HQ1 A;  4BA2 A;  1UDS A;  4DV6 I;  1PIE A;  2LCE A;  1YUI A;  3BID A;  2MKN A;  4FWD A;  4N3O A;  2WBU A;  1EH7 A;  2C37 A;  2L2N A;  4YHH E;  1JK2 A;  5DRP A;  3OTO E;  4WUB A;  2VRD A;  2PRT A;  4IFD B;  2N8X A;  4KHP E;  2FGG A;  3VYY A;  2C38 A;  2EPO A;  4R03 A;  4Z7C A;  1X49 A;  1Z59 A;  1XNR I;  3GCM A;  1KIJ A;  3J7Y p;  2HKE A;  4ZYG A;  4JG4 A;  1BKN A;  1ZXM A;  2E5L I;  3BGH A;  4NZV A;  1T4O A;  5LLQ A;  2DGC A;  1QNT A;  4DUZ E;  5A69 A;  2AE8 A;  5L3J A;  2L3C A;  2L2M A;  4B3R I;  2EMZ A;  4RPF A;  5DNX A;  2E72 A;  3ZZT A;  2UUC I;  4F9C B;  4XTJ A;  1YFH A;  3EPL A;  4RH8 A;  2LMZ A;  2VQF E;  1A1K A;  1FI4 A;  3LTO A;  3ADJ A;  5EL9 A;  1PDA A;  2EQ1 A;  4BC7 A;  4OX9 I;  1UN6 B;  2IOQ A;  1EA6 A;  4OKG A;  3DJW A;  2PNZ A;  2K7I A;  2J7K A;  4JI1 I;  1Z0W A;  2HHH E;  4DV1 I;  2AJ4 A;  2EN1 A;  4DV2 E;  4MU0 A;  2Z5C A;  4I3H A;  4JI2 E;  4QNK A;  4HYM A;  2YSP A;  3VHT B;  2YTF A;  4DV4 E;  1K47 A;  3IWC A;  4B3M I;  2MDR A;  4X66 I;  1UDQ A;  4R2C A;  4DV5 I;  4HAC A;  4DR4 I;  5FLX Q;  5IT9 C;  3BBG A;  4BA1 A;  3PYE A;  3JAM C;  4JI3 I;  1HNW I;  2LVH A;  1UEK A;  4DR3 E;  4B3S I;  4LF6 I;  3GON A;  2X36 A;  2KHX A;  3B78 A;  4NXN I;  1PJQ A;  4R2E A;  3J81 C;  4DV7 E;  1HR0 E;  2EOI A;  1DAR A;  2PNZ B;  5A6A A;  4PRX A;  2PO0 A;  2YSO A;  4F9A B;  2NN6 C;  4K0K E;  2Z5C B;  1ZAA C;  3M7N D;  2UXB E;  3LNU A;  4F6N A;  1MGT A;  2EOE A;  4NXM E;  3M6A A;  2XEX A;  1ZR9 A;  4FW5 A;  1N32 I;  2DEJ A;  2EPM X;  3F0N A;  5LMU I;  3H4L A;  3JTZ A;  2JY9 A;  1U2R A;  4DV3 I;  4JI6 I;  1IBL E;  4HAC B;  4GKJ E;  2EMX A;  2JEB A;  2EMY A;  2EOS A;  2KON A;  3P76 A;  4BA1 B;  1JK1 A;  1HNZ I;  3C4B A;  5F3W A;  4WUC A;  4USM A;  2EML A;  4HEI A;  1HNX I;  2KOU A;  4JI0 E;  1R6M A;  5K36 D;  1YUJ A;  2PNM A;  4LF8 I;  2LE2 A;  1FJG E;  2GLI A;  4MYU A;  1DGC A;  2ODR C;  3J80 Q;  4WYQ B;  1YYO A;  4R2Q A;  1X5W A;  3ZKB A;  2VF1 A;  1S16 A;  4DPX A;  1H7S A;  5A6J A;  4DR7 I;  1P42 A;  4JI5 E;  1X47 A;  2M4I A;  5JEA B;  4WXC A;  2LJU A;  4FWH A;  1BBO A;  3JU0 A;  1OYP A;  4NBQ A;  1EH6 A;  1G2F C;  2J65 A;  4R8O A;  4FW7 A;  1O0W A;  1A1J A;  1ZM3 A;  4IZJ D;  1YYW A;  2YTJ A;  2JEB B;  4JI8 E;  1NEI A;  1T4N A;  1USV A;  2B7V A;  2RS6 A;  1Y60 A;  2V8P A;  2Z5B A;  4RHB B;  2EM0 A;  5BR8 E;  2NN6 A;  4R1F A;  5DNY A;  2F1D A;  4HTG A;  2EN8 A;  1WHQ A;  2UUB E;  4WSP A;  4DV1 E;  3KRN A;  2LT7 A;  3QT5 A;  5TSE A;  2LTS A;  4OZE A;  4BA2 B;  1IBM I;  4AM3 A;  2CGE A;  2CVE A;  3P1X A;  1YHC A;  4MU4 A;  2EMW A;  3LLH A;  4P7A A;  2CPN A;  1ZM9 A;  3THO B;  4BHC A;  4DR5 E;  4GQU A;  1KJK A;  4DV5 E;  4GKK E;  1H7U A;  3CDI A;  2RQL A;  2ADR A;  1EKZ A;  4LFA E;  4DR4 E;  3Q1Q A;  4WSG A;  4BBY A;  2RSI A;  2LRS A;  1HNW E;  2JYA A;  4DR1 I;  2YRK A;  2V2V A;  2IHR 1;  2V89 A;  2B3T B;  4JI7 I;  4IFD D;  1Y5Y A;  2EM2 A;  5JEA E;  1I94 E;  2EZ6 A;  2LJH A;  4MLQ A;  4ZYH A;  2MDG A;  2NN6 B;  2J7J A;  2EOO A;  1S4E A;  2EN7 A;  2EM6 A;  2UU9 E;  2WNR A;  4JYA E;  2GHF A;  1IQO A;  2V83 A;  2EMC A;  5T6J A;  4X65 I;  3V5R A;  1G2D C;  2GPI A;  4YY3 E;  2L2K B;  1A1F A;  1N34 I;  2C39 B;  4LF7 I;  1X6H A;  4OO1 B;  4KWY A;  1AAY A;  4JV5 E;  2JE6 A;  4DV3 E;  5AAS A;  2V85 A;  4M2Z A;  2EM7 A;  1OYR A;  3QG5 C;  5DRQ A;  1J5E I;  2GO4 A;  4BS9 A;  1IMU A;  3EPH A;  5A2Q C;  5C0X E;  2NPF A;  2EOZ A;  1HNZ E;  2DEI A;  5DRR A;  1UIL A;  4R2R A;  3HJC A;  2V34 A;  2L8T A;  2O1U A;  4LFC I;  4LF9 E;  1ZU1 A;  2O3Z A;  4X64 I;  2IOP A;  4DR6 I;  4LTY A;  3ADI A;  2BR2 A;  3M7N G;  2EMF A;  1WUU A;  1RMD A;  3C6K A;  1UDO A;  2YTP A;  1E3P A;  2DB2 A;  4JI4 I;  4HXZ A;  1XMO E;  2C37 B;  2PO2 A;  2JVA A;  1X3C A;  4IJD A;  3EPK A;  4DR2 I;  2EM3 A;  4B3T I;  2EPL X;  4M0V A;  5K36 E;  1KKH A;  1PKP A;  2BV3 A;  2C38 B;  4DPT A;  4DPU A;  2VQE I;  4MQY A;  2F4V I;  2UUA E;  2YTE A;  3P3C A;  3P06 A;  5AC5 A;  3KZY A;  1WXR A;  2BA1 D;  4DMI A;  4LCF A;  2WZO A;  4F6M A;  1N33 E;  4LFB E;  2MC5 A;  4R2S A;  2OI2 A;  1WHN A;  4L5N C;  5K36 C;  5AE1 A;  3B8H A;  1GQE A;  2EOJ A;  3CDJ A;  1N36 E;  1YZ9 A;  3K85 A;  4MDT A;  2EM5 A;  4ZYE A;  1NHI A;  2LTR A;  3BF2 A;  3T1H I;  5LMN E;  1GZ6 A;  1WRJ A;  4LF5 I;  4GZN C;  4U3B A;  4DV0 E;  2LUP B;  2V2Q A;  1IBK I;  4DUY I;  1FWL A;  2EP3 A;  2UXC I;  2PO2 B;  2HK2 A;  4O43 A;  2EM4 A;  4F2J C;  5C0X D;  4FW9 A;  2EPC A;  4JV5 I;  2ZM6 I;  4MU3 A;  2CG9 A;  1Z0T A;  1VI7 A;  2R3V A;  2JPA A;  2DSY A;  3TQM A;  2EOF A;  1KYQ A;  2O1V A;  4JI7 E;  5FLX C;  2UXD I;  3PYD A;  4PU9 A;  4X64 E;  2ZM6 E;  3LML A;  2O1W A;  2BM0 A;  1Z5B A;  5AE2 A; 
#chains in the Genus database with same CATH homology
 1N0U A;  4DV6 E;  1Y4S A;  5FWK A;  2DIX A;  2WW4 A;  2N3G A;  1Z0V A;  2HKJ A;  4X65 E;  1YYK A;  1NZ0 A;  1A6F A;  3J7A G;  1HK7 A;  3QT6 A;  4YHH I;  1J26 A;  3OTO I;  2L92 A;  4KHP I;  1XNR E;  2E1M A;  1UHZ A;  4LF4 I;  4HY1 A;  2E5L E;  3HPS A;  2JOB A;  4OOG C;  2DMY A;  4GEQ B;  4B3R E;  2UUC E;  2A2C A;  2L33 A;  2GS8 A;  4OX9 E;  3K6Q A;  2M1S A;  2VQF I;  1OJ4 A;  2LUQ A;  4IZJ A;  2N3H A;  3J80 C;  4JI1 E;  1NHH A;  3AUZ A;  1ZM2 A;  1QU6 A;  5CFF E;  2HHH I;  3ZZ0 A;  1PVG A;  2ZIT A;  4ZVI A;  1Z0G A;  4DV2 I;  1XMQ I;  2B9D A;  4B3M E;  3LPS A;  4JI2 I;  4X66 E;  1B62 A;  4DV4 I;  4L8N A;  4P52 A;  4JI3 E;  4B3S E;  4LF6 E;  2G7H A;  1XHK A;  2Z5B B;  4NXN E;  4DR3 I;  3C4T A;  3J7A M;  1H74 A;  4DU8 A;  1RRE A;  1ZXN A;  4DUY E;  4IZJ B;  5IWA I;  4DV7 I;  2V8Q B;  2NUF A;  3WU4 A;  3FIG A;  4DPW A;  4TUI A;  3VK6 A;  4WFT A;  4Q28 A;  1VIS A;  4K0K I;  1H73 A;  1N32 E;  5LMU E;  4JI6 E;  3Q6N A;  3CWV A;  4X62 I;  3RMP A;  1IBL I;  3IWD A;  3B82 A;  2V2Z A;  4UT4 A;  4GKJ I;  2E1R A;  2NUE A;  1FWK A;  3T1Y I;  1HNX E;  2JWO A;  1Z5C A;  2YT4 A;  2V88 A;  2HFS A;  3QT7 A;  2H36 X;  3F6H A;  4JI0 I;  4LF8 E;  4F9B B;  2Z5E A;  1ZBQ A;  2F8B A;  1FJG I;  1QZR A;  4AQY I;  4DR7 E;  3ADL A;  2HFU A;  3VYX A;  1B63 A;  2B7T A;  4IZK A;  3ZM7 A;  2JOX A;  4LF4 E;  4DPY A;  4TUG A;  1Z0C A;  2K4V A;  4JI5 I;  2EWL A;  2L6M A;  4BCA A;  2R42 A;  4DXL A;  4F54 A;  1DI2 A;  1ZBT A;  5IT9 Q;  4JI8 I;  3JAM Q;  1D6T A;  2FV4 B;  2NA2 A;  5BR8 I;  2PNL A;  2RSM A;  4M1K A;  1MG7 A;  4J8Z A;  2UUB I;  3J81 Q;  3HUL A;  1N0V C;  1IBM E;  3Q6M A;  3PYG A;  1XMQ E;  2VF3 A;  4DKK A;  1T4L B;  4KZS A;  1ZM4 A;  2LBS B;  2V87 A;  2BM1 A;  4IZK B;  1FKA E;  4EMD A;  4DR5 I;  3ZKD A;  4GKK I;  4DR1 E;  2EFG A;  4LFA I;  2ZBK B;  2GQ0 A;  4WUD A;  4URL A;  4PRV A;  1XNQ I;  1I94 I;  2JR1 A;  2FTX B;  5IWA E;  2NUG A;  4USK A;  4KQV A;  2UU9 I;  4JYA I;  1MX0 A;  1N34 E;  4LF7 E;  4FWG A;  1RR9 A;  2VE7 C;  5ADZ A;  4YY3 I;  1DQ3 A;  1NHJ A;  1SR9 A;  1Y6Z A;  1Z5A A;  4JV5 I;  5LL6 R;  4MYT A;  1RC7 A;  4X62 E;  3ADG A;  3HXL A;  1KTV A;  1J5E E;  4P7D A;  2RTX A;  3H09 A;  4UTG A;  1Z0E A;  3T1Y E;  3F6G A;  4LFC E;  3MSW A;  4Z7Y A;  4DUZ I;  3D4J A;  1H72 C;  4DR6 E;  4M30 A;  3AV0 A;  3IWB A;  4LF9 I;  2RS7 A;  4FN5 A;  3HPZ A;  3DF6 A;  4JI4 E;  1X48 A;  2CZ9 A;  4AQY E;  1USU A;  5GMD A;  3V2U C;  1XMO I;  4DR2 E;  4B3T E;  2VQE E;  3PRY A;  5AE3 A;  3K17 A;  1STU A;  2F4V E;  2MC6 A;  3HTX A;  2L3J A;  2UUA I;  1MU5 A;  2Q2E B;  4ED4 A;  1Z0B A;  2LJP A;  3ZZU A;  4DU7 A;  3WU6 A;  1N33 I;  4LFB I;  3WU5 A;  2HK3 A;  3T1H E;  1N36 I;  4LF5 E;  1IBK E;  5LMN I;  2UXC E;  2A2D A;  4BMJ A;  2O1T A;  4DV0 I;  1HR0 I;  3OML A;  1ELO A;  4P78 A;  1RQ0 A;  3QT8 A;  2ODR D;  1KVK A;  4BC9 A;  1FNM A;  5GME A;  2UXB I;  2M7Q A;  4NXM I;  2UXD E;  3KWR A;  3PYF A;  2YZT A;  4LU9 A;  3ZOQ B;  4I8O A;  2X7I A;  1EI1 A;  2V86 A;  4X8W A;  5A2Q Q;  4X64 I;  4WPY A;  3K1J A;  1XNQ E;  2ZM6 I;  1Y4U A;  3WU3 A;  3HQ1 A;  4DV6 I;  1PIE A;  4FWD A;  4N3O A;  2L2N A;  4YHH E;  3OTO E;  4WUB A;  4KHP E;  2FGG A;  3VYY A;  4R03 A;  4Z7C A;  1X49 A;  1Z59 A;  1XNR I;  1KIJ A;  3J7Y p;  2HKE A;  4JG4 A;  1BKN A;  1ZXM A;  2E5L I;  1T4O A;  4DUZ E;  5L3J A;  2L3C A;  2L2M A;  4B3R I;  4RPF A;  2UUC I;  3ZZT A;  4F9C B;  4XTJ A;  3LTO A;  2LMZ A;  2VQF E;  1FI4 A;  4OX9 I;  3ADJ A;  4BC7 A;  2IOQ A;  1EA6 A;  3DJW A;  2J7K A;  4JI1 I;  1Z0W A;  2HHH E;  4DV1 I;  2AJ4 A;  4DV2 E;  2Z5C A;  4I3H A;  4JI2 E;  4HYM A;  4DV4 E;  1K47 A;  3IWC A;  4B3M I;  2MDR A;  4X66 I;  4DV5 I;  4HAC A;  4DR4 I;  5FLX Q;  5IT9 C;  4JI3 I;  3PYE A;  3JAM C;  1HNW I;  1UEK A;  4DR3 E;  4B3S I;  4LF6 I;  3GON A;  2X36 A;  2KHX A;  3B78 A;  4NXN I;  3J81 C;  4DV7 E;  1HR0 E;  1DAR A;  4PRX A;  4F9A B;  2Z5C B;  4K0K E;  2UXB E;  3LNU A;  4NXM E;  3M6A A;  2XEX A;  1N32 I;  2DEJ A;  4DV3 I;  3F0N A;  5LMU I;  3H4L A;  3JTZ A;  2JY9 A;  1U2R A;  4JI6 I;  1IBL E;  4HAC B;  4GKJ E;  2KON A;  1HNZ I;  3C4B A;  5F3W A;  4WUC A;  4USM A;  1HNX I;  2KOU A;  4JI0 E;  2PNM A;  4LF8 I;  2LE2 A;  1FJG E;  4MYU A;  2ODR C;  3J80 Q;  4WYQ B;  1YYO A;  3ZKB A;  2VF1 A;  1S16 A;  4DPX A;  1H7S A;  4DR7 I;  4JI5 E;  1X47 A;  2M4I A;  4FWH A;  3JU0 A;  4R8O A;  1O0W A;  1ZM3 A;  4IZJ D;  1YYW A;  4JI8 E;  1T4N A;  1USV A;  2Z5B A;  2B7V A;  2RS6 A;  2V8P A;  4R1F A;  5BR8 E;  5DNY A;  1WHQ A;  2UUB E;  4WSP A;  4DV1 E;  3QT5 A;  2LTS A;  1IBM I;  2CGE A;  3P1X A;  3LLH A;  4P7A A;  2CPN A;  1ZM9 A;  4DR5 E;  4DV5 E;  4GKK E;  1H7U A;  1EKZ A;  4DR4 E;  4LFA E;  3Q1Q A;  4BBY A;  4DR1 I;  2LRS A;  1HNW E;  2V2V A;  2IHR 1;  2V89 A;  2B3T B;  4JI7 I;  1I94 E;  2EZ6 A;  2LJH A;  1S4E A;  2UU9 E;  4JYA E;  2V83 A;  5T6J A;  4X65 I;  3V5R A;  4YY3 E;  2L2K B;  1N34 I;  4LF7 I;  4JV5 E;  4DV3 E;  5AAS A;  2V85 A;  4M2Z A;  1J5E I;  4BS9 A;  5A2Q C;  2NPF A;  1HNZ E;  2DEI A;  1UIL A;  3HJC A;  2V34 A;  2L8T A;  2O1U A;  4LFC I;  4LF9 E;  2IOP A;  4DR6 I;  4LTY A;  3ADI A;  1WUU A;  4JI4 I;  2DB2 A;  4HXZ A;  1XMO E;  2JVA A;  4DR2 I;  4B3T I;  4M0V A;  1KKH A;  1PKP A;  2BV3 A;  4DPT A;  4DPU A;  2VQE I;  2F4V I;  2UUA E;  3P06 A;  1WXR A;  4DMI A;  2WZO A;  1N33 E;  4LFB E;  2MC5 A;  2OI2 A;  1WHN A;  4L5N C;  5AE1 A;  3B8H A;  1GQE A;  1N36 E;  1YZ9 A;  3K85 A;  1NHI A;  2LTR A;  3T1H I;  5LMN E;  1GZ6 A;  4LF5 I;  1IBK I;  4DV0 E;  2LUP B;  2V2Q A;  4DUY I;  1FWL A;  2UXC I;  2HK2 A;  4FW9 A;  2CG9 A;  1Z0T A;  2R3V A;  2DSY A;  2O1V A;  4JI7 E;  5FLX C;  2UXD I;  3PYD A;  4PU9 A;  4X64 E;  2ZM6 E;  3LML A;  2O1W A;  2BM0 A;  1Z5B A;  5AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...