4DV0E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv0E02
4DUYI 4JI1E 4JI0I 2L2KB 4WUDA 2EZ6A 1EI1A 4EMDA 5L3JA 1U2RA 1HNZI 4GKJI 4FWHA 3ZZUA 1FJGE 5GMDA 1ZM9A 4JI7I 4YY3E 1IBMI 4X66I 1D6TA 2UXCE 1S4EA 1N36E 1DARA 2UU9E 4R1FA 1X49A 4DR3I 2LTSA 4DV3I 4URLA 2F4VE 1FWLA 2HKJA 2DEJA 3WU4A 3CWVA 4WFTA 4YHHE 4KQVA 4JI3E 4M30A 4WYQB 4DR6E 1Z0EA 4DR4E 4WUCA 1UEKA 1IBKE 4JV5E 4KHPE 1PVGA 3D4JA 1NHJA 2R3VA 3B8HA 4B3SE 1XNRE 3K1JA 2V2QA 2BV3A 5A2QC 3LNUA 3PYFA 4OX9I 3P1XA 4DV1I 1MU5A 3OTOE 1N34E 4DV5I 4XTJA 4DPTA 1XNQI 2UUCE 4Z7CA 2CPNA 1ZM4A 2UUAE 1NZ0A 2UUBI 4DPUA 2RTXA 1EA6A 3T1HE 1N33I 4DV2E 2UXBE 4ZVIA 4K0KI 2UXDI 4AQYI 3B78A 5A2QQ 4ED4A 2HK2A 2VQFE 2V2VA 4M1KA 4B3RI 2KHXA 4JI6E 1FKAE 4NXMI 2HFUA 1A6FA 5LMNE 1GQEA 1H7UA 1HNWI 2L33A 2Q2EB 4LFBE 2DMYA 1YZ9A 2ZM6I 2HK3A 4HACB 1X48A 5FLXQ 1KIJA 1T4NA 4JI2I 4LF8I 4X62E 1IBLE 4NXNI 2VQEE 2DIXA 4P52A 4UTGA 4JI5E 2HKEA 4B3ME 4LF6E 1H7SA 1K47A 1YYWA 4DV4I 1T4LB 5BR8E 4DUZE 2NPFA 4DR5I 2LUPB 4LFAE 1N32I 4LF7I 3T1YE 1ZXMA 3J80Q 4DV6E 1UILA 2DB2A 2A2DA 3WU3A 4Z7YA 1XMQE 3JAMQ 4X64E 4LF5E 4DU7A 4DR2E 2LTRA 1XMOI 1Z0TA 2J7KA 1H73A 4USKA 4B3TE 4DV7I 3M6AA 3GONA 1H72C 4DU8A 4LF4E 2MDRA 1B62A 1NHIA 2E1RA 1WUUA 5IWAE 4DUYE 4JI0E 3QT8A 1B63A 1RR9A 1J26A 1FI4A 4HY1A 1YYOA 1H74A 3V2UC 1HNZE 4GKJE 4JI7E 1WHQA 1Z5BA 2NUEA 1IBME 3ADJA 1Z0GA 4PRVA 4DPXA 4X66E 3ZZ0A 2WW4A 1Z5AA 4GKKI 2YT4A 4X65I 3Q1QA 4DR3E 4FWGA 4JI4I 4DV3E 1ZM3A 1Z0BA 1QZRA 4JYAI 1KVKA 4FW9A 2R42A 2B3TB 2L2MA 3J7AG 4LF9I 2NUGA 2E5LI 4DR1I 5FLXC 2LBSB 1MX0A 1XHKA 4OX9E 1ZM2A 4M2ZA 4DV1E 5LMUI 4DV5E 1J5EI 5CFFE 4DV0I 1XNQE 3VYXA 3VYYA 3ZKBA 1I94I 2UUBE 1Z0CA 2AJ4A 1DI2A 1ELOA 1HR0I 1WHNA 1N33E 2DEIA 4DR7I 3C4BA 4K0KE 4FWDA 4LFCI 1HNXI 2UXDE 3J80C 4AQYE 1VISA 2N3HA 3JAMC 1Z0WA 2HHHI 4B3RE 5LL6R 2OI2A 4P7AA 1NHHA 4NXME 4FN5A 4JI8I 2RS7A 1O0WA 4JI1I 1HNWE 3ZZTA 4HACA 2ZITA 3V5RA 1YYKA 2CZ9A 2ZM6E 4HYMA 1FJGI 4YY3I 2NUFA 2LJHA 4RPFA 3LPSA 4JI2E 4LF8E 2UXCI 2V2ZA 1N36I 2L2NA 2B7TA 4NXNE 1FWKA 2X7IA 2UU9I 3F0NA 4PRXA 2F4VI 3ADGA 4YHHI 4JI3I 3HTXA 4DR6I 4DV4E 4DR4I 1RC7A 4MYUA 4DR5E 1IBKI 3LLHA 4JV5I 1N32E 4KHPI 4LF7E 1BKNA 1KTVA 3J7AM 4B3SI 1XNRI 4WUBA 3HULA 1T4OA 5IT9Q 3PYGA 3J81Q 3OTOI 2A2CA 1N34I 1Z0VA 3QT5A 1XMOE 2BM0A 2VF3A 1RQ0A 4UT4A 2JY9A 4DV7E 2UUCI 4OOGC 3WU5A 4DPYA 2EFGA 2V34A 3WU6A 2UUAI 2L3CA 1PIEA 2RSMA 1S16A 4DXLA 3C4TA 2BM1A 2B7VA 1ZXNA 2LJPA 3T1HI 2IHR1 1OJ4A 4I3HA 4DV2I 2UXBI 4DKKA 2XEXA 3PYDA 3ZM7A 1PKPA 1Z59A 4MYTA 2GS8A 2VQFI 3QT6A 4GKKE 1KKHA 2N3GA 4X65E 2LUQA 4JI4E 1N0VC 4PU9A 4JI6I 1UHZA 3QT7A 5LMNI 4JYAE 2X36A 2JVAA 2ZBKB 4LFBI 1FNMA 4LF9E 2NA2A 3PYEA 3ADLA 2E5LE 4DR1E 3H4LA 3J7Yp 2LRSA 4X62I 2V8PA 5LMUE 1IBLI 4USMA 4HXZA 1J5EE 2VQEI 1ZBTA 4DPWA 4JI5I 4B3MI 4DV0E 4LF6I 1I94E 5BR8I 3ADIA 4JG4A 4DUZI 4X8WA 1STUA 3ZKDA 1HR0E 1MG7A 4LFAI 1RREA 3T1YI 4DR7E 4DV6I 1HNXE 4LFCE 3B82A 3LTOA 1XMQI 1EKZA 4X64I 4LF5I 3K17A 5IT9C 3J81C 4DR2I 2L3JA 1Z5CA 2RS6A 2HHHE 5GMEA 4B3TI 1QU6A 1X47A 1N0UA 4LF4I 4JI8E 2HFSA 5IWAI
chains in the Genus database with same CATH superfamily
4DUYI 4JI1E 4JI0I 4U3BA 2L2KB 4QNJA 2BA0D 2YRMA 4WUDA 2Z5CA 2EZ6A 1X6HA 1EI1A 3B4TA 2KOUA 2PO2B 4F2JC 2EMIA 5FWKA 4EMDA 2BA1G 2PRTA 1UDNA 1KYQA 4BS9A 1U2RA 2O1TA 3P3CA 2YU8A 4F6MA 5L3JA 2K4VA 2M9AA 3H09A 2YSOA 2M7QA 2C38B 1HNZI 4GKJI 4FWHA 3ZZUA 1FJGE 4MU1A 2EN8A 5GMDA 1ZM9A 4JI7I 4YY3E 1IBMI 5K36F 2VRDA 4OO1B 3HQ1A 4BA1B 4X66I 2UXCE 1D6TA 2EPRA 1A1GA 4R2CA 1N36E 1S4EA 2BBGA 1DARA 3Q6MA 3DF6A 2NN6A 2UU9E 4R1FA 1X49A 4DR3I 2LTSA 4TUIA 3ECRA 3L00A 1AAYA 3DJWA 2IERA 4ZYDA 4URLA 4DV3I 2F4VE 2G7HA 1FWLA 4BBYA 4R2RA 2DEJA 2HKJA 4LPFA 3WU4A 2L92A 4R2EA 2JT2A 3CWVA 3P3EA 4WFTA 4YHHE 2V88A 1KJKA 4LU9A 4KQVA 3ZOQB 4JI3E 2Z5EA 4M30A 4WYQB 2EN3A 4WXCA 2EN4A 4DR6E 4BCAA 1Z0EA 1A1KA 4DR4E 4WUCA 1UEKA 2EPZA 4IFDF 5JEAA 1NCSA 1IBKE 4JV5E 4KHPE 1PVGA 3D4JA 1NHJA 2R3VA 3L7ZA 3B8HA 1X3CA 4B3SE 1XNRE 4OKGA 2WP8A 3K1JA 2V2QA 5ADZA 2BV3A 2EMXA 5A2QC 3LNUA 3PYFA 2EMCA 4OX9I 3P1XA 4DV1I 4KWYA 5AE2A 1MU5A 3OTOE 2EQ1A 1N34E 2PNMA 1EH7A 4DV5I 2V83A 2DMIA 4XTJA 5JEAC 1GZ6A 4WXDA 5AC4A 4DPTA 2YTNA 1XNQI 3KRNA 2UUCE 2EN6A 4Z7CA 1HK7A 2EM2A 2EMHA 4ISAA 2CPNA 1ZM4A 3UHMA 1VI7A 2GQ0A 2LCEA 2UUAE 2EPNA 1NZ0A 3DD6A 1E3HA 2UUBI 4DPUA 2EPUA 2J7JA 2RTXA 4O4KA 5EL9A 5AASA 1EA6A 5C0XB 4FW6A 3T1HE 1N33I 4N4RB 4FW7A 4OO1F 2EE8A 4DV2E 2UXBE 2EPKX 2VF1A 1JK2A 4ZVIA 4K0KI 2LT7A 2UXDI 4AQYI 1IMUA 2JR1A 3B78A 2EM8A 2EMYA 5A2QQ 2MKDA 4ED4A 4J3DA 4AM3A 3K6QA 2HK2A 2VQFE 2V2VA 3F6GA 4M1KA 4GQUA 2C39B 2FV4B 2LO3A 2O1VA 4B3RI 2KHXA 2DLQA 5A6JA 4I8OA 4JI6E 1FKAE 4NXMI 2HFUA 4HTGA 1Z1BA 2F8BA 2YTIA 1A6FA 2BB8A 3IWCA 5LMNE 1GQEA 1H7UA 1HNWI 4FW3A 1IQSA 4BA2B 2L33A 2Q2EB 4LFBE 2DMYA 1IQOA 1YZ9A 1TF3A 3EPKA 4WPYA 2ZM6I 3EPJA 2HK3A 2Z5BB 2EPAA 2PNZA 5K36A 2LJUA 4HACB 1X48A 3LMLA 2YZTA 4MLQA 4WSGA 4LCGA 5FLXQ 1KIJA 5C0XD 2A25A 2HC5A 2YU5A 1A1JA 1T4NA 5T6JA 5ELWA 4JI2I 4LF8I 3M99B 2D9HA 2RSIA 2IOQA 4X62E 5A6KA 1IBLE 4NXNI 4F9AB 4P7DA 2VQEE 2CG9A 2DIXA 4LTYA 4P52A 2WZOA 4UTGA 1Y4SA 4JI5E 5K36C 2HKEA 4B3ME 4LF6E 1H7SA 4R8OA 1K47A 1YYWA 2EMWA 2E72A 2EM4A 2ODRC 2EQ0A 2PO0A 1LLMC 5C0XF 3CDIA 1UN6B 4IZJA 4IFDA 3FIGA 1YPNA 2M1SA 4DV4I 2EP3A 1T4LB 5BR8E 2L8TA 4L8NA 4DUZE 1UDSA 3OMLA 2NPFA 2YWQA 2LUPB 4DR5I 4LFAE 1N32I 4LF7I 3T1YE 2GHFA 5DRPA 1ZXMA 3J80Q 1X5WA 4DV6E 1F2IG 1UILA 1A1FA 2DB2A 3THNA 2A2DA 2MDGA 4Z7YA 3WU3A 1XMQE 1MGTA 2V87A 4MU0A 3JAMQ 2V85A 3PS1A 1PDAA 3KZYA 2JE6B 4IFDC 4X64E 4LF5E 1YH8A 2JEBA 4DU7A 3Q6NA 2EOQA 4DR2E 2LTRA 1XMOI 1Z0TA 2J7KA 1G2DC 1H73A 4USKA 2EN1A 2PO2A 4B3TE 4DV7I 3M6AA 3GONA 2EL4A 4AIDA 3HPSA 1H72C 4DU8A 4LF4E 2MDRA 4DMIA 1X6FA 2DSYA 1B62A 2LE2A 1NHIA 1WUUA 5IWAE 2YTJA 2EM6A 2BA0G 4DUYE 2C38A 3PRYA 5EKWA 4JI0E 3QT8A 1B63A 1RR9A 4X9JA 2KONA 1J26A 1FI4A 4HY1A 1DQ3A 1YYOA 1A1HA 2EN2A 1YUIA 4OO1A 1Y60A 1H74A 3V2UC 2DRPA 1MEYC 2NN6C 4J8ZA 2EM9A 1HNZE 4GKJE 4LCFA 5DRQA 5C0XE 3P3GA 2HJJA 2JXPA 4JI7E 2E1RA 2EPOA 1WHQA 1Z5BA 2NUEA 3IWDA 1IBME 3ADJA 1Z0GA 1BBGA 4PRVA 4DPXA 4L5NC 4X66E 3AV0A 3L7ZB 2YTOA 4N3OA 2WW4A 3ZZ0A 1Z5AA 1ZBQA 4GKKI 4R2DA 2YT4A 4OO1C 4X65I 5A6AA 3Q1QA 4DR3E 4FWGA 1R6LA 2JP9A 4JI4I 4RH8A 4R2AA 2CTDA 4DV3E 4WX9A 1ZM3A 1Z0BA 2DGCA 1QZRA 4JYAI 2N8XA 3HXLA 2F1DA 2EMGA 4MU4A 4MU3A 1KVKA 1UBDC 4FW9A 2NABA 2NN6D 2MC5A 2WCC3 2R42A 3P76A 1WRJA 1UDOA 2VE7C 2B3TB 2L2MA 3J7AG 2WBSA 1Y4UA 4LF9I 2EQ3A 2GLIA 3KWRA 2NUGA 2E5LI 2EM0A 4DR1I 5FLXC 2LBSB 1MX0A 1XHKA 2EOFA 4OX9E 1ZM2A 4M2ZA 4DV1E 2B9DA 3EPLA 4OZEA 2YTFA 3U1KA 5LMUI 1ZAAC 4DV5E 5JEAD 4O5GA 1J5EI 4NZVA 5DNYA 5CFFE 4R2PA 4DV0I 1XNQE 4IS9A 2YRKA 2H36X 2YPNA 1QNTA 2EPMX 3VYXA 4FW5A 2VESA 3VYYA 1ZU1A 3ZKBA 5KL2A 1PJQA 2EOHA 2EMKA 4O24A 5A6BA 2UUBE 1I94I 1Z0CA 2AJ4A 3C6MA 2CT1A 1DI2A 4Q35B 1ELOA 1HR0I 2PO1A 1SR9A 1WHNA 1N33E 5A69A 2DEIA 5KL5A 5DNXA 2EPLX 3VHTB 2C39A 2CGEA 4DR7I 3C4BA 4K0KE 4FWDA 4LFCI 1HNXI 1X6EA 4BC7A 2UXDE 3J80C 4AQYE 2O1UA 2V86A 1VISA 2YTPA 3JTZA 3C6KA 1G2FC 2N3HA 2YRHA 3JAMC 5KL3A 1WXRA 1Z0WA 2WNRB 4GZNC 4B3RE 5LL6R 2OI2A 2HHHI 3K85A 4P7AA 4MLVA 1GTKA 1NHHA 4NXME 4FN5A 1EH8A 4LOMA 4JI8I 2JEAA 1YHCA 2EMZA 3JU0A 4WSPA 2RS7A 2NN6E 1O0WA 4JI1I 3M7ND 1HNWE 2CVEA 2ELYA 4HACA 2ZITA 3V5RA 3ZZTA 1YYKA 4IZKA 5AE1A 3NZKA 3CDJA 2EOXA 2CZ9A 2L6MA 1RHYA 1YFHA 2ZM6E 2C37A 4HYMA 2PO0B 4ZYEA 2WP8B 3QG5C 1P42A 1USVA 2BA1D 2CSHA 1FJGI 1Y5YA 2Z5CB 2YTEA 3H1CA 4BHBA 4IJDA 4YY3I 2NUFA 2LJHA 4RPFA 3EQ1A 4M9VC 3LPSA 2K7IA 4JI2E 4LF8E 2UXCI 1ZR9A 1WJPA 2V2ZA 2L2NA 4NHRA 3UK3C 3HKMA 5JEAE 1N36I 1N3GA 2BR2A 2B7TA 5IXMB 4NXNE 1FWKA 2YSPA 2X7IA 5DRRA 2UU9I 5K36D 3F0NA 1E3PA 5DROA 2RQLA 3F6HA 3AUZA 1A1LA 2JEBB 4PRXA 2ODRD 2EM7A 2F4VI 1R6MA 2GPIA 2GO3A 2M4IA 3ADGA 4RHBB 2NN6B 3HJCA 4BC9A 4YHHI 3BGHA 2ENHA 1AH5A 2I9IA 4JI3I 4IS1C 3EPHA 2GO4A 3HTXA 2ENCA 2ELZA 4DR6I 4DV4E 4M0VA 1DGCA 1RC7A 4MYUA 4DR4I 2DLKA 2Q8UA 5KL7A 4DR5E 3PS2A 2JE6A 1IBKI 3LLHA 2AE8A 1N32E 1YSAC 1L4SA 4LF7E 5DNLA 1BKNA 4BA1A 5AE3A 4JV5I 4KHPI 2EOOA 4U3DA 2EOSA 2JYAA 1T38A 1KTVA 3IWBA 5IV8B 4B3SI 4F6NA 1XNRI 2O1WA 3J7AM 4WUBA 4IFDD 3HULA 4IZJD 1T4OA 2LVHA 2EJ4A 2IESA 4BMJA 2EWLA 5IT9Q 2EOEA 2EN7A 3PYGA 4R2SA 5JEAB 3J81Q 3OTOI 2A2CA 1N34I 1Z0VA 3THOB 3QT5A 4QNKA 2WBTA 4R03A 4BHCA 1XMOE 2BM0A 2VF3A 2EL6A 1RQ0A 1OYPA 4UT4A 2LMZA 2JY9A 4DV7E 2J65A 2UUCI 1SFEA 4OOGC 3WU5A 4DPYA 2EFGA 2V34A 4Q28A 5F3WA 2L3CA 3WU6A 1PIEA 2RSMA 2UUAI 2RPCA 2FTXB 1S16A 4DXLA 3C4TA 3MSWA 2B7VA 1TF6A 1ZXNA 3MHSC 2BM1A 3P06A 2LJPA 2FGGA 3T1HI 2EM3A 2IHR1 1OJ4A 2EOYA 1NEIA 2EL5A 4I3HA 4DV2I 2UXBI 3HPZA 4KZSA 4ZYGA 4DKKA 1P47A 1XXEA 1BBOA 2XEXA 3TQMA 3GCMA 3PYDA 3ZM7A 1PKPA 1Z59A 4MYTA 1B69A 2GS8A 2VQFI 4OO1D 2R76A 5K36E 4F9CB 4GKKE 1KKHA 3QT6A 2N3GA 2EMLA 2EMFA 4X65E 3KZZA 2LUQA 4JI4E 1N0VC 2NN6F 4PU9A 1A1IA 4JI6I 2JWOA 1UHZA 3VK6A 2EPPA 3QT7A 2EOIA 4MQYA 3M85D 5LMNI 4JYAE 2X36A 1UDQA 1USUA 5C0XA 2JVAA 2ZBKB 2LV2A 2IOPA 2JOXA 4LFBI 2EORA 3MHHC 2EOMA 4NBQA 1OYRA 1FNMA 4MDTA 1EH6A 4P78A 4LF9E 2NA2A 3GLLA 2ADRA 3PYEA 4HEIA 3ADLA 2E5LE 2EPXA 4DR1E 4IFDE 3H4LA 3J7Yp 5JEAF 2LRSA 2MC6A 2PO1B 1BB8A 2V8QB 3PS3A 3GMEA 2EM5A 5C0XC 4X62I 2I13A 2R1FA 3RMPA 1YUJA 4TUGA 2V8PA 2YTGA 5LMUE 2PNZB 1IBLI 1JK1A 4USMA 4HXZA 5K36B 1J5EE 3M85G 2VQEI 2EPCA 1ZBTA 2YTQA 1T39A 1Y6ZA 4DPWA 4JI5I 4B3MI 2WBUA 4FK5C 4DV0E 4LF6I 4BA2A 2EOJA 2PNLA 1PJSA 5LLQA 2JOBA 4LCHA 2Z5BA 4F54A 5KL6A 2JEAB 1I94E 3BF2A 5BR8I 3ADIA 4JG4A 4DUZI 2V89A 4X8WA 1STUA 4FW4A 1HR0E 2EMAA 1MG7A 4GEQB 3ZKDA 4F9BB 1RREA 3T1YI 4IZKB 4LFAI 2ENAA 4DR7E 1TN9A 4AIMA 4DV6I 2WNRA 4IFDB 3BBGA 5KL4A 4O43A 2EOZA 1HNXE 2JPAA 4LFCE 3B82A 3LTOA 2C37B 4IZJB 2E1MA 4R2QA 1XMQI 4OO1E 4ZYHA 5A6BD 1EKZA 2O3ZA 1RMDA 5TSEA 4X64I 4LF5I 3K17A 5IT9C 2HGHA 2EMBA 3J81C 1OYSA 4DR2I 2L3JA 1PJTA 5AC5A 2RS6A 1Z5CA 2HHHE 2YTDA 5GMEA 4B3TI 2MKNA 1QU6A 2BR2B 1X47A 1N0UA 4LF4I 3M7NG 4JI8E 3BIDA 3U1YA 2HFSA 5IWAI
chains in the Genus database with same CATH topology
4DUYI 4JI1E 4JI0I 2L2KB 4WUDA 2Z5CA 2EZ6A 1EI1A 5FWKA 2KOUA 4EMDA 5L3JA 4BS9A 1U2RA 2O1TA 2K4VA 3H09A 1HNZI 4GKJI 2M7QA 4FWHA 3ZZUA 1FJGE 5GMDA 1ZM9A 4JI7I 4YY3E 1IBMI 3HQ1A 4X66I 1D6TA 2UXCE 1S4EA 1N36E 1DARA 3Q6MA 3DF6A 2UU9E 4R1FA 1X49A 4DR3I 2LTSA 4TUIA 3DJWA 4DV3I 4URLA 2F4VE 2G7HA 1FWLA 4BBYA 2HKJA 2DEJA 3WU4A 2L92A 3CWVA 4WFTA 4YHHE 2V88A 4KQVA 4LU9A 3ZOQB 4JI3E 2Z5EA 4M30A 4WYQB 4DR6E 4BCAA 1Z0EA 4DR4E 4WUCA 1UEKA 1IBKE 4JV5E 4KHPE 1PVGA 3D4JA 1NHJA 2R3VA 3B8HA 4B3SE 1XNRE 3K1JA 2V2QA 5ADZA 2BV3A 5A2QC 3LNUA 3PYFA 4OX9I 3P1XA 4DV1I 5AE2A 1MU5A 3OTOE 2PNMA 1N34E 4DV5I 2V83A 4XTJA 1GZ6A 4DPTA 1XNQI 2UUCE 4Z7CA 1HK7A 2CPNA 1ZM4A 2GQ0A 2UUAE 1NZ0A 2UUBI 4DPUA 2RTXA 5AASA 1EA6A 3T1HE 1N33I 4DV2E 2UXBE 2VF1A 4ZVIA 4K0KI 2UXDI 4AQYI 2JR1A 3B78A 5A2QQ 4ED4A 3K6QA 2HK2A 2VQFE 2V2VA 3F6GA 4M1KA 2FV4B 2O1VA 4B3RI 2KHXA 4I8OA 4JI6E 1FKAE 4NXMI 2HFUA 2F8BA 1A6FA 5LMNE 3IWCA 1GQEA 1H7UA 1HNWI 2L33A 2Q2EB 4LFBE 2DMYA 1YZ9A 2ZM6I 4WPYA 2HK3A 2Z5BB 4HACB 1X48A 3LMLA 2YZTA 5FLXQ 1KIJA 1T4NA 5T6JA 4JI2I 4LF8I 2IOQA 4X62E 1IBLE 4NXNI 4F9AB 4P7DA 2VQEE 2CG9A 2DIXA 4LTYA 4P52A 2WZOA 4UTGA 1Y4SA 4JI5E 2HKEA 4B3ME 4LF6E 1H7SA 4R8OA 1K47A 1YYWA 2ODRC 4IZJA 3FIGA 2M1SA 4DV4I 1T4LB 5BR8E 2L8TA 4L8NA 4DUZE 2NPFA 3OMLA 4DR5I 2LUPB 4LFAE 1N32I 4LF7I 3T1YE 1ZXMA 3J80Q 4DV6E 1UILA 2DB2A 2A2DA 3WU3A 4Z7YA 1XMQE 2V87A 3JAMQ 2V85A 4X64E 4LF5E 4DU7A 3Q6NA 4DR2E 2LTRA 1XMOI 1Z0TA 2J7KA 1H73A 4USKA 4B3TE 4DV7I 3M6AA 3GONA 3HPSA 1H72C 4DU8A 4LF4E 2MDRA 4DMIA 2DSYA 1B62A 2LE2A 1NHIA 1WUUA 5IWAE 2E1RA 3PRYA 4DUYE 4JI0E 3QT8A 1B63A 1RR9A 2KONA 1J26A 1FI4A 4HY1A 1DQ3A 1YYOA 1H74A 3V2UC 4J8ZA 1HNZE 4GKJE 4JI7E 1WHQA 1Z5BA 2NUEA 3IWDA 1IBME 3ADJA 1Z0GA 4PRVA 4DPXA 4L5NC 4X66E 3AV0A 4N3OA 3ZZ0A 2WW4A 1Z5AA 1ZBQA 4GKKI 2YT4A 4X65I 3Q1QA 4DR3E 4FWGA 4JI4I 4DV3E 1ZM3A 1Z0BA 1QZRA 4JYAI 3HXLA 1KVKA 4FW9A 2MC5A 2R42A 2VE7C 2B3TB 2L2MA 3J7AG 1Y4UA 4LF9I 3KWRA 2NUGA 2E5LI 4DR1I 5FLXC 2LBSB 1MX0A 1XHKA 4OX9E 1ZM2A 4M2ZA 4DV1E 2B9DA 5LMUI 4DV5E 1J5EI 5DNYA 5CFFE 4DV0I 1XNQE 2H36X 3VYXA 3VYYA 3ZKBA 1I94I 2UUBE 1Z0CA 2AJ4A 1DI2A 1ELOA 1HR0I 1SR9A 1WHNA 1N33E 2DEIA 4DR7I 2CGEA 3C4BA 4K0KE 4FWDA 4LFCI 1HNXI 4BC7A 2UXDE 3J80C 4AQYE 2O1UA 2V86A 1VISA 3JTZA 2N3HA 3JAMC 1WXRA 1Z0WA 2HHHI 4B3RE 5LL6R 2OI2A 3K85A 4P7AA 1NHHA 4NXME 4FN5A 4JI8I 4WSPA 3JU0A 2RS7A 1O0WA 4JI1I 1HNWE 3ZZTA 4HACA 2ZITA 3V5RA 1YYKA 4IZKA 5AE1A 2CZ9A 2L6MA 2ZM6E 4HYMA 1USVA 1FJGI 2Z5CB 4YY3I 2NUFA 2LJHA 4RPFA 3LPSA 4JI2E 4LF8E 2UXCI 2V2ZA 1N36I 2L2NA 2B7TA 4NXNE 1FWKA 2X7IA 2UU9I 3F0NA 3F6HA 3AUZA 4PRXA 2ODRD 2F4VI 2M4IA 3ADGA 4YHHI 3HJCA 4BC9A 4JI3I 3HTXA 4DR6I 4DV4E 4M0VA 4DR4I 1RC7A 4MYUA 4DR5E 1IBKI 3LLHA 4JV5I 1N32E 4KHPI 4LF7E 1BKNA 5AE3A 1KTVA 3J7AM 3IWBA 4B3SI 1XNRI 2O1WA 4WUBA 3HULA 4IZJD 1T4OA 4BMJA 2EWLA 5IT9Q 3PYGA 3J81Q 3OTOI 2A2CA 1N34I 1Z0VA 3QT5A 4R03A 1XMOE 2BM0A 2VF3A 1RQ0A 4UT4A 2LMZA 2JY9A 4DV7E 2UUCI 4OOGC 3WU5A 4DPYA 2EFGA 2V34A 4Q28A 5F3WA 2L3CA 3WU6A 1PIEA 2RSMA 2UUAI 2FTXB 1S16A 4DXLA 3C4TA 3MSWA 2B7VA 1ZXNA 2BM1A 3P06A 2LJPA 2FGGA 3T1HI 2IHR1 1OJ4A 4I3HA 4DV2I 2UXBI 3HPZA 4KZSA 4DKKA 2XEXA 3PYDA 3ZM7A 1PKPA 1Z59A 4MYTA 2GS8A 2VQFI 4GKKE 4F9CB 1KKHA 3QT6A 2N3GA 4X65E 2LUQA 4JI4E 1N0VC 4PU9A 4JI6I 2JWOA 1UHZA 3VK6A 3QT7A 5LMNI 4JYAE 2X36A 1USUA 2JVAA 2ZBKB 2IOPA 2JOXA 4LFBI 1FNMA 4P78A 4LF9E 2NA2A 3PYEA 3ADLA 2E5LE 4DR1E 3H4LA 3J7Yp 2LRSA 2MC6A 2V8QB 4X62I 3RMPA 4TUGA 2V8PA 5LMUE 1IBLI 4USMA 4HXZA 1J5EE 2VQEI 1ZBTA 1Y6ZA 4DPWA 4JI5I 4B3MI 4DV0E 4LF6I 2PNLA 2JOBA 2Z5BA 4F54A 1I94E 5BR8I 3ADIA 4JG4A 4DUZI 2V89A 4X8WA 1STUA 3ZKDA 1HR0E 1MG7A 4LFAI 4GEQB 4F9BB 1RREA 3T1YI 4IZKB 4DR7E 4DV6I 4IZJB 1HNXE 4LFCE 3B82A 3LTOA 1XMQI 2E1MA 1EKZA 4X64I 4LF5I 3K17A 5IT9C 3J81C 4DR2I 2L3JA 1Z5CA 2RS6A 2HHHE 5GMEA 4B3TI 1QU6A 1X47A 1N0UA 4LF4I 4JI8E 2HFSA 5IWAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY I;  4JI1 E;  4JI0 I;  2L2K B;  4WUD A;  2EZ6 A;  1EI1 A;  4EMD A;  5L3J A;  1U2R A;  1HNZ I;  4GKJ I;  4FWH A;  3ZZU A;  1FJG E;  5GMD A;  1ZM9 A;  4JI7 I;  4YY3 E;  1IBM I;  4X66 I;  1D6T A;  2UXC E;  1S4E A;  1N36 E;  1DAR A;  2UU9 E;  4R1F A;  1X49 A;  4DR3 I;  2LTS A;  4DV3 I;  4URL A;  2F4V E;  1FWL A;  2HKJ A;  2DEJ A;  3WU4 A;  3CWV A;  4WFT A;  4YHH E;  4KQV A;  4JI3 E;  4M30 A;  4WYQ B;  4DR6 E;  1Z0E A;  4DR4 E;  4WUC A;  1UEK A;  1IBK E;  4JV5 E;  4KHP E;  1PVG A;  3D4J A;  1NHJ A;  2R3V A;  3B8H A;  4B3S E;  1XNR E;  3K1J A;  2V2Q A;  2BV3 A;  5A2Q C;  3LNU A;  3PYF A;  4OX9 I;  3P1X A;  4DV1 I;  1MU5 A;  3OTO E;  1N34 E;  4DV5 I;  4XTJ A;  4DPT A;  1XNQ I;  2UUC E;  4Z7C A;  2CPN A;  1ZM4 A;  2UUA E;  1NZ0 A;  2UUB I;  4DPU A;  2RTX A;  1EA6 A;  3T1H E;  1N33 I;  4DV2 E;  2UXB E;  4ZVI A;  4K0K I;  2UXD I;  4AQY I;  3B78 A;  5A2Q Q;  4ED4 A;  2HK2 A;  2VQF E;  2V2V A;  4M1K A;  4B3R I;  2KHX A;  4JI6 E;  1FKA E;  4NXM I;  2HFU A;  1A6F A;  5LMN E;  1GQE A;  1H7U A;  1HNW I;  2L33 A;  2Q2E B;  4LFB E;  2DMY A;  1YZ9 A;  2ZM6 I;  2HK3 A;  4HAC B;  1X48 A;  5FLX Q;  1KIJ A;  1T4N A;  4JI2 I;  4LF8 I;  4X62 E;  1IBL E;  4NXN I;  2VQE E;  2DIX A;  4P52 A;  4UTG A;  4JI5 E;  2HKE A;  4B3M E;  4LF6 E;  1H7S A;  1K47 A;  1YYW A;  4DV4 I;  1T4L B;  5BR8 E;  4DUZ E;  2NPF A;  4DR5 I;  2LUP B;  4LFA E;  1N32 I;  4LF7 I;  3T1Y E;  1ZXM A;  3J80 Q;  4DV6 E;  1UIL A;  2DB2 A;  2A2D A;  3WU3 A;  4Z7Y A;  1XMQ E;  3JAM Q;  4X64 E;  4LF5 E;  4DU7 A;  4DR2 E;  2LTR A;  1XMO I;  1Z0T A;  2J7K A;  1H73 A;  4USK A;  4B3T E;  4DV7 I;  3M6A A;  3GON A;  1H72 C;  4DU8 A;  4LF4 E;  2MDR A;  1B62 A;  1NHI A;  2E1R A;  1WUU A;  5IWA E;  4DUY E;  4JI0 E;  3QT8 A;  1B63 A;  1RR9 A;  1J26 A;  1FI4 A;  4HY1 A;  1YYO A;  1H74 A;  3V2U C;  1HNZ E;  4GKJ E;  4JI7 E;  1WHQ A;  1Z5B A;  2NUE A;  1IBM E;  3ADJ A;  1Z0G A;  4PRV A;  4DPX A;  4X66 E;  3ZZ0 A;  2WW4 A;  1Z5A A;  4GKK I;  2YT4 A;  4X65 I;  3Q1Q A;  4DR3 E;  4FWG A;  4JI4 I;  4DV3 E;  1ZM3 A;  1Z0B A;  1QZR A;  4JYA I;  1KVK A;  4FW9 A;  2R42 A;  2B3T B;  2L2M A;  3J7A G;  4LF9 I;  2NUG A;  2E5L I;  4DR1 I;  5FLX C;  2LBS B;  1MX0 A;  1XHK A;  4OX9 E;  1ZM2 A;  4M2Z A;  4DV1 E;  5LMU I;  4DV5 E;  1J5E I;  5CFF E;  4DV0 I;  1XNQ E;  3VYX A;  3VYY A;  3ZKB A;  1I94 I;  2UUB E;  1Z0C A;  2AJ4 A;  1DI2 A;  1ELO A;  1HR0 I;  1WHN A;  1N33 E;  2DEI A;  4DR7 I;  3C4B A;  4K0K E;  4FWD A;  4LFC I;  1HNX I;  2UXD E;  3J80 C;  4AQY E;  1VIS A;  2N3H A;  3JAM C;  1Z0W A;  2HHH I;  4B3R E;  5LL6 R;  2OI2 A;  4P7A A;  1NHH A;  4NXM E;  4FN5 A;  4JI8 I;  2RS7 A;  1O0W A;  4JI1 I;  1HNW E;  3ZZT A;  4HAC A;  2ZIT A;  3V5R A;  1YYK A;  2CZ9 A;  2ZM6 E;  4HYM A;  1FJG I;  4YY3 I;  2NUF A;  2LJH A;  4RPF A;  3LPS A;  4JI2 E;  4LF8 E;  2UXC I;  2V2Z A;  1N36 I;  2L2N A;  2B7T A;  4NXN E;  1FWK A;  2X7I A;  2UU9 I;  3F0N A;  4PRX A;  2F4V I;  3ADG A;  4YHH I;  4JI3 I;  3HTX A;  4DR6 I;  4DV4 E;  4DR4 I;  1RC7 A;  4MYU A;  4DR5 E;  1IBK I;  3LLH A;  4JV5 I;  1N32 E;  4KHP I;  4LF7 E;  1BKN A;  1KTV A;  3J7A M;  4B3S I;  1XNR I;  4WUB A;  3HUL A;  1T4O A;  5IT9 Q;  3PYG A;  3J81 Q;  3OTO I;  2A2C A;  1N34 I;  1Z0V A;  3QT5 A;  1XMO E;  2BM0 A;  2VF3 A;  1RQ0 A;  4UT4 A;  2JY9 A;  4DV7 E;  2UUC I;  4OOG C;  3WU5 A;  4DPY A;  2EFG A;  2V34 A;  3WU6 A;  2UUA I;  2L3C A;  1PIE A;  2RSM A;  1S16 A;  4DXL A;  3C4T A;  2BM1 A;  2B7V A;  1ZXN A;  2LJP A;  3T1H I;  2IHR 1;  1OJ4 A;  4I3H A;  4DV2 I;  2UXB I;  4DKK A;  2XEX A;  3PYD A;  3ZM7 A;  1PKP A;  1Z59 A;  4MYT A;  2GS8 A;  2VQF I;  3QT6 A;  4GKK E;  1KKH A;  2N3G A;  4X65 E;  2LUQ A;  4JI4 E;  1N0V C;  4PU9 A;  4JI6 I;  1UHZ A;  3QT7 A;  5LMN I;  4JYA E;  2X36 A;  2JVA A;  2ZBK B;  4LFB I;  1FNM A;  4LF9 E;  2NA2 A;  3PYE A;  3ADL A;  2E5L E;  4DR1 E;  3H4L A;  3J7Y p;  2LRS A;  4X62 I;  2V8P A;  5LMU E;  1IBL I;  4USM A;  4HXZ A;  1J5E E;  2VQE I;  1ZBT A;  4DPW A;  4JI5 I;  4B3M I;  4DV0 E;  4LF6 I;  1I94 E;  5BR8 I;  3ADI A;  4JG4 A;  4DUZ I;  4X8W A;  1STU A;  3ZKD A;  1HR0 E;  1MG7 A;  4LFA I;  1RRE A;  3T1Y I;  4DR7 E;  4DV6 I;  1HNX E;  4LFC E;  3B82 A;  3LTO A;  1XMQ I;  1EKZ A;  4X64 I;  4LF5 I;  3K17 A;  5IT9 C;  3J81 C;  4DR2 I;  2L3J A;  1Z5C A;  2RS6 A;  2HHH E;  5GME A;  4B3T I;  1QU6 A;  1X47 A;  1N0U A;  4LF4 I;  4JI8 E;  2HFS A;  5IWA I; 
#chains in the Genus database with same CATH topology
 4DUY I;  4JI1 E;  4JI0 I;  4U3B A;  2L2K B;  4QNJ A;  2BA0 D;  2YRM A;  4WUD A;  2Z5C A;  2EZ6 A;  1X6H A;  1EI1 A;  3B4T A;  2KOU A;  2PO2 B;  4F2J C;  2EMI A;  5FWK A;  4EMD A;  2BA1 G;  2PRT A;  1UDN A;  1KYQ A;  4BS9 A;  1U2R A;  2O1T A;  3P3C A;  2YU8 A;  4F6M A;  5L3J A;  2K4V A;  2M9A A;  3H09 A;  2YSO A;  2M7Q A;  2C38 B;  1HNZ I;  4GKJ I;  4FWH A;  3ZZU A;  1FJG E;  4MU1 A;  2EN8 A;  5GMD A;  1ZM9 A;  4JI7 I;  4YY3 E;  1IBM I;  5K36 F;  2VRD A;  4OO1 B;  3HQ1 A;  4BA1 B;  4X66 I;  2UXC E;  1D6T A;  2EPR A;  1A1G A;  4R2C A;  1N36 E;  1S4E A;  2BBG A;  1DAR A;  3Q6M A;  3DF6 A;  2NN6 A;  2UU9 E;  4R1F A;  1X49 A;  4DR3 I;  2LTS A;  4TUI A;  3ECR A;  3L00 A;  1AAY A;  3DJW A;  2IER A;  4ZYD A;  4URL A;  4DV3 I;  2F4V E;  2G7H A;  1FWL A;  4BBY A;  4R2R A;  2DEJ A;  2HKJ A;  4LPF A;  3WU4 A;  2L92 A;  4R2E A;  2JT2 A;  3CWV A;  3P3E A;  4WFT A;  4YHH E;  2V88 A;  1KJK A;  4LU9 A;  4KQV A;  3ZOQ B;  4JI3 E;  2Z5E A;  4M30 A;  4WYQ B;  2EN3 A;  4WXC A;  2EN4 A;  4DR6 E;  4BCA A;  1Z0E A;  1A1K A;  4DR4 E;  4WUC A;  1UEK A;  2EPZ A;  4IFD F;  5JEA A;  1NCS A;  1IBK E;  4JV5 E;  4KHP E;  1PVG A;  3D4J A;  1NHJ A;  2R3V A;  3L7Z A;  3B8H A;  1X3C A;  4B3S E;  1XNR E;  4OKG A;  2WP8 A;  3K1J A;  2V2Q A;  5ADZ A;  2BV3 A;  2EMX A;  5A2Q C;  3LNU A;  3PYF A;  2EMC A;  4OX9 I;  3P1X A;  4DV1 I;  4KWY A;  5AE2 A;  1MU5 A;  3OTO E;  2EQ1 A;  1N34 E;  2PNM A;  1EH7 A;  4DV5 I;  2V83 A;  2DMI A;  4XTJ A;  5JEA C;  1GZ6 A;  4WXD A;  5AC4 A;  4DPT A;  2YTN A;  1XNQ I;  3KRN A;  2UUC E;  2EN6 A;  4Z7C A;  1HK7 A;  2EM2 A;  2EMH A;  4ISA A;  2CPN A;  1ZM4 A;  3UHM A;  1VI7 A;  2GQ0 A;  2LCE A;  2UUA E;  2EPN A;  1NZ0 A;  3DD6 A;  1E3H A;  2UUB I;  4DPU A;  2EPU A;  2J7J A;  2RTX A;  4O4K A;  5EL9 A;  5AAS A;  1EA6 A;  5C0X B;  4FW6 A;  3T1H E;  1N33 I;  4N4R B;  4FW7 A;  4OO1 F;  2EE8 A;  4DV2 E;  2UXB E;  2EPK X;  2VF1 A;  1JK2 A;  4ZVI A;  4K0K I;  2LT7 A;  2UXD I;  4AQY I;  1IMU A;  2JR1 A;  3B78 A;  2EM8 A;  2EMY A;  5A2Q Q;  2MKD A;  4ED4 A;  4J3D A;  4AM3 A;  3K6Q A;  2HK2 A;  2VQF E;  2V2V A;  3F6G A;  4M1K A;  4GQU A;  2C39 B;  2FV4 B;  2LO3 A;  2O1V A;  4B3R I;  2KHX A;  2DLQ A;  5A6J A;  4I8O A;  4JI6 E;  1FKA E;  4NXM I;  2HFU A;  4HTG A;  1Z1B A;  2F8B A;  2YTI A;  1A6F A;  2BB8 A;  3IWC A;  5LMN E;  1GQE A;  1H7U A;  1HNW I;  4FW3 A;  1IQS A;  4BA2 B;  2L33 A;  2Q2E B;  4LFB E;  2DMY A;  1IQO A;  1YZ9 A;  1TF3 A;  3EPK A;  4WPY A;  2ZM6 I;  3EPJ A;  2HK3 A;  2Z5B B;  2EPA A;  2PNZ A;  5K36 A;  2LJU A;  4HAC B;  1X48 A;  3LML A;  2YZT A;  4MLQ A;  4WSG A;  4LCG A;  5FLX Q;  1KIJ A;  5C0X D;  2A25 A;  2HC5 A;  2YU5 A;  1A1J A;  1T4N A;  5T6J A;  5ELW A;  4JI2 I;  4LF8 I;  3M99 B;  2D9H A;  2RSI A;  2IOQ A;  4X62 E;  5A6K A;  1IBL E;  4NXN I;  4F9A B;  4P7D A;  2VQE E;  2CG9 A;  2DIX A;  4LTY A;  4P52 A;  2WZO A;  4UTG A;  1Y4S A;  4JI5 E;  5K36 C;  2HKE A;  4B3M E;  4LF6 E;  1H7S A;  4R8O A;  1K47 A;  1YYW A;  2EMW A;  2E72 A;  2EM4 A;  2ODR C;  2EQ0 A;  2PO0 A;  1LLM C;  5C0X F;  3CDI A;  1UN6 B;  4IZJ A;  4IFD A;  3FIG A;  1YPN A;  2M1S A;  4DV4 I;  2EP3 A;  1T4L B;  5BR8 E;  2L8T A;  4L8N A;  4DUZ E;  1UDS A;  3OML A;  2NPF A;  2YWQ A;  2LUP B;  4DR5 I;  4LFA E;  1N32 I;  4LF7 I;  3T1Y E;  2GHF A;  5DRP A;  1ZXM A;  3J80 Q;  1X5W A;  4DV6 E;  1F2I G;  1UIL A;  1A1F A;  2DB2 A;  3THN A;  2A2D A;  2MDG A;  4Z7Y A;  3WU3 A;  1XMQ E;  1MGT A;  2V87 A;  4MU0 A;  3JAM Q;  2V85 A;  3PS1 A;  1PDA A;  3KZY A;  2JE6 B;  4IFD C;  4X64 E;  4LF5 E;  1YH8 A;  2JEB A;  4DU7 A;  3Q6N A;  2EOQ A;  4DR2 E;  2LTR A;  1XMO I;  1Z0T A;  2J7K A;  1G2D C;  1H73 A;  4USK A;  2EN1 A;  2PO2 A;  4B3T E;  4DV7 I;  3M6A A;  3GON A;  2EL4 A;  4AID A;  3HPS A;  1H72 C;  4DU8 A;  4LF4 E;  2MDR A;  4DMI A;  1X6F A;  2DSY A;  1B62 A;  2LE2 A;  1NHI A;  1WUU A;  5IWA E;  2YTJ A;  2EM6 A;  2BA0 G;  4DUY E;  2C38 A;  3PRY A;  5EKW A;  4JI0 E;  3QT8 A;  1B63 A;  1RR9 A;  4X9J A;  2KON A;  1J26 A;  1FI4 A;  4HY1 A;  1DQ3 A;  1YYO A;  1A1H A;  2EN2 A;  1YUI A;  4OO1 A;  1Y60 A;  1H74 A;  3V2U C;  2DRP A;  1MEY C;  2NN6 C;  4J8Z A;  2EM9 A;  1HNZ E;  4GKJ E;  4LCF A;  5DRQ A;  5C0X E;  3P3G A;  2HJJ A;  2JXP A;  4JI7 E;  2E1R A;  2EPO A;  1WHQ A;  1Z5B A;  2NUE A;  3IWD A;  1IBM E;  3ADJ A;  1Z0G A;  1BBG A;  4PRV A;  4DPX A;  4L5N C;  4X66 E;  3AV0 A;  3L7Z B;  2YTO A;  4N3O A;  2WW4 A;  3ZZ0 A;  1Z5A A;  1ZBQ A;  4GKK I;  4R2D A;  2YT4 A;  4OO1 C;  4X65 I;  5A6A A;  3Q1Q A;  4DR3 E;  4FWG A;  1R6L A;  2JP9 A;  4JI4 I;  4RH8 A;  4R2A A;  2CTD A;  4DV3 E;  4WX9 A;  1ZM3 A;  1Z0B A;  2DGC A;  1QZR A;  4JYA I;  2N8X A;  3HXL A;  2F1D A;  2EMG A;  4MU4 A;  4MU3 A;  1KVK A;  1UBD C;  4FW9 A;  2NAB A;  2NN6 D;  2MC5 A;  2WCC 3;  2R42 A;  3P76 A;  1WRJ A;  1UDO A;  2VE7 C;  2B3T B;  2L2M A;  3J7A G;  2WBS A;  1Y4U A;  4LF9 I;  2EQ3 A;  2GLI A;  3KWR A;  2NUG A;  2E5L I;  2EM0 A;  4DR1 I;  5FLX C;  2LBS B;  1MX0 A;  1XHK A;  2EOF A;  4OX9 E;  1ZM2 A;  4M2Z A;  4DV1 E;  2B9D A;  3EPL A;  4OZE A;  2YTF A;  3U1K A;  5LMU I;  1ZAA C;  4DV5 E;  5JEA D;  4O5G A;  1J5E I;  4NZV A;  5DNY A;  5CFF E;  4R2P A;  4DV0 I;  1XNQ E;  4IS9 A;  2YRK A;  2H36 X;  2YPN A;  1QNT A;  2EPM X;  3VYX A;  4FW5 A;  2VES A;  3VYY A;  1ZU1 A;  3ZKB A;  5KL2 A;  1PJQ A;  2EOH A;  2EMK A;  4O24 A;  5A6B A;  2UUB E;  1I94 I;  1Z0C A;  2AJ4 A;  3C6M A;  2CT1 A;  1DI2 A;  4Q35 B;  1ELO A;  1HR0 I;  2PO1 A;  1SR9 A;  1WHN A;  1N33 E;  5A69 A;  2DEI A;  5KL5 A;  5DNX A;  2EPL X;  3VHT B;  2C39 A;  2CGE A;  4DR7 I;  3C4B A;  4K0K E;  4FWD A;  4LFC I;  1HNX I;  1X6E A;  4BC7 A;  2UXD E;  3J80 C;  4AQY E;  2O1U A;  2V86 A;  1VIS A;  2YTP A;  3JTZ A;  3C6K A;  1G2F C;  2N3H A;  2YRH A;  3JAM C;  5KL3 A;  1WXR A;  1Z0W A;  2WNR B;  4GZN C;  4B3R E;  5LL6 R;  2OI2 A;  2HHH I;  3K85 A;  4P7A A;  4MLV A;  1GTK A;  1NHH A;  4NXM E;  4FN5 A;  1EH8 A;  4LOM A;  4JI8 I;  2JEA A;  1YHC A;  2EMZ A;  3JU0 A;  4WSP A;  2RS7 A;  2NN6 E;  1O0W A;  4JI1 I;  3M7N D;  1HNW E;  2CVE A;  2ELY A;  4HAC A;  2ZIT A;  3V5R A;  3ZZT A;  1YYK A;  4IZK A;  5AE1 A;  3NZK A;  3CDJ A;  2EOX A;  2CZ9 A;  2L6M A;  1RHY A;  1YFH A;  2ZM6 E;  2C37 A;  4HYM A;  2PO0 B;  4ZYE A;  2WP8 B;  3QG5 C;  1P42 A;  1USV A;  2BA1 D;  2CSH A;  1FJG I;  1Y5Y A;  2Z5C B;  2YTE A;  3H1C A;  4BHB A;  4IJD A;  4YY3 I;  2NUF A;  2LJH A;  4RPF A;  3EQ1 A;  4M9V C;  3LPS A;  2K7I A;  4JI2 E;  4LF8 E;  2UXC I;  1ZR9 A;  1WJP A;  2V2Z A;  2L2N A;  4NHR A;  3UK3 C;  3HKM A;  5JEA E;  1N36 I;  1N3G A;  2BR2 A;  2B7T A;  5IXM B;  4NXN E;  1FWK A;  2YSP A;  2X7I A;  5DRR A;  2UU9 I;  5K36 D;  3F0N A;  1E3P A;  5DRO A;  2RQL A;  3F6H A;  3AUZ A;  1A1L A;  2JEB B;  4PRX A;  2ODR D;  2EM7 A;  2F4V I;  1R6M A;  2GPI A;  2GO3 A;  2M4I A;  3ADG A;  4RHB B;  2NN6 B;  3HJC A;  4BC9 A;  4YHH I;  3BGH A;  2ENH A;  1AH5 A;  2I9I A;  4JI3 I;  4IS1 C;  3EPH A;  2GO4 A;  3HTX A;  2ENC A;  2ELZ A;  4DR6 I;  4DV4 E;  4M0V A;  1DGC A;  1RC7 A;  4MYU A;  4DR4 I;  2DLK A;  2Q8U A;  5KL7 A;  4DR5 E;  3PS2 A;  2JE6 A;  1IBK I;  3LLH A;  2AE8 A;  1N32 E;  1YSA C;  1L4S A;  4LF7 E;  5DNL A;  1BKN A;  4BA1 A;  5AE3 A;  4JV5 I;  4KHP I;  2EOO A;  4U3D A;  2EOS A;  2JYA A;  1T38 A;  1KTV A;  3IWB A;  5IV8 B;  4B3S I;  4F6N A;  1XNR I;  2O1W A;  3J7A M;  4WUB A;  4IFD D;  3HUL A;  4IZJ D;  1T4O A;  2LVH A;  2EJ4 A;  2IES A;  4BMJ A;  2EWL A;  5IT9 Q;  2EOE A;  2EN7 A;  3PYG A;  4R2S A;  5JEA B;  3J81 Q;  3OTO I;  2A2C A;  1N34 I;  1Z0V A;  3THO B;  3QT5 A;  4QNK A;  2WBT A;  4R03 A;  4BHC A;  1XMO E;  2BM0 A;  2VF3 A;  2EL6 A;  1RQ0 A;  1OYP A;  4UT4 A;  2LMZ A;  2JY9 A;  4DV7 E;  2J65 A;  2UUC I;  1SFE A;  4OOG C;  3WU5 A;  4DPY A;  2EFG A;  2V34 A;  4Q28 A;  5F3W A;  2L3C A;  3WU6 A;  1PIE A;  2RSM A;  2UUA I;  2RPC A;  2FTX B;  1S16 A;  4DXL A;  3C4T A;  3MSW A;  2B7V A;  1TF6 A;  1ZXN A;  3MHS C;  2BM1 A;  3P06 A;  2LJP A;  2FGG A;  3T1H I;  2EM3 A;  2IHR 1;  1OJ4 A;  2EOY A;  1NEI A;  2EL5 A;  4I3H A;  4DV2 I;  2UXB I;  3HPZ A;  4KZS A;  4ZYG A;  4DKK A;  1P47 A;  1XXE A;  1BBO A;  2XEX A;  3TQM A;  3GCM A;  3PYD A;  3ZM7 A;  1PKP A;  1Z59 A;  4MYT A;  1B69 A;  2GS8 A;  2VQF I;  4OO1 D;  2R76 A;  5K36 E;  4F9C B;  4GKK E;  1KKH A;  3QT6 A;  2N3G A;  2EML A;  2EMF A;  4X65 E;  3KZZ A;  2LUQ A;  4JI4 E;  1N0V C;  2NN6 F;  4PU9 A;  1A1I A;  4JI6 I;  2JWO A;  1UHZ A;  3VK6 A;  2EPP A;  3QT7 A;  2EOI A;  4MQY A;  3M85 D;  5LMN I;  4JYA E;  2X36 A;  1UDQ A;  1USU A;  5C0X A;  2JVA A;  2ZBK B;  2LV2 A;  2IOP A;  2JOX A;  4LFB I;  2EOR A;  3MHH C;  2EOM A;  4NBQ A;  1OYR A;  1FNM A;  4MDT A;  1EH6 A;  4P78 A;  4LF9 E;  2NA2 A;  3GLL A;  2ADR A;  3PYE A;  4HEI A;  3ADL A;  2E5L E;  2EPX A;  4DR1 E;  4IFD E;  3H4L A;  3J7Y p;  5JEA F;  2LRS A;  2MC6 A;  2PO1 B;  1BB8 A;  2V8Q B;  3PS3 A;  3GME A;  2EM5 A;  5C0X C;  4X62 I;  2I13 A;  2R1F A;  3RMP A;  1YUJ A;  4TUG A;  2V8P A;  2YTG A;  5LMU E;  2PNZ B;  1IBL I;  1JK1 A;  4USM A;  4HXZ A;  5K36 B;  1J5E E;  3M85 G;  2VQE I;  2EPC A;  1ZBT A;  2YTQ A;  1T39 A;  1Y6Z A;  4DPW A;  4JI5 I;  4B3M I;  2WBU A;  4FK5 C;  4DV0 E;  4LF6 I;  4BA2 A;  2EOJ A;  2PNL A;  1PJS A;  5LLQ A;  2JOB A;  4LCH A;  2Z5B A;  4F54 A;  5KL6 A;  2JEA B;  1I94 E;  3BF2 A;  5BR8 I;  3ADI A;  4JG4 A;  4DUZ I;  2V89 A;  4X8W A;  1STU A;  4FW4 A;  1HR0 E;  2EMA A;  1MG7 A;  4GEQ B;  3ZKD A;  4F9B B;  1RRE A;  3T1Y I;  4IZK B;  4LFA I;  2ENA A;  4DR7 E;  1TN9 A;  4AIM A;  4DV6 I;  2WNR A;  4IFD B;  3BBG A;  5KL4 A;  4O43 A;  2EOZ A;  1HNX E;  2JPA A;  4LFC E;  3B82 A;  3LTO A;  2C37 B;  4IZJ B;  2E1M A;  4R2Q A;  1XMQ I;  4OO1 E;  4ZYH A;  5A6B D;  1EKZ A;  2O3Z A;  1RMD A;  5TSE A;  4X64 I;  4LF5 I;  3K17 A;  5IT9 C;  2HGH A;  2EMB A;  3J81 C;  1OYS A;  4DR2 I;  2L3J A;  1PJT A;  5AC5 A;  2RS6 A;  1Z5C A;  2HHH E;  2YTD A;  5GME A;  4B3T I;  2MKN A;  1QU6 A;  2BR2 B;  1X47 A;  1N0U A;  4LF4 I;  3M7N G;  4JI8 E;  3BID A;  3U1Y A;  2HFS A;  5IWA I; 
#chains in the Genus database with same CATH homology
 4DUY I;  4JI1 E;  4JI0 I;  2L2K B;  4WUD A;  2Z5C A;  2EZ6 A;  1EI1 A;  5FWK A;  2KOU A;  4EMD A;  5L3J A;  4BS9 A;  1U2R A;  2O1T A;  2K4V A;  3H09 A;  1HNZ I;  4GKJ I;  2M7Q A;  4FWH A;  3ZZU A;  1FJG E;  5GMD A;  1ZM9 A;  4JI7 I;  4YY3 E;  1IBM I;  3HQ1 A;  4X66 I;  1D6T A;  2UXC E;  1S4E A;  1N36 E;  1DAR A;  3Q6M A;  3DF6 A;  2UU9 E;  4R1F A;  1X49 A;  4DR3 I;  2LTS A;  4TUI A;  3DJW A;  4DV3 I;  4URL A;  2F4V E;  2G7H A;  1FWL A;  4BBY A;  2HKJ A;  2DEJ A;  3WU4 A;  2L92 A;  3CWV A;  4WFT A;  4YHH E;  2V88 A;  4KQV A;  4LU9 A;  3ZOQ B;  4JI3 E;  2Z5E A;  4M30 A;  4WYQ B;  4DR6 E;  4BCA A;  1Z0E A;  4DR4 E;  4WUC A;  1UEK A;  1IBK E;  4JV5 E;  4KHP E;  1PVG A;  3D4J A;  1NHJ A;  2R3V A;  3B8H A;  4B3S E;  1XNR E;  3K1J A;  2V2Q A;  5ADZ A;  2BV3 A;  5A2Q C;  3LNU A;  3PYF A;  4OX9 I;  3P1X A;  4DV1 I;  5AE2 A;  1MU5 A;  3OTO E;  2PNM A;  1N34 E;  4DV5 I;  2V83 A;  4XTJ A;  1GZ6 A;  4DPT A;  1XNQ I;  2UUC E;  4Z7C A;  1HK7 A;  2CPN A;  1ZM4 A;  2GQ0 A;  2UUA E;  1NZ0 A;  2UUB I;  4DPU A;  2RTX A;  5AAS A;  1EA6 A;  3T1H E;  1N33 I;  4DV2 E;  2UXB E;  2VF1 A;  4ZVI A;  4K0K I;  2UXD I;  4AQY I;  2JR1 A;  3B78 A;  5A2Q Q;  4ED4 A;  3K6Q A;  2HK2 A;  2VQF E;  2V2V A;  3F6G A;  4M1K A;  2FV4 B;  2O1V A;  4B3R I;  2KHX A;  4I8O A;  4JI6 E;  1FKA E;  4NXM I;  2HFU A;  2F8B A;  1A6F A;  5LMN E;  3IWC A;  1GQE A;  1H7U A;  1HNW I;  2L33 A;  2Q2E B;  4LFB E;  2DMY A;  1YZ9 A;  2ZM6 I;  4WPY A;  2HK3 A;  2Z5B B;  4HAC B;  1X48 A;  3LML A;  2YZT A;  5FLX Q;  1KIJ A;  1T4N A;  5T6J A;  4JI2 I;  4LF8 I;  2IOQ A;  4X62 E;  1IBL E;  4NXN I;  4F9A B;  4P7D A;  2VQE E;  2CG9 A;  2DIX A;  4LTY A;  4P52 A;  2WZO A;  4UTG A;  1Y4S A;  4JI5 E;  2HKE A;  4B3M E;  4LF6 E;  1H7S A;  4R8O A;  1K47 A;  1YYW A;  2ODR C;  4IZJ A;  3FIG A;  2M1S A;  4DV4 I;  1T4L B;  5BR8 E;  2L8T A;  4L8N A;  4DUZ E;  2NPF A;  3OML A;  4DR5 I;  2LUP B;  4LFA E;  1N32 I;  4LF7 I;  3T1Y E;  1ZXM A;  3J80 Q;  4DV6 E;  1UIL A;  2DB2 A;  2A2D A;  3WU3 A;  4Z7Y A;  1XMQ E;  2V87 A;  3JAM Q;  2V85 A;  4X64 E;  4LF5 E;  4DU7 A;  3Q6N A;  4DR2 E;  2LTR A;  1XMO I;  1Z0T A;  2J7K A;  1H73 A;  4USK A;  4B3T E;  4DV7 I;  3M6A A;  3GON A;  3HPS A;  1H72 C;  4DU8 A;  4LF4 E;  2MDR A;  4DMI A;  2DSY A;  1B62 A;  2LE2 A;  1NHI A;  1WUU A;  5IWA E;  2E1R A;  3PRY A;  4DUY E;  4JI0 E;  3QT8 A;  1B63 A;  1RR9 A;  2KON A;  1J26 A;  1FI4 A;  4HY1 A;  1DQ3 A;  1YYO A;  1H74 A;  3V2U C;  4J8Z A;  1HNZ E;  4GKJ E;  4JI7 E;  1WHQ A;  1Z5B A;  2NUE A;  3IWD A;  1IBM E;  3ADJ A;  1Z0G A;  4PRV A;  4DPX A;  4L5N C;  4X66 E;  3AV0 A;  4N3O A;  3ZZ0 A;  2WW4 A;  1Z5A A;  1ZBQ A;  4GKK I;  2YT4 A;  4X65 I;  3Q1Q A;  4DR3 E;  4FWG A;  4JI4 I;  4DV3 E;  1ZM3 A;  1Z0B A;  1QZR A;  4JYA I;  3HXL A;  1KVK A;  4FW9 A;  2MC5 A;  2R42 A;  2VE7 C;  2B3T B;  2L2M A;  3J7A G;  1Y4U A;  4LF9 I;  3KWR A;  2NUG A;  2E5L I;  4DR1 I;  5FLX C;  2LBS B;  1MX0 A;  1XHK A;  4OX9 E;  1ZM2 A;  4M2Z A;  4DV1 E;  2B9D A;  5LMU I;  4DV5 E;  1J5E I;  5DNY A;  5CFF E;  4DV0 I;  1XNQ E;  2H36 X;  3VYX A;  3VYY A;  3ZKB A;  1I94 I;  2UUB E;  1Z0C A;  2AJ4 A;  1DI2 A;  1ELO A;  1HR0 I;  1SR9 A;  1WHN A;  1N33 E;  2DEI A;  4DR7 I;  2CGE A;  3C4B A;  4K0K E;  4FWD A;  4LFC I;  1HNX I;  4BC7 A;  2UXD E;  3J80 C;  4AQY E;  2O1U A;  2V86 A;  1VIS A;  3JTZ A;  2N3H A;  3JAM C;  1WXR A;  1Z0W A;  2HHH I;  4B3R E;  5LL6 R;  2OI2 A;  3K85 A;  4P7A A;  1NHH A;  4NXM E;  4FN5 A;  4JI8 I;  4WSP A;  3JU0 A;  2RS7 A;  1O0W A;  4JI1 I;  1HNW E;  3ZZT A;  4HAC A;  2ZIT A;  3V5R A;  1YYK A;  4IZK A;  5AE1 A;  2CZ9 A;  2L6M A;  2ZM6 E;  4HYM A;  1USV A;  1FJG I;  2Z5C B;  4YY3 I;  2NUF A;  2LJH A;  4RPF A;  3LPS A;  4JI2 E;  4LF8 E;  2UXC I;  2V2Z A;  1N36 I;  2L2N A;  2B7T A;  4NXN E;  1FWK A;  2X7I A;  2UU9 I;  3F0N A;  3F6H A;  3AUZ A;  4PRX A;  2ODR D;  2F4V I;  2M4I A;  3ADG A;  4YHH I;  3HJC A;  4BC9 A;  4JI3 I;  3HTX A;  4DR6 I;  4DV4 E;  4M0V A;  4DR4 I;  1RC7 A;  4MYU A;  4DR5 E;  1IBK I;  3LLH A;  4JV5 I;  1N32 E;  4KHP I;  4LF7 E;  1BKN A;  5AE3 A;  1KTV A;  3J7A M;  3IWB A;  4B3S I;  1XNR I;  2O1W A;  4WUB A;  3HUL A;  4IZJ D;  1T4O A;  4BMJ A;  2EWL A;  5IT9 Q;  3PYG A;  3J81 Q;  3OTO I;  2A2C A;  1N34 I;  1Z0V A;  3QT5 A;  4R03 A;  1XMO E;  2BM0 A;  2VF3 A;  1RQ0 A;  4UT4 A;  2LMZ A;  2JY9 A;  4DV7 E;  2UUC I;  4OOG C;  3WU5 A;  4DPY A;  2EFG A;  2V34 A;  4Q28 A;  5F3W A;  2L3C A;  3WU6 A;  1PIE A;  2RSM A;  2UUA I;  2FTX B;  1S16 A;  4DXL A;  3C4T A;  3MSW A;  2B7V A;  1ZXN A;  2BM1 A;  3P06 A;  2LJP A;  2FGG A;  3T1H I;  2IHR 1;  1OJ4 A;  4I3H A;  4DV2 I;  2UXB I;  3HPZ A;  4KZS A;  4DKK A;  2XEX A;  3PYD A;  3ZM7 A;  1PKP A;  1Z59 A;  4MYT A;  2GS8 A;  2VQF I;  4GKK E;  4F9C B;  1KKH A;  3QT6 A;  2N3G A;  4X65 E;  2LUQ A;  4JI4 E;  1N0V C;  4PU9 A;  4JI6 I;  2JWO A;  1UHZ A;  3VK6 A;  3QT7 A;  5LMN I;  4JYA E;  2X36 A;  1USU A;  2JVA A;  2ZBK B;  2IOP A;  2JOX A;  4LFB I;  1FNM A;  4P78 A;  4LF9 E;  2NA2 A;  3PYE A;  3ADL A;  2E5L E;  4DR1 E;  3H4L A;  3J7Y p;  2LRS A;  2MC6 A;  2V8Q B;  4X62 I;  3RMP A;  4TUG A;  2V8P A;  5LMU E;  1IBL I;  4USM A;  4HXZ A;  1J5E E;  2VQE I;  1ZBT A;  1Y6Z A;  4DPW A;  4JI5 I;  4B3M I;  4DV0 E;  4LF6 I;  2PNL A;  2JOB A;  2Z5B A;  4F54 A;  1I94 E;  5BR8 I;  3ADI A;  4JG4 A;  4DUZ I;  2V89 A;  4X8W A;  1STU A;  3ZKD A;  1HR0 E;  1MG7 A;  4LFA I;  4GEQ B;  4F9B B;  1RRE A;  3T1Y I;  4IZK B;  4DR7 E;  4DV6 I;  4IZJ B;  1HNX E;  4LFC E;  3B82 A;  3LTO A;  1XMQ I;  2E1M A;  1EKZ A;  4X64 I;  4LF5 I;  3K17 A;  5IT9 C;  3J81 C;  4DR2 I;  2L3J A;  1Z5C A;  2RS6 A;  2HHH E;  5GME A;  4B3T I;  1QU6 A;  1X47 A;  1N0U A;  4LF4 I;  4JI8 E;  2HFS A;  5IWA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...