4DR5E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5E02
2VQFE 4PRXA 2UXCE 1XNQI 3LLHA 1Z5BA 2L3JA 1D6TA 1HNXI 1UILA 3LNUA 4X62E 4LF8I 4NXNI 1DARA 4JI2E 5L3JA 4DUZI 1YYKA 4X66I 4DPXA 1XNQE 1Z0GA 4LF7I 4HY1A 3K1JA 2V2ZA 1UHZA 4DR4E 4LF8E 4NXNE 1O0WA 3HTXA 4WFTA 4DUZE 1YYWA 2ZM6I 2Q2EB 3QT6A 4JI7E 2UUCE 1T4OA 1PVGA 4GKJI 2UU9I 2OI2A 4K0KI 2YT4A 2UXDE 4AQYI 4WUDA 5GMDA 1ZXMA 2NUGA 2L33A 1WUUA 4OX9E 2UU9E 4K0KE 4AQYE 1Z59A 1QU6A 4LFCI 2GS8A 4FW9A 3QT7A 4X64I 4JI8I 2JY9A 1FWLA 4X65I 1N0UA 4LF4I 2WW4A 4JI4E 1RREA 2LUQA 2UUAI 3T1YE 4JI3E 4LFBE 4DR5I 4DV0E 4X64E 2A2DA 4JI8E 3ZKBA 4DKKA 3WU4A 5LMNE 1N32E 5IWAI 4LF6I 3J80Q 4LF4E 3PYEA 4DV1I 3ZM7A 4P7AA 2L2MA 3OTOI 2F4VI 4DR5E 1ZM2A 2DEIA 4B3SI 3P1XA 1T4NA 5IWAE 4LF6E 4DUYI 3HULA 1N0VC 4PU9A 3WU6A 2V2QA 1HNZI 4DR6I 5FLXQ 1XMQI 4FWDA 1MU5A 4B3SE 4USKA 3LTOA 1ZM4A 1BKNA 2KHXA 4DPTA 2BM0A 2LTRA 2HKEA 4DV3E 4DR1E 3T1HI 4DR6E 3J80C 2LJPA 1EKZA 3VYYA 1IBKE 4USMA 4JYAI 4MYTA 3J7AM 4UT4A 2ZBKB 3ZKDA 1N34E 4DV5I 4M30A 2X36A 3WU3A 1YYOA 4YHHE 4DV2E 4YY3E 4JYAE 1MX0A 4LFAI 5A2QQ 5FLXC 1X49A 1H74A 1HNXE 3K17A 1NHHA 2L2NA 2BV3A 2L3CA 2NPFA 4X66E 1XNRI 3CWVA 4DU8A 1HR0I 1DI2A 1Z0WA 1U2RA 4R1FA 4LF7E 3ZZ0A 5BR8I 1NHIA 5LL6R 4JI1I 4WUCA 2N3HA 2HHHI 2ZM6E 2LJHA 1N36I 1HR0E 1RQ0A 4M2ZA 4GKJE 4RPFA 4ED4A 1ZM3A 4FWGA 5A2QC 2JVAA 4I3HA 2AJ4A 4URLA 4JI1E 2V2VA 2UUBI 1S4EA 4DV4I 4JG4A 3B82A 1VISA 1N36E 4JI0I 1EI1A 3M6AA 4JV5I 4JI6I 1Z5CA 4LFCE 4MYUA 2UUBE 1Z0EA 4DV6I 3ADJA 4JI0E 3V2UC 1UEKA 1FJGI 4P52A 4LF5I 1H7UA 4X65E 2HKJA 3ZZUA 4B3MI 2N3GA 4JI6E 1T4LB 4B3TI 1EA6A 2UUAE 2E5LI 2HFUA 4DU7A 1KIJA 4HYMA 1HNWI 4LF9I 4M1KA 4DV1E 2LBSB 1N33I 1I94I 3J7AG 1Z0TA 3Q1QA 4B3TE 1X47A 3OTOE 2DIXA 2F4VE 4B3RI 1KVKA 2E5LE 3J7Yp 3ADLA 2UXBI 4DUYE 4UTGA 4XTJA 4HACA 2IHR1 1KTVA 4DPYA 1XMOI 1HNZE 1XMQE 1ZBTA 1S16A 3D4JA 1QZRA 3ZZTA 1IBLI 2VQFI 4DV7I 4ZVIA 2RSMA 2UXCI 4X8WA 2CPNA 1ZXNA 2LTSA 4EMDA 4OOGC 4Z7CA 3T1HE 1FKAE 1XMOE 4NXMI 4DR7I 1H7SA 3J81Q 2XEXA 4X62I 4KQVA 4DV7E 4DV5E 3LPSA 4FN5A 4PRVA 4NXME 4DR7E 2HFSA 2E1RA 4DXLA 3V5RA 4DR4I 4LFAE 2RS6A 4DR2I 3C4BA 2EZ6A 1B63A 1J26A 5GMEA 4JI7I 2UUCI 2X7IA 1FWKA 2V34A 5IT9Q 4KHPI 1NHJA 2A2CA 2UXDI 2RS7A 3VYXA 1FI4A 1J5EI 2J7KA 2ZITA 1NZ0A 1XNRE 3J81C 4DR2E 2EFGA 1OJ4A 1Z0BA 2NUEA 2HK2A 2LRSA 5BR8E 3QT8A 1IBMI 4OX9I 4KHPE 1J5EE 4DPUA 1H73A 2HHHE 4HXZA 3C4TA 1IBME 4WYQB 1A6FA 2R3VA 4DV4E 4JI4I 2L2KB 5IT9C 3PYGA 1STUA 3T1YI 4JI3I 4LFBI 4GKKI 1XHKA 2VQEI 4DV0I 4JI5I 4JV5E 3PYDA 2R42A 1WHQA 5LMNI 1Z5AA 4DR3I 1N32I 1GQEA 3F0NA 4DV6E 2RTXA 1Z0CA 1X48A 2NUFA 2VF3A 2MDRA 1H72C 1FJGE 4HACB 4LF5E 4FWHA 3H4LA 3JAMQ 3GONA 3PYFA 2VQEE 4GKKE 4B3ME 1B62A 4WUBA 4JI5E 4DR3E 1MG7A 3ADGA 2B7VA 1RR9A 2LUPB 3WU5A 2B3TB 2NA2A 1HNWE 4LF9E 1PKPA 3ADIA 1N33E 1I94E 2V8PA 3B8HA 1Z0VA 2B7TA 5LMUI 4B3RE 3QT5A 4DV3I 1ELOA 1YZ9A 4DR1I 1PIEA 1ZM9A 2CZ9A 2DEJA 2UXBE 1IBKI 1KKHA 1FNMA 3B78A 5CFFE 2BM1A 3JAMC 1N34I 4Z7YA 5LMUE 2DMYA 1RC7A 2DB2A 1K47A 4YHHI 4DV2I 4YY3I 4DPWA 4JI2I 2HK3A 1WHNA 1IBLE
chains in the Genus database with same CATH superfamily
2VQFE 4PRXA 2YTNA 2EL6A 4O5GA 2UXCE 1XNQI 2V8QB 4L8NA 3LLHA 2IERA 1Z5BA 2L3JA 4LCGA 1HNXI 1D6TA 3HPZA 3PS2A 1NEIA 2V89A 2MKNA 4GZNC 1UILA 2EM6A 3LNUA 3FIGA 4X62E 4LF8I 1TF3A 4NXNI 1DARA 4JI2E 2BR2A 4J3DA 2KONA 5L3JA 2LV2A 4DUZI 2EMXA 3BIDA 1YYKA 2NN6A 2F1DA 4FW4A 4X66I 4DPXA 4R2AA 5A6BA 2YRMA 1XNQE 1Z0GA 2R76A 2EN8A 4F54A 2EOHA 4F6NA 2EN7A 3M7ND 4R2PA 1T39A 3OMLA 4LF7I 2C38B 4HY1A 3K1JA 2V2ZA 4WSPA 3RMPA 1ZAAC 1UHZA 3HPSA 4DR4E 2EMHA 4BC7A 4LF8E 4NXNE 1O0WA 3HTXA 4WFTA 2WBSA 4DUZE 1YYWA 2EE8A 4OKGA 2ZM6I 2EOQA 2Q2EB 4O24A 3EPJA 4JI7E 4HTGA 3QT6A 2UUCE 1T4OA 1PVGA 4LCHA 2RSIA 1SR9A 5DROA 4GKJI 2UU9I 2OI2A 2FGGA 4K0KI 2YT4A 2UXDE 2DSYA 3IWCA 1RMDA 2GO4A 5EL9A 3VHTB 4AQYI 4AM3A 2WCC3 4I8OA 2GO3A 5DNYA 4R2CA 3MSWA 1Y4SA 4WUDA 2YRKA 2EMWA 2JYAA 5GMDA 3P3EA 2BA0G 1ZXMA 2NUGA 2L33A 3IWDA 2NN6F 1WUUA 4IZJD 4BMJA 4R03A 2V85A 2UU9E 4OX9E 4K0KE 2JE6B 2I13A 1X6EA 3THNA 4J8ZA 4AQYE 1Z59A 5DRRA 3QG5C 2M7QA 1QU6A 4P7DA 4LFCI 2YTFA 2GS8A 2CVEA 2O1VA 4FW9A 1A1HA 2NN6E 3QT7A 5AE1A 4N3OA 4X64I 2J7JA 4JI8I 2JY9A 1FWLA 4LPFA 2J65A 3B4TA 4X65I 2B9DA 1N0UA 2RPCA 2G7HA 5AC4A 4LF4I 3F6HA 2LO3A 2WW4A 4JI4E 1E3HA 3GLLA 1BBGA 2JT2A 1RREA 2LUQA 4OO1E 2UUAI 3T1YE 4JI3E 4LFBE 1YH8A 4DR5I 4DV0E 4LU9A 4X64E 2A2DA 2C39A 4JI8E 3ZKBA 4DKKA 3WU4A 5LMNE 1N32E 5IWAI 4LF6I 3J80Q 4LF4E 3PYEA 4DV1I 2V86A 4OO1B 2CSHA 4Q28A 1Z1BA 2IESA 2IOQA 2EPZA 1Y4UA 3ZM7A 2PNMA 4P7AA 2L2MA 1BBOA 1OYPA 3OTOI 2F4VI 2EMYA 1GZ6A 3BGHA 5A6JA 4DR5E 2O3ZA 2BB8A 3EQ1A 1ZM2A 2DEIA 4B3SI 4FW3A 3P1XA 1T4NA 4F9CB 5IWAE 1PDAA 4LF6E 4DUYI 2JEAA 3HULA 2EOEA 3CDIA 1N0VC 4PU9A 3WU6A 1MGTA 2YTOA 3HJCA 2EN3A 2V2QA 1HNZI 4DR6I 4Q35B 5KL7A 4HEIA 4GQUA 3EPHA 5FLXQ 3HQ1A 2JXPA 3U1YA 1XMQI 2NN6D 5A6BD 4FWDA 1MU5A 2EOIA 2YTIA 4B3SE 4USKA 3LTOA 2EN2A 5C0XA 3THOB 2DLKA 1ZM4A 1BKNA 4BA1B 4R2RA 2YSOA 2KHXA 4DPTA 2BM0A 2LTRA 4FW5A 2HKEA 4DV3E 2NN6B 4DR1E 3T1HI 4ZYEA 4DR6E 3J80C 2LJPA 1ZR9A 2ADRA 1EKZA 3VYYA 1IBKE 1IQSA 4USMA 2YTEA 4JYAI 1EH7A 2EOXA 4MYTA 3J7AM 4UT4A 2ZBKB 2MC5A 5FWKA 3ZKDA 3HXLA 1N34E 5JEAA 4QNKA 4MDTA 2LT7A 1OYSA 4DV5I 4M30A 4F9BB 2X36A 4BCAA 1TN9A 4MU1A 3WU3A 4L5NC 2EPOA 2MC6A 5AE3A 1UDOA 5KL6A 1Y6ZA 2K7IA 1YYOA 4YHHE 4DV2E 4BA1A 4IFDE 4YY3E 2R1FA 2EPMX 3JU0A 3K85A 4MU0A 1YUIA 3LMLA 4JYAE 2EPPA 2CG9A 1MX0A 4LFAI 5A2QQ 1IQOA 5FLXC 1X49A 2EOJA 1H74A 1X3CA 1HK7A 4AIDA 1HNXE 2MDGA 3K17A 2HGHA 2NN6C 4M0VA 3DJWA 4LTYA 1BB8A 3AUZA 1NHHA 2WNRA 2L2NA 4OO1A 2BV3A 2EOYA 2EM3A 2L3CA 3KRNA 5EKWA 2NPFA 1ZU1A 4X66E 1XNRI 3CWVA 4DU8A 1HR0I 1AAYA 1DI2A 5C0XE 2HC5A 3F6GA 1JK1A 1Z0WA 1UDNA 1U2RA 4R1FA 1EH8A 5KL2A 5JEAF 5F3WA 4LF7E 3ZZ0A 5BR8I 2EL5A 5LL6R 1NHIA 4JI1I 2Z5CB 1A1JA 1NCSA 4IJDA 4ZYDA 4WUCA 2PNLA 2N3HA 2VESA 2HHHI 2ZM6E 2LJHA 1N36I 5K36E 4GEQB 4BC9A 1HR0E 2JPAA 4IZKB 1RQ0A 4M2ZA 4GKJE 2EN1A 2A25A 3C6MA 5JEAE 4RPFA 4ED4A 1ZM3A 4FWGA 5A2QC 2JVAA 4I3HA 1A1IA 2L6MA 2EM4A 2AJ4A 4ZYHA 4IS1C 4JI1E 2Z5BA 1DQ3A 3Q6NA 4URLA 2C39B 2V2VA 2UUBI 1S4EA 4BS9A 4DV4I 2YTGA 2NABA 1MEYC 4JG4A 2YTPA 3B82A 2JWOA 1VISA 4OO1F 1N36E 5ELWA 4LOMA 4JI0I 2ELYA 1EI1A 2Z5CA 2ENCA 2EP3A 3KZYA 3Q6MA 2EORA 2Z5EA 2EPKX 4IFDB 4F2JC 3M6AA 4IZKA 1WJPA 3BBGA 5ADZA 4AIMA 4JV5I 3H09A 4JI6I 1Z5CA 1YPNA 3ZOQB 4LFCE 2BA1D 4MYUA 2UUBE 2ELZA 2EN4A 4BHBA 1Z0EA 2GHFA 4DV6I 4NHRA 3ADJA 3P06A 4DPWA 4X9JA 2JEAB 5DNXA 4JI0E 3V2UC 2LJUA 2FV4B 1UEKA 4WXCA 4P52A 5C0XD 4LF5I 1FJGI 1ZBQA 2JOBA 4WXDA 2JOXA 4X65E 5IXMB 1H7UA 3PRYA 2V83A 2KOUA 2HKJA 3ZZUA 4B3MI 2EN6A 3JTZA 2N3GA 1A1KA 3MHSC 3UK3C 2WBTA 2HJJA 3DF6A 3L00A 4JI6E 1T4LB 1P47A 4B3TI 1EA6A 4IFDA 2WZOA 2EOZA 5C0XB 2F8BA 3GMEA 2LVHA 1QNTA 2UUAE 2O1TA 2AE8A 2E5LI 5K36D 2M1SA 2HFUA 4DU7A 3H1CA 2EOSA 1IMUA 1KIJA 4R8OA 4HYMA 1HNWI 5JEAD 5DRQA 4LF9I 4M1KA 3MHHC 4DV1E 2LBSB 4M9VC 1N33I 2WBUA 3J7AG 2EM7A 1Z0TA 1I94I 5KL3A 3Q1QA 2YWQA 1N32I 4B3TE 2EMFA 5K36B 1X47A 3OTOE 2DIXA 5A6AA 2F4VE 1JK2A 4B3RI 1KVKA 4KZSA 2M4IA 2E5LE 5JEAB 2O1WA 2RQLA 3J7Yp 1YHCA 3AV0A 1P42A 5T6JA 2EM2A 2EMGA 3ADLA 2UXBI 4DUYE 4UTGA 2E1MA 4XTJA 4FW6A 1Y5YA 4HACA 2IHR1 2MKDA 5IV8B 1KTVA 5AC5A 2DRPA 2JEBA 4DPYA 5C0XC 1USVA 1XMOI 1HNZE 4OO1D 4IFDF 4O43A 1XMQE 3NZKA 1ZBTA 2EPLX 4MLQA 4DMIA 1S16A 4F6MA 5K36A 3EPKA 3PS1A 1DGCA 3D4JA 1QZRA 3ZZTA 3ECRA 4P78A 3M85G 5AASA 2WNRB 2VQFI 1IBLI 4DV7I 2YTQA 4ZVIA 1KYQA 1WXRA 2RSMA 2PO1A 2UXCI 4X8WA 2CPNA 1UDQA 2LTSA 2N8XA 1LLMC 1G2DC 4OOGC 1ZXNA 4EMDA 4Z7CA 3T1HE 4KWYA 1FKAE 1XMOE 4QNJA 4NXMI 4DR7I 1H7SA 5JEAC 3J81Q 4FW7A 2EQ0A 4R2QA 2LCEA 2YTDA 2XEXA 1PJTA 4X62I 3VK6A 2EM0A 4NBQA 5C0XF 4KQVA 4DV7E 2C37B 4DV5E 4NZVA 3LPSA 4U3DA 4FN5A 5A69A 4PRVA 1X5WA 4NXME 4DR7E 2DGCA 2HFSA 4ISAA 2E1RA 1RHYA 2EL4A 3TQMA 2EMKA 2L8TA 2EMBA 4DXLA 1A1LA 3V5RA 4DR4I 4LFAE 4OZEA 5K36F 1X6FA 2RS6A 3C4BA 3DD6A 4DR2I 3M7NG 1N3GA 2EPXA 4R2SA 2EZ6A 4O4KA 3UHMA 2Z5BB 4OO1C 1B63A 3P76A 5DNLA 1J26A 2BBGA 3CDJA 4WSGA 5GMEA 2V87A 2CTDA 4JI7I 2UUCI 1A1GA 2X7IA 4F9AB 1FWKA 2V34A 2EPCA 2DLQA 5IT9Q 2C37A 4KHPI 2PO0B 1NHJA 2A2CA 2ODRD 2UXDI 2RS7A 2EOOA 3VYXA 1FI4A 2PO2B 3L7ZB 1Y60A 2J7KA 2ZITA 1NZ0A 1J5EI 5K36C 1XNRE 3U1KA 3J81C 5TSEA 4DR2E 4IS9A 5KL5A 1AH5A 4LCFA 2PNZB 2EFGA 2EOFA 3P3GA 2JR1A 1OJ4A 1Z0BA 2NUEA 2HK2A 2BA0D 2LRSA 5BR8E 2EPNA 3QT8A 1IBMI 4OX9I 4KHPE 4IFDD 4N4RB 2M9AA 2EOMA 1A1FA 2YU8A 1GTKA 2EMIA 1J5EE 4DPUA 1H73A 2HHHE 2I9IA 4TUGA 1OYRA 2PO0A 4HXZA 4TUIA 2C38A 4MQYA 3L7ZA 2PO2A 3C6KA 4BBYA 3BF2A 2ENAA 4ZYGA 1UBDC 2FTXB 3C4TA 2PNZA 1IBME 1R6LA 4WYQB 1A6FA 2LMZA 4WX9A 2H36X 3EPLA 2R3VA 2GPIA 4DV4E 2JP9A 4JI4I 2L2KB 2EMAA 3KWRA 1B69A 2VF1A 5IT9C 2LE2A 1PJQA 1UDSA 3PYGA 4IZJB 1STUA 3T1YI 4JI3I 4LFBI 4GKKI 2ODRC 1XHKA 2VQEI 4DV0I 2EMZA 4JI5I 4JV5E 5LLQA 2BA1G 1WRJA 2EWLA 2R42A 1WHQA 2DMIA 1Z5AA 3PYDA 2CGEA 3IWBA 2EM8A 4MU3A 2L92A 1PJSA 5LMNI 4DR3I 1GQEA 2EPAA 2GLIA 3F0NA 2EQ1A 5A6KA 4DV6E 2RTXA 1Z0CA 1UN6B 3M99B 2EM5A 4BHCA 1X48A 2NUFA 2VF3A 2MDRA 2JE6A 1H72C 1FJGE 4R2EA 1T38A 4LF5E 4FWHA 4HACB 3H4LA 3JAMQ 3GONA 4IFDC 2JEBB 4GKKE 2VQEE 1YSAC 3PYFA 4B3ME 1B62A 4WUBA 4JI5E 2V88A 4IZJA 4DR3E 2Q8UA 2O1UA 2YTJA 2EMCA 2K4VA 4WPYA 4U3BA 1MG7A 3ADGA 2B7VA 3PS3A 2EQ3A 1USUA 2EJ4A 1X6HA 1RR9A 2LUPB 3GCMA 3WU5A 1XXEA 2PO1B 2B3TB 2NA2A 4FK5C 4R2DA 1HNWE 2GQ0A 4MU4A 3KZZA 4LF9E 1R6MA 4RH8A 5KL4A 1EH6A 5AE2A 1PKPA 3ADIA 1N33E 1VI7A 2EMLA 2YPNA 1I94E 2V8PA 2IOPA 2VRDA 3B8HA 2EPUA 2ENHA 1Z0VA 4BA2B 2B7TA 5LMUI 2YRHA 4B3RE 2WP8B 3QT5A 4DV3I 1ELOA 2E72A 1YZ9A 4DR1I 1PIEA 1ZM9A 1E3PA 4RHBB 2CZ9A 2DEJA 2D9HA 1SFEA 2UXBE 1IBKI 1KKHA 1FNMA 3B78A 1YUJA 5CFFE 2BM1A 3JAMC 1TF6A 3P3CA 2PRTA 1G2FC 1N34I 2YSPA 4Z7YA 1F2IG 3M85D 2CT1A 2YZTA 5LMUE 2VE7C 1KJKA 2YU5A 2DMYA 2EPRA 2EM9A 1RC7A 1L4SA 3K6QA 1YFHA 2BR2B 5DRPA 3HKMA 2DB2A 4MLVA 1K47A 4YHHI 4DV2I 4BA2A 4YY3I 2WP8A 4JI2I 2HK3A 1WHNA 1IBLE
chains in the Genus database with same CATH topology
2VQFE 4PRXA 2UXCE 1XNQI 2V8QB 4L8NA 3LLHA 1Z5BA 2L3JA 1D6TA 1HNXI 3HPZA 2V89A 1UILA 3LNUA 3FIGA 4X62E 4LF8I 4NXNI 1DARA 4JI2E 5L3JA 2KONA 4DUZI 1YYKA 4X66I 4DPXA 1XNQE 1Z0GA 4F54A 3OMLA 4LF7I 4HY1A 3K1JA 2V2ZA 4WSPA 3RMPA 1UHZA 3HPSA 4DR4E 4BC7A 4LF8E 4NXNE 1O0WA 3HTXA 4WFTA 4DUZE 1YYWA 2ZM6I 2Q2EB 3QT6A 4JI7E 2UUCE 1T4OA 1PVGA 4GKJI 1SR9A 2UU9I 2OI2A 2FGGA 4K0KI 2YT4A 2UXDE 2DSYA 3IWCA 4AQYI 4I8OA 5DNYA 3MSWA 1Y4SA 4WUDA 5GMDA 1ZXMA 2NUGA 2L33A 3IWDA 1WUUA 4IZJD 4BMJA 4R03A 2V85A 2UU9E 4OX9E 4K0KE 4J8ZA 4AQYE 1Z59A 2M7QA 1QU6A 4P7DA 4LFCI 2GS8A 2O1VA 4FW9A 3QT7A 5AE1A 4N3OA 4X64I 4JI8I 2JY9A 1FWLA 4X65I 2B9DA 1N0UA 2G7HA 4LF4I 3F6HA 2WW4A 4JI4E 1RREA 2LUQA 2UUAI 3T1YE 4JI3E 4LFBE 4DR5I 4DV0E 4LU9A 4X64E 2A2DA 4JI8E 3ZKBA 4DKKA 3WU4A 5LMNE 1N32E 5IWAI 4LF6I 3J80Q 4LF4E 3PYEA 4DV1I 2V86A 4Q28A 2IOQA 1Y4UA 3ZM7A 2PNMA 4P7AA 2L2MA 3OTOI 2F4VI 1GZ6A 4DR5E 1ZM2A 2DEIA 4B3SI 3P1XA 1T4NA 5IWAE 4F9CB 4LF6E 4DUYI 3HULA 1N0VC 4PU9A 3WU6A 3HJCA 2V2QA 1HNZI 4DR6I 5FLXQ 3HQ1A 1XMQI 4FWDA 1MU5A 4B3SE 4USKA 3LTOA 1ZM4A 1BKNA 2KHXA 4DPTA 2BM0A 2LTRA 2HKEA 4DV3E 4DR1E 3T1HI 4DR6E 3J80C 2LJPA 1EKZA 3VYYA 1IBKE 4USMA 4JYAI 4MYTA 3J7AM 4UT4A 2ZBKB 2MC5A 5FWKA 3ZKDA 3HXLA 1N34E 4DV5I 4M30A 4F9BB 2X36A 4BCAA 3WU3A 4L5NC 2MC6A 5AE3A 1Y6ZA 1YYOA 4YHHE 4DV2E 4YY3E 3JU0A 3K85A 3LMLA 4JYAE 2CG9A 1MX0A 4LFAI 5A2QQ 5FLXC 1X49A 1H74A 1HK7A 1HNXE 3K17A 4M0VA 3DJWA 4LTYA 3AUZA 1NHHA 2L2NA 2BV3A 2L3CA 2NPFA 4X66E 1XNRI 3CWVA 4DU8A 1HR0I 1DI2A 3F6GA 1Z0WA 1U2RA 4R1FA 5F3WA 4LF7E 3ZZ0A 5BR8I 5LL6R 1NHIA 4JI1I 2Z5CB 4WUCA 2PNLA 2N3HA 2HHHI 2ZM6E 2LJHA 1N36I 4GEQB 4BC9A 1HR0E 4IZKB 1RQ0A 4M2ZA 4GKJE 4RPFA 4ED4A 1ZM3A 4FWGA 5A2QC 2JVAA 4I3HA 2L6MA 2AJ4A 4URLA 4JI1E 2Z5BA 1DQ3A 3Q6NA 2V2VA 2UUBI 1S4EA 4BS9A 4DV4I 4JG4A 3B82A 2JWOA 1VISA 1N36E 4JI0I 1EI1A 2Z5CA 3Q6MA 2Z5EA 3M6AA 4IZKA 4JV5I 5ADZA 3H09A 4JI6I 1Z5CA 3ZOQB 4LFCE 4MYUA 2UUBE 1Z0EA 4DV6I 3ADJA 3P06A 4JI0E 3V2UC 2FV4B 1UEKA 1FJGI 4P52A 4LF5I 1ZBQA 2JOBA 1H7UA 2JOXA 4X65E 3PRYA 2V83A 2KOUA 2HKJA 3ZZUA 4B3MI 3JTZA 2N3GA 3DF6A 4JI6E 1T4LB 4B3TI 1EA6A 2WZOA 2F8BA 2O1TA 2UUAE 2E5LI 2M1SA 2HFUA 4DU7A 1KIJA 4HYMA 4R8OA 1HNWI 4LF9I 4M1KA 4DV1E 2LBSB 1N33I 1I94I 3J7AG 1Z0TA 3Q1QA 4B3TE 1X47A 3OTOE 2DIXA 2F4VE 4B3RI 1KVKA 4KZSA 2M4IA 2E5LE 2O1WA 3J7Yp 3AV0A 5T6JA 3ADLA 2UXBI 4DUYE 4UTGA 2E1MA 4XTJA 4HACA 2IHR1 1KTVA 4DPYA 1USVA 1XMOI 1HNZE 1XMQE 1ZBTA 4DMIA 1S16A 3D4JA 1QZRA 3ZZTA 4P78A 5AASA 1IBLI 2VQFI 4DV7I 4ZVIA 1WXRA 2RSMA 2UXCI 4X8WA 2CPNA 1ZXNA 2LTSA 4EMDA 4OOGC 4Z7CA 3T1HE 1FKAE 1XMOE 4NXMI 4DR7I 1H7SA 3J81Q 2XEXA 4X62I 3VK6A 4KQVA 4DV7E 4DV5E 3LPSA 4FN5A 4PRVA 4NXME 4DR7E 2HFSA 2E1RA 2L8TA 4DXLA 3V5RA 4DR4I 4LFAE 2RS6A 4DR2I 3C4BA 2EZ6A 2Z5BB 1B63A 1J26A 5GMEA 2V87A 4JI7I 2UUCI 2X7IA 4F9AB 1FWKA 2V34A 5IT9Q 4KHPI 1NHJA 2A2CA 2ODRD 2UXDI 2RS7A 3VYXA 1FI4A 1J5EI 2J7KA 2ZITA 1NZ0A 1XNRE 3J81C 4DR2E 2EFGA 2JR1A 1OJ4A 1Z0BA 2NUEA 2HK2A 2LRSA 5BR8E 3QT8A 1IBMI 4OX9I 4KHPE 1J5EE 4DPUA 1H73A 2HHHE 4TUGA 4HXZA 4TUIA 4BBYA 2FTXB 3C4TA 1IBME 4WYQB 1A6FA 2LMZA 2H36X 2R3VA 4DV4E 4JI4I 2L2KB 3KWRA 2VF1A 5IT9C 2LE2A 3PYGA 4IZJB 1STUA 3T1YI 4JI3I 4LFBI 4GKKI 2ODRC 1XHKA 2VQEI 4DV0I 4JI5I 4JV5E 3PYDA 2EWLA 2R42A 1WHQA 5LMNI 1Z5AA 4DR3I 2CGEA 3IWBA 1N32I 2L92A 1GQEA 3F0NA 4DV6E 2RTXA 1Z0CA 1X48A 2NUFA 2VF3A 2MDRA 1H72C 1FJGE 4HACB 4LF5E 4FWHA 3H4LA 3JAMQ 3GONA 4GKKE 2VQEE 3PYFA 4B3ME 1B62A 4WUBA 4JI5E 2V88A 4IZJA 4DR3E 2O1UA 2K4VA 4WPYA 1MG7A 3ADGA 2B7VA 1USUA 1RR9A 2LUPB 3WU5A 2B3TB 2NA2A 1HNWE 2GQ0A 4LF9E 5AE2A 1PKPA 3ADIA 1N33E 1I94E 2V8PA 2IOPA 3B8HA 1Z0VA 2B7TA 5LMUI 4B3RE 3QT5A 4DV3I 1ELOA 1YZ9A 4DR1I 1PIEA 1ZM9A 2CZ9A 2DEJA 2UXBE 1IBKI 1KKHA 1FNMA 3B78A 5CFFE 2BM1A 3JAMC 1N34I 4Z7YA 2YZTA 5LMUE 2VE7C 2DMYA 1RC7A 3K6QA 2DB2A 1K47A 4YHHI 4DV2I 4YY3I 4DPWA 4JI2I 2HK3A 1WHNA 1IBLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF E;  4PRX A;  2UXC E;  1XNQ I;  3LLH A;  1Z5B A;  2L3J A;  1D6T A;  1HNX I;  1UIL A;  3LNU A;  4X62 E;  4LF8 I;  4NXN I;  1DAR A;  4JI2 E;  5L3J A;  4DUZ I;  1YYK A;  4X66 I;  4DPX A;  1XNQ E;  1Z0G A;  4LF7 I;  4HY1 A;  3K1J A;  2V2Z A;  1UHZ A;  4DR4 E;  4LF8 E;  4NXN E;  1O0W A;  3HTX A;  4WFT A;  4DUZ E;  1YYW A;  2ZM6 I;  2Q2E B;  3QT6 A;  4JI7 E;  2UUC E;  1T4O A;  1PVG A;  4GKJ I;  2UU9 I;  2OI2 A;  4K0K I;  2YT4 A;  2UXD E;  4AQY I;  4WUD A;  5GMD A;  1ZXM A;  2NUG A;  2L33 A;  1WUU A;  4OX9 E;  2UU9 E;  4K0K E;  4AQY E;  1Z59 A;  1QU6 A;  4LFC I;  2GS8 A;  4FW9 A;  3QT7 A;  4X64 I;  4JI8 I;  2JY9 A;  1FWL A;  4X65 I;  1N0U A;  4LF4 I;  2WW4 A;  4JI4 E;  1RRE A;  2LUQ A;  2UUA I;  3T1Y E;  4JI3 E;  4LFB E;  4DR5 I;  4DV0 E;  4X64 E;  2A2D A;  4JI8 E;  3ZKB A;  4DKK A;  3WU4 A;  5LMN E;  1N32 E;  5IWA I;  4LF6 I;  3J80 Q;  4LF4 E;  3PYE A;  4DV1 I;  3ZM7 A;  4P7A A;  2L2M A;  3OTO I;  2F4V I;  4DR5 E;  1ZM2 A;  2DEI A;  4B3S I;  3P1X A;  1T4N A;  5IWA E;  4LF6 E;  4DUY I;  3HUL A;  1N0V C;  4PU9 A;  3WU6 A;  2V2Q A;  1HNZ I;  4DR6 I;  5FLX Q;  1XMQ I;  4FWD A;  1MU5 A;  4B3S E;  4USK A;  3LTO A;  1ZM4 A;  1BKN A;  2KHX A;  4DPT A;  2BM0 A;  2LTR A;  2HKE A;  4DV3 E;  4DR1 E;  3T1H I;  4DR6 E;  3J80 C;  2LJP A;  1EKZ A;  3VYY A;  1IBK E;  4USM A;  4JYA I;  4MYT A;  3J7A M;  4UT4 A;  2ZBK B;  3ZKD A;  1N34 E;  4DV5 I;  4M30 A;  2X36 A;  3WU3 A;  1YYO A;  4YHH E;  4DV2 E;  4YY3 E;  4JYA E;  1MX0 A;  4LFA I;  5A2Q Q;  5FLX C;  1X49 A;  1H74 A;  1HNX E;  3K17 A;  1NHH A;  2L2N A;  2BV3 A;  2L3C A;  2NPF A;  4X66 E;  1XNR I;  3CWV A;  4DU8 A;  1HR0 I;  1DI2 A;  1Z0W A;  1U2R A;  4R1F A;  4LF7 E;  3ZZ0 A;  5BR8 I;  1NHI A;  5LL6 R;  4JI1 I;  4WUC A;  2N3H A;  2HHH I;  2ZM6 E;  2LJH A;  1N36 I;  1HR0 E;  1RQ0 A;  4M2Z A;  4GKJ E;  4RPF A;  4ED4 A;  1ZM3 A;  4FWG A;  5A2Q C;  2JVA A;  4I3H A;  2AJ4 A;  4URL A;  4JI1 E;  2V2V A;  2UUB I;  1S4E A;  4DV4 I;  4JG4 A;  3B82 A;  1VIS A;  1N36 E;  4JI0 I;  1EI1 A;  3M6A A;  4JV5 I;  4JI6 I;  1Z5C A;  4LFC E;  4MYU A;  2UUB E;  1Z0E A;  4DV6 I;  3ADJ A;  4JI0 E;  3V2U C;  1UEK A;  1FJG I;  4P52 A;  4LF5 I;  1H7U A;  4X65 E;  2HKJ A;  3ZZU A;  4B3M I;  2N3G A;  4JI6 E;  1T4L B;  4B3T I;  1EA6 A;  2UUA E;  2E5L I;  2HFU A;  4DU7 A;  1KIJ A;  4HYM A;  1HNW I;  4LF9 I;  4M1K A;  4DV1 E;  2LBS B;  1N33 I;  1I94 I;  3J7A G;  1Z0T A;  3Q1Q A;  4B3T E;  1X47 A;  3OTO E;  2DIX A;  2F4V E;  4B3R I;  1KVK A;  2E5L E;  3J7Y p;  3ADL A;  2UXB I;  4DUY E;  4UTG A;  4XTJ A;  4HAC A;  2IHR 1;  1KTV A;  4DPY A;  1XMO I;  1HNZ E;  1XMQ E;  1ZBT A;  1S16 A;  3D4J A;  1QZR A;  3ZZT A;  1IBL I;  2VQF I;  4DV7 I;  4ZVI A;  2RSM A;  2UXC I;  4X8W A;  2CPN A;  1ZXN A;  2LTS A;  4EMD A;  4OOG C;  4Z7C A;  3T1H E;  1FKA E;  1XMO E;  4NXM I;  4DR7 I;  1H7S A;  3J81 Q;  2XEX A;  4X62 I;  4KQV A;  4DV7 E;  4DV5 E;  3LPS A;  4FN5 A;  4PRV A;  4NXM E;  4DR7 E;  2HFS A;  2E1R A;  4DXL A;  3V5R A;  4DR4 I;  4LFA E;  2RS6 A;  4DR2 I;  3C4B A;  2EZ6 A;  1B63 A;  1J26 A;  5GME A;  4JI7 I;  2UUC I;  2X7I A;  1FWK A;  2V34 A;  5IT9 Q;  4KHP I;  1NHJ A;  2A2C A;  2UXD I;  2RS7 A;  3VYX A;  1FI4 A;  1J5E I;  2J7K A;  2ZIT A;  1NZ0 A;  1XNR E;  3J81 C;  4DR2 E;  2EFG A;  1OJ4 A;  1Z0B A;  2NUE A;  2HK2 A;  2LRS A;  5BR8 E;  3QT8 A;  1IBM I;  4OX9 I;  4KHP E;  1J5E E;  4DPU A;  1H73 A;  2HHH E;  4HXZ A;  3C4T A;  1IBM E;  4WYQ B;  1A6F A;  2R3V A;  4DV4 E;  4JI4 I;  2L2K B;  5IT9 C;  3PYG A;  1STU A;  3T1Y I;  4JI3 I;  4LFB I;  4GKK I;  1XHK A;  2VQE I;  4DV0 I;  4JI5 I;  4JV5 E;  3PYD A;  2R42 A;  1WHQ A;  5LMN I;  1Z5A A;  4DR3 I;  1N32 I;  1GQE A;  3F0N A;  4DV6 E;  2RTX A;  1Z0C A;  1X48 A;  2NUF A;  2VF3 A;  2MDR A;  1H72 C;  1FJG E;  4HAC B;  4LF5 E;  4FWH A;  3H4L A;  3JAM Q;  3GON A;  3PYF A;  2VQE E;  4GKK E;  4B3M E;  1B62 A;  4WUB A;  4JI5 E;  4DR3 E;  1MG7 A;  3ADG A;  2B7V A;  1RR9 A;  2LUP B;  3WU5 A;  2B3T B;  2NA2 A;  1HNW E;  4LF9 E;  1PKP A;  3ADI A;  1N33 E;  1I94 E;  2V8P A;  3B8H A;  1Z0V A;  2B7T A;  5LMU I;  4B3R E;  3QT5 A;  4DV3 I;  1ELO A;  1YZ9 A;  4DR1 I;  1PIE A;  1ZM9 A;  2CZ9 A;  2DEJ A;  2UXB E;  1IBK I;  1KKH A;  1FNM A;  3B78 A;  5CFF E;  2BM1 A;  3JAM C;  1N34 I;  4Z7Y A;  5LMU E;  2DMY A;  1RC7 A;  2DB2 A;  1K47 A;  4YHH I;  4DV2 I;  4YY3 I;  4DPW A;  4JI2 I;  2HK3 A;  1WHN A;  1IBL E; 
#chains in the Genus database with same CATH topology
 2VQF E;  4PRX A;  2YTN A;  2EL6 A;  4O5G A;  2UXC E;  1XNQ I;  2V8Q B;  4L8N A;  3LLH A;  2IER A;  1Z5B A;  2L3J A;  4LCG A;  1HNX I;  1D6T A;  3HPZ A;  3PS2 A;  1NEI A;  2V89 A;  2MKN A;  4GZN C;  1UIL A;  2EM6 A;  3LNU A;  3FIG A;  4X62 E;  4LF8 I;  1TF3 A;  4NXN I;  1DAR A;  4JI2 E;  2BR2 A;  4J3D A;  2KON A;  5L3J A;  2LV2 A;  4DUZ I;  2EMX A;  3BID A;  1YYK A;  2NN6 A;  2F1D A;  4FW4 A;  4X66 I;  4DPX A;  4R2A A;  5A6B A;  2YRM A;  1XNQ E;  1Z0G A;  2R76 A;  2EN8 A;  4F54 A;  2EOH A;  4F6N A;  2EN7 A;  3M7N D;  4R2P A;  1T39 A;  3OML A;  4LF7 I;  2C38 B;  4HY1 A;  3K1J A;  2V2Z A;  4WSP A;  3RMP A;  1ZAA C;  1UHZ A;  3HPS A;  4DR4 E;  2EMH A;  4BC7 A;  4LF8 E;  4NXN E;  1O0W A;  3HTX A;  4WFT A;  2WBS A;  4DUZ E;  1YYW A;  2EE8 A;  4OKG A;  2ZM6 I;  2EOQ A;  2Q2E B;  4O24 A;  3EPJ A;  4JI7 E;  4HTG A;  3QT6 A;  2UUC E;  1T4O A;  1PVG A;  4LCH A;  2RSI A;  1SR9 A;  5DRO A;  4GKJ I;  2UU9 I;  2OI2 A;  2FGG A;  4K0K I;  2YT4 A;  2UXD E;  2DSY A;  3IWC A;  1RMD A;  2GO4 A;  5EL9 A;  3VHT B;  4AQY I;  4AM3 A;  2WCC 3;  4I8O A;  2GO3 A;  5DNY A;  4R2C A;  3MSW A;  1Y4S A;  4WUD A;  2YRK A;  2EMW A;  2JYA A;  5GMD A;  3P3E A;  2BA0 G;  1ZXM A;  2NUG A;  2L33 A;  3IWD A;  2NN6 F;  1WUU A;  4IZJ D;  4BMJ A;  4R03 A;  2V85 A;  2UU9 E;  4OX9 E;  4K0K E;  2JE6 B;  2I13 A;  1X6E A;  3THN A;  4J8Z A;  4AQY E;  1Z59 A;  5DRR A;  3QG5 C;  2M7Q A;  1QU6 A;  4P7D A;  4LFC I;  2YTF A;  2GS8 A;  2CVE A;  2O1V A;  4FW9 A;  1A1H A;  2NN6 E;  3QT7 A;  5AE1 A;  4N3O A;  4X64 I;  2J7J A;  4JI8 I;  2JY9 A;  1FWL A;  4LPF A;  2J65 A;  3B4T A;  4X65 I;  2B9D A;  1N0U A;  2RPC A;  2G7H A;  5AC4 A;  4LF4 I;  3F6H A;  2LO3 A;  2WW4 A;  4JI4 E;  1E3H A;  3GLL A;  1BBG A;  2JT2 A;  1RRE A;  2LUQ A;  4OO1 E;  2UUA I;  3T1Y E;  4JI3 E;  4LFB E;  1YH8 A;  4DR5 I;  4DV0 E;  4LU9 A;  4X64 E;  2A2D A;  2C39 A;  4JI8 E;  3ZKB A;  4DKK A;  3WU4 A;  5LMN E;  1N32 E;  5IWA I;  4LF6 I;  3J80 Q;  4LF4 E;  3PYE A;  4DV1 I;  2V86 A;  4OO1 B;  2CSH A;  4Q28 A;  1Z1B A;  2IES A;  2IOQ A;  2EPZ A;  1Y4U A;  3ZM7 A;  2PNM A;  4P7A A;  2L2M A;  1BBO A;  1OYP A;  3OTO I;  2F4V I;  2EMY A;  1GZ6 A;  3BGH A;  5A6J A;  4DR5 E;  2O3Z A;  2BB8 A;  3EQ1 A;  1ZM2 A;  2DEI A;  4B3S I;  4FW3 A;  3P1X A;  1T4N A;  4F9C B;  5IWA E;  1PDA A;  4LF6 E;  4DUY I;  2JEA A;  3HUL A;  2EOE A;  3CDI A;  1N0V C;  4PU9 A;  3WU6 A;  1MGT A;  2YTO A;  3HJC A;  2EN3 A;  2V2Q A;  1HNZ I;  4DR6 I;  4Q35 B;  5KL7 A;  4HEI A;  4GQU A;  3EPH A;  5FLX Q;  3HQ1 A;  2JXP A;  3U1Y A;  1XMQ I;  2NN6 D;  5A6B D;  4FWD A;  1MU5 A;  2EOI A;  2YTI A;  4B3S E;  4USK A;  3LTO A;  2EN2 A;  5C0X A;  3THO B;  2DLK A;  1ZM4 A;  1BKN A;  4BA1 B;  4R2R A;  2YSO A;  2KHX A;  4DPT A;  2BM0 A;  2LTR A;  4FW5 A;  2HKE A;  4DV3 E;  2NN6 B;  4DR1 E;  3T1H I;  4ZYE A;  4DR6 E;  3J80 C;  2LJP A;  1ZR9 A;  2ADR A;  1EKZ A;  3VYY A;  1IBK E;  1IQS A;  4USM A;  2YTE A;  4JYA I;  1EH7 A;  2EOX A;  4MYT A;  3J7A M;  4UT4 A;  2ZBK B;  2MC5 A;  5FWK A;  3ZKD A;  3HXL A;  1N34 E;  5JEA A;  4QNK A;  4MDT A;  2LT7 A;  1OYS A;  4DV5 I;  4M30 A;  4F9B B;  2X36 A;  4BCA A;  1TN9 A;  4MU1 A;  3WU3 A;  4L5N C;  2EPO A;  2MC6 A;  5AE3 A;  1UDO A;  5KL6 A;  1Y6Z A;  2K7I A;  1YYO A;  4YHH E;  4DV2 E;  4BA1 A;  4IFD E;  4YY3 E;  2R1F A;  2EPM X;  3JU0 A;  3K85 A;  4MU0 A;  1YUI A;  3LML A;  4JYA E;  2EPP A;  2CG9 A;  1MX0 A;  4LFA I;  5A2Q Q;  1IQO A;  5FLX C;  1X49 A;  2EOJ A;  1H74 A;  1X3C A;  1HK7 A;  4AID A;  1HNX E;  2MDG A;  3K17 A;  2HGH A;  2NN6 C;  4M0V A;  3DJW A;  4LTY A;  1BB8 A;  3AUZ A;  1NHH A;  2WNR A;  2L2N A;  4OO1 A;  2BV3 A;  2EOY A;  2EM3 A;  2L3C A;  3KRN A;  5EKW A;  2NPF A;  1ZU1 A;  4X66 E;  1XNR I;  3CWV A;  4DU8 A;  1HR0 I;  1AAY A;  1DI2 A;  5C0X E;  2HC5 A;  3F6G A;  1JK1 A;  1Z0W A;  1UDN A;  1U2R A;  4R1F A;  1EH8 A;  5KL2 A;  5JEA F;  5F3W A;  4LF7 E;  3ZZ0 A;  5BR8 I;  2EL5 A;  5LL6 R;  1NHI A;  4JI1 I;  2Z5C B;  1A1J A;  1NCS A;  4IJD A;  4ZYD A;  4WUC A;  2PNL A;  2N3H A;  2VES A;  2HHH I;  2ZM6 E;  2LJH A;  1N36 I;  5K36 E;  4GEQ B;  4BC9 A;  1HR0 E;  2JPA A;  4IZK B;  1RQ0 A;  4M2Z A;  4GKJ E;  2EN1 A;  2A25 A;  3C6M A;  5JEA E;  4RPF A;  4ED4 A;  1ZM3 A;  4FWG A;  5A2Q C;  2JVA A;  4I3H A;  1A1I A;  2L6M A;  2EM4 A;  2AJ4 A;  4ZYH A;  4IS1 C;  4JI1 E;  2Z5B A;  1DQ3 A;  3Q6N A;  4URL A;  2C39 B;  2V2V A;  2UUB I;  1S4E A;  4BS9 A;  4DV4 I;  2YTG A;  2NAB A;  1MEY C;  4JG4 A;  2YTP A;  3B82 A;  2JWO A;  1VIS A;  4OO1 F;  1N36 E;  5ELW A;  4LOM A;  4JI0 I;  2ELY A;  1EI1 A;  2Z5C A;  2ENC A;  2EP3 A;  3KZY A;  3Q6M A;  2EOR A;  2Z5E A;  2EPK X;  4IFD B;  4F2J C;  3M6A A;  4IZK A;  1WJP A;  3BBG A;  5ADZ A;  4AIM A;  4JV5 I;  3H09 A;  4JI6 I;  1Z5C A;  1YPN A;  3ZOQ B;  4LFC E;  2BA1 D;  4MYU A;  2UUB E;  2ELZ A;  2EN4 A;  4BHB A;  1Z0E A;  2GHF A;  4DV6 I;  4NHR A;  3ADJ A;  3P06 A;  4DPW A;  4X9J A;  2JEA B;  5DNX A;  4JI0 E;  3V2U C;  2LJU A;  2FV4 B;  1UEK A;  4WXC A;  4P52 A;  5C0X D;  4LF5 I;  1FJG I;  1ZBQ A;  2JOB A;  4WXD A;  2JOX A;  4X65 E;  5IXM B;  1H7U A;  3PRY A;  2V83 A;  2KOU A;  2HKJ A;  3ZZU A;  4B3M I;  2EN6 A;  3JTZ A;  2N3G A;  1A1K A;  3MHS C;  3UK3 C;  2WBT A;  2HJJ A;  3DF6 A;  3L00 A;  4JI6 E;  1T4L B;  1P47 A;  4B3T I;  1EA6 A;  4IFD A;  2WZO A;  2EOZ A;  5C0X B;  2F8B A;  3GME A;  2LVH A;  1QNT A;  2UUA E;  2O1T A;  2AE8 A;  2E5L I;  5K36 D;  2M1S A;  2HFU A;  4DU7 A;  3H1C A;  2EOS A;  1IMU A;  1KIJ A;  4R8O A;  4HYM A;  1HNW I;  5JEA D;  5DRQ A;  4LF9 I;  4M1K A;  3MHH C;  4DV1 E;  2LBS B;  4M9V C;  1N33 I;  2WBU A;  3J7A G;  2EM7 A;  1Z0T A;  1I94 I;  5KL3 A;  3Q1Q A;  2YWQ A;  1N32 I;  4B3T E;  2EMF A;  5K36 B;  1X47 A;  3OTO E;  2DIX A;  5A6A A;  2F4V E;  1JK2 A;  4B3R I;  1KVK A;  4KZS A;  2M4I A;  2E5L E;  5JEA B;  2O1W A;  2RQL A;  3J7Y p;  1YHC A;  3AV0 A;  1P42 A;  5T6J A;  2EM2 A;  2EMG A;  3ADL A;  2UXB I;  4DUY E;  4UTG A;  2E1M A;  4XTJ A;  4FW6 A;  1Y5Y A;  4HAC A;  2IHR 1;  2MKD A;  5IV8 B;  1KTV A;  5AC5 A;  2DRP A;  2JEB A;  4DPY A;  5C0X C;  1USV A;  1XMO I;  1HNZ E;  4OO1 D;  4IFD F;  4O43 A;  1XMQ E;  3NZK A;  1ZBT A;  2EPL X;  4MLQ A;  4DMI A;  1S16 A;  4F6M A;  5K36 A;  3EPK A;  3PS1 A;  1DGC A;  3D4J A;  1QZR A;  3ZZT A;  3ECR A;  4P78 A;  3M85 G;  5AAS A;  2WNR B;  2VQF I;  1IBL I;  4DV7 I;  2YTQ A;  4ZVI A;  1KYQ A;  1WXR A;  2RSM A;  2PO1 A;  2UXC I;  4X8W A;  2CPN A;  1UDQ A;  2LTS A;  2N8X A;  1LLM C;  1G2D C;  4OOG C;  1ZXN A;  4EMD A;  4Z7C A;  3T1H E;  4KWY A;  1FKA E;  1XMO E;  4QNJ A;  4NXM I;  4DR7 I;  1H7S A;  5JEA C;  3J81 Q;  4FW7 A;  2EQ0 A;  4R2Q A;  2LCE A;  2YTD A;  2XEX A;  1PJT A;  4X62 I;  3VK6 A;  2EM0 A;  4NBQ A;  5C0X F;  4KQV A;  4DV7 E;  2C37 B;  4DV5 E;  4NZV A;  3LPS A;  4U3D A;  4FN5 A;  5A69 A;  4PRV A;  1X5W A;  4NXM E;  4DR7 E;  2DGC A;  2HFS A;  4ISA A;  2E1R A;  1RHY A;  2EL4 A;  3TQM A;  2EMK A;  2L8T A;  2EMB A;  4DXL A;  1A1L A;  3V5R A;  4DR4 I;  4LFA E;  4OZE A;  5K36 F;  1X6F A;  2RS6 A;  3C4B A;  3DD6 A;  4DR2 I;  3M7N G;  1N3G A;  2EPX A;  4R2S A;  2EZ6 A;  4O4K A;  3UHM A;  2Z5B B;  4OO1 C;  1B63 A;  3P76 A;  5DNL A;  1J26 A;  2BBG A;  3CDJ A;  4WSG A;  5GME A;  2V87 A;  2CTD A;  4JI7 I;  2UUC I;  1A1G A;  2X7I A;  4F9A B;  1FWK A;  2V34 A;  2EPC A;  2DLQ A;  5IT9 Q;  2C37 A;  4KHP I;  2PO0 B;  1NHJ A;  2A2C A;  2ODR D;  2UXD I;  2RS7 A;  2EOO A;  3VYX A;  1FI4 A;  2PO2 B;  3L7Z B;  1Y60 A;  2J7K A;  2ZIT A;  1NZ0 A;  1J5E I;  5K36 C;  1XNR E;  3U1K A;  3J81 C;  5TSE A;  4DR2 E;  4IS9 A;  5KL5 A;  1AH5 A;  4LCF A;  2PNZ B;  2EFG A;  2EOF A;  3P3G A;  2JR1 A;  1OJ4 A;  1Z0B A;  2NUE A;  2HK2 A;  2BA0 D;  2LRS A;  5BR8 E;  2EPN A;  3QT8 A;  1IBM I;  4OX9 I;  4KHP E;  4IFD D;  4N4R B;  2M9A A;  2EOM A;  1A1F A;  2YU8 A;  1GTK A;  2EMI A;  1J5E E;  4DPU A;  1H73 A;  2HHH E;  2I9I A;  4TUG A;  1OYR A;  2PO0 A;  4HXZ A;  4TUI A;  2C38 A;  4MQY A;  3L7Z A;  2PO2 A;  3C6K A;  4BBY A;  3BF2 A;  2ENA A;  4ZYG A;  1UBD C;  2FTX B;  3C4T A;  2PNZ A;  1IBM E;  1R6L A;  4WYQ B;  1A6F A;  2LMZ A;  4WX9 A;  2H36 X;  3EPL A;  2R3V A;  2GPI A;  4DV4 E;  2JP9 A;  4JI4 I;  2L2K B;  2EMA A;  3KWR A;  1B69 A;  2VF1 A;  5IT9 C;  2LE2 A;  1PJQ A;  1UDS A;  3PYG A;  4IZJ B;  1STU A;  3T1Y I;  4JI3 I;  4LFB I;  4GKK I;  2ODR C;  1XHK A;  2VQE I;  4DV0 I;  2EMZ A;  4JI5 I;  4JV5 E;  5LLQ A;  2BA1 G;  1WRJ A;  2EWL A;  2R42 A;  1WHQ A;  2DMI A;  1Z5A A;  3PYD A;  2CGE A;  3IWB A;  2EM8 A;  4MU3 A;  2L92 A;  1PJS A;  5LMN I;  4DR3 I;  1GQE A;  2EPA A;  2GLI A;  3F0N A;  2EQ1 A;  5A6K A;  4DV6 E;  2RTX A;  1Z0C A;  1UN6 B;  3M99 B;  2EM5 A;  4BHC A;  1X48 A;  2NUF A;  2VF3 A;  2MDR A;  2JE6 A;  1H72 C;  1FJG E;  4R2E A;  1T38 A;  4LF5 E;  4FWH A;  4HAC B;  3H4L A;  3JAM Q;  3GON A;  4IFD C;  2JEB B;  4GKK E;  2VQE E;  1YSA C;  3PYF A;  4B3M E;  1B62 A;  4WUB A;  4JI5 E;  2V88 A;  4IZJ A;  4DR3 E;  2Q8U A;  2O1U A;  2YTJ A;  2EMC A;  2K4V A;  4WPY A;  4U3B A;  1MG7 A;  3ADG A;  2B7V A;  3PS3 A;  2EQ3 A;  1USU A;  2EJ4 A;  1X6H A;  1RR9 A;  2LUP B;  3GCM A;  3WU5 A;  1XXE A;  2PO1 B;  2B3T B;  2NA2 A;  4FK5 C;  4R2D A;  1HNW E;  2GQ0 A;  4MU4 A;  3KZZ A;  4LF9 E;  1R6M A;  4RH8 A;  5KL4 A;  1EH6 A;  5AE2 A;  1PKP A;  3ADI A;  1N33 E;  1VI7 A;  2EML A;  2YPN A;  1I94 E;  2V8P A;  2IOP A;  2VRD A;  3B8H A;  2EPU A;  2ENH A;  1Z0V A;  4BA2 B;  2B7T A;  5LMU I;  2YRH A;  4B3R E;  2WP8 B;  3QT5 A;  4DV3 I;  1ELO A;  2E72 A;  1YZ9 A;  4DR1 I;  1PIE A;  1ZM9 A;  1E3P A;  4RHB B;  2CZ9 A;  2DEJ A;  2D9H A;  1SFE A;  2UXB E;  1IBK I;  1KKH A;  1FNM A;  3B78 A;  1YUJ A;  5CFF E;  2BM1 A;  3JAM C;  1TF6 A;  3P3C A;  2PRT A;  1G2F C;  1N34 I;  2YSP A;  4Z7Y A;  1F2I G;  3M85 D;  2CT1 A;  2YZT A;  5LMU E;  2VE7 C;  1KJK A;  2YU5 A;  2DMY A;  2EPR A;  2EM9 A;  1RC7 A;  1L4S A;  3K6Q A;  1YFH A;  2BR2 B;  5DRP A;  3HKM A;  2DB2 A;  4MLV A;  1K47 A;  4YHH I;  4DV2 I;  4BA2 A;  4YY3 I;  2WP8 A;  4JI2 I;  2HK3 A;  1WHN A;  1IBL E; 
#chains in the Genus database with same CATH homology
 2VQF E;  4PRX A;  2UXC E;  1XNQ I;  2V8Q B;  4L8N A;  3LLH A;  1Z5B A;  2L3J A;  1D6T A;  1HNX I;  3HPZ A;  2V89 A;  1UIL A;  3LNU A;  3FIG A;  4X62 E;  4LF8 I;  4NXN I;  1DAR A;  4JI2 E;  5L3J A;  2KON A;  4DUZ I;  1YYK A;  4X66 I;  4DPX A;  1XNQ E;  1Z0G A;  4F54 A;  3OML A;  4LF7 I;  4HY1 A;  3K1J A;  2V2Z A;  4WSP A;  3RMP A;  1UHZ A;  3HPS A;  4DR4 E;  4BC7 A;  4LF8 E;  4NXN E;  1O0W A;  3HTX A;  4WFT A;  4DUZ E;  1YYW A;  2ZM6 I;  2Q2E B;  3QT6 A;  4JI7 E;  2UUC E;  1T4O A;  1PVG A;  4GKJ I;  1SR9 A;  2UU9 I;  2OI2 A;  2FGG A;  4K0K I;  2YT4 A;  2UXD E;  2DSY A;  3IWC A;  4AQY I;  4I8O A;  5DNY A;  3MSW A;  1Y4S A;  4WUD A;  5GMD A;  1ZXM A;  2NUG A;  2L33 A;  3IWD A;  1WUU A;  4IZJ D;  4BMJ A;  4R03 A;  2V85 A;  2UU9 E;  4OX9 E;  4K0K E;  4J8Z A;  4AQY E;  1Z59 A;  2M7Q A;  1QU6 A;  4P7D A;  4LFC I;  2GS8 A;  2O1V A;  4FW9 A;  3QT7 A;  5AE1 A;  4N3O A;  4X64 I;  4JI8 I;  2JY9 A;  1FWL A;  4X65 I;  2B9D A;  1N0U A;  2G7H A;  4LF4 I;  3F6H A;  2WW4 A;  4JI4 E;  1RRE A;  2LUQ A;  2UUA I;  3T1Y E;  4JI3 E;  4LFB E;  4DR5 I;  4DV0 E;  4LU9 A;  4X64 E;  2A2D A;  4JI8 E;  3ZKB A;  4DKK A;  3WU4 A;  5LMN E;  1N32 E;  5IWA I;  4LF6 I;  3J80 Q;  4LF4 E;  3PYE A;  4DV1 I;  2V86 A;  4Q28 A;  2IOQ A;  1Y4U A;  3ZM7 A;  2PNM A;  4P7A A;  2L2M A;  3OTO I;  2F4V I;  1GZ6 A;  4DR5 E;  1ZM2 A;  2DEI A;  4B3S I;  3P1X A;  1T4N A;  5IWA E;  4F9C B;  4LF6 E;  4DUY I;  3HUL A;  1N0V C;  4PU9 A;  3WU6 A;  3HJC A;  2V2Q A;  1HNZ I;  4DR6 I;  5FLX Q;  3HQ1 A;  1XMQ I;  4FWD A;  1MU5 A;  4B3S E;  4USK A;  3LTO A;  1ZM4 A;  1BKN A;  2KHX A;  4DPT A;  2BM0 A;  2LTR A;  2HKE A;  4DV3 E;  4DR1 E;  3T1H I;  4DR6 E;  3J80 C;  2LJP A;  1EKZ A;  3VYY A;  1IBK E;  4USM A;  4JYA I;  4MYT A;  3J7A M;  4UT4 A;  2ZBK B;  2MC5 A;  5FWK A;  3ZKD A;  3HXL A;  1N34 E;  4DV5 I;  4M30 A;  4F9B B;  2X36 A;  4BCA A;  3WU3 A;  4L5N C;  2MC6 A;  5AE3 A;  1Y6Z A;  1YYO A;  4YHH E;  4DV2 E;  4YY3 E;  3JU0 A;  3K85 A;  3LML A;  4JYA E;  2CG9 A;  1MX0 A;  4LFA I;  5A2Q Q;  5FLX C;  1X49 A;  1H74 A;  1HK7 A;  1HNX E;  3K17 A;  4M0V A;  3DJW A;  4LTY A;  3AUZ A;  1NHH A;  2L2N A;  2BV3 A;  2L3C A;  2NPF A;  4X66 E;  1XNR I;  3CWV A;  4DU8 A;  1HR0 I;  1DI2 A;  3F6G A;  1Z0W A;  1U2R A;  4R1F A;  5F3W A;  4LF7 E;  3ZZ0 A;  5BR8 I;  5LL6 R;  1NHI A;  4JI1 I;  2Z5C B;  4WUC A;  2PNL A;  2N3H A;  2HHH I;  2ZM6 E;  2LJH A;  1N36 I;  4GEQ B;  4BC9 A;  1HR0 E;  4IZK B;  1RQ0 A;  4M2Z A;  4GKJ E;  4RPF A;  4ED4 A;  1ZM3 A;  4FWG A;  5A2Q C;  2JVA A;  4I3H A;  2L6M A;  2AJ4 A;  4URL A;  4JI1 E;  2Z5B A;  1DQ3 A;  3Q6N A;  2V2V A;  2UUB I;  1S4E A;  4BS9 A;  4DV4 I;  4JG4 A;  3B82 A;  2JWO A;  1VIS A;  1N36 E;  4JI0 I;  1EI1 A;  2Z5C A;  3Q6M A;  2Z5E A;  3M6A A;  4IZK A;  4JV5 I;  5ADZ A;  3H09 A;  4JI6 I;  1Z5C A;  3ZOQ B;  4LFC E;  4MYU A;  2UUB E;  1Z0E A;  4DV6 I;  3ADJ A;  3P06 A;  4JI0 E;  3V2U C;  2FV4 B;  1UEK A;  1FJG I;  4P52 A;  4LF5 I;  1ZBQ A;  2JOB A;  1H7U A;  2JOX A;  4X65 E;  3PRY A;  2V83 A;  2KOU A;  2HKJ A;  3ZZU A;  4B3M I;  3JTZ A;  2N3G A;  3DF6 A;  4JI6 E;  1T4L B;  4B3T I;  1EA6 A;  2WZO A;  2F8B A;  2O1T A;  2UUA E;  2E5L I;  2M1S A;  2HFU A;  4DU7 A;  1KIJ A;  4HYM A;  4R8O A;  1HNW I;  4LF9 I;  4M1K A;  4DV1 E;  2LBS B;  1N33 I;  1I94 I;  3J7A G;  1Z0T A;  3Q1Q A;  4B3T E;  1X47 A;  3OTO E;  2DIX A;  2F4V E;  4B3R I;  1KVK A;  4KZS A;  2M4I A;  2E5L E;  2O1W A;  3J7Y p;  3AV0 A;  5T6J A;  3ADL A;  2UXB I;  4DUY E;  4UTG A;  2E1M A;  4XTJ A;  4HAC A;  2IHR 1;  1KTV A;  4DPY A;  1USV A;  1XMO I;  1HNZ E;  1XMQ E;  1ZBT A;  4DMI A;  1S16 A;  3D4J A;  1QZR A;  3ZZT A;  4P78 A;  5AAS A;  1IBL I;  2VQF I;  4DV7 I;  4ZVI A;  1WXR A;  2RSM A;  2UXC I;  4X8W A;  2CPN A;  1ZXN A;  2LTS A;  4EMD A;  4OOG C;  4Z7C A;  3T1H E;  1FKA E;  1XMO E;  4NXM I;  4DR7 I;  1H7S A;  3J81 Q;  2XEX A;  4X62 I;  3VK6 A;  4KQV A;  4DV7 E;  4DV5 E;  3LPS A;  4FN5 A;  4PRV A;  4NXM E;  4DR7 E;  2HFS A;  2E1R A;  2L8T A;  4DXL A;  3V5R A;  4DR4 I;  4LFA E;  2RS6 A;  4DR2 I;  3C4B A;  2EZ6 A;  2Z5B B;  1B63 A;  1J26 A;  5GME A;  2V87 A;  4JI7 I;  2UUC I;  2X7I A;  4F9A B;  1FWK A;  2V34 A;  5IT9 Q;  4KHP I;  1NHJ A;  2A2C A;  2ODR D;  2UXD I;  2RS7 A;  3VYX A;  1FI4 A;  1J5E I;  2J7K A;  2ZIT A;  1NZ0 A;  1XNR E;  3J81 C;  4DR2 E;  2EFG A;  2JR1 A;  1OJ4 A;  1Z0B A;  2NUE A;  2HK2 A;  2LRS A;  5BR8 E;  3QT8 A;  1IBM I;  4OX9 I;  4KHP E;  1J5E E;  4DPU A;  1H73 A;  2HHH E;  4TUG A;  4HXZ A;  4TUI A;  4BBY A;  2FTX B;  3C4T A;  1IBM E;  4WYQ B;  1A6F A;  2LMZ A;  2H36 X;  2R3V A;  4DV4 E;  4JI4 I;  2L2K B;  3KWR A;  2VF1 A;  5IT9 C;  2LE2 A;  3PYG A;  4IZJ B;  1STU A;  3T1Y I;  4JI3 I;  4LFB I;  4GKK I;  2ODR C;  1XHK A;  2VQE I;  4DV0 I;  4JI5 I;  4JV5 E;  3PYD A;  2EWL A;  2R42 A;  1WHQ A;  5LMN I;  1Z5A A;  4DR3 I;  2CGE A;  3IWB A;  1N32 I;  2L92 A;  1GQE A;  3F0N A;  4DV6 E;  2RTX A;  1Z0C A;  1X48 A;  2NUF A;  2VF3 A;  2MDR A;  1H72 C;  1FJG E;  4HAC B;  4LF5 E;  4FWH A;  3H4L A;  3JAM Q;  3GON A;  4GKK E;  2VQE E;  3PYF A;  4B3M E;  1B62 A;  4WUB A;  4JI5 E;  2V88 A;  4IZJ A;  4DR3 E;  2O1U A;  2K4V A;  4WPY A;  1MG7 A;  3ADG A;  2B7V A;  1USU A;  1RR9 A;  2LUP B;  3WU5 A;  2B3T B;  2NA2 A;  1HNW E;  2GQ0 A;  4LF9 E;  5AE2 A;  1PKP A;  3ADI A;  1N33 E;  1I94 E;  2V8P A;  2IOP A;  3B8H A;  1Z0V A;  2B7T A;  5LMU I;  4B3R E;  3QT5 A;  4DV3 I;  1ELO A;  1YZ9 A;  4DR1 I;  1PIE A;  1ZM9 A;  2CZ9 A;  2DEJ A;  2UXB E;  1IBK I;  1KKH A;  1FNM A;  3B78 A;  5CFF E;  2BM1 A;  3JAM C;  1N34 I;  4Z7Y A;  2YZT A;  5LMU E;  2VE7 C;  2DMY A;  1RC7 A;  3K6Q A;  2DB2 A;  1K47 A;  4YHH I;  4DV2 I;  4YY3 I;  4DPW A;  4JI2 I;  2HK3 A;  1WHN A;  1IBL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...