4DR5E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5E02
4X66I 5FLXC 5IT9Q 1MU5A 3ADJA 1A6FA 3J81Q 4JI7E 3P1XA 1EI1A 5BR8I 2A2DA 1T4OA 2B3TB 2XEXA 2WW4A 2DIXA 4M30A 5L3JA 5BR8E 1STUA 3JAMQ 3B78A 4URLA 2CZ9A 4DPUA 1FWLA 3PYEA 1UEKA 4DV5E 2V8PA 1I94I 1HNXE 4LF5I 2E5LE 1BKNA 2UXCE 1EKZA 4DPWA 3J80C 4DR5I 2R42A 2EZ6A 4YY3I 4B3TE 4P7AA 2UXDE 1ZM3A 3ZKBA 2B7TA 1FI4A 4JI1E 4YY3E 3F0NA 4JV5I 2A2CA 1IBMI 3ZZTA 1QZRA 1Z0WA 2VQFE 4LF9I 2Q2EB 2NUEA 4JI8I 1D6TA 1FKAE 3LNUA 2UUBE 4DV4I 2NUGA 1IBLI 2V2ZA 5CFFE 4DR2E 4X65E 1N33I 2HHHE 2N3GA 1RR9A 1Z5BA 4K0KI 1HNWI 1IBLE 1MX0A 3VYYA 4DUYE 1HNWE 4DR3I 2LJHA 4DV1I 4YHHI 3ZKDA 5FLXQ 1T4NA 1X49A 2OI2A 3J7Yp 3ZZ0A 4NXMI 4WUCA 1U2RA 2HK3A 3HTXA 1NZ0A 2V2VA 1YYOA 1ZXNA 2VQEE 3LLHA 4LF4E 4DPXA 4PRXA 4XTJA 1XNRE 1H7UA 1Z0TA 4PU9A 4LFBE 4B3MI 4DR7E 1S4EA 4LF7I 2B7VA 4NXNE 2L3JA 3ADLA 1OJ4A 2LTSA 3QT7A 4HACA 2UXBE 4JI2I 2RTXA 3WU3A 2BM1A 1N36E 3Q1QA 3OTOI 2J7KA 1HNZI 1NHIA 2HFUA 4DR6I 4HYMA 3WU5A 4LFCE 5A2QQ 1XMQE 4X62I 4JG4A 4LFAI 2F4VE 5LMNE 4X62E 2LJPA 4GKJE 4JI7I 4LFAE 1H74A 2X36A 4LF6E 5LMUE 2HKJA 2E1RA 3B82A 4OX9I 1XNQE 1RC7A 2YT4A 2LRSA 4OX9E 4DV5I 3VYXA 2UUAE 1RREA 1HNXI 2E5LI 2UXCI 4WUDA 4B3TI 4DR4E 1KIJA 4DU7A 2UXDI 1T4LB 3QT8A 4JI1I 1Z0EA 1YZ9A 4DUZE 4DU8A 1QU6A 2VQFI 4JI5E 1UHZA 3C4BA 4USMA 2NPFA 5A2QC 1RQ0A 2UUBI 1ZM2A 4AQYI 2X7IA 3ADGA 4JI0E 1PKPA 1KTVA 4PRVA 4DR2I 4X65I 4AQYE 2HHHI 3QT5A 4DV0I 4WFTA 1YYWA 4DUYI 4USKA 4DV0E 3WU6A 4DV7E 4OOGC 4B3RE 1WHQA 2HK2A 4HY1A 1N32E 4JI4E 2N3HA 2L2NA 1X47A 1Z5AA 1IBKE 1YYKA 2VQEI 2DEIA 3C4TA 2BV3A 4LF4I 4FN5A 1N34E 1XNRI 4ZVIA 1VISA 1KKHA 4GKKE 1H7SA 4JYAE 4LFBI 4HACB 1PIEA 1WUUA 4DR7I 4NXNI 1B62A 1FWKA 3J7AM 2L2KB 3T1HE 2UXBI 4DV6I 2IHR1 1N36I 4X64E 2ZM6I 4DV6E 2LUQA 4JI6E 2ZM6E 3K17A 4LFCI 3ZM7A 3D4JA 2BM0A 1K47A 4M1KA 1XMQI 2L3CA 2L2MA 1DARA 1GQEA 4FW9A 4HXZA 2F4VI 5LMNI 4GKJI 2L33A 2JY9A 1PVGA 2DMYA 4DPYA 4LF6I 5LMUI 2UUCI 3ZZUA 1WHNA 4DR1E 3K1JA 1FNMA 1XNQI 2UUCE 1H73A 1EA6A 3PYDA 3B8HA 4KHPE 4Z7YA 4X8WA 1J5EE 1XMOI 2UUAI 4EMDA 1FJGE 4DV3E 2HKEA 1XMOE 4X66E 1NHJA 4DR4I 1Z5CA 3PYGA 4DUZI 2LBSB 4DV2I 4LF8I 4FWDA 4KQVA 4MYTA 5GMEA 4JI5I 4DV2E 4LF8E 4M2ZA 3LPSA 4JI0I 1Z0GA 1X48A 5GMDA 1I94E 2AJ4A 3CWVA 4LF5E 4RPFA 1N0UA 1ELOA 2ZITA 2DB2A 1DI2A 1UILA 1N0VC 3GONA 4ED4A 4DV7I 4B3RI 4DXLA 4DR5E 2LTRA 1ZM9A 1ZXMA 2LUPB 4JV5E 4UTGA 1N32I 3QT6A 4JI4I 1XHKA 1IBME 2V34A 5IT9C 3LTOA 4LF9E 1IBKI 3HULA 3J81C 3M6AA 4DKKA 4JI8E 4FWGA 1J26A 3J7AG 4B3SI 2RS7A 3H4LA 1N34I 4B3SE 2KHXA 4DV4E 2CPNA 1N33E 4GKKI 4JYAI 2RSMA 3JAMC 4K0KE 4DPTA 1ZM4A 3PYFA 5IWAI 3ADIA 1O0WA 3T1HI 1ZBTA 4UT4A 4DR3E 1H72C 5IWAE 4DV1E 3WU4A 4YHHE 2V2QA 4X64I 1HR0I 1NHHA 3T1YI 4JI3I 4JI6I 4NXME 4Z7CA 2ZBKB 1HR0E 2NUFA 3T1YE 4JI3E 2EFGA 4WYQB 2R3VA 2GS8A 1KVKA 4P52A 2MDRA 4FWHA 1Z0VA 1S16A 1B63A 2DEJA 4R1FA 4MYUA 2NA2A 4B3ME 4LF7E 2UU9I 2RS6A 5LL6R 4DR1I 2VF3A 4JI2E 3J80Q 2UU9E 1Z0BA 3V5RA 4WUBA 3OTOE 1Z59A 4KHPI 1HNZE 1MG7A 1J5EI 1FJGI 1Z0CA 4DV3I 2JVAA 2HFSA 4DR6E 4I3HA 3V2UC
chains in the Genus database with same CATH superfamily
1IQOA 5FLXC 4X66I 5AE2A 3M7NG 5IT9Q 2RSIA 1MU5A 3ADJA 1A6FA 2O1VA 3J81Q 2V87A 1SFEA 1YUIA 2EPXA 3HPZA 2EOIA 4JI7E 4BA1A 4FW3A 3P1XA 2E72A 1EI1A 4O5GA 5BR8I 2A2DA 4OO1D 1T4OA 4M1KA 2B3TB 2M4IA 4M9VC 2EM3A 2NN6E 2XEXA 5DNYA 2WW4A 2DIXA 4M30A 2EMLA 5L3JA 4NZVA 5BR8E 1STUA 2CVEA 3B78A 3JAMQ 3KRNA 4URLA 2CZ9A 2EM0A 2LT7A 5AC4A 2YTPA 3AUZA 5AC5A 4DPUA 5FWKA 2BB8A 2WP8B 1FWLA 1SR9A 1USUA 3PYEA 3P3CA 1UEKA 4M0VA 2NABA 1A1FA 4DV5E 4MU0A 5AASA 2V8PA 5KL2A 4GQUA 1I94I 3NZKA 1HNXE 4LF5I 2E5LE 1BKNA 2HGHA 2UXCE 2EPPA 4BC7A 2G7HA 1EKZA 4DPWA 3M7ND 3J80C 1N32I 2EOEA 2EOZA 2EZ6A 2R42A 4YY3I 4DR5I 4B3TE 1G2DC 4ZYDA 2UXDE 4P7AA 1ZM3A 3ZKBA 2EPKX 2B7TA 3IWBA 1FI4A 2EQ1A 4YY3E 4JI1E 3F0NA 4IZJB 2CSHA 4MU3A 4JV5I 2A2CA 5JEAC 1IBMI 3ZZTA 2CT1A 1QZRA 3GCMA 2M9AA 2FV4B 1Z0WA 3M85G 2VQFE 2EM9A 3EPJA 4LF9I 2JE6A 2EOXA 5K36E 2Q2EB 3GMEA 4Q28A 2NUEA 4JI8I 1YUJA 1D6TA 1FKAE 1X3CA 1A1JA 2BA1D 3LNUA 2UUBE 1DQ3A 4DV4I 2NUGA 1X6EA 1IBLI 2V2ZA 4MDTA 5CFFE 2H36X 4DR2E 4X65E 1XMQI 4BBYA 1N33I 2YWQA 1LLMC 2HHHE 2N3GA 5IV8B 1RR9A 1Z5BA 4K0KI 2GQ0A 1HNWI 1IBLE 4IZKB 1MX0A 3VYYA 4DUYE 5DNLA 1HNWE 4OO1C 3UHMA 2EOHA 3L7ZA 4BCAA 4F2JC 2NN6B 2LJHA 3P76A 5JEAF 4TUIA 4DR3I 2YTNA 4DV1I 4YHHI 2EE8A 2B9DA 3ZKDA 2DRPA 1T4NA 5FLXQ 4RHBB 1X49A 2OI2A 2V8QB 4J8ZA 3J7Yp 3ZZ0A 4NXMI 4WUCA 1U2RA 2HK3A 3HTXA 1KYQA 5KL5A 3M85D 4LTYA 1TF6A 2HJJA 3BF2A 1NZ0A 2V2VA 3C6KA 2YTFA 1YYOA 2ELYA 1ZXNA 2VQEE 2ADRA 3LLHA 1YFHA 4LF4E 4PRXA 4DPXA 4XTJA 3P06A 1XNRE 4LPFA 1H7UA 4OO1F 1Z0TA 4O4KA 5A6BD 1RMDA 4PU9A 2PNZA 2IOQA 4LFBE 4B3MI 4DR7E 1S4EA 4LF7I 2B7VA 4NXNE 3F6GA 2L3JA 3JTZA 3ADLA 1OJ4A 2LTSA 2YU8A 2VRDA 3QT7A 4HACA 2UXBE 4JI2I 2MC5A 2EPAA 5A6JA 2RTXA 4MU4A 2BM1A 1N36E 3HPSA 3WU3A 4OZEA 5EKWA 3Q1QA 5K36B 1UN6B 3OTOI 2J7KA 2YTOA 3K85A 1HNZI 4IJDA 1NHIA 1E3HA 1UDSA 2L6MA 2EQ0A 4F9CB 4ZYHA 2YRHA 2BR2A 2HFUA 4MQYA 4AM3A 3B4TA 4L8NA 5AE3A 4F6NA 2MKDA 3PS3A 3U1YA 3QG5C 3VK6A 4DR6I 2EL5A 4HYMA 2CG9A 3WU5A 3JU0A 4ZYGA 2AE8A 1ZBQA 4LFCE 5A2QQ 1IQSA 4RH8A 3UK3C 1XMQE 4BA1B 4X62I 4JG4A 4LFAI 3HQ1A 2EL4A 2C39A 2EN4A 2EQ3A 2F4VE 5LMNE 2DMIA 2EMAA 4X62E 1AH5A 4GKJE 2LJPA 4JI7I 4LFAE 3AV0A 1B69A 2C38A 2JT2A 1H74A 1BBGA 2YTIA 2RQLA 4NHRA 2X36A 4LF6E 2IOPA 3F6HA 5LMUE 2EM2A 2LO3A 1Y5YA 2E1RA 2EOYA 2HKJA 3B82A 4FW7A 1AAYA 3MSWA 2GO3A 2MDGA 2GO4A 4OX9I 1XNQE 2GLIA 2YSPA 3BBGA 2O1TA 1RC7A 1WJPA 2YT4A 2LRSA 4BHCA 3KWRA 2EN6A 5C0XF 4OX9E 4L5NC 2EL6A 3DD6A 4DV5I 3VYXA 2ODRD 2YTQA 2UUAE 1RREA 1HNXI 4AIMA 1X6FA 1IMUA 2E5LI 2UXCI 2YZTA 3CDIA 3IWCA 5TSEA 2EMHA 4WUDA 4R2QA 2MKNA 4B3TI 4DR4E 1KIJA 4DU7A 2UXDI 2EPOA 1PJSA 3TQMA 1T4LB 3QT8A 2DLKA 1Z0EA 4F9BB 4JI1I 1YZ9A 4DUZE 2JE6B 4DU8A 1QU6A 3RMPA 2BA0G 2EMIA 2VQFI 4JI5E 1RHYA 4BHBA 1UHZA 3C4BA 1P47A 2EN7A 1F2IG 5EL9A 4USMA 2NPFA 5A2QC 4F6MA 4WXDA 1A1LA 1OYPA 1RQ0A 2EMBA 4R2RA 4WX9A 1ZM2A 2UUBI 2WBTA 4AQYI 2X7IA 2I9IA 3ADGA 4JI0E 1PDAA 1PKPA 4F9AB 1KTVA 2Q8UA 4PRVA 2JOBA 4DR2I 4OKGA 5DNXA 4X65I 3PS2A 2A25A 2WBUA 4AQYE 2EPNA 1UBDC 4MU1A 2HHHI 5A69A 2EOMA 3QT5A 4ISAA 4DV0I 3Q6MA 4BC9A 3H1CA 3L7ZB 2ENAA 4WFTA 1YYWA 1ZU1A 2L92A 4DUYI 4IFDA 2EOJA 4USKA 4DV0E 2PO0A 3WU6A 2EORA 1UDQA 4IZJD 4DV7E 2IERA 4OOGC 4B3RE 5DRQA 2VE7C 4U3DA 2EWLA 4AIDA 2L8TA 1WHQA 2HK2A 5C0XA 2FTXB 3WU4A 4HY1A 3LMLA 2PO2A 5DRRA 1N32E 2K7IA 4JI4E 2N3HA 2BBGA 4OO1E 2L2NA 1X47A 1N3GA 2EM7A 5T6JA 4LCGA 4R2AA 2JPAA 2ODRC 1Z5AA 1IBKE 2EM8A 2EPLX 4QNJA 1EH8A 1YYKA 2VQEI 4NBQA 1YSAC 2DEIA 3C4TA 2BV3A 2F1DA 3HKMA 4LF4I 2WBSA 4FN5A 2PNZB 1P42A 1N34E 4IFDB 1XNRI 4ZVIA 1VISA 1KKHA 4GKKE 2PNLA 1H7SA 3MHSC 1YHCA 1MEYC 4JYAE 4LFBI 5KL3A 1PIEA 1WUUA 2NN6D 4HACB 4BA2A 4DR7I 4NXNI 1TN9A 4FW5A 1G2FC 1B62A 1FWKA 3J7AM 2EM6A 2CGEA 2L2KB 3T1HE 2JOXA 2UXBI 2PRTA 2IHR1 4DV6I 2RPCA 2YU5A 1Y4SA 1N36I 2BR2B 4X64E 5A6BA 2ZM6I 2YTDA 4DV6E 2LUQA 4JI6E 1T38A 2LJUA 2ZM6E 4GEQB 2J65A 3EPHA 3K17A 1L4SA 2K4VA 1A1HA 5KL4A 2EPCA 5DRPA 2C39B 2C37A 2FGGA 2EMGA 4MLVA 2LE2A 3D4JA 2BM0A 4BMJA 2LV2A 2V86A 2L3CA 1K47A 3IWDA 2YPNA 1GTKA 2L2MA 4R2EA 1DARA 2JYAA 1GQEA 3THNA 4FW9A 4IFDE 2C38B 5JEAA 1WXRA 2JEBA 4HXZA 5LMNI 2F4VI 3HXLA 2O3ZA 4IS9A 2PO1A 4GKJI 2DSYA 2DLQA 2L33A 3FIGA 2JY9A 5C0XE 1PVGA 1PJQA 1BB8A 4LFCI 2DMYA 2LCEA 4DPYA 4LF6I 5DROA 4IS1C 2Z5BA 3ZM7A 5K36D 2YRMA 5LMUI 2UUCI 2V89A 2ELZA 1BBOA 2Z5CA 3ZZUA 1WHNA 4DR1E 2JR1A 3P3EA 4U3BA 2WCC3 3K1JA 4Q35B 1FNMA 3OMLA 1XNQI 2UUCE 1H73A 1JK1A 2WNRA 1EA6A 2JXPA 3PYDA 2EPUA 2MC6A 1XXEA 3B8HA 2JEAA 2M1SA 2V83A 4BS9A 4KHPE 3CDJA 4Z7YA 4X8WA 1J5EE 1XMOI 2F8BA 4J3DA 4OO1A 2EN1A 2UUAI 4EMDA 1FJGE 4DV3E 1YH8A 2HKEA 4R2CA 1GZ6A 3KZZA 1XMOE 2NN6C 4X66E 4IFDF 2EP3A 1YPNA 1NHJA 4DR4I 1Z5CA 4P7DA 2EPZA 3L00A 2EMFA 3PYGA 4DUZI 2LBSB 2I13A 4DV2I 4LF8I 4FWDA 1A1GA 1OYSA 2EN8A 1Z1BA 4KQVA 1DGCA 4MYTA 1WRJA 5GMEA 4JI5I 4LCFA 3BIDA 5KL7A 4DV2E 4LF8E 2BA1G 2O1UA 4DMIA 4WSGA 5ELWA 1Y6ZA 2EOSA 4M2ZA 3LPSA 2EPMX 4FW6A 2LVHA 2EPRA 5LLQA 4R8OA 4JI0I 3EQ1A 2Z5EA 1Z0GA 1X48A 2EN2A 4FW4A 2KONA 3P3GA 2NN6F 2O1WA 5GMDA 5JEAE 3THOB 1X6HA 4F54A 2YTGA 3EPLA 2WP8A 2PO0B 4WXCA 1I94E 4TUGA 2EN3A 2EOFA 2EJ4A 4R2DA 2AJ4A 3CWVA 4LF5E 4RPFA 1N0UA 3V2UC 4X9JA 1ELOA 1PJTA 2ZITA 4LOMA 3KZYA 2DB2A 1DI2A 1UILA 1N0VC 3GONA 4ED4A 4DV7I 5C0XB 4B3RI 1USVA 4O43A 4DXLA 1A1KA 4DR5E 2IESA 2PO2B 5K36C 2EM5A 2LTRA 2EOQA 2EMCA 1ZM9A 3EPKA 2EMWA 2YTJA 2N8XA 1ZXMA 1X5WA 2GHFA 3M99B 4MLQA 2LUPB 4JV5E 3QT6A 4UTGA 4I8OA 1NEIA 1IBME 1XHKA 3DJWA 3BGHA 2V34A 3GLLA 2E1MA 4JI4I 4HTGA 4LU9A 4IZJA 5IT9C 2YSOA 3LTOA 5AE1A 2VF1A 4R03A 4LF9E 2PNMA 1IBKI 3J81C 3HULA 4IFDD 3M6AA 4DKKA 4JI8E 4R2SA 2BA0D 1J26A 4FWGA 3J7AG 4FK5C 4B3SI 2R1FA 2RS7A 5IXMB 1ZAAC 1MGTA 2GPIA 3H4LA 2ENCA 1N34I 4B3SE 2KHXA 5C0XD 4DV4E 4BA2B 2CPNA 4ZYEA 1N33E 4GKKI 2DGCA 2YRKA 1E3PA 4JYAI 2KOUA 2RSMA 1NCSA 3JAMC 4K0KE 4DPTA 5K36F 1ZM4A 3PYFA 5IWAI 2EM4A 3ADIA 1O0WA 3T1HI 1ZBTA 4IZKA 4UT4A 2YTEA 4DR3E 1H72C 3U1KA 5F3WA 5IWAE 3H09A 1KJKA 4DV1E 1UDOA 4P78A 4KWYA 1VI7A 4YHHE 2V2QA 2EMYA 3PRYA 2LMZA 1HK7A 1NHHA 4X64I 1HR0I 1Y60A 2HC5A 4N4RB 1A1IA 1OYRA 3T1YI 4JI3I 2NN6A 5ADZA 2V85A 1UDNA 2CTDA 4NXME 4N3OA 4Z7CA 2ZBKB 1HR0E 4JI6I 2C37B 2NUFA 3T1YE 4JI3E 2EFGA 4WYQB 3VHTB 2R3VA 3K6QA 1JK2A 3Q6NA 2GS8A 1KVKA 4R2PA 2WZOA 3C6MA 1TF3A 4P52A 5A6KA 5JEAB 2JP9A 1R6LA 2JEBB 2MDRA 2EMZA 2PO1B 4FWHA 4WSPA 1Z0VA 1S16A 4QNKA 1QNTA 1B63A 2DEJA 2V88A 4HEIA 4R1FA 4MYUA 2M7QA 2Z5BB 2NA2A 2R76A 1T39A 3MHHC 5A6AA 2Z5CB 2ENHA 3ECRA 4B3ME 2D9HA 1EH7A 5KL6A 3DF6A 4GZNC 4LF7E 1ZR9A 2UU9I 2WNRB 2RS6A 4O24A 5LL6R 2J7JA 4KZSA 4DR1I 2VF3A 2EMXA 3HJCA 4JI2E 3J80Q 4LCHA 2JEAB 4IFDC 2UU9E 3ZOQB 1Z0BA 3V5RA 5JEAD 2JWOA 1R6MA 2VESA 4OO1B 4WUBA 3OTOE 1EH6A 1Z59A 4KHPI 1HNZE 1MG7A 1J5EI 5K36A 4WPYA 5C0XC 3PS1A 1FJGI 1Z0CA 2EMKA 4DV3I 2JVAA 2EOOA 2HFSA 4DR6E 4I3HA 1Y4UA
chains in the Genus database with same CATH topology
5FLXC 4X66I 5AE2A 5IT9Q 1MU5A 3ADJA 1A6FA 2O1VA 3J81Q 2V87A 3HPZA 4JI7E 3P1XA 1EI1A 5BR8I 2A2DA 1T4OA 2B3TB 2M4IA 2XEXA 5DNYA 2WW4A 2DIXA 4M30A 5L3JA 5BR8E 1STUA 3JAMQ 3B78A 4URLA 2CZ9A 3AUZA 5FWKA 4DPUA 1FWLA 1SR9A 1USUA 3PYEA 1UEKA 4M0VA 4DV5E 5AASA 2V8PA 1I94I 1HNXE 4LF5I 2E5LE 1BKNA 2UXCE 4BC7A 2G7HA 1EKZA 4DPWA 3J80C 4DR5I 2R42A 2EZ6A 4YY3I 4B3TE 4P7AA 2UXDE 1ZM3A 3ZKBA 2B7TA 3IWBA 1FI4A 4JI1E 4YY3E 3F0NA 4IZJB 4JV5I 2A2CA 1IBMI 3ZZTA 1QZRA 2FV4B 1Z0WA 2VQFE 4LF9I 2Q2EB 4Q28A 2NUEA 4JI8I 1D6TA 1FKAE 3LNUA 2UUBE 1DQ3A 4DV4I 2NUGA 1IBLI 2V2ZA 5CFFE 2H36X 4DR2E 4X65E 1N33I 4BBYA 2HHHE 2N3GA 1RR9A 1Z5BA 4K0KI 2GQ0A 1HNWI 1IBLE 4IZKB 1MX0A 3VYYA 4DUYE 1HNWE 4BCAA 4DR3I 2LJHA 4TUIA 4DV1I 4YHHI 3ZKDA 2B9DA 5FLXQ 1T4NA 1X49A 2OI2A 2V8QB 4J8ZA 3J7Yp 3ZZ0A 4NXMI 4WUCA 1U2RA 2HK3A 3HTXA 4LTYA 1NZ0A 2V2VA 1YYOA 1ZXNA 2VQEE 3LLHA 4LF4E 4DPXA 4PRXA 4XTJA 3P06A 1XNRE 1H7UA 1Z0TA 4PU9A 2IOQA 4LFBE 4B3MI 4DR7E 1S4EA 4LF7I 2B7VA 4NXNE 3F6GA 2L3JA 3JTZA 3ADLA 1OJ4A 2LTSA 3QT7A 4HACA 2UXBE 4JI2I 2MC5A 2RTXA 3WU3A 2BM1A 1N36E 3HPSA 3Q1QA 3OTOI 2J7KA 3K85A 1HNZI 1NHIA 2L6MA 4F9CB 2HFUA 4L8NA 5AE3A 3VK6A 4DR6I 4HYMA 2CG9A 3WU5A 3JU0A 1ZBQA 4LFCE 5A2QQ 1XMQE 4X62I 4JG4A 4LFAI 3HQ1A 2F4VE 5LMNE 4X62E 2LJPA 4GKJE 4JI7I 4LFAE 3AV0A 1H74A 2X36A 4LF6E 2IOPA 3F6HA 5LMUE 2HKJA 2E1RA 3B82A 3MSWA 4OX9I 1XNQE 2O1TA 1RC7A 2YT4A 2LRSA 3KWRA 4OX9E 4L5NC 4DV5I 3VYXA 2ODRD 2UUAE 1RREA 1HNXI 2E5LI 2UXCI 2YZTA 3IWCA 4WUDA 4B3TI 4DR4E 1KIJA 4DU7A 2UXDI 1T4LB 3QT8A 4JI1I 1Z0EA 4F9BB 1YZ9A 4DUZE 4DU8A 1QU6A 3RMPA 2VQFI 4JI5E 1UHZA 3C4BA 4USMA 2NPFA 5A2QC 1RQ0A 2UUBI 1ZM2A 4AQYI 2X7IA 3ADGA 4JI0E 1PKPA 4F9AB 1KTVA 4PRVA 2JOBA 4DR2I 4X65I 4AQYE 2HHHI 3QT5A 4DV0I 3Q6MA 4BC9A 4WFTA 1YYWA 2L92A 4DUYI 4USKA 4DV0E 3WU6A 4IZJD 4DV7E 4OOGC 4B3RE 2VE7C 2EWLA 2L8TA 1WHQA 2HK2A 2FTXB 4HY1A 3LMLA 1N32E 4JI4E 2N3HA 2L2NA 1X47A 5T6JA 2ODRC 1Z5AA 1IBKE 1YYKA 2VQEI 2DEIA 3C4TA 2BV3A 4LF4I 4FN5A 1N34E 1XNRI 4ZVIA 1VISA 1KKHA 4GKKE 2PNLA 1H7SA 4JYAE 4LFBI 4HACB 1PIEA 1WUUA 4DR7I 4NXNI 1B62A 1FWKA 3J7AM 2CGEA 2L2KB 3T1HE 2JOXA 2UXBI 4DV6I 2IHR1 1Y4SA 1N36I 4X64E 2ZM6I 4DV6E 2LUQA 4JI6E 2ZM6E 4GEQB 3K17A 2K4VA 2FGGA 4LFCI 2LE2A 3ZM7A 3D4JA 2BM0A 4BMJA 1K47A 2V86A 2L3CA 4M1KA 3IWDA 1XMQI 2L2MA 1DARA 1GQEA 4FW9A 1WXRA 4HXZA 2F4VI 5LMNI 3HXLA 4GKJI 2DSYA 2L33A 3FIGA 2JY9A 1PVGA 2DMYA 4DPYA 4LF6I 2Z5BA 5LMUI 2UUCI 2V89A 3ZZUA 2Z5CA 1WHNA 4DR1E 2JR1A 3K1JA 1FNMA 3OMLA 1XNQI 2UUCE 1H73A 1EA6A 3PYDA 2MC6A 3B8HA 2M1SA 2V83A 4BS9A 4KHPE 4Z7YA 4X8WA 1J5EE 1XMOI 2F8BA 2UUAI 4EMDA 1FJGE 4DV3E 2HKEA 1GZ6A 1XMOE 4X66E 1NHJA 4DR4I 1Z5CA 4P7DA 3PYGA 4DUZI 2LBSB 4DV2I 4LF8I 4FWDA 4KQVA 4MYTA 5GMEA 4JI5I 4DV2E 4LF8E 2O1UA 4DMIA 1Y6ZA 4M2ZA 3LPSA 4R8OA 4JI0I 2Z5EA 1Z0GA 1X48A 2KONA 2O1WA 5GMDA 4F54A 1I94E 4TUGA 2AJ4A 3CWVA 4LF5E 4RPFA 1N0UA 3V2UC 1ELOA 2ZITA 2DB2A 1DI2A 1UILA 1N0VC 3GONA 4ED4A 4DV7I 4B3RI 1USVA 4DXLA 4DR5E 2LTRA 1ZM9A 1ZXMA 2LUPB 4JV5E 4UTGA 1N32I 3QT6A 4I8OA 1XHKA 1IBME 2V34A 3DJWA 4JI4I 2E1MA 4LU9A 4IZJA 5IT9C 3LTOA 5AE1A 2VF1A 4R03A 4LF9E 2PNMA 1IBKI 3J81C 3HULA 3M6AA 4DKKA 4JI8E 4FWGA 1J26A 3J7AG 4B3SI 2RS7A 3H4LA 1N34I 4B3SE 2KHXA 4DV4E 2CPNA 1N33E 4GKKI 4JYAI 2KOUA 2RSMA 3JAMC 4K0KE 4DPTA 1ZM4A 3PYFA 5IWAI 3ADIA 1O0WA 3T1HI 1ZBTA 4IZKA 4UT4A 4DR3E 1H72C 5F3WA 5IWAE 3H09A 4DV1E 3WU4A 4P78A 3PRYA 4YHHE 2V2QA 4X64I 2LMZA 1HK7A 1NHHA 1HR0I 3T1YI 4JI3I 5ADZA 2V85A 4JI6I 4NXME 4N3OA 4Z7CA 2ZBKB 1HR0E 2NUFA 3T1YE 4JI3E 2EFGA 4WYQB 2R3VA 3K6QA 3Q6NA 2GS8A 1KVKA 2WZOA 4P52A 2MDRA 4FWHA 4WSPA 1Z0VA 1S16A 1B63A 2DEJA 2V88A 4R1FA 4MYUA 2M7QA 2Z5BB 2NA2A 2Z5CB 4B3ME 3DF6A 4LF7E 2UU9I 2RS6A 5LL6R 4KZSA 4DR1I 2VF3A 3HJCA 4JI2E 3J80Q 2UU9E 3ZOQB 1Z0BA 3V5RA 2JWOA 4WUBA 3OTOE 1Z59A 4KHPI 1HNZE 1MG7A 1J5EI 4WPYA 1FJGI 1Z0CA 4DV3I 2JVAA 2HFSA 4DR6E 4I3HA 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 I;  5FLX C;  5IT9 Q;  1MU5 A;  3ADJ A;  1A6F A;  3J81 Q;  4JI7 E;  3P1X A;  1EI1 A;  5BR8 I;  2A2D A;  1T4O A;  2B3T B;  2XEX A;  2WW4 A;  2DIX A;  4M30 A;  5L3J A;  5BR8 E;  1STU A;  3JAM Q;  3B78 A;  4URL A;  2CZ9 A;  4DPU A;  1FWL A;  3PYE A;  1UEK A;  4DV5 E;  2V8P A;  1I94 I;  1HNX E;  4LF5 I;  2E5L E;  1BKN A;  2UXC E;  1EKZ A;  4DPW A;  3J80 C;  4DR5 I;  2R42 A;  2EZ6 A;  4YY3 I;  4B3T E;  4P7A A;  2UXD E;  1ZM3 A;  3ZKB A;  2B7T A;  1FI4 A;  4JI1 E;  4YY3 E;  3F0N A;  4JV5 I;  2A2C A;  1IBM I;  3ZZT A;  1QZR A;  1Z0W A;  2VQF E;  4LF9 I;  2Q2E B;  2NUE A;  4JI8 I;  1D6T A;  1FKA E;  3LNU A;  2UUB E;  4DV4 I;  2NUG A;  1IBL I;  2V2Z A;  5CFF E;  4DR2 E;  4X65 E;  1N33 I;  2HHH E;  2N3G A;  1RR9 A;  1Z5B A;  4K0K I;  1HNW I;  1IBL E;  1MX0 A;  3VYY A;  4DUY E;  1HNW E;  4DR3 I;  2LJH A;  4DV1 I;  4YHH I;  3ZKD A;  5FLX Q;  1T4N A;  1X49 A;  2OI2 A;  3J7Y p;  3ZZ0 A;  4NXM I;  4WUC A;  1U2R A;  2HK3 A;  3HTX A;  1NZ0 A;  2V2V A;  1YYO A;  1ZXN A;  2VQE E;  3LLH A;  4LF4 E;  4DPX A;  4PRX A;  4XTJ A;  1XNR E;  1H7U A;  1Z0T A;  4PU9 A;  4LFB E;  4B3M I;  4DR7 E;  1S4E A;  4LF7 I;  2B7V A;  4NXN E;  2L3J A;  3ADL A;  1OJ4 A;  2LTS A;  3QT7 A;  4HAC A;  2UXB E;  4JI2 I;  2RTX A;  3WU3 A;  2BM1 A;  1N36 E;  3Q1Q A;  3OTO I;  2J7K A;  1HNZ I;  1NHI A;  2HFU A;  4DR6 I;  4HYM A;  3WU5 A;  4LFC E;  5A2Q Q;  1XMQ E;  4X62 I;  4JG4 A;  4LFA I;  2F4V E;  5LMN E;  4X62 E;  2LJP A;  4GKJ E;  4JI7 I;  4LFA E;  1H74 A;  2X36 A;  4LF6 E;  5LMU E;  2HKJ A;  2E1R A;  3B82 A;  4OX9 I;  1XNQ E;  1RC7 A;  2YT4 A;  2LRS A;  4OX9 E;  4DV5 I;  3VYX A;  2UUA E;  1RRE A;  1HNX I;  2E5L I;  2UXC I;  4WUD A;  4B3T I;  4DR4 E;  1KIJ A;  4DU7 A;  2UXD I;  1T4L B;  3QT8 A;  4JI1 I;  1Z0E A;  1YZ9 A;  4DUZ E;  4DU8 A;  1QU6 A;  2VQF I;  4JI5 E;  1UHZ A;  3C4B A;  4USM A;  2NPF A;  5A2Q C;  1RQ0 A;  2UUB I;  1ZM2 A;  4AQY I;  2X7I A;  3ADG A;  4JI0 E;  1PKP A;  1KTV A;  4PRV A;  4DR2 I;  4X65 I;  4AQY E;  2HHH I;  3QT5 A;  4DV0 I;  4WFT A;  1YYW A;  4DUY I;  4USK A;  4DV0 E;  3WU6 A;  4DV7 E;  4OOG C;  4B3R E;  1WHQ A;  2HK2 A;  4HY1 A;  1N32 E;  4JI4 E;  2N3H A;  2L2N A;  1X47 A;  1Z5A A;  1IBK E;  1YYK A;  2VQE I;  2DEI A;  3C4T A;  2BV3 A;  4LF4 I;  4FN5 A;  1N34 E;  1XNR I;  4ZVI A;  1VIS A;  1KKH A;  4GKK E;  1H7S A;  4JYA E;  4LFB I;  4HAC B;  1PIE A;  1WUU A;  4DR7 I;  4NXN I;  1B62 A;  1FWK A;  3J7A M;  2L2K B;  3T1H E;  2UXB I;  4DV6 I;  2IHR 1;  1N36 I;  4X64 E;  2ZM6 I;  4DV6 E;  2LUQ A;  4JI6 E;  2ZM6 E;  3K17 A;  4LFC I;  3ZM7 A;  3D4J A;  2BM0 A;  1K47 A;  4M1K A;  1XMQ I;  2L3C A;  2L2M A;  1DAR A;  1GQE A;  4FW9 A;  4HXZ A;  2F4V I;  5LMN I;  4GKJ I;  2L33 A;  2JY9 A;  1PVG A;  2DMY A;  4DPY A;  4LF6 I;  5LMU I;  2UUC I;  3ZZU A;  1WHN A;  4DR1 E;  3K1J A;  1FNM A;  1XNQ I;  2UUC E;  1H73 A;  1EA6 A;  3PYD A;  3B8H A;  4KHP E;  4Z7Y A;  4X8W A;  1J5E E;  1XMO I;  2UUA I;  4EMD A;  1FJG E;  4DV3 E;  2HKE A;  1XMO E;  4X66 E;  1NHJ A;  4DR4 I;  1Z5C A;  3PYG A;  4DUZ I;  2LBS B;  4DV2 I;  4LF8 I;  4FWD A;  4KQV A;  4MYT A;  5GME A;  4JI5 I;  4DV2 E;  4LF8 E;  4M2Z A;  3LPS A;  4JI0 I;  1Z0G A;  1X48 A;  5GMD A;  1I94 E;  2AJ4 A;  3CWV A;  4LF5 E;  4RPF A;  1N0U A;  1ELO A;  2ZIT A;  2DB2 A;  1DI2 A;  1UIL A;  1N0V C;  3GON A;  4ED4 A;  4DV7 I;  4B3R I;  4DXL A;  4DR5 E;  2LTR A;  1ZM9 A;  1ZXM A;  2LUP B;  4JV5 E;  4UTG A;  1N32 I;  3QT6 A;  4JI4 I;  1XHK A;  1IBM E;  2V34 A;  5IT9 C;  3LTO A;  4LF9 E;  1IBK I;  3HUL A;  3J81 C;  3M6A A;  4DKK A;  4JI8 E;  4FWG A;  1J26 A;  3J7A G;  4B3S I;  2RS7 A;  3H4L A;  1N34 I;  4B3S E;  2KHX A;  4DV4 E;  2CPN A;  1N33 E;  4GKK I;  4JYA I;  2RSM A;  3JAM C;  4K0K E;  4DPT A;  1ZM4 A;  3PYF A;  5IWA I;  3ADI A;  1O0W A;  3T1H I;  1ZBT A;  4UT4 A;  4DR3 E;  1H72 C;  5IWA E;  4DV1 E;  3WU4 A;  4YHH E;  2V2Q A;  4X64 I;  1HR0 I;  1NHH A;  3T1Y I;  4JI3 I;  4JI6 I;  4NXM E;  4Z7C A;  2ZBK B;  1HR0 E;  2NUF A;  3T1Y E;  4JI3 E;  2EFG A;  4WYQ B;  2R3V A;  2GS8 A;  1KVK A;  4P52 A;  2MDR A;  4FWH A;  1Z0V A;  1S16 A;  1B63 A;  2DEJ A;  4R1F A;  4MYU A;  2NA2 A;  4B3M E;  4LF7 E;  2UU9 I;  2RS6 A;  5LL6 R;  4DR1 I;  2VF3 A;  4JI2 E;  3J80 Q;  2UU9 E;  1Z0B A;  3V5R A;  4WUB A;  3OTO E;  1Z59 A;  4KHP I;  1HNZ E;  1MG7 A;  1J5E I;  1FJG I;  1Z0C A;  4DV3 I;  2JVA A;  2HFS A;  4DR6 E;  4I3H A;  3V2U C; 
#chains in the Genus database with same CATH topology
 1IQO A;  5FLX C;  4X66 I;  5AE2 A;  3M7N G;  5IT9 Q;  2RSI A;  1MU5 A;  3ADJ A;  1A6F A;  2O1V A;  3J81 Q;  2V87 A;  1SFE A;  1YUI A;  2EPX A;  3HPZ A;  2EOI A;  4JI7 E;  4BA1 A;  4FW3 A;  3P1X A;  2E72 A;  1EI1 A;  4O5G A;  5BR8 I;  2A2D A;  4OO1 D;  1T4O A;  4M1K A;  2B3T B;  2M4I A;  4M9V C;  2EM3 A;  2NN6 E;  2XEX A;  5DNY A;  2WW4 A;  2DIX A;  4M30 A;  2EML A;  5L3J A;  4NZV A;  5BR8 E;  1STU A;  2CVE A;  3B78 A;  3JAM Q;  3KRN A;  4URL A;  2CZ9 A;  2EM0 A;  2LT7 A;  5AC4 A;  2YTP A;  3AUZ A;  5AC5 A;  4DPU A;  5FWK A;  2BB8 A;  2WP8 B;  1FWL A;  1SR9 A;  1USU A;  3PYE A;  3P3C A;  1UEK A;  4M0V A;  2NAB A;  1A1F A;  4DV5 E;  4MU0 A;  5AAS A;  2V8P A;  5KL2 A;  4GQU A;  1I94 I;  3NZK A;  1HNX E;  4LF5 I;  2E5L E;  1BKN A;  2HGH A;  2UXC E;  2EPP A;  4BC7 A;  2G7H A;  1EKZ A;  4DPW A;  3M7N D;  3J80 C;  1N32 I;  2EOE A;  2EOZ A;  2EZ6 A;  2R42 A;  4YY3 I;  4DR5 I;  4B3T E;  1G2D C;  4ZYD A;  2UXD E;  4P7A A;  1ZM3 A;  3ZKB A;  2EPK X;  2B7T A;  3IWB A;  1FI4 A;  2EQ1 A;  4YY3 E;  4JI1 E;  3F0N A;  4IZJ B;  2CSH A;  4MU3 A;  4JV5 I;  2A2C A;  5JEA C;  1IBM I;  3ZZT A;  2CT1 A;  1QZR A;  3GCM A;  2M9A A;  2FV4 B;  1Z0W A;  3M85 G;  2VQF E;  2EM9 A;  3EPJ A;  4LF9 I;  2JE6 A;  2EOX A;  5K36 E;  2Q2E B;  3GME A;  4Q28 A;  2NUE A;  4JI8 I;  1YUJ A;  1D6T A;  1FKA E;  1X3C A;  1A1J A;  2BA1 D;  3LNU A;  2UUB E;  1DQ3 A;  4DV4 I;  2NUG A;  1X6E A;  1IBL I;  2V2Z A;  4MDT A;  5CFF E;  2H36 X;  4DR2 E;  4X65 E;  1XMQ I;  4BBY A;  1N33 I;  2YWQ A;  1LLM C;  2HHH E;  2N3G A;  5IV8 B;  1RR9 A;  1Z5B A;  4K0K I;  2GQ0 A;  1HNW I;  1IBL E;  4IZK B;  1MX0 A;  3VYY A;  4DUY E;  5DNL A;  1HNW E;  4OO1 C;  3UHM A;  2EOH A;  3L7Z A;  4BCA A;  4F2J C;  2NN6 B;  2LJH A;  3P76 A;  5JEA F;  4TUI A;  4DR3 I;  2YTN A;  4DV1 I;  4YHH I;  2EE8 A;  2B9D A;  3ZKD A;  2DRP A;  1T4N A;  5FLX Q;  4RHB B;  1X49 A;  2OI2 A;  2V8Q B;  4J8Z A;  3J7Y p;  3ZZ0 A;  4NXM I;  4WUC A;  1U2R A;  2HK3 A;  3HTX A;  1KYQ A;  5KL5 A;  3M85 D;  4LTY A;  1TF6 A;  2HJJ A;  3BF2 A;  1NZ0 A;  2V2V A;  3C6K A;  2YTF A;  1YYO A;  2ELY A;  1ZXN A;  2VQE E;  2ADR A;  3LLH A;  1YFH A;  4LF4 E;  4PRX A;  4DPX A;  4XTJ A;  3P06 A;  1XNR E;  4LPF A;  1H7U A;  4OO1 F;  1Z0T A;  4O4K A;  5A6B D;  1RMD A;  4PU9 A;  2PNZ A;  2IOQ A;  4LFB E;  4B3M I;  4DR7 E;  1S4E A;  4LF7 I;  2B7V A;  4NXN E;  3F6G A;  2L3J A;  3JTZ A;  3ADL A;  1OJ4 A;  2LTS A;  2YU8 A;  2VRD A;  3QT7 A;  4HAC A;  2UXB E;  4JI2 I;  2MC5 A;  2EPA A;  5A6J A;  2RTX A;  4MU4 A;  2BM1 A;  1N36 E;  3HPS A;  3WU3 A;  4OZE A;  5EKW A;  3Q1Q A;  5K36 B;  1UN6 B;  3OTO I;  2J7K A;  2YTO A;  3K85 A;  1HNZ I;  4IJD A;  1NHI A;  1E3H A;  1UDS A;  2L6M A;  2EQ0 A;  4F9C B;  4ZYH A;  2YRH A;  2BR2 A;  2HFU A;  4MQY A;  4AM3 A;  3B4T A;  4L8N A;  5AE3 A;  4F6N A;  2MKD A;  3PS3 A;  3U1Y A;  3QG5 C;  3VK6 A;  4DR6 I;  2EL5 A;  4HYM A;  2CG9 A;  3WU5 A;  3JU0 A;  4ZYG A;  2AE8 A;  1ZBQ A;  4LFC E;  5A2Q Q;  1IQS A;  4RH8 A;  3UK3 C;  1XMQ E;  4BA1 B;  4X62 I;  4JG4 A;  4LFA I;  3HQ1 A;  2EL4 A;  2C39 A;  2EN4 A;  2EQ3 A;  2F4V E;  5LMN E;  2DMI A;  2EMA A;  4X62 E;  1AH5 A;  4GKJ E;  2LJP A;  4JI7 I;  4LFA E;  3AV0 A;  1B69 A;  2C38 A;  2JT2 A;  1H74 A;  1BBG A;  2YTI A;  2RQL A;  4NHR A;  2X36 A;  4LF6 E;  2IOP A;  3F6H A;  5LMU E;  2EM2 A;  2LO3 A;  1Y5Y A;  2E1R A;  2EOY A;  2HKJ A;  3B82 A;  4FW7 A;  1AAY A;  3MSW A;  2GO3 A;  2MDG A;  2GO4 A;  4OX9 I;  1XNQ E;  2GLI A;  2YSP A;  3BBG A;  2O1T A;  1RC7 A;  1WJP A;  2YT4 A;  2LRS A;  4BHC A;  3KWR A;  2EN6 A;  5C0X F;  4OX9 E;  4L5N C;  2EL6 A;  3DD6 A;  4DV5 I;  3VYX A;  2ODR D;  2YTQ A;  2UUA E;  1RRE A;  1HNX I;  4AIM A;  1X6F A;  1IMU A;  2E5L I;  2UXC I;  2YZT A;  3CDI A;  3IWC A;  5TSE A;  2EMH A;  4WUD A;  4R2Q A;  2MKN A;  4B3T I;  4DR4 E;  1KIJ A;  4DU7 A;  2UXD I;  2EPO A;  1PJS A;  3TQM A;  1T4L B;  3QT8 A;  2DLK A;  1Z0E A;  4F9B B;  4JI1 I;  1YZ9 A;  4DUZ E;  2JE6 B;  4DU8 A;  1QU6 A;  3RMP A;  2BA0 G;  2EMI A;  2VQF I;  4JI5 E;  1RHY A;  4BHB A;  1UHZ A;  3C4B A;  1P47 A;  2EN7 A;  1F2I G;  5EL9 A;  4USM A;  2NPF A;  5A2Q C;  4F6M A;  4WXD A;  1A1L A;  1OYP A;  1RQ0 A;  2EMB A;  4R2R A;  4WX9 A;  1ZM2 A;  2UUB I;  2WBT A;  4AQY I;  2X7I A;  2I9I A;  3ADG A;  4JI0 E;  1PDA A;  1PKP A;  4F9A B;  1KTV A;  2Q8U A;  4PRV A;  2JOB A;  4DR2 I;  4OKG A;  5DNX A;  4X65 I;  3PS2 A;  2A25 A;  2WBU A;  4AQY E;  2EPN A;  1UBD C;  4MU1 A;  2HHH I;  5A69 A;  2EOM A;  3QT5 A;  4ISA A;  4DV0 I;  3Q6M A;  4BC9 A;  3H1C A;  3L7Z B;  2ENA A;  4WFT A;  1YYW A;  1ZU1 A;  2L92 A;  4DUY I;  4IFD A;  2EOJ A;  4USK A;  4DV0 E;  2PO0 A;  3WU6 A;  2EOR A;  1UDQ A;  4IZJ D;  4DV7 E;  2IER A;  4OOG C;  4B3R E;  5DRQ A;  2VE7 C;  4U3D A;  2EWL A;  4AID A;  2L8T A;  1WHQ A;  2HK2 A;  5C0X A;  2FTX B;  3WU4 A;  4HY1 A;  3LML A;  2PO2 A;  5DRR A;  1N32 E;  2K7I A;  4JI4 E;  2N3H A;  2BBG A;  4OO1 E;  2L2N A;  1X47 A;  1N3G A;  2EM7 A;  5T6J A;  4LCG A;  4R2A A;  2JPA A;  2ODR C;  1Z5A A;  1IBK E;  2EM8 A;  2EPL X;  4QNJ A;  1EH8 A;  1YYK A;  2VQE I;  4NBQ A;  1YSA C;  2DEI A;  3C4T A;  2BV3 A;  2F1D A;  3HKM A;  4LF4 I;  2WBS A;  4FN5 A;  2PNZ B;  1P42 A;  1N34 E;  4IFD B;  1XNR I;  4ZVI A;  1VIS A;  1KKH A;  4GKK E;  2PNL A;  1H7S A;  3MHS C;  1YHC A;  1MEY C;  4JYA E;  4LFB I;  5KL3 A;  1PIE A;  1WUU A;  2NN6 D;  4HAC B;  4BA2 A;  4DR7 I;  4NXN I;  1TN9 A;  4FW5 A;  1G2F C;  1B62 A;  1FWK A;  3J7A M;  2EM6 A;  2CGE A;  2L2K B;  3T1H E;  2JOX A;  2UXB I;  2PRT A;  2IHR 1;  4DV6 I;  2RPC A;  2YU5 A;  1Y4S A;  1N36 I;  2BR2 B;  4X64 E;  5A6B A;  2ZM6 I;  2YTD A;  4DV6 E;  2LUQ A;  4JI6 E;  1T38 A;  2LJU A;  2ZM6 E;  4GEQ B;  2J65 A;  3EPH A;  3K17 A;  1L4S A;  2K4V A;  1A1H A;  5KL4 A;  2EPC A;  5DRP A;  2C39 B;  2C37 A;  2FGG A;  2EMG A;  4MLV A;  2LE2 A;  3D4J A;  2BM0 A;  4BMJ A;  2LV2 A;  2V86 A;  2L3C A;  1K47 A;  3IWD A;  2YPN A;  1GTK A;  2L2M A;  4R2E A;  1DAR A;  2JYA A;  1GQE A;  3THN A;  4FW9 A;  4IFD E;  2C38 B;  5JEA A;  1WXR A;  2JEB A;  4HXZ A;  5LMN I;  2F4V I;  3HXL A;  2O3Z A;  4IS9 A;  2PO1 A;  4GKJ I;  2DSY A;  2DLQ A;  2L33 A;  3FIG A;  2JY9 A;  5C0X E;  1PVG A;  1PJQ A;  1BB8 A;  4LFC I;  2DMY A;  2LCE A;  4DPY A;  4LF6 I;  5DRO A;  4IS1 C;  2Z5B A;  3ZM7 A;  5K36 D;  2YRM A;  5LMU I;  2UUC I;  2V89 A;  2ELZ A;  1BBO A;  2Z5C A;  3ZZU A;  1WHN A;  4DR1 E;  2JR1 A;  3P3E A;  4U3B A;  2WCC 3;  3K1J A;  4Q35 B;  1FNM A;  3OML A;  1XNQ I;  2UUC E;  1H73 A;  1JK1 A;  2WNR A;  1EA6 A;  2JXP A;  3PYD A;  2EPU A;  2MC6 A;  1XXE A;  3B8H A;  2JEA A;  2M1S A;  2V83 A;  4BS9 A;  4KHP E;  3CDJ A;  4Z7Y A;  4X8W A;  1J5E E;  1XMO I;  2F8B A;  4J3D A;  4OO1 A;  2EN1 A;  2UUA I;  4EMD A;  1FJG E;  4DV3 E;  1YH8 A;  2HKE A;  4R2C A;  1GZ6 A;  3KZZ A;  1XMO E;  2NN6 C;  4X66 E;  4IFD F;  2EP3 A;  1YPN A;  1NHJ A;  4DR4 I;  1Z5C A;  4P7D A;  2EPZ A;  3L00 A;  2EMF A;  3PYG A;  4DUZ I;  2LBS B;  2I13 A;  4DV2 I;  4LF8 I;  4FWD A;  1A1G A;  1OYS A;  2EN8 A;  1Z1B A;  4KQV A;  1DGC A;  4MYT A;  1WRJ A;  5GME A;  4JI5 I;  4LCF A;  3BID A;  5KL7 A;  4DV2 E;  4LF8 E;  2BA1 G;  2O1U A;  4DMI A;  4WSG A;  5ELW A;  1Y6Z A;  2EOS A;  4M2Z A;  3LPS A;  2EPM X;  4FW6 A;  2LVH A;  2EPR A;  5LLQ A;  4R8O A;  4JI0 I;  3EQ1 A;  2Z5E A;  1Z0G A;  1X48 A;  2EN2 A;  4FW4 A;  2KON A;  3P3G A;  2NN6 F;  2O1W A;  5GMD A;  5JEA E;  3THO B;  1X6H A;  4F54 A;  2YTG A;  3EPL A;  2WP8 A;  2PO0 B;  4WXC A;  1I94 E;  4TUG A;  2EN3 A;  2EOF A;  2EJ4 A;  4R2D A;  2AJ4 A;  3CWV A;  4LF5 E;  4RPF A;  1N0U A;  3V2U C;  4X9J A;  1ELO A;  1PJT A;  2ZIT A;  4LOM A;  3KZY A;  2DB2 A;  1DI2 A;  1UIL A;  1N0V C;  3GON A;  4ED4 A;  4DV7 I;  5C0X B;  4B3R I;  1USV A;  4O43 A;  4DXL A;  1A1K A;  4DR5 E;  2IES A;  2PO2 B;  5K36 C;  2EM5 A;  2LTR A;  2EOQ A;  2EMC A;  1ZM9 A;  3EPK A;  2EMW A;  2YTJ A;  2N8X A;  1ZXM A;  1X5W A;  2GHF A;  3M99 B;  4MLQ A;  2LUP B;  4JV5 E;  3QT6 A;  4UTG A;  4I8O A;  1NEI A;  1IBM E;  1XHK A;  3DJW A;  3BGH A;  2V34 A;  3GLL A;  2E1M A;  4JI4 I;  4HTG A;  4LU9 A;  4IZJ A;  5IT9 C;  2YSO A;  3LTO A;  5AE1 A;  2VF1 A;  4R03 A;  4LF9 E;  2PNM A;  1IBK I;  3J81 C;  3HUL A;  4IFD D;  3M6A A;  4DKK A;  4JI8 E;  4R2S A;  2BA0 D;  1J26 A;  4FWG A;  3J7A G;  4FK5 C;  4B3S I;  2R1F A;  2RS7 A;  5IXM B;  1ZAA C;  1MGT A;  2GPI A;  3H4L A;  2ENC A;  1N34 I;  4B3S E;  2KHX A;  5C0X D;  4DV4 E;  4BA2 B;  2CPN A;  4ZYE A;  1N33 E;  4GKK I;  2DGC A;  2YRK A;  1E3P A;  4JYA I;  2KOU A;  2RSM A;  1NCS A;  3JAM C;  4K0K E;  4DPT A;  5K36 F;  1ZM4 A;  3PYF A;  5IWA I;  2EM4 A;  3ADI A;  1O0W A;  3T1H I;  1ZBT A;  4IZK A;  4UT4 A;  2YTE A;  4DR3 E;  1H72 C;  3U1K A;  5F3W A;  5IWA E;  3H09 A;  1KJK A;  4DV1 E;  1UDO A;  4P78 A;  4KWY A;  1VI7 A;  4YHH E;  2V2Q A;  2EMY A;  3PRY A;  2LMZ A;  1HK7 A;  1NHH A;  4X64 I;  1HR0 I;  1Y60 A;  2HC5 A;  4N4R B;  1A1I A;  1OYR A;  3T1Y I;  4JI3 I;  2NN6 A;  5ADZ A;  2V85 A;  1UDN A;  2CTD A;  4NXM E;  4N3O A;  4Z7C A;  2ZBK B;  1HR0 E;  4JI6 I;  2C37 B;  2NUF A;  3T1Y E;  4JI3 E;  2EFG A;  4WYQ B;  3VHT B;  2R3V A;  3K6Q A;  1JK2 A;  3Q6N A;  2GS8 A;  1KVK A;  4R2P A;  2WZO A;  3C6M A;  1TF3 A;  4P52 A;  5A6K A;  5JEA B;  2JP9 A;  1R6L A;  2JEB B;  2MDR A;  2EMZ A;  2PO1 B;  4FWH A;  4WSP A;  1Z0V A;  1S16 A;  4QNK A;  1QNT A;  1B63 A;  2DEJ A;  2V88 A;  4HEI A;  4R1F A;  4MYU A;  2M7Q A;  2Z5B B;  2NA2 A;  2R76 A;  1T39 A;  3MHH C;  5A6A A;  2Z5C B;  2ENH A;  3ECR A;  4B3M E;  2D9H A;  1EH7 A;  5KL6 A;  3DF6 A;  4GZN C;  4LF7 E;  1ZR9 A;  2UU9 I;  2WNR B;  2RS6 A;  4O24 A;  5LL6 R;  2J7J A;  4KZS A;  4DR1 I;  2VF3 A;  2EMX A;  3HJC A;  4JI2 E;  3J80 Q;  4LCH A;  2JEA B;  4IFD C;  2UU9 E;  3ZOQ B;  1Z0B A;  3V5R A;  5JEA D;  2JWO A;  1R6M A;  2VES A;  4OO1 B;  4WUB A;  3OTO E;  1EH6 A;  1Z59 A;  4KHP I;  1HNZ E;  1MG7 A;  1J5E I;  5K36 A;  4WPY A;  5C0X C;  3PS1 A;  1FJG I;  1Z0C A;  2EMK A;  4DV3 I;  2JVA A;  2EOO A;  2HFS A;  4DR6 E;  4I3H A;  1Y4U A; 
#chains in the Genus database with same CATH homology
 5FLX C;  4X66 I;  5AE2 A;  5IT9 Q;  1MU5 A;  3ADJ A;  1A6F A;  2O1V A;  3J81 Q;  2V87 A;  3HPZ A;  4JI7 E;  3P1X A;  1EI1 A;  5BR8 I;  2A2D A;  1T4O A;  2B3T B;  2M4I A;  2XEX A;  5DNY A;  2WW4 A;  2DIX A;  4M30 A;  5L3J A;  5BR8 E;  1STU A;  3JAM Q;  3B78 A;  4URL A;  2CZ9 A;  3AUZ A;  5FWK A;  4DPU A;  1FWL A;  1SR9 A;  1USU A;  3PYE A;  1UEK A;  4M0V A;  4DV5 E;  5AAS A;  2V8P A;  1I94 I;  1HNX E;  4LF5 I;  2E5L E;  1BKN A;  2UXC E;  4BC7 A;  2G7H A;  1EKZ A;  4DPW A;  3J80 C;  4DR5 I;  2R42 A;  2EZ6 A;  4YY3 I;  4B3T E;  4P7A A;  2UXD E;  1ZM3 A;  3ZKB A;  2B7T A;  3IWB A;  1FI4 A;  4JI1 E;  4YY3 E;  3F0N A;  4IZJ B;  4JV5 I;  2A2C A;  1IBM I;  3ZZT A;  1QZR A;  2FV4 B;  1Z0W A;  2VQF E;  4LF9 I;  2Q2E B;  4Q28 A;  2NUE A;  4JI8 I;  1D6T A;  1FKA E;  3LNU A;  2UUB E;  1DQ3 A;  4DV4 I;  2NUG A;  1IBL I;  2V2Z A;  5CFF E;  2H36 X;  4DR2 E;  4X65 E;  1N33 I;  4BBY A;  2HHH E;  2N3G A;  1RR9 A;  1Z5B A;  4K0K I;  2GQ0 A;  1HNW I;  1IBL E;  4IZK B;  1MX0 A;  3VYY A;  4DUY E;  1HNW E;  4BCA A;  4DR3 I;  2LJH A;  4TUI A;  4DV1 I;  4YHH I;  3ZKD A;  2B9D A;  5FLX Q;  1T4N A;  1X49 A;  2OI2 A;  2V8Q B;  4J8Z A;  3J7Y p;  3ZZ0 A;  4NXM I;  4WUC A;  1U2R A;  2HK3 A;  3HTX A;  4LTY A;  1NZ0 A;  2V2V A;  1YYO A;  1ZXN A;  2VQE E;  3LLH A;  4LF4 E;  4DPX A;  4PRX A;  4XTJ A;  3P06 A;  1XNR E;  1H7U A;  1Z0T A;  4PU9 A;  2IOQ A;  4LFB E;  4B3M I;  4DR7 E;  1S4E A;  4LF7 I;  2B7V A;  4NXN E;  3F6G A;  2L3J A;  3JTZ A;  3ADL A;  1OJ4 A;  2LTS A;  3QT7 A;  4HAC A;  2UXB E;  4JI2 I;  2MC5 A;  2RTX A;  3WU3 A;  2BM1 A;  1N36 E;  3HPS A;  3Q1Q A;  3OTO I;  2J7K A;  3K85 A;  1HNZ I;  1NHI A;  2L6M A;  4F9C B;  2HFU A;  4L8N A;  5AE3 A;  3VK6 A;  4DR6 I;  4HYM A;  2CG9 A;  3WU5 A;  3JU0 A;  1ZBQ A;  4LFC E;  5A2Q Q;  1XMQ E;  4X62 I;  4JG4 A;  4LFA I;  3HQ1 A;  2F4V E;  5LMN E;  4X62 E;  2LJP A;  4GKJ E;  4JI7 I;  4LFA E;  3AV0 A;  1H74 A;  2X36 A;  4LF6 E;  2IOP A;  3F6H A;  5LMU E;  2HKJ A;  2E1R A;  3B82 A;  3MSW A;  4OX9 I;  1XNQ E;  2O1T A;  1RC7 A;  2YT4 A;  2LRS A;  3KWR A;  4OX9 E;  4L5N C;  4DV5 I;  3VYX A;  2ODR D;  2UUA E;  1RRE A;  1HNX I;  2E5L I;  2UXC I;  2YZT A;  3IWC A;  4WUD A;  4B3T I;  4DR4 E;  1KIJ A;  4DU7 A;  2UXD I;  1T4L B;  3QT8 A;  4JI1 I;  1Z0E A;  4F9B B;  1YZ9 A;  4DUZ E;  4DU8 A;  1QU6 A;  3RMP A;  2VQF I;  4JI5 E;  1UHZ A;  3C4B A;  4USM A;  2NPF A;  5A2Q C;  1RQ0 A;  2UUB I;  1ZM2 A;  4AQY I;  2X7I A;  3ADG A;  4JI0 E;  1PKP A;  4F9A B;  1KTV A;  4PRV A;  2JOB A;  4DR2 I;  4X65 I;  4AQY E;  2HHH I;  3QT5 A;  4DV0 I;  3Q6M A;  4BC9 A;  4WFT A;  1YYW A;  2L92 A;  4DUY I;  4USK A;  4DV0 E;  3WU6 A;  4IZJ D;  4DV7 E;  4OOG C;  4B3R E;  2VE7 C;  2EWL A;  2L8T A;  1WHQ A;  2HK2 A;  2FTX B;  4HY1 A;  3LML A;  1N32 E;  4JI4 E;  2N3H A;  2L2N A;  1X47 A;  5T6J A;  2ODR C;  1Z5A A;  1IBK E;  1YYK A;  2VQE I;  2DEI A;  3C4T A;  2BV3 A;  4LF4 I;  4FN5 A;  1N34 E;  1XNR I;  4ZVI A;  1VIS A;  1KKH A;  4GKK E;  2PNL A;  1H7S A;  4JYA E;  4LFB I;  4HAC B;  1PIE A;  1WUU A;  4DR7 I;  4NXN I;  1B62 A;  1FWK A;  3J7A M;  2CGE A;  2L2K B;  3T1H E;  2JOX A;  2UXB I;  4DV6 I;  2IHR 1;  1Y4S A;  1N36 I;  4X64 E;  2ZM6 I;  4DV6 E;  2LUQ A;  4JI6 E;  2ZM6 E;  4GEQ B;  3K17 A;  2K4V A;  2FGG A;  4LFC I;  2LE2 A;  3ZM7 A;  3D4J A;  2BM0 A;  4BMJ A;  1K47 A;  2V86 A;  2L3C A;  4M1K A;  3IWD A;  1XMQ I;  2L2M A;  1DAR A;  1GQE A;  4FW9 A;  1WXR A;  4HXZ A;  2F4V I;  5LMN I;  3HXL A;  4GKJ I;  2DSY A;  2L33 A;  3FIG A;  2JY9 A;  1PVG A;  2DMY A;  4DPY A;  4LF6 I;  2Z5B A;  5LMU I;  2UUC I;  2V89 A;  3ZZU A;  2Z5C A;  1WHN A;  4DR1 E;  2JR1 A;  3K1J A;  1FNM A;  3OML A;  1XNQ I;  2UUC E;  1H73 A;  1EA6 A;  3PYD A;  2MC6 A;  3B8H A;  2M1S A;  2V83 A;  4BS9 A;  4KHP E;  4Z7Y A;  4X8W A;  1J5E E;  1XMO I;  2F8B A;  2UUA I;  4EMD A;  1FJG E;  4DV3 E;  2HKE A;  1GZ6 A;  1XMO E;  4X66 E;  1NHJ A;  4DR4 I;  1Z5C A;  4P7D A;  3PYG A;  4DUZ I;  2LBS B;  4DV2 I;  4LF8 I;  4FWD A;  4KQV A;  4MYT A;  5GME A;  4JI5 I;  4DV2 E;  4LF8 E;  2O1U A;  4DMI A;  1Y6Z A;  4M2Z A;  3LPS A;  4R8O A;  4JI0 I;  2Z5E A;  1Z0G A;  1X48 A;  2KON A;  2O1W A;  5GMD A;  4F54 A;  1I94 E;  4TUG A;  2AJ4 A;  3CWV A;  4LF5 E;  4RPF A;  1N0U A;  3V2U C;  1ELO A;  2ZIT A;  2DB2 A;  1DI2 A;  1UIL A;  1N0V C;  3GON A;  4ED4 A;  4DV7 I;  4B3R I;  1USV A;  4DXL A;  4DR5 E;  2LTR A;  1ZM9 A;  1ZXM A;  2LUP B;  4JV5 E;  4UTG A;  1N32 I;  3QT6 A;  4I8O A;  1XHK A;  1IBM E;  2V34 A;  3DJW A;  4JI4 I;  2E1M A;  4LU9 A;  4IZJ A;  5IT9 C;  3LTO A;  5AE1 A;  2VF1 A;  4R03 A;  4LF9 E;  2PNM A;  1IBK I;  3J81 C;  3HUL A;  3M6A A;  4DKK A;  4JI8 E;  4FWG A;  1J26 A;  3J7A G;  4B3S I;  2RS7 A;  3H4L A;  1N34 I;  4B3S E;  2KHX A;  4DV4 E;  2CPN A;  1N33 E;  4GKK I;  4JYA I;  2KOU A;  2RSM A;  3JAM C;  4K0K E;  4DPT A;  1ZM4 A;  3PYF A;  5IWA I;  3ADI A;  1O0W A;  3T1H I;  1ZBT A;  4IZK A;  4UT4 A;  4DR3 E;  1H72 C;  5F3W A;  5IWA E;  3H09 A;  4DV1 E;  3WU4 A;  4P78 A;  3PRY A;  4YHH E;  2V2Q A;  4X64 I;  2LMZ A;  1HK7 A;  1NHH A;  1HR0 I;  3T1Y I;  4JI3 I;  5ADZ A;  2V85 A;  4JI6 I;  4NXM E;  4N3O A;  4Z7C A;  2ZBK B;  1HR0 E;  2NUF A;  3T1Y E;  4JI3 E;  2EFG A;  4WYQ B;  2R3V A;  3K6Q A;  3Q6N A;  2GS8 A;  1KVK A;  2WZO A;  4P52 A;  2MDR A;  4FWH A;  4WSP A;  1Z0V A;  1S16 A;  1B63 A;  2DEJ A;  2V88 A;  4R1F A;  4MYU A;  2M7Q A;  2Z5B B;  2NA2 A;  2Z5C B;  4B3M E;  3DF6 A;  4LF7 E;  2UU9 I;  2RS6 A;  5LL6 R;  4KZS A;  4DR1 I;  2VF3 A;  3HJC A;  4JI2 E;  3J80 Q;  2UU9 E;  3ZOQ B;  1Z0B A;  3V5R A;  2JWO A;  4WUB A;  3OTO E;  1Z59 A;  4KHP I;  1HNZ E;  1MG7 A;  1J5E I;  4WPY A;  1FJG I;  1Z0C A;  4DV3 I;  2JVA A;  2HFS A;  4DR6 E;  4I3H A;  1Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...