4DR5E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5E02
2E1RA 4JI5E 4JI6E 4DPYA 2LBSB 1B63A 4DUYE 2UUCE 3JAMC 4B3RI 1HNWE 4DV0I 4PRXA 2AJ4A 2V2VA 4LFCE 3J7AM 1YYOA 4DPTA 4K0KI 1FWLA 3LTOA 1FKAE 3ZZ0A 4LF5I 1IBMI 1HNZI 2VQEE 2L2MA 2LJHA 2BV3A 1HR0I 3T1HE 2DEJA 1WUUA 1XNQI 3QT5A 1YYWA 4DV1I 1HNXI 3J7Yp 1MU5A 4X65I 2LUQA 1XNQE 1KIJA 2LUPB 3V2UC 4DV4I 4JI0E 2F4VI 4DR3I 2DEIA 1NHJA 4P7AA 4LFBI 4ZVIA 3F0NA 5IT9Q 3T1YI 2UXCI 1UEKA 4DV4E 2KHXA 1Z5AA 4OX9I 4MYTA 1A6FA 4JI4E 2EZ6A 1YYKA 4DU8A 4JI3E 4DV5I 3T1YE 2UXCE 1XNRI 4PU9A 2J7KA 4R1FA 2VF3A 4OX9E 3ZZTA 4USMA 1Z5BA 2HKEA 1QU6A 1Z0EA 1PKPA 3P1XA 4KHPI 1K47A 3JAMQ 4FWGA 1T4NA 2BM1A 3K1JA 2ZM6I 3LPSA 1FNMA 2MDRA 4RPFA 2GS8A 4KHPE 1UHZA 3PYGA 3B8HA 4DR6I 4JI7I 5LMNE 2HHHI 4DV6E 4FW9A 5FLXC 2ZM6E 3J81C 2N3GA 1RQ0A 4DR6E 4DR7I 4JI8I 2YT4A 4KQVA 4DV2E 1N36I 4NXNI 4ED4A 1S16A 4M1KA 4JI5I 1KTVA 4X64I 4JI6I 4Z7YA 2IHR1 3J80C 1KVKA 3GONA 4YHHI 2UUCI 3OTOE 1HNWI 4HXZA 2L2KB 4X64E 4LFAI 2EFGA 4LFCI 1N32I 2WW4A 4YHHE 2ZBKB 2A2CA 5A2QC 1RREA 4LFAE 1Z0WA 2VQEI 1BKNA 1J5EE 2UXBE 3T1HI 1N32E 2E5LE 2B7VA 4YY3I 5GMDA 4JV5E 2NUFA 3VYYA 4WFTA 2JVAA 1IBKI 3K17A 4GKJI 3V5RA 2X7IA 4YY3E 2L2NA 3LLHA 3VYXA 4JI0I 1IBKE 4B3SI 4GKJE 1J26A 4PRVA 5IWAI 1Z0VA 5FLXQ 2B3TB 4URLA 2V2QA 2L3JA 2HK3A 4B3SE 4B3ME 4FWDA 4JI4I 3WU3A 5IWAE 1EI1A 1NHHA 3PYEA 4JI3I 5BR8E 2NUGA 1IBLE 3B78A 1X48A 4X8WA 2HKJA 1PIEA 1O0WA 3HULA 1T4LB 3J80Q 3WU4A 2L33A 1H7SA 4DR1I 2V2ZA 1Z59A 2DMYA 4HACA 5LL6R 2L3CA 1WHNA 2DB2A 4DR5I 5LMNI 4DV6I 4JI1I 1MX0A 4DV7E 4X62E 1YZ9A 2UXDE 1H74A 4DR1E 1S4EA 5A2QQ 4DR4E 2DIXA 4DR5E 1UILA 2JY9A 1X49A 4XTJA 4DV2I 4FWHA 4JI1E 1I94I 1ZBTA 4JYAE 4NXME 2ZITA 5L3JA 3ADLA 2X36A 4P52A 2VQFE 3D4JA 1H72C 3Q1QA 4LF9I 1ZXMA 1I94E 1Z0GA 2A2DA 1EKZA 3OTOI 1N0UA 2RSMA 1Z0TA 4USKA 1H7UA 4DKKA 4LF9E 1N34E 2B7TA 2LJPA 1NZ0A 1FI4A 3C4TA 1XHKA 2RTXA 2HK2A 4M2ZA 3M6AA 1J5EI 2UXBI 4LF8I 3CWVA 2E5LI 2LRSA 4Z7CA 4X66I 1MG7A 3ZKDA 4JV5I 1Z0CA 5CFFE 1GQEA 4LF8E 2V34A 4B3TE 4LF4E 4LF6I 4X66E 4DUZE 3WU6A 2RS7A 1ZM4A 4LF6E 4WUCA 4AQYE 1FWKA 4EMDA 3HTXA 4FN5A 4LF7I 3J7AG 1OJ4A 5LMUI 3PYDA 1FJGI 4JG4A 4B3MI 4B3RE 4JI2I 1U2RA 4DV3I 3ADGA 1DARA 1Z5CA 4DV0E 1N33I 1KKHA 4M30A 3ZM7A 4LF7E 1N0VC 5BR8I 2OI2A 5LMUE 4DU7A 1FJGE 3J81Q 1IBLI 4JI2E 4DV3E 3B82A 4K0KE 3H4LA 1N33E 4LF5E 1IBME 1HNZE 2V8PA 1HR0E 1RR9A 1ELOA 1T4OA 2R42A 1VISA 4UTGA 4GKKI 4DV1E 4HY1A 4I3HA 1DI2A 2R3VA 1HNXE 4DV7I 4X62I 4X65E 5GMEA 3ZKBA 2UXDI 4GKKE 4DPXA 4DR4I 2F4VE 3PYFA 2UUAI 4DR3E 3WU5A 2CPNA 1EA6A 4JYAI 1NHIA 4NXMI 4LFBE 2XEXA 3LNUA 4DPUA 2VQFI 2RS6A 2N3HA 2UUAE 4MYUA 1Z0BA 2UUBI 2LTSA 1ZXNA 2Q2EB 3C4BA 4DV5E 1XNRE 1ZM3A 1STUA 1XMOI 1H73A 4WUDA 4OOGC 1XMQI 2UUBE 4UT4A 1N34I 3ADIA 1RC7A 1WHQA 2UU9I 4HACB 2NUEA 2NA2A 4DPWA 3QT8A 3QT6A 1B62A 4DR2I 1XMOE 1XMQE 1X47A 2NPFA 3ADJA 2UU9E 4WYQB 1ZM2A 1ZM9A 4JI7E 4DR2E 2HHHE 4HYMA 2CZ9A 5IT9C 1D6TA 3ZZUA 4WUBA 1PVGA 2LTRA 4B3TI 4LF4I 3QT7A 4DUZI 4DR7E 4JI8E 2BM0A 1N36E 4NXNE 4DXLA 1QZRA 4DUYI 2HFUA 4AQYI 2HFSA
chains in the Genus database with same CATH superfamily
2E1RA 1SFEA 2CG9A 2EMBA 2GO3A 5KL5A 4JI5E 2EL5A 4JI6E 4Q28A 4MU3A 1GTKA 2ODRD 4DPYA 2EPXA 4NZVA 2LBSB 2EL6A 1B63A 1OYPA 4DUYE 3JAMC 2UUCE 3GMEA 5KL4A 4B3RI 1HNWE 2EOEA 4PRXA 4DV0I 2AJ4A 1JK2A 1TN9A 2V2VA 3M7NG 2V8QB 1YFHA 3M85D 4LFCE 3J7AM 2EN2A 2EMCA 2EOJA 2PO2B 1YYOA 2JYAA 1Y60A 5K36A 4DPTA 5JEAE 4K0KI 4FW4A 1UDNA 4MDTA 5JEAC 1X6HA 1FWLA 2MDGA 1FKAE 1YUIA 4WSGA 3LTOA 2BA0D 2C39A 3FIGA 2BA0G 2VQEE 3ZZ0A 1HNZI 1IBMI 2L2MA 2LJHA 2BV3A 2PO0A 1HR0I 1GZ6A 2ELZA 3T1HE 1HK7A 2M1SA 2EPPA 2DEJA 2O1WA 1IQOA 2EPUA 2Q8UA 2JPAA 1WUUA 2PNZA 1XNQI 3QT5A 3L7ZB 1YYWA 2YZTA 3PS3A 2DGCA 4DV1I 3HQ1A 5JEAF 2EPCA 1UDOA 2YTEA 2JR1A 1HNXI 1PDAA 3J7Yp 1MU5A 4X65I 2M9AA 3DD6A 1UN6B 2EM2A 2LUQA 3BGHA 3VK6A 1XNQE 2EM7A 4MU0A 5EKWA 2WNRA 1A1FA 1E3HA 1KIJA 4LCFA 2LUPB 3IWBA 3V2UC 4DV4I 4JI0E 2F4VI 5DNLA 2EMYA 4DR3I 2DEIA 2YTQA 2EOYA 2YTOA 1IMUA 2YSPA 4R03A 1NHJA 4BMJA 2EMHA 4P7AA 3LMLA 4LFBI 4ZVIA 3F0NA 1QNTA 2EOOA 4MU1A 5IT9Q 4F6NA 3T1YI 3C6MA 2UXCI 1UEKA 3Q6NA 4DV4E 3THNA 2RPCA 2PNMA 1WJPA 2KHXA 1Z5AA 4OX9I 4MYTA 1A6FA 5A69A 5AC4A 4NBQA 4JI4E 1TF6A 4MU4A 4ZYGA 2EM3A 2ENAA 1EH7A 2EZ6A 1USUA 1YYKA 2YTIA 2NN6B 2L8TA 2EMIA 4MLQA 3ZOQB 4DU8A 2G7HA 4JI3E 4DV5I 4IFDB 5A6AA 3BIDA 3T1YE 2UXCE 1UDQA 1XNRI 4PU9A 2JOXA 2J7KA 4R1FA 2VF3A 4OX9E 3ZZTA 4USMA 2EE8A 1Z5BA 4FW6A 4BA1A 4LF5I 2HKEA 4IZJB 1QU6A 4U3BA 5EL9A 1Z0EA 4FK5C 2FV4B 1PKPA 3KWRA 3P1XA 4KHPI 1K47A 1R6LA 2MKNA 2LMZA 3PS2A 2EOXA 2CT1A 4LOMA 4FWGA 1T4NA 3JAMQ 2BM1A 3K1JA 2ZM6I 2IOPA 3LPSA 5IXMB 4OO1B 2A25A 2ENHA 1FNMA 2MDRA 4BHBA 4RPFA 5F3WA 2H36X 2GS8A 4KHPE 1UHZA 3PYGA 3B8HA 4DR6I 4JI7I 1NEIA 5LMNE 2HHHI 2PO1A 4WXCA 4DV6E 4FW9A 2EOMA 1PJSA 2WZOA 2V83A 4R8OA 5FLXC 3HPZA 3J81C 2EP3A 2ZM6E 4TUGA 2N3GA 3AUZA 1VI7A 4I8OA 2MC5A 4IFDD 4BA2A 4BCAA 2EM8A 2D9HA 1RQ0A 4L5NC 2V87A 4DR6E 2IOQA 4JI8I 4DR7I 2YT4A 4IFDF 1BB8A 4KQVA 4DV2E 1N36I 5TSEA 3U1YA 4NXNI 1R6MA 4BS9A 4ED4A 3DJWA 2RSIA 2EM4A 1S16A 2WBTA 2O3ZA 1NCSA 1Y4SA 4M1KA 3IWCA 2EOHA 5C0XF 4KWYA 2FGGA 1UBDC 1KTVA 4X64I 3HXLA 4JI5I 4JI6I 2ODRC 4Z7YA 2IHR1 2M4IA 5JEAA 2JT2A 4OO1D 4R2CA 3J80C 1KVKA 4F6MA 1Y6ZA 2F1DA 4R2RA 3GONA 3C6KA 4YHHI 2UUCI 3OTOE 3Q6MA 1HNWI 2BA1G 2L2KB 2JEBA 4HXZA 1AH5A 5DRPA 4IS9A 2EMFA 2CVEA 1PJTA 2YPNA 3EPKA 2ELYA 5AE2A 4X64E 1AAYA 2BBGA 4ZYDA 2IERA 4LFAI 4AIMA 2EFGA 4GZNC 2GLIA 4LFCI 1N32I 2WW4A 5KL6A 2VF1A 4WX9A 4YHHE 2WBSA 2ZBKB 2A2CA 4M0VA 4N4RB 1A1JA 1A1KA 3NZKA 5A2QC 3M7ND 1RREA 4LFAE 1Z0WA 2VQEI 2YRHA 2IESA 1BKNA 5AE1A 1J5EE 1TF3A 2UXBE 3T1HI 1N32E 2LVHA 4R2QA 2EOFA 4ZYEA 2E5LE 3RMPA 2B7VA 4YY3I 1B69A 5GMDA 1EH8A 4JV5E 2NUFA 1L4SA 3VYYA 4AM3A 4WFTA 2JVAA 4LPFA 1Z1BA 2Z5CA 2C38B 4F54A 1IBKI 4P7DA 3K17A 2EMWA 4GKJI 2C37B 2YU5A 1USVA 3V5RA 2X7IA 2JOBA 4YY3E 3GCMA 2EN3A 5AE3A 2Z5BA 1YPNA 3P3EA 2L2NA 2YTNA 3LLHA 2BR2A 3EQ1A 2O1TA 3VYXA 4JI0I 5KL2A 1IBKE 4B3SI 5A6BD 3P76A 4GKJE 2EQ3A 1J26A 3TQMA 4M9VC 3HPSA 2DLQA 4PRVA 2EN6A 1MEYC 5IWAI 2ENCA 2KONA 2EORA 2EMZA 1XXEA 1Z0VA 2V86A 3KZYA 2J7JA 5FLXQ 2B3TB 4URLA 2EMKA 2V2QA 2L3JA 1A1HA 2HK3A 4B3SE 4X9JA 5K36B 4B3ME 4WPYA 4FWDA 4RH8A 4JI4I 1ZAAC 3WU3A 5IWAE 1T38A 1EI1A 1NHHA 2YTPA 3PYEA 4IS1C 2PO0B 4JI3I 2VE7C 5BR8E 2NUGA 1X6FA 1IBLE 5AASA 3B78A 1X48A 4GQUA 1SR9A 5KL7A 4X8WA 2HKJA 2NABA 1PIEA 1O0WA 2PNZB 5A6KA 5DRQA 3HULA 2LV2A 3EPLA 4WSPA 4FW5A 5C0XA 1T4LB 3J80Q 3K85A 3WU4A 2L33A 5KL3A 1H7SA 2L92A 4J3DA 2LO3A 2WCC3 4DR1I 2EPKX 2V2ZA 1Z59A 4LU9A 2WNRB 1G2DC 2DMYA 4BHCA 4HACA 5LL6R 2EPNA 4RHBB 2L3CA 1WHNA 2DB2A 2R76A 5LMNI 4DR5I 5K36D 1MGTA 4R2AA 4O43A 4DV6I 2CTDA 4LCGA 1MX0A 1N3GA 4X62E 4DV7E 4JI1I 2LT7A 2R1FA 2EPMX 2EMAA 2HGHA 4DMIA 1YZ9A 2UXDE 4DR1E 1H74A 1S4EA 2VESA 4IFDE 5A2QQ 4IFDC 2EQ1A 2YWQA 2WP8A 1A1GA 4DR4E 2DIXA 4DR5E 1UILA 2JY9A 1X49A 4XTJA 4DV2I 3P3GA 2DMIA 3UHMA 4FWHA 2EPLX 4JI1E 5C0XE 1ZU1A 5C0XC 1I94I 2EOQA 2EN8A 1ZBTA 1A1LA 4JYAE 4LTYA 2NN6D 2JE6A 4NXME 2O1UA 3EPJA 2AE8A 2ZITA 2HJJA 2N8XA 3ADLA 2NN6F 3QG5C 2X36A 4P52A 5L3JA 1Y5YA 2VQFE 2RQLA 2YTGA 3D4JA 4L8NA 2DRPA 4BA1B 2EN1A 2YRMA 1KJKA 1H72C 3Q1QA 4IZJD 4LF9I 1ZXMA 1I94E 2JEAB 1Z0GA 2DSYA 2I9IA 3ECRA 2A2DA 1EKZA 3OTOI 5T6JA 4OZEA 1N0UA 2RSMA 1Z0TA 3IWDA 1WRJA 1KYQA 4USKA 2V85A 1H7UA 1X3CA 3HJCA 4DKKA 4LF9E 1LLMC 2B7TA 1N34E 2J65A 4IZKB 2LJPA 1A1IA 1P42A 2YRKA 4OO1F 1NZ0A 2BA1D 1FI4A 3C4TA 2EOIA 2YSOA 2M7QA 4Q35B 1XHKA 2RTXA 2PO1B 3AV0A 5A6JA 2HK2A 4M2ZA 2YTFA 4BBYA 5AC5A 3M6AA 1J5EI 2UXBI 4LF8I 1PJQA 4TUIA 3B4TA 3CWVA 4BA2B 4R2DA 2EPOA 2V88A 1YSAC 2PO2A 2E5LI 2LRSA 4Z7CA 4X66I 1MG7A 1ZR9A 3K6QA 2JP9A 3ZKDA 4JV5I 1Z0CA 5CFFE 4QNKA 4FW7A 1GQEA 2EM6A 5FWKA 4U3DA 4LF8E 2V34A 4B3TE 1DGCA 4LF4E 1WXRA 4LF6I 4X66E 2MC6A 4DUZE 3BF2A 3WU6A 2EN7A 3CDJA 4O4KA 3JTZA 5JEAB 2EJ4A 3L7ZA 3MSWA 4FW3A 2RS7A 2GPIA 4OKGA 4O5GA 1ZM4A 4F2JC 2JEBB 3P3CA 4LF6E 4WUCA 4AQYE 1FWKA 4EMDA 5IV8B 3HTXA 4FN5A 2EOZA 4LF7I 5DNYA 3J7AG 1OJ4A 4F9CB 3THOB 3M85G 2GHFA 3PYDA 5LMUI 1FJGI 4JG4A 3L00A 4B3MI 5DRRA 4B3RE 4JI2I 1U2RA 4DV3I 4R2EA 3ADGA 4BC7A 2EL4A 1F2IG 1DARA 2K7IA 2I13A 4DV0E 1Y4UA 1Z5CA 2EWLA 4AIDA 4M30A 1KKHA 3ZM7A 4GEQB 4LF7E 1N33I 1N0VC 1T39A 1JK1A 5BR8I 2PRTA 2OI2A 5LMUE 4DU7A 1FJGE 3J81Q 1IBLI 4J8ZA 2KOUA 2PNLA 4JI2E 4DV3E 2VRDA 3B82A 4K0KE 3H4LA 3F6GA 1N33E 2C39B 4LF5E 2DLKA 3KRNA 5DROA 5JEAD 1IBME 2NN6A 3DF6A 1HNZE 2Z5CB 2EN4A 2V8PA 1HR0E 1ZBQA 4IFDA 1RR9A 1ELOA 2Z5BB 3CDIA 1T4OA 2R42A 1VISA 4IZJA 3F6HA 2LJUA 2ADRA 2WBUA 2BR2B 4UTGA 4GKKI 4LCHA 2EMLA 4DV1E 4HY1A 5K36E 4I3HA 2Z5EA 5K36C 1DI2A 2R3VA 1HNXE 1UDSA 2LE2A 4X62I 3PRYA 2E72A 4DV7I 2EM5A 4QNJA 2EOSA 4X65E 5GMEA 3ZKBA 5ELWA 2UXDI 4GKKE 4OO1A 4DPXA 2GQ0A 3MHHC 1G2FC 4DR4I 4F9BB 2F4VE 3PYFA 2UUAI 4DR3E 2B9DA 3WU5A 2CPNA 1EA6A 2LCEA 2NN6E 2NN6C 5K36F 5ADZA 2BB8A 1NHIA 4JYAI 2CSHA 4NXMI 4LFBE 3H1CA 2XEXA 5DNXA 4ISAA 2YTDA 3LNUA 4DPUA 1X6EA 2MKDA 1OYSA 2VQFI 2RS6A 2N3HA 2K4VA 1DQ3A 2UUAE 4MYUA 1Z0BA 3VHTB 2EM0A 2UUBI 4MQYA 2EQ0A 2YU8A 4IJDA 2O1VA 4ZYHA 1YH8A 2LTSA 3JU0A 4HEIA 4R2SA 5C0XB 2JEAA 1ZXNA 2Q2EB 3C4BA 2EMXA 4DV5E 1XNRE 1ZM3A 1STUA 1XMOI 1H73A 4WUDA 4OOGC 2FTXB 4AQYI 4OO1E 2EPAA 1BBOA 1XMQI 3EPHA 2UUBE 4UT4A 1E3PA 4OO1C 1IQSA 1N34I 5LLQA 3ADIA 2GO4A 1RC7A 1WHQA 2UU9I 4HACB 4IZKA 2EMGA 1X5WA 4BC9A 2NUEA 2NA2A 3MHSC 4DPWA 3QT8A 3QT6A 1YHCA 1B62A 4DR2I 4F9AB 1XMOE 2V89A 2HC5A 1XMQE 1YUJA 3M99B 4MLVA 1X47A 2CGEA 2YTJA 2NPFA 3ADJA 3BBGA 3H09A 2JWOA 4P78A 2WP8B 2UU9E 5A6BA 4WYQB 1ZM2A 1P47A 4JI7E 1OYRA 4DR2E 1ZM9A 2EPZA 4NHRA 2HHHE 4HYMA 4N3OA 3KZZA 2CZ9A 4KZSA 5IT9C 2L6MA 1BBGA 3U1KA 1D6TA 2JE6B 4HTGA 3ZZUA 1RHYA 2EM9A 5C0XD 4WUBA 1PVGA 3UK3C 2LTRA 4B3TI 4LF4I 2EPRA 3QT7A 3HKMA 4O24A 4DUZI 4DR7E 1RMDA 4JI8E 4WXDA 2BM0A 2JXPA 1N36E 2E1MA 1EH6A 4NXNE 4DXLA 3P06A 4R2PA 1QZRA 3OMLA 2F8BA 2C38A 3GLLA 3PS1A 4DUYI 2HFUA 2C37A 2HFSA
chains in the Genus database with same CATH topology
2E1RA 2CG9A 4JI5E 4JI6E 4Q28A 2ODRD 4DPYA 2LBSB 1B63A 4DUYE 3JAMC 2UUCE 4B3RI 1HNWE 4DV0I 4PRXA 2AJ4A 2V2VA 2V8QB 4LFCE 3J7AM 1YYOA 4DPTA 4K0KI 1FWLA 3LTOA 1FKAE 3ZZ0A 4LF5I 1IBMI 3FIGA 1HNZI 2VQEE 2L2MA 2LJHA 2BV3A 1HR0I 1GZ6A 3T1HE 1HK7A 2M1SA 2DEJA 2O1WA 1WUUA 1XNQI 3QT5A 1YYWA 2YZTA 4DV1I 3HQ1A 2JR1A 1HNXI 3J7Yp 1MU5A 4X65I 3VK6A 2LUQA 1XNQE 1KIJA 2LUPB 3IWBA 3V2UC 4DV4I 4JI0E 2F4VI 4DR3I 2DEIA 4R03A 1NHJA 4BMJA 4P7AA 3LMLA 4LFBI 4ZVIA 3F0NA 5IT9Q 3T1YI 2UXCI 1UEKA 3Q6NA 4DV4E 2PNMA 2KHXA 1Z5AA 4OX9I 4MYTA 1A6FA 4JI4E 1USUA 2EZ6A 1YYKA 2L8TA 3ZOQB 4DU8A 2G7HA 4JI3E 4DV5I 3T1YE 2UXCE 1XNRI 4PU9A 2JOXA 2J7KA 4R1FA 2VF3A 4OX9E 3ZZTA 4USMA 1Z5BA 2HKEA 4IZJB 1QU6A 1Z0EA 2FV4B 1PKPA 3KWRA 3P1XA 4KHPI 1K47A 2LMZA 3JAMQ 4FWGA 1T4NA 2BM1A 3K1JA 2ZM6I 2IOPA 3LPSA 1FNMA 2MDRA 4RPFA 5F3WA 2H36X 2GS8A 4KHPE 1UHZA 3PYGA 3B8HA 4DR6I 4JI7I 5LMNE 2HHHI 4DV6E 4FW9A 2WZOA 2V83A 4R8OA 5FLXC 3HPZA 3J81C 2ZM6E 4TUGA 2N3GA 3AUZA 4I8OA 2MC5A 4BCAA 1RQ0A 4L5NC 2V87A 4DR6E 2IOQA 4JI8I 4DR7I 2YT4A 4KQVA 4DV2E 1N36I 4NXNI 4BS9A 4ED4A 3DJWA 1S16A 1Y4SA 4M1KA 3IWCA 2FGGA 4JI5I 1KTVA 4X64I 3HXLA 4JI6I 2ODRC 4Z7YA 2IHR1 2M4IA 3J80C 1KVKA 1Y6ZA 3GONA 4YHHI 2UUCI 3OTOE 3Q6MA 1HNWI 4HXZA 2L2KB 5AE2A 4X64E 4LFAI 2EFGA 4LFCI 1N32I 2WW4A 2VF1A 4YHHE 2ZBKB 2A2CA 4M0VA 5A2QC 1RREA 4LFAE 1Z0WA 2VQEI 1BKNA 5AE1A 1J5EE 2UXBE 3T1HI 1N32E 2E5LE 3RMPA 2B7VA 4YY3I 5GMDA 4JV5E 2NUFA 3VYYA 4WFTA 2JVAA 2Z5CA 4F54A 1IBKI 4P7DA 3K17A 4GKJI 1USVA 3V5RA 2X7IA 2JOBA 4YY3E 5AE3A 2Z5BA 2L2NA 3LLHA 2O1TA 3VYXA 4JI0I 1IBKE 4B3SI 4GKJE 1J26A 3HPSA 4PRVA 5IWAI 2KONA 1Z0VA 2V86A 5FLXQ 2B3TB 4URLA 2V2QA 2L3JA 2HK3A 4B3SE 4B3ME 4WPYA 4FWDA 4JI4I 3WU3A 5IWAE 1EI1A 1NHHA 3PYEA 4JI3I 2VE7C 5BR8E 2NUGA 1IBLE 5AASA 3B78A 1X48A 1SR9A 4X8WA 2HKJA 1PIEA 1O0WA 3HULA 4WSPA 1T4LB 3J80Q 3K85A 3WU4A 2L33A 1H7SA 2L92A 4DR1I 2V2ZA 1Z59A 4LU9A 2DMYA 4HACA 5LL6R 2L3CA 1WHNA 2DB2A 4DR5I 5LMNI 4DV6I 4JI1I 1MX0A 4DV7E 4X62E 4DMIA 1YZ9A 2UXDE 4DR1E 1H74A 1S4EA 5A2QQ 4DR4E 2DIXA 4DR5E 1UILA 2JY9A 1X49A 4XTJA 4DV2I 4FWHA 4JI1E 1I94I 1ZBTA 4JYAE 4LTYA 2O1UA 4NXME 2ZITA 5L3JA 3ADLA 2X36A 4P52A 2VQFE 3D4JA 4L8NA 1H72C 3Q1QA 4IZJD 4LF9I 1ZXMA 1I94E 1Z0GA 2DSYA 2A2DA 1EKZA 3OTOI 5T6JA 1N0UA 2RSMA 1Z0TA 3IWDA 4USKA 2V85A 1H7UA 3HJCA 4DKKA 4LF9E 1N34E 2B7TA 4IZKB 2LJPA 1NZ0A 1FI4A 3C4TA 1XHKA 2M7QA 2RTXA 3AV0A 2HK2A 4M2ZA 4BBYA 3M6AA 1J5EI 2UXBI 4LF8I 4TUIA 3CWVA 2E5LI 2V88A 2LRSA 4Z7CA 4X66I 1MG7A 3K6QA 3ZKDA 4JV5I 1Z0CA 5CFFE 1GQEA 5FWKA 4LF8E 2V34A 4B3TE 4LF4E 4LF6I 1WXRA 4X66E 2MC6A 4DUZE 3WU6A 3JTZA 3MSWA 2RS7A 1ZM4A 4LF6E 4WUCA 4AQYE 1FWKA 4EMDA 3HTXA 4FN5A 4LF7I 5DNYA 3J7AG 1OJ4A 4F9CB 5LMUI 3PYDA 1FJGI 4JG4A 4B3MI 4B3RE 4JI2I 1U2RA 4DV3I 3ADGA 4BC7A 1DARA 1Z5CA 4DV0E 1Y4UA 2EWLA 1N33I 4M30A 1KKHA 3ZM7A 4LF7E 4GEQB 1N0VC 5BR8I 2OI2A 5LMUE 4DU7A 1FJGE 3J81Q 1IBLI 4J8ZA 2KOUA 2PNLA 4JI2E 4DV3E 3B82A 4K0KE 3H4LA 3F6GA 1N33E 4LF5E 1IBME 3DF6A 1HNZE 2Z5CB 2V8PA 1HR0E 1ZBQA 1RR9A 1ELOA 2Z5BB 1T4OA 2R42A 1VISA 4IZJA 3F6HA 4UTGA 4GKKI 4DV1E 4HY1A 4I3HA 2Z5EA 1DI2A 2R3VA 1HNXE 2LE2A 4X62I 3PRYA 4DV7I 4X65E 5GMEA 3ZKBA 2UXDI 4GKKE 4DPXA 2GQ0A 4DR4I 4F9BB 2F4VE 3PYFA 2UUAI 4DR3E 2B9DA 3WU5A 2CPNA 1EA6A 5ADZA 4JYAI 1NHIA 4NXMI 4LFBE 2XEXA 3LNUA 4DPUA 2VQFI 2RS6A 2N3HA 2K4VA 1DQ3A 2UUAE 4MYUA 1Z0BA 2UUBI 2O1VA 2LTSA 3JU0A 1ZXNA 2Q2EB 3C4BA 4DV5E 1XNRE 1ZM3A 1STUA 1XMOI 1H73A 4WUDA 4OOGC 2FTXB 1XMQI 2UUBE 4UT4A 1N34I 3ADIA 1RC7A 1WHQA 2UU9I 4HACB 4IZKA 4BC9A 2NUEA 2NA2A 4DPWA 3QT8A 3QT6A 1B62A 4DR2I 4F9AB 1XMOE 2V89A 1XMQE 1X47A 2CGEA 2NPFA 3ADJA 3H09A 2JWOA 4P78A 2UU9E 4WYQB 1ZM2A 1ZM9A 4JI7E 4DR2E 2HHHE 4HYMA 4N3OA 2CZ9A 4KZSA 5IT9C 2L6MA 1D6TA 3ZZUA 4WUBA 1PVGA 2LTRA 4B3TI 4LF4I 3QT7A 4DUZI 4DR7E 4JI8E 2BM0A 1N36E 2E1MA 4NXNE 4DXLA 3P06A 1QZRA 3OMLA 2F8BA 4DUYI 2HFUA 4AQYI 2HFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1R A;  4JI5 E;  4JI6 E;  4DPY A;  2LBS B;  1B63 A;  4DUY E;  2UUC E;  3JAM C;  4B3R I;  1HNW E;  4DV0 I;  4PRX A;  2AJ4 A;  2V2V A;  4LFC E;  3J7A M;  1YYO A;  4DPT A;  4K0K I;  1FWL A;  3LTO A;  1FKA E;  3ZZ0 A;  4LF5 I;  1IBM I;  1HNZ I;  2VQE E;  2L2M A;  2LJH A;  2BV3 A;  1HR0 I;  3T1H E;  2DEJ A;  1WUU A;  1XNQ I;  3QT5 A;  1YYW A;  4DV1 I;  1HNX I;  3J7Y p;  1MU5 A;  4X65 I;  2LUQ A;  1XNQ E;  1KIJ A;  2LUP B;  3V2U C;  4DV4 I;  4JI0 E;  2F4V I;  4DR3 I;  2DEI A;  1NHJ A;  4P7A A;  4LFB I;  4ZVI A;  3F0N A;  5IT9 Q;  3T1Y I;  2UXC I;  1UEK A;  4DV4 E;  2KHX A;  1Z5A A;  4OX9 I;  4MYT A;  1A6F A;  4JI4 E;  2EZ6 A;  1YYK A;  4DU8 A;  4JI3 E;  4DV5 I;  3T1Y E;  2UXC E;  1XNR I;  4PU9 A;  2J7K A;  4R1F A;  2VF3 A;  4OX9 E;  3ZZT A;  4USM A;  1Z5B A;  2HKE A;  1QU6 A;  1Z0E A;  1PKP A;  3P1X A;  4KHP I;  1K47 A;  3JAM Q;  4FWG A;  1T4N A;  2BM1 A;  3K1J A;  2ZM6 I;  3LPS A;  1FNM A;  2MDR A;  4RPF A;  2GS8 A;  4KHP E;  1UHZ A;  3PYG A;  3B8H A;  4DR6 I;  4JI7 I;  5LMN E;  2HHH I;  4DV6 E;  4FW9 A;  5FLX C;  2ZM6 E;  3J81 C;  2N3G A;  1RQ0 A;  4DR6 E;  4DR7 I;  4JI8 I;  2YT4 A;  4KQV A;  4DV2 E;  1N36 I;  4NXN I;  4ED4 A;  1S16 A;  4M1K A;  4JI5 I;  1KTV A;  4X64 I;  4JI6 I;  4Z7Y A;  2IHR 1;  3J80 C;  1KVK A;  3GON A;  4YHH I;  2UUC I;  3OTO E;  1HNW I;  4HXZ A;  2L2K B;  4X64 E;  4LFA I;  2EFG A;  4LFC I;  1N32 I;  2WW4 A;  4YHH E;  2ZBK B;  2A2C A;  5A2Q C;  1RRE A;  4LFA E;  1Z0W A;  2VQE I;  1BKN A;  1J5E E;  2UXB E;  3T1H I;  1N32 E;  2E5L E;  2B7V A;  4YY3 I;  5GMD A;  4JV5 E;  2NUF A;  3VYY A;  4WFT A;  2JVA A;  1IBK I;  3K17 A;  4GKJ I;  3V5R A;  2X7I A;  4YY3 E;  2L2N A;  3LLH A;  3VYX A;  4JI0 I;  1IBK E;  4B3S I;  4GKJ E;  1J26 A;  4PRV A;  5IWA I;  1Z0V A;  5FLX Q;  2B3T B;  4URL A;  2V2Q A;  2L3J A;  2HK3 A;  4B3S E;  4B3M E;  4FWD A;  4JI4 I;  3WU3 A;  5IWA E;  1EI1 A;  1NHH A;  3PYE A;  4JI3 I;  5BR8 E;  2NUG A;  1IBL E;  3B78 A;  1X48 A;  4X8W A;  2HKJ A;  1PIE A;  1O0W A;  3HUL A;  1T4L B;  3J80 Q;  3WU4 A;  2L33 A;  1H7S A;  4DR1 I;  2V2Z A;  1Z59 A;  2DMY A;  4HAC A;  5LL6 R;  2L3C A;  1WHN A;  2DB2 A;  4DR5 I;  5LMN I;  4DV6 I;  4JI1 I;  1MX0 A;  4DV7 E;  4X62 E;  1YZ9 A;  2UXD E;  1H74 A;  4DR1 E;  1S4E A;  5A2Q Q;  4DR4 E;  2DIX A;  4DR5 E;  1UIL A;  2JY9 A;  1X49 A;  4XTJ A;  4DV2 I;  4FWH A;  4JI1 E;  1I94 I;  1ZBT A;  4JYA E;  4NXM E;  2ZIT A;  5L3J A;  3ADL A;  2X36 A;  4P52 A;  2VQF E;  3D4J A;  1H72 C;  3Q1Q A;  4LF9 I;  1ZXM A;  1I94 E;  1Z0G A;  2A2D A;  1EKZ A;  3OTO I;  1N0U A;  2RSM A;  1Z0T A;  4USK A;  1H7U A;  4DKK A;  4LF9 E;  1N34 E;  2B7T A;  2LJP A;  1NZ0 A;  1FI4 A;  3C4T A;  1XHK A;  2RTX A;  2HK2 A;  4M2Z A;  3M6A A;  1J5E I;  2UXB I;  4LF8 I;  3CWV A;  2E5L I;  2LRS A;  4Z7C A;  4X66 I;  1MG7 A;  3ZKD A;  4JV5 I;  1Z0C A;  5CFF E;  1GQE A;  4LF8 E;  2V34 A;  4B3T E;  4LF4 E;  4LF6 I;  4X66 E;  4DUZ E;  3WU6 A;  2RS7 A;  1ZM4 A;  4LF6 E;  4WUC A;  4AQY E;  1FWK A;  4EMD A;  3HTX A;  4FN5 A;  4LF7 I;  3J7A G;  1OJ4 A;  5LMU I;  3PYD A;  1FJG I;  4JG4 A;  4B3M I;  4B3R E;  4JI2 I;  1U2R A;  4DV3 I;  3ADG A;  1DAR A;  1Z5C A;  4DV0 E;  1N33 I;  1KKH A;  4M30 A;  3ZM7 A;  4LF7 E;  1N0V C;  5BR8 I;  2OI2 A;  5LMU E;  4DU7 A;  1FJG E;  3J81 Q;  1IBL I;  4JI2 E;  4DV3 E;  3B82 A;  4K0K E;  3H4L A;  1N33 E;  4LF5 E;  1IBM E;  1HNZ E;  2V8P A;  1HR0 E;  1RR9 A;  1ELO A;  1T4O A;  2R42 A;  1VIS A;  4UTG A;  4GKK I;  4DV1 E;  4HY1 A;  4I3H A;  1DI2 A;  2R3V A;  1HNX E;  4DV7 I;  4X62 I;  4X65 E;  5GME A;  3ZKB A;  2UXD I;  4GKK E;  4DPX A;  4DR4 I;  2F4V E;  3PYF A;  2UUA I;  4DR3 E;  3WU5 A;  2CPN A;  1EA6 A;  4JYA I;  1NHI A;  4NXM I;  4LFB E;  2XEX A;  3LNU A;  4DPU A;  2VQF I;  2RS6 A;  2N3H A;  2UUA E;  4MYU A;  1Z0B A;  2UUB I;  2LTS A;  1ZXN A;  2Q2E B;  3C4B A;  4DV5 E;  1XNR E;  1ZM3 A;  1STU A;  1XMO I;  1H73 A;  4WUD A;  4OOG C;  1XMQ I;  2UUB E;  4UT4 A;  1N34 I;  3ADI A;  1RC7 A;  1WHQ A;  2UU9 I;  4HAC B;  2NUE A;  2NA2 A;  4DPW A;  3QT8 A;  3QT6 A;  1B62 A;  4DR2 I;  1XMO E;  1XMQ E;  1X47 A;  2NPF A;  3ADJ A;  2UU9 E;  4WYQ B;  1ZM2 A;  1ZM9 A;  4JI7 E;  4DR2 E;  2HHH E;  4HYM A;  2CZ9 A;  5IT9 C;  1D6T A;  3ZZU A;  4WUB A;  1PVG A;  2LTR A;  4B3T I;  4LF4 I;  3QT7 A;  4DUZ I;  4DR7 E;  4JI8 E;  2BM0 A;  1N36 E;  4NXN E;  4DXL A;  1QZR A;  4DUY I;  2HFU A;  4AQY I;  2HFS A; 
#chains in the Genus database with same CATH topology
 2E1R A;  1SFE A;  2CG9 A;  2EMB A;  2GO3 A;  5KL5 A;  4JI5 E;  2EL5 A;  4JI6 E;  4Q28 A;  4MU3 A;  1GTK A;  2ODR D;  4DPY A;  2EPX A;  4NZV A;  2LBS B;  2EL6 A;  1B63 A;  1OYP A;  4DUY E;  3JAM C;  2UUC E;  3GME A;  5KL4 A;  4B3R I;  1HNW E;  2EOE A;  4PRX A;  4DV0 I;  2AJ4 A;  1JK2 A;  1TN9 A;  2V2V A;  3M7N G;  2V8Q B;  1YFH A;  3M85 D;  4LFC E;  3J7A M;  2EN2 A;  2EMC A;  2EOJ A;  2PO2 B;  1YYO A;  2JYA A;  1Y60 A;  5K36 A;  4DPT A;  5JEA E;  4K0K I;  4FW4 A;  1UDN A;  4MDT A;  5JEA C;  1X6H A;  1FWL A;  2MDG A;  1FKA E;  1YUI A;  4WSG A;  3LTO A;  2BA0 D;  2C39 A;  3FIG A;  2BA0 G;  2VQE E;  3ZZ0 A;  1HNZ I;  1IBM I;  2L2M A;  2LJH A;  2BV3 A;  2PO0 A;  1HR0 I;  1GZ6 A;  2ELZ A;  3T1H E;  1HK7 A;  2M1S A;  2EPP A;  2DEJ A;  2O1W A;  1IQO A;  2EPU A;  2Q8U A;  2JPA A;  1WUU A;  2PNZ A;  1XNQ I;  3QT5 A;  3L7Z B;  1YYW A;  2YZT A;  3PS3 A;  2DGC A;  4DV1 I;  3HQ1 A;  5JEA F;  2EPC A;  1UDO A;  2YTE A;  2JR1 A;  1HNX I;  1PDA A;  3J7Y p;  1MU5 A;  4X65 I;  2M9A A;  3DD6 A;  1UN6 B;  2EM2 A;  2LUQ A;  3BGH A;  3VK6 A;  1XNQ E;  2EM7 A;  4MU0 A;  5EKW A;  2WNR A;  1A1F A;  1E3H A;  1KIJ A;  4LCF A;  2LUP B;  3IWB A;  3V2U C;  4DV4 I;  4JI0 E;  2F4V I;  5DNL A;  2EMY A;  4DR3 I;  2DEI A;  2YTQ A;  2EOY A;  2YTO A;  1IMU A;  2YSP A;  4R03 A;  1NHJ A;  4BMJ A;  2EMH A;  4P7A A;  3LML A;  4LFB I;  4ZVI A;  3F0N A;  1QNT A;  2EOO A;  4MU1 A;  5IT9 Q;  4F6N A;  3T1Y I;  3C6M A;  2UXC I;  1UEK A;  3Q6N A;  4DV4 E;  3THN A;  2RPC A;  2PNM A;  1WJP A;  2KHX A;  1Z5A A;  4OX9 I;  4MYT A;  1A6F A;  5A69 A;  5AC4 A;  4NBQ A;  4JI4 E;  1TF6 A;  4MU4 A;  4ZYG A;  2EM3 A;  2ENA A;  1EH7 A;  2EZ6 A;  1USU A;  1YYK A;  2YTI A;  2NN6 B;  2L8T A;  2EMI A;  4MLQ A;  3ZOQ B;  4DU8 A;  2G7H A;  4JI3 E;  4DV5 I;  4IFD B;  5A6A A;  3BID A;  3T1Y E;  2UXC E;  1UDQ A;  1XNR I;  4PU9 A;  2JOX A;  2J7K A;  4R1F A;  2VF3 A;  4OX9 E;  3ZZT A;  4USM A;  2EE8 A;  1Z5B A;  4FW6 A;  4BA1 A;  4LF5 I;  2HKE A;  4IZJ B;  1QU6 A;  4U3B A;  5EL9 A;  1Z0E A;  4FK5 C;  2FV4 B;  1PKP A;  3KWR A;  3P1X A;  4KHP I;  1K47 A;  1R6L A;  2MKN A;  2LMZ A;  3PS2 A;  2EOX A;  2CT1 A;  4LOM A;  4FWG A;  1T4N A;  3JAM Q;  2BM1 A;  3K1J A;  2ZM6 I;  2IOP A;  3LPS A;  5IXM B;  4OO1 B;  2A25 A;  2ENH A;  1FNM A;  2MDR A;  4BHB A;  4RPF A;  5F3W A;  2H36 X;  2GS8 A;  4KHP E;  1UHZ A;  3PYG A;  3B8H A;  4DR6 I;  4JI7 I;  1NEI A;  5LMN E;  2HHH I;  2PO1 A;  4WXC A;  4DV6 E;  4FW9 A;  2EOM A;  1PJS A;  2WZO A;  2V83 A;  4R8O A;  5FLX C;  3HPZ A;  3J81 C;  2EP3 A;  2ZM6 E;  4TUG A;  2N3G A;  3AUZ A;  1VI7 A;  4I8O A;  2MC5 A;  4IFD D;  4BA2 A;  4BCA A;  2EM8 A;  2D9H A;  1RQ0 A;  4L5N C;  2V87 A;  4DR6 E;  2IOQ A;  4JI8 I;  4DR7 I;  2YT4 A;  4IFD F;  1BB8 A;  4KQV A;  4DV2 E;  1N36 I;  5TSE A;  3U1Y A;  4NXN I;  1R6M A;  4BS9 A;  4ED4 A;  3DJW A;  2RSI A;  2EM4 A;  1S16 A;  2WBT A;  2O3Z A;  1NCS A;  1Y4S A;  4M1K A;  3IWC A;  2EOH A;  5C0X F;  4KWY A;  2FGG A;  1UBD C;  1KTV A;  4X64 I;  3HXL A;  4JI5 I;  4JI6 I;  2ODR C;  4Z7Y A;  2IHR 1;  2M4I A;  5JEA A;  2JT2 A;  4OO1 D;  4R2C A;  3J80 C;  1KVK A;  4F6M A;  1Y6Z A;  2F1D A;  4R2R A;  3GON A;  3C6K A;  4YHH I;  2UUC I;  3OTO E;  3Q6M A;  1HNW I;  2BA1 G;  2L2K B;  2JEB A;  4HXZ A;  1AH5 A;  5DRP A;  4IS9 A;  2EMF A;  2CVE A;  1PJT A;  2YPN A;  3EPK A;  2ELY A;  5AE2 A;  4X64 E;  1AAY A;  2BBG A;  4ZYD A;  2IER A;  4LFA I;  4AIM A;  2EFG A;  4GZN C;  2GLI A;  4LFC I;  1N32 I;  2WW4 A;  5KL6 A;  2VF1 A;  4WX9 A;  4YHH E;  2WBS A;  2ZBK B;  2A2C A;  4M0V A;  4N4R B;  1A1J A;  1A1K A;  3NZK A;  5A2Q C;  3M7N D;  1RRE A;  4LFA E;  1Z0W A;  2VQE I;  2YRH A;  2IES A;  1BKN A;  5AE1 A;  1J5E E;  1TF3 A;  2UXB E;  3T1H I;  1N32 E;  2LVH A;  4R2Q A;  2EOF A;  4ZYE A;  2E5L E;  3RMP A;  2B7V A;  4YY3 I;  1B69 A;  5GMD A;  1EH8 A;  4JV5 E;  2NUF A;  1L4S A;  3VYY A;  4AM3 A;  4WFT A;  2JVA A;  4LPF A;  1Z1B A;  2Z5C A;  2C38 B;  4F54 A;  1IBK I;  4P7D A;  3K17 A;  2EMW A;  4GKJ I;  2C37 B;  2YU5 A;  1USV A;  3V5R A;  2X7I A;  2JOB A;  4YY3 E;  3GCM A;  2EN3 A;  5AE3 A;  2Z5B A;  1YPN A;  3P3E A;  2L2N A;  2YTN A;  3LLH A;  2BR2 A;  3EQ1 A;  2O1T A;  3VYX A;  4JI0 I;  5KL2 A;  1IBK E;  4B3S I;  5A6B D;  3P76 A;  4GKJ E;  2EQ3 A;  1J26 A;  3TQM A;  4M9V C;  3HPS A;  2DLQ A;  4PRV A;  2EN6 A;  1MEY C;  5IWA I;  2ENC A;  2KON A;  2EOR A;  2EMZ A;  1XXE A;  1Z0V A;  2V86 A;  3KZY A;  2J7J A;  5FLX Q;  2B3T B;  4URL A;  2EMK A;  2V2Q A;  2L3J A;  1A1H A;  2HK3 A;  4B3S E;  4X9J A;  5K36 B;  4B3M E;  4WPY A;  4FWD A;  4RH8 A;  4JI4 I;  1ZAA C;  3WU3 A;  5IWA E;  1T38 A;  1EI1 A;  1NHH A;  2YTP A;  3PYE A;  4IS1 C;  2PO0 B;  4JI3 I;  2VE7 C;  5BR8 E;  2NUG A;  1X6F A;  1IBL E;  5AAS A;  3B78 A;  1X48 A;  4GQU A;  1SR9 A;  5KL7 A;  4X8W A;  2HKJ A;  2NAB A;  1PIE A;  1O0W A;  2PNZ B;  5A6K A;  5DRQ A;  3HUL A;  2LV2 A;  3EPL A;  4WSP A;  4FW5 A;  5C0X A;  1T4L B;  3J80 Q;  3K85 A;  3WU4 A;  2L33 A;  5KL3 A;  1H7S A;  2L92 A;  4J3D A;  2LO3 A;  2WCC 3;  4DR1 I;  2EPK X;  2V2Z A;  1Z59 A;  4LU9 A;  2WNR B;  1G2D C;  2DMY A;  4BHC A;  4HAC A;  5LL6 R;  2EPN A;  4RHB B;  2L3C A;  1WHN A;  2DB2 A;  2R76 A;  5LMN I;  4DR5 I;  5K36 D;  1MGT A;  4R2A A;  4O43 A;  4DV6 I;  2CTD A;  4LCG A;  1MX0 A;  1N3G A;  4X62 E;  4DV7 E;  4JI1 I;  2LT7 A;  2R1F A;  2EPM X;  2EMA A;  2HGH A;  4DMI A;  1YZ9 A;  2UXD E;  4DR1 E;  1H74 A;  1S4E A;  2VES A;  4IFD E;  5A2Q Q;  4IFD C;  2EQ1 A;  2YWQ A;  2WP8 A;  1A1G A;  4DR4 E;  2DIX A;  4DR5 E;  1UIL A;  2JY9 A;  1X49 A;  4XTJ A;  4DV2 I;  3P3G A;  2DMI A;  3UHM A;  4FWH A;  2EPL X;  4JI1 E;  5C0X E;  1ZU1 A;  5C0X C;  1I94 I;  2EOQ A;  2EN8 A;  1ZBT A;  1A1L A;  4JYA E;  4LTY A;  2NN6 D;  2JE6 A;  4NXM E;  2O1U A;  3EPJ A;  2AE8 A;  2ZIT A;  2HJJ A;  2N8X A;  3ADL A;  2NN6 F;  3QG5 C;  2X36 A;  4P52 A;  5L3J A;  1Y5Y A;  2VQF E;  2RQL A;  2YTG A;  3D4J A;  4L8N A;  2DRP A;  4BA1 B;  2EN1 A;  2YRM A;  1KJK A;  1H72 C;  3Q1Q A;  4IZJ D;  4LF9 I;  1ZXM A;  1I94 E;  2JEA B;  1Z0G A;  2DSY A;  2I9I A;  3ECR A;  2A2D A;  1EKZ A;  3OTO I;  5T6J A;  4OZE A;  1N0U A;  2RSM A;  1Z0T A;  3IWD A;  1WRJ A;  1KYQ A;  4USK A;  2V85 A;  1H7U A;  1X3C A;  3HJC A;  4DKK A;  4LF9 E;  1LLM C;  2B7T A;  1N34 E;  2J65 A;  4IZK B;  2LJP A;  1A1I A;  1P42 A;  2YRK A;  4OO1 F;  1NZ0 A;  2BA1 D;  1FI4 A;  3C4T A;  2EOI A;  2YSO A;  2M7Q A;  4Q35 B;  1XHK A;  2RTX A;  2PO1 B;  3AV0 A;  5A6J A;  2HK2 A;  4M2Z A;  2YTF A;  4BBY A;  5AC5 A;  3M6A A;  1J5E I;  2UXB I;  4LF8 I;  1PJQ A;  4TUI A;  3B4T A;  3CWV A;  4BA2 B;  4R2D A;  2EPO A;  2V88 A;  1YSA C;  2PO2 A;  2E5L I;  2LRS A;  4Z7C A;  4X66 I;  1MG7 A;  1ZR9 A;  3K6Q A;  2JP9 A;  3ZKD A;  4JV5 I;  1Z0C A;  5CFF E;  4QNK A;  4FW7 A;  1GQE A;  2EM6 A;  5FWK A;  4U3D A;  4LF8 E;  2V34 A;  4B3T E;  1DGC A;  4LF4 E;  1WXR A;  4LF6 I;  4X66 E;  2MC6 A;  4DUZ E;  3BF2 A;  3WU6 A;  2EN7 A;  3CDJ A;  4O4K A;  3JTZ A;  5JEA B;  2EJ4 A;  3L7Z A;  3MSW A;  4FW3 A;  2RS7 A;  2GPI A;  4OKG A;  4O5G A;  1ZM4 A;  4F2J C;  2JEB B;  3P3C A;  4LF6 E;  4WUC A;  4AQY E;  1FWK A;  4EMD A;  5IV8 B;  3HTX A;  4FN5 A;  2EOZ A;  4LF7 I;  5DNY A;  3J7A G;  1OJ4 A;  4F9C B;  3THO B;  3M85 G;  2GHF A;  3PYD A;  5LMU I;  1FJG I;  4JG4 A;  3L00 A;  4B3M I;  5DRR A;  4B3R E;  4JI2 I;  1U2R A;  4DV3 I;  4R2E A;  3ADG A;  4BC7 A;  2EL4 A;  1F2I G;  1DAR A;  2K7I A;  2I13 A;  4DV0 E;  1Y4U A;  1Z5C A;  2EWL A;  4AID A;  4M30 A;  1KKH A;  3ZM7 A;  4GEQ B;  4LF7 E;  1N33 I;  1N0V C;  1T39 A;  1JK1 A;  5BR8 I;  2PRT A;  2OI2 A;  5LMU E;  4DU7 A;  1FJG E;  3J81 Q;  1IBL I;  4J8Z A;  2KOU A;  2PNL A;  4JI2 E;  4DV3 E;  2VRD A;  3B82 A;  4K0K E;  3H4L A;  3F6G A;  1N33 E;  2C39 B;  4LF5 E;  2DLK A;  3KRN A;  5DRO A;  5JEA D;  1IBM E;  2NN6 A;  3DF6 A;  1HNZ E;  2Z5C B;  2EN4 A;  2V8P A;  1HR0 E;  1ZBQ A;  4IFD A;  1RR9 A;  1ELO A;  2Z5B B;  3CDI A;  1T4O A;  2R42 A;  1VIS A;  4IZJ A;  3F6H A;  2LJU A;  2ADR A;  2WBU A;  2BR2 B;  4UTG A;  4GKK I;  4LCH A;  2EML A;  4DV1 E;  4HY1 A;  5K36 E;  4I3H A;  2Z5E A;  5K36 C;  1DI2 A;  2R3V A;  1HNX E;  1UDS A;  2LE2 A;  4X62 I;  3PRY A;  2E72 A;  4DV7 I;  2EM5 A;  4QNJ A;  2EOS A;  4X65 E;  5GME A;  3ZKB A;  5ELW A;  2UXD I;  4GKK E;  4OO1 A;  4DPX A;  2GQ0 A;  3MHH C;  1G2F C;  4DR4 I;  4F9B B;  2F4V E;  3PYF A;  2UUA I;  4DR3 E;  2B9D A;  3WU5 A;  2CPN A;  1EA6 A;  2LCE A;  2NN6 E;  2NN6 C;  5K36 F;  5ADZ A;  2BB8 A;  1NHI A;  4JYA I;  2CSH A;  4NXM I;  4LFB E;  3H1C A;  2XEX A;  5DNX A;  4ISA A;  2YTD A;  3LNU A;  4DPU A;  1X6E A;  2MKD A;  1OYS A;  2VQF I;  2RS6 A;  2N3H A;  2K4V A;  1DQ3 A;  2UUA E;  4MYU A;  1Z0B A;  3VHT B;  2EM0 A;  2UUB I;  4MQY A;  2EQ0 A;  2YU8 A;  4IJD A;  2O1V A;  4ZYH A;  1YH8 A;  2LTS A;  3JU0 A;  4HEI A;  4R2S A;  5C0X B;  2JEA A;  1ZXN A;  2Q2E B;  3C4B A;  2EMX A;  4DV5 E;  1XNR E;  1ZM3 A;  1STU A;  1XMO I;  1H73 A;  4WUD A;  4OOG C;  2FTX B;  4AQY I;  4OO1 E;  2EPA A;  1BBO A;  1XMQ I;  3EPH A;  2UUB E;  4UT4 A;  1E3P A;  4OO1 C;  1IQS A;  1N34 I;  5LLQ A;  3ADI A;  2GO4 A;  1RC7 A;  1WHQ A;  2UU9 I;  4HAC B;  4IZK A;  2EMG A;  1X5W A;  4BC9 A;  2NUE A;  2NA2 A;  3MHS C;  4DPW A;  3QT8 A;  3QT6 A;  1YHC A;  1B62 A;  4DR2 I;  4F9A B;  1XMO E;  2V89 A;  2HC5 A;  1XMQ E;  1YUJ A;  3M99 B;  4MLV A;  1X47 A;  2CGE A;  2YTJ A;  2NPF A;  3ADJ A;  3BBG A;  3H09 A;  2JWO A;  4P78 A;  2WP8 B;  2UU9 E;  5A6B A;  4WYQ B;  1ZM2 A;  1P47 A;  4JI7 E;  1OYR A;  4DR2 E;  1ZM9 A;  2EPZ A;  4NHR A;  2HHH E;  4HYM A;  4N3O A;  3KZZ A;  2CZ9 A;  4KZS A;  5IT9 C;  2L6M A;  1BBG A;  3U1K A;  1D6T A;  2JE6 B;  4HTG A;  3ZZU A;  1RHY A;  2EM9 A;  5C0X D;  4WUB A;  1PVG A;  3UK3 C;  2LTR A;  4B3T I;  4LF4 I;  2EPR A;  3QT7 A;  3HKM A;  4O24 A;  4DUZ I;  4DR7 E;  1RMD A;  4JI8 E;  4WXD A;  2BM0 A;  2JXP A;  1N36 E;  2E1M A;  1EH6 A;  4NXN E;  4DXL A;  3P06 A;  4R2P A;  1QZR A;  3OML A;  2F8B A;  2C38 A;  3GLL A;  3PS1 A;  4DUY I;  2HFU A;  2C37 A;  2HFS A; 
#chains in the Genus database with same CATH homology
 2E1R A;  2CG9 A;  4JI5 E;  4JI6 E;  4Q28 A;  2ODR D;  4DPY A;  2LBS B;  1B63 A;  4DUY E;  3JAM C;  2UUC E;  4B3R I;  1HNW E;  4DV0 I;  4PRX A;  2AJ4 A;  2V2V A;  2V8Q B;  4LFC E;  3J7A M;  1YYO A;  4DPT A;  4K0K I;  1FWL A;  3LTO A;  1FKA E;  3ZZ0 A;  4LF5 I;  1IBM I;  3FIG A;  1HNZ I;  2VQE E;  2L2M A;  2LJH A;  2BV3 A;  1HR0 I;  1GZ6 A;  3T1H E;  1HK7 A;  2M1S A;  2DEJ A;  2O1W A;  1WUU A;  1XNQ I;  3QT5 A;  1YYW A;  2YZT A;  4DV1 I;  3HQ1 A;  2JR1 A;  1HNX I;  3J7Y p;  1MU5 A;  4X65 I;  3VK6 A;  2LUQ A;  1XNQ E;  1KIJ A;  2LUP B;  3IWB A;  3V2U C;  4DV4 I;  4JI0 E;  2F4V I;  4DR3 I;  2DEI A;  4R03 A;  1NHJ A;  4BMJ A;  4P7A A;  3LML A;  4LFB I;  4ZVI A;  3F0N A;  5IT9 Q;  3T1Y I;  2UXC I;  1UEK A;  3Q6N A;  4DV4 E;  2PNM A;  2KHX A;  1Z5A A;  4OX9 I;  4MYT A;  1A6F A;  4JI4 E;  1USU A;  2EZ6 A;  1YYK A;  2L8T A;  3ZOQ B;  4DU8 A;  2G7H A;  4JI3 E;  4DV5 I;  3T1Y E;  2UXC E;  1XNR I;  4PU9 A;  2JOX A;  2J7K A;  4R1F A;  2VF3 A;  4OX9 E;  3ZZT A;  4USM A;  1Z5B A;  2HKE A;  4IZJ B;  1QU6 A;  1Z0E A;  2FV4 B;  1PKP A;  3KWR A;  3P1X A;  4KHP I;  1K47 A;  2LMZ A;  3JAM Q;  4FWG A;  1T4N A;  2BM1 A;  3K1J A;  2ZM6 I;  2IOP A;  3LPS A;  1FNM A;  2MDR A;  4RPF A;  5F3W A;  2H36 X;  2GS8 A;  4KHP E;  1UHZ A;  3PYG A;  3B8H A;  4DR6 I;  4JI7 I;  5LMN E;  2HHH I;  4DV6 E;  4FW9 A;  2WZO A;  2V83 A;  4R8O A;  5FLX C;  3HPZ A;  3J81 C;  2ZM6 E;  4TUG A;  2N3G A;  3AUZ A;  4I8O A;  2MC5 A;  4BCA A;  1RQ0 A;  4L5N C;  2V87 A;  4DR6 E;  2IOQ A;  4JI8 I;  4DR7 I;  2YT4 A;  4KQV A;  4DV2 E;  1N36 I;  4NXN I;  4BS9 A;  4ED4 A;  3DJW A;  1S16 A;  1Y4S A;  4M1K A;  3IWC A;  2FGG A;  4JI5 I;  1KTV A;  4X64 I;  3HXL A;  4JI6 I;  2ODR C;  4Z7Y A;  2IHR 1;  2M4I A;  3J80 C;  1KVK A;  1Y6Z A;  3GON A;  4YHH I;  2UUC I;  3OTO E;  3Q6M A;  1HNW I;  4HXZ A;  2L2K B;  5AE2 A;  4X64 E;  4LFA I;  2EFG A;  4LFC I;  1N32 I;  2WW4 A;  2VF1 A;  4YHH E;  2ZBK B;  2A2C A;  4M0V A;  5A2Q C;  1RRE A;  4LFA E;  1Z0W A;  2VQE I;  1BKN A;  5AE1 A;  1J5E E;  2UXB E;  3T1H I;  1N32 E;  2E5L E;  3RMP A;  2B7V A;  4YY3 I;  5GMD A;  4JV5 E;  2NUF A;  3VYY A;  4WFT A;  2JVA A;  2Z5C A;  4F54 A;  1IBK I;  4P7D A;  3K17 A;  4GKJ I;  1USV A;  3V5R A;  2X7I A;  2JOB A;  4YY3 E;  5AE3 A;  2Z5B A;  2L2N A;  3LLH A;  2O1T A;  3VYX A;  4JI0 I;  1IBK E;  4B3S I;  4GKJ E;  1J26 A;  3HPS A;  4PRV A;  5IWA I;  2KON A;  1Z0V A;  2V86 A;  5FLX Q;  2B3T B;  4URL A;  2V2Q A;  2L3J A;  2HK3 A;  4B3S E;  4B3M E;  4WPY A;  4FWD A;  4JI4 I;  3WU3 A;  5IWA E;  1EI1 A;  1NHH A;  3PYE A;  4JI3 I;  2VE7 C;  5BR8 E;  2NUG A;  1IBL E;  5AAS A;  3B78 A;  1X48 A;  1SR9 A;  4X8W A;  2HKJ A;  1PIE A;  1O0W A;  3HUL A;  4WSP A;  1T4L B;  3J80 Q;  3K85 A;  3WU4 A;  2L33 A;  1H7S A;  2L92 A;  4DR1 I;  2V2Z A;  1Z59 A;  4LU9 A;  2DMY A;  4HAC A;  5LL6 R;  2L3C A;  1WHN A;  2DB2 A;  4DR5 I;  5LMN I;  4DV6 I;  4JI1 I;  1MX0 A;  4DV7 E;  4X62 E;  4DMI A;  1YZ9 A;  2UXD E;  4DR1 E;  1H74 A;  1S4E A;  5A2Q Q;  4DR4 E;  2DIX A;  4DR5 E;  1UIL A;  2JY9 A;  1X49 A;  4XTJ A;  4DV2 I;  4FWH A;  4JI1 E;  1I94 I;  1ZBT A;  4JYA E;  4LTY A;  2O1U A;  4NXM E;  2ZIT A;  5L3J A;  3ADL A;  2X36 A;  4P52 A;  2VQF E;  3D4J A;  4L8N A;  1H72 C;  3Q1Q A;  4IZJ D;  4LF9 I;  1ZXM A;  1I94 E;  1Z0G A;  2DSY A;  2A2D A;  1EKZ A;  3OTO I;  5T6J A;  1N0U A;  2RSM A;  1Z0T A;  3IWD A;  4USK A;  2V85 A;  1H7U A;  3HJC A;  4DKK A;  4LF9 E;  1N34 E;  2B7T A;  4IZK B;  2LJP A;  1NZ0 A;  1FI4 A;  3C4T A;  1XHK A;  2M7Q A;  2RTX A;  3AV0 A;  2HK2 A;  4M2Z A;  4BBY A;  3M6A A;  1J5E I;  2UXB I;  4LF8 I;  4TUI A;  3CWV A;  2E5L I;  2V88 A;  2LRS A;  4Z7C A;  4X66 I;  1MG7 A;  3K6Q A;  3ZKD A;  4JV5 I;  1Z0C A;  5CFF E;  1GQE A;  5FWK A;  4LF8 E;  2V34 A;  4B3T E;  4LF4 E;  4LF6 I;  1WXR A;  4X66 E;  2MC6 A;  4DUZ E;  3WU6 A;  3JTZ A;  3MSW A;  2RS7 A;  1ZM4 A;  4LF6 E;  4WUC A;  4AQY E;  1FWK A;  4EMD A;  3HTX A;  4FN5 A;  4LF7 I;  5DNY A;  3J7A G;  1OJ4 A;  4F9C B;  5LMU I;  3PYD A;  1FJG I;  4JG4 A;  4B3M I;  4B3R E;  4JI2 I;  1U2R A;  4DV3 I;  3ADG A;  4BC7 A;  1DAR A;  1Z5C A;  4DV0 E;  1Y4U A;  2EWL A;  1N33 I;  4M30 A;  1KKH A;  3ZM7 A;  4LF7 E;  4GEQ B;  1N0V C;  5BR8 I;  2OI2 A;  5LMU E;  4DU7 A;  1FJG E;  3J81 Q;  1IBL I;  4J8Z A;  2KOU A;  2PNL A;  4JI2 E;  4DV3 E;  3B82 A;  4K0K E;  3H4L A;  3F6G A;  1N33 E;  4LF5 E;  1IBM E;  3DF6 A;  1HNZ E;  2Z5C B;  2V8P A;  1HR0 E;  1ZBQ A;  1RR9 A;  1ELO A;  2Z5B B;  1T4O A;  2R42 A;  1VIS A;  4IZJ A;  3F6H A;  4UTG A;  4GKK I;  4DV1 E;  4HY1 A;  4I3H A;  2Z5E A;  1DI2 A;  2R3V A;  1HNX E;  2LE2 A;  4X62 I;  3PRY A;  4DV7 I;  4X65 E;  5GME A;  3ZKB A;  2UXD I;  4GKK E;  4DPX A;  2GQ0 A;  4DR4 I;  4F9B B;  2F4V E;  3PYF A;  2UUA I;  4DR3 E;  2B9D A;  3WU5 A;  2CPN A;  1EA6 A;  5ADZ A;  4JYA I;  1NHI A;  4NXM I;  4LFB E;  2XEX A;  3LNU A;  4DPU A;  2VQF I;  2RS6 A;  2N3H A;  2K4V A;  1DQ3 A;  2UUA E;  4MYU A;  1Z0B A;  2UUB I;  2O1V A;  2LTS A;  3JU0 A;  1ZXN A;  2Q2E B;  3C4B A;  4DV5 E;  1XNR E;  1ZM3 A;  1STU A;  1XMO I;  1H73 A;  4WUD A;  4OOG C;  2FTX B;  1XMQ I;  2UUB E;  4UT4 A;  1N34 I;  3ADI A;  1RC7 A;  1WHQ A;  2UU9 I;  4HAC B;  4IZK A;  4BC9 A;  2NUE A;  2NA2 A;  4DPW A;  3QT8 A;  3QT6 A;  1B62 A;  4DR2 I;  4F9A B;  1XMO E;  2V89 A;  1XMQ E;  1X47 A;  2CGE A;  2NPF A;  3ADJ A;  3H09 A;  2JWO A;  4P78 A;  2UU9 E;  4WYQ B;  1ZM2 A;  1ZM9 A;  4JI7 E;  4DR2 E;  2HHH E;  4HYM A;  4N3O A;  2CZ9 A;  4KZS A;  5IT9 C;  2L6M A;  1D6T A;  3ZZU A;  4WUB A;  1PVG A;  2LTR A;  4B3T I;  4LF4 I;  3QT7 A;  4DUZ I;  4DR7 E;  4JI8 E;  2BM0 A;  1N36 E;  2E1M A;  4NXN E;  4DXL A;  3P06 A;  1QZR A;  3OML A;  2F8B A;  4DUY I;  2HFU A;  4AQY I;  2HFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...