4NXNI

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxnI00
2WW4A 2UUBI 4JI4E 4LFBI 3WU6A 1UEKA 3T1HI 2UXDE 4DV3I 3ZZTA 5FLXC 1RR9A 2R42A 5BR8I 4HXZA 2V34A 4LFAE 4HY1A 3LNUA 3ZKDA 2E1RA 1XNQE 1ZXMA 4OX9E 2UXDI 1HR0E 2XEXA 4EMDA 1PIEA 4HACB 5IWAI 1FJGI 2OI2A 3Q1QA 3OTOE 1Z0BA 2UU9I 4LFCI 4JYAI 1Z0WA 4GKJE 4JI1I 1NZ0A 1Z0GA 4LFCE 4LF9I 4FN5A 2ZITA 3ZKBA 4DV2I 4DR2E 1IBLE 4JI8I 4B3SI 2E5LI 1HNWI 1S16A 1U2RA 4YHHI 2NPFA 1IBMI 4B3RE 1DARA 1IBKE 2R3VA 4JI0I 4K0KI 2VF3A 2HK3A 4DV5I 4B3RI 1Z5AA 3B8HA 5IT9Q 4MYTA 4DV0E 4X62E 4X65E 4LF8E 4WUBA 3J80Q 5L3JA 4B3MI 1XMOE 3M6AA 4DR5I 1FJGE 3LPSA 4URLA 4DU7A 1MU5A 1FKAE 2VQFI 3J7AG 1H74A 1D6TA 4JV5E 4DPXA 4DPTA 4Z7YA 4DPUA 1ZM2A 4JI7I 1KKHA 5A2QC 3QT6A 4DR7I 1XMQI 3PYDA 4DR7E 4PU9A 1Z59A 1NHJA 2UXCE 4LFAI 2HKJA 3QT5A 4KHPI 1NHIA 5BR8E 3OTOI 1HNXI 4AQYI 1HNWE 2HHHI 2ZBKB 1ZM9A 1FWLA 1N0UA 4UTGA 4JI5I 3D4JA 4DV5E 4JI0E 4DR3I 4RPFA 4DV0I 4P7AA 2CZ9A 1EA6A 4GKKI 4LF6E 4NXMI 3ZM7A 5GMDA 4B3ME 2Q2EB 4DUYI 3T1HE 4LF4E 2VQFE 4JI2I 4X64E 2HK2A 4XTJA 4X62I 4DR5E 4DR4I 5FLXQ 1N34I 5LMUI 4JI7E 4DR1E 1FWKA 1N32I 2HKEA 4JYAE 4LF5E 1I94I 3QT8A 4B3TI 2UUAI 4NXNI 4JG4A 4WUCA 4DV3E 2HFUA 4FWGA 1K47A 1H7SA 2F4VE 4ED4A 3J81C 4DV2E 4DR2I 5LMNE 3PYEA 4X66I 3WU5A 1ZXNA 4JI6I 4DV7I 2UXCI 4ZVIA 4YY3E 1MX0A 3JAMC 3V2UC 1OJ4A 5LMNI 5IWAE 2VQEE 1PKPA 4DR6E 2BV3A 1B62A 4USKA 2A2CA 1EI1A 4R1FA 1S4EA 1XHKA 3ZZUA 1B63A 3J7AM 3T1YE 3F0NA 4YHHE 4DV4I 4B3SE 4DPWA 1Z0EA 4DR6I 3ZZ0A 1Z0TA 2UUBE 3H4LA 4JI4I 4LF5I 1HNZE 4DUYE 1J5EI 4DV1E 4P52A 1N34E 4LF7I 4DR4E 4X65I 4DU8A 2DEIA 3B78A 2UXBE 1HR0I 1N33E 4DUZI 1XNQI 5LL6R 1I94E 1N36I 1H72C 4DR1I 4USMA 1MG7A 1VISA 4FWDA 3V5RA 1IBLI 1A6FA 4DV6I 4I3HA 4AQYE 1WUUA 4JI1E 4DV7E 1IBKI 2EFGA 4Z7CA 2V8PA 1HNXE 3PYGA 3CWVA 1ZM4A 3T1YI 1FNMA 4LF9E 3PYFA 2AJ4A 3K17A 4GKKE 2ZM6E 2UUCE 3K1JA 4JI3I 4WUDA 4JI3E 4LF4I 2UUCI 4JI2E 1FI4A 2X36A 1NHHA 3LTOA 4JV5I 1Z0CA 1RREA 1N32E 3QT7A 4LF6I 2X7IA 1N33I 4OX9I 1XMQE 1Z0VA 4LFBE 2UUAE 4UT4A 4FWHA 1KVKA 4DV1I 4MYUA 2V2ZA 4PRVA 5LMUE 4KQVA 4X66E 4DV6E 5GMEA 2J7KA 2A2DA 3JAMQ 4M1KA 3HULA 1QZRA 3B82A 2E5LE 2BM0A 2UXBI 2HHHE 2HFSA 1ZM3A 4YY3I 4JI8E 2V2VA 1KTVA 4B3TE 1BKNA 4NXNE 1N36E 4JI6E 4K0KE 4KHPE 1N0VC 2V2QA 5A2QQ 1Z5BA 2BM1A 5IT9C 4GKJI 4PRXA 4JI5E 2F4VI 1H7UA 1PVGA 2VQEI 1KIJA 3GONA 4FW9A 4DR3E 1H73A 3WU4A 1ELOA 4DXLA 2DEJA 1XNRI 2GS8A 2UU9E 4NXME 4HACA 1IBME 3WU3A 2LJPA 3J80C 4X64I 4DPYA 4DV4E 1Z5CA 4LF7E 3J81Q 1XMOI 2ZM6I 1XNRE 1J5EE 4LF8I 4DUZE 1HNZI 4HYMA
chains in the Genus database with same CATH superfamily
2WW4A 2UUBI 4JI4E 1E3HA 4LFBI 3WU6A 1UEKA 3T1HI 2UXDE 4DV3I 3ZZTA 5FLXC 1OYSA 2CG9A 1RR9A 2R42A 5BR8I 4HXZA 2IOPA 2V34A 4LCGA 4LFAE 4HY1A 3LNUA 2NN6B 3ZKDA 1UDNA 2E1RA 1XNQE 1ZXMA 4OX9E 2UXDI 2Z5EA 1HR0E 2XEXA 4EMDA 4OO1D 1PIEA 4HACB 5IWAI 1FJGI 3KRNA 4LCFA 4LPFA 2OI2A 4LOMA 3Q1QA 4IFDF 2O1WA 3OTOE 1Z0BA 2UU9I 4LFCI 4JYAI 1Z0WA 2BR2B 5EKWA 4GKJE 4JI1I 1NZ0A 1Z0GA 4LFCE 4LF9I 3NZKA 4MU0A 4FN5A 2ZITA 3ZKBA 4DV2I 4DR2E 1IBLE 4JI8I 4OO1F 4BA2B 4B3SI 2E5LI 1HNWI 1OYRA 1S16A 1U2RA 3HKMA 2NPFA 4YHHI 2C38B 1IBMI 4B3RE 1DARA 1IBKE 2R3VA 4JI0I 4K0KI 2VF3A 2HK3A 5ELWA 3M85D 4DV5I 4B3RI 1Z5AA 3B8HA 5IT9Q 4MYTA 4FW7A 4DV0E 4X62E 2C38A 3PS3A 2AE8A 4X65E 2BA1G 1YHCA 3Q6NA 1VI7A 2O3ZA 4LF8E 4WUBA 3J80Q 5L3JA 4B3MI 2WNRA 2BA0G 1XMOE 3M6AA 5JEAD 4U3DA 4DR5I 1FJGE 5C0XE 3LPSA 4URLA 4DU7A 1MU5A 1FKAE 2BA1D 2VQFI 3J7AG 1H74A 5C0XD 3CDJA 2O1UA 2PO1B 5C0XB 1D6TA 3CDIA 4JV5E 4DPXA 3M85G 2GQ0A 4DPTA 4Z7YA 4DPUA 2NN6A 2NN6D 1ZM2A 4JI7I 1KKHA 4MDTA 5A2QC 3QT6A 4DR7I 4N3OA 2VESA 1XMQI 3PYDA 2C37B 4DR7E 4PU9A 1Z59A 1NHJA 4MQYA 3HJCA 5DROA 2UXCE 3P06A 4LFAI 2HKJA 3QT5A 4KHPI 1NHIA 5BR8E 3OTOI 5JEAA 3L7ZB 1HNXI 4NBQA 2O1VA 5FWKA 4AQYI 1HNWE 1USVA 2HHHI 2JT2A 2PO2A 2ZBKB 1ZM9A 2JEBB 4IFDE 1FWLA 1N0UA 4UTGA 4JI5I 2PNZB 5K36B 4IFDD 2Z5CA 3D4JA 4DV5E 4AM3A 4IFDB 4JI0E 4IZJA 4DR3I 5K36E 4OO1E 1R6LA 4RPFA 4DV0I 4P7AA 5JEAC 3PRYA 2CZ9A 1EA6A 4GKKI 4LF6E 4NXMI 5JEAF 3ZM7A 4OO1B 4BA2A 5GMDA 4U3BA 4QNJA 5EL9A 4B3ME 2Q2EB 4DUYI 3T1HE 4LF4E 2VQFE 4JI2I 4X64E 4ISAA 2PO1A 2HK2A 4GQUA 1UDQA 2NN6C 4XTJA 4X62I 4DR5E 4DR4I 2NN6F 5FLXQ 4IS9A 1N34I 2PNLA 5LMUI 4JI7E 4DR1E 1P42A 1FWKA 1N32I 2HKEA 4JYAE 3U1YA 4LF5E 1I94I 3QT8A 4B3TI 2C37A 2UUAI 4NXNI 2JEAA 4JG4A 1UDSA 2IESA 4WUCA 4DV3E 2HFUA 4BA1B 4FWGA 1K47A 1H7SA 1Y4SA 2F4VE 3P76A 4ED4A 3J81C 4DV2E 4DR2I 5JEAB 5LMNE 4IFDC 3PS1A 3PYEA 2IOQA 4X66I 3WU5A 1ZXNA 4JI6I 4DV7I 2UXCI 4ZVIA 4YY3E 1MX0A 5K36D 3V2UC 2PO2B 3JAMC 1OJ4A 5LMNI 5IWAE 2VQEE 1PKPA 4DR6E 2WP8B 2BV3A 1B62A 4IZKB 4USKA 2A2CA 1Y4UA 1EI1A 4R1FA 1S4EA 4IZJB 1XHKA 3ZZUA 1B63A 3J7AM 3T1YE 3F0NA 2Z5BB 4YHHE 4DV4I 4B3SE 4DPWA 2F1DA 3P3GA 4MU3A 1Z0EA 4OO1A 4DR6I 3GMEA 2NN6E 3ZZ0A 1Z0TA 2UUBE 3H4LA 4JI4I 4LF5I 1HNZE 4DUYE 1J5EI 4DV1E 4P52A 1N34E 4LF7I 4DR4E 2CVEA 4X65I 4DU8A 2Z5CB 2DEIA 3B78A 2UXBE 1HR0I 1N33E 4DUZI 1XNQI 5LL6R 1I94E 4QNKA 1RHYA 1N36I 1H72C 4DR1I 2CGEA 4USMA 4LCHA 1MG7A 1VISA 4FWDA 2J65A 3M7ND 3V5RA 1IBLI 1A6FA 4DV6I 4I3HA 2JEBA 4AQYE 2O1TA 1WUUA 4JI1E 5K36A 4DV7E 1IBKI 2EFGA 1R6MA 2JE6A 2C39A 2GO3A 5C0XA 4Z7CA 2IERA 2V8PA 1HNXE 3GLLA 3PYGA 2BR2A 3CWVA 1ZM4A 3T1YI 1FNMA 1UDOA 4LF9E 3PYFA 2AJ4A 5K36F 3Q6MA 3UHMA 2Z5BA 3K17A 4GKKE 2ZM6E 2PO0A 2UUCE 5C0XC 3K1JA 1Y5YA 4JI3I 4IZJD 1E3PA 4WUDA 4JI3E 4LF4I 2UUCI 4JI2E 1FI4A 2X36A 1NHHA 3LTOA 2BA0D 4FW6A 3L7ZA 2JEAB 4AIDA 4JV5I 1Z0CA 3P3CA 1RREA 1N32E 3QT7A 4FW3A 4LF6I 1OYPA 2X7IA 1N33I 3PS2A 4OX9I 4J3DA 1XMQE 1Z0VA 4LFBE 2UUAE 2GO4A 2C39B 4UT4A 4FWHA 1KVKA 4DV1I 5DRPA 5JEAE 4MYUA 2V2ZA 4PRVA 2PNZA 5LMUE 4KQVA 2PNMA 4X66E 4DV6E 4FW4A 5GMEA 2J7KA 2A2DA 3JAMQ 4M1KA 1YH8A 3HULA 2PO0B 1QZRA 3B82A 2E5LE 3M7NG 2BM0A 2UXBI 2HHHE 2HFSA 1ZM3A 2WP8A 4YY3I 4JI8E 2V2VA 3H1CA 1KTVA 4B3TE 1BKNA 3DD6A 4NXNE 4IZKA 5DNLA 1N36E 2JE6B 4JI6E 4K0KE 4KHPE 4MU4A 1N0VC 1Y60A 2V2QA 1XXEA 5A2QQ 3K85A 1Z5BA 2BM1A 5IT9C 4GKJI 5DRRA 4PRXA 4JI5E 4MU1A 2F4VI 4OO1C 1H7UA 1PVGA 2VQEI 1KIJA 3GONA 4FW9A 4DR3E 1H73A 3WU4A 2WNRB 1ELOA 4DXLA 2DEJA 1XNRI 2GS8A 2UU9E 3P3EA 4NXME 4HACA 1IBME 5DNXA 3WU3A 3U1KA 5C0XF 2LJPA 3J80C 5DRQA 4X64I 4DPYA 4OZEA 4BA1A 5K36C 4DV4E 1Z5CA 1HK7A 4LF7E 3J81Q 1USUA 1XMOI 4FW5A 2ZM6I 4AIMA 1XNRE 4IFDA 1J5EE 1Y6ZA 4LF8I 3B4TA 4DUZE 1HNZI 3GCMA 4OKGA 4HYMA
chains in the Genus database with same CATH topology
2WW4A 2UUBI 4JI4E 4LFBI 3WU6A 1UEKA 3T1HI 2UXDE 4DV3I 3ZZTA 5FLXC 2CG9A 1RR9A 2R42A 5BR8I 4HXZA 2IOPA 2V34A 4LFAE 4HY1A 3LNUA 3ZKDA 2E1RA 1XNQE 1ZXMA 4OX9E 2UXDI 2Z5EA 1HR0E 2XEXA 4EMDA 1PIEA 4HACB 5IWAI 1FJGI 2OI2A 3Q1QA 2O1WA 3OTOE 1Z0BA 2UU9I 4LFCI 4JYAI 1Z0WA 4GKJE 4JI1I 1NZ0A 1Z0GA 4LFCE 4LF9I 4FN5A 2ZITA 3ZKBA 4DV2I 4DR2E 1IBLE 4JI8I 4B3SI 2E5LI 1HNWI 1S16A 1U2RA 4YHHI 2NPFA 1IBMI 4B3RE 1DARA 1IBKE 2R3VA 4JI0I 4K0KI 2VF3A 2HK3A 4DV5I 4B3RI 1Z5AA 3B8HA 5IT9Q 4MYTA 4DV0E 4X62E 4X65E 3Q6NA 4LF8E 4WUBA 3J80Q 5L3JA 4B3MI 1XMOE 3M6AA 4DR5I 1FJGE 3LPSA 4URLA 4DU7A 1MU5A 1FKAE 2VQFI 3J7AG 1H74A 2O1UA 1D6TA 4JV5E 4DPXA 2GQ0A 4DPTA 4Z7YA 4DPUA 1ZM2A 4JI7I 1KKHA 5A2QC 3QT6A 4DR7I 4N3OA 1XMQI 3PYDA 4DR7E 4PU9A 1Z59A 1NHJA 3HJCA 2UXCE 3P06A 4LFAI 2HKJA 3QT5A 4KHPI 1NHIA 5BR8E 3OTOI 1HNXI 2O1VA 5FWKA 4AQYI 1HNWE 1USVA 2HHHI 2ZBKB 1ZM9A 1FWLA 1N0UA 4UTGA 4JI5I 2Z5CA 3D4JA 4DV5E 4JI0E 4IZJA 4DR3I 4RPFA 4DV0I 4P7AA 3PRYA 2CZ9A 1EA6A 4GKKI 4LF6E 4NXMI 3ZM7A 5GMDA 4B3ME 2Q2EB 4DUYI 3T1HE 4LF4E 2VQFE 4JI2I 4X64E 2HK2A 4XTJA 4X62I 4DR5E 4DR4I 5FLXQ 1N34I 2PNLA 5LMUI 4JI7E 4DR1E 1FWKA 1N32I 2HKEA 4JYAE 4LF5E 1I94I 3QT8A 4B3TI 2UUAI 4NXNI 4JG4A 4WUCA 4DV3E 2HFUA 4FWGA 1K47A 1H7SA 1Y4SA 2F4VE 4ED4A 3J81C 4DV2E 4DR2I 5LMNE 3PYEA 2IOQA 4X66I 3WU5A 1ZXNA 4JI6I 4DV7I 2UXCI 4ZVIA 4YY3E 1MX0A 3JAMC 3V2UC 1OJ4A 5LMNI 5IWAE 2VQEE 1PKPA 4DR6E 2BV3A 1B62A 4IZKB 4USKA 2A2CA 1Y4UA 1EI1A 4R1FA 1S4EA 4IZJB 1XHKA 3ZZUA 1B63A 3J7AM 3T1YE 3F0NA 2Z5BB 4YHHE 4DV4I 4B3SE 4DPWA 1Z0EA 4DR6I 3ZZ0A 1Z0TA 2UUBE 3H4LA 4JI4I 4LF5I 1HNZE 4DUYE 1J5EI 4DV1E 4P52A 1N34E 4LF7I 4DR4E 4X65I 4DU8A 2Z5CB 2DEIA 3B78A 2UXBE 1HR0I 1N33E 4DUZI 1XNQI 5LL6R 1I94E 1N36I 1H72C 4DR1I 2CGEA 4USMA 1MG7A 1VISA 4FWDA 3V5RA 1IBLI 1A6FA 4DV6I 4I3HA 4AQYE 2O1TA 1WUUA 4JI1E 4DV7E 1IBKI 2EFGA 4Z7CA 2V8PA 1HNXE 3PYGA 3CWVA 1ZM4A 3T1YI 1FNMA 4LF9E 3PYFA 2AJ4A 3Q6MA 2Z5BA 3K17A 4GKKE 2ZM6E 2UUCE 3K1JA 4JI3I 4IZJD 4WUDA 4JI3E 4LF4I 2UUCI 4JI2E 1FI4A 2X36A 1NHHA 3LTOA 4JV5I 1Z0CA 1RREA 1N32E 3QT7A 4LF6I 2X7IA 1N33I 4OX9I 1XMQE 1Z0VA 4LFBE 2UUAE 4UT4A 4FWHA 1KVKA 4DV1I 4MYUA 2V2ZA 4PRVA 5LMUE 4KQVA 2PNMA 4X66E 4DV6E 5GMEA 2J7KA 2A2DA 3JAMQ 4M1KA 3HULA 1QZRA 3B82A 2E5LE 2BM0A 2UXBI 2HHHE 2HFSA 1ZM3A 4YY3I 4JI8E 2V2VA 1KTVA 4B3TE 1BKNA 4NXNE 4IZKA 1N36E 4JI6E 4K0KE 4KHPE 1N0VC 2V2QA 5A2QQ 3K85A 1Z5BA 2BM1A 5IT9C 4GKJI 4PRXA 4JI5E 2F4VI 1H7UA 1PVGA 2VQEI 1KIJA 3GONA 4FW9A 4DR3E 1H73A 3WU4A 1ELOA 4DXLA 2DEJA 1XNRI 2GS8A 2UU9E 4NXME 4HACA 1IBME 3WU3A 2LJPA 3J80C 4X64I 4DPYA 4DV4E 1Z5CA 1HK7A 4LF7E 3J81Q 1USUA 1XMOI 2ZM6I 1XNRE 1J5EE 1Y6ZA 4LF8I 4DUZE 1HNZI 4HYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WW4 A;  2UUB I;  4JI4 E;  4LFB I;  3WU6 A;  1UEK A;  3T1H I;  2UXD E;  4DV3 I;  3ZZT A;  5FLX C;  1RR9 A;  2R42 A;  5BR8 I;  4HXZ A;  2V34 A;  4LFA E;  4HY1 A;  3LNU A;  3ZKD A;  2E1R A;  1XNQ E;  1ZXM A;  4OX9 E;  2UXD I;  1HR0 E;  2XEX A;  4EMD A;  1PIE A;  4HAC B;  5IWA I;  1FJG I;  2OI2 A;  3Q1Q A;  3OTO E;  1Z0B A;  2UU9 I;  4LFC I;  4JYA I;  1Z0W A;  4GKJ E;  4JI1 I;  1NZ0 A;  1Z0G A;  4LFC E;  4LF9 I;  4FN5 A;  2ZIT A;  3ZKB A;  4DV2 I;  4DR2 E;  1IBL E;  4JI8 I;  4B3S I;  2E5L I;  1HNW I;  1S16 A;  1U2R A;  4YHH I;  2NPF A;  1IBM I;  4B3R E;  1DAR A;  1IBK E;  2R3V A;  4JI0 I;  4K0K I;  2VF3 A;  2HK3 A;  4DV5 I;  4B3R I;  1Z5A A;  3B8H A;  5IT9 Q;  4MYT A;  4DV0 E;  4X62 E;  4X65 E;  4LF8 E;  4WUB A;  3J80 Q;  5L3J A;  4B3M I;  1XMO E;  3M6A A;  4DR5 I;  1FJG E;  3LPS A;  4URL A;  4DU7 A;  1MU5 A;  1FKA E;  2VQF I;  3J7A G;  1H74 A;  1D6T A;  4JV5 E;  4DPX A;  4DPT A;  4Z7Y A;  4DPU A;  1ZM2 A;  4JI7 I;  1KKH A;  5A2Q C;  3QT6 A;  4DR7 I;  1XMQ I;  3PYD A;  4DR7 E;  4PU9 A;  1Z59 A;  1NHJ A;  2UXC E;  4LFA I;  2HKJ A;  3QT5 A;  4KHP I;  1NHI A;  5BR8 E;  3OTO I;  1HNX I;  4AQY I;  1HNW E;  2HHH I;  2ZBK B;  1ZM9 A;  1FWL A;  1N0U A;  4UTG A;  4JI5 I;  3D4J A;  4DV5 E;  4JI0 E;  4DR3 I;  4RPF A;  4DV0 I;  4P7A A;  2CZ9 A;  1EA6 A;  4GKK I;  4LF6 E;  4NXM I;  3ZM7 A;  5GMD A;  4B3M E;  2Q2E B;  4DUY I;  3T1H E;  4LF4 E;  2VQF E;  4JI2 I;  4X64 E;  2HK2 A;  4XTJ A;  4X62 I;  4DR5 E;  4DR4 I;  5FLX Q;  1N34 I;  5LMU I;  4JI7 E;  4DR1 E;  1FWK A;  1N32 I;  2HKE A;  4JYA E;  4LF5 E;  1I94 I;  3QT8 A;  4B3T I;  2UUA I;  4NXN I;  4JG4 A;  4WUC A;  4DV3 E;  2HFU A;  4FWG A;  1K47 A;  1H7S A;  2F4V E;  4ED4 A;  3J81 C;  4DV2 E;  4DR2 I;  5LMN E;  3PYE A;  4X66 I;  3WU5 A;  1ZXN A;  4JI6 I;  4DV7 I;  2UXC I;  4ZVI A;  4YY3 E;  1MX0 A;  3JAM C;  3V2U C;  1OJ4 A;  5LMN I;  5IWA E;  2VQE E;  1PKP A;  4DR6 E;  2BV3 A;  1B62 A;  4USK A;  2A2C A;  1EI1 A;  4R1F A;  1S4E A;  1XHK A;  3ZZU A;  1B63 A;  3J7A M;  3T1Y E;  3F0N A;  4YHH E;  4DV4 I;  4B3S E;  4DPW A;  1Z0E A;  4DR6 I;  3ZZ0 A;  1Z0T A;  2UUB E;  3H4L A;  4JI4 I;  4LF5 I;  1HNZ E;  4DUY E;  1J5E I;  4DV1 E;  4P52 A;  1N34 E;  4LF7 I;  4DR4 E;  4X65 I;  4DU8 A;  2DEI A;  3B78 A;  2UXB E;  1HR0 I;  1N33 E;  4DUZ I;  1XNQ I;  5LL6 R;  1I94 E;  1N36 I;  1H72 C;  4DR1 I;  4USM A;  1MG7 A;  1VIS A;  4FWD A;  3V5R A;  1IBL I;  1A6F A;  4DV6 I;  4I3H A;  4AQY E;  1WUU A;  4JI1 E;  4DV7 E;  1IBK I;  2EFG A;  4Z7C A;  2V8P A;  1HNX E;  3PYG A;  3CWV A;  1ZM4 A;  3T1Y I;  1FNM A;  4LF9 E;  3PYF A;  2AJ4 A;  3K17 A;  4GKK E;  2ZM6 E;  2UUC E;  3K1J A;  4JI3 I;  4WUD A;  4JI3 E;  4LF4 I;  2UUC I;  4JI2 E;  1FI4 A;  2X36 A;  1NHH A;  3LTO A;  4JV5 I;  1Z0C A;  1RRE A;  1N32 E;  3QT7 A;  4LF6 I;  2X7I A;  1N33 I;  4OX9 I;  1XMQ E;  1Z0V A;  4LFB E;  2UUA E;  4UT4 A;  4FWH A;  1KVK A;  4DV1 I;  4MYU A;  2V2Z A;  4PRV A;  5LMU E;  4KQV A;  4X66 E;  4DV6 E;  5GME A;  2J7K A;  2A2D A;  3JAM Q;  4M1K A;  3HUL A;  1QZR A;  3B82 A;  2E5L E;  2BM0 A;  2UXB I;  2HHH E;  2HFS A;  1ZM3 A;  4YY3 I;  4JI8 E;  2V2V A;  1KTV A;  4B3T E;  1BKN A;  4NXN E;  1N36 E;  4JI6 E;  4K0K E;  4KHP E;  1N0V C;  2V2Q A;  5A2Q Q;  1Z5B A;  2BM1 A;  5IT9 C;  4GKJ I;  4PRX A;  4JI5 E;  2F4V I;  1H7U A;  1PVG A;  2VQE I;  1KIJ A;  3GON A;  4FW9 A;  4DR3 E;  1H73 A;  3WU4 A;  1ELO A;  4DXL A;  2DEJ A;  1XNR I;  2GS8 A;  2UU9 E;  4NXM E;  4HAC A;  1IBM E;  3WU3 A;  2LJP A;  3J80 C;  4X64 I;  4DPY A;  4DV4 E;  1Z5C A;  4LF7 E;  3J81 Q;  1XMO I;  2ZM6 I;  1XNR E;  1J5E E;  4LF8 I;  4DUZ E;  1HNZ I;  4HYM A; 
#chains in the Genus database with same CATH topology
 2WW4 A;  2UUB I;  4JI4 E;  1E3H A;  4LFB I;  3WU6 A;  1UEK A;  3T1H I;  2UXD E;  4DV3 I;  3ZZT A;  5FLX C;  1OYS A;  2CG9 A;  1RR9 A;  2R42 A;  5BR8 I;  4HXZ A;  2IOP A;  2V34 A;  4LCG A;  4LFA E;  4HY1 A;  3LNU A;  2NN6 B;  3ZKD A;  1UDN A;  2E1R A;  1XNQ E;  1ZXM A;  4OX9 E;  2UXD I;  2Z5E A;  1HR0 E;  2XEX A;  4EMD A;  4OO1 D;  1PIE A;  4HAC B;  5IWA I;  1FJG I;  3KRN A;  4LCF A;  4LPF A;  2OI2 A;  4LOM A;  3Q1Q A;  4IFD F;  2O1W A;  3OTO E;  1Z0B A;  2UU9 I;  4LFC I;  4JYA I;  1Z0W A;  2BR2 B;  5EKW A;  4GKJ E;  4JI1 I;  1NZ0 A;  1Z0G A;  4LFC E;  4LF9 I;  3NZK A;  4MU0 A;  4FN5 A;  2ZIT A;  3ZKB A;  4DV2 I;  4DR2 E;  1IBL E;  4JI8 I;  4OO1 F;  4BA2 B;  4B3S I;  2E5L I;  1HNW I;  1OYR A;  1S16 A;  1U2R A;  3HKM A;  2NPF A;  4YHH I;  2C38 B;  1IBM I;  4B3R E;  1DAR A;  1IBK E;  2R3V A;  4JI0 I;  4K0K I;  2VF3 A;  2HK3 A;  5ELW A;  3M85 D;  4DV5 I;  4B3R I;  1Z5A A;  3B8H A;  5IT9 Q;  4MYT A;  4FW7 A;  4DV0 E;  4X62 E;  2C38 A;  3PS3 A;  2AE8 A;  4X65 E;  2BA1 G;  1YHC A;  3Q6N A;  1VI7 A;  2O3Z A;  4LF8 E;  4WUB A;  3J80 Q;  5L3J A;  4B3M I;  2WNR A;  2BA0 G;  1XMO E;  3M6A A;  5JEA D;  4U3D A;  4DR5 I;  1FJG E;  5C0X E;  3LPS A;  4URL A;  4DU7 A;  1MU5 A;  1FKA E;  2BA1 D;  2VQF I;  3J7A G;  1H74 A;  5C0X D;  3CDJ A;  2O1U A;  2PO1 B;  5C0X B;  1D6T A;  3CDI A;  4JV5 E;  4DPX A;  3M85 G;  2GQ0 A;  4DPT A;  4Z7Y A;  4DPU A;  2NN6 A;  2NN6 D;  1ZM2 A;  4JI7 I;  1KKH A;  4MDT A;  5A2Q C;  3QT6 A;  4DR7 I;  4N3O A;  2VES A;  1XMQ I;  3PYD A;  2C37 B;  4DR7 E;  4PU9 A;  1Z59 A;  1NHJ A;  4MQY A;  3HJC A;  5DRO A;  2UXC E;  3P06 A;  4LFA I;  2HKJ A;  3QT5 A;  4KHP I;  1NHI A;  5BR8 E;  3OTO I;  5JEA A;  3L7Z B;  1HNX I;  4NBQ A;  2O1V A;  5FWK A;  4AQY I;  1HNW E;  1USV A;  2HHH I;  2JT2 A;  2PO2 A;  2ZBK B;  1ZM9 A;  2JEB B;  4IFD E;  1FWL A;  1N0U A;  4UTG A;  4JI5 I;  2PNZ B;  5K36 B;  4IFD D;  2Z5C A;  3D4J A;  4DV5 E;  4AM3 A;  4IFD B;  4JI0 E;  4IZJ A;  4DR3 I;  5K36 E;  4OO1 E;  1R6L A;  4RPF A;  4DV0 I;  4P7A A;  5JEA C;  3PRY A;  2CZ9 A;  1EA6 A;  4GKK I;  4LF6 E;  4NXM I;  5JEA F;  3ZM7 A;  4OO1 B;  4BA2 A;  5GMD A;  4U3B A;  4QNJ A;  5EL9 A;  4B3M E;  2Q2E B;  4DUY I;  3T1H E;  4LF4 E;  2VQF E;  4JI2 I;  4X64 E;  4ISA A;  2PO1 A;  2HK2 A;  4GQU A;  1UDQ A;  2NN6 C;  4XTJ A;  4X62 I;  4DR5 E;  4DR4 I;  2NN6 F;  5FLX Q;  4IS9 A;  1N34 I;  2PNL A;  5LMU I;  4JI7 E;  4DR1 E;  1P42 A;  1FWK A;  1N32 I;  2HKE A;  4JYA E;  3U1Y A;  4LF5 E;  1I94 I;  3QT8 A;  4B3T I;  2C37 A;  2UUA I;  4NXN I;  2JEA A;  4JG4 A;  1UDS A;  2IES A;  4WUC A;  4DV3 E;  2HFU A;  4BA1 B;  4FWG A;  1K47 A;  1H7S A;  1Y4S A;  2F4V E;  3P76 A;  4ED4 A;  3J81 C;  4DV2 E;  4DR2 I;  5JEA B;  5LMN E;  4IFD C;  3PS1 A;  3PYE A;  2IOQ A;  4X66 I;  3WU5 A;  1ZXN A;  4JI6 I;  4DV7 I;  2UXC I;  4ZVI A;  4YY3 E;  1MX0 A;  5K36 D;  3V2U C;  2PO2 B;  3JAM C;  1OJ4 A;  5LMN I;  5IWA E;  2VQE E;  1PKP A;  4DR6 E;  2WP8 B;  2BV3 A;  1B62 A;  4IZK B;  4USK A;  2A2C A;  1Y4U A;  1EI1 A;  4R1F A;  1S4E A;  4IZJ B;  1XHK A;  3ZZU A;  1B63 A;  3J7A M;  3T1Y E;  3F0N A;  2Z5B B;  4YHH E;  4DV4 I;  4B3S E;  4DPW A;  2F1D A;  3P3G A;  4MU3 A;  1Z0E A;  4OO1 A;  4DR6 I;  3GME A;  2NN6 E;  3ZZ0 A;  1Z0T A;  2UUB E;  3H4L A;  4JI4 I;  4LF5 I;  1HNZ E;  4DUY E;  1J5E I;  4DV1 E;  4P52 A;  1N34 E;  4LF7 I;  4DR4 E;  2CVE A;  4X65 I;  4DU8 A;  2Z5C B;  2DEI A;  3B78 A;  2UXB E;  1HR0 I;  1N33 E;  4DUZ I;  1XNQ I;  5LL6 R;  1I94 E;  4QNK A;  1RHY A;  1N36 I;  1H72 C;  4DR1 I;  2CGE A;  4USM A;  4LCH A;  1MG7 A;  1VIS A;  4FWD A;  2J65 A;  3M7N D;  3V5R A;  1IBL I;  1A6F A;  4DV6 I;  4I3H A;  2JEB A;  4AQY E;  2O1T A;  1WUU A;  4JI1 E;  5K36 A;  4DV7 E;  1IBK I;  2EFG A;  1R6M A;  2JE6 A;  2C39 A;  2GO3 A;  5C0X A;  4Z7C A;  2IER A;  2V8P A;  1HNX E;  3GLL A;  3PYG A;  2BR2 A;  3CWV A;  1ZM4 A;  3T1Y I;  1FNM A;  1UDO A;  4LF9 E;  3PYF A;  2AJ4 A;  5K36 F;  3Q6M A;  3UHM A;  2Z5B A;  3K17 A;  4GKK E;  2ZM6 E;  2PO0 A;  2UUC E;  5C0X C;  3K1J A;  1Y5Y A;  4JI3 I;  4IZJ D;  1E3P A;  4WUD A;  4JI3 E;  4LF4 I;  2UUC I;  4JI2 E;  1FI4 A;  2X36 A;  1NHH A;  3LTO A;  2BA0 D;  4FW6 A;  3L7Z A;  2JEA B;  4AID A;  4JV5 I;  1Z0C A;  3P3C A;  1RRE A;  1N32 E;  3QT7 A;  4FW3 A;  4LF6 I;  1OYP A;  2X7I A;  1N33 I;  3PS2 A;  4OX9 I;  4J3D A;  1XMQ E;  1Z0V A;  4LFB E;  2UUA E;  2GO4 A;  2C39 B;  4UT4 A;  4FWH A;  1KVK A;  4DV1 I;  5DRP A;  5JEA E;  4MYU A;  2V2Z A;  4PRV A;  2PNZ A;  5LMU E;  4KQV A;  2PNM A;  4X66 E;  4DV6 E;  4FW4 A;  5GME A;  2J7K A;  2A2D A;  3JAM Q;  4M1K A;  1YH8 A;  3HUL A;  2PO0 B;  1QZR A;  3B82 A;  2E5L E;  3M7N G;  2BM0 A;  2UXB I;  2HHH E;  2HFS A;  1ZM3 A;  2WP8 A;  4YY3 I;  4JI8 E;  2V2V A;  3H1C A;  1KTV A;  4B3T E;  1BKN A;  3DD6 A;  4NXN E;  4IZK A;  5DNL A;  1N36 E;  2JE6 B;  4JI6 E;  4K0K E;  4KHP E;  4MU4 A;  1N0V C;  1Y60 A;  2V2Q A;  1XXE A;  5A2Q Q;  3K85 A;  1Z5B A;  2BM1 A;  5IT9 C;  4GKJ I;  5DRR A;  4PRX A;  4JI5 E;  4MU1 A;  2F4V I;  4OO1 C;  1H7U A;  1PVG A;  2VQE I;  1KIJ A;  3GON A;  4FW9 A;  4DR3 E;  1H73 A;  3WU4 A;  2WNR B;  1ELO A;  4DXL A;  2DEJ A;  1XNR I;  2GS8 A;  2UU9 E;  3P3E A;  4NXM E;  4HAC A;  1IBM E;  5DNX A;  3WU3 A;  3U1K A;  5C0X F;  2LJP A;  3J80 C;  5DRQ A;  4X64 I;  4DPY A;  4OZE A;  4BA1 A;  5K36 C;  4DV4 E;  1Z5C A;  1HK7 A;  4LF7 E;  3J81 Q;  1USU A;  1XMO I;  4FW5 A;  2ZM6 I;  4AIM A;  1XNR E;  4IFD A;  1J5E E;  1Y6Z A;  4LF8 I;  3B4T A;  4DUZ E;  1HNZ I;  3GCM A;  4OKG A;  4HYM A; 
#chains in the Genus database with same CATH homology
 2WW4 A;  2UUB I;  4JI4 E;  4LFB I;  3WU6 A;  1UEK A;  3T1H I;  2UXD E;  4DV3 I;  3ZZT A;  5FLX C;  2CG9 A;  1RR9 A;  2R42 A;  5BR8 I;  4HXZ A;  2IOP A;  2V34 A;  4LFA E;  4HY1 A;  3LNU A;  3ZKD A;  2E1R A;  1XNQ E;  1ZXM A;  4OX9 E;  2UXD I;  2Z5E A;  1HR0 E;  2XEX A;  4EMD A;  1PIE A;  4HAC B;  5IWA I;  1FJG I;  2OI2 A;  3Q1Q A;  2O1W A;  3OTO E;  1Z0B A;  2UU9 I;  4LFC I;  4JYA I;  1Z0W A;  4GKJ E;  4JI1 I;  1NZ0 A;  1Z0G A;  4LFC E;  4LF9 I;  4FN5 A;  2ZIT A;  3ZKB A;  4DV2 I;  4DR2 E;  1IBL E;  4JI8 I;  4B3S I;  2E5L I;  1HNW I;  1S16 A;  1U2R A;  4YHH I;  2NPF A;  1IBM I;  4B3R E;  1DAR A;  1IBK E;  2R3V A;  4JI0 I;  4K0K I;  2VF3 A;  2HK3 A;  4DV5 I;  4B3R I;  1Z5A A;  3B8H A;  5IT9 Q;  4MYT A;  4DV0 E;  4X62 E;  4X65 E;  3Q6N A;  4LF8 E;  4WUB A;  3J80 Q;  5L3J A;  4B3M I;  1XMO E;  3M6A A;  4DR5 I;  1FJG E;  3LPS A;  4URL A;  4DU7 A;  1MU5 A;  1FKA E;  2VQF I;  3J7A G;  1H74 A;  2O1U A;  1D6T A;  4JV5 E;  4DPX A;  2GQ0 A;  4DPT A;  4Z7Y A;  4DPU A;  1ZM2 A;  4JI7 I;  1KKH A;  5A2Q C;  3QT6 A;  4DR7 I;  4N3O A;  1XMQ I;  3PYD A;  4DR7 E;  4PU9 A;  1Z59 A;  1NHJ A;  3HJC A;  2UXC E;  3P06 A;  4LFA I;  2HKJ A;  3QT5 A;  4KHP I;  1NHI A;  5BR8 E;  3OTO I;  1HNX I;  2O1V A;  5FWK A;  4AQY I;  1HNW E;  1USV A;  2HHH I;  2ZBK B;  1ZM9 A;  1FWL A;  1N0U A;  4UTG A;  4JI5 I;  2Z5C A;  3D4J A;  4DV5 E;  4JI0 E;  4IZJ A;  4DR3 I;  4RPF A;  4DV0 I;  4P7A A;  3PRY A;  2CZ9 A;  1EA6 A;  4GKK I;  4LF6 E;  4NXM I;  3ZM7 A;  5GMD A;  4B3M E;  2Q2E B;  4DUY I;  3T1H E;  4LF4 E;  2VQF E;  4JI2 I;  4X64 E;  2HK2 A;  4XTJ A;  4X62 I;  4DR5 E;  4DR4 I;  5FLX Q;  1N34 I;  2PNL A;  5LMU I;  4JI7 E;  4DR1 E;  1FWK A;  1N32 I;  2HKE A;  4JYA E;  4LF5 E;  1I94 I;  3QT8 A;  4B3T I;  2UUA I;  4NXN I;  4JG4 A;  4WUC A;  4DV3 E;  2HFU A;  4FWG A;  1K47 A;  1H7S A;  1Y4S A;  2F4V E;  4ED4 A;  3J81 C;  4DV2 E;  4DR2 I;  5LMN E;  3PYE A;  2IOQ A;  4X66 I;  3WU5 A;  1ZXN A;  4JI6 I;  4DV7 I;  2UXC I;  4ZVI A;  4YY3 E;  1MX0 A;  3JAM C;  3V2U C;  1OJ4 A;  5LMN I;  5IWA E;  2VQE E;  1PKP A;  4DR6 E;  2BV3 A;  1B62 A;  4IZK B;  4USK A;  2A2C A;  1Y4U A;  1EI1 A;  4R1F A;  1S4E A;  4IZJ B;  1XHK A;  3ZZU A;  1B63 A;  3J7A M;  3T1Y E;  3F0N A;  2Z5B B;  4YHH E;  4DV4 I;  4B3S E;  4DPW A;  1Z0E A;  4DR6 I;  3ZZ0 A;  1Z0T A;  2UUB E;  3H4L A;  4JI4 I;  4LF5 I;  1HNZ E;  4DUY E;  1J5E I;  4DV1 E;  4P52 A;  1N34 E;  4LF7 I;  4DR4 E;  4X65 I;  4DU8 A;  2Z5C B;  2DEI A;  3B78 A;  2UXB E;  1HR0 I;  1N33 E;  4DUZ I;  1XNQ I;  5LL6 R;  1I94 E;  1N36 I;  1H72 C;  4DR1 I;  2CGE A;  4USM A;  1MG7 A;  1VIS A;  4FWD A;  3V5R A;  1IBL I;  1A6F A;  4DV6 I;  4I3H A;  4AQY E;  2O1T A;  1WUU A;  4JI1 E;  4DV7 E;  1IBK I;  2EFG A;  4Z7C A;  2V8P A;  1HNX E;  3PYG A;  3CWV A;  1ZM4 A;  3T1Y I;  1FNM A;  4LF9 E;  3PYF A;  2AJ4 A;  3Q6M A;  2Z5B A;  3K17 A;  4GKK E;  2ZM6 E;  2UUC E;  3K1J A;  4JI3 I;  4IZJ D;  4WUD A;  4JI3 E;  4LF4 I;  2UUC I;  4JI2 E;  1FI4 A;  2X36 A;  1NHH A;  3LTO A;  4JV5 I;  1Z0C A;  1RRE A;  1N32 E;  3QT7 A;  4LF6 I;  2X7I A;  1N33 I;  4OX9 I;  1XMQ E;  1Z0V A;  4LFB E;  2UUA E;  4UT4 A;  4FWH A;  1KVK A;  4DV1 I;  4MYU A;  2V2Z A;  4PRV A;  5LMU E;  4KQV A;  2PNM A;  4X66 E;  4DV6 E;  5GME A;  2J7K A;  2A2D A;  3JAM Q;  4M1K A;  3HUL A;  1QZR A;  3B82 A;  2E5L E;  2BM0 A;  2UXB I;  2HHH E;  2HFS A;  1ZM3 A;  4YY3 I;  4JI8 E;  2V2V A;  1KTV A;  4B3T E;  1BKN A;  4NXN E;  4IZK A;  1N36 E;  4JI6 E;  4K0K E;  4KHP E;  1N0V C;  2V2Q A;  5A2Q Q;  3K85 A;  1Z5B A;  2BM1 A;  5IT9 C;  4GKJ I;  4PRX A;  4JI5 E;  2F4V I;  1H7U A;  1PVG A;  2VQE I;  1KIJ A;  3GON A;  4FW9 A;  4DR3 E;  1H73 A;  3WU4 A;  1ELO A;  4DXL A;  2DEJ A;  1XNR I;  2GS8 A;  2UU9 E;  4NXM E;  4HAC A;  1IBM E;  3WU3 A;  2LJP A;  3J80 C;  4X64 I;  4DPY A;  4DV4 E;  1Z5C A;  1HK7 A;  4LF7 E;  3J81 Q;  1USU A;  1XMO I;  2ZM6 I;  1XNR E;  1J5E E;  1Y6Z A;  4LF8 I;  4DUZ E;  1HNZ I;  4HYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...