4NXNI

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxnI00
4DXLA 4LF7I 4DUYE 1IBMI 4LF6I 1HNXE 2HKEA 1XMQE 1Z5AA 4Z7YA 3ZM7A 3J7AM 1Z0EA 4KHPE 2CZ9A 4JV5E 1Z5BA 4X62E 3B78A 4YY3E 3K17A 4JV5I 2ZM6E 2UUAE 4LF4E 1RR9A 4R1FA 5BR8I 2ZM6I 4B3ME 1A6FA 2X36A 5LMUE 1HNWI 4UT4A 3WU5A 4Z7CA 4DR5I 3PYGA 2E5LE 4B3TE 4DV3I 4FW9A 5LMNE 4DR6E 3CWVA 1XNRE 4PRXA 1XNQE 1XNRI 2BM0A 1ELOA 4UTGA 5IT9Q 1XNQI 2F4VI 4JI5I 4HACA 4LF5I 2UUBI 1Z0CA 1Z59A 4NXME 4NXMI 4MYTA 3H4LA 4I3HA 4DV0E 3T1YI 3Q1QA 1Z0VA 4USKA 1D6TA 4DV0I 4JI7I 5LL6R 1HR0I 2V8PA 1N0UA 1NHJA 5L3JA 2UXCE 4OX9E 4WUBA 4DR2I 1Z0BA 1Z5CA 5IWAI 4JI1E 2V2QA 4JI4E 4ED4A 4LFCE 1NHHA 4P52A 1U2RA 4MYUA 4DR4E 3ZZTA 2XEXA 2R42A 1ZXMA 4P7AA 1ZM2A 4RPFA 4B3RI 4AQYE 4WUCA 4DUZE 1HNZI 4JYAI 4DV1E 1KIJA 4DUZI 2UU9E 4DV4I 1FNMA 1H74A 3JAMQ 2X7IA 4JI2I 2R3VA 4LF7E 4ZVIA 4LF8I 4FWHA 1IBME 1QZRA 4LF6E 2Q2EB 4X64I 3B82A 4DU8A 2HKJA 1H72C 4NXNE 4DPXA 3J7AG 4X65E 5FLXC 4NXNI 3WU6A 1RREA 4DR1E 4X65I 2HFUA 5BR8E 4DR1I 1OJ4A 1IBLI 4B3SE 4GKKI 4LF9I 3T1HE 1HNWE 4B3SI 4DR5E 3T1HI 4DPWA 4DV3E 1J5EI 1NZ0A 4DPUA 1XHKA 4KQVA 3ZKBA 1FWKA 4JI8I 4USMA 1H73A 4DV7I 2NPFA 1XMOI 2HK2A 4PU9A 2F4VE 4JI5E 3LTOA 3V5RA 4LF5E 2UUBE 1Z0TA 2VQEE 2OI2A 2VQEI 2GS8A 1Z0WA 2A2DA 2HK3A 3T1YE 2UXBI 1EA6A 1I94I 4JI7E 2WW4A 1HR0E 1N32E 1N36E 3LPSA 4GKJI 1N32I 2UXDI 1N36I 2A2CA 4YHHI 1MX0A 3QT8A 1ZXNA 4DR2E 4PRVA 4DU7A 5A2QC 3ZKDA 5IWAE 3OTOI 4X66E 1S4EA 4X66I 3PYFA 5A2QQ 1PIEA 4DV2I 1PKPA 2UUCI 4B3RE 1N34I 1H7SA 4DR3I 1DARA 1HNZE 4JYAE 3QT7A 1KKHA 4HY1A 2V2VA 4DV4E 3WU3A 4JI2E 4LF8E 2AJ4A 4URLA 4X64E 3LNUA 1KVKA 4JI6I 4WUDA 2HFSA 4M1KA 2EFGA 3J81C 4K0KE 3J80C 1NHIA 4K0KI 1N33I 5GMEA 4DPYA 4EMDA 1IBLE 2HHHI 4GKKE 3PYDA 4LF9E 4HACB 1ZM9A 1PVGA 4HYMA 4DR7I 2ZBKB 5FLXQ 4DV5E 3HULA 1J5EE 2VF3A 1ZM3A 4DUYI 4DV5I 4LFAE 1HNXI 1XMQI 4LFAI 4JI8E 3QT6A 1FKAE 4DV7E 1XMOE 4FWDA 4XTJA 4KHPI 3V2UC 4X62I 1N0VC 4YY3I 2J7KA 1MU5A 2UUAI 4LF4I 4B3MI 5LMUI 5IT9C 2VQFE 2E5LI 4B3TI 3F0NA 2UXBE 1I94E 5LMNI 2VQFI 4DR6I 1WUUA 2DEIA 1FI4A 1BKNA 1K47A 4DV6E 1B63A 4GKJE 2UXDE 2V2ZA 2V34A 4DV6I 4YHHE 1B62A 1KTVA 4FWGA 3WU4A 3D4JA 3OTOE 3PYEA 1EI1A 2LJPA 2BV3A 4LFBE 4DV2E 3K1JA 1FWLA 1Z0GA 2UUCE 3GONA 4LFBI 1S16A 1N34E 4JI0E 1ZM4A 4DR3E 2E1RA 3M6AA 3ZZUA 4JI0I 2UXCI 4OX9I 4JG4A 1IBKE 1UEKA 3B8HA 4JI1I 4JI4I 4LFCI 4JI3E 1IBKI 4FN5A 4JI6E 1VISA 1FJGE 3QT5A 4JI3I 4DR4I 3ZZ0A 5GMDA 1FJGI 3JAMC 1N33E 2DEJA 4AQYI 1H7UA 2ZITA 4HXZA 1MG7A 4DPTA 3J81Q 2HHHE 3J80Q 4DV1I 2BM1A 4DR7E 2UU9I
chains in the Genus database with same CATH superfamily
4DXLA 4LF7I 4DUYE 1IBMI 3M7ND 4LF6I 2CGEA 1HNXE 2HKEA 1XMQE 1Z5AA 4Z7YA 3ZM7A 4U3BA 3J7AM 4LCFA 4MDTA 1Z0EA 4KHPE 1R6MA 2CZ9A 4JV5E 1Z5BA 1Y5YA 3P3GA 4X62E 3B78A 4YY3E 3K17A 4JV5I 2ZM6E 1YHCA 2UUAE 4LF4E 1RR9A 4R1FA 4MU1A 3H1CA 5BR8I 2ZM6I 1UDNA 4B3ME 1A6FA 2X36A 5LMUE 1HNWI 4UT4A 3L7ZA 3WU5A 4Z7CA 4DR5I 3PYGA 2E5LE 3PRYA 2O3ZA 2BR2B 4B3TE 1Y4SA 4DV3I 4FW9A 4OZEA 5LMNE 4DR6E 5JEAB 3CWVA 1R6LA 2JEBA 1XNRE 4PRXA 1VI7A 1XNQE 4LOMA 1XNRI 1ELOA 2BM0A 4UTGA 5IT9Q 1XNQI 4OO1A 1UDOA 2F4VI 4JI5I 2O1TA 5DNLA 5C0XB 4HACA 4LF5I 2UUBI 1Z0CA 1Z59A 4NXME 4IFDB 3CDIA 4NXMI 4MYTA 5C0XE 1UDSA 3H4LA 4I3HA 4BA1A 4DV0E 3T1YI 3Q1QA 4IFDE 1Z0VA 4USKA 4QNKA 2PNZB 1OYPA 1D6TA 4U3DA 2NN6D 1E3PA 4DV0I 4JI7I 5LL6R 3HKMA 1HR0I 2JE6A 2V8PA 2PO2B 1N0UA 2BA1D 1NHJA 5L3JA 5K36A 4LPFA 2UXCE 4OX9E 4IZJA 4GQUA 4WUBA 3M85G 4DR2I 3U1YA 1Z0BA 1Z5CA 5IWAI 4JI1E 2V2QA 3B4TA 4JI4E 4ED4A 4LFCE 4OO1C 2WNRA 1NHHA 4P52A 4BA2A 1U2RA 4MYUA 4DR4E 2BA0G 3ZZTA 2XEXA 2R42A 1ZXMA 4P7AA 1ZM2A 4RPFA 4ISAA 4B3RI 4AQYE 4WUCA 4DUZE 1HNZI 4JYAI 2IERA 4DV1E 5EKWA 2Z5BB 1KIJA 5JEAF 3M7NG 2O1WA 4DUZI 2GO3A 2PO0A 2UU9E 4DV4I 1FNMA 1H74A 3JAMQ 2X7IA 4JI2I 2R3VA 4LF7E 4ZVIA 4LF8I 5K36C 3U1KA 4FWHA 1IBME 1USUA 1QZRA 5EL9A 4LF6E 2Q2EB 4X64I 2PNLA 3P3CA 2JEAA 5C0XF 3B82A 4DU8A 1HK7A 3GMEA 2HKJA 1H72C 4IFDF 4NXNE 2Z5CB 4DPXA 5JEAC 2PNMA 3J7AG 3P3EA 4X65E 5FLXC 4NXNI 4IZKA 3WU6A 1RREA 3GCMA 4DR1E 4X65I 2HFUA 5BR8E 4DR1I 1OJ4A 1IBLI 4B3SE 4GKKI 4AIMA 1OYSA 2WP8A 4LF9I 1RHYA 1UDQA 2NN6B 4MU0A 3T1HE 1HNWE 4B3SI 4DR5E 3T1HI 4DPWA 5ELWA 4DV3E 1J5EI 1NZ0A 4DPUA 2J65A 2NN6E 4QNJA 2PO1A 1XHKA 4KQVA 3ZKBA 1FWKA 5FWKA 4JI8I 2C37A 3CDJA 4USMA 1H73A 4MU4A 4DV7I 1P42A 2NPFA 1XMOI 2HK2A 4PU9A 2F4VE 4JI5E 2C38B 3LTOA 3V5RA 4LF5E 2UUBE 1Z0TA 2VQEE 2OI2A 4OKGA 2IOQA 2VQEI 4N3OA 2GS8A 1Z0WA 2A2DA 2HK3A 4OO1D 3T1YE 2UXBI 1EA6A 2BA1G 1I94I 4JI7E 2WW4A 1HR0E 1N32E 3DD6A 1N36E 2C39B 4AIDA 3LPSA 4GKJI 1N32I 2UXDI 3PS1A 1N36I 2A2CA 1E3HA 4YHHI 1MX0A 3QT8A 1ZXNA 4DR2E 4PRVA 4DU7A 5A2QC 1YH8A 3ZKDA 5IWAE 2CG9A 3OTOI 4X66E 2Z5EA 1S4EA 2BR2A 4X66I 5K36D 4FW5A 3PYFA 4NBQA 5A2QQ 4MU3A 5JEAA 4IZJD 1PIEA 4DV2I 1PKPA 4FW6A 1Y6ZA 2UUCI 2NN6F 4AM3A 4B3RE 1N34I 1H7SA 4DR3I 2JT2A 5C0XA 1DARA 1HNZE 4JYAE 3QT7A 1KKHA 4HY1A 5DROA 4IFDA 2V2VA 4DV4E 3WU3A 3PS2A 4JI2E 4LF8E 2AJ4A 4URLA 4X64E 3LNUA 3L7ZB 1KVKA 4JI6I 2PNZA 4WUDA 2HFSA 2F1DA 4M1KA 2EFGA 3J81C 4K0KE 2BA0D 1NHIA 2PO2A 3J80C 4IS9A 2JEBB 4K0KI 5DRPA 1N33I 3Q6NA 4OO1B 5GMEA 4DPYA 4EMDA 1IBLE 2HHHI 4GKKE 3PYDA 4LF9E 4HACB 1ZM9A 1Y4UA 1PVGA 4HYMA 4DR7I 2ZBKB 5C0XC 5FLXQ 3UHMA 4DV5E 3HULA 1J5EE 4OO1E 2IESA 2VF3A 1ZM3A 4DUYI 4IFDC 4DV5I 4LFAE 1HNXI 4BA1B 1XMQI 2GO4A 4LFAI 4JI8E 3QT6A 1FKAE 4DV7E 1XMOE 4FWDA 2O1VA 4XTJA 2JE6B 4J3DA 4KHPI 3V2UC 4LCGA 4X62I 1N0VC 5K36B 4YY3I 2Z5BA 2J7KA 1MU5A 2UUAI 2IOPA 4IZJB 4LF4I 1Y60A 4B3MI 4FW7A 5K36E 5LMUI 2WNRB 5IT9C 2VQFE 2E5LI 4B3TI 3F0NA 4BA2B 2UXBE 1USVA 5DNXA 1I94E 5LMNI 2VQFI 2O1UA 4DR6I 1WUUA 2Z5CA 3K85A 2DEIA 1FI4A 1BKNA 1K47A 4DV6E 1B63A 4GKJE 2UXDE 5JEAE 2V2ZA 2V34A 4DV6I 3HJCA 5DRQA 4YHHE 1B62A 1KTVA 3P06A 4FWGA 3WU4A 2NN6A 3D4JA 3OTOE 3PYEA 2PO0B 1EI1A 2LJPA 4OO1F 2BV3A 2JEAB 4LFBE 4DV2E 3K1JA 1FWLA 1Z0GA 2UUCE 3GONA 4LFBI 3GLLA 1S16A 1N34E 4JI0E 1ZM4A 4DR3E 2C38A 2E1RA 3M6AA 3ZZUA 4IZKB 4JI0I 2UXCI 5JEAD 4OX9I 4JG4A 4LCHA 3PS3A 4MQYA 1IBKE 1UEKA 2CVEA 3B8HA 2WP8B 4JI1I 4JI4I 4LFCI 3M85D 4JI3E 1IBKI 4FN5A 4JI6E 1VISA 5C0XD 1FJGE 3QT5A 1XXEA 4JI3I 2NN6C 4DR4I 5K36F 3NZKA 4FW4A 2VESA 3ZZ0A 4IFDD 5GMDA 1FJGI 3KRNA 2C39A 3Q6MA 2PO1B 3JAMC 2C37B 2GQ0A 1N33E 3P76A 2DEJA 4AQYI 1H7UA 2ZITA 4HXZA 1MG7A 4DPTA 3J81Q 2HHHE 2AE8A 3J80Q 4DV1I 1OYRA 2BM1A 4FW3A 5DRRA 4DR7E 2UU9I
chains in the Genus database with same CATH topology
4DXLA 4LF7I 4DUYE 1IBMI 4LF6I 2CGEA 1HNXE 2HKEA 1XMQE 1Z5AA 4Z7YA 3ZM7A 3J7AM 1Z0EA 4KHPE 2CZ9A 4JV5E 1Z5BA 4X62E 3B78A 4YY3E 3K17A 4JV5I 2ZM6E 2UUAE 4LF4E 1RR9A 4R1FA 5BR8I 2ZM6I 4B3ME 1A6FA 2X36A 5LMUE 1HNWI 4UT4A 3WU5A 4Z7CA 4DR5I 3PYGA 2E5LE 3PRYA 4B3TE 1Y4SA 4DV3I 4FW9A 5LMNE 4DR6E 3CWVA 1XNRE 4PRXA 1XNQE 1XNRI 2BM0A 1ELOA 4UTGA 5IT9Q 1XNQI 2F4VI 4JI5I 2O1TA 4HACA 4LF5I 2UUBI 1Z0CA 1Z59A 4NXME 4NXMI 4MYTA 3H4LA 4I3HA 4DV0E 3T1YI 3Q1QA 1Z0VA 4USKA 1D6TA 4DV0I 4JI7I 5LL6R 1HR0I 2V8PA 1N0UA 1NHJA 5L3JA 2UXCE 4OX9E 4IZJA 4WUBA 4DR2I 1Z0BA 1Z5CA 5IWAI 4JI1E 2V2QA 4JI4E 4ED4A 4LFCE 1NHHA 4P52A 1U2RA 4MYUA 4DR4E 3ZZTA 2XEXA 2R42A 1ZXMA 4P7AA 1ZM2A 4RPFA 4B3RI 4AQYE 4WUCA 4DUZE 1HNZI 4JYAI 4DV1E 2Z5BB 1KIJA 2O1WA 4DUZI 2UU9E 4DV4I 1FNMA 1H74A 3JAMQ 2X7IA 4JI2I 2R3VA 4LF7E 4ZVIA 4LF8I 4FWHA 1IBME 1USUA 1QZRA 4LF6E 2Q2EB 4X64I 2PNLA 3B82A 4DU8A 1HK7A 2HKJA 1H72C 4NXNE 2Z5CB 4DPXA 2PNMA 3J7AG 4X65E 5FLXC 4NXNI 4IZKA 3WU6A 1RREA 4DR1E 4X65I 2HFUA 5BR8E 4DR1I 1OJ4A 1IBLI 4B3SE 4GKKI 4LF9I 3T1HE 1HNWE 4B3SI 4DR5E 3T1HI 4DPWA 4DV3E 1J5EI 1NZ0A 4DPUA 1XHKA 4KQVA 3ZKBA 1FWKA 5FWKA 4JI8I 4USMA 1H73A 4DV7I 2NPFA 1XMOI 2HK2A 4PU9A 2F4VE 4JI5E 3LTOA 3V5RA 4LF5E 2UUBE 1Z0TA 2VQEE 2OI2A 2IOQA 2VQEI 4N3OA 2GS8A 1Z0WA 2A2DA 2HK3A 3T1YE 2UXBI 1EA6A 1I94I 4JI7E 2WW4A 1HR0E 1N32E 1N36E 3LPSA 4GKJI 1N32I 2UXDI 1N36I 2A2CA 4YHHI 1MX0A 3QT8A 1ZXNA 4DR2E 4PRVA 4DU7A 5A2QC 3ZKDA 5IWAE 2CG9A 3OTOI 4X66E 2Z5EA 1S4EA 4X66I 3PYFA 5A2QQ 4IZJD 1PIEA 4DV2I 1PKPA 1Y6ZA 2UUCI 4B3RE 1N34I 1H7SA 4DR3I 1DARA 1HNZE 4JYAE 3QT7A 1KKHA 4HY1A 2V2VA 4DV4E 3WU3A 4JI2E 4LF8E 2AJ4A 4URLA 4X64E 3LNUA 1KVKA 4JI6I 4WUDA 2HFSA 4M1KA 2EFGA 3J81C 4K0KE 3J80C 1NHIA 4K0KI 1N33I 3Q6NA 5GMEA 4DPYA 4EMDA 1IBLE 2HHHI 4GKKE 3PYDA 4LF9E 4HACB 1ZM9A 1Y4UA 1PVGA 4HYMA 4DR7I 2ZBKB 5FLXQ 4DV5E 3HULA 1J5EE 2VF3A 1ZM3A 4DUYI 4DV5I 4LFAE 1HNXI 1XMQI 4LFAI 4JI8E 3QT6A 1FKAE 4DV7E 1XMOE 4FWDA 2O1VA 4XTJA 4KHPI 3V2UC 4X62I 1N0VC 4YY3I 2Z5BA 2J7KA 1MU5A 2UUAI 2IOPA 4IZJB 4LF4I 4B3MI 5LMUI 5IT9C 2VQFE 2E5LI 4B3TI 3F0NA 2UXBE 1USVA 1I94E 5LMNI 2VQFI 2O1UA 4DR6I 1WUUA 2Z5CA 3K85A 2DEIA 1FI4A 1BKNA 1K47A 4DV6E 1B63A 4GKJE 2UXDE 2V2ZA 2V34A 4DV6I 3HJCA 4YHHE 1B62A 1KTVA 3P06A 4FWGA 3WU4A 3D4JA 3OTOE 3PYEA 1EI1A 2LJPA 2BV3A 4LFBE 4DV2E 3K1JA 1FWLA 1Z0GA 2UUCE 3GONA 4LFBI 1S16A 1N34E 4JI0E 1ZM4A 4DR3E 2E1RA 3M6AA 3ZZUA 4IZKB 4JI0I 2UXCI 4OX9I 4JG4A 1IBKE 1UEKA 3B8HA 4JI1I 4JI4I 4LFCI 4JI3E 1IBKI 4FN5A 4JI6E 1VISA 1FJGE 3QT5A 4JI3I 4DR4I 3ZZ0A 5GMDA 1FJGI 3Q6MA 3JAMC 2GQ0A 1N33E 2DEJA 4AQYI 1H7UA 2ZITA 4HXZA 1MG7A 4DPTA 3J81Q 2HHHE 3J80Q 4DV1I 2BM1A 4DR7E 2UU9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXL A;  4LF7 I;  4DUY E;  1IBM I;  4LF6 I;  1HNX E;  2HKE A;  1XMQ E;  1Z5A A;  4Z7Y A;  3ZM7 A;  3J7A M;  1Z0E A;  4KHP E;  2CZ9 A;  4JV5 E;  1Z5B A;  4X62 E;  3B78 A;  4YY3 E;  3K17 A;  4JV5 I;  2ZM6 E;  2UUA E;  4LF4 E;  1RR9 A;  4R1F A;  5BR8 I;  2ZM6 I;  4B3M E;  1A6F A;  2X36 A;  5LMU E;  1HNW I;  4UT4 A;  3WU5 A;  4Z7C A;  4DR5 I;  3PYG A;  2E5L E;  4B3T E;  4DV3 I;  4FW9 A;  5LMN E;  4DR6 E;  3CWV A;  1XNR E;  4PRX A;  1XNQ E;  1XNR I;  2BM0 A;  1ELO A;  4UTG A;  5IT9 Q;  1XNQ I;  2F4V I;  4JI5 I;  4HAC A;  4LF5 I;  2UUB I;  1Z0C A;  1Z59 A;  4NXM E;  4NXM I;  4MYT A;  3H4L A;  4I3H A;  4DV0 E;  3T1Y I;  3Q1Q A;  1Z0V A;  4USK A;  1D6T A;  4DV0 I;  4JI7 I;  5LL6 R;  1HR0 I;  2V8P A;  1N0U A;  1NHJ A;  5L3J A;  2UXC E;  4OX9 E;  4WUB A;  4DR2 I;  1Z0B A;  1Z5C A;  5IWA I;  4JI1 E;  2V2Q A;  4JI4 E;  4ED4 A;  4LFC E;  1NHH A;  4P52 A;  1U2R A;  4MYU A;  4DR4 E;  3ZZT A;  2XEX A;  2R42 A;  1ZXM A;  4P7A A;  1ZM2 A;  4RPF A;  4B3R I;  4AQY E;  4WUC A;  4DUZ E;  1HNZ I;  4JYA I;  4DV1 E;  1KIJ A;  4DUZ I;  2UU9 E;  4DV4 I;  1FNM A;  1H74 A;  3JAM Q;  2X7I A;  4JI2 I;  2R3V A;  4LF7 E;  4ZVI A;  4LF8 I;  4FWH A;  1IBM E;  1QZR A;  4LF6 E;  2Q2E B;  4X64 I;  3B82 A;  4DU8 A;  2HKJ A;  1H72 C;  4NXN E;  4DPX A;  3J7A G;  4X65 E;  5FLX C;  4NXN I;  3WU6 A;  1RRE A;  4DR1 E;  4X65 I;  2HFU A;  5BR8 E;  4DR1 I;  1OJ4 A;  1IBL I;  4B3S E;  4GKK I;  4LF9 I;  3T1H E;  1HNW E;  4B3S I;  4DR5 E;  3T1H I;  4DPW A;  4DV3 E;  1J5E I;  1NZ0 A;  4DPU A;  1XHK A;  4KQV A;  3ZKB A;  1FWK A;  4JI8 I;  4USM A;  1H73 A;  4DV7 I;  2NPF A;  1XMO I;  2HK2 A;  4PU9 A;  2F4V E;  4JI5 E;  3LTO A;  3V5R A;  4LF5 E;  2UUB E;  1Z0T A;  2VQE E;  2OI2 A;  2VQE I;  2GS8 A;  1Z0W A;  2A2D A;  2HK3 A;  3T1Y E;  2UXB I;  1EA6 A;  1I94 I;  4JI7 E;  2WW4 A;  1HR0 E;  1N32 E;  1N36 E;  3LPS A;  4GKJ I;  1N32 I;  2UXD I;  1N36 I;  2A2C A;  4YHH I;  1MX0 A;  3QT8 A;  1ZXN A;  4DR2 E;  4PRV A;  4DU7 A;  5A2Q C;  3ZKD A;  5IWA E;  3OTO I;  4X66 E;  1S4E A;  4X66 I;  3PYF A;  5A2Q Q;  1PIE A;  4DV2 I;  1PKP A;  2UUC I;  4B3R E;  1N34 I;  1H7S A;  4DR3 I;  1DAR A;  1HNZ E;  4JYA E;  3QT7 A;  1KKH A;  4HY1 A;  2V2V A;  4DV4 E;  3WU3 A;  4JI2 E;  4LF8 E;  2AJ4 A;  4URL A;  4X64 E;  3LNU A;  1KVK A;  4JI6 I;  4WUD A;  2HFS A;  4M1K A;  2EFG A;  3J81 C;  4K0K E;  3J80 C;  1NHI A;  4K0K I;  1N33 I;  5GME A;  4DPY A;  4EMD A;  1IBL E;  2HHH I;  4GKK E;  3PYD A;  4LF9 E;  4HAC B;  1ZM9 A;  1PVG A;  4HYM A;  4DR7 I;  2ZBK B;  5FLX Q;  4DV5 E;  3HUL A;  1J5E E;  2VF3 A;  1ZM3 A;  4DUY I;  4DV5 I;  4LFA E;  1HNX I;  1XMQ I;  4LFA I;  4JI8 E;  3QT6 A;  1FKA E;  4DV7 E;  1XMO E;  4FWD A;  4XTJ A;  4KHP I;  3V2U C;  4X62 I;  1N0V C;  4YY3 I;  2J7K A;  1MU5 A;  2UUA I;  4LF4 I;  4B3M I;  5LMU I;  5IT9 C;  2VQF E;  2E5L I;  4B3T I;  3F0N A;  2UXB E;  1I94 E;  5LMN I;  2VQF I;  4DR6 I;  1WUU A;  2DEI A;  1FI4 A;  1BKN A;  1K47 A;  4DV6 E;  1B63 A;  4GKJ E;  2UXD E;  2V2Z A;  2V34 A;  4DV6 I;  4YHH E;  1B62 A;  1KTV A;  4FWG A;  3WU4 A;  3D4J A;  3OTO E;  3PYE A;  1EI1 A;  2LJP A;  2BV3 A;  4LFB E;  4DV2 E;  3K1J A;  1FWL A;  1Z0G A;  2UUC E;  3GON A;  4LFB I;  1S16 A;  1N34 E;  4JI0 E;  1ZM4 A;  4DR3 E;  2E1R A;  3M6A A;  3ZZU A;  4JI0 I;  2UXC I;  4OX9 I;  4JG4 A;  1IBK E;  1UEK A;  3B8H A;  4JI1 I;  4JI4 I;  4LFC I;  4JI3 E;  1IBK I;  4FN5 A;  4JI6 E;  1VIS A;  1FJG E;  3QT5 A;  4JI3 I;  4DR4 I;  3ZZ0 A;  5GMD A;  1FJG I;  3JAM C;  1N33 E;  2DEJ A;  4AQY I;  1H7U A;  2ZIT A;  4HXZ A;  1MG7 A;  4DPT A;  3J81 Q;  2HHH E;  3J80 Q;  4DV1 I;  2BM1 A;  4DR7 E;  2UU9 I; 
#chains in the Genus database with same CATH topology
 4DXL A;  4LF7 I;  4DUY E;  1IBM I;  3M7N D;  4LF6 I;  2CGE A;  1HNX E;  2HKE A;  1XMQ E;  1Z5A A;  4Z7Y A;  3ZM7 A;  4U3B A;  3J7A M;  4LCF A;  4MDT A;  1Z0E A;  4KHP E;  1R6M A;  2CZ9 A;  4JV5 E;  1Z5B A;  1Y5Y A;  3P3G A;  4X62 E;  3B78 A;  4YY3 E;  3K17 A;  4JV5 I;  2ZM6 E;  1YHC A;  2UUA E;  4LF4 E;  1RR9 A;  4R1F A;  4MU1 A;  3H1C A;  5BR8 I;  2ZM6 I;  1UDN A;  4B3M E;  1A6F A;  2X36 A;  5LMU E;  1HNW I;  4UT4 A;  3L7Z A;  3WU5 A;  4Z7C A;  4DR5 I;  3PYG A;  2E5L E;  3PRY A;  2O3Z A;  2BR2 B;  4B3T E;  1Y4S A;  4DV3 I;  4FW9 A;  4OZE A;  5LMN E;  4DR6 E;  5JEA B;  3CWV A;  1R6L A;  2JEB A;  1XNR E;  4PRX A;  1VI7 A;  1XNQ E;  4LOM A;  1XNR I;  1ELO A;  2BM0 A;  4UTG A;  5IT9 Q;  1XNQ I;  4OO1 A;  1UDO A;  2F4V I;  4JI5 I;  2O1T A;  5DNL A;  5C0X B;  4HAC A;  4LF5 I;  2UUB I;  1Z0C A;  1Z59 A;  4NXM E;  4IFD B;  3CDI A;  4NXM I;  4MYT A;  5C0X E;  1UDS A;  3H4L A;  4I3H A;  4BA1 A;  4DV0 E;  3T1Y I;  3Q1Q A;  4IFD E;  1Z0V A;  4USK A;  4QNK A;  2PNZ B;  1OYP A;  1D6T A;  4U3D A;  2NN6 D;  1E3P A;  4DV0 I;  4JI7 I;  5LL6 R;  3HKM A;  1HR0 I;  2JE6 A;  2V8P A;  2PO2 B;  1N0U A;  2BA1 D;  1NHJ A;  5L3J A;  5K36 A;  4LPF A;  2UXC E;  4OX9 E;  4IZJ A;  4GQU A;  4WUB A;  3M85 G;  4DR2 I;  3U1Y A;  1Z0B A;  1Z5C A;  5IWA I;  4JI1 E;  2V2Q A;  3B4T A;  4JI4 E;  4ED4 A;  4LFC E;  4OO1 C;  2WNR A;  1NHH A;  4P52 A;  4BA2 A;  1U2R A;  4MYU A;  4DR4 E;  2BA0 G;  3ZZT A;  2XEX A;  2R42 A;  1ZXM A;  4P7A A;  1ZM2 A;  4RPF A;  4ISA A;  4B3R I;  4AQY E;  4WUC A;  4DUZ E;  1HNZ I;  4JYA I;  2IER A;  4DV1 E;  5EKW A;  2Z5B B;  1KIJ A;  5JEA F;  3M7N G;  2O1W A;  4DUZ I;  2GO3 A;  2PO0 A;  2UU9 E;  4DV4 I;  1FNM A;  1H74 A;  3JAM Q;  2X7I A;  4JI2 I;  2R3V A;  4LF7 E;  4ZVI A;  4LF8 I;  5K36 C;  3U1K A;  4FWH A;  1IBM E;  1USU A;  1QZR A;  5EL9 A;  4LF6 E;  2Q2E B;  4X64 I;  2PNL A;  3P3C A;  2JEA A;  5C0X F;  3B82 A;  4DU8 A;  1HK7 A;  3GME A;  2HKJ A;  1H72 C;  4IFD F;  4NXN E;  2Z5C B;  4DPX A;  5JEA C;  2PNM A;  3J7A G;  3P3E A;  4X65 E;  5FLX C;  4NXN I;  4IZK A;  3WU6 A;  1RRE A;  3GCM A;  4DR1 E;  4X65 I;  2HFU A;  5BR8 E;  4DR1 I;  1OJ4 A;  1IBL I;  4B3S E;  4GKK I;  4AIM A;  1OYS A;  2WP8 A;  4LF9 I;  1RHY A;  1UDQ A;  2NN6 B;  4MU0 A;  3T1H E;  1HNW E;  4B3S I;  4DR5 E;  3T1H I;  4DPW A;  5ELW A;  4DV3 E;  1J5E I;  1NZ0 A;  4DPU A;  2J65 A;  2NN6 E;  4QNJ A;  2PO1 A;  1XHK A;  4KQV A;  3ZKB A;  1FWK A;  5FWK A;  4JI8 I;  2C37 A;  3CDJ A;  4USM A;  1H73 A;  4MU4 A;  4DV7 I;  1P42 A;  2NPF A;  1XMO I;  2HK2 A;  4PU9 A;  2F4V E;  4JI5 E;  2C38 B;  3LTO A;  3V5R A;  4LF5 E;  2UUB E;  1Z0T A;  2VQE E;  2OI2 A;  4OKG A;  2IOQ A;  2VQE I;  4N3O A;  2GS8 A;  1Z0W A;  2A2D A;  2HK3 A;  4OO1 D;  3T1Y E;  2UXB I;  1EA6 A;  2BA1 G;  1I94 I;  4JI7 E;  2WW4 A;  1HR0 E;  1N32 E;  3DD6 A;  1N36 E;  2C39 B;  4AID A;  3LPS A;  4GKJ I;  1N32 I;  2UXD I;  3PS1 A;  1N36 I;  2A2C A;  1E3H A;  4YHH I;  1MX0 A;  3QT8 A;  1ZXN A;  4DR2 E;  4PRV A;  4DU7 A;  5A2Q C;  1YH8 A;  3ZKD A;  5IWA E;  2CG9 A;  3OTO I;  4X66 E;  2Z5E A;  1S4E A;  2BR2 A;  4X66 I;  5K36 D;  4FW5 A;  3PYF A;  4NBQ A;  5A2Q Q;  4MU3 A;  5JEA A;  4IZJ D;  1PIE A;  4DV2 I;  1PKP A;  4FW6 A;  1Y6Z A;  2UUC I;  2NN6 F;  4AM3 A;  4B3R E;  1N34 I;  1H7S A;  4DR3 I;  2JT2 A;  5C0X A;  1DAR A;  1HNZ E;  4JYA E;  3QT7 A;  1KKH A;  4HY1 A;  5DRO A;  4IFD A;  2V2V A;  4DV4 E;  3WU3 A;  3PS2 A;  4JI2 E;  4LF8 E;  2AJ4 A;  4URL A;  4X64 E;  3LNU A;  3L7Z B;  1KVK A;  4JI6 I;  2PNZ A;  4WUD A;  2HFS A;  2F1D A;  4M1K A;  2EFG A;  3J81 C;  4K0K E;  2BA0 D;  1NHI A;  2PO2 A;  3J80 C;  4IS9 A;  2JEB B;  4K0K I;  5DRP A;  1N33 I;  3Q6N A;  4OO1 B;  5GME A;  4DPY A;  4EMD A;  1IBL E;  2HHH I;  4GKK E;  3PYD A;  4LF9 E;  4HAC B;  1ZM9 A;  1Y4U A;  1PVG A;  4HYM A;  4DR7 I;  2ZBK B;  5C0X C;  5FLX Q;  3UHM A;  4DV5 E;  3HUL A;  1J5E E;  4OO1 E;  2IES A;  2VF3 A;  1ZM3 A;  4DUY I;  4IFD C;  4DV5 I;  4LFA E;  1HNX I;  4BA1 B;  1XMQ I;  2GO4 A;  4LFA I;  4JI8 E;  3QT6 A;  1FKA E;  4DV7 E;  1XMO E;  4FWD A;  2O1V A;  4XTJ A;  2JE6 B;  4J3D A;  4KHP I;  3V2U C;  4LCG A;  4X62 I;  1N0V C;  5K36 B;  4YY3 I;  2Z5B A;  2J7K A;  1MU5 A;  2UUA I;  2IOP A;  4IZJ B;  4LF4 I;  1Y60 A;  4B3M I;  4FW7 A;  5K36 E;  5LMU I;  2WNR B;  5IT9 C;  2VQF E;  2E5L I;  4B3T I;  3F0N A;  4BA2 B;  2UXB E;  1USV A;  5DNX A;  1I94 E;  5LMN I;  2VQF I;  2O1U A;  4DR6 I;  1WUU A;  2Z5C A;  3K85 A;  2DEI A;  1FI4 A;  1BKN A;  1K47 A;  4DV6 E;  1B63 A;  4GKJ E;  2UXD E;  5JEA E;  2V2Z A;  2V34 A;  4DV6 I;  3HJC A;  5DRQ A;  4YHH E;  1B62 A;  1KTV A;  3P06 A;  4FWG A;  3WU4 A;  2NN6 A;  3D4J A;  3OTO E;  3PYE A;  2PO0 B;  1EI1 A;  2LJP A;  4OO1 F;  2BV3 A;  2JEA B;  4LFB E;  4DV2 E;  3K1J A;  1FWL A;  1Z0G A;  2UUC E;  3GON A;  4LFB I;  3GLL A;  1S16 A;  1N34 E;  4JI0 E;  1ZM4 A;  4DR3 E;  2C38 A;  2E1R A;  3M6A A;  3ZZU A;  4IZK B;  4JI0 I;  2UXC I;  5JEA D;  4OX9 I;  4JG4 A;  4LCH A;  3PS3 A;  4MQY A;  1IBK E;  1UEK A;  2CVE A;  3B8H A;  2WP8 B;  4JI1 I;  4JI4 I;  4LFC I;  3M85 D;  4JI3 E;  1IBK I;  4FN5 A;  4JI6 E;  1VIS A;  5C0X D;  1FJG E;  3QT5 A;  1XXE A;  4JI3 I;  2NN6 C;  4DR4 I;  5K36 F;  3NZK A;  4FW4 A;  2VES A;  3ZZ0 A;  4IFD D;  5GMD A;  1FJG I;  3KRN A;  2C39 A;  3Q6M A;  2PO1 B;  3JAM C;  2C37 B;  2GQ0 A;  1N33 E;  3P76 A;  2DEJ A;  4AQY I;  1H7U A;  2ZIT A;  4HXZ A;  1MG7 A;  4DPT A;  3J81 Q;  2HHH E;  2AE8 A;  3J80 Q;  4DV1 I;  1OYR A;  2BM1 A;  4FW3 A;  5DRR A;  4DR7 E;  2UU9 I; 
#chains in the Genus database with same CATH homology
 4DXL A;  4LF7 I;  4DUY E;  1IBM I;  4LF6 I;  2CGE A;  1HNX E;  2HKE A;  1XMQ E;  1Z5A A;  4Z7Y A;  3ZM7 A;  3J7A M;  1Z0E A;  4KHP E;  2CZ9 A;  4JV5 E;  1Z5B A;  4X62 E;  3B78 A;  4YY3 E;  3K17 A;  4JV5 I;  2ZM6 E;  2UUA E;  4LF4 E;  1RR9 A;  4R1F A;  5BR8 I;  2ZM6 I;  4B3M E;  1A6F A;  2X36 A;  5LMU E;  1HNW I;  4UT4 A;  3WU5 A;  4Z7C A;  4DR5 I;  3PYG A;  2E5L E;  3PRY A;  4B3T E;  1Y4S A;  4DV3 I;  4FW9 A;  5LMN E;  4DR6 E;  3CWV A;  1XNR E;  4PRX A;  1XNQ E;  1XNR I;  2BM0 A;  1ELO A;  4UTG A;  5IT9 Q;  1XNQ I;  2F4V I;  4JI5 I;  2O1T A;  4HAC A;  4LF5 I;  2UUB I;  1Z0C A;  1Z59 A;  4NXM E;  4NXM I;  4MYT A;  3H4L A;  4I3H A;  4DV0 E;  3T1Y I;  3Q1Q A;  1Z0V A;  4USK A;  1D6T A;  4DV0 I;  4JI7 I;  5LL6 R;  1HR0 I;  2V8P A;  1N0U A;  1NHJ A;  5L3J A;  2UXC E;  4OX9 E;  4IZJ A;  4WUB A;  4DR2 I;  1Z0B A;  1Z5C A;  5IWA I;  4JI1 E;  2V2Q A;  4JI4 E;  4ED4 A;  4LFC E;  1NHH A;  4P52 A;  1U2R A;  4MYU A;  4DR4 E;  3ZZT A;  2XEX A;  2R42 A;  1ZXM A;  4P7A A;  1ZM2 A;  4RPF A;  4B3R I;  4AQY E;  4WUC A;  4DUZ E;  1HNZ I;  4JYA I;  4DV1 E;  2Z5B B;  1KIJ A;  2O1W A;  4DUZ I;  2UU9 E;  4DV4 I;  1FNM A;  1H74 A;  3JAM Q;  2X7I A;  4JI2 I;  2R3V A;  4LF7 E;  4ZVI A;  4LF8 I;  4FWH A;  1IBM E;  1USU A;  1QZR A;  4LF6 E;  2Q2E B;  4X64 I;  2PNL A;  3B82 A;  4DU8 A;  1HK7 A;  2HKJ A;  1H72 C;  4NXN E;  2Z5C B;  4DPX A;  2PNM A;  3J7A G;  4X65 E;  5FLX C;  4NXN I;  4IZK A;  3WU6 A;  1RRE A;  4DR1 E;  4X65 I;  2HFU A;  5BR8 E;  4DR1 I;  1OJ4 A;  1IBL I;  4B3S E;  4GKK I;  4LF9 I;  3T1H E;  1HNW E;  4B3S I;  4DR5 E;  3T1H I;  4DPW A;  4DV3 E;  1J5E I;  1NZ0 A;  4DPU A;  1XHK A;  4KQV A;  3ZKB A;  1FWK A;  5FWK A;  4JI8 I;  4USM A;  1H73 A;  4DV7 I;  2NPF A;  1XMO I;  2HK2 A;  4PU9 A;  2F4V E;  4JI5 E;  3LTO A;  3V5R A;  4LF5 E;  2UUB E;  1Z0T A;  2VQE E;  2OI2 A;  2IOQ A;  2VQE I;  4N3O A;  2GS8 A;  1Z0W A;  2A2D A;  2HK3 A;  3T1Y E;  2UXB I;  1EA6 A;  1I94 I;  4JI7 E;  2WW4 A;  1HR0 E;  1N32 E;  1N36 E;  3LPS A;  4GKJ I;  1N32 I;  2UXD I;  1N36 I;  2A2C A;  4YHH I;  1MX0 A;  3QT8 A;  1ZXN A;  4DR2 E;  4PRV A;  4DU7 A;  5A2Q C;  3ZKD A;  5IWA E;  2CG9 A;  3OTO I;  4X66 E;  2Z5E A;  1S4E A;  4X66 I;  3PYF A;  5A2Q Q;  4IZJ D;  1PIE A;  4DV2 I;  1PKP A;  1Y6Z A;  2UUC I;  4B3R E;  1N34 I;  1H7S A;  4DR3 I;  1DAR A;  1HNZ E;  4JYA E;  3QT7 A;  1KKH A;  4HY1 A;  2V2V A;  4DV4 E;  3WU3 A;  4JI2 E;  4LF8 E;  2AJ4 A;  4URL A;  4X64 E;  3LNU A;  1KVK A;  4JI6 I;  4WUD A;  2HFS A;  4M1K A;  2EFG A;  3J81 C;  4K0K E;  3J80 C;  1NHI A;  4K0K I;  1N33 I;  3Q6N A;  5GME A;  4DPY A;  4EMD A;  1IBL E;  2HHH I;  4GKK E;  3PYD A;  4LF9 E;  4HAC B;  1ZM9 A;  1Y4U A;  1PVG A;  4HYM A;  4DR7 I;  2ZBK B;  5FLX Q;  4DV5 E;  3HUL A;  1J5E E;  2VF3 A;  1ZM3 A;  4DUY I;  4DV5 I;  4LFA E;  1HNX I;  1XMQ I;  4LFA I;  4JI8 E;  3QT6 A;  1FKA E;  4DV7 E;  1XMO E;  4FWD A;  2O1V A;  4XTJ A;  4KHP I;  3V2U C;  4X62 I;  1N0V C;  4YY3 I;  2Z5B A;  2J7K A;  1MU5 A;  2UUA I;  2IOP A;  4IZJ B;  4LF4 I;  4B3M I;  5LMU I;  5IT9 C;  2VQF E;  2E5L I;  4B3T I;  3F0N A;  2UXB E;  1USV A;  1I94 E;  5LMN I;  2VQF I;  2O1U A;  4DR6 I;  1WUU A;  2Z5C A;  3K85 A;  2DEI A;  1FI4 A;  1BKN A;  1K47 A;  4DV6 E;  1B63 A;  4GKJ E;  2UXD E;  2V2Z A;  2V34 A;  4DV6 I;  3HJC A;  4YHH E;  1B62 A;  1KTV A;  3P06 A;  4FWG A;  3WU4 A;  3D4J A;  3OTO E;  3PYE A;  1EI1 A;  2LJP A;  2BV3 A;  4LFB E;  4DV2 E;  3K1J A;  1FWL A;  1Z0G A;  2UUC E;  3GON A;  4LFB I;  1S16 A;  1N34 E;  4JI0 E;  1ZM4 A;  4DR3 E;  2E1R A;  3M6A A;  3ZZU A;  4IZK B;  4JI0 I;  2UXC I;  4OX9 I;  4JG4 A;  1IBK E;  1UEK A;  3B8H A;  4JI1 I;  4JI4 I;  4LFC I;  4JI3 E;  1IBK I;  4FN5 A;  4JI6 E;  1VIS A;  1FJG E;  3QT5 A;  4JI3 I;  4DR4 I;  3ZZ0 A;  5GMD A;  1FJG I;  3Q6M A;  3JAM C;  2GQ0 A;  1N33 E;  2DEJ A;  4AQY I;  1H7U A;  2ZIT A;  4HXZ A;  1MG7 A;  4DPT A;  3J81 Q;  2HHH E;  3J80 Q;  4DV1 I;  2BM1 A;  4DR7 E;  2UU9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...