4NXNI

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxnI00
1B62A 2LJPA 5L3JA 4X62I 4FWDA 4ZVIA 3B82A 4LFCI 1KVKA 1N34E 3T1HE 4DUYE 1N32I 4WUDA 2UXDI 4RPFA 1MX0A 4K0KE 2ZITA 3LNUA 4DV5E 4I3HA 2V34A 1J5EI 4DR4I 4DV4E 2HK3A 4JI1I 3QT6A 2BV3A 4DUZE 4UT4A 2A2CA 4DV3I 3J80C 4NXNI 1HNWE 3M6AA 2UUBI 4KHPI 2V2QA 4DPUA 4LFAI 2F4VI 4B3ME 4FW9A 3J81C 1IBLE 4DR6E 1Z0WA 1QZRA 4DPWA 1KIJA 1U2RA 4PRXA 1HNXE 2X7IA 3PYGA 1WUUA 1EA6A 4DR1E 2V2VA 4JI6E 4JI7E 1HR0I 4X66E 4JYAE 4EMDA 1N33I 1Z0TA 4X65I 3JAMC 5LMNI 4LF9E 3OTOE 2UXCI 4JI5I 2NPFA 2HFSA 3WU4A 4HACA 4LF8I 4LF5E 4DR7E 3PYFA 1ZXMA 4JI4E 4GKJI 1N34I 1H7UA 4B3TE 1RR9A 3J7AM 4MYTA 3T1YI 3J7AG 1NHJA 4DV4I 1NHIA 2ZM6E 1DARA 1H74A 1ELOA 4AQYE 4HYMA 2UXBE 4JV5E 4FWHA 1Z5CA 4PRVA 4DV1E 1Z0BA 1FWLA 1Z0CA 2R3VA 4DV7I 1FWKA 2ZBKB 4JI2I 4FWGA 4WUBA 5IWAE 4B3MI 4OX9I 1IBME 1FJGE 2CZ9A 1KKHA 1NHHA 2UUAE 2DEJA 1N36I 1VISA 1ZM3A 4LF7I 2HHHI 4P52A 4YY3I 4X64I 4PU9A 2UU9E 3B8HA 1XMOE 5BR8E 1NZ0A 2XEXA 5FLXC 4DV0E 2AJ4A 4USKA 5A2QC 4LF6I 4DV6E 2V8PA 1ZM9A 4URLA 4MYUA 4NXMI 5GMDA 5LMUI 4GKKE 4B3TI 2R42A 3J81Q 1XMQE 2VQFE 1Z5AA 4AQYI 4DR2E 3K1JA 1B63A 4M1KA 2HKJA 2UUCI 3H4LA 4LFBE 1FJGI 2A2DA 3V2UC 2X36A 4X62E 2UUAI 1EI1A 4YHHE 4B3SI 1IBKI 1FI4A 4LFCE 2VQEE 1I94E 3JAMQ 4WUCA 3GONA 2V2ZA 1FNMA 4DV2E 1PIEA 3T1HI 4DUYI 1J5EE 2DEIA 4DR4E 4JI0E 4JI1E 3ZZUA 4DV0I 4K0KI 2GS8A 3F0NA 4DV5I 1PVGA 3WU5A 2UUBE 4DUZI 5LL6R 3ZM7A 4KHPE 4DV6I 4LFAE 2F4VE 3V5RA 1ZXNA 4DR3E 1HNWI 4USMA 1D6TA 2EFGA 1HNZE 5IT9Q 4GKKI 1IBLI 4DR6I 1XMQI 4LF4E 2VF3A 1UEKA 1HNXI 1XNQE 4HACB 4DR5E 1HR0E 4DU7A 1MG7A 2J7KA 4DR1I 2E5LE 1N33E 4X65E 4UTGA 4JI6I 4JI7I 4X66I 2HK2A 4B3RE 2WW4A 4Z7YA 2UXCE 4JYAI 4JI5E 1BKNA 1Z0VA 4LF8E 3K17A 4YHHI 4LF9I 3OTOI 1FKAE 1ZM2A 4GKJE 2VQEI 1I94I 1H72C 5A2QQ 4LF5I 4DR7I 4P7AA 3ZKDA 3J80Q 3T1YE 4JI4I 4DV2I 3ZZTA 1XHKA 4JI0I 4JI8E 3QT5A 3QT7A 1Z5BA 4DU8A 2ZM6I 1S16A 1OJ4A 3D4JA 4DV7E 2UXBI 4JI2E 4JV5I 4OX9E 3B78A 1XNRE 3ZZ0A 4DV1I 1H73A 4DR3I 2E1RA 5IWAI 3Q1QA 4DPXA 1N36E 1IBMI 2HFUA 1HNZI 4LF7E 4JI3E 2HHHE 4YY3E 4X64E 1Z0GA 4R1FA 4LF4I 1PKPA 3HULA 1N32E 2UU9I 3PYDA 1XNQI 2UXDE 1XMOI 4DR5I 5BR8I 2BM1A 2E5LI 1MU5A 2HKEA 4B3RI 4KQVA 3CWVA 4LF6E 3ZKBA 2OI2A 4DV3E 3QT8A 4NXNE 1KTVA 4DPTA 1ZM4A 1RREA 1N0VC 4NXME 4Z7CA 5LMUE 1S4EA 1H7SA 1Z0EA 4DXLA 5GMEA 4JI8I 4ED4A 3PYEA 4HXZA 4FN5A 1A6FA 3WU6A 4XTJA 2VQFI 3LTOA 3LPSA 4DR2I 4JG4A 5IT9C 2UUCE 2Q2EB 4HY1A 2BM0A 1K47A 1N0UA 1XNRI 4DPYA 5LMNE 3WU3A 4LFBI 5FLXQ 4B3SE 1IBKE 1Z59A 4JI3I
chains in the Genus database with same CATH superfamily
5EL9A 1B62A 3M85D 2AE8A 2LJPA 5L3JA 4X62I 4FWDA 4ZVIA 3P3GA 2JEBA 3B82A 4LFCI 5C0XC 1KVKA 5K36E 1N34E 1R6LA 3T1HE 4DUYE 1N32I 4U3DA 4WUDA 2UXDI 4RPFA 1MX0A 4K0KE 2F1DA 2ZITA 3LNUA 2WNRA 4DV5E 4I3HA 2JE6A 5K36B 2V34A 1J5EI 4DR4I 3L7ZA 4DV4E 2HK3A 4JI1I 3QT6A 2BV3A 2VESA 2JT2A 4DUZE 3Q6MA 4UT4A 2A2CA 4LCGA 4DV3I 3J80C 4NXNI 2C37B 1HNWE 2CG9A 3M6AA 2UUBI 4KHPI 2V2QA 4DPUA 4BA2B 4LFAI 2F4VI 4B3ME 4N3OA 4FW9A 2Z5BB 3J81C 4LCHA 3B4TA 2PNZA 1IBLE 4DR6E 2C39A 1Z0WA 1QZRA 4DPWA 1KIJA 2PNMA 2NN6A 3NZKA 1U2RA 4PRXA 3P3EA 5ELWA 4IFDF 2O3ZA 1HNXE 4J3DA 2X7IA 3PYGA 1WUUA 1UDSA 1OYRA 1EA6A 2BA1D 2PO1A 4DR1E 2V2VA 2C38B 2J65A 4JI6E 4JI7E 1HR0I 4X66E 1VI7A 1Y4UA 4JYAE 4EMDA 1N33I 1Z0TA 3Q6NA 4X65I 3JAMC 5LMNI 4LF9E 3OTOE 5C0XF 2UXCI 4JI5I 3PS3A 1E3PA 2BA0G 2NPFA 2HFSA 3WU4A 4OZEA 4HACA 4LF8I 4LF5E 4DR7E 2O1WA 3PYFA 1ZXMA 4JI4E 4GKJI 1YH8A 3P06A 1N34I 4IZJB 1H7UA 4B3TE 1RR9A 3J7AM 4MYTA 3T1YI 3J7AG 5K36F 5DNXA 1NHJA 4DV4I 1NHIA 2ZM6E 1DARA 1H74A 1ELOA 4AQYE 1UDOA 2JEAA 4HYMA 2UXBE 4JV5E 4FWHA 1Z5CA 1Y6ZA 1R6MA 4PRVA 5JEAE 5DRPA 4DV1E 1Z0BA 4IFDC 1FWLA 1Z0CA 2R3VA 4DV7I 1FWKA 2ZBKB 4JI2I 4FW4A 4FWGA 4WUBA 5IWAE 4B3MI 4OX9I 1IBME 1OYPA 5JEAB 1FJGE 1USVA 4FW7A 2BR2B 2CZ9A 1KKHA 1NHHA 2Z5CA 2DEJA 2UUAE 5JEAC 1N36I 1VISA 1ZM3A 4ISAA 4LF7I 2HHHI 4P52A 4YY3I 3H1CA 4X64I 4PU9A 2UU9E 3B8HA 1XMOE 5BR8E 1NZ0A 2O1TA 2XEXA 5FLXC 1Y60A 4IFDD 4DV0E 3M7NG 2PO0A 2AJ4A 4USKA 4FW6A 2PO2A 5A2QC 5K36C 4LF6I 4DV6E 2V8PA 1ZM9A 2GO4A 4URLA 4MYUA 2C38A 3GMEA 4OKGA 4IZKA 4MU3A 4NBQA 4NXMI 4OO1E 4AIMA 5C0XD 5GMDA 5LMUI 4GKKE 4B3TI 2R42A 1UDNA 3J81Q 4GQUA 1XMQE 4OO1B 2VQFE 4QNJA 1Z5AA 4AQYI 4DR2E 1RHYA 3K1JA 4OO1C 1B63A 5K36D 4M1KA 2HKJA 2UUCI 3HKMA 3H4LA 5JEAF 4MU4A 4LFBE 4BA1A 2JE6B 4FW3A 1FJGI 2A2DA 3L7ZB 3V2UC 2IOPA 4IFDA 2X36A 4X62E 1EI1A 2UUAI 4YHHE 5DNLA 4B3SI 1IBKI 1FI4A 4LFCE 2VQEE 1I94E 3JAMQ 4WUCA 3GONA 2WP8A 3GLLA 2V2ZA 1FNMA 4DV2E 2CGEA 2NN6E 2O1UA 1PIEA 3T1HI 4DUYI 1J5EE 2DEIA 4DR4E 4MU0A 2PNZB 4JI0E 3UHMA 2C39B 4LPFA 4JI1E 3ZZUA 4DV0I 4K0KI 3DD6A 2GS8A 3F0NA 4DV5I 1PVGA 2NN6B 5C0XA 5DRRA 3CDJA 2BA0D 3U1KA 3WU5A 2UUBE 4DUZI 5LL6R 1P42A 1XXEA 3ZM7A 3KRNA 1Y4SA 4KHPE 4DV6I 4LFAE 2F4VE 3V5RA 3GCMA 1ZXNA 4DR3E 1HNWI 4USMA 1D6TA 2EFGA 1HNZE 5IT9Q 5K36A 5FWKA 4GKKI 3PS1A 1IBLI 4DR6I 1Y5YA 4OO1F 1XMQI 4LF4E 4IZJD 2VF3A 1UEKA 3M85G 2C37A 2Z5EA 1HNXI 2IERA 1XNQE 4HACB 4DR5E 3K85A 4MU1A 4BA2A 1HR0E 4DU7A 2Z5BA 1MG7A 2J7KA 4DR1I 2E5LE 1N33E 4X65E 4UTGA 4JI6I 4JI7I 4X66I 2HK2A 4B3RE 2WW4A 4Z7YA 2UXCE 4JYAI 4JI5E 1BKNA 2IOQA 4IS9A 1Z0VA 2JEAB 4MQYA 2O1VA 3K17A 4YHHI 5JEAD 3OTOI 4LF9I 1FKAE 4LF8E 1ZM2A 4GKJE 2VQEI 1I94I 1H72C 5A2QQ 4LF5I 4DR7I 4P7AA 3ZKDA 3J80Q 3T1YE 4JI4I 4DV2I 3U1YA 3M7ND 2GO3A 3ZZTA 1XHKA 1YHCA 4JI0I 4JI8E 3QT5A 2Z5CB 3QT7A 2NN6F 1Z5BA 5EKWA 4DU8A 3CDIA 2ZM6I 1S16A 1OJ4A 3D4JA 4DV7E 2UXBI 4JI2E 4JV5I 1E3HA 4AM3A 2BA1G 2JEBB 4OX9E 3B78A 4IZJA 3P3CA 1XNRE 3ZZ0A 4DV1I 1H73A 4DR3I 2E1RA 3P76A 5IWAI 3Q1QA 1USUA 4DPXA 1N36E 1IBMI 2HFUA 1HNZI 2WNRB 1OYSA 2PO0B 2GQ0A 4LF7E 4JI3E 2HHHE 4YY3E 4X64E 4AIDA 2PO2B 1Z0GA 4R1FA 1UDQA 4LF4I 1PKPA 3HULA 4U3BA 1N32E 2UU9I 3PS2A 3PYDA 2IESA 1XNQI 2UXDE 1XMOI 4DR5I 4IZKB 5BR8I 4OO1D 5JEAA 2BM1A 3PRYA 2E5LI 4QNKA 2BR2A 1MU5A 2HKEA 4B3RI 2CVEA 4KQVA 3CWVA 5DRQA 4LF6E 3ZKBA 2OI2A 4DV3E 3QT8A 4NXNE 4MDTA 1KTVA 4DPTA 1ZM4A 2NN6C 1RREA 1N0VC 4NXME 4Z7CA 2PO1B 5LMUE 3HJCA 4IFDE 1S4EA 4BA1B 1H7SA 1Z0EA 4DXLA 5GMEA 4JI8I 4ED4A 3PYEA 4HXZA 4IFDB 4FN5A 1HK7A 1A6FA 3WU6A 4XTJA 2VQFI 3LTOA 3LPSA 2WP8B 4JG4A 4LCFA 4DR2I 2Q2EB 5IT9C 2UUCE 4FW5A 4HY1A 2BM0A 5DROA 1K47A 1N0UA 2NN6D 1XNRI 4DPYA 5C0XE 5LMNE 4LOMA 3WU3A 4LFBI 5FLXQ 4B3SE 4OO1A 1IBKE 1Z59A 2PNLA 4JI3I 5C0XB
chains in the Genus database with same CATH topology
1B62A 2LJPA 5L3JA 4X62I 4FWDA 4ZVIA 3B82A 4LFCI 1KVKA 1N34E 3T1HE 4DUYE 1N32I 4WUDA 2UXDI 4RPFA 1MX0A 4K0KE 2ZITA 3LNUA 4DV5E 4I3HA 2V34A 1J5EI 4DR4I 4DV4E 2HK3A 4JI1I 3QT6A 2BV3A 4DUZE 3Q6MA 4UT4A 2A2CA 4DV3I 3J80C 4NXNI 1HNWE 2CG9A 3M6AA 2UUBI 4KHPI 2V2QA 4DPUA 4LFAI 2F4VI 4B3ME 4N3OA 4FW9A 2Z5BB 3J81C 1IBLE 4DR6E 1Z0WA 1QZRA 4DPWA 1KIJA 2PNMA 1U2RA 4PRXA 1HNXE 2X7IA 3PYGA 1WUUA 1EA6A 4DR1E 2V2VA 4JI6E 4JI7E 1HR0I 4X66E 1Y4UA 4JYAE 4EMDA 1N33I 1Z0TA 3Q6NA 4X65I 3JAMC 5LMNI 4LF9E 3OTOE 2UXCI 4JI5I 2NPFA 2HFSA 3WU4A 4HACA 4LF8I 4LF5E 4DR7E 2O1WA 3PYFA 1ZXMA 4JI4E 4GKJI 3P06A 1N34I 4IZJB 1H7UA 4B3TE 1RR9A 3J7AM 4MYTA 3T1YI 3J7AG 1NHJA 4DV4I 1NHIA 2ZM6E 1DARA 1H74A 1ELOA 4AQYE 4HYMA 2UXBE 4JV5E 4FWHA 1Z5CA 1Y6ZA 4PRVA 4DV1E 1Z0BA 1FWLA 1Z0CA 2R3VA 4DV7I 1FWKA 2ZBKB 4JI2I 4FWGA 4WUBA 5IWAE 4B3MI 4OX9I 1IBME 1FJGE 1USVA 2CZ9A 1KKHA 1NHHA 2Z5CA 2DEJA 2UUAE 1N36I 1VISA 1ZM3A 4LF7I 2HHHI 4P52A 4YY3I 4X64I 4PU9A 2UU9E 3B8HA 1XMOE 5BR8E 1NZ0A 2O1TA 2XEXA 5FLXC 4DV0E 2AJ4A 4USKA 5A2QC 4LF6I 4DV6E 2V8PA 1ZM9A 4URLA 4MYUA 4IZKA 4NXMI 5GMDA 5LMUI 4GKKE 4B3TI 2R42A 3J81Q 1XMQE 2VQFE 1Z5AA 4AQYI 4DR2E 3K1JA 1B63A 4M1KA 2HKJA 2UUCI 3H4LA 4LFBE 1FJGI 2A2DA 3V2UC 2IOPA 2X36A 4X62E 1EI1A 2UUAI 4YHHE 4B3SI 1IBKI 1FI4A 4LFCE 2VQEE 1I94E 3JAMQ 4WUCA 3GONA 2V2ZA 1FNMA 4DV2E 2CGEA 2O1UA 1PIEA 3T1HI 4DUYI 1J5EE 2DEIA 4DR4E 4JI0E 4JI1E 3ZZUA 4DV0I 4K0KI 2GS8A 3F0NA 4DV5I 1PVGA 3WU5A 2UUBE 4DUZI 5LL6R 3ZM7A 4KHPE 1Y4SA 4DV6I 4LFAE 2F4VE 3V5RA 1ZXNA 4DR3E 1HNWI 4USMA 1D6TA 2EFGA 1HNZE 5IT9Q 5FWKA 4GKKI 1IBLI 4DR6I 1XMQI 4LF4E 4IZJD 2VF3A 1UEKA 2Z5EA 1HNXI 1XNQE 4HACB 4DR5E 3K85A 1HR0E 4DU7A 2Z5BA 1MG7A 2J7KA 4DR1I 2E5LE 1N33E 4X65E 4UTGA 4JI6I 4JI7I 4X66I 2HK2A 4B3RE 2WW4A 4Z7YA 2UXCE 4JYAI 4JI5E 1BKNA 2IOQA 1Z0VA 4LF8E 2O1VA 3K17A 4YHHI 3OTOI 4LF9I 1FKAE 1ZM2A 4GKJE 2VQEI 1I94I 1H72C 5A2QQ 4LF5I 4DR7I 4P7AA 3ZKDA 3J80Q 3T1YE 4JI4I 4DV2I 3ZZTA 1XHKA 4JI0I 4JI8E 3QT5A 2Z5CB 3QT7A 1Z5BA 4DU8A 2ZM6I 1S16A 1OJ4A 3D4JA 4DV7E 2UXBI 4JI2E 4JV5I 4OX9E 3B78A 4IZJA 1XNRE 3ZZ0A 4DV1I 1H73A 4DR3I 2E1RA 5IWAI 3Q1QA 1USUA 4DPXA 1N36E 1IBMI 2HFUA 1HNZI 2GQ0A 4LF7E 4JI3E 2HHHE 4YY3E 4X64E 1Z0GA 4R1FA 4LF4I 1PKPA 3HULA 1N32E 2UU9I 3PYDA 1XNQI 2UXDE 1XMOI 4DR5I 4IZKB 5BR8I 2BM1A 3PRYA 2E5LI 1MU5A 2HKEA 4B3RI 4KQVA 3CWVA 4LF6E 3ZKBA 2OI2A 4DV3E 3QT8A 4NXNE 1KTVA 4DPTA 1ZM4A 1RREA 1N0VC 4NXME 4Z7CA 5LMUE 3HJCA 1S4EA 1H7SA 1Z0EA 4DXLA 5GMEA 4JI8I 4ED4A 3PYEA 4HXZA 4FN5A 1HK7A 1A6FA 3WU6A 4XTJA 2VQFI 3LTOA 3LPSA 4DR2I 4JG4A 5IT9C 2UUCE 2Q2EB 4HY1A 2BM0A 1K47A 1N0UA 1XNRI 4DPYA 5LMNE 3WU3A 4LFBI 5FLXQ 4B3SE 1IBKE 1Z59A 2PNLA 4JI3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B62 A;  2LJP A;  5L3J A;  4X62 I;  4FWD A;  4ZVI A;  3B82 A;  4LFC I;  1KVK A;  1N34 E;  3T1H E;  4DUY E;  1N32 I;  4WUD A;  2UXD I;  4RPF A;  1MX0 A;  4K0K E;  2ZIT A;  3LNU A;  4DV5 E;  4I3H A;  2V34 A;  1J5E I;  4DR4 I;  4DV4 E;  2HK3 A;  4JI1 I;  3QT6 A;  2BV3 A;  4DUZ E;  4UT4 A;  2A2C A;  4DV3 I;  3J80 C;  4NXN I;  1HNW E;  3M6A A;  2UUB I;  4KHP I;  2V2Q A;  4DPU A;  4LFA I;  2F4V I;  4B3M E;  4FW9 A;  3J81 C;  1IBL E;  4DR6 E;  1Z0W A;  1QZR A;  4DPW A;  1KIJ A;  1U2R A;  4PRX A;  1HNX E;  2X7I A;  3PYG A;  1WUU A;  1EA6 A;  4DR1 E;  2V2V A;  4JI6 E;  4JI7 E;  1HR0 I;  4X66 E;  4JYA E;  4EMD A;  1N33 I;  1Z0T A;  4X65 I;  3JAM C;  5LMN I;  4LF9 E;  3OTO E;  2UXC I;  4JI5 I;  2NPF A;  2HFS A;  3WU4 A;  4HAC A;  4LF8 I;  4LF5 E;  4DR7 E;  3PYF A;  1ZXM A;  4JI4 E;  4GKJ I;  1N34 I;  1H7U A;  4B3T E;  1RR9 A;  3J7A M;  4MYT A;  3T1Y I;  3J7A G;  1NHJ A;  4DV4 I;  1NHI A;  2ZM6 E;  1DAR A;  1H74 A;  1ELO A;  4AQY E;  4HYM A;  2UXB E;  4JV5 E;  4FWH A;  1Z5C A;  4PRV A;  4DV1 E;  1Z0B A;  1FWL A;  1Z0C A;  2R3V A;  4DV7 I;  1FWK A;  2ZBK B;  4JI2 I;  4FWG A;  4WUB A;  5IWA E;  4B3M I;  4OX9 I;  1IBM E;  1FJG E;  2CZ9 A;  1KKH A;  1NHH A;  2UUA E;  2DEJ A;  1N36 I;  1VIS A;  1ZM3 A;  4LF7 I;  2HHH I;  4P52 A;  4YY3 I;  4X64 I;  4PU9 A;  2UU9 E;  3B8H A;  1XMO E;  5BR8 E;  1NZ0 A;  2XEX A;  5FLX C;  4DV0 E;  2AJ4 A;  4USK A;  5A2Q C;  4LF6 I;  4DV6 E;  2V8P A;  1ZM9 A;  4URL A;  4MYU A;  4NXM I;  5GMD A;  5LMU I;  4GKK E;  4B3T I;  2R42 A;  3J81 Q;  1XMQ E;  2VQF E;  1Z5A A;  4AQY I;  4DR2 E;  3K1J A;  1B63 A;  4M1K A;  2HKJ A;  2UUC I;  3H4L A;  4LFB E;  1FJG I;  2A2D A;  3V2U C;  2X36 A;  4X62 E;  2UUA I;  1EI1 A;  4YHH E;  4B3S I;  1IBK I;  1FI4 A;  4LFC E;  2VQE E;  1I94 E;  3JAM Q;  4WUC A;  3GON A;  2V2Z A;  1FNM A;  4DV2 E;  1PIE A;  3T1H I;  4DUY I;  1J5E E;  2DEI A;  4DR4 E;  4JI0 E;  4JI1 E;  3ZZU A;  4DV0 I;  4K0K I;  2GS8 A;  3F0N A;  4DV5 I;  1PVG A;  3WU5 A;  2UUB E;  4DUZ I;  5LL6 R;  3ZM7 A;  4KHP E;  4DV6 I;  4LFA E;  2F4V E;  3V5R A;  1ZXN A;  4DR3 E;  1HNW I;  4USM A;  1D6T A;  2EFG A;  1HNZ E;  5IT9 Q;  4GKK I;  1IBL I;  4DR6 I;  1XMQ I;  4LF4 E;  2VF3 A;  1UEK A;  1HNX I;  1XNQ E;  4HAC B;  4DR5 E;  1HR0 E;  4DU7 A;  1MG7 A;  2J7K A;  4DR1 I;  2E5L E;  1N33 E;  4X65 E;  4UTG A;  4JI6 I;  4JI7 I;  4X66 I;  2HK2 A;  4B3R E;  2WW4 A;  4Z7Y A;  2UXC E;  4JYA I;  4JI5 E;  1BKN A;  1Z0V A;  4LF8 E;  3K17 A;  4YHH I;  4LF9 I;  3OTO I;  1FKA E;  1ZM2 A;  4GKJ E;  2VQE I;  1I94 I;  1H72 C;  5A2Q Q;  4LF5 I;  4DR7 I;  4P7A A;  3ZKD A;  3J80 Q;  3T1Y E;  4JI4 I;  4DV2 I;  3ZZT A;  1XHK A;  4JI0 I;  4JI8 E;  3QT5 A;  3QT7 A;  1Z5B A;  4DU8 A;  2ZM6 I;  1S16 A;  1OJ4 A;  3D4J A;  4DV7 E;  2UXB I;  4JI2 E;  4JV5 I;  4OX9 E;  3B78 A;  1XNR E;  3ZZ0 A;  4DV1 I;  1H73 A;  4DR3 I;  2E1R A;  5IWA I;  3Q1Q A;  4DPX A;  1N36 E;  1IBM I;  2HFU A;  1HNZ I;  4LF7 E;  4JI3 E;  2HHH E;  4YY3 E;  4X64 E;  1Z0G A;  4R1F A;  4LF4 I;  1PKP A;  3HUL A;  1N32 E;  2UU9 I;  3PYD A;  1XNQ I;  2UXD E;  1XMO I;  4DR5 I;  5BR8 I;  2BM1 A;  2E5L I;  1MU5 A;  2HKE A;  4B3R I;  4KQV A;  3CWV A;  4LF6 E;  3ZKB A;  2OI2 A;  4DV3 E;  3QT8 A;  4NXN E;  1KTV A;  4DPT A;  1ZM4 A;  1RRE A;  1N0V C;  4NXM E;  4Z7C A;  5LMU E;  1S4E A;  1H7S A;  1Z0E A;  4DXL A;  5GME A;  4JI8 I;  4ED4 A;  3PYE A;  4HXZ A;  4FN5 A;  1A6F A;  3WU6 A;  4XTJ A;  2VQF I;  3LTO A;  3LPS A;  4DR2 I;  4JG4 A;  5IT9 C;  2UUC E;  2Q2E B;  4HY1 A;  2BM0 A;  1K47 A;  1N0U A;  1XNR I;  4DPY A;  5LMN E;  3WU3 A;  4LFB I;  5FLX Q;  4B3S E;  1IBK E;  1Z59 A;  4JI3 I; 
#chains in the Genus database with same CATH topology
 5EL9 A;  1B62 A;  3M85 D;  2AE8 A;  2LJP A;  5L3J A;  4X62 I;  4FWD A;  4ZVI A;  3P3G A;  2JEB A;  3B82 A;  4LFC I;  5C0X C;  1KVK A;  5K36 E;  1N34 E;  1R6L A;  3T1H E;  4DUY E;  1N32 I;  4U3D A;  4WUD A;  2UXD I;  4RPF A;  1MX0 A;  4K0K E;  2F1D A;  2ZIT A;  3LNU A;  2WNR A;  4DV5 E;  4I3H A;  2JE6 A;  5K36 B;  2V34 A;  1J5E I;  4DR4 I;  3L7Z A;  4DV4 E;  2HK3 A;  4JI1 I;  3QT6 A;  2BV3 A;  2VES A;  2JT2 A;  4DUZ E;  3Q6M A;  4UT4 A;  2A2C A;  4LCG A;  4DV3 I;  3J80 C;  4NXN I;  2C37 B;  1HNW E;  2CG9 A;  3M6A A;  2UUB I;  4KHP I;  2V2Q A;  4DPU A;  4BA2 B;  4LFA I;  2F4V I;  4B3M E;  4N3O A;  4FW9 A;  2Z5B B;  3J81 C;  4LCH A;  3B4T A;  2PNZ A;  1IBL E;  4DR6 E;  2C39 A;  1Z0W A;  1QZR A;  4DPW A;  1KIJ A;  2PNM A;  2NN6 A;  3NZK A;  1U2R A;  4PRX A;  3P3E A;  5ELW A;  4IFD F;  2O3Z A;  1HNX E;  4J3D A;  2X7I A;  3PYG A;  1WUU A;  1UDS A;  1OYR A;  1EA6 A;  2BA1 D;  2PO1 A;  4DR1 E;  2V2V A;  2C38 B;  2J65 A;  4JI6 E;  4JI7 E;  1HR0 I;  4X66 E;  1VI7 A;  1Y4U A;  4JYA E;  4EMD A;  1N33 I;  1Z0T A;  3Q6N A;  4X65 I;  3JAM C;  5LMN I;  4LF9 E;  3OTO E;  5C0X F;  2UXC I;  4JI5 I;  3PS3 A;  1E3P A;  2BA0 G;  2NPF A;  2HFS A;  3WU4 A;  4OZE A;  4HAC A;  4LF8 I;  4LF5 E;  4DR7 E;  2O1W A;  3PYF A;  1ZXM A;  4JI4 E;  4GKJ I;  1YH8 A;  3P06 A;  1N34 I;  4IZJ B;  1H7U A;  4B3T E;  1RR9 A;  3J7A M;  4MYT A;  3T1Y I;  3J7A G;  5K36 F;  5DNX A;  1NHJ A;  4DV4 I;  1NHI A;  2ZM6 E;  1DAR A;  1H74 A;  1ELO A;  4AQY E;  1UDO A;  2JEA A;  4HYM A;  2UXB E;  4JV5 E;  4FWH A;  1Z5C A;  1Y6Z A;  1R6M A;  4PRV A;  5JEA E;  5DRP A;  4DV1 E;  1Z0B A;  4IFD C;  1FWL A;  1Z0C A;  2R3V A;  4DV7 I;  1FWK A;  2ZBK B;  4JI2 I;  4FW4 A;  4FWG A;  4WUB A;  5IWA E;  4B3M I;  4OX9 I;  1IBM E;  1OYP A;  5JEA B;  1FJG E;  1USV A;  4FW7 A;  2BR2 B;  2CZ9 A;  1KKH A;  1NHH A;  2Z5C A;  2DEJ A;  2UUA E;  5JEA C;  1N36 I;  1VIS A;  1ZM3 A;  4ISA A;  4LF7 I;  2HHH I;  4P52 A;  4YY3 I;  3H1C A;  4X64 I;  4PU9 A;  2UU9 E;  3B8H A;  1XMO E;  5BR8 E;  1NZ0 A;  2O1T A;  2XEX A;  5FLX C;  1Y60 A;  4IFD D;  4DV0 E;  3M7N G;  2PO0 A;  2AJ4 A;  4USK A;  4FW6 A;  2PO2 A;  5A2Q C;  5K36 C;  4LF6 I;  4DV6 E;  2V8P A;  1ZM9 A;  2GO4 A;  4URL A;  4MYU A;  2C38 A;  3GME A;  4OKG A;  4IZK A;  4MU3 A;  4NBQ A;  4NXM I;  4OO1 E;  4AIM A;  5C0X D;  5GMD A;  5LMU I;  4GKK E;  4B3T I;  2R42 A;  1UDN A;  3J81 Q;  4GQU A;  1XMQ E;  4OO1 B;  2VQF E;  4QNJ A;  1Z5A A;  4AQY I;  4DR2 E;  1RHY A;  3K1J A;  4OO1 C;  1B63 A;  5K36 D;  4M1K A;  2HKJ A;  2UUC I;  3HKM A;  3H4L A;  5JEA F;  4MU4 A;  4LFB E;  4BA1 A;  2JE6 B;  4FW3 A;  1FJG I;  2A2D A;  3L7Z B;  3V2U C;  2IOP A;  4IFD A;  2X36 A;  4X62 E;  1EI1 A;  2UUA I;  4YHH E;  5DNL A;  4B3S I;  1IBK I;  1FI4 A;  4LFC E;  2VQE E;  1I94 E;  3JAM Q;  4WUC A;  3GON A;  2WP8 A;  3GLL A;  2V2Z A;  1FNM A;  4DV2 E;  2CGE A;  2NN6 E;  2O1U A;  1PIE A;  3T1H I;  4DUY I;  1J5E E;  2DEI A;  4DR4 E;  4MU0 A;  2PNZ B;  4JI0 E;  3UHM A;  2C39 B;  4LPF A;  4JI1 E;  3ZZU A;  4DV0 I;  4K0K I;  3DD6 A;  2GS8 A;  3F0N A;  4DV5 I;  1PVG A;  2NN6 B;  5C0X A;  5DRR A;  3CDJ A;  2BA0 D;  3U1K A;  3WU5 A;  2UUB E;  4DUZ I;  5LL6 R;  1P42 A;  1XXE A;  3ZM7 A;  3KRN A;  1Y4S A;  4KHP E;  4DV6 I;  4LFA E;  2F4V E;  3V5R A;  3GCM A;  1ZXN A;  4DR3 E;  1HNW I;  4USM A;  1D6T A;  2EFG A;  1HNZ E;  5IT9 Q;  5K36 A;  5FWK A;  4GKK I;  3PS1 A;  1IBL I;  4DR6 I;  1Y5Y A;  4OO1 F;  1XMQ I;  4LF4 E;  4IZJ D;  2VF3 A;  1UEK A;  3M85 G;  2C37 A;  2Z5E A;  1HNX I;  2IER A;  1XNQ E;  4HAC B;  4DR5 E;  3K85 A;  4MU1 A;  4BA2 A;  1HR0 E;  4DU7 A;  2Z5B A;  1MG7 A;  2J7K A;  4DR1 I;  2E5L E;  1N33 E;  4X65 E;  4UTG A;  4JI6 I;  4JI7 I;  4X66 I;  2HK2 A;  4B3R E;  2WW4 A;  4Z7Y A;  2UXC E;  4JYA I;  4JI5 E;  1BKN A;  2IOQ A;  4IS9 A;  1Z0V A;  2JEA B;  4MQY A;  2O1V A;  3K17 A;  4YHH I;  5JEA D;  3OTO I;  4LF9 I;  1FKA E;  4LF8 E;  1ZM2 A;  4GKJ E;  2VQE I;  1I94 I;  1H72 C;  5A2Q Q;  4LF5 I;  4DR7 I;  4P7A A;  3ZKD A;  3J80 Q;  3T1Y E;  4JI4 I;  4DV2 I;  3U1Y A;  3M7N D;  2GO3 A;  3ZZT A;  1XHK A;  1YHC A;  4JI0 I;  4JI8 E;  3QT5 A;  2Z5C B;  3QT7 A;  2NN6 F;  1Z5B A;  5EKW A;  4DU8 A;  3CDI A;  2ZM6 I;  1S16 A;  1OJ4 A;  3D4J A;  4DV7 E;  2UXB I;  4JI2 E;  4JV5 I;  1E3H A;  4AM3 A;  2BA1 G;  2JEB B;  4OX9 E;  3B78 A;  4IZJ A;  3P3C A;  1XNR E;  3ZZ0 A;  4DV1 I;  1H73 A;  4DR3 I;  2E1R A;  3P76 A;  5IWA I;  3Q1Q A;  1USU A;  4DPX A;  1N36 E;  1IBM I;  2HFU A;  1HNZ I;  2WNR B;  1OYS A;  2PO0 B;  2GQ0 A;  4LF7 E;  4JI3 E;  2HHH E;  4YY3 E;  4X64 E;  4AID A;  2PO2 B;  1Z0G A;  4R1F A;  1UDQ A;  4LF4 I;  1PKP A;  3HUL A;  4U3B A;  1N32 E;  2UU9 I;  3PS2 A;  3PYD A;  2IES A;  1XNQ I;  2UXD E;  1XMO I;  4DR5 I;  4IZK B;  5BR8 I;  4OO1 D;  5JEA A;  2BM1 A;  3PRY A;  2E5L I;  4QNK A;  2BR2 A;  1MU5 A;  2HKE A;  4B3R I;  2CVE A;  4KQV A;  3CWV A;  5DRQ A;  4LF6 E;  3ZKB A;  2OI2 A;  4DV3 E;  3QT8 A;  4NXN E;  4MDT A;  1KTV A;  4DPT A;  1ZM4 A;  2NN6 C;  1RRE A;  1N0V C;  4NXM E;  4Z7C A;  2PO1 B;  5LMU E;  3HJC A;  4IFD E;  1S4E A;  4BA1 B;  1H7S A;  1Z0E A;  4DXL A;  5GME A;  4JI8 I;  4ED4 A;  3PYE A;  4HXZ A;  4IFD B;  4FN5 A;  1HK7 A;  1A6F A;  3WU6 A;  4XTJ A;  2VQF I;  3LTO A;  3LPS A;  2WP8 B;  4JG4 A;  4LCF A;  4DR2 I;  2Q2E B;  5IT9 C;  2UUC E;  4FW5 A;  4HY1 A;  2BM0 A;  5DRO A;  1K47 A;  1N0U A;  2NN6 D;  1XNR I;  4DPY A;  5C0X E;  5LMN E;  4LOM A;  3WU3 A;  4LFB I;  5FLX Q;  4B3S E;  4OO1 A;  1IBK E;  1Z59 A;  2PNL A;  4JI3 I;  5C0X B; 
#chains in the Genus database with same CATH homology
 1B62 A;  2LJP A;  5L3J A;  4X62 I;  4FWD A;  4ZVI A;  3B82 A;  4LFC I;  1KVK A;  1N34 E;  3T1H E;  4DUY E;  1N32 I;  4WUD A;  2UXD I;  4RPF A;  1MX0 A;  4K0K E;  2ZIT A;  3LNU A;  4DV5 E;  4I3H A;  2V34 A;  1J5E I;  4DR4 I;  4DV4 E;  2HK3 A;  4JI1 I;  3QT6 A;  2BV3 A;  4DUZ E;  3Q6M A;  4UT4 A;  2A2C A;  4DV3 I;  3J80 C;  4NXN I;  1HNW E;  2CG9 A;  3M6A A;  2UUB I;  4KHP I;  2V2Q A;  4DPU A;  4LFA I;  2F4V I;  4B3M E;  4N3O A;  4FW9 A;  2Z5B B;  3J81 C;  1IBL E;  4DR6 E;  1Z0W A;  1QZR A;  4DPW A;  1KIJ A;  2PNM A;  1U2R A;  4PRX A;  1HNX E;  2X7I A;  3PYG A;  1WUU A;  1EA6 A;  4DR1 E;  2V2V A;  4JI6 E;  4JI7 E;  1HR0 I;  4X66 E;  1Y4U A;  4JYA E;  4EMD A;  1N33 I;  1Z0T A;  3Q6N A;  4X65 I;  3JAM C;  5LMN I;  4LF9 E;  3OTO E;  2UXC I;  4JI5 I;  2NPF A;  2HFS A;  3WU4 A;  4HAC A;  4LF8 I;  4LF5 E;  4DR7 E;  2O1W A;  3PYF A;  1ZXM A;  4JI4 E;  4GKJ I;  3P06 A;  1N34 I;  4IZJ B;  1H7U A;  4B3T E;  1RR9 A;  3J7A M;  4MYT A;  3T1Y I;  3J7A G;  1NHJ A;  4DV4 I;  1NHI A;  2ZM6 E;  1DAR A;  1H74 A;  1ELO A;  4AQY E;  4HYM A;  2UXB E;  4JV5 E;  4FWH A;  1Z5C A;  1Y6Z A;  4PRV A;  4DV1 E;  1Z0B A;  1FWL A;  1Z0C A;  2R3V A;  4DV7 I;  1FWK A;  2ZBK B;  4JI2 I;  4FWG A;  4WUB A;  5IWA E;  4B3M I;  4OX9 I;  1IBM E;  1FJG E;  1USV A;  2CZ9 A;  1KKH A;  1NHH A;  2Z5C A;  2DEJ A;  2UUA E;  1N36 I;  1VIS A;  1ZM3 A;  4LF7 I;  2HHH I;  4P52 A;  4YY3 I;  4X64 I;  4PU9 A;  2UU9 E;  3B8H A;  1XMO E;  5BR8 E;  1NZ0 A;  2O1T A;  2XEX A;  5FLX C;  4DV0 E;  2AJ4 A;  4USK A;  5A2Q C;  4LF6 I;  4DV6 E;  2V8P A;  1ZM9 A;  4URL A;  4MYU A;  4IZK A;  4NXM I;  5GMD A;  5LMU I;  4GKK E;  4B3T I;  2R42 A;  3J81 Q;  1XMQ E;  2VQF E;  1Z5A A;  4AQY I;  4DR2 E;  3K1J A;  1B63 A;  4M1K A;  2HKJ A;  2UUC I;  3H4L A;  4LFB E;  1FJG I;  2A2D A;  3V2U C;  2IOP A;  2X36 A;  4X62 E;  1EI1 A;  2UUA I;  4YHH E;  4B3S I;  1IBK I;  1FI4 A;  4LFC E;  2VQE E;  1I94 E;  3JAM Q;  4WUC A;  3GON A;  2V2Z A;  1FNM A;  4DV2 E;  2CGE A;  2O1U A;  1PIE A;  3T1H I;  4DUY I;  1J5E E;  2DEI A;  4DR4 E;  4JI0 E;  4JI1 E;  3ZZU A;  4DV0 I;  4K0K I;  2GS8 A;  3F0N A;  4DV5 I;  1PVG A;  3WU5 A;  2UUB E;  4DUZ I;  5LL6 R;  3ZM7 A;  4KHP E;  1Y4S A;  4DV6 I;  4LFA E;  2F4V E;  3V5R A;  1ZXN A;  4DR3 E;  1HNW I;  4USM A;  1D6T A;  2EFG A;  1HNZ E;  5IT9 Q;  5FWK A;  4GKK I;  1IBL I;  4DR6 I;  1XMQ I;  4LF4 E;  4IZJ D;  2VF3 A;  1UEK A;  2Z5E A;  1HNX I;  1XNQ E;  4HAC B;  4DR5 E;  3K85 A;  1HR0 E;  4DU7 A;  2Z5B A;  1MG7 A;  2J7K A;  4DR1 I;  2E5L E;  1N33 E;  4X65 E;  4UTG A;  4JI6 I;  4JI7 I;  4X66 I;  2HK2 A;  4B3R E;  2WW4 A;  4Z7Y A;  2UXC E;  4JYA I;  4JI5 E;  1BKN A;  2IOQ A;  1Z0V A;  4LF8 E;  2O1V A;  3K17 A;  4YHH I;  3OTO I;  4LF9 I;  1FKA E;  1ZM2 A;  4GKJ E;  2VQE I;  1I94 I;  1H72 C;  5A2Q Q;  4LF5 I;  4DR7 I;  4P7A A;  3ZKD A;  3J80 Q;  3T1Y E;  4JI4 I;  4DV2 I;  3ZZT A;  1XHK A;  4JI0 I;  4JI8 E;  3QT5 A;  2Z5C B;  3QT7 A;  1Z5B A;  4DU8 A;  2ZM6 I;  1S16 A;  1OJ4 A;  3D4J A;  4DV7 E;  2UXB I;  4JI2 E;  4JV5 I;  4OX9 E;  3B78 A;  4IZJ A;  1XNR E;  3ZZ0 A;  4DV1 I;  1H73 A;  4DR3 I;  2E1R A;  5IWA I;  3Q1Q A;  1USU A;  4DPX A;  1N36 E;  1IBM I;  2HFU A;  1HNZ I;  2GQ0 A;  4LF7 E;  4JI3 E;  2HHH E;  4YY3 E;  4X64 E;  1Z0G A;  4R1F A;  4LF4 I;  1PKP A;  3HUL A;  1N32 E;  2UU9 I;  3PYD A;  1XNQ I;  2UXD E;  1XMO I;  4DR5 I;  4IZK B;  5BR8 I;  2BM1 A;  3PRY A;  2E5L I;  1MU5 A;  2HKE A;  4B3R I;  4KQV A;  3CWV A;  4LF6 E;  3ZKB A;  2OI2 A;  4DV3 E;  3QT8 A;  4NXN E;  1KTV A;  4DPT A;  1ZM4 A;  1RRE A;  1N0V C;  4NXM E;  4Z7C A;  5LMU E;  3HJC A;  1S4E A;  1H7S A;  1Z0E A;  4DXL A;  5GME A;  4JI8 I;  4ED4 A;  3PYE A;  4HXZ A;  4FN5 A;  1HK7 A;  1A6F A;  3WU6 A;  4XTJ A;  2VQF I;  3LTO A;  3LPS A;  4DR2 I;  4JG4 A;  5IT9 C;  2UUC E;  2Q2E B;  4HY1 A;  2BM0 A;  1K47 A;  1N0U A;  1XNR I;  4DPY A;  5LMN E;  3WU3 A;  4LFB I;  5FLX Q;  4B3S E;  1IBK E;  1Z59 A;  2PNL A;  4JI3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...