4NXNI

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxnI00
3QT7A 1H7UA 4JV5E 1XMOI 4JI5E 4LF4I 4FWDA 5GMEA 1PVGA 4JG4A 1HR0E 2E5LE 1MX0A 1H73A 1UEKA 1Z0WA 4B3SE 4R1FA 1N0VC 4LFBE 4XTJA 1A6FA 4LF7E 3LPSA 3PYDA 5BR8E 1Z0EA 4MYTA 3QT5A 4YHHI 2ZBKB 1XMOE 4LFCE 1OJ4A 2V2ZA 2UU9E 3PYFA 4FW9A 4KHPI 2CZ9A 1NHIA 1XHKA 1IBKE 4JI6I 1NZ0A 2V2QA 4DR2I 2UXDI 4LF8E 2HFSA 3LNUA 1PKPA 1IBLE 4B3MI 2F4VI 2UUAE 4GKJI 1N36I 1PIEA 4DR4I 1ZM9A 4DUYI 4OX9I 4X65I 1DARA 3T1HE 4JI7I 1Z5AA 1ZM4A 1FWKA 4DR3I 4JI3I 2XEXA 2HFUA 3B82A 4DV1I 2V34A 4JI6E 1N32I 2UXDE 2E5LI 3ZKBA 4DR4E 1WUUA 4B3SI 4YY3E 2J7KA 4KQVA 3ZKDA 4JI2E 1I94E 4X65E 4JI7E 2UUCE 4DUZI 4DU7A 3J7AG 4LF5E 2HK3A 4Z7YA 4JI3E 4DV3E 1XNQI 4LFCI 4DV1E 2BV3A 2UU9I 1IBME 4DPXA 3J80C 4USMA 2DEIA 4AQYI 1FJGE 2ZITA 3CWVA 4DPTA 1IBKI 4M1KA 2UUBE 4DU8A 1ZM2A 1N32E 1ZXMA 5IT9C 1FKAE 3J80Q 4JI1E 1EI1A 2ZM6E 4LF8I 2X7IA 1NHJA 4P7AA 1IBLI 1Z0TA 1S4EA 4NXNE 2UUAI 2UXCI 3H4LA 5IWAI 4DR6E 1KVKA 5IT9Q 4DV7I 2Q2EB 4JI0E 1H74A 3F0NA 4DUZE 5LMUE 3T1HI 1XNQE 4DV5E 3WU6A 4HY1A 4FWGA 4AQYE 3ZZUA 3LTOA 4B3RE 2V8PA 1B63A 4DV2I 2HHHE 2BM0A 1N0UA 3PYGA 1KIJA 4X64E 2UXCE 1Z0CA 5LMNI 5IWAE 4B3TE 4YY3I 4JI4I 4DV7E 1ZM3A 4JYAE 4HACB 4JI2I 4NXMI 1I94I 4PRVA 2UUCI 2X36A 4LF6E 4LF5I 4DV3I 3V2UC 2A2CA 5GMDA 4ZVIA 2DEJA 1IBMI 3QT8A 3J81Q 4DV6I 1XMQE 4DV2E 1FJGI 3K1JA 2VQFI 3T1YI 4LF9E 2UUBI 1N33I 1ZXNA 5FLXC 1U2RA 2VF3A 4LFAI 1FI4A 1B62A 4JI1I 4DR7E 2ZM6I 1BKNA 1KTVA 5LMNE 4NXNI 4JI4E 1H72C 3QT6A 5FLXQ 4DR6I 3WU4A 4NXME 4JI0I 2UXBE 1HNXI 5LL6R 5LMUI 1RR9A 4DV5I 1K47A 4DPUA 3PYEA 1KKHA 3D4JA 4DV6E 4HYMA 4DV0E 1J5EI 3HULA 2OI2A 3T1YE 2VQFE 4B3RI 4FWHA 1QZRA 1N33E 1S16A 4HXZA 1Z0GA 4P52A 2HHHI 2HK2A 3ZZTA 3Q1QA 4LFAE 4X64I 1EA6A 3WU3A 2LJPA 1XNRI 3GONA 1MU5A 4B3TI 4DV4I 2AJ4A 1N34E 4JYAI 1HNXE 4UTGA 4DR1I 3OTOE 4LF6I 4DPWA 4PRXA 1Z0BA 1Z5CA 4USKA 4EMDA 1J5EE 2A2DA 4DR5E 1XMQI 1HNWI 4LF9I 5L3JA 2V2VA 1FWLA 1HNZI 4DR7I 2E1RA 4URLA 2VQEI 1D6TA 1XNRE 4WUCA 4DV4E 4K0KI 4LF4E 4WUDA 2NPFA 4JI8I 4X62I 4DR1E 4MYUA 2UXBI 4WUBA 3J81C 4X66I 5A2QC 3B78A 3JAMC 2R42A 4I3HA 4UT4A 3B8HA 1NHHA 4GKKI 3V5RA 4DV0I 5A2QQ 3JAMQ 3ZZ0A 2R3VA 1Z0VA 1HNWE 4FN5A 1Z59A 3ZM7A 1HNZE 4YHHE 3K17A 2WW4A 2VQEE 4KHPE 1H7SA 4JV5I 3J7AM 1VISA 4K0KE 4Z7CA 2HKJA 3M6AA 2BM1A 1FNMA 4JI5I 4DXLA 4JI8E 4X62E 2HKEA 1N34I 4DR2E 4X66E 3OTOI 4B3ME 1HR0I 2F4VE 4GKKE 4GKJE 1N36E 3WU5A 4HACA 1RREA 4RPFA 4DR5I 4DPYA 4LFBI 4DUYE 1ELOA 4OX9E 1MG7A 2GS8A 4PU9A 4LF7I 1Z5BA 4ED4A 2EFGA 4DR3E 5BR8I
chains in the Genus database with same CATH superfamily
3QT7A 1H7UA 4LCFA 4U3DA 4JV5E 1XMOI 2C38B 2GO4A 4IZJD 2C39B 4JI5E 4LF4I 4FWDA 5GMEA 2GO3A 3P76A 4BA1B 1PVGA 3UHMA 1E3PA 4JG4A 1HR0E 2E5LE 1MX0A 2PNMA 1H73A 1UEKA 2NN6C 1Z0WA 4B3SE 4R1FA 3K85A 3Q6MA 1N0VC 3PS2A 1RHYA 4LFBE 4XTJA 4FW3A 1A6FA 3M85G 4LF7E 4IFDE 3LPSA 3PYDA 5BR8E 2JE6A 1Z0EA 4MYTA 2J65A 4N3OA 3QT5A 3U1KA 2ZBKB 4YHHI 1XMOE 4LFCE 1OJ4A 2V2ZA 2UU9E 3PYFA 5C0XC 4FW9A 4KHPI 2CZ9A 1NHIA 1XHKA 1IBKE 2NN6B 4JI6I 3DD6A 1NZ0A 2V2QA 4IFDF 4DR2I 4BA2B 2UXDI 4FW6A 4LF8E 2HFSA 3HJCA 3LNUA 1PKPA 1IBLE 4B3MI 2F4VI 2UUAE 4GKJI 1N36I 1PIEA 4DR4I 1ZM9A 4OO1D 5C0XB 4DUYI 4OX9I 1P42A 4X65I 1DARA 3PRYA 3T1HE 4JI7I 1Z5AA 2Z5CA 1ZM4A 1FWKA 5JEAC 2PNZA 4DR3I 4JI3I 2JEAB 2XEXA 2WNRB 2HFUA 3B82A 4DV1I 2V34A 2O1UA 2PO2A 4JI6E 3KRNA 1N32I 4IFDA 2UXDE 4IZKA 2E5LI 2BA1G 3ZKBA 4DR4E 1WUUA 2IOQA 4B3SI 4YY3E 4MU4A 5JEAB 4OZEA 1UDQA 2J7KA 4KQVA 5DRQA 3ZKDA 4JI2E 1I94E 4X65E 4JI7E 3P06A 2UUCE 4DUZI 3GMEA 4DU7A 3J7AG 5K36A 4LF5E 2HK3A 4Z7YA 4IZJA 4JI3E 5DRPA 4DV3E 1XNQI 4OO1E 2O1VA 4LFCI 2BA1D 5K36D 2IERA 4DV1E 2BV3A 1IBME 2UU9I 4DPXA 3J80C 4USMA 2DEIA 4AQYI 1FJGE 2ZITA 3CWVA 4DPTA 1IBKI 4M1KA 2UUBE 4DU8A 1ZM2A 2O1TA 1N32E 1ZXMA 4ISAA 5IT9C 1FKAE 3J80Q 4JI1E 1EI1A 5EL9A 2ZM6E 4LF8I 2X7IA 4OO1F 1NHJA 2C37A 4P7AA 1IBLI 1Z0TA 1S4EA 4NXNE 2UUAI 2UXCI 3PS3A 3H4LA 3HKMA 5IWAI 4DR6E 1KVKA 5IT9Q 2AE8A 4DV7I 2Q2EB 4JI0E 1H74A 3F0NA 4DUZE 5LMUE 3T1HI 4IFDC 1YH8A 1XNQE 4DV5E 3WU6A 4IS9A 5EKWA 4HY1A 2PO1A 2PNZB 4FWGA 4AQYE 2JEBA 3ZZUA 3LTOA 4B3RE 2V8PA 2WP8A 1B63A 2BR2A 4DV2I 5DNXA 2HHHE 1XXEA 2BM0A 2CGEA 1N0UA 1USUA 2PO0A 5K36E 4GQUA 3PYGA 1KIJA 2O1WA 4X64E 2C39A 4OO1A 3NZKA 2UXCE 1Z0CA 4IFDB 5LMNI 5IWAE 4B3TE 4IZKB 4YY3I 4JI4I 4DV7E 1ZM3A 4JYAE 4HACB 4JI2I 4NXMI 1I94I 3CDIA 4PRVA 5K36F 1OYPA 2UUCI 2X36A 4LF6E 2Z5EA 4LF5I 1USVA 4DV3I 3V2UC 2A2CA 2F1DA 5GMDA 4ZVIA 2IESA 4IZJB 4MU3A 2DEJA 1UDNA 1IBMI 2VESA 3QT8A 3J81Q 3L7ZA 4DV6I 1XMQE 4DV2E 1FJGI 3K1JA 2VQFI 3T1YI 4LF9E 1VI7A 4J3DA 2UUBI 1N33I 1ZXNA 2Z5BA 1U2RA 5FLXC 2VF3A 4LPFA 1FI4A 4LFAI 1B62A 4U3BA 4JI1I 1HK7A 4DR7E 2ZM6I 1BKNA 2NN6A 1KTVA 5LMNE 4NXNI 1R6LA 4JI4E 1H72C 3QT6A 5FLXQ 2C37B 4AIDA 4DR6I 4BA2A 2NN6D 3WU4A 4NXME 3P3EA 4JI0I 2UXBE 1HNXI 5LL6R 5LMUI 1UDSA 3P3GA 1RR9A 4DV5I 1K47A 4DPUA 3PYEA 4OO1C 5ELWA 1KKHA 3D4JA 1Y5YA 2JE6B 4DV6E 4HYMA 2GQ0A 4DV0E 1J5EI 3HULA 2CG9A 2OI2A 3T1YE 2VQFE 2PNLA 4B3RI 4FWHA 5C0XD 1QZRA 1N33E 1S16A 4HXZA 5DRRA 1Z0GA 4P52A 2HHHI 2PO1B 2HK2A 3ZZTA 2JEBB 3Q1QA 4AIMA 2WP8B 4LFAE 2BR2B 1Y4UA 4FW4A 5FWKA 4X64I 4MQYA 2PO0B 1EA6A 3WU3A 2LJPA 1OYSA 1XNRI 1UDOA 1MU5A 3GONA 5DNLA 4B3TI 4DV4I 4OO1B 2AJ4A 1N34E 4JYAI 1HNXE 4UTGA 4DR1I 3OTOE 4MDTA 3H1CA 2BA0G 4DPWA 4LF6I 4PRXA 1Z0BA 5JEAA 1Z5CA 4MU0A 2NN6E 4USKA 2O3ZA 2Z5CB 2JT2A 4NBQA 4EMDA 1J5EE 2A2DA 5JEAD 4DR5E 3M7NG 1XMQI 3Q6NA 1YHCA 1HNWI 4LF9I 5L3JA 1Y4SA 2V2VA 3L7ZB 3U1YA 1FWLA 5K36C 4OKGA 2C38A 2PO2B 2BA0D 1HNZI 4DR7I 2NN6F 2E1RA 5C0XE 3GLLA 4URLA 2VQEI 4AM3A 2Z5BB 1D6TA 1XNRE 3P3CA 4WUCA 4LOMA 4BA1A 4DV4E 4K0KI 4LF4E 4WUDA 3M7ND 1Y6ZA 2NPFA 2CVEA 3M85D 4JI8I 4X62I 4DR1E 4MYUA 4MU1A 2UXBI 1Y60A 4WUBA 3J81C 4X66I 5A2QC 3B78A 3JAMC 2R42A 4I3HA 4UT4A 3B8HA 1NHHA 3GCMA 5C0XF 4GKKI 5K36B 3V5RA 4DV0I 3PS1A 5A2QQ 3JAMQ 3ZZ0A 2R3VA 1Z0VA 1HNWE 4FN5A 1Z59A 3ZM7A 4LCHA 5DROA 5JEAE 1HNZE 4YHHE 3K17A 2WW4A 2VQEE 2IOPA 4KHPE 1H7SA 4JV5I 3J7AM 1E3HA 1VISA 4K0KE 4Z7CA 2HKJA 4QNJA 3M6AA 2BM1A 1FNMA 4JI5I 4DXLA 4JI8E 4X62E 4FW5A 2HKEA 1N34I 4DR2E 4X66E 3OTOI 3B4TA 5JEAF 4B3ME 1HR0I 2F4VE 4GKKE 4GKJE 1N36E 5C0XA 4IFDD 3WU5A 4HACA 1RREA 4RPFA 4DR5I 4DPYA 4FW7A 4DUYE 4LFBI 1ELOA 1R6MA 4OX9E 2JEAA 1MG7A 1OYRA 2GS8A 4PU9A 3CDJA 1Z5BA 2WNRA 4LF7I 4QNKA 4ED4A 4LCGA 2EFGA 4DR3E 5BR8I
chains in the Genus database with same CATH topology
3QT7A 1H7UA 4JV5E 1XMOI 4IZJD 4JI5E 4LF4I 4FWDA 5GMEA 1PVGA 4JG4A 1HR0E 2E5LE 1MX0A 2PNMA 1H73A 1UEKA 1Z0WA 4B3SE 4R1FA 3K85A 3Q6MA 1N0VC 4LFBE 4XTJA 1A6FA 4LF7E 3LPSA 3PYDA 5BR8E 1Z0EA 4MYTA 4N3OA 3QT5A 4YHHI 2ZBKB 1XMOE 4LFCE 1OJ4A 2V2ZA 2UU9E 3PYFA 4FW9A 4KHPI 2CZ9A 1NHIA 1XHKA 1IBKE 4JI6I 1NZ0A 2V2QA 4DR2I 2UXDI 4LF8E 2HFSA 3HJCA 3LNUA 1PKPA 1IBLE 4B3MI 2F4VI 2UUAE 4GKJI 1N36I 1PIEA 4DR4I 1ZM9A 4DUYI 4OX9I 4X65I 1DARA 3PRYA 3T1HE 4JI7I 1Z5AA 2Z5CA 1ZM4A 1FWKA 4DR3I 4JI3I 2XEXA 2HFUA 3B82A 4DV1I 2V34A 2O1UA 4JI6E 1N32I 2UXDE 4IZKA 2E5LI 3ZKBA 4DR4E 1WUUA 2IOQA 4B3SI 4YY3E 2J7KA 4KQVA 3ZKDA 4JI2E 1I94E 4X65E 4JI7E 3P06A 2UUCE 4DUZI 4DU7A 3J7AG 4LF5E 2HK3A 4Z7YA 4IZJA 4JI3E 4DV3E 1XNQI 2O1VA 4LFCI 4DV1E 2BV3A 1IBME 2UU9I 4DPXA 3J80C 4USMA 2DEIA 4AQYI 1FJGE 2ZITA 3CWVA 4DPTA 1IBKI 4M1KA 2UUBE 4DU8A 1ZM2A 2O1TA 1N32E 1ZXMA 5IT9C 1FKAE 3J80Q 4JI1E 1EI1A 2ZM6E 4LF8I 2X7IA 1NHJA 4P7AA 1IBLI 1Z0TA 1S4EA 4NXNE 2UUAI 2UXCI 3H4LA 5IWAI 4DR6E 1KVKA 5IT9Q 4DV7I 2Q2EB 4JI0E 1H74A 3F0NA 4DUZE 5LMUE 3T1HI 1XNQE 4DV5E 3WU6A 4HY1A 4FWGA 4AQYE 3ZZUA 3LTOA 4B3RE 2V8PA 1B63A 4DV2I 2HHHE 2CGEA 2BM0A 1N0UA 1USUA 3PYGA 1KIJA 2O1WA 4X64E 2UXCE 1Z0CA 5LMNI 5IWAE 4B3TE 4IZKB 4YY3I 4JI4I 4DV7E 1ZM3A 4JYAE 4HACB 4JI2I 4NXMI 1I94I 4PRVA 2UUCI 2X36A 4LF6E 2Z5EA 4LF5I 1USVA 4DV3I 3V2UC 2A2CA 5GMDA 4ZVIA 4IZJB 2DEJA 1IBMI 3QT8A 3J81Q 4DV6I 1XMQE 4DV2E 1FJGI 3K1JA 2VQFI 3T1YI 4LF9E 2UUBI 1N33I 5FLXC 1ZXNA 1U2RA 2Z5BA 2VF3A 4LFAI 1FI4A 1B62A 4JI1I 4DR7E 1HK7A 2ZM6I 1BKNA 1KTVA 5LMNE 4NXNI 4JI4E 1H72C 3QT6A 5FLXQ 4DR6I 3WU4A 4NXME 4JI0I 2UXBE 1HNXI 5LL6R 5LMUI 1RR9A 4DV5I 1K47A 4DPUA 3PYEA 1KKHA 3D4JA 4DV6E 4HYMA 2GQ0A 4DV0E 1J5EI 3HULA 2CG9A 2OI2A 3T1YE 2VQFE 2PNLA 4B3RI 4FWHA 1QZRA 1N33E 1S16A 4HXZA 1Z0GA 4P52A 2HHHI 2HK2A 3ZZTA 3Q1QA 4LFAE 1Y4UA 5FWKA 4X64I 1EA6A 3WU3A 2LJPA 1XNRI 3GONA 1MU5A 4B3TI 4DV4I 2AJ4A 1N34E 4JYAI 1HNXE 4UTGA 4DR1I 3OTOE 4LF6I 4DPWA 4PRXA 1Z0BA 1Z5CA 4USKA 2Z5CB 4EMDA 1J5EE 2A2DA 4DR5E 1XMQI 3Q6NA 1HNWI 4LF9I 5L3JA 1Y4SA 2V2VA 1FWLA 1HNZI 4DR7I 2E1RA 4URLA 2VQEI 2Z5BB 1D6TA 1XNRE 4WUCA 4DV4E 4K0KI 4LF4E 4WUDA 1Y6ZA 2NPFA 4JI8I 4X62I 4DR1E 4MYUA 2UXBI 4WUBA 3J81C 4X66I 5A2QC 3B78A 3JAMC 2R42A 4I3HA 4UT4A 3B8HA 1NHHA 4GKKI 3V5RA 4DV0I 5A2QQ 3JAMQ 3ZZ0A 2R3VA 1Z0VA 1HNWE 4FN5A 1Z59A 3ZM7A 1HNZE 4YHHE 3K17A 2WW4A 2VQEE 2IOPA 4KHPE 1H7SA 4JV5I 3J7AM 1VISA 4K0KE 4Z7CA 2HKJA 3M6AA 2BM1A 1FNMA 4JI5I 4DXLA 4JI8E 4X62E 2HKEA 1N34I 4DR2E 4X66E 3OTOI 4B3ME 1HR0I 2F4VE 4GKKE 4GKJE 1N36E 3WU5A 4HACA 1RREA 4RPFA 4DR5I 4DPYA 4LFBI 4DUYE 1ELOA 4OX9E 1MG7A 2GS8A 4PU9A 4LF7I 1Z5BA 4ED4A 2EFGA 4DR3E 5BR8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT7 A;  1H7U A;  4JV5 E;  1XMO I;  4JI5 E;  4LF4 I;  4FWD A;  5GME A;  1PVG A;  4JG4 A;  1HR0 E;  2E5L E;  1MX0 A;  1H73 A;  1UEK A;  1Z0W A;  4B3S E;  4R1F A;  1N0V C;  4LFB E;  4XTJ A;  1A6F A;  4LF7 E;  3LPS A;  3PYD A;  5BR8 E;  1Z0E A;  4MYT A;  3QT5 A;  4YHH I;  2ZBK B;  1XMO E;  4LFC E;  1OJ4 A;  2V2Z A;  2UU9 E;  3PYF A;  4FW9 A;  4KHP I;  2CZ9 A;  1NHI A;  1XHK A;  1IBK E;  4JI6 I;  1NZ0 A;  2V2Q A;  4DR2 I;  2UXD I;  4LF8 E;  2HFS A;  3LNU A;  1PKP A;  1IBL E;  4B3M I;  2F4V I;  2UUA E;  4GKJ I;  1N36 I;  1PIE A;  4DR4 I;  1ZM9 A;  4DUY I;  4OX9 I;  4X65 I;  1DAR A;  3T1H E;  4JI7 I;  1Z5A A;  1ZM4 A;  1FWK A;  4DR3 I;  4JI3 I;  2XEX A;  2HFU A;  3B82 A;  4DV1 I;  2V34 A;  4JI6 E;  1N32 I;  2UXD E;  2E5L I;  3ZKB A;  4DR4 E;  1WUU A;  4B3S I;  4YY3 E;  2J7K A;  4KQV A;  3ZKD A;  4JI2 E;  1I94 E;  4X65 E;  4JI7 E;  2UUC E;  4DUZ I;  4DU7 A;  3J7A G;  4LF5 E;  2HK3 A;  4Z7Y A;  4JI3 E;  4DV3 E;  1XNQ I;  4LFC I;  4DV1 E;  2BV3 A;  2UU9 I;  1IBM E;  4DPX A;  3J80 C;  4USM A;  2DEI A;  4AQY I;  1FJG E;  2ZIT A;  3CWV A;  4DPT A;  1IBK I;  4M1K A;  2UUB E;  4DU8 A;  1ZM2 A;  1N32 E;  1ZXM A;  5IT9 C;  1FKA E;  3J80 Q;  4JI1 E;  1EI1 A;  2ZM6 E;  4LF8 I;  2X7I A;  1NHJ A;  4P7A A;  1IBL I;  1Z0T A;  1S4E A;  4NXN E;  2UUA I;  2UXC I;  3H4L A;  5IWA I;  4DR6 E;  1KVK A;  5IT9 Q;  4DV7 I;  2Q2E B;  4JI0 E;  1H74 A;  3F0N A;  4DUZ E;  5LMU E;  3T1H I;  1XNQ E;  4DV5 E;  3WU6 A;  4HY1 A;  4FWG A;  4AQY E;  3ZZU A;  3LTO A;  4B3R E;  2V8P A;  1B63 A;  4DV2 I;  2HHH E;  2BM0 A;  1N0U A;  3PYG A;  1KIJ A;  4X64 E;  2UXC E;  1Z0C A;  5LMN I;  5IWA E;  4B3T E;  4YY3 I;  4JI4 I;  4DV7 E;  1ZM3 A;  4JYA E;  4HAC B;  4JI2 I;  4NXM I;  1I94 I;  4PRV A;  2UUC I;  2X36 A;  4LF6 E;  4LF5 I;  4DV3 I;  3V2U C;  2A2C A;  5GMD A;  4ZVI A;  2DEJ A;  1IBM I;  3QT8 A;  3J81 Q;  4DV6 I;  1XMQ E;  4DV2 E;  1FJG I;  3K1J A;  2VQF I;  3T1Y I;  4LF9 E;  2UUB I;  1N33 I;  1ZXN A;  5FLX C;  1U2R A;  2VF3 A;  4LFA I;  1FI4 A;  1B62 A;  4JI1 I;  4DR7 E;  2ZM6 I;  1BKN A;  1KTV A;  5LMN E;  4NXN I;  4JI4 E;  1H72 C;  3QT6 A;  5FLX Q;  4DR6 I;  3WU4 A;  4NXM E;  4JI0 I;  2UXB E;  1HNX I;  5LL6 R;  5LMU I;  1RR9 A;  4DV5 I;  1K47 A;  4DPU A;  3PYE A;  1KKH A;  3D4J A;  4DV6 E;  4HYM A;  4DV0 E;  1J5E I;  3HUL A;  2OI2 A;  3T1Y E;  2VQF E;  4B3R I;  4FWH A;  1QZR A;  1N33 E;  1S16 A;  4HXZ A;  1Z0G A;  4P52 A;  2HHH I;  2HK2 A;  3ZZT A;  3Q1Q A;  4LFA E;  4X64 I;  1EA6 A;  3WU3 A;  2LJP A;  1XNR I;  3GON A;  1MU5 A;  4B3T I;  4DV4 I;  2AJ4 A;  1N34 E;  4JYA I;  1HNX E;  4UTG A;  4DR1 I;  3OTO E;  4LF6 I;  4DPW A;  4PRX A;  1Z0B A;  1Z5C A;  4USK A;  4EMD A;  1J5E E;  2A2D A;  4DR5 E;  1XMQ I;  1HNW I;  4LF9 I;  5L3J A;  2V2V A;  1FWL A;  1HNZ I;  4DR7 I;  2E1R A;  4URL A;  2VQE I;  1D6T A;  1XNR E;  4WUC A;  4DV4 E;  4K0K I;  4LF4 E;  4WUD A;  2NPF A;  4JI8 I;  4X62 I;  4DR1 E;  4MYU A;  2UXB I;  4WUB A;  3J81 C;  4X66 I;  5A2Q C;  3B78 A;  3JAM C;  2R42 A;  4I3H A;  4UT4 A;  3B8H A;  1NHH A;  4GKK I;  3V5R A;  4DV0 I;  5A2Q Q;  3JAM Q;  3ZZ0 A;  2R3V A;  1Z0V A;  1HNW E;  4FN5 A;  1Z59 A;  3ZM7 A;  1HNZ E;  4YHH E;  3K17 A;  2WW4 A;  2VQE E;  4KHP E;  1H7S A;  4JV5 I;  3J7A M;  1VIS A;  4K0K E;  4Z7C A;  2HKJ A;  3M6A A;  2BM1 A;  1FNM A;  4JI5 I;  4DXL A;  4JI8 E;  4X62 E;  2HKE A;  1N34 I;  4DR2 E;  4X66 E;  3OTO I;  4B3M E;  1HR0 I;  2F4V E;  4GKK E;  4GKJ E;  1N36 E;  3WU5 A;  4HAC A;  1RRE A;  4RPF A;  4DR5 I;  4DPY A;  4LFB I;  4DUY E;  1ELO A;  4OX9 E;  1MG7 A;  2GS8 A;  4PU9 A;  4LF7 I;  1Z5B A;  4ED4 A;  2EFG A;  4DR3 E;  5BR8 I; 
#chains in the Genus database with same CATH topology
 3QT7 A;  1H7U A;  4LCF A;  4U3D A;  4JV5 E;  1XMO I;  2C38 B;  2GO4 A;  4IZJ D;  2C39 B;  4JI5 E;  4LF4 I;  4FWD A;  5GME A;  2GO3 A;  3P76 A;  4BA1 B;  1PVG A;  3UHM A;  1E3P A;  4JG4 A;  1HR0 E;  2E5L E;  1MX0 A;  2PNM A;  1H73 A;  1UEK A;  2NN6 C;  1Z0W A;  4B3S E;  4R1F A;  3K85 A;  3Q6M A;  1N0V C;  3PS2 A;  1RHY A;  4LFB E;  4XTJ A;  4FW3 A;  1A6F A;  3M85 G;  4LF7 E;  4IFD E;  3LPS A;  3PYD A;  5BR8 E;  2JE6 A;  1Z0E A;  4MYT A;  2J65 A;  4N3O A;  3QT5 A;  3U1K A;  2ZBK B;  4YHH I;  1XMO E;  4LFC E;  1OJ4 A;  2V2Z A;  2UU9 E;  3PYF A;  5C0X C;  4FW9 A;  4KHP I;  2CZ9 A;  1NHI A;  1XHK A;  1IBK E;  2NN6 B;  4JI6 I;  3DD6 A;  1NZ0 A;  2V2Q A;  4IFD F;  4DR2 I;  4BA2 B;  2UXD I;  4FW6 A;  4LF8 E;  2HFS A;  3HJC A;  3LNU A;  1PKP A;  1IBL E;  4B3M I;  2F4V I;  2UUA E;  4GKJ I;  1N36 I;  1PIE A;  4DR4 I;  1ZM9 A;  4OO1 D;  5C0X B;  4DUY I;  4OX9 I;  1P42 A;  4X65 I;  1DAR A;  3PRY A;  3T1H E;  4JI7 I;  1Z5A A;  2Z5C A;  1ZM4 A;  1FWK A;  5JEA C;  2PNZ A;  4DR3 I;  4JI3 I;  2JEA B;  2XEX A;  2WNR B;  2HFU A;  3B82 A;  4DV1 I;  2V34 A;  2O1U A;  2PO2 A;  4JI6 E;  3KRN A;  1N32 I;  4IFD A;  2UXD E;  4IZK A;  2E5L I;  2BA1 G;  3ZKB A;  4DR4 E;  1WUU A;  2IOQ A;  4B3S I;  4YY3 E;  4MU4 A;  5JEA B;  4OZE A;  1UDQ A;  2J7K A;  4KQV A;  5DRQ A;  3ZKD A;  4JI2 E;  1I94 E;  4X65 E;  4JI7 E;  3P06 A;  2UUC E;  4DUZ I;  3GME A;  4DU7 A;  3J7A G;  5K36 A;  4LF5 E;  2HK3 A;  4Z7Y A;  4IZJ A;  4JI3 E;  5DRP A;  4DV3 E;  1XNQ I;  4OO1 E;  2O1V A;  4LFC I;  2BA1 D;  5K36 D;  2IER A;  4DV1 E;  2BV3 A;  1IBM E;  2UU9 I;  4DPX A;  3J80 C;  4USM A;  2DEI A;  4AQY I;  1FJG E;  2ZIT A;  3CWV A;  4DPT A;  1IBK I;  4M1K A;  2UUB E;  4DU8 A;  1ZM2 A;  2O1T A;  1N32 E;  1ZXM A;  4ISA A;  5IT9 C;  1FKA E;  3J80 Q;  4JI1 E;  1EI1 A;  5EL9 A;  2ZM6 E;  4LF8 I;  2X7I A;  4OO1 F;  1NHJ A;  2C37 A;  4P7A A;  1IBL I;  1Z0T A;  1S4E A;  4NXN E;  2UUA I;  2UXC I;  3PS3 A;  3H4L A;  3HKM A;  5IWA I;  4DR6 E;  1KVK A;  5IT9 Q;  2AE8 A;  4DV7 I;  2Q2E B;  4JI0 E;  1H74 A;  3F0N A;  4DUZ E;  5LMU E;  3T1H I;  4IFD C;  1YH8 A;  1XNQ E;  4DV5 E;  3WU6 A;  4IS9 A;  5EKW A;  4HY1 A;  2PO1 A;  2PNZ B;  4FWG A;  4AQY E;  2JEB A;  3ZZU A;  3LTO A;  4B3R E;  2V8P A;  2WP8 A;  1B63 A;  2BR2 A;  4DV2 I;  5DNX A;  2HHH E;  1XXE A;  2BM0 A;  2CGE A;  1N0U A;  1USU A;  2PO0 A;  5K36 E;  4GQU A;  3PYG A;  1KIJ A;  2O1W A;  4X64 E;  2C39 A;  4OO1 A;  3NZK A;  2UXC E;  1Z0C A;  4IFD B;  5LMN I;  5IWA E;  4B3T E;  4IZK B;  4YY3 I;  4JI4 I;  4DV7 E;  1ZM3 A;  4JYA E;  4HAC B;  4JI2 I;  4NXM I;  1I94 I;  3CDI A;  4PRV A;  5K36 F;  1OYP A;  2UUC I;  2X36 A;  4LF6 E;  2Z5E A;  4LF5 I;  1USV A;  4DV3 I;  3V2U C;  2A2C A;  2F1D A;  5GMD A;  4ZVI A;  2IES A;  4IZJ B;  4MU3 A;  2DEJ A;  1UDN A;  1IBM I;  2VES A;  3QT8 A;  3J81 Q;  3L7Z A;  4DV6 I;  1XMQ E;  4DV2 E;  1FJG I;  3K1J A;  2VQF I;  3T1Y I;  4LF9 E;  1VI7 A;  4J3D A;  2UUB I;  1N33 I;  1ZXN A;  2Z5B A;  1U2R A;  5FLX C;  2VF3 A;  4LPF A;  1FI4 A;  4LFA I;  1B62 A;  4U3B A;  4JI1 I;  1HK7 A;  4DR7 E;  2ZM6 I;  1BKN A;  2NN6 A;  1KTV A;  5LMN E;  4NXN I;  1R6L A;  4JI4 E;  1H72 C;  3QT6 A;  5FLX Q;  2C37 B;  4AID A;  4DR6 I;  4BA2 A;  2NN6 D;  3WU4 A;  4NXM E;  3P3E A;  4JI0 I;  2UXB E;  1HNX I;  5LL6 R;  5LMU I;  1UDS A;  3P3G A;  1RR9 A;  4DV5 I;  1K47 A;  4DPU A;  3PYE A;  4OO1 C;  5ELW A;  1KKH A;  3D4J A;  1Y5Y A;  2JE6 B;  4DV6 E;  4HYM A;  2GQ0 A;  4DV0 E;  1J5E I;  3HUL A;  2CG9 A;  2OI2 A;  3T1Y E;  2VQF E;  2PNL A;  4B3R I;  4FWH A;  5C0X D;  1QZR A;  1N33 E;  1S16 A;  4HXZ A;  5DRR A;  1Z0G A;  4P52 A;  2HHH I;  2PO1 B;  2HK2 A;  3ZZT A;  2JEB B;  3Q1Q A;  4AIM A;  2WP8 B;  4LFA E;  2BR2 B;  1Y4U A;  4FW4 A;  5FWK A;  4X64 I;  4MQY A;  2PO0 B;  1EA6 A;  3WU3 A;  2LJP A;  1OYS A;  1XNR I;  1UDO A;  1MU5 A;  3GON A;  5DNL A;  4B3T I;  4DV4 I;  4OO1 B;  2AJ4 A;  1N34 E;  4JYA I;  1HNX E;  4UTG A;  4DR1 I;  3OTO E;  4MDT A;  3H1C A;  2BA0 G;  4DPW A;  4LF6 I;  4PRX A;  1Z0B A;  5JEA A;  1Z5C A;  4MU0 A;  2NN6 E;  4USK A;  2O3Z A;  2Z5C B;  2JT2 A;  4NBQ A;  4EMD A;  1J5E E;  2A2D A;  5JEA D;  4DR5 E;  3M7N G;  1XMQ I;  3Q6N A;  1YHC A;  1HNW I;  4LF9 I;  5L3J A;  1Y4S A;  2V2V A;  3L7Z B;  3U1Y A;  1FWL A;  5K36 C;  4OKG A;  2C38 A;  2PO2 B;  2BA0 D;  1HNZ I;  4DR7 I;  2NN6 F;  2E1R A;  5C0X E;  3GLL A;  4URL A;  2VQE I;  4AM3 A;  2Z5B B;  1D6T A;  1XNR E;  3P3C A;  4WUC A;  4LOM A;  4BA1 A;  4DV4 E;  4K0K I;  4LF4 E;  4WUD A;  3M7N D;  1Y6Z A;  2NPF A;  2CVE A;  3M85 D;  4JI8 I;  4X62 I;  4DR1 E;  4MYU A;  4MU1 A;  2UXB I;  1Y60 A;  4WUB A;  3J81 C;  4X66 I;  5A2Q C;  3B78 A;  3JAM C;  2R42 A;  4I3H A;  4UT4 A;  3B8H A;  1NHH A;  3GCM A;  5C0X F;  4GKK I;  5K36 B;  3V5R A;  4DV0 I;  3PS1 A;  5A2Q Q;  3JAM Q;  3ZZ0 A;  2R3V A;  1Z0V A;  1HNW E;  4FN5 A;  1Z59 A;  3ZM7 A;  4LCH A;  5DRO A;  5JEA E;  1HNZ E;  4YHH E;  3K17 A;  2WW4 A;  2VQE E;  2IOP A;  4KHP E;  1H7S A;  4JV5 I;  3J7A M;  1E3H A;  1VIS A;  4K0K E;  4Z7C A;  2HKJ A;  4QNJ A;  3M6A A;  2BM1 A;  1FNM A;  4JI5 I;  4DXL A;  4JI8 E;  4X62 E;  4FW5 A;  2HKE A;  1N34 I;  4DR2 E;  4X66 E;  3OTO I;  3B4T A;  5JEA F;  4B3M E;  1HR0 I;  2F4V E;  4GKK E;  4GKJ E;  1N36 E;  5C0X A;  4IFD D;  3WU5 A;  4HAC A;  1RRE A;  4RPF A;  4DR5 I;  4DPY A;  4FW7 A;  4DUY E;  4LFB I;  1ELO A;  1R6M A;  4OX9 E;  2JEA A;  1MG7 A;  1OYR A;  2GS8 A;  4PU9 A;  3CDJ A;  1Z5B A;  2WNR A;  4LF7 I;  4QNK A;  4ED4 A;  4LCG A;  2EFG A;  4DR3 E;  5BR8 I; 
#chains in the Genus database with same CATH homology
 3QT7 A;  1H7U A;  4JV5 E;  1XMO I;  4IZJ D;  4JI5 E;  4LF4 I;  4FWD A;  5GME A;  1PVG A;  4JG4 A;  1HR0 E;  2E5L E;  1MX0 A;  2PNM A;  1H73 A;  1UEK A;  1Z0W A;  4B3S E;  4R1F A;  3K85 A;  3Q6M A;  1N0V C;  4LFB E;  4XTJ A;  1A6F A;  4LF7 E;  3LPS A;  3PYD A;  5BR8 E;  1Z0E A;  4MYT A;  4N3O A;  3QT5 A;  4YHH I;  2ZBK B;  1XMO E;  4LFC E;  1OJ4 A;  2V2Z A;  2UU9 E;  3PYF A;  4FW9 A;  4KHP I;  2CZ9 A;  1NHI A;  1XHK A;  1IBK E;  4JI6 I;  1NZ0 A;  2V2Q A;  4DR2 I;  2UXD I;  4LF8 E;  2HFS A;  3HJC A;  3LNU A;  1PKP A;  1IBL E;  4B3M I;  2F4V I;  2UUA E;  4GKJ I;  1N36 I;  1PIE A;  4DR4 I;  1ZM9 A;  4DUY I;  4OX9 I;  4X65 I;  1DAR A;  3PRY A;  3T1H E;  4JI7 I;  1Z5A A;  2Z5C A;  1ZM4 A;  1FWK A;  4DR3 I;  4JI3 I;  2XEX A;  2HFU A;  3B82 A;  4DV1 I;  2V34 A;  2O1U A;  4JI6 E;  1N32 I;  2UXD E;  4IZK A;  2E5L I;  3ZKB A;  4DR4 E;  1WUU A;  2IOQ A;  4B3S I;  4YY3 E;  2J7K A;  4KQV A;  3ZKD A;  4JI2 E;  1I94 E;  4X65 E;  4JI7 E;  3P06 A;  2UUC E;  4DUZ I;  4DU7 A;  3J7A G;  4LF5 E;  2HK3 A;  4Z7Y A;  4IZJ A;  4JI3 E;  4DV3 E;  1XNQ I;  2O1V A;  4LFC I;  4DV1 E;  2BV3 A;  1IBM E;  2UU9 I;  4DPX A;  3J80 C;  4USM A;  2DEI A;  4AQY I;  1FJG E;  2ZIT A;  3CWV A;  4DPT A;  1IBK I;  4M1K A;  2UUB E;  4DU8 A;  1ZM2 A;  2O1T A;  1N32 E;  1ZXM A;  5IT9 C;  1FKA E;  3J80 Q;  4JI1 E;  1EI1 A;  2ZM6 E;  4LF8 I;  2X7I A;  1NHJ A;  4P7A A;  1IBL I;  1Z0T A;  1S4E A;  4NXN E;  2UUA I;  2UXC I;  3H4L A;  5IWA I;  4DR6 E;  1KVK A;  5IT9 Q;  4DV7 I;  2Q2E B;  4JI0 E;  1H74 A;  3F0N A;  4DUZ E;  5LMU E;  3T1H I;  1XNQ E;  4DV5 E;  3WU6 A;  4HY1 A;  4FWG A;  4AQY E;  3ZZU A;  3LTO A;  4B3R E;  2V8P A;  1B63 A;  4DV2 I;  2HHH E;  2CGE A;  2BM0 A;  1N0U A;  1USU A;  3PYG A;  1KIJ A;  2O1W A;  4X64 E;  2UXC E;  1Z0C A;  5LMN I;  5IWA E;  4B3T E;  4IZK B;  4YY3 I;  4JI4 I;  4DV7 E;  1ZM3 A;  4JYA E;  4HAC B;  4JI2 I;  4NXM I;  1I94 I;  4PRV A;  2UUC I;  2X36 A;  4LF6 E;  2Z5E A;  4LF5 I;  1USV A;  4DV3 I;  3V2U C;  2A2C A;  5GMD A;  4ZVI A;  4IZJ B;  2DEJ A;  1IBM I;  3QT8 A;  3J81 Q;  4DV6 I;  1XMQ E;  4DV2 E;  1FJG I;  3K1J A;  2VQF I;  3T1Y I;  4LF9 E;  2UUB I;  1N33 I;  5FLX C;  1ZXN A;  1U2R A;  2Z5B A;  2VF3 A;  4LFA I;  1FI4 A;  1B62 A;  4JI1 I;  4DR7 E;  1HK7 A;  2ZM6 I;  1BKN A;  1KTV A;  5LMN E;  4NXN I;  4JI4 E;  1H72 C;  3QT6 A;  5FLX Q;  4DR6 I;  3WU4 A;  4NXM E;  4JI0 I;  2UXB E;  1HNX I;  5LL6 R;  5LMU I;  1RR9 A;  4DV5 I;  1K47 A;  4DPU A;  3PYE A;  1KKH A;  3D4J A;  4DV6 E;  4HYM A;  2GQ0 A;  4DV0 E;  1J5E I;  3HUL A;  2CG9 A;  2OI2 A;  3T1Y E;  2VQF E;  2PNL A;  4B3R I;  4FWH A;  1QZR A;  1N33 E;  1S16 A;  4HXZ A;  1Z0G A;  4P52 A;  2HHH I;  2HK2 A;  3ZZT A;  3Q1Q A;  4LFA E;  1Y4U A;  5FWK A;  4X64 I;  1EA6 A;  3WU3 A;  2LJP A;  1XNR I;  3GON A;  1MU5 A;  4B3T I;  4DV4 I;  2AJ4 A;  1N34 E;  4JYA I;  1HNX E;  4UTG A;  4DR1 I;  3OTO E;  4LF6 I;  4DPW A;  4PRX A;  1Z0B A;  1Z5C A;  4USK A;  2Z5C B;  4EMD A;  1J5E E;  2A2D A;  4DR5 E;  1XMQ I;  3Q6N A;  1HNW I;  4LF9 I;  5L3J A;  1Y4S A;  2V2V A;  1FWL A;  1HNZ I;  4DR7 I;  2E1R A;  4URL A;  2VQE I;  2Z5B B;  1D6T A;  1XNR E;  4WUC A;  4DV4 E;  4K0K I;  4LF4 E;  4WUD A;  1Y6Z A;  2NPF A;  4JI8 I;  4X62 I;  4DR1 E;  4MYU A;  2UXB I;  4WUB A;  3J81 C;  4X66 I;  5A2Q C;  3B78 A;  3JAM C;  2R42 A;  4I3H A;  4UT4 A;  3B8H A;  1NHH A;  4GKK I;  3V5R A;  4DV0 I;  5A2Q Q;  3JAM Q;  3ZZ0 A;  2R3V A;  1Z0V A;  1HNW E;  4FN5 A;  1Z59 A;  3ZM7 A;  1HNZ E;  4YHH E;  3K17 A;  2WW4 A;  2VQE E;  2IOP A;  4KHP E;  1H7S A;  4JV5 I;  3J7A M;  1VIS A;  4K0K E;  4Z7C A;  2HKJ A;  3M6A A;  2BM1 A;  1FNM A;  4JI5 I;  4DXL A;  4JI8 E;  4X62 E;  2HKE A;  1N34 I;  4DR2 E;  4X66 E;  3OTO I;  4B3M E;  1HR0 I;  2F4V E;  4GKK E;  4GKJ E;  1N36 E;  3WU5 A;  4HAC A;  1RRE A;  4RPF A;  4DR5 I;  4DPY A;  4LFB I;  4DUY E;  1ELO A;  4OX9 E;  1MG7 A;  2GS8 A;  4PU9 A;  4LF7 I;  1Z5B A;  4ED4 A;  2EFG A;  4DR3 E;  5BR8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...