4JI0E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji0E02
4B3ME 5FLXC 1IBKE 5GMDA 2UUCE 1X47A 4R1FA 1IBME 4GKJE 5BR8E 4B3SE 4LF6E 1PKPA 2LJHA 3CWVA 4LFBE 2HFSA 4DPYA 3V5RA 1N36E 4RPFA 4DUYE 4JI3I 1Z59A 4JV5I 1I94I 4DV0I 1FWKA 4DR1E 1RREA 4DV2E 1ZM9A 1Z0TA 1YYKA 3LPSA 1J5EI 4M1KA 2HK2A 1BKNA 5CFFE 3OTOI 2ZBKB 4GKKE 2VQEE 5LL6R 4UTGA 4DR5I 2UUBE 2UU9I 1HNXE 4X62E 1N32I 2UXBI 4DR7I 3JAMC 1XHKA 1NHIA 1Z0WA 1HNXI 1HNWE 4HY1A 4OX9I 4FWGA 1U2RA 4DV6E 2A2DA 4KHPE 5IWAI 2RTXA 3K1JA 3P1XA 2NUEA 4I3HA 2A2CA 1Z5AA 2ZM6E 1FWLA 4LFCI 4NXME 1EI1A 4JI1E 4B3RI 4AQYE 4DKKA 5FLXQ 4DV3I 2V2ZA 2KHXA 2LBSB 3V2UC 4X64E 4P7AA 2N3GA 4JI4I 4X65I 1VISA 5LMNI 4JI8I 5LMUI 4FN5A 4WYQB 1FI4A 4X64I 4LF9E 1ZBTA 2UXDE 3WU3A 4Z7YA 1YYWA 2LJPA 2UXCE 1H72C 4NXNE 2UUAI 1UILA 4YY3I 1B62A 1T4NA 3VYXA 3J7AG 4DR2I 4LF4E 1ELOA 4LF5I 4JI2I 2B7TA 4DPUA 2L2KB 1S4EA 3M6AA 3ZZUA 1NHHA 1MU5A 2LTRA 1K47A 2LRSA 3JAMQ 1PIEA 2XEXA 4JI0I 2AJ4A 2NUFA 2BV3A 2NUGA 2X36A 1MG7A 4WUBA 2L3JA 4JI3E 4JV5E 1I94E 1T4LB 3LTOA 4DV0E 4UT4A 4LF7I 3LNUA 1J5EE 1B63A 1KIJA 3OTOE 3T1YI 4JI5I 3ADIA 2DEIA 1DI2A 2ZITA 2DB2A 2L33A 1NZ0A 4DR5E 2UU9E 1XMOI 4P52A 1Z0GA 2BM0A 1H74A 3ADJA 1N32E 2UXBE 4DR7E 1HNZI 1WHQA 2DMYA 2JY9A 3Q1QA 1PVGA 2HKEA 2LUPB 4DV4I 3PYGA 3ZKDA 2VF3A 3QT8A 3H4LA 4OX9E 2OI2A 1XNQI 2CPNA 2BM1A 1OJ4A 1FJGI 5IWAE 1X49A 2NA2A 4LFAI 3QT7A 4MYTA 1STUA 3HULA 1Z5BA 4LFCE 1WHNA 4MYUA 4ED4A 4B3RE 1A6FA 3WU4A 4DV3E 2L2MA 4DR4I 4JYAI 1KTVA 1ZM2A 4DR6I 3VYYA 2B7VA 3ZM7A 4HACA 4K0KI 1N0VC 3ADGA 4JI4E 4B3TI 4X65E 3J7Yp 5LMNE 4JI8E 2Q2EB 5LMUE 3T1HI 4WUCA 1RR9A 4PRVA 4HXZA 4ZVIA 2HFUA 2DEJA 1ZXMA 4DV5I 4WUDA 3J7AM 1YYOA 2UUAE 1HR0E 4JG4A 1H7SA 1N33E 1GQEA 4YY3E 1UHZA 4JI7I 4DR2E 1Z0BA 4LF5E 3J80C 4JI2E 3B78A 4DPTA 1ZM4A 1HR0I 1N33I 4DV7I 4DUZE 4DPXA 3PYFA 1N34I 2EFGA 1FKAE 4JI0E 3QT6A 1KKHA 2L3CA 5A2QC 1IBLI 2V8PA 4DPWA 4JI6I 4DUZI 4KQVA 4USMA 4HYMA 2L2NA 3ZKBA 2CZ9A 4LF7E 2GS8A 3C4TA 3T1YE 4JI5E 4LF8I 2VQFI 4FW9A 4M30A 1YZ9A 2LTSA 1KVKA 1X48A 1XMOE 4YHHI 5L3JA 1XMQI 1Z0VA 2F4VI 2E5LI 4OOGC 2EZ6A 2IHR1 3B8HA 1HNZE 4X66E 2WW4A 3PYEA 1QZRA 4B3MI 1RQ0A 5IT9C 1IBKI 4DV4E 2NPFA 2UUCI 1XNRE 2HK3A 1O0WA 1IBMI 4GKJI 4X8WA 4X66I 5BR8I 1XNQE 4B3SI 4LF6I 1RC7A 3WU6A 2R3VA 1FJGE 1T4OA 4LFBI 2J7KA 1XNRI 5GMEA 3B82A 1N36I 4LFAE 4DUYI 3J81C 4WFTA 1ZM3A 1Z5CA 4PRXA 3J80Q 4DR1I 4DR4E 4DV2I 4JYAE 3GONA 4URLA 4DR6E 4EMDA 2MDRA 3ADLA 2YT4A 4K0KE 4GKKI 4B3TE 2E1RA 4DU7A 5A2QQ 2RS6A 2RS7A 3T1HE 2VQEI 2HHHE 1Z0EA 1QU6A 2UUBI 4DR3E 4HACB 4USKA 1EA6A 4Z7CA 4X62I 4DV5E 2RSMA 2B3TB 1MX0A 2HHHI 3ZZ0A 4DR3I 1H73A 4XTJA 4JI7E 3PYDA 1HNWI 3QT5A 1UEKA 3K17A 2V2QA 4DV7E 2V2VA 1WUUA 4DV6I 4KHPI 1N34E 2HKJA 3D4JA 2ZM6I 1IBLE 1NHJA 3LLHA 1ZXNA 4DV1E 3F0NA 3ZZTA 4JI6E 4NXMI 2V34A 2DIXA 4JI1I 4AQYI 1FNMA 1Z0CA 5IT9Q 4FWHA 3HTXA 4DV1I 4DXLA 3C4BA 3WU5A 1S16A 1N0UA 4LF8E 2VQFE 3J81Q 4LF9I 1DARA 2UXDI 4PU9A 1EKZA 2X7IA 2R42A 2UXCI 1D6TA 4YHHE 1XMQE 4NXNI 4M2ZA 2F4VE 2E5LE 4DU8A 2JVAA 4FWDA 1H7UA 4LF4I 1J26A 2N3HA 2LUQA
chains in the Genus database with same CATH superfamily
4IFDE 4O5GA 5FLXC 4B3ME 1IBKE 5GMDA 2FGGA 3VK6A 2UUCE 2C39A 1Y5YA 2YTJA 2EMFA 1X47A 4R1FA 1IBME 4BHBA 4GKJE 4O43A 5BR8E 2EPXA 1ZU1A 1XXEA 2EMXA 4B3SE 4LF6E 2CSHA 5T6JA 5KL5A 2EOXA 2E72A 1PKPA 2LJHA 1T38A 3CWVA 4LFBE 2HFSA 4DPYA 3V5RA 3HKMA 2PNZB 2IERA 5JEAF 1N36E 4RPFA 4DUYE 2JE6B 4JI3I 2WZOA 1Z59A 3EPLA 5JEAE 1I94I 4JV5I 4U3BA 2EN7A 2EOMA 4BA1B 4DV0I 2EQ3A 1FWKA 4DR1E 1RREA 4DV2E 2EM3A 4BCAA 1Z0TA 1ZM9A 1SFEA 5K36B 1YYKA 4P7DA 4MLVA 3LPSA 1TF3A 1J5EI 4M1KA 2HK2A 4NZVA 1BKNA 3NZKA 5CFFE 3OTOI 4AIDA 2ZBKB 2MKDA 3P3EA 2L8TA 4GKKE 2J7JA 2CG9A 2M9AA 3ZOQB 4X9JA 2M4IA 5LL6R 2HJJA 2VQEE 3KRNA 1YSAC 4UTGA 4DR5I 2UUBE 2ELYA 2UU9I 3GCMA 5F3WA 1HNXE 1R6MA 4HTGA 4FW5A 4X62E 1E3HA 4MU1A 1N32I 2UXBI 4WSPA 2EOIA 3JAMC 4DR7I 2KONA 4QNJA 5K36D 1XHKA 5C0XC 1NHIA 3K6QA 3U1YA 2JOBA 3M7ND 1Z0WA 2EM9A 1HNXI 5C0XA 1WXRA 4BHCA 2V87A 2F1DA 3OMLA 4R2SA 3GMEA 1P47A 1HNWE 1AAYA 4HY1A 5JEAB 2JEAA 4IFDD 2H36X 1UBDC 2O1VA 4OX9I 4FWGA 1U2RA 2F8BA 5DNYA 4DV6E 4KHPE 2A2DA 2Z5CA 4OO1C 5IWAI 2BB8A 2RTXA 3K1JA 2EMAA 3P1XA 2IOQA 2NUEA 4I3HA 2A2CA 3EPKA 4FK5C 1Z5AA 3M99B 2ZM6E 1FWLA 4OO1A 5FWKA 2WBTA 2JYAA 4LFCI 4R03A 2EPUA 2RSIA 2EMGA 4NXME 1EI1A 4JI1E 4B3RI 3HPSA 4DKKA 4AQYE 5FLXQ 4DV3I 1A1LA 4R8OA 2V2ZA 2KHXA 1IQSA 2LBSB 3V2UC 2GO4A 4BA2A 4MU0A 3KZZA 4X64E 4P7AA 2MC6A 1IMUA 2N3GA 3IWCA 2EMYA 4JI4I 1EH8A 2N8XA 4X65I 1VISA 5LMNI 4J8ZA 5EL9A 2C38A 4JI8I 5LMUI 3HPZA 4FN5A 2YTFA 2Q8UA 1PJTA 4WYQB 2BR2B 1FI4A 1PJQA 2EOEA 4FW3A 4LF9E 4X64I 1ZBTA 3H1CA 2YRMA 2UXDE 3M85G 5DNXA 2GLIA 3WU3A 2AE8A 4LPFA 4Z7YA 1YYWA 5AE3A 2LJPA 1X6HA 1TF6A 2UXCE 3L7ZA 3PS3A 5ELWA 4FW7A 1H72C 3RMPA 4NXNE 2UUAI 1UILA 2V89A 2EM7A 2YZTA 4YY3I 1B62A 3AV0A 1T4NA 2EQ1A 3J7AG 2YTOA 3VYXA 4DR2I 1A1JA 4LF4E 1ELOA 4LF5I 1YUJA 4JI2I 2B7TA 4DPUA 2ENAA 2L2KB 3UHMA 1S4EA 3M6AA 4BC9A 1EH6A 3DJWA 1NHHA 3ZZUA 2DLQA 4ZYDA 4WPYA 2EOHA 2ODRD 4WSGA 1MU5A 5DRPA 2JPAA 1IQOA 4MQYA 2LTRA 1Z1BA 1K47A 2JT2A 2LRSA 1JK2A 3JAMQ 1PIEA 2XEXA 2KOUA 4TUGA 4JI0I 3BGHA 2YSPA 2FTXB 4BMJA 2JP9A 2AJ4A 2NUFA 2EN2A 1PDAA 2RPCA 2BV3A 2C39B 2NUGA 2YRHA 4OZEA 3H09A 2JEBA 2X36A 1HK7A 3KWRA 1MG7A 4WUBA 1T39A 2L3JA 4JI3E 4JV5E 1I94E 1UDSA 1EH7A 5C0XF 3ECRA 2PO2A 2EM6A 2JXPA 1T4LB 3LTOA 4DV0E 2NN6C 5C0XE 2M7QA 4UT4A 1A1KA 5ADZA 4NBQA 4LF7I 2R76A 3JU0A 4RH8A 1J5EE 1B63A 2FV4B 3EQ1A 1KIJA 2BBGA 1UDNA 2NN6A 3OTOE 1ZBQA 1NEIA 2ENHA 3T1YI 4JI5I 1YFHA 3ADIA 2EM5A 3GLLA 2DEIA 1DI2A 2ZITA 2DB2A 1P42A 4IZJA 5DROA 3L00A 2L33A 2PRTA 2WBSA 4OO1F 1NZ0A 3FIGA 4DR5E 1AH5A 2ENCA 2EL4A 2UU9E 2DLKA 4F9AB 4P52A 1XMOI 1Z0GA 2EOSA 2BM0A 1H74A 2V88A 2YTPA 2YTNA 3ADJA 1N32E 2UXBE 4DR7E 2O1TA 1HNZI 2LJUA 1WHQA 2DMYA 1KYQA 2M1SA 2EE8A 2JY9A 4L8NA 2EL5A 4GEQB 2EPZA 1PVGA 3Q1QA 2EM0A 2O1UA 1QNTA 4F6MA 2HKEA 2LUPB 4DV4I 2WNRA 2DGCA 3PYGA 1Y60A 4BS9A 2Z5BA 3ZKDA 1BBOA 1B69A 2VF3A 3QT8A 3H4LA 1JK1A 2MKNA 4OX9E 2OI2A 1XNQI 2CPNA 1GTKA 2BM1A 2EPRA 1OJ4A 5C0XB 1FJGI 2EM2A 5IWAE 5IV8B 1X49A 2NA2A 4LFAI 2EOZA 2EPOA 3QT7A 2JEAB 4MYTA 1L4SA 1STUA 3HULA 1Z5BA 3QG5C 3F6GA 5EKWA 4LFCE 4N4RB 1WHNA 4MYUA 4ED4A 4B3RE 2EN3A 1A6FA 2Z5CB 3WU4A 4DV3E 2L2MA 4DR4I 4FW6A 4JYAI 2WBUA 3IWBA 4R2AA 1KTVA 1ZM2A 4DR6I 3P3GA 4OO1B 3VYYA 2B7VA 1DGCA 3ZM7A 2ADRA 4HACA 4K0KI 5C0XD 2CVEA 1N0VC 4MDTA 2I13A 4LCGA 2YTIA 1DQ3A 3ADGA 4JI4E 2LMZA 5KL4A 4X65E 3J7Yp 5LMNE 4B3TI 4JI8E 2Q2EB 5LMUE 3T1HI 5JEAD 1OYSA 4WUCA 1RR9A 2PO0A 2EMLA 4PRVA 2VE7C 4HXZA 4LOMA 4BA2B 4ZVIA 1BB8A 2HFUA 2YTQA 3MSWA 2LVHA 4ZYEA 2DEJA 1ZXMA 4DV5I 4MLQA 4Q35B 4R2DA 1E3PA 1UDQA 4WUDA 4F9BB 5A6KA 2C38B 2CTDA 3PS2A 3J7AM 1YYOA 2R1FA 4RHBB 1HR0E 2UUAE 1H7SA 2GHFA 4JG4A 1N33E 1GQEA 3HQ1A 4R2QA 2EPKX 2BA0G 1BBGA 4YY3E 1UHZA 4JI7I 1UDOA 1Y4SA 4DR2E 1Z0BA 2NN6F 4IZKA 4LF5E 2I9IA 3L7ZB 2DRPA 5KL2A 3J80C 3M85D 4JI2E 1A1FA 3B78A 3CDJA 4DPTA 1R6LA 2WP8A 1ZM4A 2NN6E 2WP8B 1HR0I 1N33I 4R2CA 4MU3A 4DV7I 2EP3A 2VF1A 2EMZA 4LU9A 1ZR9A 2EOFA 4DUZE 4KWYA 4DPXA 3PYFA 3AUZA 2EFGA 1N34I 2C37A 1FKAE 4JI0E 2C37B 4MU4A 5A2QC 1KKHA 2L3CA 1YH8A 3QT6A 1IBLI 2V8PA 2EORA 1X6EA 2L92A 5AE2A 4AM3A 4F9CB 4DPWA 4JI6I 2V86A 5A6BA 5DNLA 1TN9A 4DUZI 2YU8A 2YU5A 3TQMA 3B4TA 2VRDA 4KQVA 3BIDA 2EN8A 4USMA 2EPPA 2EMIA 3MHHC 4HYMA 2K4VA 2L2NA 3PS1A 2IOPA 3ZKBA 2EMCA 3IWDA 2CZ9A 2EPAA 4LF7E 2JEBB 2EJ4A 2GS8A 2EPMX 5A6AA 5DRQA 3PRYA 3C4TA 4F54A 2EMHA 3LMLA 2JOXA 3T1YE 4JI5E 3VHTB 4IS1C 2PO2B 4U3DA 5KL6A 4LF8I 2PNMA 2VQFI 1WRJA 1WJPA 2EMBA 2EQ0A 4FW9A 4F6NA 3JTZA 3DD6A 4IFDF 4M30A 1YZ9A 2LTSA 1KVKA 2V85A 1X48A 1XMOE 2A25A 2NN6B 2K7IA 4M9VC 4IS9A 4LCFA 5L3JA 4FW4A 4YHHI 1Z0VA 1XMQI 2F4VI 2E5LI 4OOGC 2PO1A 5AASA 2EZ6A 2PO1B 2IHR1 4R2RA 3B8HA 4KZSA 2LCEA 1KJKA 1HNZE 2LV2A 4R2PA 4R2EA 1MEYC 2O1WA 2VESA 2EOQA 4IZJB 4O24A 4X66E 2YTEA 2WW4A 4QNKA 3PYEA 4I8OA 2LE2A 1QZRA 1RQ0A 5IT9C 4B3MI 4O4KA 1IBKI 3C6KA 4DV4E 4OO1E 2NPFA 2UUCI 2EM4A 2PNZA 2YTGA 1XNRE 2HK3A 1G2DC 1O0WA 1USUA 2JE6A 1IBMI 1F2IG 4N3OA 4GKJI 4X8WA 4X66I 5BR8I 1XNQE 2NN6D 3BBGA 4B3SI 4LF6I 5K36C 1RC7A 4J3DA 3WU6A 4BA1A 1G2FC 1FJGE 1T4OA 2R3VA 4LFBI 1OYRA 1LLMC 2J7KA 2WNRB 1XNRI 4IZJD 3B82A 5GMEA 1N36I 2JWOA 3MHSC 4LFAE 4DUYI 2Z5BB 1MGTA 5K36A 3J81C 2CT1A 4Q28A 4WFTA 2EPLX 1NCSA 1UN6B 1ZM3A 1Z5CA 4TUIA 4PRXA 4IFDC 2EL6A 3J80Q 1RHYA 4DR1I 5KL7A 4DR4E 4DV2I 4JYAE 3GONA 4URLA 4DR6E 4EMDA 4IFDA 2MDRA 4IFDB 3HXLA 3HJCA 3ADLA 2MC5A 3C6MA 2YT4A 4K0KE 3DF6A 5LLQA 3LNUA 2B9DA 4BC7A 4OKGA 4ZYHA 3EPJA 4GKKI 5IXMB 4B3TE 2E1RA 4DU7A 5A2QQ 3M7NG 2EOYA 2RS6A 2RS7A 3T1HE 2ELZA 5A69A 2DMIA 2VQEI 4WXDA 3BF2A 1YPNA 2HHHE 2G7HA 1QU6A 1Z0EA 2UUBI 5JEAC 4DR3E 4HACB 4USKA 2DSYA 2NABA 4WX9A 1EA6A 2J65A 4Z7CA 4X62I 4DV5E 5AC5A 1ZAAC 2EOJA 2RSMA 4BBYA 5JEAA 1X5WA 2B3TB 4IJDA 1A1IA 2PO0B 1MX0A 3UK3C 3EPHA 2HHHI 5A6JA 3ZZ0A 4DR3I 2CGEA 2YRKA 1H73A 2HC5A 4XTJA 4JI7E 1YHCA 1A1HA 3PYDA 4LCHA 1HNWI 3THOB 5KL3A 5AC4A 3QT5A 2L6MA 2V8QB 3U1KA 1UEKA 3K17A 2YTDA 4OO1D 1X3CA 4F2JC 2BA1G 4HEIA 2V2QA 4M0VA 4DV7E 2V2VA 1WUUA 1RMDA 4DV6I 4KHPI 2EOOA 4ZYGA 2PNLA 2BA1D 1N34E 2EN1A 2BA0D 4IZKB 2HKJA 3F6HA 4L5NC 3D4JA 2LT7A 3CDIA 2ZM6I 1IBLE 4LTYA 1NHJA 2EPNA 2EN6A 3K85A 3LLHA 4NHRA 1ZXNA 2E1MA 4DV1E 3F0NA 3ZZTA 4JI6E 4NXMI 2V34A 2YPNA 1YUIA 2DIXA 4JI1I 2EMKA 4AQYI 1FNMA 1Z0CA 2GQ0A 5IT9Q 2YSOA 3Q6MA 2EN4A 5AE1A 5TSEA 2MDGA 2ODRC 2Z5EA 3P3CA 2BR2A 4FWHA 3HTXA 3Q6NA 1A1GA 2WCC3 1OYPA 4DV1I 1SR9A 4DXLA 2LO3A 3C4BA 4AIMA 2GPIA 3THNA 3WU5A 1PJSA 1S16A 1GZ6A 1N0UA 5DRRA 4GQUA 1N3GA 3P76A 4LF8E 2GO3A 4ISAA 1X6FA 2EMWA 2D9HA 2VQFE 2EM8A 3J81Q 1DARA 4LF9I 5K36F 2UXDI 1USVA 4WXCA 1VI7A 2YWQA 1Y4UA 2O3ZA 1EKZA 2IESA 4PU9A 2X7IA 2JR1A 5K36E 2R42A 2UXCI 1Y6ZA 1D6TA 4YHHE 1XMQE 4NXNI 4M2ZA 2EPCA 2EWLA 4DMIA 2E5LE 2F4VE 4DU8A 2RQLA 2JVAA 4P78A 4GZNC 2HGHA 3KZYA 4FWDA 5A6BD 2V83A 1H7UA 4LF4I 3P06A 1J26A 2N3HA 2LUQA
chains in the Genus database with same CATH topology
5FLXC 4B3ME 1IBKE 5GMDA 2FGGA 3VK6A 2UUCE 1X47A 4R1FA 1IBME 4GKJE 5BR8E 4B3SE 4LF6E 5T6JA 1PKPA 2LJHA 3CWVA 4LFBE 2HFSA 4DPYA 3V5RA 1N36E 4RPFA 4DUYE 4JI3I 2WZOA 1Z59A 4JV5I 1I94I 4DV0I 1FWKA 4DR1E 1RREA 4DV2E 1ZM9A 4BCAA 1Z0TA 1YYKA 4P7DA 3LPSA 1J5EI 4M1KA 2HK2A 1BKNA 5CFFE 3OTOI 2ZBKB 2L8TA 4GKKE 2CG9A 3ZOQB 2M4IA 5LL6R 2VQEE 4UTGA 4DR5I 2UUBE 2UU9I 5F3WA 1HNXE 4X62E 1N32I 2UXBI 4WSPA 4DR7I 3JAMC 2KONA 1XHKA 1NHIA 3K6QA 2JOBA 1Z0WA 1HNXI 1WXRA 2V87A 3OMLA 1HNWE 4HY1A 2H36X 2O1VA 4OX9I 4FWGA 1U2RA 2F8BA 5DNYA 4DV6E 4KHPE 2A2DA 2Z5CA 5IWAI 2RTXA 3K1JA 3P1XA 2IOQA 2NUEA 4I3HA 2A2CA 1Z5AA 2ZM6E 1FWLA 5FWKA 4LFCI 4R03A 4NXME 1EI1A 4JI1E 4B3RI 3HPSA 4DKKA 4AQYE 5FLXQ 4DV3I 4R8OA 2V2ZA 2KHXA 2LBSB 3V2UC 4X64E 4P7AA 2MC6A 2N3GA 3IWCA 4JI4I 4X65I 1VISA 5LMNI 4J8ZA 4JI8I 5LMUI 3HPZA 4FN5A 4WYQB 1FI4A 4X64I 4LF9E 1ZBTA 2UXDE 3WU3A 4Z7YA 1YYWA 5AE3A 2LJPA 2UXCE 1H72C 3RMPA 4NXNE 2UUAI 1UILA 2V89A 2YZTA 4YY3I 1B62A 3AV0A 1T4NA 3J7AG 3VYXA 4DR2I 4LF4E 1ELOA 4LF5I 4JI2I 2B7TA 4DPUA 2L2KB 1S4EA 3M6AA 4BC9A 3ZZUA 3DJWA 1NHHA 4WPYA 2ODRD 1MU5A 2LTRA 1K47A 2LRSA 3JAMQ 1PIEA 2XEXA 2KOUA 4TUGA 4JI0I 2FTXB 4BMJA 2AJ4A 2NUFA 2BV3A 2NUGA 3H09A 2X36A 1HK7A 3KWRA 1MG7A 4WUBA 2L3JA 4JI3E 4JV5E 1I94E 1T4LB 3LTOA 4DV0E 2M7QA 4UT4A 5ADZA 4LF7I 3LNUA 3JU0A 1J5EE 1B63A 1KIJA 2FV4B 3OTOE 1ZBQA 3T1YI 4JI5I 3ADIA 2DEIA 1DI2A 2ZITA 2DB2A 4IZJA 2L33A 1NZ0A 3FIGA 4DR5E 2UU9E 4F9AB 1XMOI 4P52A 1Z0GA 2BM0A 1H74A 2V88A 3ADJA 1N32E 2UXBE 4DR7E 2O1TA 1HNZI 1WHQA 2DMYA 2M1SA 2JY9A 4L8NA 4GEQB 3Q1QA 1PVGA 2O1UA 2HKEA 2LUPB 4DV4I 3PYGA 4BS9A 2Z5BA 3ZKDA 2VF3A 3QT8A 3H4LA 4OX9E 2OI2A 1XNQI 2CPNA 2BM1A 1OJ4A 1FJGI 5IWAE 1X49A 2NA2A 4LFAI 3QT7A 4MYTA 1STUA 3HULA 1Z5BA 3F6GA 4LFCE 1WHNA 4MYUA 4ED4A 4B3RE 1A6FA 2Z5CB 3WU4A 4DV3E 2L2MA 4DR4I 4JYAI 3IWBA 1KTVA 1ZM2A 4DR6I 3VYYA 2B7VA 3ZM7A 4HACA 4K0KI 1N0VC 1DQ3A 3ADGA 4JI4E 2LMZA 4X65E 3J7Yp 4B3TI 5LMNE 4JI8E 2Q2EB 5LMUE 3T1HI 4WUCA 1RR9A 4PRVA 2VE7C 4HXZA 4ZVIA 2HFUA 3MSWA 2DEJA 1ZXMA 4DV5I 4WUDA 4F9BB 3J7AM 1YYOA 2UUAE 1HR0E 4JG4A 1H7SA 1N33E 1GQEA 3HQ1A 4YY3E 1UHZA 4JI7I 1Y4SA 4DR2E 1Z0BA 4IZKA 4LF5E 3J80C 4JI2E 3B78A 4DPTA 1ZM4A 1HR0I 1N33I 4DV7I 2VF1A 4LU9A 4DUZE 4DPXA 3PYFA 3AUZA 2EFGA 1N34I 1FKAE 4JI0E 5A2QC 1KKHA 2L3CA 3QT6A 1IBLI 2V8PA 2L92A 5AE2A 4F9CB 4DPWA 4JI6I 2V86A 4DUZI 4KQVA 4USMA 4HYMA 2K4VA 2L2NA 2IOPA 3ZKBA 3IWDA 2CZ9A 4LF7E 2GS8A 3PRYA 3C4TA 4F54A 3LMLA 2JOXA 3T1YE 4JI5E 4LF8I 2PNMA 2VQFI 4FW9A 3JTZA 4M30A 1YZ9A 2LTSA 1KVKA 2V85A 1X48A 1XMOE 4YHHI 5L3JA 1XMQI 1Z0VA 2F4VI 2E5LI 4OOGC 5AASA 2EZ6A 2IHR1 4KZSA 3B8HA 1HNZE 2O1WA 4IZJB 4X66E 2WW4A 3PYEA 4I8OA 2LE2A 1QZRA 1RQ0A 5IT9C 4B3MI 1IBKI 4DV4E 2NPFA 2UUCI 1XNRE 2HK3A 1O0WA 1USUA 1IBMI 4GKJI 4N3OA 4X8WA 4X66I 5BR8I 1XNQE 4B3SI 4LF6I 1RC7A 3WU6A 2R3VA 1FJGE 1T4OA 4LFBI 2J7KA 1XNRI 4IZJD 3B82A 5GMEA 1N36I 2JWOA 4LFAE 4DUYI 2Z5BB 3J81C 4Q28A 4WFTA 1ZM3A 1Z5CA 4TUIA 4PRXA 3J80Q 4DR1I 4DR4E 4DV2I 4JYAE 3GONA 4URLA 4DR6E 4EMDA 2MDRA 3HXLA 3HJCA 3ADLA 2MC5A 2YT4A 4K0KE 3DF6A 2B9DA 4BC7A 4GKKI 4B3TE 2E1RA 4DU7A 5A2QQ 2RS6A 2RS7A 3T1HE 2VQEI 2HHHE 2G7HA 1QU6A 1Z0EA 2UUBI 4DR3E 4HACB 4USKA 2DSYA 1EA6A 4Z7CA 4X62I 4DV5E 2RSMA 4BBYA 2B3TB 1MX0A 2HHHI 3ZZ0A 4DR3I 2CGEA 1H73A 4XTJA 4JI7E 3PYDA 1HNWI 3QT5A 2L6MA 2V8QB 1UEKA 3K17A 2V2QA 4M0VA 4DV7E 2V2VA 1WUUA 4DV6I 4KHPI 2PNLA 1N34E 4IZKB 2HKJA 3F6HA 4L5NC 3D4JA 2ZM6I 1IBLE 4LTYA 1NHJA 3K85A 3LLHA 1ZXNA 2E1MA 4DV1E 3F0NA 3ZZTA 4JI6E 4NXMI 2V34A 2DIXA 4JI1I 4AQYI 1FNMA 1Z0CA 2GQ0A 5IT9Q 3Q6MA 5AE1A 2ODRC 2Z5EA 4FWHA 3HTXA 3Q6NA 4DV1I 1SR9A 4DXLA 3C4BA 3WU5A 1S16A 1GZ6A 1N0UA 4LF8E 2VQFE 3J81Q 4LF9I 1DARA 2UXDI 1USVA 1Y4UA 4PU9A 1EKZA 2X7IA 2JR1A 2R42A 2UXCI 1Y6ZA 1D6TA 4YHHE 1XMQE 4NXNI 4M2ZA 4DMIA 2EWLA 2E5LE 2F4VE 4DU8A 2JVAA 4P78A 4FWDA 2V83A 1H7UA 4LF4I 3P06A 1J26A 2N3HA 2LUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M E;  5FLX C;  1IBK E;  5GMD A;  2UUC E;  1X47 A;  4R1F A;  1IBM E;  4GKJ E;  5BR8 E;  4B3S E;  4LF6 E;  1PKP A;  2LJH A;  3CWV A;  4LFB E;  2HFS A;  4DPY A;  3V5R A;  1N36 E;  4RPF A;  4DUY E;  4JI3 I;  1Z59 A;  4JV5 I;  1I94 I;  4DV0 I;  1FWK A;  4DR1 E;  1RRE A;  4DV2 E;  1ZM9 A;  1Z0T A;  1YYK A;  3LPS A;  1J5E I;  4M1K A;  2HK2 A;  1BKN A;  5CFF E;  3OTO I;  2ZBK B;  4GKK E;  2VQE E;  5LL6 R;  4UTG A;  4DR5 I;  2UUB E;  2UU9 I;  1HNX E;  4X62 E;  1N32 I;  2UXB I;  4DR7 I;  3JAM C;  1XHK A;  1NHI A;  1Z0W A;  1HNX I;  1HNW E;  4HY1 A;  4OX9 I;  4FWG A;  1U2R A;  4DV6 E;  2A2D A;  4KHP E;  5IWA I;  2RTX A;  3K1J A;  3P1X A;  2NUE A;  4I3H A;  2A2C A;  1Z5A A;  2ZM6 E;  1FWL A;  4LFC I;  4NXM E;  1EI1 A;  4JI1 E;  4B3R I;  4AQY E;  4DKK A;  5FLX Q;  4DV3 I;  2V2Z A;  2KHX A;  2LBS B;  3V2U C;  4X64 E;  4P7A A;  2N3G A;  4JI4 I;  4X65 I;  1VIS A;  5LMN I;  4JI8 I;  5LMU I;  4FN5 A;  4WYQ B;  1FI4 A;  4X64 I;  4LF9 E;  1ZBT A;  2UXD E;  3WU3 A;  4Z7Y A;  1YYW A;  2LJP A;  2UXC E;  1H72 C;  4NXN E;  2UUA I;  1UIL A;  4YY3 I;  1B62 A;  1T4N A;  3VYX A;  3J7A G;  4DR2 I;  4LF4 E;  1ELO A;  4LF5 I;  4JI2 I;  2B7T A;  4DPU A;  2L2K B;  1S4E A;  3M6A A;  3ZZU A;  1NHH A;  1MU5 A;  2LTR A;  1K47 A;  2LRS A;  3JAM Q;  1PIE A;  2XEX A;  4JI0 I;  2AJ4 A;  2NUF A;  2BV3 A;  2NUG A;  2X36 A;  1MG7 A;  4WUB A;  2L3J A;  4JI3 E;  4JV5 E;  1I94 E;  1T4L B;  3LTO A;  4DV0 E;  4UT4 A;  4LF7 I;  3LNU A;  1J5E E;  1B63 A;  1KIJ A;  3OTO E;  3T1Y I;  4JI5 I;  3ADI A;  2DEI A;  1DI2 A;  2ZIT A;  2DB2 A;  2L33 A;  1NZ0 A;  4DR5 E;  2UU9 E;  1XMO I;  4P52 A;  1Z0G A;  2BM0 A;  1H74 A;  3ADJ A;  1N32 E;  2UXB E;  4DR7 E;  1HNZ I;  1WHQ A;  2DMY A;  2JY9 A;  3Q1Q A;  1PVG A;  2HKE A;  2LUP B;  4DV4 I;  3PYG A;  3ZKD A;  2VF3 A;  3QT8 A;  3H4L A;  4OX9 E;  2OI2 A;  1XNQ I;  2CPN A;  2BM1 A;  1OJ4 A;  1FJG I;  5IWA E;  1X49 A;  2NA2 A;  4LFA I;  3QT7 A;  4MYT A;  1STU A;  3HUL A;  1Z5B A;  4LFC E;  1WHN A;  4MYU A;  4ED4 A;  4B3R E;  1A6F A;  3WU4 A;  4DV3 E;  2L2M A;  4DR4 I;  4JYA I;  1KTV A;  1ZM2 A;  4DR6 I;  3VYY A;  2B7V A;  3ZM7 A;  4HAC A;  4K0K I;  1N0V C;  3ADG A;  4JI4 E;  4B3T I;  4X65 E;  3J7Y p;  5LMN E;  4JI8 E;  2Q2E B;  5LMU E;  3T1H I;  4WUC A;  1RR9 A;  4PRV A;  4HXZ A;  4ZVI A;  2HFU A;  2DEJ A;  1ZXM A;  4DV5 I;  4WUD A;  3J7A M;  1YYO A;  2UUA E;  1HR0 E;  4JG4 A;  1H7S A;  1N33 E;  1GQE A;  4YY3 E;  1UHZ A;  4JI7 I;  4DR2 E;  1Z0B A;  4LF5 E;  3J80 C;  4JI2 E;  3B78 A;  4DPT A;  1ZM4 A;  1HR0 I;  1N33 I;  4DV7 I;  4DUZ E;  4DPX A;  3PYF A;  1N34 I;  2EFG A;  1FKA E;  4JI0 E;  3QT6 A;  1KKH A;  2L3C A;  5A2Q C;  1IBL I;  2V8P A;  4DPW A;  4JI6 I;  4DUZ I;  4KQV A;  4USM A;  4HYM A;  2L2N A;  3ZKB A;  2CZ9 A;  4LF7 E;  2GS8 A;  3C4T A;  3T1Y E;  4JI5 E;  4LF8 I;  2VQF I;  4FW9 A;  4M30 A;  1YZ9 A;  2LTS A;  1KVK A;  1X48 A;  1XMO E;  4YHH I;  5L3J A;  1XMQ I;  1Z0V A;  2F4V I;  2E5L I;  4OOG C;  2EZ6 A;  2IHR 1;  3B8H A;  1HNZ E;  4X66 E;  2WW4 A;  3PYE A;  1QZR A;  4B3M I;  1RQ0 A;  5IT9 C;  1IBK I;  4DV4 E;  2NPF A;  2UUC I;  1XNR E;  2HK3 A;  1O0W A;  1IBM I;  4GKJ I;  4X8W A;  4X66 I;  5BR8 I;  1XNQ E;  4B3S I;  4LF6 I;  1RC7 A;  3WU6 A;  2R3V A;  1FJG E;  1T4O A;  4LFB I;  2J7K A;  1XNR I;  5GME A;  3B82 A;  1N36 I;  4LFA E;  4DUY I;  3J81 C;  4WFT A;  1ZM3 A;  1Z5C A;  4PRX A;  3J80 Q;  4DR1 I;  4DR4 E;  4DV2 I;  4JYA E;  3GON A;  4URL A;  4DR6 E;  4EMD A;  2MDR A;  3ADL A;  2YT4 A;  4K0K E;  4GKK I;  4B3T E;  2E1R A;  4DU7 A;  5A2Q Q;  2RS6 A;  2RS7 A;  3T1H E;  2VQE I;  2HHH E;  1Z0E A;  1QU6 A;  2UUB I;  4DR3 E;  4HAC B;  4USK A;  1EA6 A;  4Z7C A;  4X62 I;  4DV5 E;  2RSM A;  2B3T B;  1MX0 A;  2HHH I;  3ZZ0 A;  4DR3 I;  1H73 A;  4XTJ A;  4JI7 E;  3PYD A;  1HNW I;  3QT5 A;  1UEK A;  3K17 A;  2V2Q A;  4DV7 E;  2V2V A;  1WUU A;  4DV6 I;  4KHP I;  1N34 E;  2HKJ A;  3D4J A;  2ZM6 I;  1IBL E;  1NHJ A;  3LLH A;  1ZXN A;  4DV1 E;  3F0N A;  3ZZT A;  4JI6 E;  4NXM I;  2V34 A;  2DIX A;  4JI1 I;  4AQY I;  1FNM A;  1Z0C A;  5IT9 Q;  4FWH A;  3HTX A;  4DV1 I;  4DXL A;  3C4B A;  3WU5 A;  1S16 A;  1N0U A;  4LF8 E;  2VQF E;  3J81 Q;  4LF9 I;  1DAR A;  2UXD I;  4PU9 A;  1EKZ A;  2X7I A;  2R42 A;  2UXC I;  1D6T A;  4YHH E;  1XMQ E;  4NXN I;  4M2Z A;  2F4V E;  2E5L E;  4DU8 A;  2JVA A;  4FWD A;  1H7U A;  4LF4 I;  1J26 A;  2N3H A;  2LUQ A; 
#chains in the Genus database with same CATH topology
 4IFD E;  4O5G A;  5FLX C;  4B3M E;  1IBK E;  5GMD A;  2FGG A;  3VK6 A;  2UUC E;  2C39 A;  1Y5Y A;  2YTJ A;  2EMF A;  1X47 A;  4R1F A;  1IBM E;  4BHB A;  4GKJ E;  4O43 A;  5BR8 E;  2EPX A;  1ZU1 A;  1XXE A;  2EMX A;  4B3S E;  4LF6 E;  2CSH A;  5T6J A;  5KL5 A;  2EOX A;  2E72 A;  1PKP A;  2LJH A;  1T38 A;  3CWV A;  4LFB E;  2HFS A;  4DPY A;  3V5R A;  3HKM A;  2PNZ B;  2IER A;  5JEA F;  1N36 E;  4RPF A;  4DUY E;  2JE6 B;  4JI3 I;  2WZO A;  1Z59 A;  3EPL A;  5JEA E;  1I94 I;  4JV5 I;  4U3B A;  2EN7 A;  2EOM A;  4BA1 B;  4DV0 I;  2EQ3 A;  1FWK A;  4DR1 E;  1RRE A;  4DV2 E;  2EM3 A;  4BCA A;  1Z0T A;  1ZM9 A;  1SFE A;  5K36 B;  1YYK A;  4P7D A;  4MLV A;  3LPS A;  1TF3 A;  1J5E I;  4M1K A;  2HK2 A;  4NZV A;  1BKN A;  3NZK A;  5CFF E;  3OTO I;  4AID A;  2ZBK B;  2MKD A;  3P3E A;  2L8T A;  4GKK E;  2J7J A;  2CG9 A;  2M9A A;  3ZOQ B;  4X9J A;  2M4I A;  5LL6 R;  2HJJ A;  2VQE E;  3KRN A;  1YSA C;  4UTG A;  4DR5 I;  2UUB E;  2ELY A;  2UU9 I;  3GCM A;  5F3W A;  1HNX E;  1R6M A;  4HTG A;  4FW5 A;  4X62 E;  1E3H A;  4MU1 A;  1N32 I;  2UXB I;  4WSP A;  2EOI A;  3JAM C;  4DR7 I;  2KON A;  4QNJ A;  5K36 D;  1XHK A;  5C0X C;  1NHI A;  3K6Q A;  3U1Y A;  2JOB A;  3M7N D;  1Z0W A;  2EM9 A;  1HNX I;  5C0X A;  1WXR A;  4BHC A;  2V87 A;  2F1D A;  3OML A;  4R2S A;  3GME A;  1P47 A;  1HNW E;  1AAY A;  4HY1 A;  5JEA B;  2JEA A;  4IFD D;  2H36 X;  1UBD C;  2O1V A;  4OX9 I;  4FWG A;  1U2R A;  2F8B A;  5DNY A;  4DV6 E;  4KHP E;  2A2D A;  2Z5C A;  4OO1 C;  5IWA I;  2BB8 A;  2RTX A;  3K1J A;  2EMA A;  3P1X A;  2IOQ A;  2NUE A;  4I3H A;  2A2C A;  3EPK A;  4FK5 C;  1Z5A A;  3M99 B;  2ZM6 E;  1FWL A;  4OO1 A;  5FWK A;  2WBT A;  2JYA A;  4LFC I;  4R03 A;  2EPU A;  2RSI A;  2EMG A;  4NXM E;  1EI1 A;  4JI1 E;  4B3R I;  3HPS A;  4DKK A;  4AQY E;  5FLX Q;  4DV3 I;  1A1L A;  4R8O A;  2V2Z A;  2KHX A;  1IQS A;  2LBS B;  3V2U C;  2GO4 A;  4BA2 A;  4MU0 A;  3KZZ A;  4X64 E;  4P7A A;  2MC6 A;  1IMU A;  2N3G A;  3IWC A;  2EMY A;  4JI4 I;  1EH8 A;  2N8X A;  4X65 I;  1VIS A;  5LMN I;  4J8Z A;  5EL9 A;  2C38 A;  4JI8 I;  5LMU I;  3HPZ A;  4FN5 A;  2YTF A;  2Q8U A;  1PJT A;  4WYQ B;  2BR2 B;  1FI4 A;  1PJQ A;  2EOE A;  4FW3 A;  4LF9 E;  4X64 I;  1ZBT A;  3H1C A;  2YRM A;  2UXD E;  3M85 G;  5DNX A;  2GLI A;  3WU3 A;  2AE8 A;  4LPF A;  4Z7Y A;  1YYW A;  5AE3 A;  2LJP A;  1X6H A;  1TF6 A;  2UXC E;  3L7Z A;  3PS3 A;  5ELW A;  4FW7 A;  1H72 C;  3RMP A;  4NXN E;  2UUA I;  1UIL A;  2V89 A;  2EM7 A;  2YZT A;  4YY3 I;  1B62 A;  3AV0 A;  1T4N A;  2EQ1 A;  3J7A G;  2YTO A;  3VYX A;  4DR2 I;  1A1J A;  4LF4 E;  1ELO A;  4LF5 I;  1YUJ A;  4JI2 I;  2B7T A;  4DPU A;  2ENA A;  2L2K B;  3UHM A;  1S4E A;  3M6A A;  4BC9 A;  1EH6 A;  3DJW A;  1NHH A;  3ZZU A;  2DLQ A;  4ZYD A;  4WPY A;  2EOH A;  2ODR D;  4WSG A;  1MU5 A;  5DRP A;  2JPA A;  1IQO A;  4MQY A;  2LTR A;  1Z1B A;  1K47 A;  2JT2 A;  2LRS A;  1JK2 A;  3JAM Q;  1PIE A;  2XEX A;  2KOU A;  4TUG A;  4JI0 I;  3BGH A;  2YSP A;  2FTX B;  4BMJ A;  2JP9 A;  2AJ4 A;  2NUF A;  2EN2 A;  1PDA A;  2RPC A;  2BV3 A;  2C39 B;  2NUG A;  2YRH A;  4OZE A;  3H09 A;  2JEB A;  2X36 A;  1HK7 A;  3KWR A;  1MG7 A;  4WUB A;  1T39 A;  2L3J A;  4JI3 E;  4JV5 E;  1I94 E;  1UDS A;  1EH7 A;  5C0X F;  3ECR A;  2PO2 A;  2EM6 A;  2JXP A;  1T4L B;  3LTO A;  4DV0 E;  2NN6 C;  5C0X E;  2M7Q A;  4UT4 A;  1A1K A;  5ADZ A;  4NBQ A;  4LF7 I;  2R76 A;  3JU0 A;  4RH8 A;  1J5E E;  1B63 A;  2FV4 B;  3EQ1 A;  1KIJ A;  2BBG A;  1UDN A;  2NN6 A;  3OTO E;  1ZBQ A;  1NEI A;  2ENH A;  3T1Y I;  4JI5 I;  1YFH A;  3ADI A;  2EM5 A;  3GLL A;  2DEI A;  1DI2 A;  2ZIT A;  2DB2 A;  1P42 A;  4IZJ A;  5DRO A;  3L00 A;  2L33 A;  2PRT A;  2WBS A;  4OO1 F;  1NZ0 A;  3FIG A;  4DR5 E;  1AH5 A;  2ENC A;  2EL4 A;  2UU9 E;  2DLK A;  4F9A B;  4P52 A;  1XMO I;  1Z0G A;  2EOS A;  2BM0 A;  1H74 A;  2V88 A;  2YTP A;  2YTN A;  3ADJ A;  1N32 E;  2UXB E;  4DR7 E;  2O1T A;  1HNZ I;  2LJU A;  1WHQ A;  2DMY A;  1KYQ A;  2M1S A;  2EE8 A;  2JY9 A;  4L8N A;  2EL5 A;  4GEQ B;  2EPZ A;  1PVG A;  3Q1Q A;  2EM0 A;  2O1U A;  1QNT A;  4F6M A;  2HKE A;  2LUP B;  4DV4 I;  2WNR A;  2DGC A;  3PYG A;  1Y60 A;  4BS9 A;  2Z5B A;  3ZKD A;  1BBO A;  1B69 A;  2VF3 A;  3QT8 A;  3H4L A;  1JK1 A;  2MKN A;  4OX9 E;  2OI2 A;  1XNQ I;  2CPN A;  1GTK A;  2BM1 A;  2EPR A;  1OJ4 A;  5C0X B;  1FJG I;  2EM2 A;  5IWA E;  5IV8 B;  1X49 A;  2NA2 A;  4LFA I;  2EOZ A;  2EPO A;  3QT7 A;  2JEA B;  4MYT A;  1L4S A;  1STU A;  3HUL A;  1Z5B A;  3QG5 C;  3F6G A;  5EKW A;  4LFC E;  4N4R B;  1WHN A;  4MYU A;  4ED4 A;  4B3R E;  2EN3 A;  1A6F A;  2Z5C B;  3WU4 A;  4DV3 E;  2L2M A;  4DR4 I;  4FW6 A;  4JYA I;  2WBU A;  3IWB A;  4R2A A;  1KTV A;  1ZM2 A;  4DR6 I;  3P3G A;  4OO1 B;  3VYY A;  2B7V A;  1DGC A;  3ZM7 A;  2ADR A;  4HAC A;  4K0K I;  5C0X D;  2CVE A;  1N0V C;  4MDT A;  2I13 A;  4LCG A;  2YTI A;  1DQ3 A;  3ADG A;  4JI4 E;  2LMZ A;  5KL4 A;  4X65 E;  3J7Y p;  5LMN E;  4B3T I;  4JI8 E;  2Q2E B;  5LMU E;  3T1H I;  5JEA D;  1OYS A;  4WUC A;  1RR9 A;  2PO0 A;  2EML A;  4PRV A;  2VE7 C;  4HXZ A;  4LOM A;  4BA2 B;  4ZVI A;  1BB8 A;  2HFU A;  2YTQ A;  3MSW A;  2LVH A;  4ZYE A;  2DEJ A;  1ZXM A;  4DV5 I;  4MLQ A;  4Q35 B;  4R2D A;  1E3P A;  1UDQ A;  4WUD A;  4F9B B;  5A6K A;  2C38 B;  2CTD A;  3PS2 A;  3J7A M;  1YYO A;  2R1F A;  4RHB B;  1HR0 E;  2UUA E;  1H7S A;  2GHF A;  4JG4 A;  1N33 E;  1GQE A;  3HQ1 A;  4R2Q A;  2EPK X;  2BA0 G;  1BBG A;  4YY3 E;  1UHZ A;  4JI7 I;  1UDO A;  1Y4S A;  4DR2 E;  1Z0B A;  2NN6 F;  4IZK A;  4LF5 E;  2I9I A;  3L7Z B;  2DRP A;  5KL2 A;  3J80 C;  3M85 D;  4JI2 E;  1A1F A;  3B78 A;  3CDJ A;  4DPT A;  1R6L A;  2WP8 A;  1ZM4 A;  2NN6 E;  2WP8 B;  1HR0 I;  1N33 I;  4R2C A;  4MU3 A;  4DV7 I;  2EP3 A;  2VF1 A;  2EMZ A;  4LU9 A;  1ZR9 A;  2EOF A;  4DUZ E;  4KWY A;  4DPX A;  3PYF A;  3AUZ A;  2EFG A;  1N34 I;  2C37 A;  1FKA E;  4JI0 E;  2C37 B;  4MU4 A;  5A2Q C;  1KKH A;  2L3C A;  1YH8 A;  3QT6 A;  1IBL I;  2V8P A;  2EOR A;  1X6E A;  2L92 A;  5AE2 A;  4AM3 A;  4F9C B;  4DPW A;  4JI6 I;  2V86 A;  5A6B A;  5DNL A;  1TN9 A;  4DUZ I;  2YU8 A;  2YU5 A;  3TQM A;  3B4T A;  2VRD A;  4KQV A;  3BID A;  2EN8 A;  4USM A;  2EPP A;  2EMI A;  3MHH C;  4HYM A;  2K4V A;  2L2N A;  3PS1 A;  2IOP A;  3ZKB A;  2EMC A;  3IWD A;  2CZ9 A;  2EPA A;  4LF7 E;  2JEB B;  2EJ4 A;  2GS8 A;  2EPM X;  5A6A A;  5DRQ A;  3PRY A;  3C4T A;  4F54 A;  2EMH A;  3LML A;  2JOX A;  3T1Y E;  4JI5 E;  3VHT B;  4IS1 C;  2PO2 B;  4U3D A;  5KL6 A;  4LF8 I;  2PNM A;  2VQF I;  1WRJ A;  1WJP A;  2EMB A;  2EQ0 A;  4FW9 A;  4F6N A;  3JTZ A;  3DD6 A;  4IFD F;  4M30 A;  1YZ9 A;  2LTS A;  1KVK A;  2V85 A;  1X48 A;  1XMO E;  2A25 A;  2NN6 B;  2K7I A;  4M9V C;  4IS9 A;  4LCF A;  5L3J A;  4FW4 A;  4YHH I;  1Z0V A;  1XMQ I;  2F4V I;  2E5L I;  4OOG C;  2PO1 A;  5AAS A;  2EZ6 A;  2PO1 B;  2IHR 1;  4R2R A;  3B8H A;  4KZS A;  2LCE A;  1KJK A;  1HNZ E;  2LV2 A;  4R2P A;  4R2E A;  1MEY C;  2O1W A;  2VES A;  2EOQ A;  4IZJ B;  4O24 A;  4X66 E;  2YTE A;  2WW4 A;  4QNK A;  3PYE A;  4I8O A;  2LE2 A;  1QZR A;  1RQ0 A;  5IT9 C;  4B3M I;  4O4K A;  1IBK I;  3C6K A;  4DV4 E;  4OO1 E;  2NPF A;  2UUC I;  2EM4 A;  2PNZ A;  2YTG A;  1XNR E;  2HK3 A;  1G2D C;  1O0W A;  1USU A;  2JE6 A;  1IBM I;  1F2I G;  4N3O A;  4GKJ I;  4X8W A;  4X66 I;  5BR8 I;  1XNQ E;  2NN6 D;  3BBG A;  4B3S I;  4LF6 I;  5K36 C;  1RC7 A;  4J3D A;  3WU6 A;  4BA1 A;  1G2F C;  1FJG E;  1T4O A;  2R3V A;  4LFB I;  1OYR A;  1LLM C;  2J7K A;  2WNR B;  1XNR I;  4IZJ D;  3B82 A;  5GME A;  1N36 I;  2JWO A;  3MHS C;  4LFA E;  4DUY I;  2Z5B B;  1MGT A;  5K36 A;  3J81 C;  2CT1 A;  4Q28 A;  4WFT A;  2EPL X;  1NCS A;  1UN6 B;  1ZM3 A;  1Z5C A;  4TUI A;  4PRX A;  4IFD C;  2EL6 A;  3J80 Q;  1RHY A;  4DR1 I;  5KL7 A;  4DR4 E;  4DV2 I;  4JYA E;  3GON A;  4URL A;  4DR6 E;  4EMD A;  4IFD A;  2MDR A;  4IFD B;  3HXL A;  3HJC A;  3ADL A;  2MC5 A;  3C6M A;  2YT4 A;  4K0K E;  3DF6 A;  5LLQ A;  3LNU A;  2B9D A;  4BC7 A;  4OKG A;  4ZYH A;  3EPJ A;  4GKK I;  5IXM B;  4B3T E;  2E1R A;  4DU7 A;  5A2Q Q;  3M7N G;  2EOY A;  2RS6 A;  2RS7 A;  3T1H E;  2ELZ A;  5A69 A;  2DMI A;  2VQE I;  4WXD A;  3BF2 A;  1YPN A;  2HHH E;  2G7H A;  1QU6 A;  1Z0E A;  2UUB I;  5JEA C;  4DR3 E;  4HAC B;  4USK A;  2DSY A;  2NAB A;  4WX9 A;  1EA6 A;  2J65 A;  4Z7C A;  4X62 I;  4DV5 E;  5AC5 A;  1ZAA C;  2EOJ A;  2RSM A;  4BBY A;  5JEA A;  1X5W A;  2B3T B;  4IJD A;  1A1I A;  2PO0 B;  1MX0 A;  3UK3 C;  3EPH A;  2HHH I;  5A6J A;  3ZZ0 A;  4DR3 I;  2CGE A;  2YRK A;  1H73 A;  2HC5 A;  4XTJ A;  4JI7 E;  1YHC A;  1A1H A;  3PYD A;  4LCH A;  1HNW I;  3THO B;  5KL3 A;  5AC4 A;  3QT5 A;  2L6M A;  2V8Q B;  3U1K A;  1UEK A;  3K17 A;  2YTD A;  4OO1 D;  1X3C A;  4F2J C;  2BA1 G;  4HEI A;  2V2Q A;  4M0V A;  4DV7 E;  2V2V A;  1WUU A;  1RMD A;  4DV6 I;  4KHP I;  2EOO A;  4ZYG A;  2PNL A;  2BA1 D;  1N34 E;  2EN1 A;  2BA0 D;  4IZK B;  2HKJ A;  3F6H A;  4L5N C;  3D4J A;  2LT7 A;  3CDI A;  2ZM6 I;  1IBL E;  4LTY A;  1NHJ A;  2EPN A;  2EN6 A;  3K85 A;  3LLH A;  4NHR A;  1ZXN A;  2E1M A;  4DV1 E;  3F0N A;  3ZZT A;  4JI6 E;  4NXM I;  2V34 A;  2YPN A;  1YUI A;  2DIX A;  4JI1 I;  2EMK A;  4AQY I;  1FNM A;  1Z0C A;  2GQ0 A;  5IT9 Q;  2YSO A;  3Q6M A;  2EN4 A;  5AE1 A;  5TSE A;  2MDG A;  2ODR C;  2Z5E A;  3P3C A;  2BR2 A;  4FWH A;  3HTX A;  3Q6N A;  1A1G A;  2WCC 3;  1OYP A;  4DV1 I;  1SR9 A;  4DXL A;  2LO3 A;  3C4B A;  4AIM A;  2GPI A;  3THN A;  3WU5 A;  1PJS A;  1S16 A;  1GZ6 A;  1N0U A;  5DRR A;  4GQU A;  1N3G A;  3P76 A;  4LF8 E;  2GO3 A;  4ISA A;  1X6F A;  2EMW A;  2D9H A;  2VQF E;  2EM8 A;  3J81 Q;  1DAR A;  4LF9 I;  5K36 F;  2UXD I;  1USV A;  4WXC A;  1VI7 A;  2YWQ A;  1Y4U A;  2O3Z A;  1EKZ A;  2IES A;  4PU9 A;  2X7I A;  2JR1 A;  5K36 E;  2R42 A;  2UXC I;  1Y6Z A;  1D6T A;  4YHH E;  1XMQ E;  4NXN I;  4M2Z A;  2EPC A;  2EWL A;  4DMI A;  2E5L E;  2F4V E;  4DU8 A;  2RQL A;  2JVA A;  4P78 A;  4GZN C;  2HGH A;  3KZY A;  4FWD A;  5A6B D;  2V83 A;  1H7U A;  4LF4 I;  3P06 A;  1J26 A;  2N3H A;  2LUQ A; 
#chains in the Genus database with same CATH homology
 5FLX C;  4B3M E;  1IBK E;  5GMD A;  2FGG A;  3VK6 A;  2UUC E;  1X47 A;  4R1F A;  1IBM E;  4GKJ E;  5BR8 E;  4B3S E;  4LF6 E;  5T6J A;  1PKP A;  2LJH A;  3CWV A;  4LFB E;  2HFS A;  4DPY A;  3V5R A;  1N36 E;  4RPF A;  4DUY E;  4JI3 I;  2WZO A;  1Z59 A;  4JV5 I;  1I94 I;  4DV0 I;  1FWK A;  4DR1 E;  1RRE A;  4DV2 E;  1ZM9 A;  4BCA A;  1Z0T A;  1YYK A;  4P7D A;  3LPS A;  1J5E I;  4M1K A;  2HK2 A;  1BKN A;  5CFF E;  3OTO I;  2ZBK B;  2L8T A;  4GKK E;  2CG9 A;  3ZOQ B;  2M4I A;  5LL6 R;  2VQE E;  4UTG A;  4DR5 I;  2UUB E;  2UU9 I;  5F3W A;  1HNX E;  4X62 E;  1N32 I;  2UXB I;  4WSP A;  4DR7 I;  3JAM C;  2KON A;  1XHK A;  1NHI A;  3K6Q A;  2JOB A;  1Z0W A;  1HNX I;  1WXR A;  2V87 A;  3OML A;  1HNW E;  4HY1 A;  2H36 X;  2O1V A;  4OX9 I;  4FWG A;  1U2R A;  2F8B A;  5DNY A;  4DV6 E;  4KHP E;  2A2D A;  2Z5C A;  5IWA I;  2RTX A;  3K1J A;  3P1X A;  2IOQ A;  2NUE A;  4I3H A;  2A2C A;  1Z5A A;  2ZM6 E;  1FWL A;  5FWK A;  4LFC I;  4R03 A;  4NXM E;  1EI1 A;  4JI1 E;  4B3R I;  3HPS A;  4DKK A;  4AQY E;  5FLX Q;  4DV3 I;  4R8O A;  2V2Z A;  2KHX A;  2LBS B;  3V2U C;  4X64 E;  4P7A A;  2MC6 A;  2N3G A;  3IWC A;  4JI4 I;  4X65 I;  1VIS A;  5LMN I;  4J8Z A;  4JI8 I;  5LMU I;  3HPZ A;  4FN5 A;  4WYQ B;  1FI4 A;  4X64 I;  4LF9 E;  1ZBT A;  2UXD E;  3WU3 A;  4Z7Y A;  1YYW A;  5AE3 A;  2LJP A;  2UXC E;  1H72 C;  3RMP A;  4NXN E;  2UUA I;  1UIL A;  2V89 A;  2YZT A;  4YY3 I;  1B62 A;  3AV0 A;  1T4N A;  3J7A G;  3VYX A;  4DR2 I;  4LF4 E;  1ELO A;  4LF5 I;  4JI2 I;  2B7T A;  4DPU A;  2L2K B;  1S4E A;  3M6A A;  4BC9 A;  3ZZU A;  3DJW A;  1NHH A;  4WPY A;  2ODR D;  1MU5 A;  2LTR A;  1K47 A;  2LRS A;  3JAM Q;  1PIE A;  2XEX A;  2KOU A;  4TUG A;  4JI0 I;  2FTX B;  4BMJ A;  2AJ4 A;  2NUF A;  2BV3 A;  2NUG A;  3H09 A;  2X36 A;  1HK7 A;  3KWR A;  1MG7 A;  4WUB A;  2L3J A;  4JI3 E;  4JV5 E;  1I94 E;  1T4L B;  3LTO A;  4DV0 E;  2M7Q A;  4UT4 A;  5ADZ A;  4LF7 I;  3LNU A;  3JU0 A;  1J5E E;  1B63 A;  1KIJ A;  2FV4 B;  3OTO E;  1ZBQ A;  3T1Y I;  4JI5 I;  3ADI A;  2DEI A;  1DI2 A;  2ZIT A;  2DB2 A;  4IZJ A;  2L33 A;  1NZ0 A;  3FIG A;  4DR5 E;  2UU9 E;  4F9A B;  1XMO I;  4P52 A;  1Z0G A;  2BM0 A;  1H74 A;  2V88 A;  3ADJ A;  1N32 E;  2UXB E;  4DR7 E;  2O1T A;  1HNZ I;  1WHQ A;  2DMY A;  2M1S A;  2JY9 A;  4L8N A;  4GEQ B;  3Q1Q A;  1PVG A;  2O1U A;  2HKE A;  2LUP B;  4DV4 I;  3PYG A;  4BS9 A;  2Z5B A;  3ZKD A;  2VF3 A;  3QT8 A;  3H4L A;  4OX9 E;  2OI2 A;  1XNQ I;  2CPN A;  2BM1 A;  1OJ4 A;  1FJG I;  5IWA E;  1X49 A;  2NA2 A;  4LFA I;  3QT7 A;  4MYT A;  1STU A;  3HUL A;  1Z5B A;  3F6G A;  4LFC E;  1WHN A;  4MYU A;  4ED4 A;  4B3R E;  1A6F A;  2Z5C B;  3WU4 A;  4DV3 E;  2L2M A;  4DR4 I;  4JYA I;  3IWB A;  1KTV A;  1ZM2 A;  4DR6 I;  3VYY A;  2B7V A;  3ZM7 A;  4HAC A;  4K0K I;  1N0V C;  1DQ3 A;  3ADG A;  4JI4 E;  2LMZ A;  4X65 E;  3J7Y p;  4B3T I;  5LMN E;  4JI8 E;  2Q2E B;  5LMU E;  3T1H I;  4WUC A;  1RR9 A;  4PRV A;  2VE7 C;  4HXZ A;  4ZVI A;  2HFU A;  3MSW A;  2DEJ A;  1ZXM A;  4DV5 I;  4WUD A;  4F9B B;  3J7A M;  1YYO A;  2UUA E;  1HR0 E;  4JG4 A;  1H7S A;  1N33 E;  1GQE A;  3HQ1 A;  4YY3 E;  1UHZ A;  4JI7 I;  1Y4S A;  4DR2 E;  1Z0B A;  4IZK A;  4LF5 E;  3J80 C;  4JI2 E;  3B78 A;  4DPT A;  1ZM4 A;  1HR0 I;  1N33 I;  4DV7 I;  2VF1 A;  4LU9 A;  4DUZ E;  4DPX A;  3PYF A;  3AUZ A;  2EFG A;  1N34 I;  1FKA E;  4JI0 E;  5A2Q C;  1KKH A;  2L3C A;  3QT6 A;  1IBL I;  2V8P A;  2L92 A;  5AE2 A;  4F9C B;  4DPW A;  4JI6 I;  2V86 A;  4DUZ I;  4KQV A;  4USM A;  4HYM A;  2K4V A;  2L2N A;  2IOP A;  3ZKB A;  3IWD A;  2CZ9 A;  4LF7 E;  2GS8 A;  3PRY A;  3C4T A;  4F54 A;  3LML A;  2JOX A;  3T1Y E;  4JI5 E;  4LF8 I;  2PNM A;  2VQF I;  4FW9 A;  3JTZ A;  4M30 A;  1YZ9 A;  2LTS A;  1KVK A;  2V85 A;  1X48 A;  1XMO E;  4YHH I;  5L3J A;  1XMQ I;  1Z0V A;  2F4V I;  2E5L I;  4OOG C;  5AAS A;  2EZ6 A;  2IHR 1;  4KZS A;  3B8H A;  1HNZ E;  2O1W A;  4IZJ B;  4X66 E;  2WW4 A;  3PYE A;  4I8O A;  2LE2 A;  1QZR A;  1RQ0 A;  5IT9 C;  4B3M I;  1IBK I;  4DV4 E;  2NPF A;  2UUC I;  1XNR E;  2HK3 A;  1O0W A;  1USU A;  1IBM I;  4GKJ I;  4N3O A;  4X8W A;  4X66 I;  5BR8 I;  1XNQ E;  4B3S I;  4LF6 I;  1RC7 A;  3WU6 A;  2R3V A;  1FJG E;  1T4O A;  4LFB I;  2J7K A;  1XNR I;  4IZJ D;  3B82 A;  5GME A;  1N36 I;  2JWO A;  4LFA E;  4DUY I;  2Z5B B;  3J81 C;  4Q28 A;  4WFT A;  1ZM3 A;  1Z5C A;  4TUI A;  4PRX A;  3J80 Q;  4DR1 I;  4DR4 E;  4DV2 I;  4JYA E;  3GON A;  4URL A;  4DR6 E;  4EMD A;  2MDR A;  3HXL A;  3HJC A;  3ADL A;  2MC5 A;  2YT4 A;  4K0K E;  3DF6 A;  2B9D A;  4BC7 A;  4GKK I;  4B3T E;  2E1R A;  4DU7 A;  5A2Q Q;  2RS6 A;  2RS7 A;  3T1H E;  2VQE I;  2HHH E;  2G7H A;  1QU6 A;  1Z0E A;  2UUB I;  4DR3 E;  4HAC B;  4USK A;  2DSY A;  1EA6 A;  4Z7C A;  4X62 I;  4DV5 E;  2RSM A;  4BBY A;  2B3T B;  1MX0 A;  2HHH I;  3ZZ0 A;  4DR3 I;  2CGE A;  1H73 A;  4XTJ A;  4JI7 E;  3PYD A;  1HNW I;  3QT5 A;  2L6M A;  2V8Q B;  1UEK A;  3K17 A;  2V2Q A;  4M0V A;  4DV7 E;  2V2V A;  1WUU A;  4DV6 I;  4KHP I;  2PNL A;  1N34 E;  4IZK B;  2HKJ A;  3F6H A;  4L5N C;  3D4J A;  2ZM6 I;  1IBL E;  4LTY A;  1NHJ A;  3K85 A;  3LLH A;  1ZXN A;  2E1M A;  4DV1 E;  3F0N A;  3ZZT A;  4JI6 E;  4NXM I;  2V34 A;  2DIX A;  4JI1 I;  4AQY I;  1FNM A;  1Z0C A;  2GQ0 A;  5IT9 Q;  3Q6M A;  5AE1 A;  2ODR C;  2Z5E A;  4FWH A;  3HTX A;  3Q6N A;  4DV1 I;  1SR9 A;  4DXL A;  3C4B A;  3WU5 A;  1S16 A;  1GZ6 A;  1N0U A;  4LF8 E;  2VQF E;  3J81 Q;  4LF9 I;  1DAR A;  2UXD I;  1USV A;  1Y4U A;  4PU9 A;  1EKZ A;  2X7I A;  2JR1 A;  2R42 A;  2UXC I;  1Y6Z A;  1D6T A;  4YHH E;  1XMQ E;  4NXN I;  4M2Z A;  4DMI A;  2EWL A;  2E5L E;  2F4V E;  4DU8 A;  2JVA A;  4P78 A;  4FWD A;  2V83 A;  1H7U A;  4LF4 I;  3P06 A;  1J26 A;  2N3H A;  2LUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...