4JI0E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji0E02
2V2QA 1J5EI 2UXDE 3LPSA 1N34I 2YT4A 2NUFA 4JI1E 1FWKA 4LFCI 3B8HA 2L3JA 1KIJA 4MYTA 1IBKE 1OJ4A 4LF9E 4EMDA 3WU6A 1NHHA 3J81Q 1O0WA 4LFBE 1N0VC 2E5LI 4B3SI 2L2MA 4X66E 2UXBE 4LF5I 2ZM6E 4JG4A 4OX9I 3QT8A 4DV7E 3Q1QA 1EA6A 3HTXA 4DU8A 1N34E 4LFCE 1N33I 4LFAI 2LRSA 1RREA 2A2CA 4HY1A 3T1HI 2V34A 3OTOE 2L3CA 3ADJA 4XTJA 2E5LE 1N36E 4URLA 2LJHA 4JI2E 4JI8I 2B7TA 3C4BA 2HKJA 4JI5I 2RS6A 4LF5E 3H4LA 1XMOI 1UILA 4OX9E 2LJPA 4M2ZA 3ZKDA 1WHQA 4DUYE 1VISA 2UUAI 2WW4A 4B3MI 4JV5I 4KQVA 1PKPA 5LL6R 1XMQE 1N33E 2N3GA 5L3JA 1ZM3A 3T1HE 1WHNA 2BM1A 3ADIA 1Z0WA 3ZM7A 3P1XA 2VQEI 3WU5A 4JI7E 2N3HA 4DR6I 3GONA 3JAMC 4HACA 4JI8E 3LLHA 4GKKI 2NA2A 4WUCA 5LMUI 4DV2I 1XMOE 5LMNI 3J7AM 4DV6I 4YY3I 1ELOA 5GMEA 2LUPB 2UUAE 1H73A 4P7AA 3ZZ0A 1RQ0A 2E1RA 4B3ME 1RC7A 4JV5E 1ZM2A 1X48A 2AJ4A 1RR9A 4M30A 3C4TA 1B63A 1XHKA 2JY9A 2V8PA 4GKJE 2GS8A 2VQEE 4JI0E 2DEJA 4WUBA 4DR6E 1ZBTA 2F4VE 1Z0VA 4LF7I 4WUDA 1KVKA 2RTXA 1Z5AA 2B3TB 2CZ9A 4DV2E 2DB2A 3ADLA 2OI2A 4AQYI 4DV6E 1XNQI 4YY3E 4B3RE 4LF4I 3J80Q 4JI4E 4FWHA 1Z59A 4USKA 4JI6E 1Z0CA 2X7IA 5BR8I 4WYQB 1FJGI 1YZ9A 2LTRA 4USMA 1HR0I 1IBLI 3QT5A 1N32I 1PIEA 4DR4I 4LF7E 3J7AG 3LNUA 1J5EE 4NXMI 1HNWI 3M6AA 1J26A 1S4EA 4DPXA 1HNZI 4FWDA 4AQYE 4YHHI 3D4JA 4FW9A 1EKZA 5GMDA 4JI3I 5IWAI 2ZITA 4DU7A 5BR8E 2LUQA 4KHPI 1FJGE 1B62A 4DKKA 5A2QC 4B3SE 1HR0E 1NHIA 2RS7A 1Z0EA 1ZM9A 2DIXA 4DR4E 3ZZUA 4PRVA 2HK2A 4DR3I 3J7Yp 3PYEA 4LF8I 2Q2EB 1HNWE 1KTVA 2HHHI 4DV4I 2UXCI 4LFAE 4ED4A 2J7KA 4JI3E 5IWAE 4DV3I 1S16A 5IT9Q 2EFGA 2NUGA 1YYWA 4HXZA 4KHPE 1X47A 2BV3A 4X62I 1MG7A 4DR1I 2L2KB 2EZ6A 2CPNA 4JI5E 1A6FA 1H7UA 1H74A 4DR3E 2VF3A 1HNXI 2HFUA 4LF8E 1ZXMA 2HHHE 2B7VA 2UXCE 1Z5CA 3J80C 4RPFA 1KKHA 3F0NA 4DV5I 4DV3E 4M1KA 3T1YI 3J81C 1UHZA 3B82A 3ZKBA 4HACB 1K47A 4DR5I 3WU4A 4DUZI 4GKKE 2JVAA 5LMUE 2VQFI 3JAMQ 5LMNE 1MX0A 1ZXNA 1HNXE 1Z5BA 1QU6A 4X66I 1YYKA 4OOGC 1H7SA 4DPWA 4DR7I 2R3VA 1D6TA 2RSMA 4DV5E 3K17A 1FNMA 3T1YE 1GQEA 5FLXQ 3VYXA 4JYAI 1WUUA 1T4NA 3ADGA 4I3HA 3OTOI 4DR5E 2HFSA 4DUZE 1IBMI 4ZVIA 2VQFE 3V5RA 2L33A 1I94I 1T4LB 1N36I 1X49A 1XNQE 1XNRI 2UU9I 4LF4E 1N0UA 4JI2I 4FN5A 1NZ0A 4Z7YA 4B3TI 3K1JA 3HULA 1DI2A 1MU5A 2KHXA 3PYFA 4DPTA 2V2ZA 1Z0BA 4DV1I 4DR7E 1FWLA 4DUYI 4X64I 2V2VA 2UUBI 4DXLA 3VYYA 4UT4A 1IBLE 5IT9C 1XMQI 1N32E 4JYAE 4X8WA 4NXNI 3QT6A 4NXME 4DPYA 1IBME 4Z7CA 4FWGA 4JI7I 1HNZE 2L2NA 1I94E 2HK3A 2A2DA 4YHHE 1XNRE 2UU9E 4K0KI 4LF6I 3PYDA 2LTSA 1T4OA 4B3TE 4X65I 4DV1E 2NPFA 4PRXA 2XEXA 4DPUA 2MDRA 2DMYA 4X64E 2UUBE 4DR2I 4DV0I 3QT7A 2BM0A 2NUEA 1Z0TA 5CFFE 5A2QQ 1FI4A 4GKJI 2HKEA 3ZZTA 1QZRA 1ZM4A 3B78A 2LBSB 4NXNE 4P52A 4JI0I 1U2RA 3PYGA 4R1FA 2F4VI 4UTGA 4DV4E 2UUCI 4K0KE 4LF6E 2UXDI 4X65E 2DEIA 2IHR1 4B3RI 4JI1I 1BKNA 1IBKI 4JI4I 1YYOA 4LF9I 4X62E 4DR1E 4JI6I 3V2UC 4DR2E 4WFTA 2X36A 4DV0E 1H72C 1STUA 4LFBI 3WU3A 2R42A 1Z0GA 5FLXC 1NHJA 1PVGA 1EI1A 1DARA 4MYUA 2UXBI 2ZM6I 2ZBKB 1FKAE 1UEKA 3CWVA 3LTOA 4PU9A 4DV7I 4HYMA 2UUCE
chains in the Genus database with same CATH superfamily
2V2QA 1J5EI 2EOYA 2UXDE 3LPSA 5ADZA 4BBYA 5KL5A 4OO1E 1N34I 2YT4A 2NUFA 3UK3C 2C37A 1A1HA 4JI1E 1FWKA 3B8HA 2L3JA 4LFCI 1KIJA 1LLMC 4MYTA 1RMDA 1ZR9A 4P78A 1IBKE 1OJ4A 4DMIA 5A6BD 4LF9E 1Y4UA 5A6JA 2JEBA 5K36F 2V89A 2I13A 2PO1A 4EMDA 2GPIA 3WU6A 5JEAA 1NHHA 4R2AA 3J81Q 1O0WA 4IFDB 2GO3A 5K36D 1USVA 4LFBE 4LPFA 1N0VC 2E5LI 2LV2A 3BGHA 1PJTA 3CDIA 4B3SI 2AE8A 4F9BB 1X6HA 2L2MA 4X66E 2UXBE 1R6MA 4LF5I 3JU0A 2ZM6E 1A1JA 5C0XD 2EOHA 2R1FA 4JG4A 4OX9I 2ELZA 2ODRC 2WBTA 4DV7E 2CGEA 2VRDA 3QT8A 3HKMA 1OYPA 2YTIA 2EORA 5DNYA 3Q1QA 1EA6A 3HTXA 4DU8A 1N34E 2Z5CB 1L4SA 2Z5EA 4LFCE 2EM5A 4N3OA 1N33I 4LFAI 2LRSA 1RREA 2A2CA 2JOBA 4HY1A 3T1HI 2FGGA 2YTNA 2V34A 3OTOE 2IOPA 1HK7A 2L3CA 3ADJA 2DSYA 4XTJA 3MHSC 2GHFA 2E5LE 4LCGA 4U3DA 3P76A 2O1WA 1N36E 4WSPA 4L5NC 4WPYA 4OO1A 4F6NA 1GZ6A 2WNRB 3NZKA 4URLA 2LJHA 4JI2E 5AC4A 4JI8I 2YTEA 2DLQA 1R6LA 2B7TA 4RHBB 3C4BA 2HKJA 2E1MA 2EQ1A 2L6MA 2M1SA 2RS6A 4LF5E 3H4LA 1XMOI 4JI5I 1BBOA 2NN6B 4RH8A 3L00A 1UILA 4OX9E 2LJPA 4M2ZA 3ZKDA 1WHQA 5LLQA 4DUYE 1VISA 2RPCA 2UUAI 2EMAA 1PJSA 1X5WA 2KONA 2L8TA 2PO2A 3PS3A 2WW4A 4ZYEA 2YU5A 4X9JA 4B3MI 2YTOA 4KQVA 4F2JC 1UDQA 4JV5I 2M4IA 5DNXA 1PKPA 2V86A 3LMLA 5LL6R 4IFDC 2EJ4A 1XMQE 2YWQA 4IFDE 1N33E 2N3GA 3HPSA 2MC5A 2EN8A 5L3JA 1ZM3A 3T1HE 3GMEA 4NHRA 1WHNA 2V87A 2BM1A 2EOZA 3ADIA 1Z0WA 3M7NG 3ZM7A 3P1XA 1IMUA 2VQEI 3WU5A 4JI7E 2EPKX 2N3HA 2PRTA 4DR6I 5IXMB 3GONA 5JEAD 3JAMC 2YRKA 5KL2A 4IZJA 4HACA 2EOIA 3HQ1A 4JI8E 2EMXA 3LLHA 2J65A 2JEAA 4GKKI 2NA2A 4F9AB 4MLQA 4WUCA 1A1FA 3P3CA 5LMUI 4DV2I 1VI7A 5A6AA 1XMOE 5LMNI 1E3PA 3J7AM 2IOQA 4DV6I 3M85D 2EOFA 4YY3I 1ELOA 4GZNC 3KZZA 2EE8A 4P7DA 4HEIA 5GMEA 2PNZA 2LUPB 1BB8A 2UUAE 5DRQA 1H73A 4P7AA 5A6KA 5DRPA 3ZZ0A 1RQ0A 2E1RA 4B3ME 1RC7A 3VHTB 2EWLA 1X48A 2EMCA 2EN1A 4JV5E 2EM6A 1ZM2A 1RR9A 2AJ4A 2PNMA 5K36B 4L8NA 1EH7A 2FTXB 2EOOA 4M30A 2V88A 3C4TA 5F3WA 1B63A 2EMLA 1XHKA 2JYAA 2JY9A 2V8PA 4R2SA 4GKJE 3EPHA 4J3DA 2G7HA 3L7ZA 1G2DC 1MGTA 4BMJA 2GS8A 2BA1D 1YHCA 3ECRA 3KWRA 4O4KA 1N3GA 2VQEE 4JI0E 5C0XB 1Y60A 2DEJA 2VESA 4WUBA 4DR6E 1ZBTA 1RHYA 3FIGA 4OKGA 2YPNA 4R2EA 2F4VE 2MC6A 2NN6E 1Z0VA 4LF7I 3DJWA 4WUDA 1KVKA 2EMWA 2RTXA 1Z5AA 2F1DA 4IFDA 4OO1D 2B3TB 4M0VA 2V85A 2CZ9A 4DV2E 2YSPA 2JE6B 4GEQB 2DB2A 3ADLA 2OI2A 4AQYI 4DV6E 3VK6A 1XNQI 4YY3E 1NEIA 4B3RE 4LF4I 3J80Q 2WBUA 2BBGA 4JI4E 4FWHA 4BA2B 2EM3A 2EM4A 1Z59A 4USKA 4R2DA 4JI6E 1Z0CA 1EH8A 5KL6A 4IZKA 2YTPA 2X7IA 5BR8I 2DRPA 2CVEA 4MU4A 4WYQB 2WCC3 4BC7A 1A1LA 4NZVA 1FJGI 1YZ9A 2LTRA 4F9CB 5C0XF 1DGCA 4OZEA 2HC5A 4USMA 2EQ3A 1ZBQA 2EM2A 2H36X 2Z5CA 1HR0I 3RMPA 4AIDA 1IBLI 1TF6A 3QT5A 5DNLA 1N32I 2EMKA 2F8BA 1PIEA 4DR4I 2J7JA 2EPOA 4R2RA 2YTJA 4BA1A 4LF7E 2JWOA 2EN4A 2WBSA 3J7AG 3LNUA 2Z5BA 4IZJD 1J5EE 4LCHA 5DROA 4NXMI 1HNWI 3M6AA 1J26A 2YTFA 1S4EA 4DPXA 1HNZI 4FWDA 3AUZA 2O1UA 5K36C 4AQYE 4R2CA 4YHHI 5AASA 5K36E 3D4JA 2EM7A 4R2PA 2BR2A 4FW9A 1UDSA 1EKZA 2JOXA 2V83A 5GMDA 2JEBB 2LE2A 4JI3I 2NN6A 2ZITA 5IWAI 4DU7A 5ELWA 2EL4A 5BR8E 4MU0A 2YZTA 3OMLA 5C0XC 2CSHA 2LJUA 2LUQA 2CT1A 2M7QA 5EKWA 1FJGE 1B62A 4KHPI 2C39A 1UDOA 4DKKA 5A2QC 3IWDA 2DGCA 2EPAA 4B3SE 1IQSA 4R2QA 2EMGA 2N8XA 2JR1A 1HR0E 1YSAC 2RQLA 3U1KA 3M99B 1NHIA 2RSIA 2RS7A 1Z0EA 3BBGA 2DIXA 4BHCA 1UDNA 1YH8A 4DR4E 1ZM9A 3PRYA 2HK2A 2CG9A 4PRVA 3ZZUA 3J7Yp 4DR3I 3PYEA 1T38A 2Q8UA 4LF8I 2Q2EB 1HNWE 2DMIA 3BF2A 2EM9A 3PS1A 4M9VC 1KTVA 3M7ND 4IFDD 4HTGA 4WXCA 1A1KA 2HHHI 4DV4I 1NCSA 2YSOA 2JP9A 4LFAE 1YPNA 2UXCI 3HJCA 1T39A 2EOMA 1KYQA 2EPNA 4ZYGA 2O1TA 4ED4A 5JEAF 2EPLX 3THOB 4JI3E 5IWAE 2J7KA 4DV3I 1S16A 4FW6A 1MEYC 2EFGA 2EOQA 5IT9Q 2K7IA 2NUGA 5A6BA 1YYWA 4HXZA 2EOSA 1PDAA 1X47A 3IWCA 3JTZA 4KHPE 2BV3A 4X62I 1MG7A 2ELYA 4DR1I 4FK5C 2WP8A 5K36A 2VF1A 2L2KB 2CPNA 4Q28A 2EZ6A 3DD6A 1AH5A 4JI5E 2EN2A 1A6FA 2YTDA 1H7UA 1H74A 3U1YA 4KZSA 4DR3E 2VF3A 1HNXI 2PNLA 1IQOA 2HFUA 4U3BA 4LF8E 2KOUA 5IV8B 2LVHA 4F54A 1WXRA 1ZXMA 2BB8A 2EOJA 1Z1BA 2D9HA 2HHHE 1SR9A 2EOEA 3GCMA 2C38A 2B7VA 5A69A 5JEAC 1YUJA 2EN6A 3QG5C 2UXCE 1Z5CA 3J80C 4RPFA 1Y6ZA 2GQ0A 1KKHA 5EL9A 2O3ZA 4BHBA 3P3EA 3F0NA 4DV5I 2ENAA 4DV3E 4QNKA 2NABA 3TQMA 4M1KA 3T1YI 2YTQA 3J81C 2NN6D 2EPXA 4AM3A 1UHZA 4OO1F 4BA2A 3B82A 4I8OA 2MDGA 3ZKBA 1P42A 4HACB 1X6FA 2VE7C 1K47A 3KRNA 4FW5A 3WU4A 4MDTA 4DR5I 4DUZI 4GKKE 2EMBA 2JVAA 4FW7A 2JEAB 3C6MA 1UBDC 5LMUE 2VQFI 2EMZA 3JAMQ 3KZYA 5LMNE 3CDJA 4LCFA 3HPZA 4O5GA 4R8OA 1MX0A 2CTDA 5AE3A 3GLLA 1ZXNA 1QNTA 1G2FC 1HNXE 1Z5BA 1QU6A 4X66I 1DQ3A 1OYSA 2HJJA 1YYKA 2LCEA 4AIMA 1OYRA 4OOGC 1H7SA 4BCAA 4DPWA 1Y5YA 4BS9A 3PS2A 4DR7I 1XXEA 2BA0G 3UHMA 2R3VA 3F6GA 1D6TA 2BA1G 2EPCA 1E3HA 2RSMA 4OO1C 3L7ZB 4DV5E 2EPUA 3K17A 5KL4A 1FNMA 2EL5A 1JK2A 3T1YE 2EMYA 2JXPA 1GQEA 2ODRD 3VYXA 5FLXQ 3EQ1A 4O43A 4GQUA 2JPAA 2PO0B 3C6KA 4JYAI 1WUUA 1T4NA 3ADGA 5KL7A 4I3HA 3OTOI 4DR5E 2GLIA 3AV0A 2HFSA 5TSEA 4DUZE 1IBMI 4ZVIA 1AAYA 2EPPA 2ENCA 2VQFE 3B4TA 2L33A 3V5RA 4LU9A 1I94I 3H09A 1T4LB 4WX9A 1X49A 1XNQE 2WNRA 2EMHA 2YRHA 1N36I 1XNRI 2C37B 2UU9I 4LF4E 1N0UA 2WZOA 3ZOQB 4JI2I 4MU1A 4FN5A 1NZ0A 4J8ZA 1WRJA 1WJPA 1B69A 4NBQA 1ZAAC 4Z7YA 4B3TI 3K1JA 2PO1B 3HULA 1DI2A 1MU5A 2EN7A 2KHXA 4N4RB 3PYFA 4ISAA 2EOXA 2E72A 4ZYDA 1Z0BA 2V2ZA 4IZKB 2EM8A 4DR7E 4DPTA 1FWLA 5JEAB 4DUYI 4WXDA 2K4VA 5AE2A 5C0XE 1KJKA 4X64I 2V2VA 4IJDA 2HGHA 2UUBI 4DXLA 2MKDA 3VYYA 4UT4A 2ENHA 1IBLE 4IS9A 5IT9C 4MQYA 2I9IA 1XMQI 1F2IG 1N32E 4ZYHA 4R03A 4IFDF 4JYAE 4X8WA 5DRRA 4NXNI 4BA1B 3QT6A 4NXME 2EP3A 4DPYA 1IBME 4Z7CA 2Z5BB 3MHHC 2EPZA 4FWGA 4JI7I 4F6MA 3HXLA 2LO3A 1HNZE 4Q35B 4MLVA 1JK1A 2LT7A 2L2NA 1I94E 2HK3A 2A2DA 4YHHE 1XNRE 2V8QB 2EQ0A 2UU9E 2EN3A 5T6JA 4K0KI 4LF6I 2BR2B 4BC9A 2DLKA 3PYDA 2LTSA 1T4OA 4WSGA 4B3TE 4X65I 1YFHA 1UN6B 4LTYA 4KWYA 1USUA 4DV1E 2NPFA 2IESA 4PRXA 2A25A 5AC5A 2EL6A 2XEXA 1GTKA 4DPUA 1BBGA 2MDRA 4FW4A 2DMYA 4X64E 2LMZA 2UUBE 2C39B 4OO1B 4DR2I 2EPMX 5AE1A 4DV0I 4MU3A 2FV4B 3QT7A 3K6QA 2BM0A 2NUEA 1Z0TA 5CFFE 4O24A 1P47A 2GO4A 5A2QQ 1FI4A 4GKJI 2HKEA 3ZZTA 1QZRA 1ZM4A 3B78A 2LBSB 4NXNE 5C0XA 4P52A 2YTGA 2YU8A 5FWKA 2PO2B 3P3GA 4JI0I 3THNA 1U2RA 4TUGA 3K85A 2MKNA 3PYGA 4R1FA 2F4VI 4UTGA 4DV4E 2R76A 5JEAE 1SFEA 2UUCI 4K0KE 4LF6E 1TN9A 2NN6F 2UXDI 2JE6A 2EM0A 4X65E 2DEIA 2IHR1 3P06A 3Q6MA 1PJQA 4IS1C 4B3RI 2JT2A 1EH6A 4JI1I 1BKNA 1IBKI 4JI4I 2IERA 2EMFA 1YYOA 4LF9I 4X62E 2EMIA 4IZJB 4DR1E 4LOMA 4JI6I 3V2UC 2EPRA 4WFTA 4TUIA 4DV0E 4DR2E 1A1GA 2WP8B 2X36A 4DV1I 2M9AA 1H72C 2O1VA 3M85G 1STUA 4LFBI 3WU3A 2R42A 3Q6NA 3IWBA 5KL3A 1YUIA 1Z0GA 1ZU1A 5FLXC 1NHJA 1Y4SA 2BA0D 3F6HA 1PVGA 2B9DA 1EI1A 1DARA 4MYUA 3H1CA 3EPLA 1TF3A 4QNJA 1A1IA 2PNZB 2UXBI 1X6EA 2YRMA 3MSWA 2ZM6I 1X3CA 4FW3A 2ZBKB 3DF6A 1FKAE 2PO0A 1UEKA 3BIDA 2NN6C 3CWVA 2ADRA 2L92A 3EPJA 3EPKA 3LTOA 4PU9A 4DV7I 4HYMA 2C38B 2UUCE
chains in the Genus database with same CATH topology
2V2QA 1J5EI 2UXDE 3LPSA 5ADZA 4BBYA 1N34I 2YT4A 2NUFA 4JI1E 1FWKA 4LFCI 3B8HA 2L3JA 1KIJA 4MYTA 1IBKE 4P78A 1OJ4A 4DMIA 4LF9E 1Y4UA 2V89A 4EMDA 3WU6A 1NHHA 3J81Q 1O0WA 1USVA 4LFBE 1N0VC 2E5LI 4B3SI 4F9BB 2L2MA 4X66E 2UXBE 4LF5I 3JU0A 2ZM6E 4JG4A 4OX9I 2ODRC 2CGEA 4DV7E 3QT8A 5DNYA 3Q1QA 1EA6A 3HTXA 4DU8A 1N34E 2Z5CB 2Z5EA 4LFCE 4N3OA 1N33I 4LFAI 2LRSA 1RREA 2A2CA 2JOBA 4HY1A 3T1HI 2FGGA 2V34A 3OTOE 2IOPA 1HK7A 2L3CA 3ADJA 2DSYA 4XTJA 2E5LE 2O1WA 1N36E 4WSPA 4L5NC 4WPYA 1GZ6A 4URLA 2LJHA 4JI2E 4JI8I 2B7TA 3C4BA 2HKJA 2E1MA 2L6MA 2M1SA 2RS6A 4LF5E 3H4LA 1XMOI 4JI5I 1UILA 4OX9E 2LJPA 4M2ZA 3ZKDA 1WHQA 4DUYE 1VISA 2UUAI 2KONA 2L8TA 2WW4A 4B3MI 4JV5I 4KQVA 2M4IA 1PKPA 2V86A 3LMLA 5LL6R 1XMQE 1N33E 2N3GA 3HPSA 2MC5A 5L3JA 1ZM3A 3T1HE 1WHNA 2V87A 2BM1A 3ADIA 1Z0WA 3ZM7A 3P1XA 2VQEI 3WU5A 4JI7E 2N3HA 4DR6I 3GONA 3JAMC 4IZJA 4HACA 3HQ1A 4JI8E 3LLHA 4GKKI 2NA2A 4F9AB 4WUCA 5LMUI 4DV2I 1XMOE 5LMNI 3J7AM 2IOQA 4DV6I 4YY3I 1ELOA 4P7DA 5GMEA 2LUPB 2UUAE 1H73A 4P7AA 3ZZ0A 1RQ0A 2E1RA 4B3ME 1RC7A 4JV5E 2EWLA 1X48A 1ZM2A 2AJ4A 2PNMA 1RR9A 4L8NA 2FTXB 4M30A 2V88A 3C4TA 5F3WA 1B63A 1XHKA 2JY9A 2V8PA 4GKJE 2G7HA 4BMJA 2GS8A 3KWRA 2VQEE 4JI0E 2DEJA 4WUBA 4DR6E 1ZBTA 3FIGA 2F4VE 2MC6A 1Z0VA 4LF7I 3DJWA 4WUDA 1KVKA 2RTXA 1Z5AA 2B3TB 4M0VA 2V85A 2CZ9A 4DV2E 4GEQB 2DB2A 3ADLA 2OI2A 4AQYI 4DV6E 3VK6A 1XNQI 4YY3E 4B3RE 4LF4I 3J80Q 4JI4E 4FWHA 1Z59A 4USKA 4JI6E 1Z0CA 4IZKA 2X7IA 5BR8I 4WYQB 4BC7A 1FJGI 1YZ9A 2LTRA 4F9CB 4USMA 1ZBQA 2H36X 2Z5CA 1HR0I 3RMPA 1IBLI 3QT5A 1N32I 1PIEA 2F8BA 4DR4I 4LF7E 2JWOA 3J7AG 3LNUA 4IZJD 2Z5BA 1J5EE 4NXMI 1HNWI 3M6AA 1J26A 1S4EA 4DPXA 1HNZI 4FWDA 3AUZA 2O1UA 4AQYE 4YHHI 5AASA 3D4JA 4FW9A 1EKZA 2JOXA 2V83A 5GMDA 2LE2A 4JI3I 5IWAI 2ZITA 4DU7A 5BR8E 2YZTA 3OMLA 2LUQA 2M7QA 4KHPI 1B62A 1FJGE 4DKKA 5A2QC 3IWDA 4B3SE 2JR1A 1HR0E 1NHIA 2RS7A 1Z0EA 1ZM9A 2DIXA 4DR4E 3PRYA 4PRVA 2HK2A 2CG9A 3ZZUA 4DR3I 3J7Yp 3PYEA 4LF8I 2Q2EB 1HNWE 1KTVA 2HHHI 4DV4I 2UXCI 4LFAE 3HJCA 2O1TA 4ED4A 2J7KA 4JI3E 5IWAE 4DV3I 1S16A 5IT9Q 2EFGA 2NUGA 1YYWA 4HXZA 3JTZA 4KHPE 1X47A 3IWCA 2BV3A 4X62I 1MG7A 4DR1I 2VF1A 2L2KB 2CPNA 4Q28A 2EZ6A 4JI5E 1A6FA 1H7UA 1H74A 4KZSA 4DR3E 2VF3A 1HNXI 2PNLA 2HFUA 4LF8E 2KOUA 4F54A 1WXRA 1ZXMA 2HHHE 1SR9A 2B7VA 2UXCE 1Z5CA 3J80C 4RPFA 1Y6ZA 2GQ0A 1KKHA 3F0NA 4DV5I 4DV3E 4M1KA 3T1YI 3J81C 1UHZA 3B82A 4I8OA 3ZKBA 4HACB 2VE7C 1K47A 4DR5I 3WU4A 4DUZI 4GKKE 2JVAA 5LMUE 2VQFI 3JAMQ 5LMNE 3HPZA 4R8OA 1MX0A 5AE3A 1ZXNA 1HNXE 1Z5BA 1QU6A 4X66I 1DQ3A 1YYKA 4OOGC 1H7SA 4BCAA 4DPWA 4BS9A 4DR7I 2R3VA 3F6GA 1D6TA 2RSMA 4DV5E 3K17A 1FNMA 3T1YE 1GQEA 2ODRD 3VYXA 5FLXQ 4JYAI 1WUUA 1T4NA 3ADGA 4I3HA 3OTOI 4DR5E 2HFSA 3AV0A 4DUZE 1IBMI 4ZVIA 2VQFE 3V5RA 2L33A 4LU9A 1I94I 3H09A 1T4LB 1N36I 1X49A 1XNQE 1XNRI 2UU9I 4LF4E 1N0UA 2WZOA 3ZOQB 4JI2I 4FN5A 1NZ0A 4J8ZA 4Z7YA 4B3TI 3K1JA 3HULA 1DI2A 1MU5A 2KHXA 3PYFA 4IZKB 4DPTA 2V2ZA 1Z0BA 4DV1I 4DR7E 1FWLA 4DUYI 2K4VA 5AE2A 4X64I 2V2VA 2UUBI 4DXLA 3VYYA 4UT4A 1IBLE 5IT9C 1XMQI 1N32E 4R03A 4JYAE 4X8WA 4NXNI 3QT6A 4NXME 4DPYA 1IBME 4Z7CA 2Z5BB 4FWGA 4JI7I 3HXLA 1HNZE 2L2NA 1I94E 2HK3A 2A2DA 4YHHE 1XNRE 2V8QB 2UU9E 5T6JA 4K0KI 4LF6I 4BC9A 3PYDA 2LTSA 1T4OA 4B3TE 4X65I 4LTYA 1USUA 4DV1E 2NPFA 4PRXA 2XEXA 4DPUA 2MDRA 2DMYA 4X64E 2LMZA 2UUBE 4DR2I 5AE1A 4DV0I 2FV4B 3QT7A 3K6QA 2BM0A 2NUEA 1Z0TA 5CFFE 5A2QQ 1FI4A 4GKJI 2HKEA 3ZZTA 1QZRA 1ZM4A 3B78A 2LBSB 4NXNE 4P52A 5FWKA 4JI0I 1U2RA 4TUGA 3K85A 3PYGA 4R1FA 2F4VI 4UTGA 4DV4E 2UUCI 4K0KE 4LF6E 2UXDI 4X65E 2DEIA 2IHR1 3P06A 3Q6MA 4B3RI 4JI1I 1BKNA 1IBKI 4JI4I 1YYOA 4LF9I 4X62E 4IZJB 4DR1E 4JI6I 3V2UC 4TUIA 4WFTA 4DR2E 4DV0E 2X36A 1H72C 2O1VA 1STUA 4LFBI 3WU3A 2R42A 3Q6NA 3IWBA 1Z0GA 5FLXC 1NHJA 1Y4SA 3F6HA 1PVGA 2B9DA 1EI1A 1DARA 4MYUA 2UXBI 3MSWA 2ZM6I 2ZBKB 3DF6A 1FKAE 1UEKA 3CWVA 3LTOA 2L92A 4PU9A 4DV7I 4HYMA 2UUCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2Q A;  1J5E I;  2UXD E;  3LPS A;  1N34 I;  2YT4 A;  2NUF A;  4JI1 E;  1FWK A;  4LFC I;  3B8H A;  2L3J A;  1KIJ A;  4MYT A;  1IBK E;  1OJ4 A;  4LF9 E;  4EMD A;  3WU6 A;  1NHH A;  3J81 Q;  1O0W A;  4LFB E;  1N0V C;  2E5L I;  4B3S I;  2L2M A;  4X66 E;  2UXB E;  4LF5 I;  2ZM6 E;  4JG4 A;  4OX9 I;  3QT8 A;  4DV7 E;  3Q1Q A;  1EA6 A;  3HTX A;  4DU8 A;  1N34 E;  4LFC E;  1N33 I;  4LFA I;  2LRS A;  1RRE A;  2A2C A;  4HY1 A;  3T1H I;  2V34 A;  3OTO E;  2L3C A;  3ADJ A;  4XTJ A;  2E5L E;  1N36 E;  4URL A;  2LJH A;  4JI2 E;  4JI8 I;  2B7T A;  3C4B A;  2HKJ A;  4JI5 I;  2RS6 A;  4LF5 E;  3H4L A;  1XMO I;  1UIL A;  4OX9 E;  2LJP A;  4M2Z A;  3ZKD A;  1WHQ A;  4DUY E;  1VIS A;  2UUA I;  2WW4 A;  4B3M I;  4JV5 I;  4KQV A;  1PKP A;  5LL6 R;  1XMQ E;  1N33 E;  2N3G A;  5L3J A;  1ZM3 A;  3T1H E;  1WHN A;  2BM1 A;  3ADI A;  1Z0W A;  3ZM7 A;  3P1X A;  2VQE I;  3WU5 A;  4JI7 E;  2N3H A;  4DR6 I;  3GON A;  3JAM C;  4HAC A;  4JI8 E;  3LLH A;  4GKK I;  2NA2 A;  4WUC A;  5LMU I;  4DV2 I;  1XMO E;  5LMN I;  3J7A M;  4DV6 I;  4YY3 I;  1ELO A;  5GME A;  2LUP B;  2UUA E;  1H73 A;  4P7A A;  3ZZ0 A;  1RQ0 A;  2E1R A;  4B3M E;  1RC7 A;  4JV5 E;  1ZM2 A;  1X48 A;  2AJ4 A;  1RR9 A;  4M30 A;  3C4T A;  1B63 A;  1XHK A;  2JY9 A;  2V8P A;  4GKJ E;  2GS8 A;  2VQE E;  4JI0 E;  2DEJ A;  4WUB A;  4DR6 E;  1ZBT A;  2F4V E;  1Z0V A;  4LF7 I;  4WUD A;  1KVK A;  2RTX A;  1Z5A A;  2B3T B;  2CZ9 A;  4DV2 E;  2DB2 A;  3ADL A;  2OI2 A;  4AQY I;  4DV6 E;  1XNQ I;  4YY3 E;  4B3R E;  4LF4 I;  3J80 Q;  4JI4 E;  4FWH A;  1Z59 A;  4USK A;  4JI6 E;  1Z0C A;  2X7I A;  5BR8 I;  4WYQ B;  1FJG I;  1YZ9 A;  2LTR A;  4USM A;  1HR0 I;  1IBL I;  3QT5 A;  1N32 I;  1PIE A;  4DR4 I;  4LF7 E;  3J7A G;  3LNU A;  1J5E E;  4NXM I;  1HNW I;  3M6A A;  1J26 A;  1S4E A;  4DPX A;  1HNZ I;  4FWD A;  4AQY E;  4YHH I;  3D4J A;  4FW9 A;  1EKZ A;  5GMD A;  4JI3 I;  5IWA I;  2ZIT A;  4DU7 A;  5BR8 E;  2LUQ A;  4KHP I;  1FJG E;  1B62 A;  4DKK A;  5A2Q C;  4B3S E;  1HR0 E;  1NHI A;  2RS7 A;  1Z0E A;  1ZM9 A;  2DIX A;  4DR4 E;  3ZZU A;  4PRV A;  2HK2 A;  4DR3 I;  3J7Y p;  3PYE A;  4LF8 I;  2Q2E B;  1HNW E;  1KTV A;  2HHH I;  4DV4 I;  2UXC I;  4LFA E;  4ED4 A;  2J7K A;  4JI3 E;  5IWA E;  4DV3 I;  1S16 A;  5IT9 Q;  2EFG A;  2NUG A;  1YYW A;  4HXZ A;  4KHP E;  1X47 A;  2BV3 A;  4X62 I;  1MG7 A;  4DR1 I;  2L2K B;  2EZ6 A;  2CPN A;  4JI5 E;  1A6F A;  1H7U A;  1H74 A;  4DR3 E;  2VF3 A;  1HNX I;  2HFU A;  4LF8 E;  1ZXM A;  2HHH E;  2B7V A;  2UXC E;  1Z5C A;  3J80 C;  4RPF A;  1KKH A;  3F0N A;  4DV5 I;  4DV3 E;  4M1K A;  3T1Y I;  3J81 C;  1UHZ A;  3B82 A;  3ZKB A;  4HAC B;  1K47 A;  4DR5 I;  3WU4 A;  4DUZ I;  4GKK E;  2JVA A;  5LMU E;  2VQF I;  3JAM Q;  5LMN E;  1MX0 A;  1ZXN A;  1HNX E;  1Z5B A;  1QU6 A;  4X66 I;  1YYK A;  4OOG C;  1H7S A;  4DPW A;  4DR7 I;  2R3V A;  1D6T A;  2RSM A;  4DV5 E;  3K17 A;  1FNM A;  3T1Y E;  1GQE A;  5FLX Q;  3VYX A;  4JYA I;  1WUU A;  1T4N A;  3ADG A;  4I3H A;  3OTO I;  4DR5 E;  2HFS A;  4DUZ E;  1IBM I;  4ZVI A;  2VQF E;  3V5R A;  2L33 A;  1I94 I;  1T4L B;  1N36 I;  1X49 A;  1XNQ E;  1XNR I;  2UU9 I;  4LF4 E;  1N0U A;  4JI2 I;  4FN5 A;  1NZ0 A;  4Z7Y A;  4B3T I;  3K1J A;  3HUL A;  1DI2 A;  1MU5 A;  2KHX A;  3PYF A;  4DPT A;  2V2Z A;  1Z0B A;  4DV1 I;  4DR7 E;  1FWL A;  4DUY I;  4X64 I;  2V2V A;  2UUB I;  4DXL A;  3VYY A;  4UT4 A;  1IBL E;  5IT9 C;  1XMQ I;  1N32 E;  4JYA E;  4X8W A;  4NXN I;  3QT6 A;  4NXM E;  4DPY A;  1IBM E;  4Z7C A;  4FWG A;  4JI7 I;  1HNZ E;  2L2N A;  1I94 E;  2HK3 A;  2A2D A;  4YHH E;  1XNR E;  2UU9 E;  4K0K I;  4LF6 I;  3PYD A;  2LTS A;  1T4O A;  4B3T E;  4X65 I;  4DV1 E;  2NPF A;  4PRX A;  2XEX A;  4DPU A;  2MDR A;  2DMY A;  4X64 E;  2UUB E;  4DR2 I;  4DV0 I;  3QT7 A;  2BM0 A;  2NUE A;  1Z0T A;  5CFF E;  5A2Q Q;  1FI4 A;  4GKJ I;  2HKE A;  3ZZT A;  1QZR A;  1ZM4 A;  3B78 A;  2LBS B;  4NXN E;  4P52 A;  4JI0 I;  1U2R A;  3PYG A;  4R1F A;  2F4V I;  4UTG A;  4DV4 E;  2UUC I;  4K0K E;  4LF6 E;  2UXD I;  4X65 E;  2DEI A;  2IHR 1;  4B3R I;  4JI1 I;  1BKN A;  1IBK I;  4JI4 I;  1YYO A;  4LF9 I;  4X62 E;  4DR1 E;  4JI6 I;  3V2U C;  4DR2 E;  4WFT A;  2X36 A;  4DV0 E;  1H72 C;  1STU A;  4LFB I;  3WU3 A;  2R42 A;  1Z0G A;  5FLX C;  1NHJ A;  1PVG A;  1EI1 A;  1DAR A;  4MYU A;  2UXB I;  2ZM6 I;  2ZBK B;  1FKA E;  1UEK A;  3CWV A;  3LTO A;  4PU9 A;  4DV7 I;  4HYM A;  2UUC E; 
#chains in the Genus database with same CATH topology
 2V2Q A;  1J5E I;  2EOY A;  2UXD E;  3LPS A;  5ADZ A;  4BBY A;  5KL5 A;  4OO1 E;  1N34 I;  2YT4 A;  2NUF A;  3UK3 C;  2C37 A;  1A1H A;  4JI1 E;  1FWK A;  3B8H A;  2L3J A;  4LFC I;  1KIJ A;  1LLM C;  4MYT A;  1RMD A;  1ZR9 A;  4P78 A;  1IBK E;  1OJ4 A;  4DMI A;  5A6B D;  4LF9 E;  1Y4U A;  5A6J A;  2JEB A;  5K36 F;  2V89 A;  2I13 A;  2PO1 A;  4EMD A;  2GPI A;  3WU6 A;  5JEA A;  1NHH A;  4R2A A;  3J81 Q;  1O0W A;  4IFD B;  2GO3 A;  5K36 D;  1USV A;  4LFB E;  4LPF A;  1N0V C;  2E5L I;  2LV2 A;  3BGH A;  1PJT A;  3CDI A;  4B3S I;  2AE8 A;  4F9B B;  1X6H A;  2L2M A;  4X66 E;  2UXB E;  1R6M A;  4LF5 I;  3JU0 A;  2ZM6 E;  1A1J A;  5C0X D;  2EOH A;  2R1F A;  4JG4 A;  4OX9 I;  2ELZ A;  2ODR C;  2WBT A;  4DV7 E;  2CGE A;  2VRD A;  3QT8 A;  3HKM A;  1OYP A;  2YTI A;  2EOR A;  5DNY A;  3Q1Q A;  1EA6 A;  3HTX A;  4DU8 A;  1N34 E;  2Z5C B;  1L4S A;  2Z5E A;  4LFC E;  2EM5 A;  4N3O A;  1N33 I;  4LFA I;  2LRS A;  1RRE A;  2A2C A;  2JOB A;  4HY1 A;  3T1H I;  2FGG A;  2YTN A;  2V34 A;  3OTO E;  2IOP A;  1HK7 A;  2L3C A;  3ADJ A;  2DSY A;  4XTJ A;  3MHS C;  2GHF A;  2E5L E;  4LCG A;  4U3D A;  3P76 A;  2O1W A;  1N36 E;  4WSP A;  4L5N C;  4WPY A;  4OO1 A;  4F6N A;  1GZ6 A;  2WNR B;  3NZK A;  4URL A;  2LJH A;  4JI2 E;  5AC4 A;  4JI8 I;  2YTE A;  2DLQ A;  1R6L A;  2B7T A;  4RHB B;  3C4B A;  2HKJ A;  2E1M A;  2EQ1 A;  2L6M A;  2M1S A;  2RS6 A;  4LF5 E;  3H4L A;  1XMO I;  4JI5 I;  1BBO A;  2NN6 B;  4RH8 A;  3L00 A;  1UIL A;  4OX9 E;  2LJP A;  4M2Z A;  3ZKD A;  1WHQ A;  5LLQ A;  4DUY E;  1VIS A;  2RPC A;  2UUA I;  2EMA A;  1PJS A;  1X5W A;  2KON A;  2L8T A;  2PO2 A;  3PS3 A;  2WW4 A;  4ZYE A;  2YU5 A;  4X9J A;  4B3M I;  2YTO A;  4KQV A;  4F2J C;  1UDQ A;  4JV5 I;  2M4I A;  5DNX A;  1PKP A;  2V86 A;  3LML A;  5LL6 R;  4IFD C;  2EJ4 A;  1XMQ E;  2YWQ A;  4IFD E;  1N33 E;  2N3G A;  3HPS A;  2MC5 A;  2EN8 A;  5L3J A;  1ZM3 A;  3T1H E;  3GME A;  4NHR A;  1WHN A;  2V87 A;  2BM1 A;  2EOZ A;  3ADI A;  1Z0W A;  3M7N G;  3ZM7 A;  3P1X A;  1IMU A;  2VQE I;  3WU5 A;  4JI7 E;  2EPK X;  2N3H A;  2PRT A;  4DR6 I;  5IXM B;  3GON A;  5JEA D;  3JAM C;  2YRK A;  5KL2 A;  4IZJ A;  4HAC A;  2EOI A;  3HQ1 A;  4JI8 E;  2EMX A;  3LLH A;  2J65 A;  2JEA A;  4GKK I;  2NA2 A;  4F9A B;  4MLQ A;  4WUC A;  1A1F A;  3P3C A;  5LMU I;  4DV2 I;  1VI7 A;  5A6A A;  1XMO E;  5LMN I;  1E3P A;  3J7A M;  2IOQ A;  4DV6 I;  3M85 D;  2EOF A;  4YY3 I;  1ELO A;  4GZN C;  3KZZ A;  2EE8 A;  4P7D A;  4HEI A;  5GME A;  2PNZ A;  2LUP B;  1BB8 A;  2UUA E;  5DRQ A;  1H73 A;  4P7A A;  5A6K A;  5DRP A;  3ZZ0 A;  1RQ0 A;  2E1R A;  4B3M E;  1RC7 A;  3VHT B;  2EWL A;  1X48 A;  2EMC A;  2EN1 A;  4JV5 E;  2EM6 A;  1ZM2 A;  1RR9 A;  2AJ4 A;  2PNM A;  5K36 B;  4L8N A;  1EH7 A;  2FTX B;  2EOO A;  4M30 A;  2V88 A;  3C4T A;  5F3W A;  1B63 A;  2EML A;  1XHK A;  2JYA A;  2JY9 A;  2V8P A;  4R2S A;  4GKJ E;  3EPH A;  4J3D A;  2G7H A;  3L7Z A;  1G2D C;  1MGT A;  4BMJ A;  2GS8 A;  2BA1 D;  1YHC A;  3ECR A;  3KWR A;  4O4K A;  1N3G A;  2VQE E;  4JI0 E;  5C0X B;  1Y60 A;  2DEJ A;  2VES A;  4WUB A;  4DR6 E;  1ZBT A;  1RHY A;  3FIG A;  4OKG A;  2YPN A;  4R2E A;  2F4V E;  2MC6 A;  2NN6 E;  1Z0V A;  4LF7 I;  3DJW A;  4WUD A;  1KVK A;  2EMW A;  2RTX A;  1Z5A A;  2F1D A;  4IFD A;  4OO1 D;  2B3T B;  4M0V A;  2V85 A;  2CZ9 A;  4DV2 E;  2YSP A;  2JE6 B;  4GEQ B;  2DB2 A;  3ADL A;  2OI2 A;  4AQY I;  4DV6 E;  3VK6 A;  1XNQ I;  4YY3 E;  1NEI A;  4B3R E;  4LF4 I;  3J80 Q;  2WBU A;  2BBG A;  4JI4 E;  4FWH A;  4BA2 B;  2EM3 A;  2EM4 A;  1Z59 A;  4USK A;  4R2D A;  4JI6 E;  1Z0C A;  1EH8 A;  5KL6 A;  4IZK A;  2YTP A;  2X7I A;  5BR8 I;  2DRP A;  2CVE A;  4MU4 A;  4WYQ B;  2WCC 3;  4BC7 A;  1A1L A;  4NZV A;  1FJG I;  1YZ9 A;  2LTR A;  4F9C B;  5C0X F;  1DGC A;  4OZE A;  2HC5 A;  4USM A;  2EQ3 A;  1ZBQ A;  2EM2 A;  2H36 X;  2Z5C A;  1HR0 I;  3RMP A;  4AID A;  1IBL I;  1TF6 A;  3QT5 A;  5DNL A;  1N32 I;  2EMK A;  2F8B A;  1PIE A;  4DR4 I;  2J7J A;  2EPO A;  4R2R A;  2YTJ A;  4BA1 A;  4LF7 E;  2JWO A;  2EN4 A;  2WBS A;  3J7A G;  3LNU A;  2Z5B A;  4IZJ D;  1J5E E;  4LCH A;  5DRO A;  4NXM I;  1HNW I;  3M6A A;  1J26 A;  2YTF A;  1S4E A;  4DPX A;  1HNZ I;  4FWD A;  3AUZ A;  2O1U A;  5K36 C;  4AQY E;  4R2C A;  4YHH I;  5AAS A;  5K36 E;  3D4J A;  2EM7 A;  4R2P A;  2BR2 A;  4FW9 A;  1UDS A;  1EKZ A;  2JOX A;  2V83 A;  5GMD A;  2JEB B;  2LE2 A;  4JI3 I;  2NN6 A;  2ZIT A;  5IWA I;  4DU7 A;  5ELW A;  2EL4 A;  5BR8 E;  4MU0 A;  2YZT A;  3OML A;  5C0X C;  2CSH A;  2LJU A;  2LUQ A;  2CT1 A;  2M7Q A;  5EKW A;  1FJG E;  1B62 A;  4KHP I;  2C39 A;  1UDO A;  4DKK A;  5A2Q C;  3IWD A;  2DGC A;  2EPA A;  4B3S E;  1IQS A;  4R2Q A;  2EMG A;  2N8X A;  2JR1 A;  1HR0 E;  1YSA C;  2RQL A;  3U1K A;  3M99 B;  1NHI A;  2RSI A;  2RS7 A;  1Z0E A;  3BBG A;  2DIX A;  4BHC A;  1UDN A;  1YH8 A;  4DR4 E;  1ZM9 A;  3PRY A;  2HK2 A;  2CG9 A;  4PRV A;  3ZZU A;  3J7Y p;  4DR3 I;  3PYE A;  1T38 A;  2Q8U A;  4LF8 I;  2Q2E B;  1HNW E;  2DMI A;  3BF2 A;  2EM9 A;  3PS1 A;  4M9V C;  1KTV A;  3M7N D;  4IFD D;  4HTG A;  4WXC A;  1A1K A;  2HHH I;  4DV4 I;  1NCS A;  2YSO A;  2JP9 A;  4LFA E;  1YPN A;  2UXC I;  3HJC A;  1T39 A;  2EOM A;  1KYQ A;  2EPN A;  4ZYG A;  2O1T A;  4ED4 A;  5JEA F;  2EPL X;  3THO B;  4JI3 E;  5IWA E;  2J7K A;  4DV3 I;  1S16 A;  4FW6 A;  1MEY C;  2EFG A;  2EOQ A;  5IT9 Q;  2K7I A;  2NUG A;  5A6B A;  1YYW A;  4HXZ A;  2EOS A;  1PDA A;  1X47 A;  3IWC A;  3JTZ A;  4KHP E;  2BV3 A;  4X62 I;  1MG7 A;  2ELY A;  4DR1 I;  4FK5 C;  2WP8 A;  5K36 A;  2VF1 A;  2L2K B;  2CPN A;  4Q28 A;  2EZ6 A;  3DD6 A;  1AH5 A;  4JI5 E;  2EN2 A;  1A6F A;  2YTD A;  1H7U A;  1H74 A;  3U1Y A;  4KZS A;  4DR3 E;  2VF3 A;  1HNX I;  2PNL A;  1IQO A;  2HFU A;  4U3B A;  4LF8 E;  2KOU A;  5IV8 B;  2LVH A;  4F54 A;  1WXR A;  1ZXM A;  2BB8 A;  2EOJ A;  1Z1B A;  2D9H A;  2HHH E;  1SR9 A;  2EOE A;  3GCM A;  2C38 A;  2B7V A;  5A69 A;  5JEA C;  1YUJ A;  2EN6 A;  3QG5 C;  2UXC E;  1Z5C A;  3J80 C;  4RPF A;  1Y6Z A;  2GQ0 A;  1KKH A;  5EL9 A;  2O3Z A;  4BHB A;  3P3E A;  3F0N A;  4DV5 I;  2ENA A;  4DV3 E;  4QNK A;  2NAB A;  3TQM A;  4M1K A;  3T1Y I;  2YTQ A;  3J81 C;  2NN6 D;  2EPX A;  4AM3 A;  1UHZ A;  4OO1 F;  4BA2 A;  3B82 A;  4I8O A;  2MDG A;  3ZKB A;  1P42 A;  4HAC B;  1X6F A;  2VE7 C;  1K47 A;  3KRN A;  4FW5 A;  3WU4 A;  4MDT A;  4DR5 I;  4DUZ I;  4GKK E;  2EMB A;  2JVA A;  4FW7 A;  2JEA B;  3C6M A;  1UBD C;  5LMU E;  2VQF I;  2EMZ A;  3JAM Q;  3KZY A;  5LMN E;  3CDJ A;  4LCF A;  3HPZ A;  4O5G A;  4R8O A;  1MX0 A;  2CTD A;  5AE3 A;  3GLL A;  1ZXN A;  1QNT A;  1G2F C;  1HNX E;  1Z5B A;  1QU6 A;  4X66 I;  1DQ3 A;  1OYS A;  2HJJ A;  1YYK A;  2LCE A;  4AIM A;  1OYR A;  4OOG C;  1H7S A;  4BCA A;  4DPW A;  1Y5Y A;  4BS9 A;  3PS2 A;  4DR7 I;  1XXE A;  2BA0 G;  3UHM A;  2R3V A;  3F6G A;  1D6T A;  2BA1 G;  2EPC A;  1E3H A;  2RSM A;  4OO1 C;  3L7Z B;  4DV5 E;  2EPU A;  3K17 A;  5KL4 A;  1FNM A;  2EL5 A;  1JK2 A;  3T1Y E;  2EMY A;  2JXP A;  1GQE A;  2ODR D;  3VYX A;  5FLX Q;  3EQ1 A;  4O43 A;  4GQU A;  2JPA A;  2PO0 B;  3C6K A;  4JYA I;  1WUU A;  1T4N A;  3ADG A;  5KL7 A;  4I3H A;  3OTO I;  4DR5 E;  2GLI A;  3AV0 A;  2HFS A;  5TSE A;  4DUZ E;  1IBM I;  4ZVI A;  1AAY A;  2EPP A;  2ENC A;  2VQF E;  3B4T A;  2L33 A;  3V5R A;  4LU9 A;  1I94 I;  3H09 A;  1T4L B;  4WX9 A;  1X49 A;  1XNQ E;  2WNR A;  2EMH A;  2YRH A;  1N36 I;  1XNR I;  2C37 B;  2UU9 I;  4LF4 E;  1N0U A;  2WZO A;  3ZOQ B;  4JI2 I;  4MU1 A;  4FN5 A;  1NZ0 A;  4J8Z A;  1WRJ A;  1WJP A;  1B69 A;  4NBQ A;  1ZAA C;  4Z7Y A;  4B3T I;  3K1J A;  2PO1 B;  3HUL A;  1DI2 A;  1MU5 A;  2EN7 A;  2KHX A;  4N4R B;  3PYF A;  4ISA A;  2EOX A;  2E72 A;  4ZYD A;  1Z0B A;  2V2Z A;  4IZK B;  2EM8 A;  4DR7 E;  4DPT A;  1FWL A;  5JEA B;  4DUY I;  4WXD A;  2K4V A;  5AE2 A;  5C0X E;  1KJK A;  4X64 I;  2V2V A;  4IJD A;  2HGH A;  2UUB I;  4DXL A;  2MKD A;  3VYY A;  4UT4 A;  2ENH A;  1IBL E;  4IS9 A;  5IT9 C;  4MQY A;  2I9I A;  1XMQ I;  1F2I G;  1N32 E;  4ZYH A;  4R03 A;  4IFD F;  4JYA E;  4X8W A;  5DRR A;  4NXN I;  4BA1 B;  3QT6 A;  4NXM E;  2EP3 A;  4DPY A;  1IBM E;  4Z7C A;  2Z5B B;  3MHH C;  2EPZ A;  4FWG A;  4JI7 I;  4F6M A;  3HXL A;  2LO3 A;  1HNZ E;  4Q35 B;  4MLV A;  1JK1 A;  2LT7 A;  2L2N A;  1I94 E;  2HK3 A;  2A2D A;  4YHH E;  1XNR E;  2V8Q B;  2EQ0 A;  2UU9 E;  2EN3 A;  5T6J A;  4K0K I;  4LF6 I;  2BR2 B;  4BC9 A;  2DLK A;  3PYD A;  2LTS A;  1T4O A;  4WSG A;  4B3T E;  4X65 I;  1YFH A;  1UN6 B;  4LTY A;  4KWY A;  1USU A;  4DV1 E;  2NPF A;  2IES A;  4PRX A;  2A25 A;  5AC5 A;  2EL6 A;  2XEX A;  1GTK A;  4DPU A;  1BBG A;  2MDR A;  4FW4 A;  2DMY A;  4X64 E;  2LMZ A;  2UUB E;  2C39 B;  4OO1 B;  4DR2 I;  2EPM X;  5AE1 A;  4DV0 I;  4MU3 A;  2FV4 B;  3QT7 A;  3K6Q A;  2BM0 A;  2NUE A;  1Z0T A;  5CFF E;  4O24 A;  1P47 A;  2GO4 A;  5A2Q Q;  1FI4 A;  4GKJ I;  2HKE A;  3ZZT A;  1QZR A;  1ZM4 A;  3B78 A;  2LBS B;  4NXN E;  5C0X A;  4P52 A;  2YTG A;  2YU8 A;  5FWK A;  2PO2 B;  3P3G A;  4JI0 I;  3THN A;  1U2R A;  4TUG A;  3K85 A;  2MKN A;  3PYG A;  4R1F A;  2F4V I;  4UTG A;  4DV4 E;  2R76 A;  5JEA E;  1SFE A;  2UUC I;  4K0K E;  4LF6 E;  1TN9 A;  2NN6 F;  2UXD I;  2JE6 A;  2EM0 A;  4X65 E;  2DEI A;  2IHR 1;  3P06 A;  3Q6M A;  1PJQ A;  4IS1 C;  4B3R I;  2JT2 A;  1EH6 A;  4JI1 I;  1BKN A;  1IBK I;  4JI4 I;  2IER A;  2EMF A;  1YYO A;  4LF9 I;  4X62 E;  2EMI A;  4IZJ B;  4DR1 E;  4LOM A;  4JI6 I;  3V2U C;  2EPR A;  4WFT A;  4TUI A;  4DV0 E;  4DR2 E;  1A1G A;  2WP8 B;  2X36 A;  4DV1 I;  2M9A A;  1H72 C;  2O1V A;  3M85 G;  1STU A;  4LFB I;  3WU3 A;  2R42 A;  3Q6N A;  3IWB A;  5KL3 A;  1YUI A;  1Z0G A;  1ZU1 A;  5FLX C;  1NHJ A;  1Y4S A;  2BA0 D;  3F6H A;  1PVG A;  2B9D A;  1EI1 A;  1DAR A;  4MYU A;  3H1C A;  3EPL A;  1TF3 A;  4QNJ A;  1A1I A;  2PNZ B;  2UXB I;  1X6E A;  2YRM A;  3MSW A;  2ZM6 I;  1X3C A;  4FW3 A;  2ZBK B;  3DF6 A;  1FKA E;  2PO0 A;  1UEK A;  3BID A;  2NN6 C;  3CWV A;  2ADR A;  2L92 A;  3EPJ A;  3EPK A;  3LTO A;  4PU9 A;  4DV7 I;  4HYM A;  2C38 B;  2UUC E; 
#chains in the Genus database with same CATH homology
 2V2Q A;  1J5E I;  2UXD E;  3LPS A;  5ADZ A;  4BBY A;  1N34 I;  2YT4 A;  2NUF A;  4JI1 E;  1FWK A;  4LFC I;  3B8H A;  2L3J A;  1KIJ A;  4MYT A;  1IBK E;  4P78 A;  1OJ4 A;  4DMI A;  4LF9 E;  1Y4U A;  2V89 A;  4EMD A;  3WU6 A;  1NHH A;  3J81 Q;  1O0W A;  1USV A;  4LFB E;  1N0V C;  2E5L I;  4B3S I;  4F9B B;  2L2M A;  4X66 E;  2UXB E;  4LF5 I;  3JU0 A;  2ZM6 E;  4JG4 A;  4OX9 I;  2ODR C;  2CGE A;  4DV7 E;  3QT8 A;  5DNY A;  3Q1Q A;  1EA6 A;  3HTX A;  4DU8 A;  1N34 E;  2Z5C B;  2Z5E A;  4LFC E;  4N3O A;  1N33 I;  4LFA I;  2LRS A;  1RRE A;  2A2C A;  2JOB A;  4HY1 A;  3T1H I;  2FGG A;  2V34 A;  3OTO E;  2IOP A;  1HK7 A;  2L3C A;  3ADJ A;  2DSY A;  4XTJ A;  2E5L E;  2O1W A;  1N36 E;  4WSP A;  4L5N C;  4WPY A;  1GZ6 A;  4URL A;  2LJH A;  4JI2 E;  4JI8 I;  2B7T A;  3C4B A;  2HKJ A;  2E1M A;  2L6M A;  2M1S A;  2RS6 A;  4LF5 E;  3H4L A;  1XMO I;  4JI5 I;  1UIL A;  4OX9 E;  2LJP A;  4M2Z A;  3ZKD A;  1WHQ A;  4DUY E;  1VIS A;  2UUA I;  2KON A;  2L8T A;  2WW4 A;  4B3M I;  4JV5 I;  4KQV A;  2M4I A;  1PKP A;  2V86 A;  3LML A;  5LL6 R;  1XMQ E;  1N33 E;  2N3G A;  3HPS A;  2MC5 A;  5L3J A;  1ZM3 A;  3T1H E;  1WHN A;  2V87 A;  2BM1 A;  3ADI A;  1Z0W A;  3ZM7 A;  3P1X A;  2VQE I;  3WU5 A;  4JI7 E;  2N3H A;  4DR6 I;  3GON A;  3JAM C;  4IZJ A;  4HAC A;  3HQ1 A;  4JI8 E;  3LLH A;  4GKK I;  2NA2 A;  4F9A B;  4WUC A;  5LMU I;  4DV2 I;  1XMO E;  5LMN I;  3J7A M;  2IOQ A;  4DV6 I;  4YY3 I;  1ELO A;  4P7D A;  5GME A;  2LUP B;  2UUA E;  1H73 A;  4P7A A;  3ZZ0 A;  1RQ0 A;  2E1R A;  4B3M E;  1RC7 A;  4JV5 E;  2EWL A;  1X48 A;  1ZM2 A;  2AJ4 A;  2PNM A;  1RR9 A;  4L8N A;  2FTX B;  4M30 A;  2V88 A;  3C4T A;  5F3W A;  1B63 A;  1XHK A;  2JY9 A;  2V8P A;  4GKJ E;  2G7H A;  4BMJ A;  2GS8 A;  3KWR A;  2VQE E;  4JI0 E;  2DEJ A;  4WUB A;  4DR6 E;  1ZBT A;  3FIG A;  2F4V E;  2MC6 A;  1Z0V A;  4LF7 I;  3DJW A;  4WUD A;  1KVK A;  2RTX A;  1Z5A A;  2B3T B;  4M0V A;  2V85 A;  2CZ9 A;  4DV2 E;  4GEQ B;  2DB2 A;  3ADL A;  2OI2 A;  4AQY I;  4DV6 E;  3VK6 A;  1XNQ I;  4YY3 E;  4B3R E;  4LF4 I;  3J80 Q;  4JI4 E;  4FWH A;  1Z59 A;  4USK A;  4JI6 E;  1Z0C A;  4IZK A;  2X7I A;  5BR8 I;  4WYQ B;  4BC7 A;  1FJG I;  1YZ9 A;  2LTR A;  4F9C B;  4USM A;  1ZBQ A;  2H36 X;  2Z5C A;  1HR0 I;  3RMP A;  1IBL I;  3QT5 A;  1N32 I;  1PIE A;  2F8B A;  4DR4 I;  4LF7 E;  2JWO A;  3J7A G;  3LNU A;  4IZJ D;  2Z5B A;  1J5E E;  4NXM I;  1HNW I;  3M6A A;  1J26 A;  1S4E A;  4DPX A;  1HNZ I;  4FWD A;  3AUZ A;  2O1U A;  4AQY E;  4YHH I;  5AAS A;  3D4J A;  4FW9 A;  1EKZ A;  2JOX A;  2V83 A;  5GMD A;  2LE2 A;  4JI3 I;  5IWA I;  2ZIT A;  4DU7 A;  5BR8 E;  2YZT A;  3OML A;  2LUQ A;  2M7Q A;  4KHP I;  1B62 A;  1FJG E;  4DKK A;  5A2Q C;  3IWD A;  4B3S E;  2JR1 A;  1HR0 E;  1NHI A;  2RS7 A;  1Z0E A;  1ZM9 A;  2DIX A;  4DR4 E;  3PRY A;  4PRV A;  2HK2 A;  2CG9 A;  3ZZU A;  4DR3 I;  3J7Y p;  3PYE A;  4LF8 I;  2Q2E B;  1HNW E;  1KTV A;  2HHH I;  4DV4 I;  2UXC I;  4LFA E;  3HJC A;  2O1T A;  4ED4 A;  2J7K A;  4JI3 E;  5IWA E;  4DV3 I;  1S16 A;  5IT9 Q;  2EFG A;  2NUG A;  1YYW A;  4HXZ A;  3JTZ A;  4KHP E;  1X47 A;  3IWC A;  2BV3 A;  4X62 I;  1MG7 A;  4DR1 I;  2VF1 A;  2L2K B;  2CPN A;  4Q28 A;  2EZ6 A;  4JI5 E;  1A6F A;  1H7U A;  1H74 A;  4KZS A;  4DR3 E;  2VF3 A;  1HNX I;  2PNL A;  2HFU A;  4LF8 E;  2KOU A;  4F54 A;  1WXR A;  1ZXM A;  2HHH E;  1SR9 A;  2B7V A;  2UXC E;  1Z5C A;  3J80 C;  4RPF A;  1Y6Z A;  2GQ0 A;  1KKH A;  3F0N A;  4DV5 I;  4DV3 E;  4M1K A;  3T1Y I;  3J81 C;  1UHZ A;  3B82 A;  4I8O A;  3ZKB A;  4HAC B;  2VE7 C;  1K47 A;  4DR5 I;  3WU4 A;  4DUZ I;  4GKK E;  2JVA A;  5LMU E;  2VQF I;  3JAM Q;  5LMN E;  3HPZ A;  4R8O A;  1MX0 A;  5AE3 A;  1ZXN A;  1HNX E;  1Z5B A;  1QU6 A;  4X66 I;  1DQ3 A;  1YYK A;  4OOG C;  1H7S A;  4BCA A;  4DPW A;  4BS9 A;  4DR7 I;  2R3V A;  3F6G A;  1D6T A;  2RSM A;  4DV5 E;  3K17 A;  1FNM A;  3T1Y E;  1GQE A;  2ODR D;  3VYX A;  5FLX Q;  4JYA I;  1WUU A;  1T4N A;  3ADG A;  4I3H A;  3OTO I;  4DR5 E;  2HFS A;  3AV0 A;  4DUZ E;  1IBM I;  4ZVI A;  2VQF E;  3V5R A;  2L33 A;  4LU9 A;  1I94 I;  3H09 A;  1T4L B;  1N36 I;  1X49 A;  1XNQ E;  1XNR I;  2UU9 I;  4LF4 E;  1N0U A;  2WZO A;  3ZOQ B;  4JI2 I;  4FN5 A;  1NZ0 A;  4J8Z A;  4Z7Y A;  4B3T I;  3K1J A;  3HUL A;  1DI2 A;  1MU5 A;  2KHX A;  3PYF A;  4IZK B;  4DPT A;  2V2Z A;  1Z0B A;  4DV1 I;  4DR7 E;  1FWL A;  4DUY I;  2K4V A;  5AE2 A;  4X64 I;  2V2V A;  2UUB I;  4DXL A;  3VYY A;  4UT4 A;  1IBL E;  5IT9 C;  1XMQ I;  1N32 E;  4R03 A;  4JYA E;  4X8W A;  4NXN I;  3QT6 A;  4NXM E;  4DPY A;  1IBM E;  4Z7C A;  2Z5B B;  4FWG A;  4JI7 I;  3HXL A;  1HNZ E;  2L2N A;  1I94 E;  2HK3 A;  2A2D A;  4YHH E;  1XNR E;  2V8Q B;  2UU9 E;  5T6J A;  4K0K I;  4LF6 I;  4BC9 A;  3PYD A;  2LTS A;  1T4O A;  4B3T E;  4X65 I;  4LTY A;  1USU A;  4DV1 E;  2NPF A;  4PRX A;  2XEX A;  4DPU A;  2MDR A;  2DMY A;  4X64 E;  2LMZ A;  2UUB E;  4DR2 I;  5AE1 A;  4DV0 I;  2FV4 B;  3QT7 A;  3K6Q A;  2BM0 A;  2NUE A;  1Z0T A;  5CFF E;  5A2Q Q;  1FI4 A;  4GKJ I;  2HKE A;  3ZZT A;  1QZR A;  1ZM4 A;  3B78 A;  2LBS B;  4NXN E;  4P52 A;  5FWK A;  4JI0 I;  1U2R A;  4TUG A;  3K85 A;  3PYG A;  4R1F A;  2F4V I;  4UTG A;  4DV4 E;  2UUC I;  4K0K E;  4LF6 E;  2UXD I;  4X65 E;  2DEI A;  2IHR 1;  3P06 A;  3Q6M A;  4B3R I;  4JI1 I;  1BKN A;  1IBK I;  4JI4 I;  1YYO A;  4LF9 I;  4X62 E;  4IZJ B;  4DR1 E;  4JI6 I;  3V2U C;  4TUI A;  4WFT A;  4DR2 E;  4DV0 E;  2X36 A;  1H72 C;  2O1V A;  1STU A;  4LFB I;  3WU3 A;  2R42 A;  3Q6N A;  3IWB A;  1Z0G A;  5FLX C;  1NHJ A;  1Y4S A;  3F6H A;  1PVG A;  2B9D A;  1EI1 A;  1DAR A;  4MYU A;  2UXB I;  3MSW A;  2ZM6 I;  2ZBK B;  3DF6 A;  1FKA E;  1UEK A;  3CWV A;  3LTO A;  2L92 A;  4PU9 A;  4DV7 I;  4HYM A;  2UUC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...