4JI0E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji0E02
3F0NA 1HNZE 4DV1I 4USMA 3T1YI 1RREA 1HNXI 4B3SE 3QT7A 5LMNE 1HR0I 4KHPE 1PIEA 4DV0E 4B3TE 4USKA 2E5LI 4I3HA 1Z5BA 1U2RA 4FWGA 4LFAE 1IBKI 4M30A 4JI2E 4UT4A 4LF4I 2JY9A 4RPFA 4DV3I 1XNRE 4B3MI 1FJGI 4MYTA 4DPTA 4JI7I 1VISA 4OX9I 2UXCE 2OI2A 4OOGC 1HNWE 1FKAE 4DV6E 2UXDE 5IWAE 2V34A 2UUAI 4X66I 2LUPB 1NHIA 4YHHE 4URLA 1DI2A 4WYQB 4DV4E 4P52A 1I94E 2L2NA 1Z0BA 4DKKA 2UUAE 4M1KA 1IBME 2L33A 2UUBE 1B62A 4JI4E 1N32E 4LF5E 1KTVA 4DR6I 2UUCI 3J7AG 1Z0WA 4P7AA 1N36E 4DV2E 1NZ0A 4NXMI 1STUA 2L2MA 1J5EE 1N0VC 4DV5I 4DR4I 4YY3E 4JYAE 4R1FA 2CPNA 4DPWA 1MX0A 4DR1I 3T1HI 4DR2I 1MG7A 2HK3A 4DR3I 4X65E 2V2ZA 2HKEA 4B3RI 5BR8I 4UTGA 4HY1A 2X7IA 1S4EA 2HFUA 2VF3A 2UU9I 4DPXA 1T4OA 5BR8E 4LF9E 4M2ZA 2R42A 4JI1E 4DUYE 4ED4A 3ZZUA 2NUEA 1Z0TA 1ELOA 2F4VI 2VQEI 2RS7A 2XEXA 2UXBE 1N34I 1H72C 2LJPA 2B7TA 2F4VE 1N33I 1XNQI 3OTOE 2EZ6A 2BM1A 1MU5A 3J81C 4AQYI 1NHJA 2VQFI 5CFFE 4PU9A 2DIXA 2HFSA 1HNZI 2V2VA 2LUQA 1XMOE 1KKHA 1RR9A 3GONA 1OJ4A 4B3SI 5LMNI 4KHPI 4DV0I 4B3TI 3HTXA 4JV5E 1ZM3A 4JI0E 4LF7E 4LFAI 4JI2I 3V2UC 1YYWA 2LJHA 4X62E 1KIJA 1XNRI 3CWVA 4XTJA 4LF6E 4X64E 1H7SA 1IBLE 2UXCI 2KHXA 3ADGA 1HNWI 1FWKA 3LPSA 5LL6R 1Z5AA 2HHHE 4DV6I 2UXDI 2ZM6E 5IWAI 5GMDA 2N3HA 1H7UA 1K47A 3PYDA 4YHHI 4LFBI 1H74A 4HYMA 4DV4I 4HACB 2AJ4A 1I94I 3LTOA 2L3CA 1ZXMA 1Z5CA 1IBMI 3J81Q 4LFBE 2UUBI 4X8WA 4JI4I 1WUUA 1EA6A 4KQVA 1N32I 4JI5E 1ZM4A 4LF5I 2YT4A 4DR5E 1H73A 1N36I 1WHQA 4DV2I 1J5EI 1ZM2A 4MYUA 1Z0GA 4YY3I 1NHHA 5GMEA 4JYAI 3Q1QA 4DU7A 3K17A 4HACA 4GKJE 2DMYA 2ZBKB 4Z7YA 2NUGA 4DR7E 1Z0EA 1X49A 4X65I 1T4LB 3D4JA 3QT6A 1XMQE 3VYYA 1B63A 4WUBA 4HXZA 4LF9I 4LFCE 2L3JA 3PYGA 4JI1I 4DUYI 4JG4A 5LMUI 4K0KE 1QU6A 4FN5A 2IHR1 2UXBI 5LMUE 4WUDA 1PVGA 4DPYA 5L3JA 3OTOI 3J80C 4JI3E 1X48A 2RS6A 3ZM7A 4WFTA 2LBSB 1FNMA 1XMOI 2DB2A 3B8HA 3B82A 1T4NA 4DUZE 1UILA 1ZBTA 3LLHA 4DV7E 2MDRA 2NUFA 4JV5I 2JVAA 4JI0I 4LF7I 2E1RA 3QT8A 3M6AA 1ZM9A 2DEJA 4X62I 4NXNE 2X36A 3WU5A 4LF6I 3PYEA 1YYKA 4X64I 2NPFA 1X47A 1S16A 4JI8E 1IBLI 1XHKA 4DU8A 2RTXA 2LRSA 1FWLA 3P1XA 4ZVIA 2HHHI 1QZRA 2ZM6I 5IT9C 3C4TA 3V5RA 4JI6E 3PYFA 4DXLA 4GKKE 2LTRA 2HKJA 3VYXA 3K1JA 4DV1E 2A2DA 3J80Q 1N0UA 2N3GA 3T1YE 3C4BA 2R3VA 1HNXE 1EI1A 1HR0E 1J26A 4LF8I 2HK2A 2E5LE 4JI5I 2GS8A 1UEKA 2NA2A 3J7AM 4LF8E 1IBKE 4DR5I 2J7KA 4LF4E 5FLXC 4FWDA 4DV3E 4B3ME 4FW9A 1FJGE 4DPUA 4JI7E 2WW4A 2BV3A 4OX9E 2RSMA 2A2CA 4GKJI 1PKPA 3ADLA 2Q2EB 4X66E 1EKZA 4DR7I 3B78A 1KVKA 1XMQI 3ADJA 5IT9Q 1RQ0A 1D6TA 2LTSA 4LFCI 4PRVA 3JAMC 4DR6E 3QT5A 2EFGA 3J7Yp 2UUCE 1O0WA 4K0KI 4EMDA 5A2QC 1Z59A 3ZKBA 1RC7A 2V2QA 4NXME 2L2KB 3WU6A 4JI3I 3ZKDA 2B3TB 4DR4E 4DV5E 3LNUA 5FLXQ 4DR1E 3T1HE 4DR2E 2V8PA 3WU3A 2CZ9A 1A6FA 1FI4A 4DUZI 4DR3E 3ZZTA 4WUCA 1BKNA 1ZXNA 3WU4A 4DV7I 3ADIA 1YYOA 4B3RE 4FWHA 1UHZA 2B7VA 2UU9E 1DARA 2ZITA 4Z7CA 2BM0A 1WHNA 1GQEA 2VQEE 4NXNI 1Z0CA 3ZZ0A 3H4LA 1N34E 1N33E 4JI8I 1XNQE 3JAMQ 3HULA 4PRXA 1YZ9A 5A2QQ 4AQYE 2DEIA 4JI6I 2VQFE 4GKKI 1Z0VA
chains in the Genus database with same CATH superfamily
1ZU1A 5A6BA 1HNZE 3F0NA 4DV1I 2WP8B 1TF6A 2YU5A 4USMA 3TQMA 3T1YI 1NEIA 2YRMA 1RREA 1HNXI 3THOB 4B3SE 1A1IA 3QT7A 1A1FA 4BS9A 5LMNE 3H1CA 5A6JA 3PS1A 1HR0I 2VESA 4KHPE 2ODRC 2EPNA 5KL2A 4DV0E 4B3TE 1PIEA 4USKA 2E5LI 2EPMX 4I3HA 1Z5BA 1U2RA 1Z1BA 2EMGA 4OKGA 2EPRA 4ZYEA 4FWGA 2EQ1A 4LFAE 1IBKI 2EP3A 4M30A 4JI2E 1YH8A 4UT4A 2WCC3 1YUJA 4MQYA 2BA1G 4LF4I 5C0XA 4OO1B 2JY9A 2O1VA 3CDIA 1BBGA 4RPFA 1EH6A 1XNRE 4DV3I 4B3MI 1FJGI 4MYTA 2WBTA 2EMIA 4DPTA 4JI7I 1VISA 4OX9I 2UXCE 2PNLA 1N3GA 2OI2A 4OOGC 2YWQA 1HNWE 1FKAE 5AC4A 5JEAF 4DV6E 2EMLA 2UXDE 2YSOA 4LTYA 5DRQA 5IWAE 5JEAE 2EN1A 2V34A 2UUAI 4O43A 2EMXA 4X66I 4P7DA 2LUPB 2Z5EA 2EPKX 4OO1D 2YPNA 1NHIA 4YHHE 4URLA 1DI2A 4WYQB 4R03A 1A1JA 5LLQA 3EPLA 4DV4E 4P52A 4AIMA 1I94E 1UBDC 2L2NA 4O24A 4DKKA 2UUAE 1Z0BA 4M1KA 2LT7A 1IBME 2O3ZA 2L33A 2UUBE 2Z5CB 1G2DC 2EJ4A 2EOEA 1B62A 5KL4A 3IWDA 4JI4E 1N32E 2EN4A 4LF5E 4IZJB 1BB8A 1KTVA 4DR6I 2DMIA 3VK6A 2UUCI 2IESA 3J7AG 1Z0WA 2JEBA 4BCAA 2YRHA 4BC7A 4F2JC 1KYQA 4IS1C 1PDAA 4HEIA 2NN6C 1N36E 1KJKA 4P7AA 2BA0D 4DV2E 4FK5C 1NZ0A 3RMPA 4NXMI 1L4SA 2DRPA 3HJCA 1STUA 2L2MA 5AE1A 3BBGA 1YSAC 1J5EE 1N0VC 2F1DA 4DV5I 2EPZA 4DR4I 4YY3E 4JYAE 2CTDA 4R1FA 2CPNA 5KL3A 3B4TA 2LVHA 4GZNC 4N4RB 1NCSA 3GLLA 4DPWA 2H36X 5F3WA 1MX0A 2GO3A 1AH5A 3PS2A 4MU1A 4DR1I 3T1HI 2EOZA 2ENHA 3AV0A 1MG7A 1Y60A 5EL9A 4DR2I 5K36B 1RMDA 2EQ0A 2Z5CA 3PS3A 1WXRA 4F6MA 2HK3A 3HQ1A 4DR3I 4X65E 3LMLA 2JR1A 2V2ZA 3P76A 2V89A 5KL5A 2HKEA 4B3RI 4IS9A 5BR8I 2FGGA 5DNLA 4UTGA 4HY1A 4IFDF 2JXPA 4NZVA 1S4EA 4GEQB 2HFUA 2X7IA 2VF3A 4J3DA 2UU9I 4DPXA 4IFDE 3IWBA 1T4OA 5BR8E 5DRRA 4LF9E 4M2ZA 3CDJA 1ZAAC 2YTJA 2R42A 3K85A 2EM6A 4RH8A 4JI1E 4DUYE 4ED4A 2EN6A 2NUEA 3ZZUA 1B69A 1ELOA 1Z0TA 2F4VI 5K36D 2DLKA 2VQEI 3C6KA 2RS7A 2XEXA 4OO1C 2J65A 1T39A 5IV8B 3M7NG 2FTXB 2UXBE 3P3CA 1N34I 1H72C 2LJPA 2B7TA 2F4VE 1N33I 1XNQI 3OTOE 2EZ6A 2CT1A 2BM1A 1AAYA 3EPHA 4BA2B 2YZTA 2IOQA 1MU5A 3J81C 4AQYI 1NHJA 2NN6F 2VQFI 1X5WA 1T38A 2EOIA 3MHSC 2YTDA 5CFFE 4PU9A 2DIXA 4L5NC 4FW7A 2V86A 2YTFA 2HFSA 1HNZI 2V2VA 2O1TA 2LUQA 2GHFA 1XMOE 4IZKB 2V83A 4MLVA 1A1KA 1KKHA 1RR9A 4F9BB 3GONA 5C0XF 1OJ4A 2BR2B 5C0XE 4B3SI 2EWLA 3C6MA 4U3BA 5LMNI 2L6MA 1SR9A 4KHPI 2PO2B 4DV0I 4B3TI 2DLQA 3HTXA 4JV5E 1Y6ZA 4AIDA 2MKNA 1ZM3A 3KWRA 4JI0E 1TF3A 4LF7E 2E72A 4OZEA 2VRDA 1R6LA 4LFAI 3EPJA 4JI2I 2C39B 3V2UC 2NN6A 2LE2A 4U3DA 1YYWA 2LJHA 4BHBA 2ENAA 4X62E 2ADRA 4TUIA 5AC5A 4P78A 1KIJA 1XNRI 4BA2A 2YTOA 3CWVA 4XTJA 4LF6E 4X64E 1UDSA 3FIGA 2EPCA 1H7SA 2YTQA 1R6MA 1P47A 1IBLE 3ECRA 2UXCI 2JYAA 2KHXA 3ADGA 1Y4SA 2EL6A 1FWKA 1HNWI 5AASA 3LPSA 2M4IA 4F54A 4IZKA 5LL6R 3DJWA 2EPXA 2HHHE 1Z5AA 4DV6I 2UXDI 2ZM6E 4R8OA 4R2QA 5IWAI 3KZYA 2BR2A 5GMDA 2N3HA 1QNTA 2B9DA 4BC9A 1H7UA 1K47A 2YU8A 2WP8A 2Z5BB 3PYDA 4LOMA 4YHHI 4X9JA 1H74A 2BA1D 4HYMA 4LFBI 5K36C 2PO2A 4DV4I 4HACB 3DF6A 2AJ4A 1I94I 2GPIA 3OMLA 3LTOA 2EM7A 2L3CA 1ZXMA 1Z5CA 1IBMI 3J81Q 4I8OA 2MC5A 4LFBE 3QG5C 2UUBI 2V8QB 2YTIA 4X8WA 2FV4B 4JI4I 1WUUA 1EA6A 4KQVA 4MLQA 1N32I 2V87A 4JI5E 1ZM4A 4LF5I 2JOXA 2PO1B 2YTPA 4OO1A 1PJQA 2R76A 1EH8A 2YT4A 1UN6B 4Q28A 2LJUA 4DR5E 1H73A 2ENCA 2PNMA 1PJTA 1N36I 1WHQA 2Q8UA 1DQ3A 4DV2I 3P3EA 5DRPA 2J7JA 5DNYA 4BHCA 1IQSA 2EM3A 2L8TA 1J5EI 2DGCA 1ZM2A 4MYUA 1Z0GA 2PO0B 1NHHA 3NZKA 5GMEA 4YY3I 4JYAI 2Z5BA 2EN7A 3Q1QA 5JEAD 4BBYA 5A69A 3K17A 4O5GA 4HACA 4DU7A 4GKJE 2DMYA 2EOQA 1YPNA 2C37B 4NHRA 2EN2A 2ZBKB 4J8ZA 3F6GA 4Z7YA 4M0VA 2NUGA 4DR7E 1Z0EA 3MSWA 1X49A 3JU0A 3U1KA 1XXEA 4X65I 1T4LB 1YHCA 3D4JA 3QT6A 1XMQE 2LMZA 2EMCA 2LV2A 3L00A 2JPAA 2AE8A 4LCHA 3VYYA 1B63A 2EOHA 2PO1A 2EE8A 2PNZB 2EM0A 1GZ6A 4WUBA 4HXZA 1Y5YA 5AE2A 4LF9I 4IZJA 4LFCE 2L3JA 2EOOA 2JT2A 3PYGA 4JI1I 2JE6B 4DUYI 4JG4A 1LLMC 5LMUI 4TUGA 2MDGA 2EORA 3M85D 2EM2A 4K0KE 1QU6A 2PRTA 4FN5A 2IHR1 2F8BA 2PO0A 5DNXA 2UXBI 4FW3A 5LMUE 2I9IA 4WUDA 1PVGA 1YUIA 4DPYA 5L3JA 3OTOI 3J80C 2GLIA 4JI3E 4IFDB 1X48A 2C37A 2RS6A 1ZBQA 4LU9A 4MDTA 2WNRB 4QNJA 1USUA 3ZM7A 2EOSA 2E1MA 2YTGA 4WFTA 2LBSB 1FNMA 2LO3A 3HPZA 3ZOQB 5K36A 2YTEA 2DSYA 1XMOI 2HC5A 2IOPA 1X3CA 4ISAA 2DB2A 4BMJA 3B8HA 4IJDA 3M7ND 3B82A 2PNZA 2M7QA 1T4NA 4R2SA 4DUZE 2NN6E 4QNKA 1UILA 3K6QA 1ZBTA 4F9AB 3LLHA 2YSPA 4R2DA 2KOUA 1WJPA 2WBSA 2MDRA 2V85A 4DV7E 2VE7C 2NUFA 2EM4A 2BB8A 4IFDD 4JV5I 2JVAA 3HXLA 2ELZA 2EMBA 4JI0I 2E1RA 4LF7I 2EN8A 3PRYA 4WX9A 3QT8A 5JEAC 4KZSA 2RSIA 1A1GA 2D9HA 3EQ1A 3M6AA 5KL7A 2I13A 1ZM9A 5A6BD 2EMAA 1G2FC 3MHHC 2DEJA 4X62I 4NXNE 3Q6MA 5FWKA 5A6AA 2X36A 3KRNA 3WU5A 4LF6I 2WNRA 3PYEA 1YYKA 4X64I 2NPFA 1X47A 3DD6A 1S16A 2EL4A 4JI8E 1IBLI 1XHKA 2HJJA 4DU8A 2CVEA 2RTXA 2LRSA 1A1HA 4R2EA 1FWLA 4R2CA 2CSHA 2EM8A 3P1XA 2NABA 4ZVIA 2HHHI 5IT9C 1QZRA 2NN6D 4FW5A 3C4TA 4WXCA 3V5RA 2ZM6I 4JI6E 3PYFA 2KONA 4DXLA 4GKKE 2LTRA 2HKJA 3AUZA 3VYXA 4MU4A 2ELYA 2EQ3A 3K1JA 2K4VA 4R2PA 4O4KA 4DV1E 1N0UA 2N3GA 2A2DA 5C0XD 3J80Q 4OO1F 1WRJA 3T1YE 3C4BA 4KWYA 2R3VA 4OO1E 2EMFA 1Y4UA 1HNXE 3Q6NA 5ADZA 3VHTB 1EI1A 3L7ZB 3EPKA 1HR0E 5EKWA 1ZR9A 1J26A 1E3HA 2YRKA 2HK2A 1BBOA 4LF8I 3KZZA 2JEAB 2E5LE 4JI5I 2EL5A 4WPYA 1UDOA 2GS8A 3HPSA 1UEKA 2NA2A 2M9AA 4N3OA 4LF8E 3J7AM 1IBKE 2C39A 4MU3A 1MEYC 2EMWA 2JEBB 2J7KA 5JEAB 4LF4E 5DROA 4DR5I 4MU0A 4L8NA 2CGEA 2EPPA 5FLXC 4FWDA 4AM3A 4DV3E 4B3ME 4FW9A 1FJGE 4R2RA 1X6HA 4DPUA 4JI7E 5KL6A 4WXDA 2WW4A 2BV3A 2JOBA 3JTZA 4OX9E 4IFDC 2RSMA 2A2CA 3GMEA 2EM9A 1PJSA 1EH7A 2M1SA 4FW6A 3F6HA 4HTGA 4GKJI 1E3PA 1PKPA 3ADLA 4RHBB 2EMYA 2O1WA 2Q2EB 4X66E 4M9VC 4BA1B 1EKZA 4DR7I 3BGHA 2EMZA 1RHYA 3L7ZA 3B78A 2BA0G 2EOJA 2JEAA 1KVKA 2V88A 2C38B 1XMQI 3ADJA 5IT9Q 1RQ0A 1OYRA 2BBGA 2RQLA 1D6TA 4F6NA 2LTSA 2IERA 2EOFA 1X6EA 5JEAA 4F9CB 4LFCI 1TN9A 1JK2A 1IMUA 2EMHA 4PRVA 3JAMC 4DR6E 3IWCA 3QT5A 2EFGA 3H09A 4LPFA 3J7Yp 2UUCE 1JK1A 1USVA 4LCFA 3P06A 5K36F 1YFHA 1O0WA 4K0KI 2EOYA 5TSEA 5A2QC 4EMDA 5C0XC 5K36E 1F2IG 1Z59A 1MGTA 2EPLX 3ZKBA 2G7HA 1RC7A 2V2QA 1OYPA 4NBQA 2MKDA 4GQUA 4NXME 2L2KB 4LCGA 1IQOA 2ODRD 3WU6A 4IZJD 2EN3A 2EOXA 4ZYGA 2A25A 3ZKDA 2B3TB 4JI3I 4DR4E 4DV5E 2WZOA 3LNUA 5ELWA 4BA1A 3M85G 2JWOA 5T6JA 4R2AA 5FLXQ 1OYSA 3U1YA 4DR1E 2C38A 1GTKA 1SFEA 2EM5A 3T1HE 2MC6A 3P3GA 2EMKA 2EPOA 4WSPA 5A6KA 4DR2E 2V8PA 3WU3A 2CZ9A 1A6FA 1FI4A 2EPAA 3BF2A 1HK7A 4ZYHA 3GCMA 4DUZI 2JP9A 4ZYDA 4DR3E 3ZZTA 4WUCA 1BKNA 1ZXNA 3WU4A 4DV7I 3ADIA 1YYOA 4B3RE 1UDNA 2L92A 4FWHA 1X6FA 1UHZA 3HKMA 3UHMA 4FW4A 2B7VA 2YTNA 2UU9E 5IXMB 5AE3A 1DARA 2ZITA 4DMIA 2WBUA 4Z7CA 3UK3C 2BM0A 2JE6A 1GQEA 1WHNA 2NN6B 2EPUA 2VQEE 2O1UA 1DGCA 1UDQA 1Z0CA 4NXNI 3ZZ0A 1VI7A 3H4LA 4WSGA 1N34E 2VF1A 4Q35B 2GQ0A 1N33E 5C0XB 4JI8I 1XNQE 2N8XA 2LCEA 2RPCA 3JAMQ 3M99B 3HULA 4PRXA 3THNA 4IFDA 1P42A 3BIDA 2K7IA 1YZ9A 2GO4A 5A2QQ 1A1LA 2EOMA 4AQYE 2HGHA 2DEIA 2CG9A 2VQFE 4JI6I 4GKKI 2R1FA 1Z0VA
chains in the Genus database with same CATH topology
3F0NA 1HNZE 4DV1I 4USMA 3T1YI 1RREA 1HNXI 4B3SE 3QT7A 4BS9A 5LMNE 1HR0I 4KHPE 2ODRC 1PIEA 4DV0E 4B3TE 4USKA 2E5LI 4I3HA 1Z5BA 1U2RA 4FWGA 4LFAE 1IBKI 4M30A 4JI2E 4UT4A 4LF4I 2JY9A 2O1VA 4RPFA 4DV3I 1XNRE 4B3MI 1FJGI 4MYTA 4DPTA 4JI7I 1VISA 4OX9I 2UXCE 2PNLA 2OI2A 4OOGC 1HNWE 1FKAE 4DV6E 2UXDE 4LTYA 5IWAE 2V34A 2UUAI 4X66I 4P7DA 2LUPB 2Z5EA 1NHIA 4YHHE 4URLA 1DI2A 4WYQB 4R03A 4DV4E 4P52A 1I94E 2L2NA 1Z0BA 4DKKA 2UUAE 4M1KA 1IBME 2L33A 2UUBE 2Z5CB 1B62A 3IWDA 4JI4E 1N32E 4LF5E 4IZJB 1KTVA 4DR6I 3VK6A 2UUCI 3J7AG 1Z0WA 4BCAA 4BC7A 4P7AA 1N36E 4DV2E 1NZ0A 3RMPA 4NXMI 3HJCA 1STUA 2L2MA 5AE1A 1J5EE 1N0VC 4DV5I 4DR4I 4YY3E 4JYAE 4R1FA 2CPNA 4DPWA 2H36X 5F3WA 1MX0A 4DR1I 3T1HI 3AV0A 4DR2I 1MG7A 2Z5CA 1WXRA 2HK3A 3HQ1A 4DR3I 4X65E 3LMLA 2JR1A 2V2ZA 2V89A 2HKEA 4B3RI 5BR8I 2FGGA 4UTGA 4HY1A 2X7IA 1S4EA 2HFUA 4GEQB 2VF3A 2UU9I 4DPXA 3IWBA 1T4OA 5BR8E 4LF9E 4M2ZA 2R42A 3K85A 4JI1E 4DUYE 4ED4A 3ZZUA 2NUEA 1Z0TA 1ELOA 2F4VI 2VQEI 2RS7A 2XEXA 2FTXB 2UXBE 1N34I 1H72C 2LJPA 2B7TA 2F4VE 1N33I 1XNQI 3OTOE 2EZ6A 2BM1A 2YZTA 2IOQA 1MU5A 3J81C 4AQYI 1NHJA 2VQFI 5CFFE 4PU9A 2DIXA 4L5NC 2V86A 2HFSA 1HNZI 2V2VA 2O1TA 2LUQA 4IZKB 1XMOE 2V83A 1KKHA 1RR9A 4F9BB 3GONA 1OJ4A 4B3SI 2EWLA 5LMNI 2L6MA 1SR9A 4KHPI 4DV0I 4B3TI 3HTXA 4JV5E 1Y6ZA 1ZM3A 3KWRA 4JI0E 4LF7E 4LFAI 4JI2I 3V2UC 2LE2A 1YYWA 2LJHA 4X62E 4TUIA 4P78A 1KIJA 1XNRI 3CWVA 4XTJA 4LF6E 4X64E 3FIGA 1H7SA 1IBLE 2UXCI 2KHXA 3ADGA 1Y4SA 1HNWI 1FWKA 5AASA 3LPSA 2M4IA 4F54A 4IZKA 5LL6R 3DJWA 1Z5AA 2HHHE 4DV6I 2UXDI 2ZM6E 4R8OA 5IWAI 5GMDA 2N3HA 2B9DA 4BC9A 1H7UA 1K47A 3PYDA 2Z5BB 4YHHI 4LFBI 1H74A 4HYMA 4DV4I 4HACB 3DF6A 2AJ4A 1I94I 3OMLA 3LTOA 2L3CA 1ZXMA 1Z5CA 1IBMI 3J81Q 4I8OA 2MC5A 4LFBE 2UUBI 2V8QB 4X8WA 2FV4B 4JI4I 1WUUA 1EA6A 4KQVA 1N32I 2V87A 4JI5E 1ZM4A 4LF5I 2JOXA 2YT4A 4Q28A 4DR5E 1H73A 2PNMA 1N36I 1WHQA 1DQ3A 4DV2I 5DNYA 2L8TA 1J5EI 1ZM2A 4MYUA 1Z0GA 4YY3I 1NHHA 5GMEA 4JYAI 2Z5BA 3Q1QA 4BBYA 4DU7A 3K17A 4HACA 4GKJE 2DMYA 2ZBKB 4J8ZA 3F6GA 4Z7YA 4M0VA 2NUGA 4DR7E 1Z0EA 3MSWA 1X49A 3JU0A 4X65I 1T4LB 3D4JA 3QT6A 1XMQE 2LMZA 3VYYA 1B63A 1GZ6A 4WUBA 4HXZA 5AE2A 4LF9I 4IZJA 4LFCE 2L3JA 3PYGA 4JI1I 4DUYI 4JG4A 5LMUI 4TUGA 4K0KE 1QU6A 4FN5A 2IHR1 2F8BA 2UXBI 5LMUE 4WUDA 1PVGA 4DPYA 5L3JA 3OTOI 3J80C 4JI3E 1X48A 2RS6A 1ZBQA 4LU9A 1USUA 3ZM7A 2E1MA 4WFTA 2LBSB 1FNMA 3HPZA 3ZOQB 2DSYA 1XMOI 2IOPA 2DB2A 4BMJA 3B8HA 3B82A 2M7QA 1T4NA 4DUZE 1UILA 3K6QA 1ZBTA 4F9AB 3LLHA 4DV7E 2KOUA 2MDRA 2V85A 2VE7C 2NUFA 4JV5I 2JVAA 3HXLA 4JI0I 4LF7I 2E1RA 3QT8A 3PRYA 4KZSA 3M6AA 1ZM9A 2DEJA 4X62I 4NXNE 3Q6MA 5FWKA 2X36A 3WU5A 4LF6I 3PYEA 1YYKA 4X64I 2NPFA 1X47A 1S16A 4JI8E 1IBLI 1XHKA 4DU8A 2RTXA 2LRSA 1FWLA 3P1XA 4ZVIA 2HHHI 5IT9C 1QZRA 2ZM6I 3C4TA 3V5RA 4JI6E 3PYFA 2KONA 4DXLA 4GKKE 2LTRA 2HKJA 3AUZA 3VYXA 3K1JA 2K4VA 4DV1E 2A2DA 1N0UA 3J80Q 2N3GA 3T1YE 3C4BA 2R3VA 1Y4UA 1HNXE 3Q6NA 5ADZA 1EI1A 1HR0E 1J26A 4LF8I 2HK2A 2E5LE 4JI5I 4WPYA 2GS8A 3HPSA 1UEKA 2NA2A 4N3OA 3J7AM 4LF8E 1IBKE 4DR5I 2J7KA 4LF4E 4L8NA 2CGEA 5FLXC 4FWDA 4DV3E 4B3ME 4FW9A 1FJGE 4DPUA 4JI7E 2WW4A 2BV3A 2JOBA 3JTZA 4OX9E 2RSMA 2A2CA 2M1SA 3F6HA 4GKJI 1PKPA 3ADLA 2O1WA 2Q2EB 4X66E 1EKZA 4DR7I 3B78A 1KVKA 2V88A 1XMQI 3ADJA 5IT9Q 1RQ0A 1D6TA 2LTSA 4F9CB 4LFCI 4PRVA 3JAMC 4DR6E 3IWCA 3QT5A 2EFGA 3H09A 3J7Yp 2UUCE 1USVA 3P06A 1O0WA 4K0KI 5A2QC 4EMDA 1Z59A 3ZKBA 2G7HA 1RC7A 2V2QA 4NXME 2L2KB 2ODRD 3WU6A 4IZJD 4JI3I 3ZKDA 2B3TB 4DR4E 4DV5E 2WZOA 3LNUA 2JWOA 5T6JA 5FLXQ 4DR1E 3T1HE 2MC6A 4WSPA 4DR2E 2V8PA 3WU3A 2CZ9A 1A6FA 1FI4A 1HK7A 4DUZI 4DR3E 3ZZTA 4WUCA 1BKNA 1ZXNA 3WU4A 4DV7I 3ADIA 1YYOA 4B3RE 2L92A 4FWHA 1UHZA 2B7VA 2UU9E 5AE3A 1DARA 2ZITA 4DMIA 4Z7CA 2BM0A 1WHNA 1GQEA 2VQEE 2O1UA 4NXNI 1Z0CA 3ZZ0A 3H4LA 1N34E 2VF1A 2GQ0A 1N33E 4JI8I 1XNQE 3JAMQ 3HULA 4PRXA 1YZ9A 5A2QQ 4AQYE 2DEIA 2CG9A 2VQFE 4JI6I 4GKKI 1Z0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0N A;  1HNZ E;  4DV1 I;  4USM A;  3T1Y I;  1RRE A;  1HNX I;  4B3S E;  3QT7 A;  5LMN E;  1HR0 I;  4KHP E;  1PIE A;  4DV0 E;  4B3T E;  4USK A;  2E5L I;  4I3H A;  1Z5B A;  1U2R A;  4FWG A;  4LFA E;  1IBK I;  4M30 A;  4JI2 E;  4UT4 A;  4LF4 I;  2JY9 A;  4RPF A;  4DV3 I;  1XNR E;  4B3M I;  1FJG I;  4MYT A;  4DPT A;  4JI7 I;  1VIS A;  4OX9 I;  2UXC E;  2OI2 A;  4OOG C;  1HNW E;  1FKA E;  4DV6 E;  2UXD E;  5IWA E;  2V34 A;  2UUA I;  4X66 I;  2LUP B;  1NHI A;  4YHH E;  4URL A;  1DI2 A;  4WYQ B;  4DV4 E;  4P52 A;  1I94 E;  2L2N A;  1Z0B A;  4DKK A;  2UUA E;  4M1K A;  1IBM E;  2L33 A;  2UUB E;  1B62 A;  4JI4 E;  1N32 E;  4LF5 E;  1KTV A;  4DR6 I;  2UUC I;  3J7A G;  1Z0W A;  4P7A A;  1N36 E;  4DV2 E;  1NZ0 A;  4NXM I;  1STU A;  2L2M A;  1J5E E;  1N0V C;  4DV5 I;  4DR4 I;  4YY3 E;  4JYA E;  4R1F A;  2CPN A;  4DPW A;  1MX0 A;  4DR1 I;  3T1H I;  4DR2 I;  1MG7 A;  2HK3 A;  4DR3 I;  4X65 E;  2V2Z A;  2HKE A;  4B3R I;  5BR8 I;  4UTG A;  4HY1 A;  2X7I A;  1S4E A;  2HFU A;  2VF3 A;  2UU9 I;  4DPX A;  1T4O A;  5BR8 E;  4LF9 E;  4M2Z A;  2R42 A;  4JI1 E;  4DUY E;  4ED4 A;  3ZZU A;  2NUE A;  1Z0T A;  1ELO A;  2F4V I;  2VQE I;  2RS7 A;  2XEX A;  2UXB E;  1N34 I;  1H72 C;  2LJP A;  2B7T A;  2F4V E;  1N33 I;  1XNQ I;  3OTO E;  2EZ6 A;  2BM1 A;  1MU5 A;  3J81 C;  4AQY I;  1NHJ A;  2VQF I;  5CFF E;  4PU9 A;  2DIX A;  2HFS A;  1HNZ I;  2V2V A;  2LUQ A;  1XMO E;  1KKH A;  1RR9 A;  3GON A;  1OJ4 A;  4B3S I;  5LMN I;  4KHP I;  4DV0 I;  4B3T I;  3HTX A;  4JV5 E;  1ZM3 A;  4JI0 E;  4LF7 E;  4LFA I;  4JI2 I;  3V2U C;  1YYW A;  2LJH A;  4X62 E;  1KIJ A;  1XNR I;  3CWV A;  4XTJ A;  4LF6 E;  4X64 E;  1H7S A;  1IBL E;  2UXC I;  2KHX A;  3ADG A;  1HNW I;  1FWK A;  3LPS A;  5LL6 R;  1Z5A A;  2HHH E;  4DV6 I;  2UXD I;  2ZM6 E;  5IWA I;  5GMD A;  2N3H A;  1H7U A;  1K47 A;  3PYD A;  4YHH I;  4LFB I;  1H74 A;  4HYM A;  4DV4 I;  4HAC B;  2AJ4 A;  1I94 I;  3LTO A;  2L3C A;  1ZXM A;  1Z5C A;  1IBM I;  3J81 Q;  4LFB E;  2UUB I;  4X8W A;  4JI4 I;  1WUU A;  1EA6 A;  4KQV A;  1N32 I;  4JI5 E;  1ZM4 A;  4LF5 I;  2YT4 A;  4DR5 E;  1H73 A;  1N36 I;  1WHQ A;  4DV2 I;  1J5E I;  1ZM2 A;  4MYU A;  1Z0G A;  4YY3 I;  1NHH A;  5GME A;  4JYA I;  3Q1Q A;  4DU7 A;  3K17 A;  4HAC A;  4GKJ E;  2DMY A;  2ZBK B;  4Z7Y A;  2NUG A;  4DR7 E;  1Z0E A;  1X49 A;  4X65 I;  1T4L B;  3D4J A;  3QT6 A;  1XMQ E;  3VYY A;  1B63 A;  4WUB A;  4HXZ A;  4LF9 I;  4LFC E;  2L3J A;  3PYG A;  4JI1 I;  4DUY I;  4JG4 A;  5LMU I;  4K0K E;  1QU6 A;  4FN5 A;  2IHR 1;  2UXB I;  5LMU E;  4WUD A;  1PVG A;  4DPY A;  5L3J A;  3OTO I;  3J80 C;  4JI3 E;  1X48 A;  2RS6 A;  3ZM7 A;  4WFT A;  2LBS B;  1FNM A;  1XMO I;  2DB2 A;  3B8H A;  3B82 A;  1T4N A;  4DUZ E;  1UIL A;  1ZBT A;  3LLH A;  4DV7 E;  2MDR A;  2NUF A;  4JV5 I;  2JVA A;  4JI0 I;  4LF7 I;  2E1R A;  3QT8 A;  3M6A A;  1ZM9 A;  2DEJ A;  4X62 I;  4NXN E;  2X36 A;  3WU5 A;  4LF6 I;  3PYE A;  1YYK A;  4X64 I;  2NPF A;  1X47 A;  1S16 A;  4JI8 E;  1IBL I;  1XHK A;  4DU8 A;  2RTX A;  2LRS A;  1FWL A;  3P1X A;  4ZVI A;  2HHH I;  1QZR A;  2ZM6 I;  5IT9 C;  3C4T A;  3V5R A;  4JI6 E;  3PYF A;  4DXL A;  4GKK E;  2LTR A;  2HKJ A;  3VYX A;  3K1J A;  4DV1 E;  2A2D A;  3J80 Q;  1N0U A;  2N3G A;  3T1Y E;  3C4B A;  2R3V A;  1HNX E;  1EI1 A;  1HR0 E;  1J26 A;  4LF8 I;  2HK2 A;  2E5L E;  4JI5 I;  2GS8 A;  1UEK A;  2NA2 A;  3J7A M;  4LF8 E;  1IBK E;  4DR5 I;  2J7K A;  4LF4 E;  5FLX C;  4FWD A;  4DV3 E;  4B3M E;  4FW9 A;  1FJG E;  4DPU A;  4JI7 E;  2WW4 A;  2BV3 A;  4OX9 E;  2RSM A;  2A2C A;  4GKJ I;  1PKP A;  3ADL A;  2Q2E B;  4X66 E;  1EKZ A;  4DR7 I;  3B78 A;  1KVK A;  1XMQ I;  3ADJ A;  5IT9 Q;  1RQ0 A;  1D6T A;  2LTS A;  4LFC I;  4PRV A;  3JAM C;  4DR6 E;  3QT5 A;  2EFG A;  3J7Y p;  2UUC E;  1O0W A;  4K0K I;  4EMD A;  5A2Q C;  1Z59 A;  3ZKB A;  1RC7 A;  2V2Q A;  4NXM E;  2L2K B;  3WU6 A;  4JI3 I;  3ZKD A;  2B3T B;  4DR4 E;  4DV5 E;  3LNU A;  5FLX Q;  4DR1 E;  3T1H E;  4DR2 E;  2V8P A;  3WU3 A;  2CZ9 A;  1A6F A;  1FI4 A;  4DUZ I;  4DR3 E;  3ZZT A;  4WUC A;  1BKN A;  1ZXN A;  3WU4 A;  4DV7 I;  3ADI A;  1YYO A;  4B3R E;  4FWH A;  1UHZ A;  2B7V A;  2UU9 E;  1DAR A;  2ZIT A;  4Z7C A;  2BM0 A;  1WHN A;  1GQE A;  2VQE E;  4NXN I;  1Z0C A;  3ZZ0 A;  3H4L A;  1N34 E;  1N33 E;  4JI8 I;  1XNQ E;  3JAM Q;  3HUL A;  4PRX A;  1YZ9 A;  5A2Q Q;  4AQY E;  2DEI A;  4JI6 I;  2VQF E;  4GKK I;  1Z0V A; 
#chains in the Genus database with same CATH topology
 1ZU1 A;  5A6B A;  1HNZ E;  3F0N A;  4DV1 I;  2WP8 B;  1TF6 A;  2YU5 A;  4USM A;  3TQM A;  3T1Y I;  1NEI A;  2YRM A;  1RRE A;  1HNX I;  3THO B;  4B3S E;  1A1I A;  3QT7 A;  1A1F A;  4BS9 A;  5LMN E;  3H1C A;  5A6J A;  3PS1 A;  1HR0 I;  2VES A;  4KHP E;  2ODR C;  2EPN A;  5KL2 A;  4DV0 E;  4B3T E;  1PIE A;  4USK A;  2E5L I;  2EPM X;  4I3H A;  1Z5B A;  1U2R A;  1Z1B A;  2EMG A;  4OKG A;  2EPR A;  4ZYE A;  4FWG A;  2EQ1 A;  4LFA E;  1IBK I;  2EP3 A;  4M30 A;  4JI2 E;  1YH8 A;  4UT4 A;  2WCC 3;  1YUJ A;  4MQY A;  2BA1 G;  4LF4 I;  5C0X A;  4OO1 B;  2JY9 A;  2O1V A;  3CDI A;  1BBG A;  4RPF A;  1EH6 A;  1XNR E;  4DV3 I;  4B3M I;  1FJG I;  4MYT A;  2WBT A;  2EMI A;  4DPT A;  4JI7 I;  1VIS A;  4OX9 I;  2UXC E;  2PNL A;  1N3G A;  2OI2 A;  4OOG C;  2YWQ A;  1HNW E;  1FKA E;  5AC4 A;  5JEA F;  4DV6 E;  2EML A;  2UXD E;  2YSO A;  4LTY A;  5DRQ A;  5IWA E;  5JEA E;  2EN1 A;  2V34 A;  2UUA I;  4O43 A;  2EMX A;  4X66 I;  4P7D A;  2LUP B;  2Z5E A;  2EPK X;  4OO1 D;  2YPN A;  1NHI A;  4YHH E;  4URL A;  1DI2 A;  4WYQ B;  4R03 A;  1A1J A;  5LLQ A;  3EPL A;  4DV4 E;  4P52 A;  4AIM A;  1I94 E;  1UBD C;  2L2N A;  4O24 A;  4DKK A;  2UUA E;  1Z0B A;  4M1K A;  2LT7 A;  1IBM E;  2O3Z A;  2L33 A;  2UUB E;  2Z5C B;  1G2D C;  2EJ4 A;  2EOE A;  1B62 A;  5KL4 A;  3IWD A;  4JI4 E;  1N32 E;  2EN4 A;  4LF5 E;  4IZJ B;  1BB8 A;  1KTV A;  4DR6 I;  2DMI A;  3VK6 A;  2UUC I;  2IES A;  3J7A G;  1Z0W A;  2JEB A;  4BCA A;  2YRH A;  4BC7 A;  4F2J C;  1KYQ A;  4IS1 C;  1PDA A;  4HEI A;  2NN6 C;  1N36 E;  1KJK A;  4P7A A;  2BA0 D;  4DV2 E;  4FK5 C;  1NZ0 A;  3RMP A;  4NXM I;  1L4S A;  2DRP A;  3HJC A;  1STU A;  2L2M A;  5AE1 A;  3BBG A;  1YSA C;  1J5E E;  1N0V C;  2F1D A;  4DV5 I;  2EPZ A;  4DR4 I;  4YY3 E;  4JYA E;  2CTD A;  4R1F A;  2CPN A;  5KL3 A;  3B4T A;  2LVH A;  4GZN C;  4N4R B;  1NCS A;  3GLL A;  4DPW A;  2H36 X;  5F3W A;  1MX0 A;  2GO3 A;  1AH5 A;  3PS2 A;  4MU1 A;  4DR1 I;  3T1H I;  2EOZ A;  2ENH A;  3AV0 A;  1MG7 A;  1Y60 A;  5EL9 A;  4DR2 I;  5K36 B;  1RMD A;  2EQ0 A;  2Z5C A;  3PS3 A;  1WXR A;  4F6M A;  2HK3 A;  3HQ1 A;  4DR3 I;  4X65 E;  3LML A;  2JR1 A;  2V2Z A;  3P76 A;  2V89 A;  5KL5 A;  2HKE A;  4B3R I;  4IS9 A;  5BR8 I;  2FGG A;  5DNL A;  4UTG A;  4HY1 A;  4IFD F;  2JXP A;  4NZV A;  1S4E A;  4GEQ B;  2HFU A;  2X7I A;  2VF3 A;  4J3D A;  2UU9 I;  4DPX A;  4IFD E;  3IWB A;  1T4O A;  5BR8 E;  5DRR A;  4LF9 E;  4M2Z A;  3CDJ A;  1ZAA C;  2YTJ A;  2R42 A;  3K85 A;  2EM6 A;  4RH8 A;  4JI1 E;  4DUY E;  4ED4 A;  2EN6 A;  2NUE A;  3ZZU A;  1B69 A;  1ELO A;  1Z0T A;  2F4V I;  5K36 D;  2DLK A;  2VQE I;  3C6K A;  2RS7 A;  2XEX A;  4OO1 C;  2J65 A;  1T39 A;  5IV8 B;  3M7N G;  2FTX B;  2UXB E;  3P3C A;  1N34 I;  1H72 C;  2LJP A;  2B7T A;  2F4V E;  1N33 I;  1XNQ I;  3OTO E;  2EZ6 A;  2CT1 A;  2BM1 A;  1AAY A;  3EPH A;  4BA2 B;  2YZT A;  2IOQ A;  1MU5 A;  3J81 C;  4AQY I;  1NHJ A;  2NN6 F;  2VQF I;  1X5W A;  1T38 A;  2EOI A;  3MHS C;  2YTD A;  5CFF E;  4PU9 A;  2DIX A;  4L5N C;  4FW7 A;  2V86 A;  2YTF A;  2HFS A;  1HNZ I;  2V2V A;  2O1T A;  2LUQ A;  2GHF A;  1XMO E;  4IZK B;  2V83 A;  4MLV A;  1A1K A;  1KKH A;  1RR9 A;  4F9B B;  3GON A;  5C0X F;  1OJ4 A;  2BR2 B;  5C0X E;  4B3S I;  2EWL A;  3C6M A;  4U3B A;  5LMN I;  2L6M A;  1SR9 A;  4KHP I;  2PO2 B;  4DV0 I;  4B3T I;  2DLQ A;  3HTX A;  4JV5 E;  1Y6Z A;  4AID A;  2MKN A;  1ZM3 A;  3KWR A;  4JI0 E;  1TF3 A;  4LF7 E;  2E72 A;  4OZE A;  2VRD A;  1R6L A;  4LFA I;  3EPJ A;  4JI2 I;  2C39 B;  3V2U C;  2NN6 A;  2LE2 A;  4U3D A;  1YYW A;  2LJH A;  4BHB A;  2ENA A;  4X62 E;  2ADR A;  4TUI A;  5AC5 A;  4P78 A;  1KIJ A;  1XNR I;  4BA2 A;  2YTO A;  3CWV A;  4XTJ A;  4LF6 E;  4X64 E;  1UDS A;  3FIG A;  2EPC A;  1H7S A;  2YTQ A;  1R6M A;  1P47 A;  1IBL E;  3ECR A;  2UXC I;  2JYA A;  2KHX A;  3ADG A;  1Y4S A;  2EL6 A;  1FWK A;  1HNW I;  5AAS A;  3LPS A;  2M4I A;  4F54 A;  4IZK A;  5LL6 R;  3DJW A;  2EPX A;  2HHH E;  1Z5A A;  4DV6 I;  2UXD I;  2ZM6 E;  4R8O A;  4R2Q A;  5IWA I;  3KZY A;  2BR2 A;  5GMD A;  2N3H A;  1QNT A;  2B9D A;  4BC9 A;  1H7U A;  1K47 A;  2YU8 A;  2WP8 A;  2Z5B B;  3PYD A;  4LOM A;  4YHH I;  4X9J A;  1H74 A;  2BA1 D;  4HYM A;  4LFB I;  5K36 C;  2PO2 A;  4DV4 I;  4HAC B;  3DF6 A;  2AJ4 A;  1I94 I;  2GPI A;  3OML A;  3LTO A;  2EM7 A;  2L3C A;  1ZXM A;  1Z5C A;  1IBM I;  3J81 Q;  4I8O A;  2MC5 A;  4LFB E;  3QG5 C;  2UUB I;  2V8Q B;  2YTI A;  4X8W A;  2FV4 B;  4JI4 I;  1WUU A;  1EA6 A;  4KQV A;  4MLQ A;  1N32 I;  2V87 A;  4JI5 E;  1ZM4 A;  4LF5 I;  2JOX A;  2PO1 B;  2YTP A;  4OO1 A;  1PJQ A;  2R76 A;  1EH8 A;  2YT4 A;  1UN6 B;  4Q28 A;  2LJU A;  4DR5 E;  1H73 A;  2ENC A;  2PNM A;  1PJT A;  1N36 I;  1WHQ A;  2Q8U A;  1DQ3 A;  4DV2 I;  3P3E A;  5DRP A;  2J7J A;  5DNY A;  4BHC A;  1IQS A;  2EM3 A;  2L8T A;  1J5E I;  2DGC A;  1ZM2 A;  4MYU A;  1Z0G A;  2PO0 B;  1NHH A;  3NZK A;  5GME A;  4YY3 I;  4JYA I;  2Z5B A;  2EN7 A;  3Q1Q A;  5JEA D;  4BBY A;  5A69 A;  3K17 A;  4O5G A;  4HAC A;  4DU7 A;  4GKJ E;  2DMY A;  2EOQ A;  1YPN A;  2C37 B;  4NHR A;  2EN2 A;  2ZBK B;  4J8Z A;  3F6G A;  4Z7Y A;  4M0V A;  2NUG A;  4DR7 E;  1Z0E A;  3MSW A;  1X49 A;  3JU0 A;  3U1K A;  1XXE A;  4X65 I;  1T4L B;  1YHC A;  3D4J A;  3QT6 A;  1XMQ E;  2LMZ A;  2EMC A;  2LV2 A;  3L00 A;  2JPA A;  2AE8 A;  4LCH A;  3VYY A;  1B63 A;  2EOH A;  2PO1 A;  2EE8 A;  2PNZ B;  2EM0 A;  1GZ6 A;  4WUB A;  4HXZ A;  1Y5Y A;  5AE2 A;  4LF9 I;  4IZJ A;  4LFC E;  2L3J A;  2EOO A;  2JT2 A;  3PYG A;  4JI1 I;  2JE6 B;  4DUY I;  4JG4 A;  1LLM C;  5LMU I;  4TUG A;  2MDG A;  2EOR A;  3M85 D;  2EM2 A;  4K0K E;  1QU6 A;  2PRT A;  4FN5 A;  2IHR 1;  2F8B A;  2PO0 A;  5DNX A;  2UXB I;  4FW3 A;  5LMU E;  2I9I A;  4WUD A;  1PVG A;  1YUI A;  4DPY A;  5L3J A;  3OTO I;  3J80 C;  2GLI A;  4JI3 E;  4IFD B;  1X48 A;  2C37 A;  2RS6 A;  1ZBQ A;  4LU9 A;  4MDT A;  2WNR B;  4QNJ A;  1USU A;  3ZM7 A;  2EOS A;  2E1M A;  2YTG A;  4WFT A;  2LBS B;  1FNM A;  2LO3 A;  3HPZ A;  3ZOQ B;  5K36 A;  2YTE A;  2DSY A;  1XMO I;  2HC5 A;  2IOP A;  1X3C A;  4ISA A;  2DB2 A;  4BMJ A;  3B8H A;  4IJD A;  3M7N D;  3B82 A;  2PNZ A;  2M7Q A;  1T4N A;  4R2S A;  4DUZ E;  2NN6 E;  4QNK A;  1UIL A;  3K6Q A;  1ZBT A;  4F9A B;  3LLH A;  2YSP A;  4R2D A;  2KOU A;  1WJP A;  2WBS A;  2MDR A;  2V85 A;  4DV7 E;  2VE7 C;  2NUF A;  2EM4 A;  2BB8 A;  4IFD D;  4JV5 I;  2JVA A;  3HXL A;  2ELZ A;  2EMB A;  4JI0 I;  2E1R A;  4LF7 I;  2EN8 A;  3PRY A;  4WX9 A;  3QT8 A;  5JEA C;  4KZS A;  2RSI A;  1A1G A;  2D9H A;  3EQ1 A;  3M6A A;  5KL7 A;  2I13 A;  1ZM9 A;  5A6B D;  2EMA A;  1G2F C;  3MHH C;  2DEJ A;  4X62 I;  4NXN E;  3Q6M A;  5FWK A;  5A6A A;  2X36 A;  3KRN A;  3WU5 A;  4LF6 I;  2WNR A;  3PYE A;  1YYK A;  4X64 I;  2NPF A;  1X47 A;  3DD6 A;  1S16 A;  2EL4 A;  4JI8 E;  1IBL I;  1XHK A;  2HJJ A;  4DU8 A;  2CVE A;  2RTX A;  2LRS A;  1A1H A;  4R2E A;  1FWL A;  4R2C A;  2CSH A;  2EM8 A;  3P1X A;  2NAB A;  4ZVI A;  2HHH I;  5IT9 C;  1QZR A;  2NN6 D;  4FW5 A;  3C4T A;  4WXC A;  3V5R A;  2ZM6 I;  4JI6 E;  3PYF A;  2KON A;  4DXL A;  4GKK E;  2LTR A;  2HKJ A;  3AUZ A;  3VYX A;  4MU4 A;  2ELY A;  2EQ3 A;  3K1J A;  2K4V A;  4R2P A;  4O4K A;  4DV1 E;  1N0U A;  2N3G A;  2A2D A;  5C0X D;  3J80 Q;  4OO1 F;  1WRJ A;  3T1Y E;  3C4B A;  4KWY A;  2R3V A;  4OO1 E;  2EMF A;  1Y4U A;  1HNX E;  3Q6N A;  5ADZ A;  3VHT B;  1EI1 A;  3L7Z B;  3EPK A;  1HR0 E;  5EKW A;  1ZR9 A;  1J26 A;  1E3H A;  2YRK A;  2HK2 A;  1BBO A;  4LF8 I;  3KZZ A;  2JEA B;  2E5L E;  4JI5 I;  2EL5 A;  4WPY A;  1UDO A;  2GS8 A;  3HPS A;  1UEK A;  2NA2 A;  2M9A A;  4N3O A;  4LF8 E;  3J7A M;  1IBK E;  2C39 A;  4MU3 A;  1MEY C;  2EMW A;  2JEB B;  2J7K A;  5JEA B;  4LF4 E;  5DRO A;  4DR5 I;  4MU0 A;  4L8N A;  2CGE A;  2EPP A;  5FLX C;  4FWD A;  4AM3 A;  4DV3 E;  4B3M E;  4FW9 A;  1FJG E;  4R2R A;  1X6H A;  4DPU A;  4JI7 E;  5KL6 A;  4WXD A;  2WW4 A;  2BV3 A;  2JOB A;  3JTZ A;  4OX9 E;  4IFD C;  2RSM A;  2A2C A;  3GME A;  2EM9 A;  1PJS A;  1EH7 A;  2M1S A;  4FW6 A;  3F6H A;  4HTG A;  4GKJ I;  1E3P A;  1PKP A;  3ADL A;  4RHB B;  2EMY A;  2O1W A;  2Q2E B;  4X66 E;  4M9V C;  4BA1 B;  1EKZ A;  4DR7 I;  3BGH A;  2EMZ A;  1RHY A;  3L7Z A;  3B78 A;  2BA0 G;  2EOJ A;  2JEA A;  1KVK A;  2V88 A;  2C38 B;  1XMQ I;  3ADJ A;  5IT9 Q;  1RQ0 A;  1OYR A;  2BBG A;  2RQL A;  1D6T A;  4F6N A;  2LTS A;  2IER A;  2EOF A;  1X6E A;  5JEA A;  4F9C B;  4LFC I;  1TN9 A;  1JK2 A;  1IMU A;  2EMH A;  4PRV A;  3JAM C;  4DR6 E;  3IWC A;  3QT5 A;  2EFG A;  3H09 A;  4LPF A;  3J7Y p;  2UUC E;  1JK1 A;  1USV A;  4LCF A;  3P06 A;  5K36 F;  1YFH A;  1O0W A;  4K0K I;  2EOY A;  5TSE A;  5A2Q C;  4EMD A;  5C0X C;  5K36 E;  1F2I G;  1Z59 A;  1MGT A;  2EPL X;  3ZKB A;  2G7H A;  1RC7 A;  2V2Q A;  1OYP A;  4NBQ A;  2MKD A;  4GQU A;  4NXM E;  2L2K B;  4LCG A;  1IQO A;  2ODR D;  3WU6 A;  4IZJ D;  2EN3 A;  2EOX A;  4ZYG A;  2A25 A;  3ZKD A;  2B3T B;  4JI3 I;  4DR4 E;  4DV5 E;  2WZO A;  3LNU A;  5ELW A;  4BA1 A;  3M85 G;  2JWO A;  5T6J A;  4R2A A;  5FLX Q;  1OYS A;  3U1Y A;  4DR1 E;  2C38 A;  1GTK A;  1SFE A;  2EM5 A;  3T1H E;  2MC6 A;  3P3G A;  2EMK A;  2EPO A;  4WSP A;  5A6K A;  4DR2 E;  2V8P A;  3WU3 A;  2CZ9 A;  1A6F A;  1FI4 A;  2EPA A;  3BF2 A;  1HK7 A;  4ZYH A;  3GCM A;  4DUZ I;  2JP9 A;  4ZYD A;  4DR3 E;  3ZZT A;  4WUC A;  1BKN A;  1ZXN A;  3WU4 A;  4DV7 I;  3ADI A;  1YYO A;  4B3R E;  1UDN A;  2L92 A;  4FWH A;  1X6F A;  1UHZ A;  3HKM A;  3UHM A;  4FW4 A;  2B7V A;  2YTN A;  2UU9 E;  5IXM B;  5AE3 A;  1DAR A;  2ZIT A;  4DMI A;  2WBU A;  4Z7C A;  3UK3 C;  2BM0 A;  2JE6 A;  1GQE A;  1WHN A;  2NN6 B;  2EPU A;  2VQE E;  2O1U A;  1DGC A;  1UDQ A;  1Z0C A;  4NXN I;  3ZZ0 A;  1VI7 A;  3H4L A;  4WSG A;  1N34 E;  2VF1 A;  4Q35 B;  2GQ0 A;  1N33 E;  5C0X B;  4JI8 I;  1XNQ E;  2N8X A;  2LCE A;  2RPC A;  3JAM Q;  3M99 B;  3HUL A;  4PRX A;  3THN A;  4IFD A;  1P42 A;  3BID A;  2K7I A;  1YZ9 A;  2GO4 A;  5A2Q Q;  1A1L A;  2EOM A;  4AQY E;  2HGH A;  2DEI A;  2CG9 A;  2VQF E;  4JI6 I;  4GKK I;  2R1F A;  1Z0V A; 
#chains in the Genus database with same CATH homology
 3F0N A;  1HNZ E;  4DV1 I;  4USM A;  3T1Y I;  1RRE A;  1HNX I;  4B3S E;  3QT7 A;  4BS9 A;  5LMN E;  1HR0 I;  4KHP E;  2ODR C;  1PIE A;  4DV0 E;  4B3T E;  4USK A;  2E5L I;  4I3H A;  1Z5B A;  1U2R A;  4FWG A;  4LFA E;  1IBK I;  4M30 A;  4JI2 E;  4UT4 A;  4LF4 I;  2JY9 A;  2O1V A;  4RPF A;  4DV3 I;  1XNR E;  4B3M I;  1FJG I;  4MYT A;  4DPT A;  4JI7 I;  1VIS A;  4OX9 I;  2UXC E;  2PNL A;  2OI2 A;  4OOG C;  1HNW E;  1FKA E;  4DV6 E;  2UXD E;  4LTY A;  5IWA E;  2V34 A;  2UUA I;  4X66 I;  4P7D A;  2LUP B;  2Z5E A;  1NHI A;  4YHH E;  4URL A;  1DI2 A;  4WYQ B;  4R03 A;  4DV4 E;  4P52 A;  1I94 E;  2L2N A;  1Z0B A;  4DKK A;  2UUA E;  4M1K A;  1IBM E;  2L33 A;  2UUB E;  2Z5C B;  1B62 A;  3IWD A;  4JI4 E;  1N32 E;  4LF5 E;  4IZJ B;  1KTV A;  4DR6 I;  3VK6 A;  2UUC I;  3J7A G;  1Z0W A;  4BCA A;  4BC7 A;  4P7A A;  1N36 E;  4DV2 E;  1NZ0 A;  3RMP A;  4NXM I;  3HJC A;  1STU A;  2L2M A;  5AE1 A;  1J5E E;  1N0V C;  4DV5 I;  4DR4 I;  4YY3 E;  4JYA E;  4R1F A;  2CPN A;  4DPW A;  2H36 X;  5F3W A;  1MX0 A;  4DR1 I;  3T1H I;  3AV0 A;  4DR2 I;  1MG7 A;  2Z5C A;  1WXR A;  2HK3 A;  3HQ1 A;  4DR3 I;  4X65 E;  3LML A;  2JR1 A;  2V2Z A;  2V89 A;  2HKE A;  4B3R I;  5BR8 I;  2FGG A;  4UTG A;  4HY1 A;  2X7I A;  1S4E A;  2HFU A;  4GEQ B;  2VF3 A;  2UU9 I;  4DPX A;  3IWB A;  1T4O A;  5BR8 E;  4LF9 E;  4M2Z A;  2R42 A;  3K85 A;  4JI1 E;  4DUY E;  4ED4 A;  3ZZU A;  2NUE A;  1Z0T A;  1ELO A;  2F4V I;  2VQE I;  2RS7 A;  2XEX A;  2FTX B;  2UXB E;  1N34 I;  1H72 C;  2LJP A;  2B7T A;  2F4V E;  1N33 I;  1XNQ I;  3OTO E;  2EZ6 A;  2BM1 A;  2YZT A;  2IOQ A;  1MU5 A;  3J81 C;  4AQY I;  1NHJ A;  2VQF I;  5CFF E;  4PU9 A;  2DIX A;  4L5N C;  2V86 A;  2HFS A;  1HNZ I;  2V2V A;  2O1T A;  2LUQ A;  4IZK B;  1XMO E;  2V83 A;  1KKH A;  1RR9 A;  4F9B B;  3GON A;  1OJ4 A;  4B3S I;  2EWL A;  5LMN I;  2L6M A;  1SR9 A;  4KHP I;  4DV0 I;  4B3T I;  3HTX A;  4JV5 E;  1Y6Z A;  1ZM3 A;  3KWR A;  4JI0 E;  4LF7 E;  4LFA I;  4JI2 I;  3V2U C;  2LE2 A;  1YYW A;  2LJH A;  4X62 E;  4TUI A;  4P78 A;  1KIJ A;  1XNR I;  3CWV A;  4XTJ A;  4LF6 E;  4X64 E;  3FIG A;  1H7S A;  1IBL E;  2UXC I;  2KHX A;  3ADG A;  1Y4S A;  1HNW I;  1FWK A;  5AAS A;  3LPS A;  2M4I A;  4F54 A;  4IZK A;  5LL6 R;  3DJW A;  1Z5A A;  2HHH E;  4DV6 I;  2UXD I;  2ZM6 E;  4R8O A;  5IWA I;  5GMD A;  2N3H A;  2B9D A;  4BC9 A;  1H7U A;  1K47 A;  3PYD A;  2Z5B B;  4YHH I;  4LFB I;  1H74 A;  4HYM A;  4DV4 I;  4HAC B;  3DF6 A;  2AJ4 A;  1I94 I;  3OML A;  3LTO A;  2L3C A;  1ZXM A;  1Z5C A;  1IBM I;  3J81 Q;  4I8O A;  2MC5 A;  4LFB E;  2UUB I;  2V8Q B;  4X8W A;  2FV4 B;  4JI4 I;  1WUU A;  1EA6 A;  4KQV A;  1N32 I;  2V87 A;  4JI5 E;  1ZM4 A;  4LF5 I;  2JOX A;  2YT4 A;  4Q28 A;  4DR5 E;  1H73 A;  2PNM A;  1N36 I;  1WHQ A;  1DQ3 A;  4DV2 I;  5DNY A;  2L8T A;  1J5E I;  1ZM2 A;  4MYU A;  1Z0G A;  4YY3 I;  1NHH A;  5GME A;  4JYA I;  2Z5B A;  3Q1Q A;  4BBY A;  4DU7 A;  3K17 A;  4HAC A;  4GKJ E;  2DMY A;  2ZBK B;  4J8Z A;  3F6G A;  4Z7Y A;  4M0V A;  2NUG A;  4DR7 E;  1Z0E A;  3MSW A;  1X49 A;  3JU0 A;  4X65 I;  1T4L B;  3D4J A;  3QT6 A;  1XMQ E;  2LMZ A;  3VYY A;  1B63 A;  1GZ6 A;  4WUB A;  4HXZ A;  5AE2 A;  4LF9 I;  4IZJ A;  4LFC E;  2L3J A;  3PYG A;  4JI1 I;  4DUY I;  4JG4 A;  5LMU I;  4TUG A;  4K0K E;  1QU6 A;  4FN5 A;  2IHR 1;  2F8B A;  2UXB I;  5LMU E;  4WUD A;  1PVG A;  4DPY A;  5L3J A;  3OTO I;  3J80 C;  4JI3 E;  1X48 A;  2RS6 A;  1ZBQ A;  4LU9 A;  1USU A;  3ZM7 A;  2E1M A;  4WFT A;  2LBS B;  1FNM A;  3HPZ A;  3ZOQ B;  2DSY A;  1XMO I;  2IOP A;  2DB2 A;  4BMJ A;  3B8H A;  3B82 A;  2M7Q A;  1T4N A;  4DUZ E;  1UIL A;  3K6Q A;  1ZBT A;  4F9A B;  3LLH A;  4DV7 E;  2KOU A;  2MDR A;  2V85 A;  2VE7 C;  2NUF A;  4JV5 I;  2JVA A;  3HXL A;  4JI0 I;  4LF7 I;  2E1R A;  3QT8 A;  3PRY A;  4KZS A;  3M6A A;  1ZM9 A;  2DEJ A;  4X62 I;  4NXN E;  3Q6M A;  5FWK A;  2X36 A;  3WU5 A;  4LF6 I;  3PYE A;  1YYK A;  4X64 I;  2NPF A;  1X47 A;  1S16 A;  4JI8 E;  1IBL I;  1XHK A;  4DU8 A;  2RTX A;  2LRS A;  1FWL A;  3P1X A;  4ZVI A;  2HHH I;  5IT9 C;  1QZR A;  2ZM6 I;  3C4T A;  3V5R A;  4JI6 E;  3PYF A;  2KON A;  4DXL A;  4GKK E;  2LTR A;  2HKJ A;  3AUZ A;  3VYX A;  3K1J A;  2K4V A;  4DV1 E;  2A2D A;  1N0U A;  3J80 Q;  2N3G A;  3T1Y E;  3C4B A;  2R3V A;  1Y4U A;  1HNX E;  3Q6N A;  5ADZ A;  1EI1 A;  1HR0 E;  1J26 A;  4LF8 I;  2HK2 A;  2E5L E;  4JI5 I;  4WPY A;  2GS8 A;  3HPS A;  1UEK A;  2NA2 A;  4N3O A;  3J7A M;  4LF8 E;  1IBK E;  4DR5 I;  2J7K A;  4LF4 E;  4L8N A;  2CGE A;  5FLX C;  4FWD A;  4DV3 E;  4B3M E;  4FW9 A;  1FJG E;  4DPU A;  4JI7 E;  2WW4 A;  2BV3 A;  2JOB A;  3JTZ A;  4OX9 E;  2RSM A;  2A2C A;  2M1S A;  3F6H A;  4GKJ I;  1PKP A;  3ADL A;  2O1W A;  2Q2E B;  4X66 E;  1EKZ A;  4DR7 I;  3B78 A;  1KVK A;  2V88 A;  1XMQ I;  3ADJ A;  5IT9 Q;  1RQ0 A;  1D6T A;  2LTS A;  4F9C B;  4LFC I;  4PRV A;  3JAM C;  4DR6 E;  3IWC A;  3QT5 A;  2EFG A;  3H09 A;  3J7Y p;  2UUC E;  1USV A;  3P06 A;  1O0W A;  4K0K I;  5A2Q C;  4EMD A;  1Z59 A;  3ZKB A;  2G7H A;  1RC7 A;  2V2Q A;  4NXM E;  2L2K B;  2ODR D;  3WU6 A;  4IZJ D;  4JI3 I;  3ZKD A;  2B3T B;  4DR4 E;  4DV5 E;  2WZO A;  3LNU A;  2JWO A;  5T6J A;  5FLX Q;  4DR1 E;  3T1H E;  2MC6 A;  4WSP A;  4DR2 E;  2V8P A;  3WU3 A;  2CZ9 A;  1A6F A;  1FI4 A;  1HK7 A;  4DUZ I;  4DR3 E;  3ZZT A;  4WUC A;  1BKN A;  1ZXN A;  3WU4 A;  4DV7 I;  3ADI A;  1YYO A;  4B3R E;  2L92 A;  4FWH A;  1UHZ A;  2B7V A;  2UU9 E;  5AE3 A;  1DAR A;  2ZIT A;  4DMI A;  4Z7C A;  2BM0 A;  1WHN A;  1GQE A;  2VQE E;  2O1U A;  4NXN I;  1Z0C A;  3ZZ0 A;  3H4L A;  1N34 E;  2VF1 A;  2GQ0 A;  1N33 E;  4JI8 I;  1XNQ E;  3JAM Q;  3HUL A;  4PRX A;  1YZ9 A;  5A2Q Q;  4AQY E;  2DEI A;  2CG9 A;  2VQF E;  4JI6 I;  4GKK I;  1Z0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...