4LF7E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf7E02
4B3RI 2LUQA 1YZ9A 4X62I 4KHPI 1X48A 1EKZA 2X7IA 1J5EI 2UXDE 1KTVA 4OX9I 1Z0BA 3VYXA 1Z0WA 2LJPA 1J26A 3OTOI 4WUCA 1T4OA 4NXNI 4DV5E 4LF6E 5LMUE 2LTRA 4DR4E 1I94E 4DR2E 2B3TB 4X66I 2NUEA 3J7Yp 1YYKA 2DB2A 4WFTA 5A2QQ 4MYUA 4HACA 2UXCI 4YY3E 4M30A 4DV0E 2UU9I 2B7VA 4DV2I 1B63A 2GS8A 1N0VC 3QT8A 2NUGA 1XMQI 4JI0E 2JY9A 4HXZA 1VISA 2UUBI 1GQEA 4P52A 3P1XA 4HACB 1T4NA 2RTXA 3ZM7A 1HNZI 2KHXA 4MYTA 2LBSB 1H72C 4JI5E 4WUDA 5L3JA 2HK2A 1NHJA 2HHHI 2JVAA 1Z0TA 2V2VA 3V2UC 3LPSA 2VQFI 1T4LB 2XEXA 1FKAE 1IBMI 4B3SI 3ZZTA 1Z5CA 2UUCE 4PU9A 4X64I 4R1FA 2R42A 4X65E 3T1HE 1IBKI 4LF5E 1PKPA 4FW9A 1Z0VA 3ADLA 4DPTA 2LRSA 1D6TA 5IT9C 4DPYA 1EA6A 3ZZ0A 4JI2I 2Q2EB 2RS6A 4DV7I 1RC7A 2N3GA 1EI1A 4DV2E 3B8HA 3C4TA 4WYQB 4LF4E 5IT9Q 4GKKI 1XMQE 4FWHA 4JI8I 4ED4A 3WU5A 5BR8I 5LMNE 2R3VA 2RSMA 4DR7E 3T1YE 3ADIA 4M2ZA 3QT7A 4JYAI 1XNRI 4JG4A 2IHR1 4DR1E 2UXBE 1DARA 4URLA 5IWAI 2E5LI 4DUYE 3C4BA 3K1JA 4YHHE 4DV3I 4LF8E 2VQEI 2F4VI 1U2RA 2VQFE 1S4EA 1XNQI 1WHQA 1IBME 2HK3A 5GMEA 4LF9I 1XHKA 2E1RA 5A2QC 3LTOA 4JV5I 4JI3I 1N32E 3J7AM 3JAMQ 4JI1I 4UTGA 4DV4E 3M6AA 2NPFA 4DR6I 2UUAE 4LF7E 4DKKA 1X49A 4Z7YA 4LFBE 4P7AA 4DV6I 4USMA 1N33I 2A2CA 1MX0A 4JI2E 3ZKDA 1FWLA 1HR0I 1XMOI 3F0NA 1RR9A 1FI4A 2HKEA 4ZVIA 1N34I 4GKKE 2WW4A 1K47A 4LFAI 4DV1E 1MG7A 2MDRA 4JI4I 2ZM6E 2LUPB 5BR8E 5FLXQ 4DR5E 4JI7I 1NHIA 2A2DA 2AJ4A 1Z5BA 1HNXE 3ZZUA 1S16A 1N36I 4K0KI 1RREA 4NXME 1ZM3A 1FJGE 4XTJA 4B3MI 2LJHA 4JYAE 3HULA 4X8WA 2NUFA 1B62A 1IBLE 4DV3E 4B3RE 2ZBKB 1FNMA 4HYMA 4KHPE 4X62E 3ADGA 1J5EE 4FWDA 1O0WA 1XNQE 4OX9E 4LF9E 3OTOE 4NXNE 3WU3A 3QT6A 2NA2A 2V2QA 4X66E 2ZITA 3PYFA 4DXLA 1ZXMA 4JI6I 4LF6I 2UXCE 3V5RA 1I94I 2UU9E 1N33E 1UEKA 2RS7A 2B7TA 1BKNA 3J7AG 1XMOE 2N3HA 2L2MA 4YY3I 4DV0I 3PYGA 4GKJI 1ZM9A 2V8PA 2UUBE 2DIXA 2EZ6A 1HNZE 1Z0GA 4JI0I 3WU6A 4B3TI 1ZBTA 4DU7A 3K17A 4JI7E 3GONA 4AQYI 3JAMC 2HHHE 3J81Q 4B3ME 4UT4A 2EFGA 4JI5I 2VF3A 4B3SE 4DPUA 4X64E 4EMDA 4DPWA 2L2NA 3J80Q 3B82A 1ZM4A 1IBKE 1ZM2A 4M1KA 2BM1A 2UUCI 2J7KA 1H74A 1MU5A 1UILA 3B78A 4X65I 3T1HI 4FN5A 2LTSA 3LLHA 4LF5I 2BM0A 4PRXA 4WUBA 2HFSA 1ZXNA 1UHZA 4JI6E 1PVGA 4DV7E 1YYOA 5FLXC 1Z59A 2DEJA 1HNWI 2DMYA 2DEIA 2V34A 1NHHA 1X47A 4GKJE 4JI8E 5LL6R 2X36A 4LF4I 1ELOA 4LFCI 1QU6A 4B3TE 3LNUA 1XNRE 1WUUA 4RPFA 1H7UA 1KIJA 5LMNI 4AQYE 1PIEA 3ADJA 5IWAE 2E5LE 4DR7I 3T1YI 4DUZI 2VQEE 2F4VE 5GMDA 4DR1I 4DR3I 1RQ0A 2UXBI 4DUYI 4JV5E 4YHHI 4JI3E 4LF8I 4JI1E 2YT4A 4OOGC 2UXDI 3PYEA 1KVKA 3HTXA 1YYWA 3CWVA 4DR6E 1FWKA 3PYDA 1DI2A 1N32I 4FWGA 4DV5I 5LMUI 4DV6E 4DV4I 4DR4I 3VYYA 4DR2I 5CFFE 4DPXA 2UUAI 3WU4A 4LF7I 1A6FA 2V2ZA 1HR0E 1WHNA 4LFBI 2L2KB 1HNWE 1N34E 2BV3A 4HY1A 4I3HA 1QZRA 3J81C 2L3JA 1Z0EA 1Z5AA 4LFAE 4JI4E 2HKJA 3QT5A 4KQVA 4USKA 3ZKBA 2CZ9A 4LFCE 2L33A 1H73A 4K0KE 2CPNA 1N36E 1OJ4A 2L3CA 3J80C 1Z0CA 3H4LA 4DV1I 1NZ0A 4Z7CA 1H7SA 2ZM6I 4DR5I 2OI2A 3Q1QA 3D4JA 1STUA 1KKHA 1HNXI 1N0UA 4NXMI 4PRVA 2HFUA 1FJGI 4DUZE 4DU8A 4DR3E 1IBLI
chains in the Genus database with same CATH superfamily
3KZYA 4IJDA 1SFEA 2ENAA 2KONA 2YTGA 4ZYHA 1LLMC 1E3PA 3C6MA 3H09A 1YUJA 2C37A 2LUQA 1YZ9A 5JEAF 4X62I 2EM3A 4B3RI 4KHPI 1X48A 1EKZA 2X7IA 1J5EI 2UXDE 3P3EA 1KTVA 4OX9I 2H36X 2BA0D 1T39A 4TUGA 2K4VA 3VYXA 1Z0BA 1Z0WA 2LJPA 2EOEA 1J26A 3OTOI 4WUCA 1T4OA 2EOFA 2IERA 4NXNI 4DV5E 4LF6E 1YH8A 2JEAA 2PNZB 4OO1A 5LMUE 2LTRA 4DR4E 1I94E 4DR2E 2B3TB 2NN6C 4X66I 1A1JA 2EP3A 4FK5C 3J7Yp 2NUEA 1YHCA 2GQ0A 2YSOA 1UDOA 1PJQA 1YYKA 2BA0G 2C37B 2DB2A 4WFTA 3HKMA 5A2QQ 2PRTA 1X6HA 1EH8A 4MYUA 5C0XF 4HACA 4RH8A 2UXCI 4YY3E 4M30A 3VK6A 4DV0E 1E3HA 2UU9I 2NN6E 2B7VA 2EM7A 2G7HA 4DV2I 4NZVA 4WXDA 5KL7A 1B63A 5K36F 2EPMX 2LT7A 4ZYDA 2GS8A 1N0VC 5KL3A 2JEAB 4OO1B 3QT8A 2NUGA 2CVEA 2R76A 2JE6A 1XMQI 3HPSA 5A6JA 4JI0E 5DRRA 2PO0A 4F2JC 5KL5A 2JY9A 4FW7A 4HXZA 1PJSA 4WPYA 1VISA 2UUBI 1GQEA 4P52A 3P1XA 2GLIA 4DMIA 2EM2A 2V89A 4LCHA 2LO3A 2EN8A 1T4NA 2EMAA 2MC5A 2RTXA 1P42A 4HACB 3ZM7A 2B9DA 4X9JA 1HNZI 1F2IG 2KHXA 2BBGA 2M7QA 1HK7A 3K6QA 5DRPA 4MYTA 4MLVA 4BMJA 2LBSB 4IZKA 1H72C 2VRDA 2YTPA 2YU8A 4JI5E 2N8XA 4WUDA 5L3JA 5JEAD 3M85D 3M7ND 2HK2A 2JE6B 4IFDF 1NHJA 2HHHI 2JVAA 2V87A 1IQOA 1Z0TA 2BA1G 2V2VA 2Z5CA 2M1SA 2LMZA 2PO0B 2C39A 2I9IA 1OYPA 2IOPA 3LPSA 2EORA 2K7IA 2VQFI 2V86A 1T4LB 2O1WA 1FKAE 2XEXA 1IBMI 4B3SI 3ZZTA 1Z5CA 2UUCE 5JEAA 4PU9A 4X64I 2LJUA 1KYQA 1AAYA 2R42A 4R1FA 5ELWA 2YTJA 4X65E 2EMZA 3T1HE 4IZKB 1IBKI 4LF5E 1PKPA 3TQMA 4FW9A 4R2CA 2A25A 2EMXA 1Z0VA 4MU1A 2Z5CB 2EM4A 2C39B 2MDGA 3ADLA 4DPTA 1R6LA 2RQLA 2LRSA 4R03A 4N3OA 2EWLA 1D6TA 1UDSA 5IT9C 4DPYA 5JEAB 5A6AA 1EA6A 3ZZ0A 4LOMA 5AE3A 2M9AA 2O1UA 4JI2I 2Q2EB 2EOIA 2JPAA 5C0XA 2RS6A 1Z1BA 2ENHA 3AUZA 4DV7I 1X5WA 2EN4A 4GQUA 2EN2A 2L8TA 1RC7A 5K36A 2N3GA 2YRMA 4I8OA 1ZR9A 4DV2E 1EI1A 3C4TA 3B8HA 4WYQB 4LF4E 1OYSA 5IT9Q 3KWRA 4GKKI 1NCSA 4FW3A 1XMQE 1RHYA 2EMFA 4BS9A 2EM0A 3P76A 2EJ4A 5A6BA 2RPCA 2GO3A 4FWHA 4JI8I 2EMKA 2YZTA 5C0XB 4ED4A 3WU5A 5BR8I 1RMDA 5LMNE 2R3VA 2RSMA 3L7ZA 4R2DA 4F6NA 4DR7E 5K36B 4O4KA 3T1YE 3GLLA 3ADIA 2JYAA 3PS2A 4ISAA 1IQSA 4M2ZA 2EM5A 3QT7A 2EL4A 4JYAI 2EPCA 4BHBA 1XNRI 4JG4A 4IFDA 3EPHA 2IHR1 5A6KA 4DR1E 2PNMA 4MU0A 3L00A 2YU5A 2UXBE 1DARA 4URLA 5IWAI 2E5LI 4DUYE 3C4BA 1SR9A 5IV8B 3M99B 4YHHE 3K1JA 3U1YA 4DV3I 4OO1D 4L8NA 4LF8E 2VQEI 2F4VI 2LV2A 1U2RA 2VQFE 4WXCA 2EMGA 1S4EA 1USUA 1WHQA 4WX9A 1IBME 4BCAA 2HK3A 2J65A 3L7ZB 3IWCA 5GMEA 5EL9A 4LF9I 3IWDA 1XHKA 2E1RA 2EN6A 5A2QC 1DGCA 3LTOA 2DMIA 4JV5I 2EQ1A 4BA1A 2EMCA 4JI3I 2EMHA 1N32E 4R2PA 1UN6B 3JAMQ 3J7AM 3AV0A 4JI1I 4IFDB 2EQ3A 4UTGA 1DQ3A 1ZU1A 1A1IA 4DV4E 1NEIA 3P3GA 3M6AA 2YTNA 4AIMA 4ZYEA 4MDTA 1YFHA 2NPFA 4DR6I 2UUAE 2Q8UA 1BBGA 1A1GA 3K85A 1YSAC 4LF7E 4DKKA 4O24A 1ZAAC 1X49A 4Z7YA 4LFBE 1L4SA 2WBUA 4P7AA 4DV6I 2YTIA 1GTKA 4USMA 1N33I 5KL4A 2A2CA 1MX0A 5AASA 2EQ0A 3FIGA 4JI2E 4BA1B 3EPJA 4LPFA 3LMLA 2O1TA 4AM3A 3ZKDA 1FWLA 2ODRC 1HR0I 1XMOI 2JEBB 4R2RA 2AE8A 3F0NA 2V85A 2EOXA 1RR9A 1FI4A 2WP8A 2HKEA 3BBGA 4ZVIA 2BR2A 4L5NC 2J7JA 1OYRA 1N34I 2C38A 2EPOA 2EN1A 2EPXA 1EH7A 2JR1A 2GHFA 3EQ1A 2L6MA 4F9CB 4GKKE 2WW4A 1K47A 4Q35B 3Q6NA 4LFAI 4DV1E 4MLQA 2EOJA 1MG7A 2MDRA 2F1DA 3MHHC 2PNLA 4JI4I 4GEQB 2ZM6E 2LCEA 2LUPB 5KL2A 1Y4SA 4U3BA 5BR8E 5FLXQ 4DR5E 1Y60A 4MU4A 4JI7I 1NHIA 2A2DA 2ELZA 2AJ4A 1Z5BA 4FW6A 5DNXA 4OO1C 1HNXE 2GPIA 1S16A 3ZZUA 1N36I 4K0KI 5DNLA 4QNJA 1A1KA 1RREA 1X3CA 1Y6ZA 4NXME 2WP8B 3EPLA 3HXLA 3BF2A 1ZM3A 2BR2B 1FJGE 2C38B 4XTJA 4B3MI 2LJHA 4P78A 4JYAE 3HULA 4X8WA 2NUFA 1Y5YA 1ZBQA 2NN6F 1B62A 4OO1E 2EN7A 3THOB 1IBLE 2YRKA 3HQ1A 3M85G 4M0VA 2V8QB 3M7NG 4DV3E 1JK1A 4B3RE 4RHBB 2CTDA 2ZBKB 3DF6A 4KWYA 4F54A 3ADGA 4X62E 4KHPE 1J5EE 1FNMA 2VESA 3HJCA 4FWDA 1O0WA 1XNQE 4OX9E 4HYMA 4O43A 5AC4A 5C0XD 4LF9E 2RSIA 2CT1A 5A69A 2EOMA 2YPNA 3OTOE 2DGCA 2JP9A 2GO4A 4Q28A 4NXNE 5K36D 1JK2A 2EMLA 1G2DC 5FWKA 2VF1A 3WU3A 3QT6A 2NA2A 2EN3A 4X66E 2V2QA 2ZITA 3P3CA 2EOHA 3PYFA 4DXLA 1ZXMA 4JI6I 2YWQA 4LF6I 1UBDC 5A6BD 2UXCE 2JOBA 3V5RA 1I94I 2UU9E 5AE1A 1N33E 3MHSC 1UDNA 1UEKA 2DLQA 5EKWA 2HGHA 2RS7A 2B7TA 1BKNA 2F8BA 2YTOA 3J7AG 1XMOE 4R2AA 2N3HA 2EPAA 5JEAC 2L2MA 4YY3I 4DV0I 3PYGA 4GKJI 4IFDD 1ZM9A 2V8PA 2UUBE 2DIXA 2ADRA 1BB8A 4MU3A 2NN6D 3BIDA 2EZ6A 1HNZE 5JEAE 2ELYA 1Z0GA 4JI0I 3WU6A 4FW4A 4B3TI 1ZBTA 4DU7A 4BC7A 1PJTA 3K17A 2PO1A 4JI7E 1WRJA 2V83A 4WSPA 3GONA 2PO2A 4J3DA 3U1KA 4AQYI 2MKDA 3JAMC 2HHHE 3J81Q 3JU0A 2EMYA 2NN6A 2EL6A 2R1FA 4B3ME 3DJWA 4UT4A 3B4TA 4KZSA 2WNRA 2EFGA 3THNA 4JI5I 2VF3A 4B3SE 5K36C 4DPUA 2FTXB 4X64E 4EMDA 2EM6A 3CDIA 4DPWA 1EH6A 4NHRA 4LCGA 2L2NA 3J80Q 3B82A 2PO1B 2EPKX 4BA2A 1ZM4A 1IBKE 1ZM2A 2JEBA 4M1KA 2YTQA 2PO2B 5K36E 3QG5C 2IESA 4BC9A 2BM1A 2L92A 2UUCI 2J7KA 2VE7C 1H74A 1MU5A 2NN6B 3Q6MA 1UILA 5KL6A 3B78A 4X65I 4FW5A 4NBQA 3T1HI 1PDAA 3UHMA 1GZ6A 2WNRB 4FN5A 2LTSA 3LLHA 4LF5I 3PS3A 2BM0A 2EOYA 1N3GA 4PRXA 1TN9A 2NABA 1TF3A 4WUBA 4MQYA 2LE2A 4R2QA 2I13A 2EPLX 2HFSA 1ZXNA 4IS1C 4IFDC 1UHZA 4BA2B 4JI6E 4N4RB 2EMWA 1PVGA 2YTFA 3NZKA 3V2UC 4DV7E 4AIDA 2EOSA 5AC5A 1P47A 1YYOA 2WZOA 2HC5A 5FLXC 1Z59A 2DEJA 4LU9A 5DRQA 1HNWI 2YSPA 3EPKA 2DMYA 2LVHA 2WCC3 2O3ZA 4IS9A 1XXEA 2DEIA 2V34A 1WJPA 4IFDE 1BBOA 4LTYA 2FV4B 4F9AB 5AE2A 5LLQA 1NHHA 1X47A 4GKJE 5DNYA 4IZJD 2WBSA 4JI8E 4J8ZA 2YRHA 5LL6R 2X36A 4LF4I 4F9BB 4HEIA 1ELOA 4LFCI 2EM8A 4U3DA 3BGHA 3CDJA 2DLKA 4R2EA 2CGEA 5IXMB 2EM9A 1QU6A 4B3TE 3LNUA 1XNRE 3UK3C 1VI7A 1WUUA 2Z5EA 4IZJA 3VHTB 1Y4UA 4RPFA 2BA1D 1H7UA 1KIJA 5LMNI 2EOOA 4AQYE 1PIEA 2EL5A 3PRYA 3ADJA 4R8OA 4BBYA 5IWAE 2E5LE 3T1YI 4DR7I 1UDQA 4DUZI 2VQEE 2F4VE 2Z5BA 2E1MA 2YTEA 5GMDA 4DR1I 3ECRA 4DR3I 1RQ0A 4HTGA 2UXBI 2EMBA 4QNKA 4DUYI 4JV5E 3GCMA 1KJKA 4YHHI 4JI3E 2EPNA 3ZOQB 4LF8I 2IOQA 3KRNA 4JI1E 4M9VC 4IZJB 1MGTA 2CG9A 2YT4A 2M4IA 4OOGC 2UXDI 3HPZA 2YTDA 3PYEA 1KVKA 3HTXA 1YYWA 3CWVA 4DR6E 2EPRA 1FWKA 2EOQA 3PYDA 1DI2A 1N32I 4F6MA 3GMEA 4FWGA 4DV5I 2Z5BB 4P7DA 1R6MA 2EPZA 5LMUI 4DV6E 1MEYC 1YUIA 4DV4I 3VYYA 4DR4I 2D9HA 2JT2A 4DR2I 5CFFE 4OO1F 2MC6A 3F6HA 4DPXA 5F3WA 3F6GA 2UUAI 3DD6A 3WU4A 1IMUA 1USVA 4LF7I 1A6FA 2V2ZA 1HR0E 1WHNA 4LFBI 4BHCA 1G2FC 3MSWA 1QNTA 2ENCA 3P06A 4OZEA 2L2KB 5T6JA 4TUIA 1HNWE 2JWOA 1N34E 2BV3A 4HY1A 1AH5A 3PS1A 4I3HA 1QZRA 3J81C 4GZNC 2E72A 2KOUA 2L3JA 1X6FA 3KZZA 1Z0EA 1WXRA 2CSHA 1Z5AA 5DROA 2HJJA 4LFAE 1T38A 1XNQI 2JXPA 1A1HA 4JI4E 2EPPA 2JOXA 2HKJA 3QT5A 3RMPA 4KQVA 4USKA 4WSGA 3ZKBA 5ADZA 2CZ9A 1X6EA 4LFCE 2L33A 1A1FA 4K0KE 1H73A 2CPNA 5TSEA 3IWBA 3J80C 2L3CA 1N36E 2MKNA 2EMIA 1B69A 1OJ4A 1Z0CA 3H4LA 4OKGA 4DV1I 2FGGA 3JTZA 1NZ0A 4Z7CA 5C0XC 1H7SA 2ZM6I 2ODRD 2DSYA 2EOZA 2WBTA 1TF6A 4DR5I 2OI2A 3C6KA 3Q1QA 4O5GA 4ZYGA 1YPNA 1A1LA 3D4JA 4LCFA 1STUA 1KKHA 1HNXI 1N0UA 2EE8A 3H1CA 4R2SA 4NXMI 2O1VA 4PRVA 2HFUA 5C0XE 2V88A 2BB8A 4DUZE 1FJGI 4DU8A 2DRPA 3OMLA 2PNZA 2EPUA 4DR3E 1IBLI
chains in the Genus database with same CATH topology
2KONA 4B3RI 3H09A 2LUQA 1YZ9A 4X62I 4KHPI 1X48A 1EKZA 2X7IA 1J5EI 2UXDE 1KTVA 4OX9I 2H36X 1Z0BA 4TUGA 2K4VA 3VYXA 1Z0WA 2LJPA 1J26A 3OTOI 4WUCA 1T4OA 4NXNI 4DV5E 4LF6E 5LMUE 2LTRA 4DR4E 1I94E 4DR2E 2B3TB 4X66I 2NUEA 3J7Yp 2GQ0A 1YYKA 2DB2A 4WFTA 5A2QQ 4MYUA 4HACA 2UXCI 4YY3E 4M30A 3VK6A 4DV0E 2UU9I 2B7VA 2G7HA 4DV2I 1B63A 2GS8A 1N0VC 3QT8A 2NUGA 1XMQI 3HPSA 4JI0E 2JY9A 4HXZA 4WPYA 1VISA 2UUBI 1GQEA 4P52A 3P1XA 4DMIA 2V89A 4HACB 1T4NA 2MC5A 2RTXA 3ZM7A 1HNZI 2B9DA 2KHXA 2M7QA 1HK7A 3K6QA 4MYTA 4BMJA 2LBSB 4IZKA 1H72C 4JI5E 4WUDA 5L3JA 2HK2A 1NHJA 2HHHI 2JVAA 2V87A 1Z0TA 2V2VA 2Z5CA 3V2UC 2M1SA 2LMZA 3LPSA 2IOPA 2VQFI 2V86A 1T4LB 2O1WA 1FKAE 2XEXA 1IBMI 4B3SI 3ZZTA 1Z5CA 2UUCE 4PU9A 4X64I 4R1FA 2R42A 4X65E 3T1HE 4IZKB 1IBKI 4LF5E 1PKPA 4FW9A 1Z0VA 2Z5CB 3ADLA 4DPTA 2LRSA 4R03A 4N3OA 2EWLA 1D6TA 5IT9C 4DPYA 1EA6A 3ZZ0A 5AE3A 2O1UA 4JI2I 2Q2EB 2RS6A 3AUZA 4DV7I 2L8TA 1RC7A 2N3GA 4I8OA 4DV2E 1EI1A 3C4TA 3B8HA 4WYQB 4LF4E 5IT9Q 3KWRA 4GKKI 1XMQE 4BS9A 4FWHA 4JI8I 2YZTA 4ED4A 3WU5A 5BR8I 5LMNE 2R3VA 2RSMA 4DR7E 3T1YE 3ADIA 4M2ZA 3QT7A 4JYAI 1XNRI 4JG4A 2PNMA 2IHR1 4DR1E 2UXBE 1DARA 4URLA 5IWAI 2E5LI 4DUYE 3C4BA 1SR9A 3K1JA 4YHHE 4DV3I 4L8NA 4LF8E 2VQEI 2F4VI 1U2RA 2VQFE 1USUA 1S4EA 1XNQI 1WHQA 1IBME 2HK3A 4BCAA 5GMEA 3IWCA 4LF9I 3IWDA 1XHKA 2E1RA 5A2QC 3LTOA 4JV5I 4JI3I 1N32E 3J7AM 3JAMQ 3AV0A 4JI1I 4UTGA 1DQ3A 4DV4E 3M6AA 2NPFA 4DR6I 2UUAE 3K85A 4LF7E 4DKKA 1X49A 4Z7YA 4LFBE 4P7AA 4DV6I 4USMA 1N33I 2A2CA 1MX0A 5AASA 3FIGA 4JI2E 3LMLA 2O1TA 3ZKDA 1FWLA 2ODRC 1HR0I 1XMOI 3F0NA 2V85A 1RR9A 1FI4A 2HKEA 4ZVIA 4L5NC 1N34I 2JR1A 2L6MA 4F9CB 4GKKE 2WW4A 1K47A 3Q6NA 4LFAI 4DV1E 1MG7A 2MDRA 2PNLA 4JI4I 4GEQB 2ZM6E 1Y4SA 2LUPB 5BR8E 5FLXQ 4DR5E 4JI7I 1NHIA 2A2DA 2AJ4A 1Z5BA 1HNXE 3ZZUA 1S16A 1N36I 4K0KI 1RREA 1Y6ZA 4NXME 3HXLA 1ZM3A 1FJGE 4XTJA 4B3MI 2LJHA 4P78A 4JYAE 3HULA 4X8WA 2NUFA 1ZBQA 1B62A 1IBLE 3HQ1A 4M0VA 2V8QB 4DV3E 4B3RE 2ZBKB 1FNMA 4F54A 4KHPE 3DF6A 4X62E 3ADGA 1J5EE 4FWDA 3HJCA 4HYMA 1O0WA 1XNQE 4OX9E 4LF9E 3OTOE 4Q28A 4NXNE 5FWKA 2VF1A 3WU3A 3QT6A 2NA2A 2V2QA 4X66E 2ZITA 3PYFA 4DXLA 1ZXMA 4JI6I 4LF6I 2UXCE 2JOBA 3V5RA 1I94I 2UU9E 5AE1A 1N33E 1UEKA 2RS7A 2B7TA 1BKNA 2F8BA 3J7AG 1XMOE 2N3HA 2L2MA 4YY3I 4DV0I 3PYGA 4GKJI 1ZM9A 2V8PA 2UUBE 2DIXA 2EZ6A 1HNZE 1Z0GA 4JI0I 3WU6A 4B3TI 1ZBTA 4DU7A 4BC7A 3K17A 4JI7E 2V83A 4WSPA 3GONA 4AQYI 3JAMC 2HHHE 3J81Q 3JU0A 4B3ME 3DJWA 4UT4A 4KZSA 2EFGA 4JI5I 2VF3A 4B3SE 4DPUA 2FTXB 4X64E 4EMDA 4DPWA 2L2NA 3J80Q 3B82A 1ZM4A 1IBKE 1ZM2A 4M1KA 4BC9A 2BM1A 2L92A 2UUCI 2J7KA 2VE7C 1H74A 1MU5A 3Q6MA 1UILA 3B78A 4X65I 3T1HI 1GZ6A 4FN5A 2LTSA 3LLHA 4LF5I 2BM0A 4PRXA 4WUBA 2LE2A 2HFSA 1ZXNA 1UHZA 4JI6E 1PVGA 4DV7E 1YYOA 2WZOA 5FLXC 1Z59A 2DEJA 4LU9A 1HNWI 2DMYA 2DEIA 2V34A 4LTYA 2FV4B 4F9AB 5AE2A 1NHHA 1X47A 4GKJE 5DNYA 4IZJD 4JI8E 4J8ZA 5LL6R 2X36A 4LF4I 4F9BB 1ELOA 4LFCI 2CGEA 1QU6A 4B3TE 3LNUA 1XNRE 2Z5EA 1WUUA 4IZJA 4RPFA 1Y4UA 1H7UA 1KIJA 5LMNI 3PRYA 4AQYE 1PIEA 3ADJA 4R8OA 4BBYA 5IWAE 2E5LE 3T1YI 4DR7I 4DUZI 2VQEE 2F4VE 2Z5BA 2E1MA 5GMDA 4DR1I 4DR3I 1RQ0A 2UXBI 4DUYI 4JV5E 4YHHI 4JI3E 3ZOQB 4LF8I 2IOQA 4JI1E 4IZJB 2CG9A 2YT4A 2M4IA 4OOGC 2UXDI 3HPZA 3PYEA 1KVKA 3HTXA 1YYWA 3CWVA 4DR6E 1FWKA 3PYDA 1DI2A 1N32I 4FWGA 4DV5I 2Z5BB 4P7DA 5LMUI 4DV6E 4DV4I 4DR4I 3VYYA 4DR2I 5CFFE 2MC6A 3F6HA 4DPXA 5F3WA 3F6GA 2UUAI 3WU4A 1USVA 4LF7I 1A6FA 2V2ZA 1HR0E 1WHNA 4LFBI 3MSWA 3P06A 2L2KB 5T6JA 4TUIA 1HNWE 2JWOA 1N34E 2BV3A 4HY1A 4I3HA 1QZRA 3J81C 2KOUA 2L3JA 1Z0EA 1Z5AA 1WXRA 4LFAE 4JI4E 2HKJA 2JOXA 3QT5A 3RMPA 4KQVA 4USKA 3ZKBA 5ADZA 2CZ9A 4LFCE 2L33A 1H73A 4K0KE 2CPNA 3J80C 3IWBA 2L3CA 1N36E 1OJ4A 1Z0CA 3H4LA 4DV1I 2FGGA 3JTZA 1NZ0A 4Z7CA 1H7SA 2ZM6I 2ODRD 2DSYA 4DR5I 2OI2A 3Q1QA 3D4JA 1STUA 1KKHA 1HNXI 1N0UA 4NXMI 2O1VA 4PRVA 2HFUA 1FJGI 2V88A 4DUZE 4DU8A 3OMLA 4DR3E 1IBLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R I;  2LUQ A;  1YZ9 A;  4X62 I;  4KHP I;  1X48 A;  1EKZ A;  2X7I A;  1J5E I;  2UXD E;  1KTV A;  4OX9 I;  1Z0B A;  3VYX A;  1Z0W A;  2LJP A;  1J26 A;  3OTO I;  4WUC A;  1T4O A;  4NXN I;  4DV5 E;  4LF6 E;  5LMU E;  2LTR A;  4DR4 E;  1I94 E;  4DR2 E;  2B3T B;  4X66 I;  2NUE A;  3J7Y p;  1YYK A;  2DB2 A;  4WFT A;  5A2Q Q;  4MYU A;  4HAC A;  2UXC I;  4YY3 E;  4M30 A;  4DV0 E;  2UU9 I;  2B7V A;  4DV2 I;  1B63 A;  2GS8 A;  1N0V C;  3QT8 A;  2NUG A;  1XMQ I;  4JI0 E;  2JY9 A;  4HXZ A;  1VIS A;  2UUB I;  1GQE A;  4P52 A;  3P1X A;  4HAC B;  1T4N A;  2RTX A;  3ZM7 A;  1HNZ I;  2KHX A;  4MYT A;  2LBS B;  1H72 C;  4JI5 E;  4WUD A;  5L3J A;  2HK2 A;  1NHJ A;  2HHH I;  2JVA A;  1Z0T A;  2V2V A;  3V2U C;  3LPS A;  2VQF I;  1T4L B;  2XEX A;  1FKA E;  1IBM I;  4B3S I;  3ZZT A;  1Z5C A;  2UUC E;  4PU9 A;  4X64 I;  4R1F A;  2R42 A;  4X65 E;  3T1H E;  1IBK I;  4LF5 E;  1PKP A;  4FW9 A;  1Z0V A;  3ADL A;  4DPT A;  2LRS A;  1D6T A;  5IT9 C;  4DPY A;  1EA6 A;  3ZZ0 A;  4JI2 I;  2Q2E B;  2RS6 A;  4DV7 I;  1RC7 A;  2N3G A;  1EI1 A;  4DV2 E;  3B8H A;  3C4T A;  4WYQ B;  4LF4 E;  5IT9 Q;  4GKK I;  1XMQ E;  4FWH A;  4JI8 I;  4ED4 A;  3WU5 A;  5BR8 I;  5LMN E;  2R3V A;  2RSM A;  4DR7 E;  3T1Y E;  3ADI A;  4M2Z A;  3QT7 A;  4JYA I;  1XNR I;  4JG4 A;  2IHR 1;  4DR1 E;  2UXB E;  1DAR A;  4URL A;  5IWA I;  2E5L I;  4DUY E;  3C4B A;  3K1J A;  4YHH E;  4DV3 I;  4LF8 E;  2VQE I;  2F4V I;  1U2R A;  2VQF E;  1S4E A;  1XNQ I;  1WHQ A;  1IBM E;  2HK3 A;  5GME A;  4LF9 I;  1XHK A;  2E1R A;  5A2Q C;  3LTO A;  4JV5 I;  4JI3 I;  1N32 E;  3J7A M;  3JAM Q;  4JI1 I;  4UTG A;  4DV4 E;  3M6A A;  2NPF A;  4DR6 I;  2UUA E;  4LF7 E;  4DKK A;  1X49 A;  4Z7Y A;  4LFB E;  4P7A A;  4DV6 I;  4USM A;  1N33 I;  2A2C A;  1MX0 A;  4JI2 E;  3ZKD A;  1FWL A;  1HR0 I;  1XMO I;  3F0N A;  1RR9 A;  1FI4 A;  2HKE A;  4ZVI A;  1N34 I;  4GKK E;  2WW4 A;  1K47 A;  4LFA I;  4DV1 E;  1MG7 A;  2MDR A;  4JI4 I;  2ZM6 E;  2LUP B;  5BR8 E;  5FLX Q;  4DR5 E;  4JI7 I;  1NHI A;  2A2D A;  2AJ4 A;  1Z5B A;  1HNX E;  3ZZU A;  1S16 A;  1N36 I;  4K0K I;  1RRE A;  4NXM E;  1ZM3 A;  1FJG E;  4XTJ A;  4B3M I;  2LJH A;  4JYA E;  3HUL A;  4X8W A;  2NUF A;  1B62 A;  1IBL E;  4DV3 E;  4B3R E;  2ZBK B;  1FNM A;  4HYM A;  4KHP E;  4X62 E;  3ADG A;  1J5E E;  4FWD A;  1O0W A;  1XNQ E;  4OX9 E;  4LF9 E;  3OTO E;  4NXN E;  3WU3 A;  3QT6 A;  2NA2 A;  2V2Q A;  4X66 E;  2ZIT A;  3PYF A;  4DXL A;  1ZXM A;  4JI6 I;  4LF6 I;  2UXC E;  3V5R A;  1I94 I;  2UU9 E;  1N33 E;  1UEK A;  2RS7 A;  2B7T A;  1BKN A;  3J7A G;  1XMO E;  2N3H A;  2L2M A;  4YY3 I;  4DV0 I;  3PYG A;  4GKJ I;  1ZM9 A;  2V8P A;  2UUB E;  2DIX A;  2EZ6 A;  1HNZ E;  1Z0G A;  4JI0 I;  3WU6 A;  4B3T I;  1ZBT A;  4DU7 A;  3K17 A;  4JI7 E;  3GON A;  4AQY I;  3JAM C;  2HHH E;  3J81 Q;  4B3M E;  4UT4 A;  2EFG A;  4JI5 I;  2VF3 A;  4B3S E;  4DPU A;  4X64 E;  4EMD A;  4DPW A;  2L2N A;  3J80 Q;  3B82 A;  1ZM4 A;  1IBK E;  1ZM2 A;  4M1K A;  2BM1 A;  2UUC I;  2J7K A;  1H74 A;  1MU5 A;  1UIL A;  3B78 A;  4X65 I;  3T1H I;  4FN5 A;  2LTS A;  3LLH A;  4LF5 I;  2BM0 A;  4PRX A;  4WUB A;  2HFS A;  1ZXN A;  1UHZ A;  4JI6 E;  1PVG A;  4DV7 E;  1YYO A;  5FLX C;  1Z59 A;  2DEJ A;  1HNW I;  2DMY A;  2DEI A;  2V34 A;  1NHH A;  1X47 A;  4GKJ E;  4JI8 E;  5LL6 R;  2X36 A;  4LF4 I;  1ELO A;  4LFC I;  1QU6 A;  4B3T E;  3LNU A;  1XNR E;  1WUU A;  4RPF A;  1H7U A;  1KIJ A;  5LMN I;  4AQY E;  1PIE A;  3ADJ A;  5IWA E;  2E5L E;  4DR7 I;  3T1Y I;  4DUZ I;  2VQE E;  2F4V E;  5GMD A;  4DR1 I;  4DR3 I;  1RQ0 A;  2UXB I;  4DUY I;  4JV5 E;  4YHH I;  4JI3 E;  4LF8 I;  4JI1 E;  2YT4 A;  4OOG C;  2UXD I;  3PYE A;  1KVK A;  3HTX A;  1YYW A;  3CWV A;  4DR6 E;  1FWK A;  3PYD A;  1DI2 A;  1N32 I;  4FWG A;  4DV5 I;  5LMU I;  4DV6 E;  4DV4 I;  4DR4 I;  3VYY A;  4DR2 I;  5CFF E;  4DPX A;  2UUA I;  3WU4 A;  4LF7 I;  1A6F A;  2V2Z A;  1HR0 E;  1WHN A;  4LFB I;  2L2K B;  1HNW E;  1N34 E;  2BV3 A;  4HY1 A;  4I3H A;  1QZR A;  3J81 C;  2L3J A;  1Z0E A;  1Z5A A;  4LFA E;  4JI4 E;  2HKJ A;  3QT5 A;  4KQV A;  4USK A;  3ZKB A;  2CZ9 A;  4LFC E;  2L33 A;  1H73 A;  4K0K E;  2CPN A;  1N36 E;  1OJ4 A;  2L3C A;  3J80 C;  1Z0C A;  3H4L A;  4DV1 I;  1NZ0 A;  4Z7C A;  1H7S A;  2ZM6 I;  4DR5 I;  2OI2 A;  3Q1Q A;  3D4J A;  1STU A;  1KKH A;  1HNX I;  1N0U A;  4NXM I;  4PRV A;  2HFU A;  1FJG I;  4DUZ E;  4DU8 A;  4DR3 E;  1IBL I; 
#chains in the Genus database with same CATH topology
 3KZY A;  4IJD A;  1SFE A;  2ENA A;  2KON A;  2YTG A;  4ZYH A;  1LLM C;  1E3P A;  3C6M A;  3H09 A;  1YUJ A;  2C37 A;  2LUQ A;  1YZ9 A;  5JEA F;  4X62 I;  2EM3 A;  4B3R I;  4KHP I;  1X48 A;  1EKZ A;  2X7I A;  1J5E I;  2UXD E;  3P3E A;  1KTV A;  4OX9 I;  2H36 X;  2BA0 D;  1T39 A;  4TUG A;  2K4V A;  3VYX A;  1Z0B A;  1Z0W A;  2LJP A;  2EOE A;  1J26 A;  3OTO I;  4WUC A;  1T4O A;  2EOF A;  2IER A;  4NXN I;  4DV5 E;  4LF6 E;  1YH8 A;  2JEA A;  2PNZ B;  4OO1 A;  5LMU E;  2LTR A;  4DR4 E;  1I94 E;  4DR2 E;  2B3T B;  2NN6 C;  4X66 I;  1A1J A;  2EP3 A;  4FK5 C;  3J7Y p;  2NUE A;  1YHC A;  2GQ0 A;  2YSO A;  1UDO A;  1PJQ A;  1YYK A;  2BA0 G;  2C37 B;  2DB2 A;  4WFT A;  3HKM A;  5A2Q Q;  2PRT A;  1X6H A;  1EH8 A;  4MYU A;  5C0X F;  4HAC A;  4RH8 A;  2UXC I;  4YY3 E;  4M30 A;  3VK6 A;  4DV0 E;  1E3H A;  2UU9 I;  2NN6 E;  2B7V A;  2EM7 A;  2G7H A;  4DV2 I;  4NZV A;  4WXD A;  5KL7 A;  1B63 A;  5K36 F;  2EPM X;  2LT7 A;  4ZYD A;  2GS8 A;  1N0V C;  5KL3 A;  2JEA B;  4OO1 B;  3QT8 A;  2NUG A;  2CVE A;  2R76 A;  2JE6 A;  1XMQ I;  3HPS A;  5A6J A;  4JI0 E;  5DRR A;  2PO0 A;  4F2J C;  5KL5 A;  2JY9 A;  4FW7 A;  4HXZ A;  1PJS A;  4WPY A;  1VIS A;  2UUB I;  1GQE A;  4P52 A;  3P1X A;  2GLI A;  4DMI A;  2EM2 A;  2V89 A;  4LCH A;  2LO3 A;  2EN8 A;  1T4N A;  2EMA A;  2MC5 A;  2RTX A;  1P42 A;  4HAC B;  3ZM7 A;  2B9D A;  4X9J A;  1HNZ I;  1F2I G;  2KHX A;  2BBG A;  2M7Q A;  1HK7 A;  3K6Q A;  5DRP A;  4MYT A;  4MLV A;  4BMJ A;  2LBS B;  4IZK A;  1H72 C;  2VRD A;  2YTP A;  2YU8 A;  4JI5 E;  2N8X A;  4WUD A;  5L3J A;  5JEA D;  3M85 D;  3M7N D;  2HK2 A;  2JE6 B;  4IFD F;  1NHJ A;  2HHH I;  2JVA A;  2V87 A;  1IQO A;  1Z0T A;  2BA1 G;  2V2V A;  2Z5C A;  2M1S A;  2LMZ A;  2PO0 B;  2C39 A;  2I9I A;  1OYP A;  2IOP A;  3LPS A;  2EOR A;  2K7I A;  2VQF I;  2V86 A;  1T4L B;  2O1W A;  1FKA E;  2XEX A;  1IBM I;  4B3S I;  3ZZT A;  1Z5C A;  2UUC E;  5JEA A;  4PU9 A;  4X64 I;  2LJU A;  1KYQ A;  1AAY A;  2R42 A;  4R1F A;  5ELW A;  2YTJ A;  4X65 E;  2EMZ A;  3T1H E;  4IZK B;  1IBK I;  4LF5 E;  1PKP A;  3TQM A;  4FW9 A;  4R2C A;  2A25 A;  2EMX A;  1Z0V A;  4MU1 A;  2Z5C B;  2EM4 A;  2C39 B;  2MDG A;  3ADL A;  4DPT A;  1R6L A;  2RQL A;  2LRS A;  4R03 A;  4N3O A;  2EWL A;  1D6T A;  1UDS A;  5IT9 C;  4DPY A;  5JEA B;  5A6A A;  1EA6 A;  3ZZ0 A;  4LOM A;  5AE3 A;  2M9A A;  2O1U A;  4JI2 I;  2Q2E B;  2EOI A;  2JPA A;  5C0X A;  2RS6 A;  1Z1B A;  2ENH A;  3AUZ A;  4DV7 I;  1X5W A;  2EN4 A;  4GQU A;  2EN2 A;  2L8T A;  1RC7 A;  5K36 A;  2N3G A;  2YRM A;  4I8O A;  1ZR9 A;  4DV2 E;  1EI1 A;  3C4T A;  3B8H A;  4WYQ B;  4LF4 E;  1OYS A;  5IT9 Q;  3KWR A;  4GKK I;  1NCS A;  4FW3 A;  1XMQ E;  1RHY A;  2EMF A;  4BS9 A;  2EM0 A;  3P76 A;  2EJ4 A;  5A6B A;  2RPC A;  2GO3 A;  4FWH A;  4JI8 I;  2EMK A;  2YZT A;  5C0X B;  4ED4 A;  3WU5 A;  5BR8 I;  1RMD A;  5LMN E;  2R3V A;  2RSM A;  3L7Z A;  4R2D A;  4F6N A;  4DR7 E;  5K36 B;  4O4K A;  3T1Y E;  3GLL A;  3ADI A;  2JYA A;  3PS2 A;  4ISA A;  1IQS A;  4M2Z A;  2EM5 A;  3QT7 A;  2EL4 A;  4JYA I;  2EPC A;  4BHB A;  1XNR I;  4JG4 A;  4IFD A;  3EPH A;  2IHR 1;  5A6K A;  4DR1 E;  2PNM A;  4MU0 A;  3L00 A;  2YU5 A;  2UXB E;  1DAR A;  4URL A;  5IWA I;  2E5L I;  4DUY E;  3C4B A;  1SR9 A;  5IV8 B;  3M99 B;  4YHH E;  3K1J A;  3U1Y A;  4DV3 I;  4OO1 D;  4L8N A;  4LF8 E;  2VQE I;  2F4V I;  2LV2 A;  1U2R A;  2VQF E;  4WXC A;  2EMG A;  1S4E A;  1USU A;  1WHQ A;  4WX9 A;  1IBM E;  4BCA A;  2HK3 A;  2J65 A;  3L7Z B;  3IWC A;  5GME A;  5EL9 A;  4LF9 I;  3IWD A;  1XHK A;  2E1R A;  2EN6 A;  5A2Q C;  1DGC A;  3LTO A;  2DMI A;  4JV5 I;  2EQ1 A;  4BA1 A;  2EMC A;  4JI3 I;  2EMH A;  1N32 E;  4R2P A;  1UN6 B;  3JAM Q;  3J7A M;  3AV0 A;  4JI1 I;  4IFD B;  2EQ3 A;  4UTG A;  1DQ3 A;  1ZU1 A;  1A1I A;  4DV4 E;  1NEI A;  3P3G A;  3M6A A;  2YTN A;  4AIM A;  4ZYE A;  4MDT A;  1YFH A;  2NPF A;  4DR6 I;  2UUA E;  2Q8U A;  1BBG A;  1A1G A;  3K85 A;  1YSA C;  4LF7 E;  4DKK A;  4O24 A;  1ZAA C;  1X49 A;  4Z7Y A;  4LFB E;  1L4S A;  2WBU A;  4P7A A;  4DV6 I;  2YTI A;  1GTK A;  4USM A;  1N33 I;  5KL4 A;  2A2C A;  1MX0 A;  5AAS A;  2EQ0 A;  3FIG A;  4JI2 E;  4BA1 B;  3EPJ A;  4LPF A;  3LML A;  2O1T A;  4AM3 A;  3ZKD A;  1FWL A;  2ODR C;  1HR0 I;  1XMO I;  2JEB B;  4R2R A;  2AE8 A;  3F0N A;  2V85 A;  2EOX A;  1RR9 A;  1FI4 A;  2WP8 A;  2HKE A;  3BBG A;  4ZVI A;  2BR2 A;  4L5N C;  2J7J A;  1OYR A;  1N34 I;  2C38 A;  2EPO A;  2EN1 A;  2EPX A;  1EH7 A;  2JR1 A;  2GHF A;  3EQ1 A;  2L6M A;  4F9C B;  4GKK E;  2WW4 A;  1K47 A;  4Q35 B;  3Q6N A;  4LFA I;  4DV1 E;  4MLQ A;  2EOJ A;  1MG7 A;  2MDR A;  2F1D A;  3MHH C;  2PNL A;  4JI4 I;  4GEQ B;  2ZM6 E;  2LCE A;  2LUP B;  5KL2 A;  1Y4S A;  4U3B A;  5BR8 E;  5FLX Q;  4DR5 E;  1Y60 A;  4MU4 A;  4JI7 I;  1NHI A;  2A2D A;  2ELZ A;  2AJ4 A;  1Z5B A;  4FW6 A;  5DNX A;  4OO1 C;  1HNX E;  2GPI A;  1S16 A;  3ZZU A;  1N36 I;  4K0K I;  5DNL A;  4QNJ A;  1A1K A;  1RRE A;  1X3C A;  1Y6Z A;  4NXM E;  2WP8 B;  3EPL A;  3HXL A;  3BF2 A;  1ZM3 A;  2BR2 B;  1FJG E;  2C38 B;  4XTJ A;  4B3M I;  2LJH A;  4P78 A;  4JYA E;  3HUL A;  4X8W A;  2NUF A;  1Y5Y A;  1ZBQ A;  2NN6 F;  1B62 A;  4OO1 E;  2EN7 A;  3THO B;  1IBL E;  2YRK A;  3HQ1 A;  3M85 G;  4M0V A;  2V8Q B;  3M7N G;  4DV3 E;  1JK1 A;  4B3R E;  4RHB B;  2CTD A;  2ZBK B;  3DF6 A;  4KWY A;  4F54 A;  3ADG A;  4X62 E;  4KHP E;  1J5E E;  1FNM A;  2VES A;  3HJC A;  4FWD A;  1O0W A;  1XNQ E;  4OX9 E;  4HYM A;  4O43 A;  5AC4 A;  5C0X D;  4LF9 E;  2RSI A;  2CT1 A;  5A69 A;  2EOM A;  2YPN A;  3OTO E;  2DGC A;  2JP9 A;  2GO4 A;  4Q28 A;  4NXN E;  5K36 D;  1JK2 A;  2EML A;  1G2D C;  5FWK A;  2VF1 A;  3WU3 A;  3QT6 A;  2NA2 A;  2EN3 A;  4X66 E;  2V2Q A;  2ZIT A;  3P3C A;  2EOH A;  3PYF A;  4DXL A;  1ZXM A;  4JI6 I;  2YWQ A;  4LF6 I;  1UBD C;  5A6B D;  2UXC E;  2JOB A;  3V5R A;  1I94 I;  2UU9 E;  5AE1 A;  1N33 E;  3MHS C;  1UDN A;  1UEK A;  2DLQ A;  5EKW A;  2HGH A;  2RS7 A;  2B7T A;  1BKN A;  2F8B A;  2YTO A;  3J7A G;  1XMO E;  4R2A A;  2N3H A;  2EPA A;  5JEA C;  2L2M A;  4YY3 I;  4DV0 I;  3PYG A;  4GKJ I;  4IFD D;  1ZM9 A;  2V8P A;  2UUB E;  2DIX A;  2ADR A;  1BB8 A;  4MU3 A;  2NN6 D;  3BID A;  2EZ6 A;  1HNZ E;  5JEA E;  2ELY A;  1Z0G A;  4JI0 I;  3WU6 A;  4FW4 A;  4B3T I;  1ZBT A;  4DU7 A;  4BC7 A;  1PJT A;  3K17 A;  2PO1 A;  4JI7 E;  1WRJ A;  2V83 A;  4WSP A;  3GON A;  2PO2 A;  4J3D A;  3U1K A;  4AQY I;  2MKD A;  3JAM C;  2HHH E;  3J81 Q;  3JU0 A;  2EMY A;  2NN6 A;  2EL6 A;  2R1F A;  4B3M E;  3DJW A;  4UT4 A;  3B4T A;  4KZS A;  2WNR A;  2EFG A;  3THN A;  4JI5 I;  2VF3 A;  4B3S E;  5K36 C;  4DPU A;  2FTX B;  4X64 E;  4EMD A;  2EM6 A;  3CDI A;  4DPW A;  1EH6 A;  4NHR A;  4LCG A;  2L2N A;  3J80 Q;  3B82 A;  2PO1 B;  2EPK X;  4BA2 A;  1ZM4 A;  1IBK E;  1ZM2 A;  2JEB A;  4M1K A;  2YTQ A;  2PO2 B;  5K36 E;  3QG5 C;  2IES A;  4BC9 A;  2BM1 A;  2L92 A;  2UUC I;  2J7K A;  2VE7 C;  1H74 A;  1MU5 A;  2NN6 B;  3Q6M A;  1UIL A;  5KL6 A;  3B78 A;  4X65 I;  4FW5 A;  4NBQ A;  3T1H I;  1PDA A;  3UHM A;  1GZ6 A;  2WNR B;  4FN5 A;  2LTS A;  3LLH A;  4LF5 I;  3PS3 A;  2BM0 A;  2EOY A;  1N3G A;  4PRX A;  1TN9 A;  2NAB A;  1TF3 A;  4WUB A;  4MQY A;  2LE2 A;  4R2Q A;  2I13 A;  2EPL X;  2HFS A;  1ZXN A;  4IS1 C;  4IFD C;  1UHZ A;  4BA2 B;  4JI6 E;  4N4R B;  2EMW A;  1PVG A;  2YTF A;  3NZK A;  3V2U C;  4DV7 E;  4AID A;  2EOS A;  5AC5 A;  1P47 A;  1YYO A;  2WZO A;  2HC5 A;  5FLX C;  1Z59 A;  2DEJ A;  4LU9 A;  5DRQ A;  1HNW I;  2YSP A;  3EPK A;  2DMY A;  2LVH A;  2WCC 3;  2O3Z A;  4IS9 A;  1XXE A;  2DEI A;  2V34 A;  1WJP A;  4IFD E;  1BBO A;  4LTY A;  2FV4 B;  4F9A B;  5AE2 A;  5LLQ A;  1NHH A;  1X47 A;  4GKJ E;  5DNY A;  4IZJ D;  2WBS A;  4JI8 E;  4J8Z A;  2YRH A;  5LL6 R;  2X36 A;  4LF4 I;  4F9B B;  4HEI A;  1ELO A;  4LFC I;  2EM8 A;  4U3D A;  3BGH A;  3CDJ A;  2DLK A;  4R2E A;  2CGE A;  5IXM B;  2EM9 A;  1QU6 A;  4B3T E;  3LNU A;  1XNR E;  3UK3 C;  1VI7 A;  1WUU A;  2Z5E A;  4IZJ A;  3VHT B;  1Y4U A;  4RPF A;  2BA1 D;  1H7U A;  1KIJ A;  5LMN I;  2EOO A;  4AQY E;  1PIE A;  2EL5 A;  3PRY A;  3ADJ A;  4R8O A;  4BBY A;  5IWA E;  2E5L E;  3T1Y I;  4DR7 I;  1UDQ A;  4DUZ I;  2VQE E;  2F4V E;  2Z5B A;  2E1M A;  2YTE A;  5GMD A;  4DR1 I;  3ECR A;  4DR3 I;  1RQ0 A;  4HTG A;  2UXB I;  2EMB A;  4QNK A;  4DUY I;  4JV5 E;  3GCM A;  1KJK A;  4YHH I;  4JI3 E;  2EPN A;  3ZOQ B;  4LF8 I;  2IOQ A;  3KRN A;  4JI1 E;  4M9V C;  4IZJ B;  1MGT A;  2CG9 A;  2YT4 A;  2M4I A;  4OOG C;  2UXD I;  3HPZ A;  2YTD A;  3PYE A;  1KVK A;  3HTX A;  1YYW A;  3CWV A;  4DR6 E;  2EPR A;  1FWK A;  2EOQ A;  3PYD A;  1DI2 A;  1N32 I;  4F6M A;  3GME A;  4FWG A;  4DV5 I;  2Z5B B;  4P7D A;  1R6M A;  2EPZ A;  5LMU I;  4DV6 E;  1MEY C;  1YUI A;  4DV4 I;  3VYY A;  4DR4 I;  2D9H A;  2JT2 A;  4DR2 I;  5CFF E;  4OO1 F;  2MC6 A;  3F6H A;  4DPX A;  5F3W A;  3F6G A;  2UUA I;  3DD6 A;  3WU4 A;  1IMU A;  1USV A;  4LF7 I;  1A6F A;  2V2Z A;  1HR0 E;  1WHN A;  4LFB I;  4BHC A;  1G2F C;  3MSW A;  1QNT A;  2ENC A;  3P06 A;  4OZE A;  2L2K B;  5T6J A;  4TUI A;  1HNW E;  2JWO A;  1N34 E;  2BV3 A;  4HY1 A;  1AH5 A;  3PS1 A;  4I3H A;  1QZR A;  3J81 C;  4GZN C;  2E72 A;  2KOU A;  2L3J A;  1X6F A;  3KZZ A;  1Z0E A;  1WXR A;  2CSH A;  1Z5A A;  5DRO A;  2HJJ A;  4LFA E;  1T38 A;  1XNQ I;  2JXP A;  1A1H A;  4JI4 E;  2EPP A;  2JOX A;  2HKJ A;  3QT5 A;  3RMP A;  4KQV A;  4USK A;  4WSG A;  3ZKB A;  5ADZ A;  2CZ9 A;  1X6E A;  4LFC E;  2L33 A;  1A1F A;  4K0K E;  1H73 A;  2CPN A;  5TSE A;  3IWB A;  3J80 C;  2L3C A;  1N36 E;  2MKN A;  2EMI A;  1B69 A;  1OJ4 A;  1Z0C A;  3H4L A;  4OKG A;  4DV1 I;  2FGG A;  3JTZ A;  1NZ0 A;  4Z7C A;  5C0X C;  1H7S A;  2ZM6 I;  2ODR D;  2DSY A;  2EOZ A;  2WBT A;  1TF6 A;  4DR5 I;  2OI2 A;  3C6K A;  3Q1Q A;  4O5G A;  4ZYG A;  1YPN A;  1A1L A;  3D4J A;  4LCF A;  1STU A;  1KKH A;  1HNX I;  1N0U A;  2EE8 A;  3H1C A;  4R2S A;  4NXM I;  2O1V A;  4PRV A;  2HFU A;  5C0X E;  2V88 A;  2BB8 A;  4DUZ E;  1FJG I;  4DU8 A;  2DRP A;  3OML A;  2PNZ A;  2EPU A;  4DR3 E;  1IBL I; 
#chains in the Genus database with same CATH homology
 2KON A;  4B3R I;  3H09 A;  2LUQ A;  1YZ9 A;  4X62 I;  4KHP I;  1X48 A;  1EKZ A;  2X7I A;  1J5E I;  2UXD E;  1KTV A;  4OX9 I;  2H36 X;  1Z0B A;  4TUG A;  2K4V A;  3VYX A;  1Z0W A;  2LJP A;  1J26 A;  3OTO I;  4WUC A;  1T4O A;  4NXN I;  4DV5 E;  4LF6 E;  5LMU E;  2LTR A;  4DR4 E;  1I94 E;  4DR2 E;  2B3T B;  4X66 I;  2NUE A;  3J7Y p;  2GQ0 A;  1YYK A;  2DB2 A;  4WFT A;  5A2Q Q;  4MYU A;  4HAC A;  2UXC I;  4YY3 E;  4M30 A;  3VK6 A;  4DV0 E;  2UU9 I;  2B7V A;  2G7H A;  4DV2 I;  1B63 A;  2GS8 A;  1N0V C;  3QT8 A;  2NUG A;  1XMQ I;  3HPS A;  4JI0 E;  2JY9 A;  4HXZ A;  4WPY A;  1VIS A;  2UUB I;  1GQE A;  4P52 A;  3P1X A;  4DMI A;  2V89 A;  4HAC B;  1T4N A;  2MC5 A;  2RTX A;  3ZM7 A;  1HNZ I;  2B9D A;  2KHX A;  2M7Q A;  1HK7 A;  3K6Q A;  4MYT A;  4BMJ A;  2LBS B;  4IZK A;  1H72 C;  4JI5 E;  4WUD A;  5L3J A;  2HK2 A;  1NHJ A;  2HHH I;  2JVA A;  2V87 A;  1Z0T A;  2V2V A;  2Z5C A;  3V2U C;  2M1S A;  2LMZ A;  3LPS A;  2IOP A;  2VQF I;  2V86 A;  1T4L B;  2O1W A;  1FKA E;  2XEX A;  1IBM I;  4B3S I;  3ZZT A;  1Z5C A;  2UUC E;  4PU9 A;  4X64 I;  4R1F A;  2R42 A;  4X65 E;  3T1H E;  4IZK B;  1IBK I;  4LF5 E;  1PKP A;  4FW9 A;  1Z0V A;  2Z5C B;  3ADL A;  4DPT A;  2LRS A;  4R03 A;  4N3O A;  2EWL A;  1D6T A;  5IT9 C;  4DPY A;  1EA6 A;  3ZZ0 A;  5AE3 A;  2O1U A;  4JI2 I;  2Q2E B;  2RS6 A;  3AUZ A;  4DV7 I;  2L8T A;  1RC7 A;  2N3G A;  4I8O A;  4DV2 E;  1EI1 A;  3C4T A;  3B8H A;  4WYQ B;  4LF4 E;  5IT9 Q;  3KWR A;  4GKK I;  1XMQ E;  4BS9 A;  4FWH A;  4JI8 I;  2YZT A;  4ED4 A;  3WU5 A;  5BR8 I;  5LMN E;  2R3V A;  2RSM A;  4DR7 E;  3T1Y E;  3ADI A;  4M2Z A;  3QT7 A;  4JYA I;  1XNR I;  4JG4 A;  2PNM A;  2IHR 1;  4DR1 E;  2UXB E;  1DAR A;  4URL A;  5IWA I;  2E5L I;  4DUY E;  3C4B A;  1SR9 A;  3K1J A;  4YHH E;  4DV3 I;  4L8N A;  4LF8 E;  2VQE I;  2F4V I;  1U2R A;  2VQF E;  1USU A;  1S4E A;  1XNQ I;  1WHQ A;  1IBM E;  2HK3 A;  4BCA A;  5GME A;  3IWC A;  4LF9 I;  3IWD A;  1XHK A;  2E1R A;  5A2Q C;  3LTO A;  4JV5 I;  4JI3 I;  1N32 E;  3J7A M;  3JAM Q;  3AV0 A;  4JI1 I;  4UTG A;  1DQ3 A;  4DV4 E;  3M6A A;  2NPF A;  4DR6 I;  2UUA E;  3K85 A;  4LF7 E;  4DKK A;  1X49 A;  4Z7Y A;  4LFB E;  4P7A A;  4DV6 I;  4USM A;  1N33 I;  2A2C A;  1MX0 A;  5AAS A;  3FIG A;  4JI2 E;  3LML A;  2O1T A;  3ZKD A;  1FWL A;  2ODR C;  1HR0 I;  1XMO I;  3F0N A;  2V85 A;  1RR9 A;  1FI4 A;  2HKE A;  4ZVI A;  4L5N C;  1N34 I;  2JR1 A;  2L6M A;  4F9C B;  4GKK E;  2WW4 A;  1K47 A;  3Q6N A;  4LFA I;  4DV1 E;  1MG7 A;  2MDR A;  2PNL A;  4JI4 I;  4GEQ B;  2ZM6 E;  1Y4S A;  2LUP B;  5BR8 E;  5FLX Q;  4DR5 E;  4JI7 I;  1NHI A;  2A2D A;  2AJ4 A;  1Z5B A;  1HNX E;  3ZZU A;  1S16 A;  1N36 I;  4K0K I;  1RRE A;  1Y6Z A;  4NXM E;  3HXL A;  1ZM3 A;  1FJG E;  4XTJ A;  4B3M I;  2LJH A;  4P78 A;  4JYA E;  3HUL A;  4X8W A;  2NUF A;  1ZBQ A;  1B62 A;  1IBL E;  3HQ1 A;  4M0V A;  2V8Q B;  4DV3 E;  4B3R E;  2ZBK B;  1FNM A;  4F54 A;  4KHP E;  3DF6 A;  4X62 E;  3ADG A;  1J5E E;  4FWD A;  3HJC A;  4HYM A;  1O0W A;  1XNQ E;  4OX9 E;  4LF9 E;  3OTO E;  4Q28 A;  4NXN E;  5FWK A;  2VF1 A;  3WU3 A;  3QT6 A;  2NA2 A;  2V2Q A;  4X66 E;  2ZIT A;  3PYF A;  4DXL A;  1ZXM A;  4JI6 I;  4LF6 I;  2UXC E;  2JOB A;  3V5R A;  1I94 I;  2UU9 E;  5AE1 A;  1N33 E;  1UEK A;  2RS7 A;  2B7T A;  1BKN A;  2F8B A;  3J7A G;  1XMO E;  2N3H A;  2L2M A;  4YY3 I;  4DV0 I;  3PYG A;  4GKJ I;  1ZM9 A;  2V8P A;  2UUB E;  2DIX A;  2EZ6 A;  1HNZ E;  1Z0G A;  4JI0 I;  3WU6 A;  4B3T I;  1ZBT A;  4DU7 A;  4BC7 A;  3K17 A;  4JI7 E;  2V83 A;  4WSP A;  3GON A;  4AQY I;  3JAM C;  2HHH E;  3J81 Q;  3JU0 A;  4B3M E;  3DJW A;  4UT4 A;  4KZS A;  2EFG A;  4JI5 I;  2VF3 A;  4B3S E;  4DPU A;  2FTX B;  4X64 E;  4EMD A;  4DPW A;  2L2N A;  3J80 Q;  3B82 A;  1ZM4 A;  1IBK E;  1ZM2 A;  4M1K A;  4BC9 A;  2BM1 A;  2L92 A;  2UUC I;  2J7K A;  2VE7 C;  1H74 A;  1MU5 A;  3Q6M A;  1UIL A;  3B78 A;  4X65 I;  3T1H I;  1GZ6 A;  4FN5 A;  2LTS A;  3LLH A;  4LF5 I;  2BM0 A;  4PRX A;  4WUB A;  2LE2 A;  2HFS A;  1ZXN A;  1UHZ A;  4JI6 E;  1PVG A;  4DV7 E;  1YYO A;  2WZO A;  5FLX C;  1Z59 A;  2DEJ A;  4LU9 A;  1HNW I;  2DMY A;  2DEI A;  2V34 A;  4LTY A;  2FV4 B;  4F9A B;  5AE2 A;  1NHH A;  1X47 A;  4GKJ E;  5DNY A;  4IZJ D;  4JI8 E;  4J8Z A;  5LL6 R;  2X36 A;  4LF4 I;  4F9B B;  1ELO A;  4LFC I;  2CGE A;  1QU6 A;  4B3T E;  3LNU A;  1XNR E;  2Z5E A;  1WUU A;  4IZJ A;  4RPF A;  1Y4U A;  1H7U A;  1KIJ A;  5LMN I;  3PRY A;  4AQY E;  1PIE A;  3ADJ A;  4R8O A;  4BBY A;  5IWA E;  2E5L E;  3T1Y I;  4DR7 I;  4DUZ I;  2VQE E;  2F4V E;  2Z5B A;  2E1M A;  5GMD A;  4DR1 I;  4DR3 I;  1RQ0 A;  2UXB I;  4DUY I;  4JV5 E;  4YHH I;  4JI3 E;  3ZOQ B;  4LF8 I;  2IOQ A;  4JI1 E;  4IZJ B;  2CG9 A;  2YT4 A;  2M4I A;  4OOG C;  2UXD I;  3HPZ A;  3PYE A;  1KVK A;  3HTX A;  1YYW A;  3CWV A;  4DR6 E;  1FWK A;  3PYD A;  1DI2 A;  1N32 I;  4FWG A;  4DV5 I;  2Z5B B;  4P7D A;  5LMU I;  4DV6 E;  4DV4 I;  4DR4 I;  3VYY A;  4DR2 I;  5CFF E;  2MC6 A;  3F6H A;  4DPX A;  5F3W A;  3F6G A;  2UUA I;  3WU4 A;  1USV A;  4LF7 I;  1A6F A;  2V2Z A;  1HR0 E;  1WHN A;  4LFB I;  3MSW A;  3P06 A;  2L2K B;  5T6J A;  4TUI A;  1HNW E;  2JWO A;  1N34 E;  2BV3 A;  4HY1 A;  4I3H A;  1QZR A;  3J81 C;  2KOU A;  2L3J A;  1Z0E A;  1Z5A A;  1WXR A;  4LFA E;  4JI4 E;  2HKJ A;  2JOX A;  3QT5 A;  3RMP A;  4KQV A;  4USK A;  3ZKB A;  5ADZ A;  2CZ9 A;  4LFC E;  2L33 A;  1H73 A;  4K0K E;  2CPN A;  3J80 C;  3IWB A;  2L3C A;  1N36 E;  1OJ4 A;  1Z0C A;  3H4L A;  4DV1 I;  2FGG A;  3JTZ A;  1NZ0 A;  4Z7C A;  1H7S A;  2ZM6 I;  2ODR D;  2DSY A;  4DR5 I;  2OI2 A;  3Q1Q A;  3D4J A;  1STU A;  1KKH A;  1HNX I;  1N0U A;  4NXM I;  2O1V A;  4PRV A;  2HFU A;  1FJG I;  2V88 A;  4DUZ E;  4DU8 A;  3OML A;  4DR3 E;  1IBL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...