4LF7E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf7E02
3C4BA 4DR4E 4DR5I 2GS8A 1Z5CA 2V2ZA 2X36A 3QT5A 4LF7I 4NXNI 2HFSA 2VQEI 1HNZE 4HY1A 2EZ6A 1FKAE 3J80C 1XMOI 4DUYI 5A2QQ 4OX9I 4JV5I 1IBMI 2ZM6I 1H72C 5LMNE 2WW4A 3ZZ0A 4JG4A 1FWKA 4DV4I 1DARA 4JI6E 2YT4A 4M30A 1PKPA 3QT6A 3J81Q 4DV6I 2HKEA 4B3RE 1Z0EA 1XHKA 4P52A 3LLHA 1H7SA 1HR0I 2MDRA 4X8WA 5FLXC 2J7KA 4K0KE 3T1YI 4WUCA 4X62I 3CWVA 4X65E 1WUUA 2L3JA 1N0VC 1Z0WA 1I94I 2Q2EB 2DEJA 3WU5A 5LMUE 4DV7I 4DU8A 4LFCE 1T4LB 1D6TA 3PYGA 1RC7A 5IWAI 2L33A 2UU9E 2V8PA 4DV0I 2X7IA 1X47A 1T4NA 3PYFA 3WU3A 4JI8I 5LL6R 1KTVA 4JI2I 2UUBE 1Z0BA 4B3TE 3V5RA 2DIXA 1NZ0A 4DKKA 1RR9A 2A2DA 3LPSA 1N36I 2CPNA 2R3VA 1QZRA 1J5EE 3T1HI 3J7AG 1YYKA 1X49A 2JY9A 4LF8I 4X66E 4UTGA 4DV2E 4OOGC 2UXCE 1ZM2A 4YHHI 1WHQA 3HTXA 3ADGA 2EFGA 4EMDA 1N34E 4GKJE 1ZXMA 4JI7E 1Z0TA 4DPYA 1XNRE 3B8HA 2CZ9A 2B3TB 4DPUA 3PYDA 3JAMC 4KHPE 1MX0A 1HNWE 4B3MI 4LFAE 2UUAE 1UILA 2NPFA 2E5LE 1N0UA 5IT9C 4DUZE 4LFBI 1Z0VA 1PIEA 1IBLE 2NUEA 4M2ZA 2NUGA 4WUBA 1Z59A 4Z7YA 4JI3E 3J7AM 1IBKE 3ZKDA 2V2VA 2JVAA 1QU6A 1Z0GA 2B7VA 2UXBI 2LTSA 4MYUA 5CFFE 3ZKBA 1J26A 1FJGE 2UUCE 4JI5I 2BM0A 2RS6A 4DV3I 4JI4I 4R1FA 3P1XA 4DR5E 4AQYI 3ADJA 4LF7E 4NXNE 1FI4A 4MYTA 2VQEE 1XMQE 1XMOE 4DR7I 4DUYE 1FWLA 4OX9E 4PU9A 2ZBKB 3GONA 4JV5E 1IBME 1XNQI 2ZM6E 4JYAI 2B7TA 1ELOA 3M6AA 3ZZUA 4DR2I 3F0NA 5GMEA 4DV4E 4WUDA 4USKA 4DR6I 4DV6E 3WU4A 4DV1I 3ADIA 1KVKA 2L3CA 3K1JA 4X64I 1H7UA 1A6FA 1HR0E 2BM1A 1H73A 4B3SE 2L2MA 3T1YE 4DPWA 5BR8I 2VF3A 3J80Q 4X62E 2RTXA 4DPTA 2VQFI 1I94E 2XEXA 2UXDI 1N32I 4DV7E 4UT4A 2LRSA 2L2NA 3PYEA 5IWAE 2NA2A 4DR3I 1HNXI 4LF5I 2V2QA 4ED4A 2HHHI 4DV0E 4DR1I 2IHR1 2BV3A 4JI8E 4LF9I 4XTJA 1U2RA 4GKKI 4LF4I 3J7Yp 4JI2E 3WU6A 3LNUA 1N33I 4JI1I 5FLXQ 4DPXA 1X48A 4LF6I 1N34I 1N36E 2NUFA 4ZVIA 4YY3E 3T1HE 3QT7A 4LF8E 4JI0I 2F4VI 4NXMI 4PRVA 4HXZA 4YHHE 1T4OA 5A2QC 3OTOI 1Z5AA 2L2KB 3H4LA 3Q1QA 2DEIA 3QT8A 4HACB 4DV5I 4RPFA 4B3ME 1KKHA 1NHIA 4FN5A 4LFBE 2DMYA 3J81C 2HK3A 2HFUA 4DR4I 2HKJA 2LJPA 4WFTA 4I3HA 1GQEA 1OJ4A 4Z7CA 1HNZI 1ZXNA 1ZM4A 1MG7A 3C4TA 2A2CA 5LMNI 2UXBE 2KHXA 1NHHA 1EI1A 4DXLA 3JAMQ 1XMQI 4JI5E 4DV3E 2AJ4A 4JI6I 4JI4E 5IT9Q 4AQYE 4B3RI 2LJHA 2V34A 4DR7E 1Z5BA 4M1KA 4K0KI 3ZZTA 2LUQA 1BKNA 4X65I 1XNQE 4JYAE 1UEKA 4WYQB 4HACA 4DR2E 5LMUI 4PRXA 4LFCI 1K47A 1YYWA 3B82A 4FWGA 4B3SI 2UU9I 4DR6E 2E1RA 1H74A 4DV1E 2ZITA 4X64E 1YZ9A 1NHJA 3HULA 4FW9A 2HK2A 1ZM3A 1B63A 4P7AA 5BR8E 1PVGA 2UUBI 4B3TI 3V2UC 1ZM9A 2VQFE 2UXDE 2RS7A 2N3GA 1N32E 1ZBTA 1VISA 2LBSB 1J5EI 1S16A 1O0WA 4FWDA 5GMDA 1RREA 4X66I 4DV2I 4DR3E 1HNXE 2UXCI 4LF5E 3K17A 2HHHE 5L3JA 3VYYA 1DI2A 4DR1E 1MU5A 4KQVA 4GKJI 4JI7I 1Z0CA 4LF9E 1YYOA 4YY3I 1XNRI 1B62A 3B78A 4GKKE 1STUA 3VYXA 4LF4E 4URLA 1N33E 4JI1E 4KHPI 1HNWI 4LFAI 2UUAI 3D4JA 4FWHA 4LF6E 1S4EA 2E5LI 4DUZI 1EA6A 3ZM7A 4JI0E 1IBLI 2OI2A 2F4VE 4NXME 2N3HA 2LTRA 2R42A 2RSMA 2LUPB 3OTOE 4HYMA 1RQ0A 4JI3I 1IBKI 1EKZA 1KIJA 1WHNA 2DB2A 4DV5E 1FNMA 3ADLA 4DU7A 3LTOA 4USMA 1UHZA 1FJGI 2UUCI
chains in the Genus database with same CATH superfamily
2EM4A 1RHYA 4IZJB 3C4BA 2KONA 4BA1B 4DR4E 5KL4A 3F6GA 2EOXA 3HQ1A 3MSWA 2GS8A 1Z5CA 2V2ZA 2X36A 2Z5CB 4OKGA 2ENAA 3U1KA 3QT5A 4LF7I 4NXNI 4BMJA 2HFSA 4OZEA 2DSYA 2VQEI 1BBGA 1HNZE 4HY1A 2YTDA 2EZ6A 3J80C 1FKAE 1UBDC 1XMOI 4DUYI 2EQ1A 5A2QQ 3Q6MA 4OX9I 2JR1A 4JV5I 1IBMI 2EPZA 1Y6ZA 3M85G 2WNRB 2ZM6I 4NZVA 5LLQA 2EPKX 1H72C 4LPFA 2EL5A 5LMNE 2C39A 2WW4A 4R2SA 2RSIA 3KWRA 3ZZ0A 4BS9A 2EPXA 3DD6A 2EMCA 4MQYA 3JTZA 2DMIA 3HXLA 4JG4A 1FWKA 2PO0B 4DV4I 4FW3A 5A6BD 1PJQA 1DARA 4JI6E 3P76A 2YT4A 2E72A 4NHRA 1ZBQA 4M30A 4TUGA 3UHMA 3M7ND 1PKPA 1PJSA 2JOBA 2JOXA 1IMUA 3QT6A 3J81Q 2VF1A 4DV6I 2HKEA 4B3RE 1Z0EA 1XHKA 1DGCA 4P52A 2LV2A 4AM3A 3LLHA 2K7IA 1H7SA 5IXMB 1SFEA 2MDRA 4P7DA 1HR0I 4X8WA 2LVHA 2FGGA 2V8QB 5FLXC 4K0KE 2J7KA 5DNXA 3T1YI 3DJWA 4FK5C 3Q6NA 1LLMC 1Y5YA 4WUCA 3CWVA 4QNJA 4X65E 4X62I 1WUUA 2L3JA 1N0VC 1Z0WA 1I94I 2WBUA 2Q2EB 2DEJA 4OO1C 3WU5A 5LMUE 2YTGA 1JK1A 4DV7I 4O43A 5K36E 2YTEA 4DU8A 4I8OA 4LFCE 2YTIA 1T4LB 1OYSA 1D6TA 3PYGA 1IQOA 1RC7A 2NN6F 4RHBB 5IWAI 2PNZB 3KZZA 2PO1B 4IZJA 2L33A 2EN8A 2UU9E 4N4RB 2V8PA 5DRPA 4L8NA 2EOFA 4BA1A 3HPZA 5K36B 4M9VC 4DV0I 3F6HA 3BBGA 2Z5CA 2X7IA 1P47A 1EH8A 1X47A 1T4NA 3M99B 3PYFA 3WU3A 4JI8I 5LL6R 2IOQA 3VHTB 2L92A 1KTVA 2EM5A 1G2DC 3P3CA 1QNTA 3OMLA 2RQLA 4JI2I 2UUBE 1Z0BA 2B9DA 4B3TE 3V5RA 2JPAA 2DIXA 5KL5A 5A6AA 3K85A 1NZ0A 4DKKA 1YUJA 1RR9A 2A2DA 2YTFA 2WNRA 3LPSA 1N36I 2CPNA 2R3VA 1UDOA 1QZRA 1J5EE 4LCHA 2LJUA 3J7AG 1YYKA 3T1HI 1X49A 2JY9A 4LF8I 5C0XE 4P78A 4X66E 2CVEA 4UTGA 4DV2E 2PO0A 4OOGC 3HKMA 4IFDF 4N3OA 5DROA 2UXCE 1SR9A 5JEAF 4WSGA 1YUIA 1ZM2A 4DMIA 4LCGA 4YHHI 2F8BA 1WHQA 3HTXA 2PRTA 4IZKB 3ADGA 2EFGA 4EMDA 3AUZA 1N34E 4GKJE 2MKNA 1ZXMA 4JI7E 5KL7A 5C0XB 1Z0TA 4DPYA 2D9HA 2MC6A 1NEIA 2CT1A 4F9AB 4R2AA 2WBTA 3K6QA 5AC4A 3P06A 1XNRE 4WPYA 2O3ZA 3B8HA 2CZ9A 2EQ0A 2B3TB 3C6MA 4DPUA 3IWCA 2EMYA 3JAMC 3PYDA 2YU8A 4KHPE 1MX0A 1HNWE 2YTJA 4LFAE 4B3MI 1A1LA 2UUAE 4MDTA 5FWKA 1UILA 4AIMA 4MU4A 2CSHA 2NPFA 5IT9C 1NCSA 2E5LE 4DUZE 1YFHA 1N0UA 4LFBI 1IQSA 1X3CA 2YWQA 2F1DA 5DRRA 3UK3C 5A6JA 1Z0VA 4Q35B 1PIEA 3IWDA 3CDJA 2GPIA 1IBLE 1DQ3A 3HPSA 4J8ZA 4M2ZA 2NUEA 2VRDA 3GMEA 4BHBA 2PNZA 1HK7A 2PO1A 4WXDA 1TF6A 2EM7A 2BBGA 2YTOA 2PNMA 3HJCA 2O1TA 2EPLX 4ZYGA 2NUGA 4WUBA 3M7NG 1Z59A 2EMLA 2PO2B 4Z7YA 2V88A 2YPNA 1EH7A 4JI3E 3J7AM 1IBKE 2YRMA 3ZKDA 2V2VA 2R1FA 4F54A 2JEAB 2EPCA 3EPJA 4HTGA 2EMIA 1X5WA 2JVAA 1QU6A 1Z0GA 2M9AA 2B7VA 3GLLA 2LTSA 2UXBI 2DGCA 4MYUA 4LTYA 5CFFE 3ZKBA 1J26A 2YTNA 1E3PA 1FJGE 2UUCE 1YSAC 5DNYA 4JI5I 2EMFA 2BM0A 2RS6A 4MU0A 5AE2A 4DV3I 4JI4I 3L00A 2I13A 4R1FA 2EWLA 3P1XA 4DR5E 2JP9A 4LOMA 4AQYI 1KJKA 2MKDA 3ADJA 2JEBA 4LF7E 4NXNE 2EMWA 2LMZA 1FI4A 1TN9A 2VQEE 4MYTA 4IFDA 4IZKA 5ADZA 1XMQE 1XMOE 4DR7I 4DUYE 2BA1D 1FWLA 5JEAA 5C0XA 3LMLA 4OX9E 4PU9A 2ZBKB 3GONA 4JV5E 1IBME 4F6MA 1XNQI 1ZR9A 4IZJD 2ZM6E 2EP3A 4JYAI 4OO1F 2B7TA 1ELOA 4IS1C 3M6AA 3ZZUA 4DR2I 2M7QA 2EM8A 1JK2A 4WXCA 3EPKA 3F0NA 2H36X 4OO1B 2EOZA 5GMEA 1USVA 4DV4E 1PDAA 3KZYA 3P3EA 4MLQA 4WUDA 4USKA 2LCEA 2HGHA 4QNKA 1Y4UA 4DR6I 4DV6E 2EMHA 3WU4A 4DV1I 3ADIA 1KVKA 2L3CA 2NN6E 3K1JA 4X64I 1H7UA 2GQ0A 1A6FA 1X6HA 1HR0E 1TF3A 2HJJA 1ZU1A 2BM1A 4R2RA 1H73A 4B3SE 2PO2A 2VESA 2L2MA 1EH6A 3MHSC 4ZYEA 3T1YE 2BA1G 4GQUA 3U1YA 2EMAA 2GLIA 2NN6B 3EPHA 2VF3A 5BR8I 3J80Q 4X62E 2RTXA 2JEAA 2V87A 4DPTA 3PS1A 2VQFI 1I94E 2XEXA 2UXDI 2Z5EA 1N32I 4R8OA 4DV7E 1A1HA 4UT4A 2LRSA 2L2NA 1PJTA 2EN2A 1RMDA 3THNA 2WP8A 2EJ4A 3PYEA 3L7ZB 5IWAE 2NA2A 2EOQA 5TSEA 4DR3I 2RPCA 1A1KA 2JXPA 2C38B 1HNXI 4LF5I 2EPMX 4R2CA 2V2QA 4ED4A 2HHHI 4DV0E 1T39A 2V89A 4DR1I 4F9BB 1A1FA 2FTXB 3MHHC 2ENCA 4IFDE 3ECRA 2R76A 2EMKA 2IHR1 2BV3A 4JI8E 4F6NA 4LF9I 1A1GA 5JEAE 4XTJA 3QG5C 2EPAA 3EQ1A 2IESA 2YTQA 2JEBB 1U2RA 4GKKI 4O5GA 2JWOA 2YSOA 4LF4I 3J7Yp 1T38A 2MC5A 4Q28A 4JI2E 4IFDB 3WU6A 5K36C 3LNUA 4BA2B 2J65A 1N33I 4JI1I 2A25A 3CDIA 4ISAA 4DPXA 5FLXQ 5JEAB 1MEYC 1X48A 2YSPA 1P42A 4NBQA 4LF6I 1N34I 1N36E 5K36D 2NUFA 2LT7A 1OYPA 4ZVIA 4YY3E 3T1HE 3QT7A 3H1CA 2KOUA 1A1JA 2EN4A 1X6FA 4LF8E 4JI0I 1Z1BA 1A1IA 4OO1A 2F4VI 2V85A 4NXMI 2L8TA 4R03A 4BBYA 4PRVA 2EPRA 3THOB 4HXZA 5A2QC 1T4OA 4YHHE 1UN6B 2ENHA 2CTDA 2FV4B 2EM0A 3OTOI 3DF6A 2L2KB 1Z5AA 3H4LA 2EN7A 3Q1QA 2LE2A 2E1MA 2DEIA 2WCC3 2EQ3A 4WSPA 3QT8A 2ODRC 4M0VA 3TQMA 1WJPA 4HACB 4DV5I 4FW6A 2EOYA 4RPFA 3BGHA 2NN6A 4B3ME 4MLVA 2ODRD 2V83A 1KKHA 1UDQA 2EOOA 5C0XC 1NHIA 3H09A 1B69A 4FN5A 5T6JA 2DMYA 4LFBE 3PRYA 1KYQA 2C37B 3J81C 2IOPA 4IFDD 4TUIA 2YZTA 2HK3A 3GCMA 2HFUA 3FIGA 4DR4I 4O24A 5EKWA 5JEAD 1AAYA 5C0XD 2HKJA 2LJPA 3L7ZA 3M85D 4BCAA 4HEIA 2EM3A 4WFTA 2O1UA 2EMXA 2C38A 2WP8B 4I3HA 2G7HA 1G2FC 1L4SA 1GQEA 3NZKA 1OJ4A 4Z7CA 1HNZI 4R2EA 5ELWA 3PS2A 1ZXNA 2EOJA 1ZM4A 2JT2A 3IWBA 1MG7A 1VI7A 1YH8A 1MGTA 2WZOA 3C4TA 2A2CA 2EOEA 2BR2B 2UXBE 4J3DA 2EN6A 2DLQA 5KL3A 4O4KA 4BC9A 4ZYDA 2KHXA 4R2DA 4BA2A 2JYAA 1NHHA 5A69A 1EI1A 5EL9A 4DXLA 3JAMQ 1XMQI 2EN3A 2EMGA 1ZAAC 2EORA 2M1SA 4JI5E 4DV3E 2M4IA 1YPNA 2AJ4A 4JI6I 4JI4E 4OO1E 2YTPA 5IT9Q 1X6EA 4AQYE 4B3RI 2LJHA 2NABA 3B4TA 1GZ6A 1Y4SA 3JU0A 2V34A 2IERA 2HC5A 5F3WA 2ELYA 5LMNI 5AC5A 2EM2A 3PS3A 4DR7E 1Z5BA 2DRPA 2EL6A 4M1KA 4K0KI 4L5NC 3ZZTA 2ADRA 3EPLA 2EPNA 2LUQA 2EPUA 1BKNA 4X65I 1XNQE 2J7JA 1UDNA 2EMZA 4JYAE 4BHCA 1E3HA 4WYQB 1UEKA 4GEQB 1USUA 4HACA 4DR2E 5LMUI 4ZYHA 4PRXA 4MU1A 4LFCI 2Q8UA 1Y60A 1K47A 4DPWA 1YYWA 4LCFA 2MDGA 3B82A 2C37A 4FWGA 4B3SI 2UU9I 4GZNC 2JE6B 4FW5A 4DR6E 2E1RA 2AE8A 1H74A 1F2IG 4DV1E 2EOHA 2ZITA 4X64E 1YZ9A 1NHJA 3HULA 4FW9A 2EMBA 2HK2A 5A6BA 1ZM3A 2ELZA 1N3GA 1B63A 4P7AA 2EPPA 2YU5A 2CGEA 5K36F 5BR8E 2BB8A 3RMPA 1PVGA 2Z5BB 3P3GA 2UUBI 4B3TI 4OO1D 2O1VA 2LO3A 1GTKA 2EOIA 1ZM9A 3AV0A 3V2UC 2VQFE 2EOSA 2UXDE 2RS7A 2N3GA 4F2JC 1N32E 1ZBTA 4IS9A 1VISA 1XXEA 2LBSB 2BR2A 1J5EI 1S16A 2EL4A 1O0WA 2WBSA 1WXRA 1RREA 4FWDA 4F9CB 5GMDA 2V86A 4X66I 4KZSA 4FW7A 2NN6C 2CG9A 2PNLA 4DR3E 4AIDA 1UDSA 4DV2I 1HNXE 2UXCI 4LF5E 1AH5A 4RH8A 2HHHE 3K17A 5L3JA 3VYYA 2EE8A 1DI2A 4DR1E 1MU5A 4KQVA 4GKJI 2NN6D 4DR5I 4JI7I 1Z0CA 2GO3A 4FW4A 4LF9E 2BA0D 1YYOA 5KL6A 4YY3I 1XNRI 5AASA 2EM9A 1B62A 3B78A 4U3DA 4GKKE 1STUA 3VYXA 4LF4E 2L6MA 2C39B 2DLKA 4URLA 2EM6A 4JI1E 1N33E 2N8XA 4KHPI 5C0XF 4LFAI 2UUAI 4X9JA 3C6KA 1HNWI 4R2QA 3BIDA 3D4JA 5DNLA 4FWHA 2YRHA 4LF6E 1S4EA 2E5LI 3KRNA 4DUZI 5AE3A 1YHCA 2I9IA 4IJDA 2VE7C 1EA6A 3ZM7A 1OYRA 4JI0E 3ZOQB 4R2PA 5DRQA 1IBLI 2OI2A 2F4VE 4IFDC 4NXME 2N3HA 4MU3A 4WX9A 4KWYA 5A6KA 5IV8B 2LTRA 2O1WA 5JEAC 1R6LA 2R42A 2RSMA 5AE1A 2JE6A 2LUPB 3OTOE 3BF2A 1WRJA 4HYMA 1RQ0A 4JI3I 1IBKI 4U3BA 2YRKA 1EKZA 2K4VA 1KIJA 2EOMA 2GO4A 2BA0G 1WHNA 3VK6A 2EPOA 2DB2A 2EN1A 4DV5E 1BB8A 2GHFA 1FNMA 4BC7A 4LU9A 3ADLA 1BBOA 1R6MA 2Z5BA 4DU7A 5KL2A 3LTOA 5K36A 4USMA 1UHZA 1FJGI 2UUCI
chains in the Genus database with same CATH topology
4IZJB 3C4BA 2KONA 4DR4E 3F6GA 3HQ1A 2Z5CB 3MSWA 2GS8A 1Z5CA 2V2ZA 2X36A 4DR5I 3QT5A 4LF7I 4NXNI 4BMJA 2HFSA 2DSYA 2VQEI 1HNZE 4HY1A 2EZ6A 3J80C 1FKAE 1XMOI 4DUYI 5A2QQ 3Q6MA 4OX9I 2JR1A 4JV5I 1IBMI 1Y6ZA 2ZM6I 1H72C 5LMNE 2WW4A 3KWRA 3ZZ0A 4BS9A 3JTZA 3HXLA 4JG4A 1FWKA 4DV4I 1DARA 4JI6E 2YT4A 1ZBQA 4M30A 4TUGA 1PKPA 2JOBA 2JOXA 3QT6A 3J81Q 2VF1A 4DV6I 2HKEA 4B3RE 1Z0EA 1XHKA 4P52A 3LLHA 1H7SA 1HR0I 2MDRA 4P7DA 4X8WA 2V8QB 2FGGA 5FLXC 4K0KE 2J7KA 3T1YI 3DJWA 3Q6NA 4WUCA 4X62I 3CWVA 4X65E 1WUUA 2L3JA 1N0VC 1Z0WA 1I94I 2Q2EB 2DEJA 3WU5A 5LMUE 4DV7I 4DU8A 4I8OA 4LFCE 1T4LB 1D6TA 3PYGA 1RC7A 5IWAI 4IZJA 2L33A 2UU9E 2V8PA 4L8NA 3HPZA 4DV0I 3F6HA 2Z5CA 2X7IA 1X47A 1T4NA 3PYFA 3WU3A 4JI8I 5LL6R 2IOQA 2L92A 1KTVA 3OMLA 4JI2I 2UUBE 1Z0BA 2B9DA 4B3TE 3V5RA 2DIXA 3K85A 1NZ0A 4DKKA 1RR9A 2A2DA 3LPSA 1N36I 2CPNA 2R3VA 1QZRA 1J5EE 3J7AG 3T1HI 1YYKA 1X49A 2JY9A 4LF8I 4P78A 4X66E 4UTGA 4DV2E 4OOGC 4N3OA 2UXCE 1SR9A 1ZM2A 4DMIA 4YHHI 2F8BA 1WHQA 3HTXA 4IZKB 3ADGA 2EFGA 4EMDA 3AUZA 1N34E 4GKJE 1ZXMA 4JI7E 1Z0TA 4DPYA 2MC6A 4F9AB 3K6QA 3P06A 1XNRE 4WPYA 3B8HA 2CZ9A 2B3TB 4DPUA 3IWCA 3JAMC 3PYDA 4KHPE 1MX0A 1HNWE 4B3MI 4LFAE 2UUAE 5FWKA 1UILA 2NPFA 5IT9C 2E5LE 1N0UA 4DUZE 4LFBI 1Z0VA 1PIEA 3IWDA 1IBLE 1DQ3A 3HPSA 4J8ZA 4M2ZA 2NUEA 1HK7A 2PNMA 3HJCA 2O1TA 2NUGA 4WUBA 1Z59A 4Z7YA 2V88A 4JI3E 3J7AM 1IBKE 3ZKDA 2V2VA 4F54A 2JVAA 1QU6A 1Z0GA 2B7VA 2UXBI 2LTSA 4MYUA 4LTYA 5CFFE 3ZKBA 1J26A 1FJGE 2UUCE 5DNYA 4JI5I 2BM0A 2RS6A 4DV3I 5AE2A 4JI4I 4R1FA 2EWLA 3P1XA 4DR5E 4AQYI 3ADJA 4LF7E 4NXNE 2LMZA 1FI4A 4MYTA 2VQEE 4IZKA 5ADZA 1XMQE 1XMOE 4DR7I 4DUYE 1FWLA 3LMLA 4OX9E 4PU9A 2ZBKB 3GONA 4JV5E 1IBME 1XNQI 4IZJD 2ZM6E 4JYAI 2B7TA 1ELOA 3M6AA 3ZZUA 4DR2I 2M7QA 3F0NA 2H36X 5GMEA 1USVA 4DV4E 4WUDA 4USKA 4DR6I 1Y4UA 4DV6E 3WU4A 4DV1I 3ADIA 1KVKA 2L3CA 3K1JA 4X64I 1H7UA 2GQ0A 1A6FA 1HR0E 2BM1A 1H73A 4B3SE 2L2MA 3T1YE 4DPWA 5BR8I 2VF3A 3J80Q 4X62E 2RTXA 2V87A 4DPTA 2VQFI 1I94E 2XEXA 2UXDI 2Z5EA 1N32I 4R8OA 4DV7E 4UT4A 2LRSA 2L2NA 3PYEA 5IWAE 2NA2A 4DR3I 1HNXI 4LF5I 2V2QA 4ED4A 2HHHI 4DV0E 2V89A 4DR1I 4F9BB 2FTXB 2IHR1 2BV3A 4JI8E 4LF9I 4XTJA 1U2RA 4GKKI 2JWOA 4LF4I 3J7Yp 2MC5A 4Q28A 4JI2E 3WU6A 3LNUA 1N33I 4JI1I 5FLXQ 4DPXA 1X48A 4LF6I 1N34I 1N36E 2NUFA 4ZVIA 4YY3E 3T1HE 3QT7A 2KOUA 4LF8E 4JI0I 2F4VI 2V85A 4NXMI 2L8TA 4R03A 4BBYA 4PRVA 4HXZA 5A2QC 1T4OA 4YHHE 2FV4B 3OTOI 3DF6A 2L2KB 1Z5AA 3H4LA 3Q1QA 2LE2A 2E1MA 2DEIA 4WSPA 3QT8A 2ODRC 4M0VA 4HACB 4DV5I 4RPFA 4B3ME 2ODRD 2V83A 1KKHA 1NHIA 3H09A 4FN5A 4LFBE 5T6JA 2DMYA 3PRYA 2IOPA 3J81C 4TUIA 2YZTA 2HK3A 2HFUA 3FIGA 4DR4I 2HKJA 2LJPA 4BCAA 4WFTA 2O1UA 4I3HA 2G7HA 1GQEA 1OJ4A 4Z7CA 1HNZI 1ZXNA 1ZM4A 3IWBA 1MG7A 2WZOA 3C4TA 2A2CA 5LMNI 2UXBE 4BC9A 2KHXA 1NHHA 1EI1A 4DXLA 3JAMQ 1XMQI 2M1SA 4JI5E 4DV3E 2M4IA 2AJ4A 4JI6I 4JI4E 5IT9Q 4AQYE 4B3RI 2LJHA 1GZ6A 1Y4SA 3JU0A 2V34A 5F3WA 4DR7E 1Z5BA 4M1KA 4K0KI 4L5NC 3ZZTA 2LUQA 1BKNA 4X65I 1XNQE 4JYAE 1UEKA 4WYQB 1USUA 4GEQB 4HACA 4DR2E 5LMUI 4PRXA 4LFCI 1K47A 1YYWA 3B82A 4FWGA 4B3SI 2UU9I 4DR6E 2E1RA 1H74A 4DV1E 2ZITA 4X64E 1YZ9A 1NHJA 3HULA 4FW9A 2HK2A 1ZM3A 1B63A 4P7AA 2CGEA 5BR8E 3RMPA 1PVGA 2Z5BB 2UUBI 4B3TI 2O1VA 3V2UC 1ZM9A 3AV0A 2VQFE 2UXDE 2RS7A 2N3GA 1N32E 1ZBTA 1VISA 2LBSB 1J5EI 1S16A 1O0WA 4FWDA 1WXRA 1RREA 5GMDA 4F9CB 2V86A 4X66I 4KZSA 4DV2I 2CG9A 2PNLA 4DR3E 1HNXE 2UXCI 4LF5E 3K17A 2HHHE 5L3JA 3VYYA 1DI2A 4DR1E 1MU5A 4KQVA 4GKJI 4JI7I 1Z0CA 4LF9E 1YYOA 4YY3I 1XNRI 5AASA 1B62A 3B78A 4GKKE 1STUA 3VYXA 4LF4E 2L6MA 4URLA 1N33E 4JI1E 4KHPI 1HNWI 4LFAI 2UUAI 3D4JA 4FWHA 4LF6E 1S4EA 2E5LI 4DUZI 5AE3A 2VE7C 1EA6A 3ZM7A 4JI0E 3ZOQB 1IBLI 2OI2A 2F4VE 4NXME 2N3HA 2LTRA 2O1WA 2R42A 2RSMA 5AE1A 2LUPB 3OTOE 4HYMA 1RQ0A 4JI3I 1IBKI 1EKZA 2K4VA 1KIJA 1WHNA 3VK6A 2DB2A 4DV5E 1FNMA 4BC7A 4LU9A 3ADLA 2Z5BA 4DU7A 3LTOA 4USMA 1UHZA 1FJGI 2UUCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4B A;  4DR4 E;  4DR5 I;  2GS8 A;  1Z5C A;  2V2Z A;  2X36 A;  3QT5 A;  4LF7 I;  4NXN I;  2HFS A;  2VQE I;  1HNZ E;  4HY1 A;  2EZ6 A;  1FKA E;  3J80 C;  1XMO I;  4DUY I;  5A2Q Q;  4OX9 I;  4JV5 I;  1IBM I;  2ZM6 I;  1H72 C;  5LMN E;  2WW4 A;  3ZZ0 A;  4JG4 A;  1FWK A;  4DV4 I;  1DAR A;  4JI6 E;  2YT4 A;  4M30 A;  1PKP A;  3QT6 A;  3J81 Q;  4DV6 I;  2HKE A;  4B3R E;  1Z0E A;  1XHK A;  4P52 A;  3LLH A;  1H7S A;  1HR0 I;  2MDR A;  4X8W A;  5FLX C;  2J7K A;  4K0K E;  3T1Y I;  4WUC A;  4X62 I;  3CWV A;  4X65 E;  1WUU A;  2L3J A;  1N0V C;  1Z0W A;  1I94 I;  2Q2E B;  2DEJ A;  3WU5 A;  5LMU E;  4DV7 I;  4DU8 A;  4LFC E;  1T4L B;  1D6T A;  3PYG A;  1RC7 A;  5IWA I;  2L33 A;  2UU9 E;  2V8P A;  4DV0 I;  2X7I A;  1X47 A;  1T4N A;  3PYF A;  3WU3 A;  4JI8 I;  5LL6 R;  1KTV A;  4JI2 I;  2UUB E;  1Z0B A;  4B3T E;  3V5R A;  2DIX A;  1NZ0 A;  4DKK A;  1RR9 A;  2A2D A;  3LPS A;  1N36 I;  2CPN A;  2R3V A;  1QZR A;  1J5E E;  3T1H I;  3J7A G;  1YYK A;  1X49 A;  2JY9 A;  4LF8 I;  4X66 E;  4UTG A;  4DV2 E;  4OOG C;  2UXC E;  1ZM2 A;  4YHH I;  1WHQ A;  3HTX A;  3ADG A;  2EFG A;  4EMD A;  1N34 E;  4GKJ E;  1ZXM A;  4JI7 E;  1Z0T A;  4DPY A;  1XNR E;  3B8H A;  2CZ9 A;  2B3T B;  4DPU A;  3PYD A;  3JAM C;  4KHP E;  1MX0 A;  1HNW E;  4B3M I;  4LFA E;  2UUA E;  1UIL A;  2NPF A;  2E5L E;  1N0U A;  5IT9 C;  4DUZ E;  4LFB I;  1Z0V A;  1PIE A;  1IBL E;  2NUE A;  4M2Z A;  2NUG A;  4WUB A;  1Z59 A;  4Z7Y A;  4JI3 E;  3J7A M;  1IBK E;  3ZKD A;  2V2V A;  2JVA A;  1QU6 A;  1Z0G A;  2B7V A;  2UXB I;  2LTS A;  4MYU A;  5CFF E;  3ZKB A;  1J26 A;  1FJG E;  2UUC E;  4JI5 I;  2BM0 A;  2RS6 A;  4DV3 I;  4JI4 I;  4R1F A;  3P1X A;  4DR5 E;  4AQY I;  3ADJ A;  4LF7 E;  4NXN E;  1FI4 A;  4MYT A;  2VQE E;  1XMQ E;  1XMO E;  4DR7 I;  4DUY E;  1FWL A;  4OX9 E;  4PU9 A;  2ZBK B;  3GON A;  4JV5 E;  1IBM E;  1XNQ I;  2ZM6 E;  4JYA I;  2B7T A;  1ELO A;  3M6A A;  3ZZU A;  4DR2 I;  3F0N A;  5GME A;  4DV4 E;  4WUD A;  4USK A;  4DR6 I;  4DV6 E;  3WU4 A;  4DV1 I;  3ADI A;  1KVK A;  2L3C A;  3K1J A;  4X64 I;  1H7U A;  1A6F A;  1HR0 E;  2BM1 A;  1H73 A;  4B3S E;  2L2M A;  3T1Y E;  4DPW A;  5BR8 I;  2VF3 A;  3J80 Q;  4X62 E;  2RTX A;  4DPT A;  2VQF I;  1I94 E;  2XEX A;  2UXD I;  1N32 I;  4DV7 E;  4UT4 A;  2LRS A;  2L2N A;  3PYE A;  5IWA E;  2NA2 A;  4DR3 I;  1HNX I;  4LF5 I;  2V2Q A;  4ED4 A;  2HHH I;  4DV0 E;  4DR1 I;  2IHR 1;  2BV3 A;  4JI8 E;  4LF9 I;  4XTJ A;  1U2R A;  4GKK I;  4LF4 I;  3J7Y p;  4JI2 E;  3WU6 A;  3LNU A;  1N33 I;  4JI1 I;  5FLX Q;  4DPX A;  1X48 A;  4LF6 I;  1N34 I;  1N36 E;  2NUF A;  4ZVI A;  4YY3 E;  3T1H E;  3QT7 A;  4LF8 E;  4JI0 I;  2F4V I;  4NXM I;  4PRV A;  4HXZ A;  4YHH E;  1T4O A;  5A2Q C;  3OTO I;  1Z5A A;  2L2K B;  3H4L A;  3Q1Q A;  2DEI A;  3QT8 A;  4HAC B;  4DV5 I;  4RPF A;  4B3M E;  1KKH A;  1NHI A;  4FN5 A;  4LFB E;  2DMY A;  3J81 C;  2HK3 A;  2HFU A;  4DR4 I;  2HKJ A;  2LJP A;  4WFT A;  4I3H A;  1GQE A;  1OJ4 A;  4Z7C A;  1HNZ I;  1ZXN A;  1ZM4 A;  1MG7 A;  3C4T A;  2A2C A;  5LMN I;  2UXB E;  2KHX A;  1NHH A;  1EI1 A;  4DXL A;  3JAM Q;  1XMQ I;  4JI5 E;  4DV3 E;  2AJ4 A;  4JI6 I;  4JI4 E;  5IT9 Q;  4AQY E;  4B3R I;  2LJH A;  2V34 A;  4DR7 E;  1Z5B A;  4M1K A;  4K0K I;  3ZZT A;  2LUQ A;  1BKN A;  4X65 I;  1XNQ E;  4JYA E;  1UEK A;  4WYQ B;  4HAC A;  4DR2 E;  5LMU I;  4PRX A;  4LFC I;  1K47 A;  1YYW A;  3B82 A;  4FWG A;  4B3S I;  2UU9 I;  4DR6 E;  2E1R A;  1H74 A;  4DV1 E;  2ZIT A;  4X64 E;  1YZ9 A;  1NHJ A;  3HUL A;  4FW9 A;  2HK2 A;  1ZM3 A;  1B63 A;  4P7A A;  5BR8 E;  1PVG A;  2UUB I;  4B3T I;  3V2U C;  1ZM9 A;  2VQF E;  2UXD E;  2RS7 A;  2N3G A;  1N32 E;  1ZBT A;  1VIS A;  2LBS B;  1J5E I;  1S16 A;  1O0W A;  4FWD A;  5GMD A;  1RRE A;  4X66 I;  4DV2 I;  4DR3 E;  1HNX E;  2UXC I;  4LF5 E;  3K17 A;  2HHH E;  5L3J A;  3VYY A;  1DI2 A;  4DR1 E;  1MU5 A;  4KQV A;  4GKJ I;  4JI7 I;  1Z0C A;  4LF9 E;  1YYO A;  4YY3 I;  1XNR I;  1B62 A;  3B78 A;  4GKK E;  1STU A;  3VYX A;  4LF4 E;  4URL A;  1N33 E;  4JI1 E;  4KHP I;  1HNW I;  4LFA I;  2UUA I;  3D4J A;  4FWH A;  4LF6 E;  1S4E A;  2E5L I;  4DUZ I;  1EA6 A;  3ZM7 A;  4JI0 E;  1IBL I;  2OI2 A;  2F4V E;  4NXM E;  2N3H A;  2LTR A;  2R42 A;  2RSM A;  2LUP B;  3OTO E;  4HYM A;  1RQ0 A;  4JI3 I;  1IBK I;  1EKZ A;  1KIJ A;  1WHN A;  2DB2 A;  4DV5 E;  1FNM A;  3ADL A;  4DU7 A;  3LTO A;  4USM A;  1UHZ A;  1FJG I;  2UUC I; 
#chains in the Genus database with same CATH topology
 2EM4 A;  1RHY A;  4IZJ B;  3C4B A;  2KON A;  4BA1 B;  4DR4 E;  5KL4 A;  3F6G A;  2EOX A;  3HQ1 A;  3MSW A;  2GS8 A;  1Z5C A;  2V2Z A;  2X36 A;  2Z5C B;  4OKG A;  2ENA A;  3U1K A;  3QT5 A;  4LF7 I;  4NXN I;  4BMJ A;  2HFS A;  4OZE A;  2DSY A;  2VQE I;  1BBG A;  1HNZ E;  4HY1 A;  2YTD A;  2EZ6 A;  3J80 C;  1FKA E;  1UBD C;  1XMO I;  4DUY I;  2EQ1 A;  5A2Q Q;  3Q6M A;  4OX9 I;  2JR1 A;  4JV5 I;  1IBM I;  2EPZ A;  1Y6Z A;  3M85 G;  2WNR B;  2ZM6 I;  4NZV A;  5LLQ A;  2EPK X;  1H72 C;  4LPF A;  2EL5 A;  5LMN E;  2C39 A;  2WW4 A;  4R2S A;  2RSI A;  3KWR A;  3ZZ0 A;  4BS9 A;  2EPX A;  3DD6 A;  2EMC A;  4MQY A;  3JTZ A;  2DMI A;  3HXL A;  4JG4 A;  1FWK A;  2PO0 B;  4DV4 I;  4FW3 A;  5A6B D;  1PJQ A;  1DAR A;  4JI6 E;  3P76 A;  2YT4 A;  2E72 A;  4NHR A;  1ZBQ A;  4M30 A;  4TUG A;  3UHM A;  3M7N D;  1PKP A;  1PJS A;  2JOB A;  2JOX A;  1IMU A;  3QT6 A;  3J81 Q;  2VF1 A;  4DV6 I;  2HKE A;  4B3R E;  1Z0E A;  1XHK A;  1DGC A;  4P52 A;  2LV2 A;  4AM3 A;  3LLH A;  2K7I A;  1H7S A;  5IXM B;  1SFE A;  2MDR A;  4P7D A;  1HR0 I;  4X8W A;  2LVH A;  2FGG A;  2V8Q B;  5FLX C;  4K0K E;  2J7K A;  5DNX A;  3T1Y I;  3DJW A;  4FK5 C;  3Q6N A;  1LLM C;  1Y5Y A;  4WUC A;  3CWV A;  4QNJ A;  4X65 E;  4X62 I;  1WUU A;  2L3J A;  1N0V C;  1Z0W A;  1I94 I;  2WBU A;  2Q2E B;  2DEJ A;  4OO1 C;  3WU5 A;  5LMU E;  2YTG A;  1JK1 A;  4DV7 I;  4O43 A;  5K36 E;  2YTE A;  4DU8 A;  4I8O A;  4LFC E;  2YTI A;  1T4L B;  1OYS A;  1D6T A;  3PYG A;  1IQO A;  1RC7 A;  2NN6 F;  4RHB B;  5IWA I;  2PNZ B;  3KZZ A;  2PO1 B;  4IZJ A;  2L33 A;  2EN8 A;  2UU9 E;  4N4R B;  2V8P A;  5DRP A;  4L8N A;  2EOF A;  4BA1 A;  3HPZ A;  5K36 B;  4M9V C;  4DV0 I;  3F6H A;  3BBG A;  2Z5C A;  2X7I A;  1P47 A;  1EH8 A;  1X47 A;  1T4N A;  3M99 B;  3PYF A;  3WU3 A;  4JI8 I;  5LL6 R;  2IOQ A;  3VHT B;  2L92 A;  1KTV A;  2EM5 A;  1G2D C;  3P3C A;  1QNT A;  3OML A;  2RQL A;  4JI2 I;  2UUB E;  1Z0B A;  2B9D A;  4B3T E;  3V5R A;  2JPA A;  2DIX A;  5KL5 A;  5A6A A;  3K85 A;  1NZ0 A;  4DKK A;  1YUJ A;  1RR9 A;  2A2D A;  2YTF A;  2WNR A;  3LPS A;  1N36 I;  2CPN A;  2R3V A;  1UDO A;  1QZR A;  1J5E E;  4LCH A;  2LJU A;  3J7A G;  1YYK A;  3T1H I;  1X49 A;  2JY9 A;  4LF8 I;  5C0X E;  4P78 A;  4X66 E;  2CVE A;  4UTG A;  4DV2 E;  2PO0 A;  4OOG C;  3HKM A;  4IFD F;  4N3O A;  5DRO A;  2UXC E;  1SR9 A;  5JEA F;  4WSG A;  1YUI A;  1ZM2 A;  4DMI A;  4LCG A;  4YHH I;  2F8B A;  1WHQ A;  3HTX A;  2PRT A;  4IZK B;  3ADG A;  2EFG A;  4EMD A;  3AUZ A;  1N34 E;  4GKJ E;  2MKN A;  1ZXM A;  4JI7 E;  5KL7 A;  5C0X B;  1Z0T A;  4DPY A;  2D9H A;  2MC6 A;  1NEI A;  2CT1 A;  4F9A B;  4R2A A;  2WBT A;  3K6Q A;  5AC4 A;  3P06 A;  1XNR E;  4WPY A;  2O3Z A;  3B8H A;  2CZ9 A;  2EQ0 A;  2B3T B;  3C6M A;  4DPU A;  3IWC A;  2EMY A;  3JAM C;  3PYD A;  2YU8 A;  4KHP E;  1MX0 A;  1HNW E;  2YTJ A;  4LFA E;  4B3M I;  1A1L A;  2UUA E;  4MDT A;  5FWK A;  1UIL A;  4AIM A;  4MU4 A;  2CSH A;  2NPF A;  5IT9 C;  1NCS A;  2E5L E;  4DUZ E;  1YFH A;  1N0U A;  4LFB I;  1IQS A;  1X3C A;  2YWQ A;  2F1D A;  5DRR A;  3UK3 C;  5A6J A;  1Z0V A;  4Q35 B;  1PIE A;  3IWD A;  3CDJ A;  2GPI A;  1IBL E;  1DQ3 A;  3HPS A;  4J8Z A;  4M2Z A;  2NUE A;  2VRD A;  3GME A;  4BHB A;  2PNZ A;  1HK7 A;  2PO1 A;  4WXD A;  1TF6 A;  2EM7 A;  2BBG A;  2YTO A;  2PNM A;  3HJC A;  2O1T A;  2EPL X;  4ZYG A;  2NUG A;  4WUB A;  3M7N G;  1Z59 A;  2EML A;  2PO2 B;  4Z7Y A;  2V88 A;  2YPN A;  1EH7 A;  4JI3 E;  3J7A M;  1IBK E;  2YRM A;  3ZKD A;  2V2V A;  2R1F A;  4F54 A;  2JEA B;  2EPC A;  3EPJ A;  4HTG A;  2EMI A;  1X5W A;  2JVA A;  1QU6 A;  1Z0G A;  2M9A A;  2B7V A;  3GLL A;  2LTS A;  2UXB I;  2DGC A;  4MYU A;  4LTY A;  5CFF E;  3ZKB A;  1J26 A;  2YTN A;  1E3P A;  1FJG E;  2UUC E;  1YSA C;  5DNY A;  4JI5 I;  2EMF A;  2BM0 A;  2RS6 A;  4MU0 A;  5AE2 A;  4DV3 I;  4JI4 I;  3L00 A;  2I13 A;  4R1F A;  2EWL A;  3P1X A;  4DR5 E;  2JP9 A;  4LOM A;  4AQY I;  1KJK A;  2MKD A;  3ADJ A;  2JEB A;  4LF7 E;  4NXN E;  2EMW A;  2LMZ A;  1FI4 A;  1TN9 A;  2VQE E;  4MYT A;  4IFD A;  4IZK A;  5ADZ A;  1XMQ E;  1XMO E;  4DR7 I;  4DUY E;  2BA1 D;  1FWL A;  5JEA A;  5C0X A;  3LML A;  4OX9 E;  4PU9 A;  2ZBK B;  3GON A;  4JV5 E;  1IBM E;  4F6M A;  1XNQ I;  1ZR9 A;  4IZJ D;  2ZM6 E;  2EP3 A;  4JYA I;  4OO1 F;  2B7T A;  1ELO A;  4IS1 C;  3M6A A;  3ZZU A;  4DR2 I;  2M7Q A;  2EM8 A;  1JK2 A;  4WXC A;  3EPK A;  3F0N A;  2H36 X;  4OO1 B;  2EOZ A;  5GME A;  1USV A;  4DV4 E;  1PDA A;  3KZY A;  3P3E A;  4MLQ A;  4WUD A;  4USK A;  2LCE A;  2HGH A;  4QNK A;  1Y4U A;  4DR6 I;  4DV6 E;  2EMH A;  3WU4 A;  4DV1 I;  3ADI A;  1KVK A;  2L3C A;  2NN6 E;  3K1J A;  4X64 I;  1H7U A;  2GQ0 A;  1A6F A;  1X6H A;  1HR0 E;  1TF3 A;  2HJJ A;  1ZU1 A;  2BM1 A;  4R2R A;  1H73 A;  4B3S E;  2PO2 A;  2VES A;  2L2M A;  1EH6 A;  3MHS C;  4ZYE A;  3T1Y E;  2BA1 G;  4GQU A;  3U1Y A;  2EMA A;  2GLI A;  2NN6 B;  3EPH A;  2VF3 A;  5BR8 I;  3J80 Q;  4X62 E;  2RTX A;  2JEA A;  2V87 A;  4DPT A;  3PS1 A;  2VQF I;  1I94 E;  2XEX A;  2UXD I;  2Z5E A;  1N32 I;  4R8O A;  4DV7 E;  1A1H A;  4UT4 A;  2LRS A;  2L2N A;  1PJT A;  2EN2 A;  1RMD A;  3THN A;  2WP8 A;  2EJ4 A;  3PYE A;  3L7Z B;  5IWA E;  2NA2 A;  2EOQ A;  5TSE A;  4DR3 I;  2RPC A;  1A1K A;  2JXP A;  2C38 B;  1HNX I;  4LF5 I;  2EPM X;  4R2C A;  2V2Q A;  4ED4 A;  2HHH I;  4DV0 E;  1T39 A;  2V89 A;  4DR1 I;  4F9B B;  1A1F A;  2FTX B;  3MHH C;  2ENC A;  4IFD E;  3ECR A;  2R76 A;  2EMK A;  2IHR 1;  2BV3 A;  4JI8 E;  4F6N A;  4LF9 I;  1A1G A;  5JEA E;  4XTJ A;  3QG5 C;  2EPA A;  3EQ1 A;  2IES A;  2YTQ A;  2JEB B;  1U2R A;  4GKK I;  4O5G A;  2JWO A;  2YSO A;  4LF4 I;  3J7Y p;  1T38 A;  2MC5 A;  4Q28 A;  4JI2 E;  4IFD B;  3WU6 A;  5K36 C;  3LNU A;  4BA2 B;  2J65 A;  1N33 I;  4JI1 I;  2A25 A;  3CDI A;  4ISA A;  4DPX A;  5FLX Q;  5JEA B;  1MEY C;  1X48 A;  2YSP A;  1P42 A;  4NBQ A;  4LF6 I;  1N34 I;  1N36 E;  5K36 D;  2NUF A;  2LT7 A;  1OYP A;  4ZVI A;  4YY3 E;  3T1H E;  3QT7 A;  3H1C A;  2KOU A;  1A1J A;  2EN4 A;  1X6F A;  4LF8 E;  4JI0 I;  1Z1B A;  1A1I A;  4OO1 A;  2F4V I;  2V85 A;  4NXM I;  2L8T A;  4R03 A;  4BBY A;  4PRV A;  2EPR A;  3THO B;  4HXZ A;  5A2Q C;  1T4O A;  4YHH E;  1UN6 B;  2ENH A;  2CTD A;  2FV4 B;  2EM0 A;  3OTO I;  3DF6 A;  2L2K B;  1Z5A A;  3H4L A;  2EN7 A;  3Q1Q A;  2LE2 A;  2E1M A;  2DEI A;  2WCC 3;  2EQ3 A;  4WSP A;  3QT8 A;  2ODR C;  4M0V A;  3TQM A;  1WJP A;  4HAC B;  4DV5 I;  4FW6 A;  2EOY A;  4RPF A;  3BGH A;  2NN6 A;  4B3M E;  4MLV A;  2ODR D;  2V83 A;  1KKH A;  1UDQ A;  2EOO A;  5C0X C;  1NHI A;  3H09 A;  1B69 A;  4FN5 A;  5T6J A;  2DMY A;  4LFB E;  3PRY A;  1KYQ A;  2C37 B;  3J81 C;  2IOP A;  4IFD D;  4TUI A;  2YZT A;  2HK3 A;  3GCM A;  2HFU A;  3FIG A;  4DR4 I;  4O24 A;  5EKW A;  5JEA D;  1AAY A;  5C0X D;  2HKJ A;  2LJP A;  3L7Z A;  3M85 D;  4BCA A;  4HEI A;  2EM3 A;  4WFT A;  2O1U A;  2EMX A;  2C38 A;  2WP8 B;  4I3H A;  2G7H A;  1G2F C;  1L4S A;  1GQE A;  3NZK A;  1OJ4 A;  4Z7C A;  1HNZ I;  4R2E A;  5ELW A;  3PS2 A;  1ZXN A;  2EOJ A;  1ZM4 A;  2JT2 A;  3IWB A;  1MG7 A;  1VI7 A;  1YH8 A;  1MGT A;  2WZO A;  3C4T A;  2A2C A;  2EOE A;  2BR2 B;  2UXB E;  4J3D A;  2EN6 A;  2DLQ A;  5KL3 A;  4O4K A;  4BC9 A;  4ZYD A;  2KHX A;  4R2D A;  4BA2 A;  2JYA A;  1NHH A;  5A69 A;  1EI1 A;  5EL9 A;  4DXL A;  3JAM Q;  1XMQ I;  2EN3 A;  2EMG A;  1ZAA C;  2EOR A;  2M1S A;  4JI5 E;  4DV3 E;  2M4I A;  1YPN A;  2AJ4 A;  4JI6 I;  4JI4 E;  4OO1 E;  2YTP A;  5IT9 Q;  1X6E A;  4AQY E;  4B3R I;  2LJH A;  2NAB A;  3B4T A;  1GZ6 A;  1Y4S A;  3JU0 A;  2V34 A;  2IER A;  2HC5 A;  5F3W A;  2ELY A;  5LMN I;  5AC5 A;  2EM2 A;  3PS3 A;  4DR7 E;  1Z5B A;  2DRP A;  2EL6 A;  4M1K A;  4K0K I;  4L5N C;  3ZZT A;  2ADR A;  3EPL A;  2EPN A;  2LUQ A;  2EPU A;  1BKN A;  4X65 I;  1XNQ E;  2J7J A;  1UDN A;  2EMZ A;  4JYA E;  4BHC A;  1E3H A;  4WYQ B;  1UEK A;  4GEQ B;  1USU A;  4HAC A;  4DR2 E;  5LMU I;  4ZYH A;  4PRX A;  4MU1 A;  4LFC I;  2Q8U A;  1Y60 A;  1K47 A;  4DPW A;  1YYW A;  4LCF A;  2MDG A;  3B82 A;  2C37 A;  4FWG A;  4B3S I;  2UU9 I;  4GZN C;  2JE6 B;  4FW5 A;  4DR6 E;  2E1R A;  2AE8 A;  1H74 A;  1F2I G;  4DV1 E;  2EOH A;  2ZIT A;  4X64 E;  1YZ9 A;  1NHJ A;  3HUL A;  4FW9 A;  2EMB A;  2HK2 A;  5A6B A;  1ZM3 A;  2ELZ A;  1N3G A;  1B63 A;  4P7A A;  2EPP A;  2YU5 A;  2CGE A;  5K36 F;  5BR8 E;  2BB8 A;  3RMP A;  1PVG A;  2Z5B B;  3P3G A;  2UUB I;  4B3T I;  4OO1 D;  2O1V A;  2LO3 A;  1GTK A;  2EOI A;  1ZM9 A;  3AV0 A;  3V2U C;  2VQF E;  2EOS A;  2UXD E;  2RS7 A;  2N3G A;  4F2J C;  1N32 E;  1ZBT A;  4IS9 A;  1VIS A;  1XXE A;  2LBS B;  2BR2 A;  1J5E I;  1S16 A;  2EL4 A;  1O0W A;  2WBS A;  1WXR A;  1RRE A;  4FWD A;  4F9C B;  5GMD A;  2V86 A;  4X66 I;  4KZS A;  4FW7 A;  2NN6 C;  2CG9 A;  2PNL A;  4DR3 E;  4AID A;  1UDS A;  4DV2 I;  1HNX E;  2UXC I;  4LF5 E;  1AH5 A;  4RH8 A;  2HHH E;  3K17 A;  5L3J A;  3VYY A;  2EE8 A;  1DI2 A;  4DR1 E;  1MU5 A;  4KQV A;  4GKJ I;  2NN6 D;  4DR5 I;  4JI7 I;  1Z0C A;  2GO3 A;  4FW4 A;  4LF9 E;  2BA0 D;  1YYO A;  5KL6 A;  4YY3 I;  1XNR I;  5AAS A;  2EM9 A;  1B62 A;  3B78 A;  4U3D A;  4GKK E;  1STU A;  3VYX A;  4LF4 E;  2L6M A;  2C39 B;  2DLK A;  4URL A;  2EM6 A;  4JI1 E;  1N33 E;  2N8X A;  4KHP I;  5C0X F;  4LFA I;  2UUA I;  4X9J A;  3C6K A;  1HNW I;  4R2Q A;  3BID A;  3D4J A;  5DNL A;  4FWH A;  2YRH A;  4LF6 E;  1S4E A;  2E5L I;  3KRN A;  4DUZ I;  5AE3 A;  1YHC A;  2I9I A;  4IJD A;  2VE7 C;  1EA6 A;  3ZM7 A;  1OYR A;  4JI0 E;  3ZOQ B;  4R2P A;  5DRQ A;  1IBL I;  2OI2 A;  2F4V E;  4IFD C;  4NXM E;  2N3H A;  4MU3 A;  4WX9 A;  4KWY A;  5A6K A;  5IV8 B;  2LTR A;  2O1W A;  5JEA C;  1R6L A;  2R42 A;  2RSM A;  5AE1 A;  2JE6 A;  2LUP B;  3OTO E;  3BF2 A;  1WRJ A;  4HYM A;  1RQ0 A;  4JI3 I;  1IBK I;  4U3B A;  2YRK A;  1EKZ A;  2K4V A;  1KIJ A;  2EOM A;  2GO4 A;  2BA0 G;  1WHN A;  3VK6 A;  2EPO A;  2DB2 A;  2EN1 A;  4DV5 E;  1BB8 A;  2GHF A;  1FNM A;  4BC7 A;  4LU9 A;  3ADL A;  1BBO A;  1R6M A;  2Z5B A;  4DU7 A;  5KL2 A;  3LTO A;  5K36 A;  4USM A;  1UHZ A;  1FJG I;  2UUC I; 
#chains in the Genus database with same CATH homology
 4IZJ B;  3C4B A;  2KON A;  4DR4 E;  3F6G A;  3HQ1 A;  2Z5C B;  3MSW A;  2GS8 A;  1Z5C A;  2V2Z A;  2X36 A;  4DR5 I;  3QT5 A;  4LF7 I;  4NXN I;  4BMJ A;  2HFS A;  2DSY A;  2VQE I;  1HNZ E;  4HY1 A;  2EZ6 A;  3J80 C;  1FKA E;  1XMO I;  4DUY I;  5A2Q Q;  3Q6M A;  4OX9 I;  2JR1 A;  4JV5 I;  1IBM I;  1Y6Z A;  2ZM6 I;  1H72 C;  5LMN E;  2WW4 A;  3KWR A;  3ZZ0 A;  4BS9 A;  3JTZ A;  3HXL A;  4JG4 A;  1FWK A;  4DV4 I;  1DAR A;  4JI6 E;  2YT4 A;  1ZBQ A;  4M30 A;  4TUG A;  1PKP A;  2JOB A;  2JOX A;  3QT6 A;  3J81 Q;  2VF1 A;  4DV6 I;  2HKE A;  4B3R E;  1Z0E A;  1XHK A;  4P52 A;  3LLH A;  1H7S A;  1HR0 I;  2MDR A;  4P7D A;  4X8W A;  2V8Q B;  2FGG A;  5FLX C;  4K0K E;  2J7K A;  3T1Y I;  3DJW A;  3Q6N A;  4WUC A;  4X62 I;  3CWV A;  4X65 E;  1WUU A;  2L3J A;  1N0V C;  1Z0W A;  1I94 I;  2Q2E B;  2DEJ A;  3WU5 A;  5LMU E;  4DV7 I;  4DU8 A;  4I8O A;  4LFC E;  1T4L B;  1D6T A;  3PYG A;  1RC7 A;  5IWA I;  4IZJ A;  2L33 A;  2UU9 E;  2V8P A;  4L8N A;  3HPZ A;  4DV0 I;  3F6H A;  2Z5C A;  2X7I A;  1X47 A;  1T4N A;  3PYF A;  3WU3 A;  4JI8 I;  5LL6 R;  2IOQ A;  2L92 A;  1KTV A;  3OML A;  4JI2 I;  2UUB E;  1Z0B A;  2B9D A;  4B3T E;  3V5R A;  2DIX A;  3K85 A;  1NZ0 A;  4DKK A;  1RR9 A;  2A2D A;  3LPS A;  1N36 I;  2CPN A;  2R3V A;  1QZR A;  1J5E E;  3J7A G;  3T1H I;  1YYK A;  1X49 A;  2JY9 A;  4LF8 I;  4P78 A;  4X66 E;  4UTG A;  4DV2 E;  4OOG C;  4N3O A;  2UXC E;  1SR9 A;  1ZM2 A;  4DMI A;  4YHH I;  2F8B A;  1WHQ A;  3HTX A;  4IZK B;  3ADG A;  2EFG A;  4EMD A;  3AUZ A;  1N34 E;  4GKJ E;  1ZXM A;  4JI7 E;  1Z0T A;  4DPY A;  2MC6 A;  4F9A B;  3K6Q A;  3P06 A;  1XNR E;  4WPY A;  3B8H A;  2CZ9 A;  2B3T B;  4DPU A;  3IWC A;  3JAM C;  3PYD A;  4KHP E;  1MX0 A;  1HNW E;  4B3M I;  4LFA E;  2UUA E;  5FWK A;  1UIL A;  2NPF A;  5IT9 C;  2E5L E;  1N0U A;  4DUZ E;  4LFB I;  1Z0V A;  1PIE A;  3IWD A;  1IBL E;  1DQ3 A;  3HPS A;  4J8Z A;  4M2Z A;  2NUE A;  1HK7 A;  2PNM A;  3HJC A;  2O1T A;  2NUG A;  4WUB A;  1Z59 A;  4Z7Y A;  2V88 A;  4JI3 E;  3J7A M;  1IBK E;  3ZKD A;  2V2V A;  4F54 A;  2JVA A;  1QU6 A;  1Z0G A;  2B7V A;  2UXB I;  2LTS A;  4MYU A;  4LTY A;  5CFF E;  3ZKB A;  1J26 A;  1FJG E;  2UUC E;  5DNY A;  4JI5 I;  2BM0 A;  2RS6 A;  4DV3 I;  5AE2 A;  4JI4 I;  4R1F A;  2EWL A;  3P1X A;  4DR5 E;  4AQY I;  3ADJ A;  4LF7 E;  4NXN E;  2LMZ A;  1FI4 A;  4MYT A;  2VQE E;  4IZK A;  5ADZ A;  1XMQ E;  1XMO E;  4DR7 I;  4DUY E;  1FWL A;  3LML A;  4OX9 E;  4PU9 A;  2ZBK B;  3GON A;  4JV5 E;  1IBM E;  1XNQ I;  4IZJ D;  2ZM6 E;  4JYA I;  2B7T A;  1ELO A;  3M6A A;  3ZZU A;  4DR2 I;  2M7Q A;  3F0N A;  2H36 X;  5GME A;  1USV A;  4DV4 E;  4WUD A;  4USK A;  4DR6 I;  1Y4U A;  4DV6 E;  3WU4 A;  4DV1 I;  3ADI A;  1KVK A;  2L3C A;  3K1J A;  4X64 I;  1H7U A;  2GQ0 A;  1A6F A;  1HR0 E;  2BM1 A;  1H73 A;  4B3S E;  2L2M A;  3T1Y E;  4DPW A;  5BR8 I;  2VF3 A;  3J80 Q;  4X62 E;  2RTX A;  2V87 A;  4DPT A;  2VQF I;  1I94 E;  2XEX A;  2UXD I;  2Z5E A;  1N32 I;  4R8O A;  4DV7 E;  4UT4 A;  2LRS A;  2L2N A;  3PYE A;  5IWA E;  2NA2 A;  4DR3 I;  1HNX I;  4LF5 I;  2V2Q A;  4ED4 A;  2HHH I;  4DV0 E;  2V89 A;  4DR1 I;  4F9B B;  2FTX B;  2IHR 1;  2BV3 A;  4JI8 E;  4LF9 I;  4XTJ A;  1U2R A;  4GKK I;  2JWO A;  4LF4 I;  3J7Y p;  2MC5 A;  4Q28 A;  4JI2 E;  3WU6 A;  3LNU A;  1N33 I;  4JI1 I;  5FLX Q;  4DPX A;  1X48 A;  4LF6 I;  1N34 I;  1N36 E;  2NUF A;  4ZVI A;  4YY3 E;  3T1H E;  3QT7 A;  2KOU A;  4LF8 E;  4JI0 I;  2F4V I;  2V85 A;  4NXM I;  2L8T A;  4R03 A;  4BBY A;  4PRV A;  4HXZ A;  5A2Q C;  1T4O A;  4YHH E;  2FV4 B;  3OTO I;  3DF6 A;  2L2K B;  1Z5A A;  3H4L A;  3Q1Q A;  2LE2 A;  2E1M A;  2DEI A;  4WSP A;  3QT8 A;  2ODR C;  4M0V A;  4HAC B;  4DV5 I;  4RPF A;  4B3M E;  2ODR D;  2V83 A;  1KKH A;  1NHI A;  3H09 A;  4FN5 A;  4LFB E;  5T6J A;  2DMY A;  3PRY A;  2IOP A;  3J81 C;  4TUI A;  2YZT A;  2HK3 A;  2HFU A;  3FIG A;  4DR4 I;  2HKJ A;  2LJP A;  4BCA A;  4WFT A;  2O1U A;  4I3H A;  2G7H A;  1GQE A;  1OJ4 A;  4Z7C A;  1HNZ I;  1ZXN A;  1ZM4 A;  3IWB A;  1MG7 A;  2WZO A;  3C4T A;  2A2C A;  5LMN I;  2UXB E;  4BC9 A;  2KHX A;  1NHH A;  1EI1 A;  4DXL A;  3JAM Q;  1XMQ I;  2M1S A;  4JI5 E;  4DV3 E;  2M4I A;  2AJ4 A;  4JI6 I;  4JI4 E;  5IT9 Q;  4AQY E;  4B3R I;  2LJH A;  1GZ6 A;  1Y4S A;  3JU0 A;  2V34 A;  5F3W A;  4DR7 E;  1Z5B A;  4M1K A;  4K0K I;  4L5N C;  3ZZT A;  2LUQ A;  1BKN A;  4X65 I;  1XNQ E;  4JYA E;  1UEK A;  4WYQ B;  1USU A;  4GEQ B;  4HAC A;  4DR2 E;  5LMU I;  4PRX A;  4LFC I;  1K47 A;  1YYW A;  3B82 A;  4FWG A;  4B3S I;  2UU9 I;  4DR6 E;  2E1R A;  1H74 A;  4DV1 E;  2ZIT A;  4X64 E;  1YZ9 A;  1NHJ A;  3HUL A;  4FW9 A;  2HK2 A;  1ZM3 A;  1B63 A;  4P7A A;  2CGE A;  5BR8 E;  3RMP A;  1PVG A;  2Z5B B;  2UUB I;  4B3T I;  2O1V A;  3V2U C;  1ZM9 A;  3AV0 A;  2VQF E;  2UXD E;  2RS7 A;  2N3G A;  1N32 E;  1ZBT A;  1VIS A;  2LBS B;  1J5E I;  1S16 A;  1O0W A;  4FWD A;  1WXR A;  1RRE A;  5GMD A;  4F9C B;  2V86 A;  4X66 I;  4KZS A;  4DV2 I;  2CG9 A;  2PNL A;  4DR3 E;  1HNX E;  2UXC I;  4LF5 E;  3K17 A;  2HHH E;  5L3J A;  3VYY A;  1DI2 A;  4DR1 E;  1MU5 A;  4KQV A;  4GKJ I;  4JI7 I;  1Z0C A;  4LF9 E;  1YYO A;  4YY3 I;  1XNR I;  5AAS A;  1B62 A;  3B78 A;  4GKK E;  1STU A;  3VYX A;  4LF4 E;  2L6M A;  4URL A;  1N33 E;  4JI1 E;  4KHP I;  1HNW I;  4LFA I;  2UUA I;  3D4J A;  4FWH A;  4LF6 E;  1S4E A;  2E5L I;  4DUZ I;  5AE3 A;  2VE7 C;  1EA6 A;  3ZM7 A;  4JI0 E;  3ZOQ B;  1IBL I;  2OI2 A;  2F4V E;  4NXM E;  2N3H A;  2LTR A;  2O1W A;  2R42 A;  2RSM A;  5AE1 A;  2LUP B;  3OTO E;  4HYM A;  1RQ0 A;  4JI3 I;  1IBK I;  1EKZ A;  2K4V A;  1KIJ A;  1WHN A;  3VK6 A;  2DB2 A;  4DV5 E;  1FNM A;  4BC7 A;  4LU9 A;  3ADL A;  2Z5B A;  4DU7 A;  3LTO A;  4USM A;  1UHZ A;  1FJG I;  2UUC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...