4LF7E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf7E02
2MDRA 1KTVA 4HXZA 4YHHE 1WUUA 4JV5I 4DV2I 2LTSA 4DR5I 5LMUI 1Z0WA 1FI4A 1YYOA 1YYWA 3ZZTA 3B82A 4DV3E 4B3RI 1GQEA 4GKJI 2LRSA 1XNQE 4M1KA 4LF7I 4DR7E 3HTXA 4LF5E 4LFCE 4MYTA 1XHKA 4LF9I 1H74A 4FWHA 1MU5A 4JI6E 4PU9A 4NXNE 1UHZA 1VISA 1N34E 1H7UA 1UEKA 4P7AA 4LFBE 1UILA 3J81Q 1H7SA 1DI2A 3QT7A 1ZM2A 2HK2A 2VQEI 4DU8A 3J80Q 3PYDA 2UXDI 1HNZI 1Z59A 2A2CA 4JI2E 2UUAI 1XNRE 1NHHA 4GKKI 4OX9E 4HACA 2BM0A 2UXBE 4FWGA 3LPSA 4DV7I 1T4NA 1IBKI 1FNMA 3WU3A 2YT4A 2HFSA 5LMNE 3ZZ0A 2E1RA 2BM1A 3ZKDA 3ADGA 4OOGC 1FWKA 4P52A 2B3TB 3V2UC 3J81C 4DR1I 2DEIA 4DR2E 4M2ZA 4B3SI 1HNXI 1WHNA 4Z7YA 1HR0I 2GS8A 4LF6E 4DKKA 3ZM7A 4DR3I 4DV6E 1IBME 2HKJA 3J7AM 4AQYE 2HHHE 1NHJA 2UU9I 1N32E 4X65I 3WU4A 4LFBI 3T1YE 1A6FA 1N0UA 1Z0BA 1STUA 2DIXA 4DU7A 4B3ME 4DV0I 2UUCE 4PRXA 4JI2I 4K0KI 3LTOA 3P1XA 4EMDA 2N3GA 2CZ9A 3JAMQ 4JI1E 3ADJA 5IT9C 4JG4A 1Z5AA 2HKEA 2L2MA 5LL6R 4M30A 4DUYE 4LF8I 1N0VC 1QU6A 4DPUA 5BR8E 1I94I 3J7Yp 1B63A 4DUZI 2LJHA 1J26A 1ZBTA 4X62E 2B7TA 5L3JA 4JI0E 2L3CA 2B7VA 2V8PA 3K1JA 4DV6I 2ZITA 4KHPI 1ZM3A 4DR6E 2F4VE 2UUBI 1FWLA 2ZBKB 2JY9A 2E5LE 1U2RA 2J7KA 1XMQI 2V2QA 2L2NA 1N36I 3V5RA 3B8HA 5IWAE 4DV1E 3OTOI 2NUFA 3ZKBA 4JI8E 2LUQA 2IHR1 2L33A 4FWDA 4JI7I 1IBLE 1J5EE 4JYAE 2NPFA 4YY3E 4JI4E 4DPYA 4X64I 4NXME 1EI1A 1N33E 4DV5E 1HNWI 3T1HE 1X47A 1Z5CA 2NUGA 4LFAI 5GMDA 1QZRA 3PYFA 4JI3I 1FKAE 4DR4E 4YHHI 1K47A 4FW9A 1Z0VA 3PYGA 1DARA 1FJGE 4DV4E 5BR8I 1PIEA 1Z5BA 2V2VA 4DV3I 1RC7A 1XMOE 4Z7CA 2R3VA 2DEJA 2X7IA 4URLA 1XNQI 4DR7I 4LF5I 1PKPA 4JI0I 5FLXQ 4FN5A 2KHXA 4LFCI 4JV5E 4DV2E 4RPFA 3J80C 5LMUE 2EZ6A 4KQVA 2F4VI 3Q1QA 4JI6I 4WUBA 4NXNI 4B3TE 1YZ9A 1MG7A 1N34I 1Z0TA 3D4JA 1O0WA 1H72C 1RQ0A 4JI8I 1KIJA 4GKJE 4LF4E 4UTGA 4LF7E 2L3JA 1T4LB 1NZ0A 2LTRA 1BKNA 4LF9E 3VYYA 1XNRI 4OX9I 3H4LA 2UXBI 4HYMA 3HULA 2V2ZA 2LJPA 3ZZUA 4X66E 1MX0A 2JVAA 4WFTA 3J7AG 3GONA 5LMNI 2VQEE 1ZXMA 2UXDE 2LBSB 1XMOI 2OI2A 3M6AA 2UUAE 3C4TA 3LLHA 4GKKE 4DR2I 4DV7E 1ZM9A 1IBKE 2N3HA 1Z0EA 4LF6I 1Z0CA 3CWVA 1IBMI 3WU5A 2RS6A 4B3TI 4AQYI 2NA2A 2Q2EB 4USKA 3LNUA 1KKHA 4WYQB 1H73A 3JAMC 4USMA 1S4EA 2HHHI 1N32I 1RR9A 5GMEA 1EKZA 3QT8A 4R1FA 1X49A 3T1YI 4LF4I 1PVGA 4DR1E 4XTJA 4HACB 4B3SE 2WW4A 1HNXE 2VF3A 1HR0E 3WU6A 2EFGA 2V34A 4DR3E 4B3MI 3K17A 2UUCI 2ZM6E 2L2KB 2UU9E 4X65E 4JI1I 4X66I 4MYUA 3QT6A 4DUYI 1T4OA 4JI5E 2HK3A 1Z0GA 2HFUA 4DV0E 2UXCE 1ELOA 4K0KE 4WUDA 1S16A 2CPNA 1WHQA 4X62I 4DPXA 2AJ4A 3C4BA 2VQFE 1KVKA 4DR5E 4DR6I 4LF8E 2R42A 2E5LI 1RREA 2XEXA 4B3RE 3VYXA 5IWAI 1I94E 4DV1I 1ZM4A 4DUZE 2DMYA 4WUCA 2NUEA 2BV3A 5A2QQ 1IBLI 1J5EI 4JYAI 4YY3I 4JI4I 5IT9Q 4PRVA 4NXMI 2X36A 1N33I 4DV5I 1X48A 1YYKA 4KHPE 4DPTA 2UUBE 3ADLA 3T1HI 2ZM6I 3B78A 4ZVIA 1XMQE 3PYEA 1N36E 1D6TA 3OTOE 4I3HA 4X8WA 5FLXC 2RTXA 1NHIA 4DPWA 4DR4I 4JI7E 1FJGI 1EA6A 3F0NA 2RS7A 3QT5A 4UT4A 4DV4I 4JI5I 4X64E 1ZXNA 1HNZE 1HNWE 2UXCI 2A2DA 1B62A 1OJ4A 3ADIA 4ED4A 2DB2A 4LFAE 4DXLA 5A2QC 2LUPB 2RSMA 4HY1A 2VQFI 5CFFE 4JI3E
chains in the Genus database with same CATH superfamily
2MDRA 1KTVA 4HXZA 3THNA 4YHHE 1WUUA 2B9DA 4JV5I 4DV2I 2VRDA 2LTSA 4DR5I 5LMUI 2EPPA 2K4VA 2DMIA 2DSYA 1Z0WA 1FI4A 1YYOA 4FW7A 1YYWA 3ZZTA 2IESA 4P7DA 2EMXA 5ADZA 3B82A 4DV3E 1Y4SA 4B3RI 2LJUA 5A6BA 1GQEA 3F6GA 2EM9A 3UK3C 4GKJI 4U3DA 3KRNA 1NEIA 3M7ND 2LRSA 1NCSA 2EP3A 1XNQE 2ENAA 2EOQA 4R2AA 2EMLA 4M1KA 5AE3A 4DR7E 4LF7I 3JU0A 3HTXA 2PO0B 4LF5E 4MLVA 3U1KA 3IWCA 2EM7A 4LFCE 1WRJA 4MYTA 1XHKA 2BA1D 4LF9I 2JYAA 1H74A 2V83A 4FWHA 2EPXA 2VE7C 4NHRA 4JI6E 3HQ1A 1MU5A 1UDOA 4PU9A 4NXNE 1PJQA 5K36C 2J7JA 1UHZA 2PO2A 2D9HA 1EH8A 2GO4A 1VISA 1N34E 2C39A 1H7UA 1UEKA 4FW3A 4P7AA 1UDQA 3P3GA 1BBOA 4LFBE 5JEAC 2JOBA 1UILA 4LPFA 4AIMA 5K36B 2GPIA 3J81Q 1X5WA 1OYRA 1H7SA 2EPKX 1DI2A 3QT7A 4OO1C 4NZVA 1ZM2A 2EL6A 2HK2A 2NN6C 3RMPA 2VQEI 4DU8A 2C38A 5DNXA 3J80Q 3PYDA 5JEAB 1HNZI 2UXDI 1KYQA 1Z59A 2A2CA 2J65A 2WP8B 4IS9A 2JP9A 4JI2E 5K36E 2UUAI 2EOFA 1XNRE 1NHHA 4GKKI 4OX9E 4HACA 4OO1B 2BA0D 2EMGA 2L8TA 2UXBE 2BM0A 3DD6A 2YTFA 3LPSA 2V89A 2JXPA 4FWGA 1T4NA 4DV7I 4LOMA 1IBKI 3M7NG 3MHHC 2WCC3 3H09A 5JEAE 1FNMA 5T6JA 2JEBB 2EM6A 3WU3A 2YT4A 3OMLA 2BR2A 2EOSA 3EPJA 4BMJA 4MU4A 3DF6A 4GZNC 1SFEA 5KL2A 2GHFA 2BA1G 4OO1E 2HFSA 4IZJD 5LMNE 3ZZ0A 1IQOA 2E1RA 3PS2A 2KONA 2BM1A 3ZKDA 2BBGA 5JEAD 3ADGA 4BHCA 2PRTA 4OOGC 1FWKA 4P52A 3DJWA 2B3TB 1YUJA 3V2UC 3J81C 4NBQA 4DR1I 2DEIA 4DR2E 4M2ZA 4B3SI 1HNXI 5A69A 1WHNA 4IZJA 4Z7YA 1HR0I 2GS8A 1TF6A 2YTNA 5C0XC 4LF6E 3F6HA 4DKKA 3ZM7A 4DR3I 4DV6E 2RQLA 1IBME 3Q6NA 1A1FA 2EMWA 2HKJA 2Z5BA 3J7AM 4AQYE 2A25A 2DLKA 2EMKA 3EQ1A 5C0XB 3P3CA 4MU1A 2FGGA 2BA0G 4BA2B 1PJTA 2HHHE 1NHJA 2UU9I 1N32E 4X65I 5KL4A 4FW6A 2YSOA 3WU4A 4MU0A 4LFBI 3T1YE 2EN7A 1A6FA 1N0UA 1Z0BA 1STUA 2YTDA 4HTGA 2EJ4A 1WXRA 2MC6A 3BIDA 4F9CB 2WBUA 4LCFA 5C0XE 4ISAA 4IFDA 3C6MA 5A6JA 2DIXA 4DU7A 2EOYA 4B3ME 5DNLA 4DV0I 2EN8A 2UUCE 1VI7A 4PRXA 4JI2I 4K0KI 2LO3A 2PO1A 3LTOA 3ECRA 3M99B 2M7QA 3P1XA 4EMDA 2C37A 3P76A 1Y60A 2K7IA 2N3GA 2CG9A 1JK2A 2CZ9A 5C0XD 2E1MA 4ZYHA 3JAMQ 4JI1E 3ADJA 5IT9C 4JG4A 3JTZA 4LCHA 5IV8B 3K6QA 1Z5AA 2YTIA 4KWYA 2Z5CB 2HKEA 2L2MA 2BB8A 5LL6R 4IJDA 2LCEA 1A1KA 3PRYA 2YTQA 4M30A 4DUYE 1T38A 1N0VC 1QU6A 4Q28A 1USUA 1TF3A 4LF8I 2EMFA 4DPUA 2EWLA 5BR8E 2R1FA 2EN1A 3FIGA 2F8BA 3KZZA 1I94I 3J7Yp 2EOOA 1B63A 4DUZI 2JEAA 2LJHA 1J26A 4KZSA 2LT7A 1ZBTA 2DRPA 5F3WA 4X62E 2V8QB 1OYPA 2C39B 3EPHA 5FWKA 4LTYA 2B7TA 2H36X 2I13A 5L3JA 1YSAC 4JI0E 2L3CA 2B7VA 2V8PA 3K1JA 4MU3A 4DV6I 1QNTA 2ZITA 4KHPI 1ZM3A 4DR6E 2F4VE 2UUBI 2EQ0A 1FWLA 2ZBKB 2JY9A 1AH5A 4F54A 1N3GA 2E5LE 4BA1A 5KL7A 1YUIA 2YTGA 1U2RA 4R8OA 4O43A 4BBYA 4F9BB 2J7KA 4J3DA 2V2QA 1XMQI 2L2NA 1N36I 3V5RA 3B8HA 5IWAE 2EM0A 4DV1E 3OTOI 3HXLA 2NUFA 5K36F 3ZKBA 1DGCA 4JI8E 5AC4A 3EPKA 1X6FA 1X6EA 2LUQA 2IHR1 2L33A 4IS1C 4FWDA 4JI7I 2LVHA 1IBLE 1J5EE 4JYAE 2EOJA 3HPSA 4YY3E 2NPFA 5JEAF 1BBGA 2FTXB 4JI4E 4DPYA 1YPNA 1JK1A 4X64I 4NXME 1EI1A 1N33E 4DV5E 2EPOA 2EE8A 1HNWI 3GLLA 4OO1F 4RH8A 2EMZA 3T1HE 1B69A 2JE6B 1X47A 2YTPA 1Z5CA 2NUGA 5IXMB 2VESA 3B4TA 2EN6A 4LFAI 2NN6B 5GMDA 2EM4A 2PO0A 2LV2A 1QZRA 4AIDA 5DRPA 3PYFA 4JI3I 4ZYGA 1BB8A 3CDIA 1FKAE 4DR4E 4YHHI 4AM3A 3H1CA 4R2DA 1T39A 5K36D 1K47A 4FW9A 2EOIA 4LU9A 1Z0VA 3PYGA 3L7ZB 5DRQA 1DARA 1FJGE 2NN6E 4DV4E 2YPNA 3THOB 5BR8I 1PIEA 1Z5BA 1DQ3A 4BC7A 2V2VA 1A1GA 1RC7A 4DV3I 1XMOE 4Z7CA 2YU8A 5A6AA 2R3VA 2Z5BB 4QNJA 2ENHA 1RHYA 2MKDA 2EPNA 2M4IA 2V86A 3ZOQB 4IZKA 5K36A 2DEJA 2PNMA 2X7IA 4URLA 2NN6D 1XNQI 4OO1D 2MKNA 1P42A 4DR7I 4MLQA 3MHSC 2HC5A 2ADRA 2LMZA 3AUZA 4MQYA 4LF5I 1PKPA 4IFDC 2YU5A 4JI0I 5FLXQ 2EMAA 4FN5A 2KHXA 4LFCI 2EN4A 4JV5E 2LE2A 2YRKA 3J80C 4DV2E 1R6LA 1YH8A 4RPFA 5JEAA 2WP8A 5LMUE 2EZ6A 4KQVA 4I8OA 2F4VI 1Y5YA 3Q1QA 5C0XF 4WUBA 2WNRA 4JI6I 4OO1A 4NXNI 4B3TE 1YZ9A 4IFDB 2CTDA 2RSIA 1MG7A 2EMIA 2ENCA 1N34I 1Z0TA 3D4JA 4GEQB 3U1YA 2R76A 1O0WA 4FK5C 2MC5A 1RQ0A 2ODRC 1H72C 1A1JA 2YZTA 2V87A 4JI8I 1KIJA 4GKJE 2CVEA 4OKGA 2JEBA 4LF4E 4UTGA 3GMEA 1RMDA 4LF7E 2L3JA 4IFDE 2EOMA 1T4LB 3KWRA 1NZ0A 2LTRA 4FW4A 1BKNA 2EN2A 2EPCA 1Y4UA 2GQ0A 5TSEA 4LF9E 4R2RA 5EKWA 2O3ZA 3VYYA 1XNRI 2EL5A 2EOZA 4OX9I 2FV4B 3H4LA 3AV0A 4HYMA 2UXBI 5AASA 1GTKA 4X9JA 4R2QA 2I9IA 3HULA 2V2ZA 2LJPA 4M0VA 3ZZUA 2JEAB 2WZOA 4X66E 1MX0A 2JVAA 4TUGA 2V85A 2DGCA 4BS9A 4WFTA 4WSGA 3VHTB 2YRMA 3J7AG 2PNLA 4F2JC 2EPMX 2EMHA 5DNYA 2GO3A 3GONA 3IWDA 2ODRD 5LMNI 2M1SA 5C0XA 2VQEE 1ZXMA 2UXDE 4GQUA 2LBSB 1YFHA 2L92A 4R2SA 1YHCA 2JR1A 1XMOI 2OI2A 3M6AA 2EN3A 1X3CA 2UUAE 2Z5EA 2EM2A 4BA1B 3LMLA 3C4TA 3LLHA 4GKKE 3CDJA 4O5GA 2F1DA 5KL6A 1Y6ZA 4F6NA 1PJSA 4R2EA 2PO2B 4DV7E 4DR2I 2YWQA 1ZM9A 1IBKE 1USVA 2N3HA 2EM5A 1ZAAC 1UN6B 3PS1A 5A6BD 1Z0EA 2EMCA 4LF6I 2EOXA 3BF2A 1Z0CA 2EPZA 1WJPA 3CWVA 4O24A 3M85D 4M9VC 5DRRA 1IBMI 2IOPA 4BHBA 3BBGA 3EPLA 2PNZA 3WU5A 2RS6A 4B3TI 4AQYI 2NA2A 2Q2EB 4USKA 4F9AB 3LNUA 1IQSA 1KKHA 4WYQB 2ELYA 1Z1BA 1H73A 4BCAA 3JAMC 2C38B 4USMA 1S4EA 2HHHI 1N32I 1G2FC 1E3PA 1RR9A 2O1UA 1EKZA 5GMEA 3QT8A 4R1FA 4OZEA 4U3BA 1X49A 2Z5CA 3T1YI 4LF4I 2EOEA 1A1HA 4DR1E 1PVGA 1HK7A 4HACB 4XTJA 2EORA 3KZYA 4B3SE 2JPAA 1HNXE 2WW4A 2VF3A 4BC9A 3C6KA 1HR0E 4L8NA 2YSPA 3WU6A 4WPYA 2EFGA 4DMIA 3P06A 2GLIA 2V34A 3IWBA 4DR3E 1L4SA 3K17A 4B3MI 2BR2B 2UUCI 3QG5C 3VK6A 2NN6F 3HPZA 1ZR9A 2E72A 2O1TA 2ZM6E 1A1IA 5AE2A 1PDAA 3HKMA 3L00A 2L2KB 2UU9E 2O1VA 4WX9A 4X65E 4R2CA 3NZKA 4JI1I 5ELWA 4X66I 4MYUA 3QT6A 4IZKB 1R6MA 4HEIA 4DUYI 4QNKA 3M85G 4IZJB 4WXDA 1T4OA 2NABA 4JI5E 1OYSA 2HK3A 2EOHA 5AC5A 1Z0GA 2HFUA 4N4RB 4WSPA 4DV0E 3GCMA 2UXCE 1ELOA 5AE1A 4K0KE 2WNRB 1XXEA 4RHBB 4WUDA 1S16A 2DLQA 2CPNA 1WHQA 2EPUA 2IOQA 4X62I 4DPXA 2AJ4A 3C4BA 5DROA 2VQFE 2AE8A 5KL3A 5A6KA 1KVKA 5KL5A 4LCGA 1ZU1A 2EM8A 4DR5E 4IFDF 4DR6I 4LF8E 1UBDC 2R42A 2E5LI 2JE6A 2L6MA 2WBTA 4R2PA 2YTJA 2G7HA 2NN6A 1RREA 2XEXA 2N8XA 4N3OA 1P47A 4B3RE 2EPRA 2HJJA 2HGHA 1I94E 3VYXA 1IMUA 2YTOA 2IERA 1ZM4A 4WXCA 5IWAI 4DV1I 4DUZE 2CT1A 2DMYA 4WUCA 2M9AA 2PO1B 1G2DC 3BGHA 2NUEA 3HJCA 2KOUA 2BV3A 2EQ1A 2C37B 1E3HA 1X6HA 5A2QQ 2Q8UA 1IBLI 4F6MA 3L7ZA 4FW5A 3UHMA 1J5EI 4JYAI 4YY3I 3PS3A 1EH6A 4JI4I 5IT9Q 2CGEA 1ZBQA 2YTEA 2YRHA 4Q35B 1A1LA 1SR9A 2WBSA 4PRVA 4NXMI 2X36A 2EMBA 4DV5I 1N33I 2EQ3A 1X48A 1YYKA 4KHPE 1GZ6A 4DPTA 5EL9A 2UUBE 1F2IG 3ADLA 4MDTA 3T1HI 2ZM6I 3B78A 4IFDD 4ZVIA 2EMYA 1XMQE 3PYEA 1N36E 1D6TA 2JWOA 2CSHA 3OTOE 2EM3A 4I3HA 4X8WA 5FLXC 1MGTA 4J8ZA 4L5NC 4O4KA 2RTXA 1NHIA 4DPWA 4DR4I 2MDGA 4JI7E 3TQMA 1LLMC 2EPLX 4TUIA 4P78A 1FJGI 1UDSA 1EA6A 3F0NA 2EL4A 2RS7A 1MEYC 3QT5A 4UT4A 4DV4I 4JI5I 1EH7A 4X64E 3Q6MA 2V88A 4ZYEA 4R03A 1ZXNA 4BA2A 1HNZE 2VF1A 1HNWE 3K85A 2UXCI 2A2DA 1B62A 3P3EA 2PNZB 1KJKA 1OJ4A 2EPAA 3ADIA 1AAYA 4ED4A 2DB2A 5A2QC 4LFAE 4ZYDA 2LUPB 1UDNA 2RPCA 2ELZA 1TN9A 2JT2A 4DXLA 2RSMA 2JOXA 4HY1A 2O1WA 3MSWA 2VQFI 5CFFE 4JI3E 5LLQA
chains in the Genus database with same CATH topology
2MDRA 1KTVA 4HXZA 4YHHE 1WUUA 2B9DA 4JV5I 4DV2I 2LTSA 4DR5I 5LMUI 2K4VA 2DSYA 1Z0WA 1FI4A 1YYOA 1YYWA 3ZZTA 4P7DA 3B82A 5ADZA 4DV3E 1Y4SA 4B3RI 1GQEA 3F6GA 4GKJI 2LRSA 1XNQE 4M1KA 4LF7I 5AE3A 4DR7E 3JU0A 3HTXA 4LF5E 3IWCA 4LFCE 4MYTA 1XHKA 4LF9I 1H74A 2V83A 4FWHA 2VE7C 1MU5A 4JI6E 3HQ1A 4PU9A 4NXNE 1UHZA 1VISA 1N34E 1H7UA 1UEKA 4P7AA 4LFBE 2JOBA 1UILA 3J81Q 1H7SA 1DI2A 3QT7A 1ZM2A 2HK2A 3RMPA 2VQEI 4DU8A 3J80Q 3PYDA 2UXDI 1HNZI 1Z59A 2A2CA 4JI2E 2UUAI 1XNRE 1NHHA 4GKKI 4OX9E 4HACA 2BM0A 2L8TA 2UXBE 4FWGA 3LPSA 2V89A 4DV7I 1T4NA 1IBKI 3H09A 1FNMA 5T6JA 3WU3A 2YT4A 3OMLA 4BMJA 3DF6A 2HFSA 4IZJD 5LMNE 3ZZ0A 2E1RA 2KONA 2BM1A 3ZKDA 3ADGA 4OOGC 1FWKA 4P52A 3DJWA 2B3TB 3V2UC 3J81C 4DR1I 2DEIA 4DR2E 4M2ZA 4B3SI 1HNXI 1WHNA 4IZJA 4Z7YA 1HR0I 2GS8A 4LF6E 3F6HA 4DKKA 3ZM7A 4DR3I 4DV6E 1IBME 3Q6NA 2HKJA 2Z5BA 3J7AM 4AQYE 2FGGA 2HHHE 1NHJA 2UU9I 1N32E 4X65I 3WU4A 4LFBI 3T1YE 1A6FA 1N0UA 1Z0BA 1STUA 1WXRA 2MC6A 4F9CB 2DIXA 4DU7A 4B3ME 4DV0I 2UUCE 4PRXA 4JI2I 4K0KI 3LTOA 2M7QA 3P1XA 4EMDA 2CG9A 2N3GA 2CZ9A 2E1MA 3JAMQ 4JI1E 3ADJA 5IT9C 4JG4A 3JTZA 3K6QA 1Z5AA 2Z5CB 2HKEA 2L2MA 3PRYA 5LL6R 4M30A 4DUYE 1USUA 1N0VC 1QU6A 4Q28A 4LF8I 4DPUA 2EWLA 5BR8E 3FIGA 2F8BA 1I94I 3J7Yp 1B63A 4DUZI 2LJHA 1J26A 4KZSA 1ZBTA 5F3WA 4X62E 2V8QB 5FWKA 4LTYA 2B7TA 2H36X 5L3JA 4JI0E 2L3CA 2B7VA 2V8PA 3K1JA 4DV6I 2ZITA 4KHPI 1ZM3A 4DR6E 2F4VE 2UUBI 1FWLA 2ZBKB 2JY9A 4F54A 2E5LE 1U2RA 4R8OA 2J7KA 4BBYA 4F9BB 1XMQI 2V2QA 2L2NA 1N36I 3V5RA 3B8HA 5IWAE 4DV1E 3OTOI 3HXLA 2NUFA 3ZKBA 4JI8E 2LUQA 2IHR1 2L33A 4FWDA 4JI7I 1IBLE 1J5EE 4JYAE 3HPSA 2NPFA 4YY3E 2FTXB 4JI4E 4DPYA 4X64I 4NXME 1EI1A 1N33E 4DV5E 1HNWI 3T1HE 1X47A 1Z5CA 2NUGA 4LFAI 5GMDA 1QZRA 3PYFA 4JI3I 1FKAE 4DR4E 4YHHI 1K47A 4FW9A 4LU9A 1Z0VA 3PYGA 1DARA 1FJGE 4DV4E 5BR8I 1PIEA 1Z5BA 1DQ3A 4BC7A 2V2VA 4DV3I 1RC7A 1XMOE 4Z7CA 2R3VA 2Z5BB 2M4IA 2V86A 4IZKA 2DEJA 2PNMA 2X7IA 4URLA 1XNQI 4DR7I 2LMZA 3AUZA 4LF5I 1PKPA 4JI0I 5FLXQ 4FN5A 2KHXA 4LFCI 4JV5E 2LE2A 3J80C 4DV2E 4RPFA 5LMUE 2EZ6A 4KQVA 4I8OA 2F4VI 3Q1QA 4JI6I 4WUBA 4NXNI 4B3TE 1YZ9A 1MG7A 1N34I 1Z0TA 3D4JA 4GEQB 1O0WA 1H72C 2MC5A 1RQ0A 2ODRC 2YZTA 2V87A 4JI8I 1KIJA 4GKJE 4LF4E 4UTGA 4LF7E 2L3JA 1T4LB 3KWRA 1NZ0A 2LTRA 1BKNA 1Y4UA 2GQ0A 4LF9E 3VYYA 1XNRI 4OX9I 2FV4B 3H4LA 3AV0A 4HYMA 2UXBI 5AASA 3HULA 2V2ZA 2LJPA 4M0VA 3ZZUA 2WZOA 4X66E 1MX0A 2JVAA 4TUGA 2V85A 4BS9A 4WFTA 3J7AG 2PNLA 5DNYA 3GONA 3IWDA 2ODRD 5LMNI 2M1SA 2VQEE 1ZXMA 2UXDE 2LBSB 2L92A 1XMOI 2JR1A 2OI2A 3M6AA 2UUAE 2Z5EA 3LMLA 3C4TA 3LLHA 4GKKE 1Y6ZA 4DR2I 4DV7E 1ZM9A 1IBKE 1USVA 2N3HA 1Z0EA 4LF6I 1Z0CA 3CWVA 1IBMI 2IOPA 3WU5A 2RS6A 4B3TI 4AQYI 2NA2A 2Q2EB 4USKA 4F9AB 3LNUA 1KKHA 4WYQB 1H73A 4BCAA 3JAMC 4USMA 1S4EA 2HHHI 1N32I 1RR9A 5GMEA 2O1UA 1EKZA 3QT8A 4R1FA 1X49A 2Z5CA 3T1YI 4LF4I 1PVGA 4DR1E 1HK7A 4HACB 4XTJA 4B3SE 2WW4A 1HNXE 2VF3A 4BC9A 1HR0E 4L8NA 3WU6A 4WPYA 2EFGA 4DMIA 3P06A 2V34A 3IWBA 4DR3E 4B3MI 3K17A 2UUCI 3VK6A 3MSWA 3HPZA 2O1TA 2ZM6E 5AE2A 2O1VA 2L2KB 2UU9E 4X65E 4JI1I 4X66I 4MYUA 3QT6A 4IZKB 4DUYI 4IZJB 1T4OA 4JI5E 2HK3A 1Z0GA 2HFUA 4WSPA 4DV0E 2UXCE 1ELOA 5AE1A 4K0KE 4WUDA 1S16A 2CPNA 1WHQA 2IOQA 4X62I 4DPXA 2AJ4A 3C4BA 2VQFE 1KVKA 4DR5E 4DR6I 4LF8E 2R42A 2E5LI 2L6MA 2G7HA 4N3OA 1RREA 2XEXA 4B3RE 3VYXA 5IWAI 1I94E 4DV1I 1ZM4A 4DUZE 2DMYA 4WUCA 2NUEA 3HJCA 2KOUA 2BV3A 5A2QQ 1IBLI 1J5EI 4JYAI 4YY3I 4JI4I 5IT9Q 2CGEA 1ZBQA 4PRVA 1SR9A 4NXMI 2X36A 1N33I 4DV5I 1X48A 1YYKA 4KHPE 1GZ6A 4DPTA 2UUBE 3ADLA 3T1HI 2ZM6I 3B78A 4ZVIA 1XMQE 3PYEA 1N36E 1D6TA 2JWOA 3OTOE 4I3HA 4X8WA 5FLXC 4J8ZA 4L5NC 2RTXA 1NHIA 4DPWA 4DR4I 4JI7E 4TUIA 4P78A 1FJGI 1EA6A 3F0NA 2RS7A 3QT5A 4UT4A 4DV4I 4JI5I 3Q6MA 4X64E 2V88A 4R03A 1ZXNA 1HNZE 2VF1A 1HNWE 3K85A 2UXCI 2A2DA 1B62A 1OJ4A 3ADIA 4ED4A 2DB2A 5A2QC 4LFAE 4DXLA 2LUPB 2RSMA 2JOXA 4HY1A 2O1WA 3ZOQB 2VQFI 5CFFE 4JI3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDR A;  1KTV A;  4HXZ A;  4YHH E;  1WUU A;  4JV5 I;  4DV2 I;  2LTS A;  4DR5 I;  5LMU I;  1Z0W A;  1FI4 A;  1YYO A;  1YYW A;  3ZZT A;  3B82 A;  4DV3 E;  4B3R I;  1GQE A;  4GKJ I;  2LRS A;  1XNQ E;  4M1K A;  4LF7 I;  4DR7 E;  3HTX A;  4LF5 E;  4LFC E;  4MYT A;  1XHK A;  4LF9 I;  1H74 A;  4FWH A;  1MU5 A;  4JI6 E;  4PU9 A;  4NXN E;  1UHZ A;  1VIS A;  1N34 E;  1H7U A;  1UEK A;  4P7A A;  4LFB E;  1UIL A;  3J81 Q;  1H7S A;  1DI2 A;  3QT7 A;  1ZM2 A;  2HK2 A;  2VQE I;  4DU8 A;  3J80 Q;  3PYD A;  2UXD I;  1HNZ I;  1Z59 A;  2A2C A;  4JI2 E;  2UUA I;  1XNR E;  1NHH A;  4GKK I;  4OX9 E;  4HAC A;  2BM0 A;  2UXB E;  4FWG A;  3LPS A;  4DV7 I;  1T4N A;  1IBK I;  1FNM A;  3WU3 A;  2YT4 A;  2HFS A;  5LMN E;  3ZZ0 A;  2E1R A;  2BM1 A;  3ZKD A;  3ADG A;  4OOG C;  1FWK A;  4P52 A;  2B3T B;  3V2U C;  3J81 C;  4DR1 I;  2DEI A;  4DR2 E;  4M2Z A;  4B3S I;  1HNX I;  1WHN A;  4Z7Y A;  1HR0 I;  2GS8 A;  4LF6 E;  4DKK A;  3ZM7 A;  4DR3 I;  4DV6 E;  1IBM E;  2HKJ A;  3J7A M;  4AQY E;  2HHH E;  1NHJ A;  2UU9 I;  1N32 E;  4X65 I;  3WU4 A;  4LFB I;  3T1Y E;  1A6F A;  1N0U A;  1Z0B A;  1STU A;  2DIX A;  4DU7 A;  4B3M E;  4DV0 I;  2UUC E;  4PRX A;  4JI2 I;  4K0K I;  3LTO A;  3P1X A;  4EMD A;  2N3G A;  2CZ9 A;  3JAM Q;  4JI1 E;  3ADJ A;  5IT9 C;  4JG4 A;  1Z5A A;  2HKE A;  2L2M A;  5LL6 R;  4M30 A;  4DUY E;  4LF8 I;  1N0V C;  1QU6 A;  4DPU A;  5BR8 E;  1I94 I;  3J7Y p;  1B63 A;  4DUZ I;  2LJH A;  1J26 A;  1ZBT A;  4X62 E;  2B7T A;  5L3J A;  4JI0 E;  2L3C A;  2B7V A;  2V8P A;  3K1J A;  4DV6 I;  2ZIT A;  4KHP I;  1ZM3 A;  4DR6 E;  2F4V E;  2UUB I;  1FWL A;  2ZBK B;  2JY9 A;  2E5L E;  1U2R A;  2J7K A;  1XMQ I;  2V2Q A;  2L2N A;  1N36 I;  3V5R A;  3B8H A;  5IWA E;  4DV1 E;  3OTO I;  2NUF A;  3ZKB A;  4JI8 E;  2LUQ A;  2IHR 1;  2L33 A;  4FWD A;  4JI7 I;  1IBL E;  1J5E E;  4JYA E;  2NPF A;  4YY3 E;  4JI4 E;  4DPY A;  4X64 I;  4NXM E;  1EI1 A;  1N33 E;  4DV5 E;  1HNW I;  3T1H E;  1X47 A;  1Z5C A;  2NUG A;  4LFA I;  5GMD A;  1QZR A;  3PYF A;  4JI3 I;  1FKA E;  4DR4 E;  4YHH I;  1K47 A;  4FW9 A;  1Z0V A;  3PYG A;  1DAR A;  1FJG E;  4DV4 E;  5BR8 I;  1PIE A;  1Z5B A;  2V2V A;  4DV3 I;  1RC7 A;  1XMO E;  4Z7C A;  2R3V A;  2DEJ A;  2X7I A;  4URL A;  1XNQ I;  4DR7 I;  4LF5 I;  1PKP A;  4JI0 I;  5FLX Q;  4FN5 A;  2KHX A;  4LFC I;  4JV5 E;  4DV2 E;  4RPF A;  3J80 C;  5LMU E;  2EZ6 A;  4KQV A;  2F4V I;  3Q1Q A;  4JI6 I;  4WUB A;  4NXN I;  4B3T E;  1YZ9 A;  1MG7 A;  1N34 I;  1Z0T A;  3D4J A;  1O0W A;  1H72 C;  1RQ0 A;  4JI8 I;  1KIJ A;  4GKJ E;  4LF4 E;  4UTG A;  4LF7 E;  2L3J A;  1T4L B;  1NZ0 A;  2LTR A;  1BKN A;  4LF9 E;  3VYY A;  1XNR I;  4OX9 I;  3H4L A;  2UXB I;  4HYM A;  3HUL A;  2V2Z A;  2LJP A;  3ZZU A;  4X66 E;  1MX0 A;  2JVA A;  4WFT A;  3J7A G;  3GON A;  5LMN I;  2VQE E;  1ZXM A;  2UXD E;  2LBS B;  1XMO I;  2OI2 A;  3M6A A;  2UUA E;  3C4T A;  3LLH A;  4GKK E;  4DR2 I;  4DV7 E;  1ZM9 A;  1IBK E;  2N3H A;  1Z0E A;  4LF6 I;  1Z0C A;  3CWV A;  1IBM I;  3WU5 A;  2RS6 A;  4B3T I;  4AQY I;  2NA2 A;  2Q2E B;  4USK A;  3LNU A;  1KKH A;  4WYQ B;  1H73 A;  3JAM C;  4USM A;  1S4E A;  2HHH I;  1N32 I;  1RR9 A;  5GME A;  1EKZ A;  3QT8 A;  4R1F A;  1X49 A;  3T1Y I;  4LF4 I;  1PVG A;  4DR1 E;  4XTJ A;  4HAC B;  4B3S E;  2WW4 A;  1HNX E;  2VF3 A;  1HR0 E;  3WU6 A;  2EFG A;  2V34 A;  4DR3 E;  4B3M I;  3K17 A;  2UUC I;  2ZM6 E;  2L2K B;  2UU9 E;  4X65 E;  4JI1 I;  4X66 I;  4MYU A;  3QT6 A;  4DUY I;  1T4O A;  4JI5 E;  2HK3 A;  1Z0G A;  2HFU A;  4DV0 E;  2UXC E;  1ELO A;  4K0K E;  4WUD A;  1S16 A;  2CPN A;  1WHQ A;  4X62 I;  4DPX A;  2AJ4 A;  3C4B A;  2VQF E;  1KVK A;  4DR5 E;  4DR6 I;  4LF8 E;  2R42 A;  2E5L I;  1RRE A;  2XEX A;  4B3R E;  3VYX A;  5IWA I;  1I94 E;  4DV1 I;  1ZM4 A;  4DUZ E;  2DMY A;  4WUC A;  2NUE A;  2BV3 A;  5A2Q Q;  1IBL I;  1J5E I;  4JYA I;  4YY3 I;  4JI4 I;  5IT9 Q;  4PRV A;  4NXM I;  2X36 A;  1N33 I;  4DV5 I;  1X48 A;  1YYK A;  4KHP E;  4DPT A;  2UUB E;  3ADL A;  3T1H I;  2ZM6 I;  3B78 A;  4ZVI A;  1XMQ E;  3PYE A;  1N36 E;  1D6T A;  3OTO E;  4I3H A;  4X8W A;  5FLX C;  2RTX A;  1NHI A;  4DPW A;  4DR4 I;  4JI7 E;  1FJG I;  1EA6 A;  3F0N A;  2RS7 A;  3QT5 A;  4UT4 A;  4DV4 I;  4JI5 I;  4X64 E;  1ZXN A;  1HNZ E;  1HNW E;  2UXC I;  2A2D A;  1B62 A;  1OJ4 A;  3ADI A;  4ED4 A;  2DB2 A;  4LFA E;  4DXL A;  5A2Q C;  2LUP B;  2RSM A;  4HY1 A;  2VQF I;  5CFF E;  4JI3 E; 
#chains in the Genus database with same CATH topology
 2MDR A;  1KTV A;  4HXZ A;  3THN A;  4YHH E;  1WUU A;  2B9D A;  4JV5 I;  4DV2 I;  2VRD A;  2LTS A;  4DR5 I;  5LMU I;  2EPP A;  2K4V A;  2DMI A;  2DSY A;  1Z0W A;  1FI4 A;  1YYO A;  4FW7 A;  1YYW A;  3ZZT A;  2IES A;  4P7D A;  2EMX A;  5ADZ A;  3B82 A;  4DV3 E;  1Y4S A;  4B3R I;  2LJU A;  5A6B A;  1GQE A;  3F6G A;  2EM9 A;  3UK3 C;  4GKJ I;  4U3D A;  3KRN A;  1NEI A;  3M7N D;  2LRS A;  1NCS A;  2EP3 A;  1XNQ E;  2ENA A;  2EOQ A;  4R2A A;  2EML A;  4M1K A;  5AE3 A;  4DR7 E;  4LF7 I;  3JU0 A;  3HTX A;  2PO0 B;  4LF5 E;  4MLV A;  3U1K A;  3IWC A;  2EM7 A;  4LFC E;  1WRJ A;  4MYT A;  1XHK A;  2BA1 D;  4LF9 I;  2JYA A;  1H74 A;  2V83 A;  4FWH A;  2EPX A;  2VE7 C;  4NHR A;  4JI6 E;  3HQ1 A;  1MU5 A;  1UDO A;  4PU9 A;  4NXN E;  1PJQ A;  5K36 C;  2J7J A;  1UHZ A;  2PO2 A;  2D9H A;  1EH8 A;  2GO4 A;  1VIS A;  1N34 E;  2C39 A;  1H7U A;  1UEK A;  4FW3 A;  4P7A A;  1UDQ A;  3P3G A;  1BBO A;  4LFB E;  5JEA C;  2JOB A;  1UIL A;  4LPF A;  4AIM A;  5K36 B;  2GPI A;  3J81 Q;  1X5W A;  1OYR A;  1H7S A;  2EPK X;  1DI2 A;  3QT7 A;  4OO1 C;  4NZV A;  1ZM2 A;  2EL6 A;  2HK2 A;  2NN6 C;  3RMP A;  2VQE I;  4DU8 A;  2C38 A;  5DNX A;  3J80 Q;  3PYD A;  5JEA B;  1HNZ I;  2UXD I;  1KYQ A;  1Z59 A;  2A2C A;  2J65 A;  2WP8 B;  4IS9 A;  2JP9 A;  4JI2 E;  5K36 E;  2UUA I;  2EOF A;  1XNR E;  1NHH A;  4GKK I;  4OX9 E;  4HAC A;  4OO1 B;  2BA0 D;  2EMG A;  2L8T A;  2UXB E;  2BM0 A;  3DD6 A;  2YTF A;  3LPS A;  2V89 A;  2JXP A;  4FWG A;  1T4N A;  4DV7 I;  4LOM A;  1IBK I;  3M7N G;  3MHH C;  2WCC 3;  3H09 A;  5JEA E;  1FNM A;  5T6J A;  2JEB B;  2EM6 A;  3WU3 A;  2YT4 A;  3OML A;  2BR2 A;  2EOS A;  3EPJ A;  4BMJ A;  4MU4 A;  3DF6 A;  4GZN C;  1SFE A;  5KL2 A;  2GHF A;  2BA1 G;  4OO1 E;  2HFS A;  4IZJ D;  5LMN E;  3ZZ0 A;  1IQO A;  2E1R A;  3PS2 A;  2KON A;  2BM1 A;  3ZKD A;  2BBG A;  5JEA D;  3ADG A;  4BHC A;  2PRT A;  4OOG C;  1FWK A;  4P52 A;  3DJW A;  2B3T B;  1YUJ A;  3V2U C;  3J81 C;  4NBQ A;  4DR1 I;  2DEI A;  4DR2 E;  4M2Z A;  4B3S I;  1HNX I;  5A69 A;  1WHN A;  4IZJ A;  4Z7Y A;  1HR0 I;  2GS8 A;  1TF6 A;  2YTN A;  5C0X C;  4LF6 E;  3F6H A;  4DKK A;  3ZM7 A;  4DR3 I;  4DV6 E;  2RQL A;  1IBM E;  3Q6N A;  1A1F A;  2EMW A;  2HKJ A;  2Z5B A;  3J7A M;  4AQY E;  2A25 A;  2DLK A;  2EMK A;  3EQ1 A;  5C0X B;  3P3C A;  4MU1 A;  2FGG A;  2BA0 G;  4BA2 B;  1PJT A;  2HHH E;  1NHJ A;  2UU9 I;  1N32 E;  4X65 I;  5KL4 A;  4FW6 A;  2YSO A;  3WU4 A;  4MU0 A;  4LFB I;  3T1Y E;  2EN7 A;  1A6F A;  1N0U A;  1Z0B A;  1STU A;  2YTD A;  4HTG A;  2EJ4 A;  1WXR A;  2MC6 A;  3BID A;  4F9C B;  2WBU A;  4LCF A;  5C0X E;  4ISA A;  4IFD A;  3C6M A;  5A6J A;  2DIX A;  4DU7 A;  2EOY A;  4B3M E;  5DNL A;  4DV0 I;  2EN8 A;  2UUC E;  1VI7 A;  4PRX A;  4JI2 I;  4K0K I;  2LO3 A;  2PO1 A;  3LTO A;  3ECR A;  3M99 B;  2M7Q A;  3P1X A;  4EMD A;  2C37 A;  3P76 A;  1Y60 A;  2K7I A;  2N3G A;  2CG9 A;  1JK2 A;  2CZ9 A;  5C0X D;  2E1M A;  4ZYH A;  3JAM Q;  4JI1 E;  3ADJ A;  5IT9 C;  4JG4 A;  3JTZ A;  4LCH A;  5IV8 B;  3K6Q A;  1Z5A A;  2YTI A;  4KWY A;  2Z5C B;  2HKE A;  2L2M A;  2BB8 A;  5LL6 R;  4IJD A;  2LCE A;  1A1K A;  3PRY A;  2YTQ A;  4M30 A;  4DUY E;  1T38 A;  1N0V C;  1QU6 A;  4Q28 A;  1USU A;  1TF3 A;  4LF8 I;  2EMF A;  4DPU A;  2EWL A;  5BR8 E;  2R1F A;  2EN1 A;  3FIG A;  2F8B A;  3KZZ A;  1I94 I;  3J7Y p;  2EOO A;  1B63 A;  4DUZ I;  2JEA A;  2LJH A;  1J26 A;  4KZS A;  2LT7 A;  1ZBT A;  2DRP A;  5F3W A;  4X62 E;  2V8Q B;  1OYP A;  2C39 B;  3EPH A;  5FWK A;  4LTY A;  2B7T A;  2H36 X;  2I13 A;  5L3J A;  1YSA C;  4JI0 E;  2L3C A;  2B7V A;  2V8P A;  3K1J A;  4MU3 A;  4DV6 I;  1QNT A;  2ZIT A;  4KHP I;  1ZM3 A;  4DR6 E;  2F4V E;  2UUB I;  2EQ0 A;  1FWL A;  2ZBK B;  2JY9 A;  1AH5 A;  4F54 A;  1N3G A;  2E5L E;  4BA1 A;  5KL7 A;  1YUI A;  2YTG A;  1U2R A;  4R8O A;  4O43 A;  4BBY A;  4F9B B;  2J7K A;  4J3D A;  2V2Q A;  1XMQ I;  2L2N A;  1N36 I;  3V5R A;  3B8H A;  5IWA E;  2EM0 A;  4DV1 E;  3OTO I;  3HXL A;  2NUF A;  5K36 F;  3ZKB A;  1DGC A;  4JI8 E;  5AC4 A;  3EPK A;  1X6F A;  1X6E A;  2LUQ A;  2IHR 1;  2L33 A;  4IS1 C;  4FWD A;  4JI7 I;  2LVH A;  1IBL E;  1J5E E;  4JYA E;  2EOJ A;  3HPS A;  4YY3 E;  2NPF A;  5JEA F;  1BBG A;  2FTX B;  4JI4 E;  4DPY A;  1YPN A;  1JK1 A;  4X64 I;  4NXM E;  1EI1 A;  1N33 E;  4DV5 E;  2EPO A;  2EE8 A;  1HNW I;  3GLL A;  4OO1 F;  4RH8 A;  2EMZ A;  3T1H E;  1B69 A;  2JE6 B;  1X47 A;  2YTP A;  1Z5C A;  2NUG A;  5IXM B;  2VES A;  3B4T A;  2EN6 A;  4LFA I;  2NN6 B;  5GMD A;  2EM4 A;  2PO0 A;  2LV2 A;  1QZR A;  4AID A;  5DRP A;  3PYF A;  4JI3 I;  4ZYG A;  1BB8 A;  3CDI A;  1FKA E;  4DR4 E;  4YHH I;  4AM3 A;  3H1C A;  4R2D A;  1T39 A;  5K36 D;  1K47 A;  4FW9 A;  2EOI A;  4LU9 A;  1Z0V A;  3PYG A;  3L7Z B;  5DRQ A;  1DAR A;  1FJG E;  2NN6 E;  4DV4 E;  2YPN A;  3THO B;  5BR8 I;  1PIE A;  1Z5B A;  1DQ3 A;  4BC7 A;  2V2V A;  1A1G A;  1RC7 A;  4DV3 I;  1XMO E;  4Z7C A;  2YU8 A;  5A6A A;  2R3V A;  2Z5B B;  4QNJ A;  2ENH A;  1RHY A;  2MKD A;  2EPN A;  2M4I A;  2V86 A;  3ZOQ B;  4IZK A;  5K36 A;  2DEJ A;  2PNM A;  2X7I A;  4URL A;  2NN6 D;  1XNQ I;  4OO1 D;  2MKN A;  1P42 A;  4DR7 I;  4MLQ A;  3MHS C;  2HC5 A;  2ADR A;  2LMZ A;  3AUZ A;  4MQY A;  4LF5 I;  1PKP A;  4IFD C;  2YU5 A;  4JI0 I;  5FLX Q;  2EMA A;  4FN5 A;  2KHX A;  4LFC I;  2EN4 A;  4JV5 E;  2LE2 A;  2YRK A;  3J80 C;  4DV2 E;  1R6L A;  1YH8 A;  4RPF A;  5JEA A;  2WP8 A;  5LMU E;  2EZ6 A;  4KQV A;  4I8O A;  2F4V I;  1Y5Y A;  3Q1Q A;  5C0X F;  4WUB A;  2WNR A;  4JI6 I;  4OO1 A;  4NXN I;  4B3T E;  1YZ9 A;  4IFD B;  2CTD A;  2RSI A;  1MG7 A;  2EMI A;  2ENC A;  1N34 I;  1Z0T A;  3D4J A;  4GEQ B;  3U1Y A;  2R76 A;  1O0W A;  4FK5 C;  2MC5 A;  1RQ0 A;  2ODR C;  1H72 C;  1A1J A;  2YZT A;  2V87 A;  4JI8 I;  1KIJ A;  4GKJ E;  2CVE A;  4OKG A;  2JEB A;  4LF4 E;  4UTG A;  3GME A;  1RMD A;  4LF7 E;  2L3J A;  4IFD E;  2EOM A;  1T4L B;  3KWR A;  1NZ0 A;  2LTR A;  4FW4 A;  1BKN A;  2EN2 A;  2EPC A;  1Y4U A;  2GQ0 A;  5TSE A;  4LF9 E;  4R2R A;  5EKW A;  2O3Z A;  3VYY A;  1XNR I;  2EL5 A;  2EOZ A;  4OX9 I;  2FV4 B;  3H4L A;  3AV0 A;  4HYM A;  2UXB I;  5AAS A;  1GTK A;  4X9J A;  4R2Q A;  2I9I A;  3HUL A;  2V2Z A;  2LJP A;  4M0V A;  3ZZU A;  2JEA B;  2WZO A;  4X66 E;  1MX0 A;  2JVA A;  4TUG A;  2V85 A;  2DGC A;  4BS9 A;  4WFT A;  4WSG A;  3VHT B;  2YRM A;  3J7A G;  2PNL A;  4F2J C;  2EPM X;  2EMH A;  5DNY A;  2GO3 A;  3GON A;  3IWD A;  2ODR D;  5LMN I;  2M1S A;  5C0X A;  2VQE E;  1ZXM A;  2UXD E;  4GQU A;  2LBS B;  1YFH A;  2L92 A;  4R2S A;  1YHC A;  2JR1 A;  1XMO I;  2OI2 A;  3M6A A;  2EN3 A;  1X3C A;  2UUA E;  2Z5E A;  2EM2 A;  4BA1 B;  3LML A;  3C4T A;  3LLH A;  4GKK E;  3CDJ A;  4O5G A;  2F1D A;  5KL6 A;  1Y6Z A;  4F6N A;  1PJS A;  4R2E A;  2PO2 B;  4DV7 E;  4DR2 I;  2YWQ A;  1ZM9 A;  1IBK E;  1USV A;  2N3H A;  2EM5 A;  1ZAA C;  1UN6 B;  3PS1 A;  5A6B D;  1Z0E A;  2EMC A;  4LF6 I;  2EOX A;  3BF2 A;  1Z0C A;  2EPZ A;  1WJP A;  3CWV A;  4O24 A;  3M85 D;  4M9V C;  5DRR A;  1IBM I;  2IOP A;  4BHB A;  3BBG A;  3EPL A;  2PNZ A;  3WU5 A;  2RS6 A;  4B3T I;  4AQY I;  2NA2 A;  2Q2E B;  4USK A;  4F9A B;  3LNU A;  1IQS A;  1KKH A;  4WYQ B;  2ELY A;  1Z1B A;  1H73 A;  4BCA A;  3JAM C;  2C38 B;  4USM A;  1S4E A;  2HHH I;  1N32 I;  1G2F C;  1E3P A;  1RR9 A;  2O1U A;  1EKZ A;  5GME A;  3QT8 A;  4R1F A;  4OZE A;  4U3B A;  1X49 A;  2Z5C A;  3T1Y I;  4LF4 I;  2EOE A;  1A1H A;  4DR1 E;  1PVG A;  1HK7 A;  4HAC B;  4XTJ A;  2EOR A;  3KZY A;  4B3S E;  2JPA A;  1HNX E;  2WW4 A;  2VF3 A;  4BC9 A;  3C6K A;  1HR0 E;  4L8N A;  2YSP A;  3WU6 A;  4WPY A;  2EFG A;  4DMI A;  3P06 A;  2GLI A;  2V34 A;  3IWB A;  4DR3 E;  1L4S A;  3K17 A;  4B3M I;  2BR2 B;  2UUC I;  3QG5 C;  3VK6 A;  2NN6 F;  3HPZ A;  1ZR9 A;  2E72 A;  2O1T A;  2ZM6 E;  1A1I A;  5AE2 A;  1PDA A;  3HKM A;  3L00 A;  2L2K B;  2UU9 E;  2O1V A;  4WX9 A;  4X65 E;  4R2C A;  3NZK A;  4JI1 I;  5ELW A;  4X66 I;  4MYU A;  3QT6 A;  4IZK B;  1R6M A;  4HEI A;  4DUY I;  4QNK A;  3M85 G;  4IZJ B;  4WXD A;  1T4O A;  2NAB A;  4JI5 E;  1OYS A;  2HK3 A;  2EOH A;  5AC5 A;  1Z0G A;  2HFU A;  4N4R B;  4WSP A;  4DV0 E;  3GCM A;  2UXC E;  1ELO A;  5AE1 A;  4K0K E;  2WNR B;  1XXE A;  4RHB B;  4WUD A;  1S16 A;  2DLQ A;  2CPN A;  1WHQ A;  2EPU A;  2IOQ A;  4X62 I;  4DPX A;  2AJ4 A;  3C4B A;  5DRO A;  2VQF E;  2AE8 A;  5KL3 A;  5A6K A;  1KVK A;  5KL5 A;  4LCG A;  1ZU1 A;  2EM8 A;  4DR5 E;  4IFD F;  4DR6 I;  4LF8 E;  1UBD C;  2R42 A;  2E5L I;  2JE6 A;  2L6M A;  2WBT A;  4R2P A;  2YTJ A;  2G7H A;  2NN6 A;  1RRE A;  2XEX A;  2N8X A;  4N3O A;  1P47 A;  4B3R E;  2EPR A;  2HJJ A;  2HGH A;  1I94 E;  3VYX A;  1IMU A;  2YTO A;  2IER A;  1ZM4 A;  4WXC A;  5IWA I;  4DV1 I;  4DUZ E;  2CT1 A;  2DMY A;  4WUC A;  2M9A A;  2PO1 B;  1G2D C;  3BGH A;  2NUE A;  3HJC A;  2KOU A;  2BV3 A;  2EQ1 A;  2C37 B;  1E3H A;  1X6H A;  5A2Q Q;  2Q8U A;  1IBL I;  4F6M A;  3L7Z A;  4FW5 A;  3UHM A;  1J5E I;  4JYA I;  4YY3 I;  3PS3 A;  1EH6 A;  4JI4 I;  5IT9 Q;  2CGE A;  1ZBQ A;  2YTE A;  2YRH A;  4Q35 B;  1A1L A;  1SR9 A;  2WBS A;  4PRV A;  4NXM I;  2X36 A;  2EMB A;  4DV5 I;  1N33 I;  2EQ3 A;  1X48 A;  1YYK A;  4KHP E;  1GZ6 A;  4DPT A;  5EL9 A;  2UUB E;  1F2I G;  3ADL A;  4MDT A;  3T1H I;  2ZM6 I;  3B78 A;  4IFD D;  4ZVI A;  2EMY A;  1XMQ E;  3PYE A;  1N36 E;  1D6T A;  2JWO A;  2CSH A;  3OTO E;  2EM3 A;  4I3H A;  4X8W A;  5FLX C;  1MGT A;  4J8Z A;  4L5N C;  4O4K A;  2RTX A;  1NHI A;  4DPW A;  4DR4 I;  2MDG A;  4JI7 E;  3TQM A;  1LLM C;  2EPL X;  4TUI A;  4P78 A;  1FJG I;  1UDS A;  1EA6 A;  3F0N A;  2EL4 A;  2RS7 A;  1MEY C;  3QT5 A;  4UT4 A;  4DV4 I;  4JI5 I;  1EH7 A;  4X64 E;  3Q6M A;  2V88 A;  4ZYE A;  4R03 A;  1ZXN A;  4BA2 A;  1HNZ E;  2VF1 A;  1HNW E;  3K85 A;  2UXC I;  2A2D A;  1B62 A;  3P3E A;  2PNZ B;  1KJK A;  1OJ4 A;  2EPA A;  3ADI A;  1AAY A;  4ED4 A;  2DB2 A;  5A2Q C;  4LFA E;  4ZYD A;  2LUP B;  1UDN A;  2RPC A;  2ELZ A;  1TN9 A;  2JT2 A;  4DXL A;  2RSM A;  2JOX A;  4HY1 A;  2O1W A;  3MSW A;  2VQF I;  5CFF E;  4JI3 E;  5LLQ A; 
#chains in the Genus database with same CATH homology
 2MDR A;  1KTV A;  4HXZ A;  4YHH E;  1WUU A;  2B9D A;  4JV5 I;  4DV2 I;  2LTS A;  4DR5 I;  5LMU I;  2K4V A;  2DSY A;  1Z0W A;  1FI4 A;  1YYO A;  1YYW A;  3ZZT A;  4P7D A;  3B82 A;  5ADZ A;  4DV3 E;  1Y4S A;  4B3R I;  1GQE A;  3F6G A;  4GKJ I;  2LRS A;  1XNQ E;  4M1K A;  4LF7 I;  5AE3 A;  4DR7 E;  3JU0 A;  3HTX A;  4LF5 E;  3IWC A;  4LFC E;  4MYT A;  1XHK A;  4LF9 I;  1H74 A;  2V83 A;  4FWH A;  2VE7 C;  1MU5 A;  4JI6 E;  3HQ1 A;  4PU9 A;  4NXN E;  1UHZ A;  1VIS A;  1N34 E;  1H7U A;  1UEK A;  4P7A A;  4LFB E;  2JOB A;  1UIL A;  3J81 Q;  1H7S A;  1DI2 A;  3QT7 A;  1ZM2 A;  2HK2 A;  3RMP A;  2VQE I;  4DU8 A;  3J80 Q;  3PYD A;  2UXD I;  1HNZ I;  1Z59 A;  2A2C A;  4JI2 E;  2UUA I;  1XNR E;  1NHH A;  4GKK I;  4OX9 E;  4HAC A;  2BM0 A;  2L8T A;  2UXB E;  4FWG A;  3LPS A;  2V89 A;  4DV7 I;  1T4N A;  1IBK I;  3H09 A;  1FNM A;  5T6J A;  3WU3 A;  2YT4 A;  3OML A;  4BMJ A;  3DF6 A;  2HFS A;  4IZJ D;  5LMN E;  3ZZ0 A;  2E1R A;  2KON A;  2BM1 A;  3ZKD A;  3ADG A;  4OOG C;  1FWK A;  4P52 A;  3DJW A;  2B3T B;  3V2U C;  3J81 C;  4DR1 I;  2DEI A;  4DR2 E;  4M2Z A;  4B3S I;  1HNX I;  1WHN A;  4IZJ A;  4Z7Y A;  1HR0 I;  2GS8 A;  4LF6 E;  3F6H A;  4DKK A;  3ZM7 A;  4DR3 I;  4DV6 E;  1IBM E;  3Q6N A;  2HKJ A;  2Z5B A;  3J7A M;  4AQY E;  2FGG A;  2HHH E;  1NHJ A;  2UU9 I;  1N32 E;  4X65 I;  3WU4 A;  4LFB I;  3T1Y E;  1A6F A;  1N0U A;  1Z0B A;  1STU A;  1WXR A;  2MC6 A;  4F9C B;  2DIX A;  4DU7 A;  4B3M E;  4DV0 I;  2UUC E;  4PRX A;  4JI2 I;  4K0K I;  3LTO A;  2M7Q A;  3P1X A;  4EMD A;  2CG9 A;  2N3G A;  2CZ9 A;  2E1M A;  3JAM Q;  4JI1 E;  3ADJ A;  5IT9 C;  4JG4 A;  3JTZ A;  3K6Q A;  1Z5A A;  2Z5C B;  2HKE A;  2L2M A;  3PRY A;  5LL6 R;  4M30 A;  4DUY E;  1USU A;  1N0V C;  1QU6 A;  4Q28 A;  4LF8 I;  4DPU A;  2EWL A;  5BR8 E;  3FIG A;  2F8B A;  1I94 I;  3J7Y p;  1B63 A;  4DUZ I;  2LJH A;  1J26 A;  4KZS A;  1ZBT A;  5F3W A;  4X62 E;  2V8Q B;  5FWK A;  4LTY A;  2B7T A;  2H36 X;  5L3J A;  4JI0 E;  2L3C A;  2B7V A;  2V8P A;  3K1J A;  4DV6 I;  2ZIT A;  4KHP I;  1ZM3 A;  4DR6 E;  2F4V E;  2UUB I;  1FWL A;  2ZBK B;  2JY9 A;  4F54 A;  2E5L E;  1U2R A;  4R8O A;  2J7K A;  4BBY A;  4F9B B;  1XMQ I;  2V2Q A;  2L2N A;  1N36 I;  3V5R A;  3B8H A;  5IWA E;  4DV1 E;  3OTO I;  3HXL A;  2NUF A;  3ZKB A;  4JI8 E;  2LUQ A;  2IHR 1;  2L33 A;  4FWD A;  4JI7 I;  1IBL E;  1J5E E;  4JYA E;  3HPS A;  2NPF A;  4YY3 E;  2FTX B;  4JI4 E;  4DPY A;  4X64 I;  4NXM E;  1EI1 A;  1N33 E;  4DV5 E;  1HNW I;  3T1H E;  1X47 A;  1Z5C A;  2NUG A;  4LFA I;  5GMD A;  1QZR A;  3PYF A;  4JI3 I;  1FKA E;  4DR4 E;  4YHH I;  1K47 A;  4FW9 A;  4LU9 A;  1Z0V A;  3PYG A;  1DAR A;  1FJG E;  4DV4 E;  5BR8 I;  1PIE A;  1Z5B A;  1DQ3 A;  4BC7 A;  2V2V A;  4DV3 I;  1RC7 A;  1XMO E;  4Z7C A;  2R3V A;  2Z5B B;  2M4I A;  2V86 A;  4IZK A;  2DEJ A;  2PNM A;  2X7I A;  4URL A;  1XNQ I;  4DR7 I;  2LMZ A;  3AUZ A;  4LF5 I;  1PKP A;  4JI0 I;  5FLX Q;  4FN5 A;  2KHX A;  4LFC I;  4JV5 E;  2LE2 A;  3J80 C;  4DV2 E;  4RPF A;  5LMU E;  2EZ6 A;  4KQV A;  4I8O A;  2F4V I;  3Q1Q A;  4JI6 I;  4WUB A;  4NXN I;  4B3T E;  1YZ9 A;  1MG7 A;  1N34 I;  1Z0T A;  3D4J A;  4GEQ B;  1O0W A;  1H72 C;  2MC5 A;  1RQ0 A;  2ODR C;  2YZT A;  2V87 A;  4JI8 I;  1KIJ A;  4GKJ E;  4LF4 E;  4UTG A;  4LF7 E;  2L3J A;  1T4L B;  3KWR A;  1NZ0 A;  2LTR A;  1BKN A;  1Y4U A;  2GQ0 A;  4LF9 E;  3VYY A;  1XNR I;  4OX9 I;  2FV4 B;  3H4L A;  3AV0 A;  4HYM A;  2UXB I;  5AAS A;  3HUL A;  2V2Z A;  2LJP A;  4M0V A;  3ZZU A;  2WZO A;  4X66 E;  1MX0 A;  2JVA A;  4TUG A;  2V85 A;  4BS9 A;  4WFT A;  3J7A G;  2PNL A;  5DNY A;  3GON A;  3IWD A;  2ODR D;  5LMN I;  2M1S A;  2VQE E;  1ZXM A;  2UXD E;  2LBS B;  2L92 A;  1XMO I;  2JR1 A;  2OI2 A;  3M6A A;  2UUA E;  2Z5E A;  3LML A;  3C4T A;  3LLH A;  4GKK E;  1Y6Z A;  4DR2 I;  4DV7 E;  1ZM9 A;  1IBK E;  1USV A;  2N3H A;  1Z0E A;  4LF6 I;  1Z0C A;  3CWV A;  1IBM I;  2IOP A;  3WU5 A;  2RS6 A;  4B3T I;  4AQY I;  2NA2 A;  2Q2E B;  4USK A;  4F9A B;  3LNU A;  1KKH A;  4WYQ B;  1H73 A;  4BCA A;  3JAM C;  4USM A;  1S4E A;  2HHH I;  1N32 I;  1RR9 A;  5GME A;  2O1U A;  1EKZ A;  3QT8 A;  4R1F A;  1X49 A;  2Z5C A;  3T1Y I;  4LF4 I;  1PVG A;  4DR1 E;  1HK7 A;  4HAC B;  4XTJ A;  4B3S E;  2WW4 A;  1HNX E;  2VF3 A;  4BC9 A;  1HR0 E;  4L8N A;  3WU6 A;  4WPY A;  2EFG A;  4DMI A;  3P06 A;  2V34 A;  3IWB A;  4DR3 E;  4B3M I;  3K17 A;  2UUC I;  3VK6 A;  3MSW A;  3HPZ A;  2O1T A;  2ZM6 E;  5AE2 A;  2O1V A;  2L2K B;  2UU9 E;  4X65 E;  4JI1 I;  4X66 I;  4MYU A;  3QT6 A;  4IZK B;  4DUY I;  4IZJ B;  1T4O A;  4JI5 E;  2HK3 A;  1Z0G A;  2HFU A;  4WSP A;  4DV0 E;  2UXC E;  1ELO A;  5AE1 A;  4K0K E;  4WUD A;  1S16 A;  2CPN A;  1WHQ A;  2IOQ A;  4X62 I;  4DPX A;  2AJ4 A;  3C4B A;  2VQF E;  1KVK A;  4DR5 E;  4DR6 I;  4LF8 E;  2R42 A;  2E5L I;  2L6M A;  2G7H A;  4N3O A;  1RRE A;  2XEX A;  4B3R E;  3VYX A;  5IWA I;  1I94 E;  4DV1 I;  1ZM4 A;  4DUZ E;  2DMY A;  4WUC A;  2NUE A;  3HJC A;  2KOU A;  2BV3 A;  5A2Q Q;  1IBL I;  1J5E I;  4JYA I;  4YY3 I;  4JI4 I;  5IT9 Q;  2CGE A;  1ZBQ A;  4PRV A;  1SR9 A;  4NXM I;  2X36 A;  1N33 I;  4DV5 I;  1X48 A;  1YYK A;  4KHP E;  1GZ6 A;  4DPT A;  2UUB E;  3ADL A;  3T1H I;  2ZM6 I;  3B78 A;  4ZVI A;  1XMQ E;  3PYE A;  1N36 E;  1D6T A;  2JWO A;  3OTO E;  4I3H A;  4X8W A;  5FLX C;  4J8Z A;  4L5N C;  2RTX A;  1NHI A;  4DPW A;  4DR4 I;  4JI7 E;  4TUI A;  4P78 A;  1FJG I;  1EA6 A;  3F0N A;  2RS7 A;  3QT5 A;  4UT4 A;  4DV4 I;  4JI5 I;  3Q6M A;  4X64 E;  2V88 A;  4R03 A;  1ZXN A;  1HNZ E;  2VF1 A;  1HNW E;  3K85 A;  2UXC I;  2A2D A;  1B62 A;  1OJ4 A;  3ADI A;  4ED4 A;  2DB2 A;  5A2Q C;  4LFA E;  4DXL A;  2LUP B;  2RSM A;  2JOX A;  4HY1 A;  2O1W A;  3ZOQ B;  2VQF I;  5CFF E;  4JI3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...