3T1HI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1hI00
1HR0E 4X65I 1N32E 1FWKA 4JYAE 4LFAE 4YY3E 1PIEA 3J81C 2VQEE 3J80Q 3QT7A 4JI0I 4LF8E 3V2UC 1N36I 4DR1I 4DR6E 1IBKI 1HNWE 4LFBI 4MYUA 4B3SE 4DUZE 2XEXA 1HNXE 3OTOI 1KVKA 3Q1QA 2F4VE 2BM0A 2HK3A 4DPWA 4LFCE 4DV0I 4USKA 1ZM2A 1MU5A 4LF6E 4DV5I 4JI6E 3J81Q 4UTGA 1S16A 1N33E 4DPUA 2J7KA 1I94E 2V34A 4FWHA 1XNQE 5FLXC 1FKAE 4PRXA 3T1YE 4GKJE 4FWGA 1Z0VA 4B3ME 3ZM7A 4DV7E 2UUAE 4DR5I 4DV6E 5GMDA 3T1YI 4DU7A 4AQYE 4EMDA 4B3MI 4FWDA 4PRVA 4JI4I 2UUAI 4DV6I 1Z0CA 1H7SA 4B3RI 2UXCI 3M6AA 4DV3I 4HACB 4JI3E 4R1FA 1ZXMA 4K0KE 1NHJA 1Z0BA 1IBLE 4ED4A 5FLXQ 4DV1E 4WUDA 1ZM4A 1N34E 3ZZ0A 1Z0EA 3K1JA 4GKKE 2ZM6I 1QZRA 2UXDE 4USMA 4KHPI 4JI1I 1KIJA 1XNRE 2R3VA 2UUCE 5A2QC 4X64I 3J80C 4DUYE 4X66I 2A2DA 1XMOE 4PU9A 2OI2A 1H72C 2E5LE 1Z0GA 3WU5A 3HULA 3OTOE 4DV2E 4Z7CA 3LTOA 3J7AG 1H74A 4X65E 1MX0A 4MYTA 2UUBI 3GONA 1J5EI 4NXNI 4JI0E 4WUCA 3V5RA 1N36E 4JI2I 5A2QQ 4DR1E 1PVGA 1WUUA 4JI7I 1IBKE 4LFBE 3K17A 4NXMI 2LJPA 2V2QA 1FJGE 3PYGA 5GMEA 3D4JA 4LF4I 1U2RA 2NPFA 1FJGI 4LF5I 4DV0E 4JI5I 3B8HA 4DU8A 4DR2I 4DV5E 2R42A 1K47A 4HY1A 3B82A 4JV5I 1Z5AA 1NHHA 2HKJA 3B78A 4P52A 5LMUI 1FNMA 4LF9I 1N0VC 4JG4A 4ZVIA 1KKHA 2V8PA 4DR5E 5L3JA 4OX9I 4B3TI 2V2VA 4FW9A 4JI4E 3QT8A 4B3RE 3PYDA 4LF7I 1XMQI 2HK2A 2UXCE 2BV3A 4DV3E 3ZKDA 3ZZUA 2HHHI 4DPYA 5IWAI 1N0UA 2UU9I 1D6TA 4I3HA 4DR4I 2ZM6E 1KTVA 1S4EA 4KHPE 1IBMI 4JI1E 2X36A 3WU3A 1Z0TA 4X64E 4DR7E 1UEKA 4YHHE 3JAMC 3WU4A 4X66E 2HFSA 4DR7I 4YHHI 2DEIA 1A6FA 3T1HI 1ZM3A 4WUBA 1HNZI 2UUBE 3ZZTA 1EA6A 2AJ4A 4JI8I 1J5EE 1NZ0A 4NXNE 4JI2E 2V2ZA 4JI7E 3ZKBA 3JAMQ 4NXME 4LF4E 4DR3I 4DPTA 1H7UA 2VQFI 4DV4I 1FWLA 4X62I 4LF5E 4UT4A 3H4LA 4P7AA 4JI5E 1VISA 4DR2E 1DARA 1EI1A 1HR0I 3LPSA 5BR8E 2DEJA 4JYAI 1N32I 1Z5BA 4LFAI 2EFGA 4YY3I 1Z5CA 2GS8A 4JV5E 5BR8I 3J7AM 2VQEI 5LMUE 1XHKA 4Z7YA 4LF9E 4LF8I 5LMNE 3WU6A 4OX9E 3QT5A 4HXZA 4B3TE 4DR6I 1Z59A 1HNWI 1ZXNA 5LMNI 4B3SI 4DUZI 2Q2EB 1HNXI 2BM1A 2F4VI 4LF7E 1XMQE 4LFCI 2WW4A 1FI4A 4LF6I 3PYFA 4JI6I 3CWVA 2HHHE 4HACA 1N33I 1RR9A 1B63A 5IWAE 2A2CA 1I94I 5LL6R 2UU9E 4RPFA 1Z0WA 4DR4E 1XNQI 2HFUA 4GKJI 1IBME 2VF3A 4DV7I 1ELOA 4AQYI 3PYEA 1PKPA 1MG7A 2X7IA 3F0NA 2ZITA 5IT9C 1NHIA 4JI3I 2ZBKB 3T1HE 4K0KI 4KQVA 3LNUA 2CZ9A 2HKEA 1IBLI 1HNZE 4M1KA 4DV1I 4JI8E 4URLA 1N34I 4GKKI 2UXDI 1OJ4A 4FN5A 1XNRI 1B62A 2UUCI 2UXBE 1BKNA 3QT6A 4DR3E 5IT9Q 4DPXA 4DUYI 2E1RA 2VQFE 4DV4E 4X62E 1XMOI 1ZM9A 4HYMA 4DXLA 2UXBI 1RREA 4XTJA 2E5LI 4DV2I 1H73A
chains in the Genus database with same CATH superfamily
5C0XC 1HR0E 4QNJA 3U1KA 4X65I 2Z5BB 1FWKA 1N32E 4JYAE 4LFAE 4YY3E 1PIEA 3J81C 4FW6A 1UDQA 4OO1A 5DNLA 2VQEE 3J80Q 3QT7A 4JI0I 2PO2B 5K36A 4LF8E 5JEAE 3V2UC 1N36I 4DR1I 4DR6E 1IBKI 1HNWE 4LFBI 4MYUA 4B3SE 4DUZE 2J65A 2XEXA 1HNXE 4MU4A 1KVKA 3Q1QA 2F4VE 2BM0A 2HK3A 2PO0A 4DPWA 3P06A 4LFCE 4IZJA 4DV0I 4USKA 5DNXA 1VI7A 2BA1G 1ZM2A 1MU5A 5C0XE 4LF6E 4DV5I 4JI6E 3J81Q 4UTGA 1S16A 2JEBA 2NN6B 4DPUA 1N33E 3CDIA 2J7KA 2PNZA 1I94E 5ELWA 2V34A 4FWHA 4OZEA 5C0XB 4FW3A 4BA2B 1XNQE 2F1DA 5FLXC 1FKAE 3M85D 4PRXA 3T1YE 4GKJE 4FWGA 1Z0VA 4B3ME 3ZM7A 4DV7E 2UUAE 4DR5I 2AE8A 4DV6E 5DROA 5GMDA 3T1YI 4DU7A 3B4TA 5C0XD 1USUA 4AQYE 4EMDA 4B3MI 3GMEA 1P42A 4FWDA 4PRVA 4JI4I 2UUAI 4DV6I 3UHMA 1Z0CA 2Z5CA 1H7SA 4B3RI 3K85A 2UXCI 3M6AA 4DV3I 3P3CA 4HACB 4JI3E 2CVEA 4R1FA 1ZXMA 4K0KE 1NHJA 2C38B 3PS2A 1Z0BA 1IBLE 4ED4A 1XXEA 5FLXQ 4DV1E 4WUDA 1ZM4A 1N34E 2C37B 3ZZ0A 1Z0EA 4LCGA 3K1JA 4GKKE 2ZM6I 1QZRA 2UXDE 4USMA 2BA1D 4KHPI 2PO1B 5DRRA 4JI1I 1KIJA 1XNRE 5DRQA 2R3VA 2UUCE 5A2QC 4X64I 3J80C 4DUYE 4X66I 2A2DA 1XMOE 4LOMA 4OO1F 4PU9A 2OI2A 4OO1C 1H72C 1Y5YA 2E5LE 4IFDC 4IZKA 1Z0GA 3WU5A 3HULA 3OTOE 4DV2E 4Z7CA 3LTOA 3J7AG 3H1CA 3P3EA 4AM3A 5K36C 2IESA 2C39B 1H74A 4X65E 2Z5BA 5JEAF 4AIMA 1MX0A 4MYTA 4N3OA 4J3DA 2UUBI 3GONA 1J5EI 4NXNI 4JI0E 4WUCA 2IOQA 4FW4A 3V5RA 1N36E 4JI2I 5A2QQ 4DR1E 1PVGA 1WUUA 4JI7I 1IBKE 4LFBE 3K17A 4NXMI 1OYRA 2LJPA 2V2QA 1FJGE 3PYGA 5GMEA 3D4JA 4LF4I 1U2RA 2NPFA 4IFDE 5JEAA 1FJGI 4LF5I 3PS1A 4DV0E 4QNKA 4JI5I 3B8HA 4DU8A 2NN6E 3PRYA 4DR2I 4DV5E 3GLLA 2IERA 2JEAB 2IOPA 3L7ZB 2R42A 4IFDB 1K47A 4LPFA 4HY1A 3B82A 4U3BA 5K36B 5C0XA 4JV5I 1Z5AA 3Q6NA 4BA2A 1NHHA 2HKJA 3B78A 4P52A 2PNLA 5LMUI 1FNMA 4LF9I 1N0VC 4JG4A 4IFDD 4ZVIA 1KKHA 2V8PA 4DR5E 5L3JA 4OX9I 4B3TI 2V2VA 2PO0B 2NN6D 5K36D 4FW9A 4JI4E 3QT8A 5FWKA 2PNMA 4B3RE 3PYDA 4LF7I 3GCMA 1XMQI 2HK2A 2UXCE 1USVA 2BV3A 4DV3E 3ZKDA 2JEBB 3ZZUA 2PNZB 3DD6A 2C38A 5DRPA 2HHHI 4DPYA 5IWAI 1N0UA 4ISAA 2UU9I 1D6TA 4I3HA 4DR4I 2ZM6E 1YHCA 1KTVA 2JT2A 1S4EA 4KHPE 1IBMI 4JI1E 1HK7A 2X36A 3WU3A 1Z0TA 4OKGA 4X64E 4DR7E 1UEKA 4YHHE 3JAMC 2WNRA 3WU4A 2GO3A 4X66E 2HFSA 4DR7I 4YHHI 2DEIA 1A6FA 4BA1B 2CGEA 4FW7A 2BR2A 4IS9A 2C39A 2O1WA 4AIDA 3T1HI 1ZM3A 4WUBA 4MQYA 1HNZI 2WP8B 3Q6MA 2UUBE 3ZZTA 1EA6A 2AJ4A 4JI8I 1J5EE 1NZ0A 4NXNE 5JEAC 4JI2E 2V2ZA 3P76A 4JI7E 3ZKBA 3JAMQ 3M7ND 2JE6B 2PO2A 4NXME 2NN6F 1UDOA 4LF4E 4DR3I 4DPTA 1E3HA 1H7UA 2VQFI 4DV4I 1FWLA 5C0XF 4X62I 4LF5E 4UT4A 3H4LA 4P7AA 4JI5E 1VISA 4DR2E 4OO1E 1DARA 2CG9A 1EI1A 4FW5A 5EKWA 2JEAA 4MU1A 4U3DA 1HR0I 3LPSA 3L7ZA 5BR8E 5K36E 4IFDA 2DEJA 4JYAI 1N32I 1Z5BA 4LCHA 4GQUA 4LFAI 2EFGA 4YY3I 1Z5CA 4OO1B 2GS8A 4JV5E 2NN6A 3PS3A 5BR8I 3J7AM 2VQEI 5LMUE 1XHKA 4Z7YA 2BA0G 4LF9E 4LF8I 3P3GA 5LMNE 1Y6ZA 3WU6A 4OX9E 3QT5A 4HXZA 4B3TE 4DR6I 1Z59A 5JEAB 4OO1D 1HNWI 1ZXNA 5LMNI 4B3SI 4DUZI 2Q2EB 3CDJA 1HNXI 2BM1A 2F4VI 4LF7E 1XMQE 1RHYA 4LFCI 4IZJB 2WW4A 1FI4A 5JEAD 4LF6I 3HKMA 3PYFA 3HJCA 4JI6I 1E3PA 3CWVA 2HHHE 4HACA 4MU3A 3M7NG 1RR9A 1N33I 2O1VA 1B63A 5IWAE 2A2CA 1I94I 4IZJD 5LL6R 2UU9E 4NBQA 4RPFA 1Z0WA 4DR4E 1XNQI 2HFUA 1Y60A 2Z5EA 1R6MA 4GKJI 1IBME 2C37A 4DV2I 2VF3A 4DV7I 3NZKA 1ELOA 2PO1A 4AQYI 3PYEA 1R6LA 1PKPA 2Z5CB 1OYPA 2VESA 1MG7A 2X7IA 4LCFA 3F0NA 2ZITA 5IT9C 4BA1A 2BA0D 1NHIA 4MU0A 4JI3I 2GQ0A 2O1UA 2ZBKB 2O3ZA 3KRNA 3T1HE 4K0KI 4KQVA 3LNUA 2CZ9A 2HKEA 1OYSA 2GO4A 1IBLI 1HNZE 1Y4UA 4M1KA 4DV1I 2WP8A 4JI8E 4URLA 1N34I 3U1YA 1UDSA 1UDNA 5EL9A 4GKKI 2UXDI 2WNRB 1OJ4A 2JE6A 4FN5A 1XNRI 1B62A 4IFDF 4MDTA 2UUCI 2UXBE 1BKNA 3QT6A 4DR3E 1YH8A 5IT9Q 4DPXA 4DUYI 2E1RA 2VQFE 4DV4E 4X62E 1XMOI 5K36F 1ZM9A 4HYMA 4DXLA 2UXBI 1RREA 4XTJA 2O1TA 2NN6C 4IZKB 3M85G 2BR2B 1Y4SA 2E5LI 3OTOI 1H73A
chains in the Genus database with same CATH topology
1HR0E 4X65I 2Z5BB 1FWKA 1N32E 4JYAE 4LFAE 4YY3E 1PIEA 3J81C 2VQEE 3J80Q 3QT7A 4JI0I 4LF8E 3V2UC 1N36I 4DR1I 4DR6E 1IBKI 1HNWE 4LFBI 4MYUA 4B3SE 4DUZE 2XEXA 1HNXE 3OTOI 1KVKA 3Q1QA 2F4VE 2BM0A 2HK3A 4DPWA 3P06A 4LFCE 4IZJA 4DV0I 4USKA 1ZM2A 1MU5A 4LF6E 4DV5I 4JI6E 3J81Q 4UTGA 1S16A 1N33E 4DPUA 2J7KA 1I94E 2V34A 4FWHA 1XNQE 5FLXC 1FKAE 4PRXA 3T1YE 4GKJE 4FWGA 1Z0VA 4B3ME 3ZM7A 4DV7E 2UUAE 4DR5I 4DV6E 5GMDA 3T1YI 4DU7A 4AQYE 1USUA 4EMDA 4B3MI 4FWDA 4PRVA 4JI4I 2UUAI 4DV6I 1Z0CA 2Z5CA 1H7SA 4B3RI 3K85A 2UXCI 3M6AA 4DV3I 4HACB 4JI3E 4R1FA 1ZXMA 4K0KE 1NHJA 1Z0BA 1IBLE 4ED4A 5FLXQ 4DV1E 4WUDA 1N34E 1ZM4A 3ZZ0A 1Z0EA 3K1JA 4GKKE 2ZM6I 1QZRA 2UXDE 4USMA 4KHPI 4JI1I 1KIJA 1XNRE 2R3VA 2UUCE 5A2QC 4X64I 3J80C 4DUYE 4X66I 2A2DA 1XMOE 4PU9A 2OI2A 1H72C 2E5LE 4IZKA 1Z0GA 3WU5A 3HULA 3OTOE 4DV2E 4Z7CA 3LTOA 3J7AG 1H74A 4X65E 2Z5BA 1MX0A 4MYTA 4N3OA 2UUBI 3GONA 1J5EI 4NXNI 4JI0E 4WUCA 2IOQA 3V5RA 1N36E 4JI2I 5A2QQ 4DR1E 1PVGA 1WUUA 4JI7I 1IBKE 4LFBE 3K17A 4NXMI 2LJPA 2V2QA 1FJGE 3PYGA 5GMEA 3D4JA 4LF4I 1U2RA 2NPFA 1FJGI 4LF5I 4DV0E 4JI5I 3B8HA 4DU8A 3PRYA 4DR2I 4DV5E 2IOPA 2R42A 1K47A 4HY1A 3B82A 4JV5I 1Z5AA 3Q6NA 1NHHA 2HKJA 3B78A 4P52A 2PNLA 5LMUI 1FNMA 4LF9I 1N0VC 4JG4A 4ZVIA 1KKHA 2V8PA 4DR5E 5L3JA 4OX9I 4B3TI 2V2VA 4FW9A 4JI4E 3QT8A 5FWKA 2PNMA 4B3RE 3PYDA 4LF7I 1XMQI 2HK2A 2UXCE 1USVA 2BV3A 4DV3E 3ZKDA 3ZZUA 2HHHI 4DPYA 5IWAI 1N0UA 2UU9I 1D6TA 4I3HA 4DR4I 2ZM6E 1KTVA 1S4EA 4KHPE 1IBMI 4JI1E 1HK7A 2X36A 3WU3A 1Z0TA 4X64E 4DR7E 1UEKA 4YHHE 3JAMC 3WU4A 4X66E 2HFSA 4DR7I 4YHHI 2DEIA 1A6FA 2CGEA 2O1WA 3T1HI 1ZM3A 4WUBA 1HNZI 3Q6MA 2UUBE 3ZZTA 1EA6A 2AJ4A 4JI8I 1J5EE 1NZ0A 4NXNE 4JI2E 2V2ZA 4JI7E 3ZKBA 3JAMQ 4NXME 4LF4E 4DR3I 4DPTA 1H7UA 2VQFI 4DV4I 1FWLA 4X62I 4LF5E 4UT4A 3H4LA 4P7AA 4JI5E 1VISA 4DR2E 1DARA 2CG9A 1EI1A 1HR0I 3LPSA 5BR8E 2DEJA 4JYAI 1N32I 1Z5BA 4LFAI 2EFGA 4YY3I 1Z5CA 2GS8A 4JV5E 5BR8I 3J7AM 2VQEI 5LMUE 1XHKA 4Z7YA 4LF9E 4LF8I 5LMNE 1Y6ZA 3WU6A 4OX9E 3QT5A 4HXZA 4B3TE 4DR6I 1Z59A 1HNWI 1ZXNA 5LMNI 4B3SI 4DUZI 2Q2EB 1HNXI 2BM1A 2F4VI 4LF7E 1XMQE 4LFCI 4IZJB 2WW4A 1FI4A 4LF6I 3PYFA 3HJCA 4JI6I 3CWVA 2HHHE 4HACA 1N33I 1RR9A 2O1VA 1B63A 5IWAE 2A2CA 1I94I 4IZJD 5LL6R 2UU9E 4RPFA 1Z0WA 4DR4E 1XNQI 2HFUA 2Z5EA 4GKJI 1IBME 2VF3A 4DV7I 1ELOA 4AQYI 3PYEA 1PKPA 2Z5CB 1MG7A 2X7IA 3F0NA 2ZITA 5IT9C 1NHIA 4JI3I 2GQ0A 2O1UA 2ZBKB 3T1HE 4K0KI 4KQVA 3LNUA 2CZ9A 2HKEA 1IBLI 1HNZE 1Y4UA 4M1KA 4DV1I 4JI8E 4URLA 1N34I 4GKKI 2UXDI 1OJ4A 4FN5A 1XNRI 1B62A 2UUCI 2UXBE 1BKNA 3QT6A 4DR3E 5IT9Q 4DPXA 4DUYI 2E1RA 2VQFE 4DV4E 1XMOI 4X62E 1ZM9A 4HYMA 4DXLA 2UXBI 1RREA 4XTJA 2O1TA 4IZKB 1Y4SA 2E5LI 4DV2I 1H73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 E;  4X65 I;  1N32 E;  1FWK A;  4JYA E;  4LFA E;  4YY3 E;  1PIE A;  3J81 C;  2VQE E;  3J80 Q;  3QT7 A;  4JI0 I;  4LF8 E;  3V2U C;  1N36 I;  4DR1 I;  4DR6 E;  1IBK I;  1HNW E;  4LFB I;  4MYU A;  4B3S E;  4DUZ E;  2XEX A;  1HNX E;  3OTO I;  1KVK A;  3Q1Q A;  2F4V E;  2BM0 A;  2HK3 A;  4DPW A;  4LFC E;  4DV0 I;  4USK A;  1ZM2 A;  1MU5 A;  4LF6 E;  4DV5 I;  4JI6 E;  3J81 Q;  4UTG A;  1S16 A;  1N33 E;  4DPU A;  2J7K A;  1I94 E;  2V34 A;  4FWH A;  1XNQ E;  5FLX C;  1FKA E;  4PRX A;  3T1Y E;  4GKJ E;  4FWG A;  1Z0V A;  4B3M E;  3ZM7 A;  4DV7 E;  2UUA E;  4DR5 I;  4DV6 E;  5GMD A;  3T1Y I;  4DU7 A;  4AQY E;  4EMD A;  4B3M I;  4FWD A;  4PRV A;  4JI4 I;  2UUA I;  4DV6 I;  1Z0C A;  1H7S A;  4B3R I;  2UXC I;  3M6A A;  4DV3 I;  4HAC B;  4JI3 E;  4R1F A;  1ZXM A;  4K0K E;  1NHJ A;  1Z0B A;  1IBL E;  4ED4 A;  5FLX Q;  4DV1 E;  4WUD A;  1ZM4 A;  1N34 E;  3ZZ0 A;  1Z0E A;  3K1J A;  4GKK E;  2ZM6 I;  1QZR A;  2UXD E;  4USM A;  4KHP I;  4JI1 I;  1KIJ A;  1XNR E;  2R3V A;  2UUC E;  5A2Q C;  4X64 I;  3J80 C;  4DUY E;  4X66 I;  2A2D A;  1XMO E;  4PU9 A;  2OI2 A;  1H72 C;  2E5L E;  1Z0G A;  3WU5 A;  3HUL A;  3OTO E;  4DV2 E;  4Z7C A;  3LTO A;  3J7A G;  1H74 A;  4X65 E;  1MX0 A;  4MYT A;  2UUB I;  3GON A;  1J5E I;  4NXN I;  4JI0 E;  4WUC A;  3V5R A;  1N36 E;  4JI2 I;  5A2Q Q;  4DR1 E;  1PVG A;  1WUU A;  4JI7 I;  1IBK E;  4LFB E;  3K17 A;  4NXM I;  2LJP A;  2V2Q A;  1FJG E;  3PYG A;  5GME A;  3D4J A;  4LF4 I;  1U2R A;  2NPF A;  1FJG I;  4LF5 I;  4DV0 E;  4JI5 I;  3B8H A;  4DU8 A;  4DR2 I;  4DV5 E;  2R42 A;  1K47 A;  4HY1 A;  3B82 A;  4JV5 I;  1Z5A A;  1NHH A;  2HKJ A;  3B78 A;  4P52 A;  5LMU I;  1FNM A;  4LF9 I;  1N0V C;  4JG4 A;  4ZVI A;  1KKH A;  2V8P A;  4DR5 E;  5L3J A;  4OX9 I;  4B3T I;  2V2V A;  4FW9 A;  4JI4 E;  3QT8 A;  4B3R E;  3PYD A;  4LF7 I;  1XMQ I;  2HK2 A;  2UXC E;  2BV3 A;  4DV3 E;  3ZKD A;  3ZZU A;  2HHH I;  4DPY A;  5IWA I;  1N0U A;  2UU9 I;  1D6T A;  4I3H A;  4DR4 I;  2ZM6 E;  1KTV A;  1S4E A;  4KHP E;  1IBM I;  4JI1 E;  2X36 A;  3WU3 A;  1Z0T A;  4X64 E;  4DR7 E;  1UEK A;  4YHH E;  3JAM C;  3WU4 A;  4X66 E;  2HFS A;  4DR7 I;  4YHH I;  2DEI A;  1A6F A;  3T1H I;  1ZM3 A;  4WUB A;  1HNZ I;  2UUB E;  3ZZT A;  1EA6 A;  2AJ4 A;  4JI8 I;  1J5E E;  1NZ0 A;  4NXN E;  4JI2 E;  2V2Z A;  4JI7 E;  3ZKB A;  3JAM Q;  4NXM E;  4LF4 E;  4DR3 I;  4DPT A;  1H7U A;  2VQF I;  4DV4 I;  1FWL A;  4X62 I;  4LF5 E;  4UT4 A;  3H4L A;  4P7A A;  4JI5 E;  1VIS A;  4DR2 E;  1DAR A;  1EI1 A;  1HR0 I;  3LPS A;  5BR8 E;  2DEJ A;  4JYA I;  1N32 I;  1Z5B A;  4LFA I;  2EFG A;  4YY3 I;  1Z5C A;  2GS8 A;  4JV5 E;  5BR8 I;  3J7A M;  2VQE I;  5LMU E;  1XHK A;  4Z7Y A;  4LF9 E;  4LF8 I;  5LMN E;  3WU6 A;  4OX9 E;  3QT5 A;  4HXZ A;  4B3T E;  4DR6 I;  1Z59 A;  1HNW I;  1ZXN A;  5LMN I;  4B3S I;  4DUZ I;  2Q2E B;  1HNX I;  2BM1 A;  2F4V I;  4LF7 E;  1XMQ E;  4LFC I;  2WW4 A;  1FI4 A;  4LF6 I;  3PYF A;  4JI6 I;  3CWV A;  2HHH E;  4HAC A;  1N33 I;  1RR9 A;  1B63 A;  5IWA E;  2A2C A;  1I94 I;  5LL6 R;  2UU9 E;  4RPF A;  1Z0W A;  4DR4 E;  1XNQ I;  2HFU A;  4GKJ I;  1IBM E;  2VF3 A;  4DV7 I;  1ELO A;  4AQY I;  3PYE A;  1PKP A;  1MG7 A;  2X7I A;  3F0N A;  2ZIT A;  5IT9 C;  1NHI A;  4JI3 I;  2ZBK B;  3T1H E;  4K0K I;  4KQV A;  3LNU A;  2CZ9 A;  2HKE A;  1IBL I;  1HNZ E;  4M1K A;  4DV1 I;  4JI8 E;  4URL A;  1N34 I;  4GKK I;  2UXD I;  1OJ4 A;  4FN5 A;  1XNR I;  1B62 A;  2UUC I;  2UXB E;  1BKN A;  3QT6 A;  4DR3 E;  5IT9 Q;  4DPX A;  4DUY I;  2E1R A;  2VQF E;  4DV4 E;  4X62 E;  1XMO I;  1ZM9 A;  4HYM A;  4DXL A;  2UXB I;  1RRE A;  4XTJ A;  2E5L I;  4DV2 I;  1H73 A; 
#chains in the Genus database with same CATH topology
 5C0X C;  1HR0 E;  4QNJ A;  3U1K A;  4X65 I;  2Z5B B;  1FWK A;  1N32 E;  4JYA E;  4LFA E;  4YY3 E;  1PIE A;  3J81 C;  4FW6 A;  1UDQ A;  4OO1 A;  5DNL A;  2VQE E;  3J80 Q;  3QT7 A;  4JI0 I;  2PO2 B;  5K36 A;  4LF8 E;  5JEA E;  3V2U C;  1N36 I;  4DR1 I;  4DR6 E;  1IBK I;  1HNW E;  4LFB I;  4MYU A;  4B3S E;  4DUZ E;  2J65 A;  2XEX A;  1HNX E;  4MU4 A;  1KVK A;  3Q1Q A;  2F4V E;  2BM0 A;  2HK3 A;  2PO0 A;  4DPW A;  3P06 A;  4LFC E;  4IZJ A;  4DV0 I;  4USK A;  5DNX A;  1VI7 A;  2BA1 G;  1ZM2 A;  1MU5 A;  5C0X E;  4LF6 E;  4DV5 I;  4JI6 E;  3J81 Q;  4UTG A;  1S16 A;  2JEB A;  2NN6 B;  4DPU A;  1N33 E;  3CDI A;  2J7K A;  2PNZ A;  1I94 E;  5ELW A;  2V34 A;  4FWH A;  4OZE A;  5C0X B;  4FW3 A;  4BA2 B;  1XNQ E;  2F1D A;  5FLX C;  1FKA E;  3M85 D;  4PRX A;  3T1Y E;  4GKJ E;  4FWG A;  1Z0V A;  4B3M E;  3ZM7 A;  4DV7 E;  2UUA E;  4DR5 I;  2AE8 A;  4DV6 E;  5DRO A;  5GMD A;  3T1Y I;  4DU7 A;  3B4T A;  5C0X D;  1USU A;  4AQY E;  4EMD A;  4B3M I;  3GME A;  1P42 A;  4FWD A;  4PRV A;  4JI4 I;  2UUA I;  4DV6 I;  3UHM A;  1Z0C A;  2Z5C A;  1H7S A;  4B3R I;  3K85 A;  2UXC I;  3M6A A;  4DV3 I;  3P3C A;  4HAC B;  4JI3 E;  2CVE A;  4R1F A;  1ZXM A;  4K0K E;  1NHJ A;  2C38 B;  3PS2 A;  1Z0B A;  1IBL E;  4ED4 A;  1XXE A;  5FLX Q;  4DV1 E;  4WUD A;  1ZM4 A;  1N34 E;  2C37 B;  3ZZ0 A;  1Z0E A;  4LCG A;  3K1J A;  4GKK E;  2ZM6 I;  1QZR A;  2UXD E;  4USM A;  2BA1 D;  4KHP I;  2PO1 B;  5DRR A;  4JI1 I;  1KIJ A;  1XNR E;  5DRQ A;  2R3V A;  2UUC E;  5A2Q C;  4X64 I;  3J80 C;  4DUY E;  4X66 I;  2A2D A;  1XMO E;  4LOM A;  4OO1 F;  4PU9 A;  2OI2 A;  4OO1 C;  1H72 C;  1Y5Y A;  2E5L E;  4IFD C;  4IZK A;  1Z0G A;  3WU5 A;  3HUL A;  3OTO E;  4DV2 E;  4Z7C A;  3LTO A;  3J7A G;  3H1C A;  3P3E A;  4AM3 A;  5K36 C;  2IES A;  2C39 B;  1H74 A;  4X65 E;  2Z5B A;  5JEA F;  4AIM A;  1MX0 A;  4MYT A;  4N3O A;  4J3D A;  2UUB I;  3GON A;  1J5E I;  4NXN I;  4JI0 E;  4WUC A;  2IOQ A;  4FW4 A;  3V5R A;  1N36 E;  4JI2 I;  5A2Q Q;  4DR1 E;  1PVG A;  1WUU A;  4JI7 I;  1IBK E;  4LFB E;  3K17 A;  4NXM I;  1OYR A;  2LJP A;  2V2Q A;  1FJG E;  3PYG A;  5GME A;  3D4J A;  4LF4 I;  1U2R A;  2NPF A;  4IFD E;  5JEA A;  1FJG I;  4LF5 I;  3PS1 A;  4DV0 E;  4QNK A;  4JI5 I;  3B8H A;  4DU8 A;  2NN6 E;  3PRY A;  4DR2 I;  4DV5 E;  3GLL A;  2IER A;  2JEA B;  2IOP A;  3L7Z B;  2R42 A;  4IFD B;  1K47 A;  4LPF A;  4HY1 A;  3B82 A;  4U3B A;  5K36 B;  5C0X A;  4JV5 I;  1Z5A A;  3Q6N A;  4BA2 A;  1NHH A;  2HKJ A;  3B78 A;  4P52 A;  2PNL A;  5LMU I;  1FNM A;  4LF9 I;  1N0V C;  4JG4 A;  4IFD D;  4ZVI A;  1KKH A;  2V8P A;  4DR5 E;  5L3J A;  4OX9 I;  4B3T I;  2V2V A;  2PO0 B;  2NN6 D;  5K36 D;  4FW9 A;  4JI4 E;  3QT8 A;  5FWK A;  2PNM A;  4B3R E;  3PYD A;  4LF7 I;  3GCM A;  1XMQ I;  2HK2 A;  2UXC E;  1USV A;  2BV3 A;  4DV3 E;  3ZKD A;  2JEB B;  3ZZU A;  2PNZ B;  3DD6 A;  2C38 A;  5DRP A;  2HHH I;  4DPY A;  5IWA I;  1N0U A;  4ISA A;  2UU9 I;  1D6T A;  4I3H A;  4DR4 I;  2ZM6 E;  1YHC A;  1KTV A;  2JT2 A;  1S4E A;  4KHP E;  1IBM I;  4JI1 E;  1HK7 A;  2X36 A;  3WU3 A;  1Z0T A;  4OKG A;  4X64 E;  4DR7 E;  1UEK A;  4YHH E;  3JAM C;  2WNR A;  3WU4 A;  2GO3 A;  4X66 E;  2HFS A;  4DR7 I;  4YHH I;  2DEI A;  1A6F A;  4BA1 B;  2CGE A;  4FW7 A;  2BR2 A;  4IS9 A;  2C39 A;  2O1W A;  4AID A;  3T1H I;  1ZM3 A;  4WUB A;  4MQY A;  1HNZ I;  2WP8 B;  3Q6M A;  2UUB E;  3ZZT A;  1EA6 A;  2AJ4 A;  4JI8 I;  1J5E E;  1NZ0 A;  4NXN E;  5JEA C;  4JI2 E;  2V2Z A;  3P76 A;  4JI7 E;  3ZKB A;  3JAM Q;  3M7N D;  2JE6 B;  2PO2 A;  4NXM E;  2NN6 F;  1UDO A;  4LF4 E;  4DR3 I;  4DPT A;  1E3H A;  1H7U A;  2VQF I;  4DV4 I;  1FWL A;  5C0X F;  4X62 I;  4LF5 E;  4UT4 A;  3H4L A;  4P7A A;  4JI5 E;  1VIS A;  4DR2 E;  4OO1 E;  1DAR A;  2CG9 A;  1EI1 A;  4FW5 A;  5EKW A;  2JEA A;  4MU1 A;  4U3D A;  1HR0 I;  3LPS A;  3L7Z A;  5BR8 E;  5K36 E;  4IFD A;  2DEJ A;  4JYA I;  1N32 I;  1Z5B A;  4LCH A;  4GQU A;  4LFA I;  2EFG A;  4YY3 I;  1Z5C A;  4OO1 B;  2GS8 A;  4JV5 E;  2NN6 A;  3PS3 A;  5BR8 I;  3J7A M;  2VQE I;  5LMU E;  1XHK A;  4Z7Y A;  2BA0 G;  4LF9 E;  4LF8 I;  3P3G A;  5LMN E;  1Y6Z A;  3WU6 A;  4OX9 E;  3QT5 A;  4HXZ A;  4B3T E;  4DR6 I;  1Z59 A;  5JEA B;  4OO1 D;  1HNW I;  1ZXN A;  5LMN I;  4B3S I;  4DUZ I;  2Q2E B;  3CDJ A;  1HNX I;  2BM1 A;  2F4V I;  4LF7 E;  1XMQ E;  1RHY A;  4LFC I;  4IZJ B;  2WW4 A;  1FI4 A;  5JEA D;  4LF6 I;  3HKM A;  3PYF A;  3HJC A;  4JI6 I;  1E3P A;  3CWV A;  2HHH E;  4HAC A;  4MU3 A;  3M7N G;  1RR9 A;  1N33 I;  2O1V A;  1B63 A;  5IWA E;  2A2C A;  1I94 I;  4IZJ D;  5LL6 R;  2UU9 E;  4NBQ A;  4RPF A;  1Z0W A;  4DR4 E;  1XNQ I;  2HFU A;  1Y60 A;  2Z5E A;  1R6M A;  4GKJ I;  1IBM E;  2C37 A;  4DV2 I;  2VF3 A;  4DV7 I;  3NZK A;  1ELO A;  2PO1 A;  4AQY I;  3PYE A;  1R6L A;  1PKP A;  2Z5C B;  1OYP A;  2VES A;  1MG7 A;  2X7I A;  4LCF A;  3F0N A;  2ZIT A;  5IT9 C;  4BA1 A;  2BA0 D;  1NHI A;  4MU0 A;  4JI3 I;  2GQ0 A;  2O1U A;  2ZBK B;  2O3Z A;  3KRN A;  3T1H E;  4K0K I;  4KQV A;  3LNU A;  2CZ9 A;  2HKE A;  1OYS A;  2GO4 A;  1IBL I;  1HNZ E;  1Y4U A;  4M1K A;  4DV1 I;  2WP8 A;  4JI8 E;  4URL A;  1N34 I;  3U1Y A;  1UDS A;  1UDN A;  5EL9 A;  4GKK I;  2UXD I;  2WNR B;  1OJ4 A;  2JE6 A;  4FN5 A;  1XNR I;  1B62 A;  4IFD F;  4MDT A;  2UUC I;  2UXB E;  1BKN A;  3QT6 A;  4DR3 E;  1YH8 A;  5IT9 Q;  4DPX A;  4DUY I;  2E1R A;  2VQF E;  4DV4 E;  4X62 E;  1XMO I;  5K36 F;  1ZM9 A;  4HYM A;  4DXL A;  2UXB I;  1RRE A;  4XTJ A;  2O1T A;  2NN6 C;  4IZK B;  3M85 G;  2BR2 B;  1Y4S A;  2E5L I;  3OTO I;  1H73 A; 
#chains in the Genus database with same CATH homology
 1HR0 E;  4X65 I;  2Z5B B;  1FWK A;  1N32 E;  4JYA E;  4LFA E;  4YY3 E;  1PIE A;  3J81 C;  2VQE E;  3J80 Q;  3QT7 A;  4JI0 I;  4LF8 E;  3V2U C;  1N36 I;  4DR1 I;  4DR6 E;  1IBK I;  1HNW E;  4LFB I;  4MYU A;  4B3S E;  4DUZ E;  2XEX A;  1HNX E;  3OTO I;  1KVK A;  3Q1Q A;  2F4V E;  2BM0 A;  2HK3 A;  4DPW A;  3P06 A;  4LFC E;  4IZJ A;  4DV0 I;  4USK A;  1ZM2 A;  1MU5 A;  4LF6 E;  4DV5 I;  4JI6 E;  3J81 Q;  4UTG A;  1S16 A;  1N33 E;  4DPU A;  2J7K A;  1I94 E;  2V34 A;  4FWH A;  1XNQ E;  5FLX C;  1FKA E;  4PRX A;  3T1Y E;  4GKJ E;  4FWG A;  1Z0V A;  4B3M E;  3ZM7 A;  4DV7 E;  2UUA E;  4DR5 I;  4DV6 E;  5GMD A;  3T1Y I;  4DU7 A;  4AQY E;  1USU A;  4EMD A;  4B3M I;  4FWD A;  4PRV A;  4JI4 I;  2UUA I;  4DV6 I;  1Z0C A;  2Z5C A;  1H7S A;  4B3R I;  3K85 A;  2UXC I;  3M6A A;  4DV3 I;  4HAC B;  4JI3 E;  4R1F A;  1ZXM A;  4K0K E;  1NHJ A;  1Z0B A;  1IBL E;  4ED4 A;  5FLX Q;  4DV1 E;  4WUD A;  1N34 E;  1ZM4 A;  3ZZ0 A;  1Z0E A;  3K1J A;  4GKK E;  2ZM6 I;  1QZR A;  2UXD E;  4USM A;  4KHP I;  4JI1 I;  1KIJ A;  1XNR E;  2R3V A;  2UUC E;  5A2Q C;  4X64 I;  3J80 C;  4DUY E;  4X66 I;  2A2D A;  1XMO E;  4PU9 A;  2OI2 A;  1H72 C;  2E5L E;  4IZK A;  1Z0G A;  3WU5 A;  3HUL A;  3OTO E;  4DV2 E;  4Z7C A;  3LTO A;  3J7A G;  1H74 A;  4X65 E;  2Z5B A;  1MX0 A;  4MYT A;  4N3O A;  2UUB I;  3GON A;  1J5E I;  4NXN I;  4JI0 E;  4WUC A;  2IOQ A;  3V5R A;  1N36 E;  4JI2 I;  5A2Q Q;  4DR1 E;  1PVG A;  1WUU A;  4JI7 I;  1IBK E;  4LFB E;  3K17 A;  4NXM I;  2LJP A;  2V2Q A;  1FJG E;  3PYG A;  5GME A;  3D4J A;  4LF4 I;  1U2R A;  2NPF A;  1FJG I;  4LF5 I;  4DV0 E;  4JI5 I;  3B8H A;  4DU8 A;  3PRY A;  4DR2 I;  4DV5 E;  2IOP A;  2R42 A;  1K47 A;  4HY1 A;  3B82 A;  4JV5 I;  1Z5A A;  3Q6N A;  1NHH A;  2HKJ A;  3B78 A;  4P52 A;  2PNL A;  5LMU I;  1FNM A;  4LF9 I;  1N0V C;  4JG4 A;  4ZVI A;  1KKH A;  2V8P A;  4DR5 E;  5L3J A;  4OX9 I;  4B3T I;  2V2V A;  4FW9 A;  4JI4 E;  3QT8 A;  5FWK A;  2PNM A;  4B3R E;  3PYD A;  4LF7 I;  1XMQ I;  2HK2 A;  2UXC E;  1USV A;  2BV3 A;  4DV3 E;  3ZKD A;  3ZZU A;  2HHH I;  4DPY A;  5IWA I;  1N0U A;  2UU9 I;  1D6T A;  4I3H A;  4DR4 I;  2ZM6 E;  1KTV A;  1S4E A;  4KHP E;  1IBM I;  4JI1 E;  1HK7 A;  2X36 A;  3WU3 A;  1Z0T A;  4X64 E;  4DR7 E;  1UEK A;  4YHH E;  3JAM C;  3WU4 A;  4X66 E;  2HFS A;  4DR7 I;  4YHH I;  2DEI A;  1A6F A;  2CGE A;  2O1W A;  3T1H I;  1ZM3 A;  4WUB A;  1HNZ I;  3Q6M A;  2UUB E;  3ZZT A;  1EA6 A;  2AJ4 A;  4JI8 I;  1J5E E;  1NZ0 A;  4NXN E;  4JI2 E;  2V2Z A;  4JI7 E;  3ZKB A;  3JAM Q;  4NXM E;  4LF4 E;  4DR3 I;  4DPT A;  1H7U A;  2VQF I;  4DV4 I;  1FWL A;  4X62 I;  4LF5 E;  4UT4 A;  3H4L A;  4P7A A;  4JI5 E;  1VIS A;  4DR2 E;  1DAR A;  2CG9 A;  1EI1 A;  1HR0 I;  3LPS A;  5BR8 E;  2DEJ A;  4JYA I;  1N32 I;  1Z5B A;  4LFA I;  2EFG A;  4YY3 I;  1Z5C A;  2GS8 A;  4JV5 E;  5BR8 I;  3J7A M;  2VQE I;  5LMU E;  1XHK A;  4Z7Y A;  4LF9 E;  4LF8 I;  5LMN E;  1Y6Z A;  3WU6 A;  4OX9 E;  3QT5 A;  4HXZ A;  4B3T E;  4DR6 I;  1Z59 A;  1HNW I;  1ZXN A;  5LMN I;  4B3S I;  4DUZ I;  2Q2E B;  1HNX I;  2BM1 A;  2F4V I;  4LF7 E;  1XMQ E;  4LFC I;  4IZJ B;  2WW4 A;  1FI4 A;  4LF6 I;  3PYF A;  3HJC A;  4JI6 I;  3CWV A;  2HHH E;  4HAC A;  1N33 I;  1RR9 A;  2O1V A;  1B63 A;  5IWA E;  2A2C A;  1I94 I;  4IZJ D;  5LL6 R;  2UU9 E;  4RPF A;  1Z0W A;  4DR4 E;  1XNQ I;  2HFU A;  2Z5E A;  4GKJ I;  1IBM E;  2VF3 A;  4DV7 I;  1ELO A;  4AQY I;  3PYE A;  1PKP A;  2Z5C B;  1MG7 A;  2X7I A;  3F0N A;  2ZIT A;  5IT9 C;  1NHI A;  4JI3 I;  2GQ0 A;  2O1U A;  2ZBK B;  3T1H E;  4K0K I;  4KQV A;  3LNU A;  2CZ9 A;  2HKE A;  1IBL I;  1HNZ E;  1Y4U A;  4M1K A;  4DV1 I;  4JI8 E;  4URL A;  1N34 I;  4GKK I;  2UXD I;  1OJ4 A;  4FN5 A;  1XNR I;  1B62 A;  2UUC I;  2UXB E;  1BKN A;  3QT6 A;  4DR3 E;  5IT9 Q;  4DPX A;  4DUY I;  2E1R A;  2VQF E;  4DV4 E;  1XMO I;  4X62 E;  1ZM9 A;  4HYM A;  4DXL A;  2UXB I;  1RRE A;  4XTJ A;  2O1T A;  4IZK B;  1Y4S A;  2E5L I;  4DV2 I;  1H73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...