3T1HI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1hI00
4USMA 4LF5I 4RPFA 4LF5E 2DEJA 2UUBI 2UUBE 1Z0BA 4YHHI 4YHHE 4JI6I 3ZKBA 4JI6E 1NHHA 4DR1I 5A2QC 4OX9I 4OX9E 1A6FA 2UU9I 2UU9E 4UT4A 1FNMA 1IBLI 2EFGA 1IBLE 2CZ9A 2A2CA 2HFSA 1BKNA 1FWKA 4DV7I 4JV5I 4DV7E 5FLXC 4JV5E 4M1KA 4LF7I 3PYFA 2E1RA 4LF7E 4B3SI 4B3SE 4DPTA 1EI1A 3HULA 1Z5BA 4URLA 5IWAI 4AQYI 5IWAE 4AQYE 2UXBI 2UXBE 4B3RI 1PIEA 4B3RE 4YY3I 4DV4I 4YY3E 4DV4E 4LF9I 4DUYI 4LF9E 4DUYE 4FWDA 4DR2I 4DR2E 4DR4I 3PYEA 4JG4A 4DU8A 4DR4E 3LNUA 1FWLA 4DV0I 1ZM3A 4DV0E 4X64I 1Z0VA 4X64E 1XNRI 5A2QQ 1XNRE 1RREA 1I94I 1I94E 4JI4I 4JI4E 5GMEA 4GKJI 4JI3I 4GKJE 4JI3E 3F0NA 4LF8I 1D6TA 1H7UA 4LF8E 4JYAI 3J81C 1IBMI 4WUDA 4JYAE 1IBME 4WUBA 3J80C 2ZM6I 5FLXQ 1Z0EA 2ZM6E 4UTGA 1DARA 1H73A 1PVGA 1ZM9A 4JI7I 4JI7E 1ZXMA 1RR9A 4LFAI 2WW4A 4LFAE 2BM0A 1NZ0A 4DR5I 4DR5E 1QZRA 1KVKA 1ZXNA 2BM1A 2UUAI 1N32I 4DR1E 4I3HA 2UUAE 1N32E 4NXNI 4X62I 2Q2EB 1KTVA 4NXNE 3B8HA 1VISA 4X62E 3J7AM 4ZVIA 4DV6I 2X36A 4DV2I 4DV6E 1ZM2A 4DV2E 4JI1I 4JI1E 2VQFI 1MU5A 2VQFE 1N33I 1N33E 1MX0A 4NXMI 2VF3A 3H4LA 4NXME 3K17A 4LFCI 2NPFA 2HFUA 1H74A 4LFCE 1Z59A 1EA6A 3J7AG 1N36I 4DR6I 2V8PA 1N36E 3T1HI 4DR6E 3J81Q 3T1HE 4MYTA 3T1YI 3J80Q 1Z0TA 3T1YE 3QT5A 2ZITA 1KKHA 1FKAE 3M6AA 2E5LI 4X65I 4X65E 2UXDI 2UXDE 1N34I 2VQEI 1H72C 3WU5A 1N34E 2VQEE 1OJ4A 2HK3A 4FW9A 4FN5A 2UXCI 2UXCE 1HNWI 1HNWE 3QT6A 3PYGA 1FI4A 2X7IA 1Z5AA 3PYDA 3CWVA 4B3TI 4B3TE 4B3MI 1IBKI 4B3ME 4LF4I 4GKKI 5LMNI 1IBKE 4LF4E 4GKKE 2LJPA 5LMNE 4DV3I 3ZZUA 3QT8A 4DPYA 4HYMA 3JAMC 4DXLA 3ZM7A 4EMDA 2HK2A 2OI2A 3LPSA 1Z5CA 1FJGI 2F4VI 1FJGE 2F4VE 3ZZ0A 4PRVA 1XMQI 1S16A 4LF6I 1XMQE 2BV3A 4LF6E 3B82A 1HNXI 1B62A 1Z0GA 1HNXE 3D4JA 4JI2I 4JI2E 3LTOA 2R3VA 2GS8A 2HHHI 2HHHE 1NHJA 4JI8I 4FWGA 4JI8E 4HXZA 4DR7I 4DR7E 3V5RA 1HNZI 1MG7A 4DPWA 5LL6R 2HKJA 2R42A 1HNZE 1J5EI 1HR0I 3ZZTA 4Z7CA 1J5EE 1Z0WA 1HR0E 4DPUA 4DPXA 4USKA 4XTJA 1XHKA 3JAMQ 1H7SA 3Q1QA 1XMOI 4JI5I 4DV5I 1NHIA 4HY1A 1XMOE 4MYUA 4JI5E 4DV5E 1ELOA 4KQVA 4HACA 2AJ4A 4HACB 2E5LE 4JI0I 1N0UA 4JI0E 4DR3I 4DV1I 4DR3E 4DV1E 4PU9A 3OTOI 3QT7A 1ZM4A 3OTOE 1WUUA 1XNQI 5IT9Q 1XNQE 2V34A 4K0KI 3WU3A 4K0KE 4DUZI 4DUZE 5GMDA 1U2RA 2A2DA 2V2VA 2HKEA 1S4EA 1Z0CA 3WU6A 2DEIA 4R1FA 4DV3E 1K47A 1KIJA 4WUCA 3V2UC 5BR8I 2V2QA 5BR8E 1UEKA 2ZBKB 4P52A 5LMUI 5LMUE 4P7AA 4Z7YA 4PRXA 3K1JA 2XEXA 1B63A 3GONA 3ZKDA 2V2ZA 3WU4A 4X66I 4LFBI 4FWHA 1N0VC 4X66E 4LFBE 2UUCI 4DU7A 4ED4A 2UUCE 3B78A 5L3JA 4KHPI 2J7KA 1PKPA 4KHPE 5IT9C
chains in the Genus database with same CATH superfamily
2JEAB 3PS1A 4USMA 2C37A 4LF5I 4RPFA 4LF5E 2DEJA 2UUBI 2UUBE 1Z0BA 4YHHI 2BA1D 4YHHE 4JI6I 3ZKBA 4JI6E 1NHHA 5EKWA 4DR1I 3P3EA 5A2QC 4OX9I 3U1YA 4OX9E 1A6FA 2UU9I 2UU9E 4UT4A 2WNRA 1FNMA 4IZJD 2WNRB 1IBLI 2GO4A 2EFGA 1IBLE 2CZ9A 2CVEA 2JEBA 2A2CA 2HFSA 2JEBB 1BKNA 1FWKA 1YH8A 5C0XA 3P06A 5C0XB 1Y6ZA 3M7ND 4DV7I 4JV5I 3P76A 4MU0A 4DV7E 5FLXC 4JV5E 4IS9A 4M1KA 4LF7I 3PYFA 2E1RA 4GQUA 4LF7E 2CG9A 4J3DA 4B3SI 4B3SE 4DPTA 5JEAA 5JEAB 1EI1A 3HULA 1Z5BA 2IOPA 4URLA 5IWAI 4AQYI 5IWAE 5C0XC 4AQYE 2GO3A 2UXBI 4U3DA 2UXBE 4B3RI 1PIEA 5K36F 5DRQA 4B3RE 4YY3I 4DV4I 4YY3E 4DV4E 4LF9I 4DUYI 2F1DA 4LF9E 4DUYE 4FWDA 5C0XE 4DR2I 4DR2E 4DR4I 3PYEA 4JG4A 4DU8A 4DR4E 3LNUA 3Q6NA 1FWLA 1RHYA 4DV0I 5JEAC 2PNZA 1ZM3A 4DV0E 4X64I 2PNZB 1Z0VA 4X64E 1XNRI 5C0XD 5A2QQ 1XNRE 4IZKA 1RREA 1I94I 1I94E 3P3GA 5JEAE 4JI4I 4JI4E 2IERA 5GMEA 4GKJI 4JI3I 4GKJE 4JI3E 2BA1G 4QNKA 3F0NA 4LF8I 1D6TA 5DNLA 1H7UA 5JEAD 4LF8E 2Z5BA 4JYAI 3PS2A 3J81C 1IBMI 2Z5BB 4WUDA 4JYAE 1IBME 4WUBA 1UDSA 2NN6F 3J80C 2ZM6I 5FLXQ 1Z0EA 3DD6A 2ZM6E 4UTGA 1DARA 1H73A 1PVGA 2O1WA 1ZM9A 4JI7I 2J65A 4JI7E 2PO1B 4U3BA 1ZXMA 1RR9A 4AIMA 4LFAI 2Z5EA 1UDOA 2WW4A 4LFAE 2PNMA 2C37B 2BM0A 1NZ0A 3L7ZA 4DR5I 4DR5E 3M7NG 1QZRA 4AM3A 3B4TA 1KVKA 1ZXNA 2BM1A 3NZKA 2UUAI 1N32I 4DR1E 5EL9A 4I3HA 2UUAE 1N32E 4NXNI 2GQ0A 4X62I 2Q2EB 1KTVA 4NXNE 3B8HA 1VISA 4X62E 3J7AM 2PNLA 1UDNA 4ZVIA 4DV6I 2X36A 4DV2I 4FW6A 1ZM2A 4DV6E 4DV2E 2Z5CA 4JI1I 2Z5CB 2VQFI 4JI1E 1MU5A 4IFDA 4BA1A 3P3CA 2VQFE 1N33I 4MU1A 2PO0A 4BA1B 1N33E 5DRPA 1MX0A 4NXMI 2VF3A 3H4LA 4NXME 1Y5YA 1Y4UA 3K17A 4LFCI 2NPFA 2HFUA 1H74A 4LFCE 2O1VA 1Z59A 1EA6A 3J7AG 1N36I 2JT2A 4DR6I 2O1TA 2V8PA 1N36E 3T1HI 4DR6E 3J81Q 4OKGA 3T1HE 4MYTA 3T1YI 3J80Q 1Z0TA 3T1YE 1R6LA 1YHCA 3QT5A 1OYPA 2ZITA 4IFDC 1KKHA 2IOQA 2VESA 1FKAE 3M6AA 2E5LI 3KRNA 4X65I 5ELWA 4LCGA 4X65E 5C0XF 2UXDI 2UXDE 1N34I 2VQEI 4IFDE 2C38A 1H72C 3WU5A 1N34E 2VQEE 1OJ4A 2PO2A 2PO2B 2HK3A 4FW9A 3CDJA 4FN5A 2UXCI 4MDTA 4IFDD 2UXCE 1HNWI 4IZKB 5JEAF 1HNWE 3QT6A 3PYGA 4N3OA 1FI4A 2X7IA 3Q6MA 1Z5AA 3PYDA 3CWVA 4B3TI 4OO1A 4B3TE 4B3MI 1IBKI 3H1CA 4B3ME 4LF4I 4GKKI 5LMNI 1IBKE 4LF4E 4GKKE 2LJPA 5LMNE 4DV3I 5DROA 3ZZUA 3QT8A 3CDIA 4DPYA 1OYRA 4HYMA 4NBQA 3JAMC 4DXLA 3ZM7A 4EMDA 2HK2A 2OI2A 3LPSA 1Z5CA 1FJGI 2F4VI 1FJGE 2F4VE 3ZZ0A 4PRVA 1XMQI 1S16A 4LF6I 1XMQE 1E3HA 1R6MA 2BV3A 4LF6E 4OO1C 3B82A 3L7ZB 1HNXI 1B62A 3U1KA 1Z0GA 1HNXE 3D4JA 1XXEA 4JI2I 4OO1E 4JI2E 3LTOA 4QNJA 2R3VA 2JEAA 2GS8A 2NN6D 2HHHI 2HHHE 4OO1D 1NHJA 3GLLA 2AE8A 4JI8I 4FWGA 4JI8E 4FW3A 4HXZA 4DR7I 1E3PA 4DR7E 3V5RA 3PRYA 1HNZI 1MG7A 4MU4A 4DPWA 4IFDB 5LL6R 2HKJA 2R42A 1HNZE 1J5EI 2PO0B 1HR0I 3ZZTA 4Z7CA 1J5EE 1Z0WA 1HR0E 4DPUA 2IESA 4LCFA 4DPXA 5K36A 5K36B 4USKA 3HJCA 1Y60A 5DNXA 4XTJA 1XHKA 3JAMQ 1H7SA 3Q1QA 2BA0G 3M85G 4OZEA 4LPFA 1XMOI 4JI5I 4DV5I 1NHIA 4HY1A 1XMOE 4MYUA 4JI5E 4DV5E 3K85A 1ELOA 4KQVA 4LOMA 4LCHA 4HACA 2AJ4A 4HACB 2E5LE 4JI0I 1N0UA 4IFDF 4JI0E 1P42A 2O1UA 2CGEA 4DR3I 3UHMA 4DV1I 4DR3E 2C38B 4FW7A 4DV1E 5K36C 4PU9A 3GMEA 3OTOI 3QT7A 1ZM4A 3OTOE 1WUUA 1XNQI 5IT9Q 1XNQE 2BA0D 1OYSA 2V34A 3M85D 3WU3A 2O3ZA 4K0KI 5K36E 4K0KE 4DUZI 4DUZE 5GMDA 1U2RA 2NN6A 2A2DA 2NN6B 2V2VA 2HKEA 1S4EA 4OO1B 1USUA 1Z0CA 5K36D 2WP8A 4MU3A 2WP8B 3WU6A 2DEIA 4R1FA 4DV3E 1K47A 1HK7A 1KIJA 4ISAA 4WUCA 3V2UC 3HKMA 3GCMA 2C39A 5BR8I 1VI7A 2C39B 2V2QA 5BR8E 1UEKA 2ZBKB 4P52A 5LMUI 5DRRA 4IZJA 4MQYA 5LMUE 3PS3A 4IZJB 4P7AA 4Z7YA 4PRXA 3K1JA 2NN6C 1UDQA 2XEXA 1B63A 3GONA 3ZKDA 2V2ZA 3WU4A 4FW4A 2JE6A 2JE6B 4X66I 4BA2A 4LFBI 4FWHA 1N0VC 4BA2B 4X66E 4LFBE 1Y4SA 2UUCI 4DU7A 5FWKA 4ED4A 4OO1F 2UUCE 2NN6E 3B78A 5L3JA 4KHPI 2BR2A 2J7KA 1PKPA 4KHPE 2BR2B 2PO1A 4FW5A 5IT9C 4AIDA 1USVA
chains in the Genus database with same CATH topology
4USMA 4LF5I 4RPFA 4LF5E 2DEJA 2UUBI 2UUBE 1Z0BA 4YHHI 4YHHE 4JI6I 3ZKBA 4JI6E 1NHHA 4DR1I 5A2QC 4OX9I 4OX9E 1A6FA 2UU9I 2UU9E 4UT4A 1FNMA 4IZJD 1IBLI 2EFGA 1IBLE 2CZ9A 2A2CA 2HFSA 1BKNA 1FWKA 3P06A 1Y6ZA 4DV7I 4JV5I 4DV7E 5FLXC 4JV5E 4M1KA 4LF7I 3PYFA 2E1RA 4LF7E 2CG9A 4B3SI 4B3SE 4DPTA 1EI1A 3HULA 1Z5BA 2IOPA 4URLA 5IWAI 4AQYI 5IWAE 4AQYE 2UXBI 2UXBE 4B3RI 1PIEA 4B3RE 4YY3I 4DV4I 4YY3E 4DV4E 4LF9I 4DUYI 4LF9E 4DUYE 4FWDA 4DR2I 4DR2E 4DR4I 3PYEA 4JG4A 4DU8A 4DR4E 3LNUA 3Q6NA 1FWLA 4DV0I 1ZM3A 4DV0E 4X64I 1Z0VA 4X64E 1XNRI 5A2QQ 1XNRE 4IZKA 1RREA 1I94I 1I94E 4JI4I 4JI4E 5GMEA 4GKJI 4JI3I 4GKJE 4JI3E 3F0NA 4LF8I 1D6TA 1H7UA 4LF8E 2Z5BA 4JYAI 3J81C 1IBMI 2Z5BB 4WUDA 4JYAE 1IBME 4WUBA 3J80C 2ZM6I 5FLXQ 1Z0EA 2ZM6E 4UTGA 1DARA 1H73A 1PVGA 2O1WA 1ZM9A 4JI7I 4JI7E 1ZXMA 1RR9A 4LFAI 2Z5EA 2WW4A 4LFAE 2PNMA 2BM0A 1NZ0A 4DR5I 4DR5E 1QZRA 1KVKA 1ZXNA 2BM1A 2UUAI 1N32I 4DR1E 4I3HA 2UUAE 1N32E 4NXNI 2GQ0A 4X62I 2Q2EB 1KTVA 4NXNE 3B8HA 1VISA 4X62E 3J7AM 2PNLA 4ZVIA 4DV6I 2X36A 4DV2I 4DV6E 1ZM2A 4DV2E 2Z5CA 4JI1I 2Z5CB 2VQFI 4JI1E 1MU5A 2VQFE 1N33I 1N33E 1MX0A 4NXMI 2VF3A 3H4LA 4NXME 1Y4UA 3K17A 4LFCI 2NPFA 2HFUA 1H74A 4LFCE 2O1VA 1Z59A 1EA6A 3J7AG 1N36I 4DR6I 2O1TA 2V8PA 1N36E 3T1HI 4DR6E 3J81Q 3T1HE 4MYTA 3T1YI 3J80Q 1Z0TA 3T1YE 3QT5A 2ZITA 1KKHA 2IOQA 1FKAE 3M6AA 2E5LI 4X65I 4X65E 2UXDI 2UXDE 1N34I 2VQEI 1H72C 3WU5A 1N34E 2VQEE 1OJ4A 2HK3A 4FW9A 4FN5A 2UXCI 2UXCE 1HNWI 4IZKB 1HNWE 3QT6A 3PYGA 4N3OA 1FI4A 2X7IA 3Q6MA 1Z5AA 3PYDA 3CWVA 4B3TI 4B3TE 4B3MI 1IBKI 4B3ME 4LF4I 4GKKI 5LMNI 1IBKE 4LF4E 4GKKE 2LJPA 5LMNE 4DV3I 3ZZUA 3QT8A 4DPYA 4HYMA 3JAMC 4DXLA 3ZM7A 4EMDA 2HK2A 2OI2A 3LPSA 1Z5CA 1FJGI 2F4VI 1FJGE 2F4VE 3ZZ0A 4PRVA 1XMQI 1S16A 4LF6I 1XMQE 2BV3A 4LF6E 3B82A 1HNXI 1B62A 1Z0GA 1HNXE 3D4JA 4JI2I 4JI2E 3LTOA 2R3VA 2GS8A 2HHHI 2HHHE 1NHJA 4JI8I 4FWGA 4JI8E 4HXZA 4DR7I 4DR7E 3V5RA 3PRYA 1HNZI 1MG7A 4DPWA 5LL6R 2HKJA 2R42A 1HNZE 1J5EI 1HR0I 3ZZTA 4Z7CA 1J5EE 1Z0WA 1HR0E 4DPUA 4DPXA 4USKA 3HJCA 4XTJA 1XHKA 3JAMQ 1H7SA 3Q1QA 1XMOI 4JI5I 4DV5I 1NHIA 4HY1A 1XMOE 4MYUA 4JI5E 4DV5E 3K85A 1ELOA 4KQVA 4HACA 2AJ4A 4HACB 2E5LE 4JI0I 1N0UA 4JI0E 2O1UA 2CGEA 4DR3I 4DV1I 4DR3E 4DV1E 4PU9A 3OTOI 3QT7A 1ZM4A 3OTOE 1WUUA 1XNQI 5IT9Q 1XNQE 2V34A 4K0KI 3WU3A 4K0KE 4DUZI 4DUZE 5GMDA 1U2RA 2A2DA 2V2VA 2HKEA 1S4EA 1USUA 1Z0CA 3WU6A 2DEIA 4R1FA 4DV3E 1K47A 1HK7A 1KIJA 4WUCA 3V2UC 5BR8I 2V2QA 5BR8E 1UEKA 2ZBKB 4P52A 5LMUI 4IZJA 5LMUE 4IZJB 4P7AA 4Z7YA 4PRXA 3K1JA 2XEXA 1B63A 3GONA 3ZKDA 2V2ZA 3WU4A 4X66I 4LFBI 4FWHA 1N0VC 4X66E 4LFBE 1Y4SA 2UUCI 4DU7A 5FWKA 4ED4A 2UUCE 3B78A 5L3JA 4KHPI 2J7KA 1PKPA 4KHPE 5IT9C 1USVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USM A;  4LF5 I;  4RPF A;  4LF5 E;  2DEJ A;  2UUB I;  2UUB E;  1Z0B A;  4YHH I;  4YHH E;  4JI6 I;  3ZKB A;  4JI6 E;  1NHH A;  4DR1 I;  5A2Q C;  4OX9 I;  4OX9 E;  1A6F A;  2UU9 I;  2UU9 E;  4UT4 A;  1FNM A;  1IBL I;  2EFG A;  1IBL E;  2CZ9 A;  2A2C A;  2HFS A;  1BKN A;  1FWK A;  4DV7 I;  4JV5 I;  4DV7 E;  5FLX C;  4JV5 E;  4M1K A;  4LF7 I;  3PYF A;  2E1R A;  4LF7 E;  4B3S I;  4B3S E;  4DPT A;  1EI1 A;  3HUL A;  1Z5B A;  4URL A;  5IWA I;  4AQY I;  5IWA E;  4AQY E;  2UXB I;  2UXB E;  4B3R I;  1PIE A;  4B3R E;  4YY3 I;  4DV4 I;  4YY3 E;  4DV4 E;  4LF9 I;  4DUY I;  4LF9 E;  4DUY E;  4FWD A;  4DR2 I;  4DR2 E;  4DR4 I;  3PYE A;  4JG4 A;  4DU8 A;  4DR4 E;  3LNU A;  1FWL A;  4DV0 I;  1ZM3 A;  4DV0 E;  4X64 I;  1Z0V A;  4X64 E;  1XNR I;  5A2Q Q;  1XNR E;  1RRE A;  1I94 I;  1I94 E;  4JI4 I;  4JI4 E;  5GME A;  4GKJ I;  4JI3 I;  4GKJ E;  4JI3 E;  3F0N A;  4LF8 I;  1D6T A;  1H7U A;  4LF8 E;  4JYA I;  3J81 C;  1IBM I;  4WUD A;  4JYA E;  1IBM E;  4WUB A;  3J80 C;  2ZM6 I;  5FLX Q;  1Z0E A;  2ZM6 E;  4UTG A;  1DAR A;  1H73 A;  1PVG A;  1ZM9 A;  4JI7 I;  4JI7 E;  1ZXM A;  1RR9 A;  4LFA I;  2WW4 A;  4LFA E;  2BM0 A;  1NZ0 A;  4DR5 I;  4DR5 E;  1QZR A;  1KVK A;  1ZXN A;  2BM1 A;  2UUA I;  1N32 I;  4DR1 E;  4I3H A;  2UUA E;  1N32 E;  4NXN I;  4X62 I;  2Q2E B;  1KTV A;  4NXN E;  3B8H A;  1VIS A;  4X62 E;  3J7A M;  4ZVI A;  4DV6 I;  2X36 A;  4DV2 I;  4DV6 E;  1ZM2 A;  4DV2 E;  4JI1 I;  4JI1 E;  2VQF I;  1MU5 A;  2VQF E;  1N33 I;  1N33 E;  1MX0 A;  4NXM I;  2VF3 A;  3H4L A;  4NXM E;  3K17 A;  4LFC I;  2NPF A;  2HFU A;  1H74 A;  4LFC E;  1Z59 A;  1EA6 A;  3J7A G;  1N36 I;  4DR6 I;  2V8P A;  1N36 E;  3T1H I;  4DR6 E;  3J81 Q;  3T1H E;  4MYT A;  3T1Y I;  3J80 Q;  1Z0T A;  3T1Y E;  3QT5 A;  2ZIT A;  1KKH A;  1FKA E;  3M6A A;  2E5L I;  4X65 I;  4X65 E;  2UXD I;  2UXD E;  1N34 I;  2VQE I;  1H72 C;  3WU5 A;  1N34 E;  2VQE E;  1OJ4 A;  2HK3 A;  4FW9 A;  4FN5 A;  2UXC I;  2UXC E;  1HNW I;  1HNW E;  3QT6 A;  3PYG A;  1FI4 A;  2X7I A;  1Z5A A;  3PYD A;  3CWV A;  4B3T I;  4B3T E;  4B3M I;  1IBK I;  4B3M E;  4LF4 I;  4GKK I;  5LMN I;  1IBK E;  4LF4 E;  4GKK E;  2LJP A;  5LMN E;  4DV3 I;  3ZZU A;  3QT8 A;  4DPY A;  4HYM A;  3JAM C;  4DXL A;  3ZM7 A;  4EMD A;  2HK2 A;  2OI2 A;  3LPS A;  1Z5C A;  1FJG I;  2F4V I;  1FJG E;  2F4V E;  3ZZ0 A;  4PRV A;  1XMQ I;  1S16 A;  4LF6 I;  1XMQ E;  2BV3 A;  4LF6 E;  3B82 A;  1HNX I;  1B62 A;  1Z0G A;  1HNX E;  3D4J A;  4JI2 I;  4JI2 E;  3LTO A;  2R3V A;  2GS8 A;  2HHH I;  2HHH E;  1NHJ A;  4JI8 I;  4FWG A;  4JI8 E;  4HXZ A;  4DR7 I;  4DR7 E;  3V5R A;  1HNZ I;  1MG7 A;  4DPW A;  5LL6 R;  2HKJ A;  2R42 A;  1HNZ E;  1J5E I;  1HR0 I;  3ZZT A;  4Z7C A;  1J5E E;  1Z0W A;  1HR0 E;  4DPU A;  4DPX A;  4USK A;  4XTJ A;  1XHK A;  3JAM Q;  1H7S A;  3Q1Q A;  1XMO I;  4JI5 I;  4DV5 I;  1NHI A;  4HY1 A;  1XMO E;  4MYU A;  4JI5 E;  4DV5 E;  1ELO A;  4KQV A;  4HAC A;  2AJ4 A;  4HAC B;  2E5L E;  4JI0 I;  1N0U A;  4JI0 E;  4DR3 I;  4DV1 I;  4DR3 E;  4DV1 E;  4PU9 A;  3OTO I;  3QT7 A;  1ZM4 A;  3OTO E;  1WUU A;  1XNQ I;  5IT9 Q;  1XNQ E;  2V34 A;  4K0K I;  3WU3 A;  4K0K E;  4DUZ I;  4DUZ E;  5GMD A;  1U2R A;  2A2D A;  2V2V A;  2HKE A;  1S4E A;  1Z0C A;  3WU6 A;  2DEI A;  4R1F A;  4DV3 E;  1K47 A;  1KIJ A;  4WUC A;  3V2U C;  5BR8 I;  2V2Q A;  5BR8 E;  1UEK A;  2ZBK B;  4P52 A;  5LMU I;  5LMU E;  4P7A A;  4Z7Y A;  4PRX A;  3K1J A;  2XEX A;  1B63 A;  3GON A;  3ZKD A;  2V2Z A;  3WU4 A;  4X66 I;  4LFB I;  4FWH A;  1N0V C;  4X66 E;  4LFB E;  2UUC I;  4DU7 A;  4ED4 A;  2UUC E;  3B78 A;  5L3J A;  4KHP I;  2J7K A;  1PKP A;  4KHP E;  5IT9 C; 
#chains in the Genus database with same CATH topology
 2JEA B;  3PS1 A;  4USM A;  2C37 A;  4LF5 I;  4RPF A;  4LF5 E;  2DEJ A;  2UUB I;  2UUB E;  1Z0B A;  4YHH I;  2BA1 D;  4YHH E;  4JI6 I;  3ZKB A;  4JI6 E;  1NHH A;  5EKW A;  4DR1 I;  3P3E A;  5A2Q C;  4OX9 I;  3U1Y A;  4OX9 E;  1A6F A;  2UU9 I;  2UU9 E;  4UT4 A;  2WNR A;  1FNM A;  4IZJ D;  2WNR B;  1IBL I;  2GO4 A;  2EFG A;  1IBL E;  2CZ9 A;  2CVE A;  2JEB A;  2A2C A;  2HFS A;  2JEB B;  1BKN A;  1FWK A;  1YH8 A;  5C0X A;  3P06 A;  5C0X B;  1Y6Z A;  3M7N D;  4DV7 I;  4JV5 I;  3P76 A;  4MU0 A;  4DV7 E;  5FLX C;  4JV5 E;  4IS9 A;  4M1K A;  4LF7 I;  3PYF A;  2E1R A;  4GQU A;  4LF7 E;  2CG9 A;  4J3D A;  4B3S I;  4B3S E;  4DPT A;  5JEA A;  5JEA B;  1EI1 A;  3HUL A;  1Z5B A;  2IOP A;  4URL A;  5IWA I;  4AQY I;  5IWA E;  5C0X C;  4AQY E;  2GO3 A;  2UXB I;  4U3D A;  2UXB E;  4B3R I;  1PIE A;  5K36 F;  5DRQ A;  4B3R E;  4YY3 I;  4DV4 I;  4YY3 E;  4DV4 E;  4LF9 I;  4DUY I;  2F1D A;  4LF9 E;  4DUY E;  4FWD A;  5C0X E;  4DR2 I;  4DR2 E;  4DR4 I;  3PYE A;  4JG4 A;  4DU8 A;  4DR4 E;  3LNU A;  3Q6N A;  1FWL A;  1RHY A;  4DV0 I;  5JEA C;  2PNZ A;  1ZM3 A;  4DV0 E;  4X64 I;  2PNZ B;  1Z0V A;  4X64 E;  1XNR I;  5C0X D;  5A2Q Q;  1XNR E;  4IZK A;  1RRE A;  1I94 I;  1I94 E;  3P3G A;  5JEA E;  4JI4 I;  4JI4 E;  2IER A;  5GME A;  4GKJ I;  4JI3 I;  4GKJ E;  4JI3 E;  2BA1 G;  4QNK A;  3F0N A;  4LF8 I;  1D6T A;  5DNL A;  1H7U A;  5JEA D;  4LF8 E;  2Z5B A;  4JYA I;  3PS2 A;  3J81 C;  1IBM I;  2Z5B B;  4WUD A;  4JYA E;  1IBM E;  4WUB A;  1UDS A;  2NN6 F;  3J80 C;  2ZM6 I;  5FLX Q;  1Z0E A;  3DD6 A;  2ZM6 E;  4UTG A;  1DAR A;  1H73 A;  1PVG A;  2O1W A;  1ZM9 A;  4JI7 I;  2J65 A;  4JI7 E;  2PO1 B;  4U3B A;  1ZXM A;  1RR9 A;  4AIM A;  4LFA I;  2Z5E A;  1UDO A;  2WW4 A;  4LFA E;  2PNM A;  2C37 B;  2BM0 A;  1NZ0 A;  3L7Z A;  4DR5 I;  4DR5 E;  3M7N G;  1QZR A;  4AM3 A;  3B4T A;  1KVK A;  1ZXN A;  2BM1 A;  3NZK A;  2UUA I;  1N32 I;  4DR1 E;  5EL9 A;  4I3H A;  2UUA E;  1N32 E;  4NXN I;  2GQ0 A;  4X62 I;  2Q2E B;  1KTV A;  4NXN E;  3B8H A;  1VIS A;  4X62 E;  3J7A M;  2PNL A;  1UDN A;  4ZVI A;  4DV6 I;  2X36 A;  4DV2 I;  4FW6 A;  1ZM2 A;  4DV6 E;  4DV2 E;  2Z5C A;  4JI1 I;  2Z5C B;  2VQF I;  4JI1 E;  1MU5 A;  4IFD A;  4BA1 A;  3P3C A;  2VQF E;  1N33 I;  4MU1 A;  2PO0 A;  4BA1 B;  1N33 E;  5DRP A;  1MX0 A;  4NXM I;  2VF3 A;  3H4L A;  4NXM E;  1Y5Y A;  1Y4U A;  3K17 A;  4LFC I;  2NPF A;  2HFU A;  1H74 A;  4LFC E;  2O1V A;  1Z59 A;  1EA6 A;  3J7A G;  1N36 I;  2JT2 A;  4DR6 I;  2O1T A;  2V8P A;  1N36 E;  3T1H I;  4DR6 E;  3J81 Q;  4OKG A;  3T1H E;  4MYT A;  3T1Y I;  3J80 Q;  1Z0T A;  3T1Y E;  1R6L A;  1YHC A;  3QT5 A;  1OYP A;  2ZIT A;  4IFD C;  1KKH A;  2IOQ A;  2VES A;  1FKA E;  3M6A A;  2E5L I;  3KRN A;  4X65 I;  5ELW A;  4LCG A;  4X65 E;  5C0X F;  2UXD I;  2UXD E;  1N34 I;  2VQE I;  4IFD E;  2C38 A;  1H72 C;  3WU5 A;  1N34 E;  2VQE E;  1OJ4 A;  2PO2 A;  2PO2 B;  2HK3 A;  4FW9 A;  3CDJ A;  4FN5 A;  2UXC I;  4MDT A;  4IFD D;  2UXC E;  1HNW I;  4IZK B;  5JEA F;  1HNW E;  3QT6 A;  3PYG A;  4N3O A;  1FI4 A;  2X7I A;  3Q6M A;  1Z5A A;  3PYD A;  3CWV A;  4B3T I;  4OO1 A;  4B3T E;  4B3M I;  1IBK I;  3H1C A;  4B3M E;  4LF4 I;  4GKK I;  5LMN I;  1IBK E;  4LF4 E;  4GKK E;  2LJP A;  5LMN E;  4DV3 I;  5DRO A;  3ZZU A;  3QT8 A;  3CDI A;  4DPY A;  1OYR A;  4HYM A;  4NBQ A;  3JAM C;  4DXL A;  3ZM7 A;  4EMD A;  2HK2 A;  2OI2 A;  3LPS A;  1Z5C A;  1FJG I;  2F4V I;  1FJG E;  2F4V E;  3ZZ0 A;  4PRV A;  1XMQ I;  1S16 A;  4LF6 I;  1XMQ E;  1E3H A;  1R6M A;  2BV3 A;  4LF6 E;  4OO1 C;  3B82 A;  3L7Z B;  1HNX I;  1B62 A;  3U1K A;  1Z0G A;  1HNX E;  3D4J A;  1XXE A;  4JI2 I;  4OO1 E;  4JI2 E;  3LTO A;  4QNJ A;  2R3V A;  2JEA A;  2GS8 A;  2NN6 D;  2HHH I;  2HHH E;  4OO1 D;  1NHJ A;  3GLL A;  2AE8 A;  4JI8 I;  4FWG A;  4JI8 E;  4FW3 A;  4HXZ A;  4DR7 I;  1E3P A;  4DR7 E;  3V5R A;  3PRY A;  1HNZ I;  1MG7 A;  4MU4 A;  4DPW A;  4IFD B;  5LL6 R;  2HKJ A;  2R42 A;  1HNZ E;  1J5E I;  2PO0 B;  1HR0 I;  3ZZT A;  4Z7C A;  1J5E E;  1Z0W A;  1HR0 E;  4DPU A;  2IES A;  4LCF A;  4DPX A;  5K36 A;  5K36 B;  4USK A;  3HJC A;  1Y60 A;  5DNX A;  4XTJ A;  1XHK A;  3JAM Q;  1H7S A;  3Q1Q A;  2BA0 G;  3M85 G;  4OZE A;  4LPF A;  1XMO I;  4JI5 I;  4DV5 I;  1NHI A;  4HY1 A;  1XMO E;  4MYU A;  4JI5 E;  4DV5 E;  3K85 A;  1ELO A;  4KQV A;  4LOM A;  4LCH A;  4HAC A;  2AJ4 A;  4HAC B;  2E5L E;  4JI0 I;  1N0U A;  4IFD F;  4JI0 E;  1P42 A;  2O1U A;  2CGE A;  4DR3 I;  3UHM A;  4DV1 I;  4DR3 E;  2C38 B;  4FW7 A;  4DV1 E;  5K36 C;  4PU9 A;  3GME A;  3OTO I;  3QT7 A;  1ZM4 A;  3OTO E;  1WUU A;  1XNQ I;  5IT9 Q;  1XNQ E;  2BA0 D;  1OYS A;  2V34 A;  3M85 D;  3WU3 A;  2O3Z A;  4K0K I;  5K36 E;  4K0K E;  4DUZ I;  4DUZ E;  5GMD A;  1U2R A;  2NN6 A;  2A2D A;  2NN6 B;  2V2V A;  2HKE A;  1S4E A;  4OO1 B;  1USU A;  1Z0C A;  5K36 D;  2WP8 A;  4MU3 A;  2WP8 B;  3WU6 A;  2DEI A;  4R1F A;  4DV3 E;  1K47 A;  1HK7 A;  1KIJ A;  4ISA A;  4WUC A;  3V2U C;  3HKM A;  3GCM A;  2C39 A;  5BR8 I;  1VI7 A;  2C39 B;  2V2Q A;  5BR8 E;  1UEK A;  2ZBK B;  4P52 A;  5LMU I;  5DRR A;  4IZJ A;  4MQY A;  5LMU E;  3PS3 A;  4IZJ B;  4P7A A;  4Z7Y A;  4PRX A;  3K1J A;  2NN6 C;  1UDQ A;  2XEX A;  1B63 A;  3GON A;  3ZKD A;  2V2Z A;  3WU4 A;  4FW4 A;  2JE6 A;  2JE6 B;  4X66 I;  4BA2 A;  4LFB I;  4FWH A;  1N0V C;  4BA2 B;  4X66 E;  4LFB E;  1Y4S A;  2UUC I;  4DU7 A;  5FWK A;  4ED4 A;  4OO1 F;  2UUC E;  2NN6 E;  3B78 A;  5L3J A;  4KHP I;  2BR2 A;  2J7K A;  1PKP A;  4KHP E;  2BR2 B;  2PO1 A;  4FW5 A;  5IT9 C;  4AID A;  1USV A; 
#chains in the Genus database with same CATH homology
 4USM A;  4LF5 I;  4RPF A;  4LF5 E;  2DEJ A;  2UUB I;  2UUB E;  1Z0B A;  4YHH I;  4YHH E;  4JI6 I;  3ZKB A;  4JI6 E;  1NHH A;  4DR1 I;  5A2Q C;  4OX9 I;  4OX9 E;  1A6F A;  2UU9 I;  2UU9 E;  4UT4 A;  1FNM A;  4IZJ D;  1IBL I;  2EFG A;  1IBL E;  2CZ9 A;  2A2C A;  2HFS A;  1BKN A;  1FWK A;  3P06 A;  1Y6Z A;  4DV7 I;  4JV5 I;  4DV7 E;  5FLX C;  4JV5 E;  4M1K A;  4LF7 I;  3PYF A;  2E1R A;  4LF7 E;  2CG9 A;  4B3S I;  4B3S E;  4DPT A;  1EI1 A;  3HUL A;  1Z5B A;  2IOP A;  4URL A;  5IWA I;  4AQY I;  5IWA E;  4AQY E;  2UXB I;  2UXB E;  4B3R I;  1PIE A;  4B3R E;  4YY3 I;  4DV4 I;  4YY3 E;  4DV4 E;  4LF9 I;  4DUY I;  4LF9 E;  4DUY E;  4FWD A;  4DR2 I;  4DR2 E;  4DR4 I;  3PYE A;  4JG4 A;  4DU8 A;  4DR4 E;  3LNU A;  3Q6N A;  1FWL A;  4DV0 I;  1ZM3 A;  4DV0 E;  4X64 I;  1Z0V A;  4X64 E;  1XNR I;  5A2Q Q;  1XNR E;  4IZK A;  1RRE A;  1I94 I;  1I94 E;  4JI4 I;  4JI4 E;  5GME A;  4GKJ I;  4JI3 I;  4GKJ E;  4JI3 E;  3F0N A;  4LF8 I;  1D6T A;  1H7U A;  4LF8 E;  2Z5B A;  4JYA I;  3J81 C;  1IBM I;  2Z5B B;  4WUD A;  4JYA E;  1IBM E;  4WUB A;  3J80 C;  2ZM6 I;  5FLX Q;  1Z0E A;  2ZM6 E;  4UTG A;  1DAR A;  1H73 A;  1PVG A;  2O1W A;  1ZM9 A;  4JI7 I;  4JI7 E;  1ZXM A;  1RR9 A;  4LFA I;  2Z5E A;  2WW4 A;  4LFA E;  2PNM A;  2BM0 A;  1NZ0 A;  4DR5 I;  4DR5 E;  1QZR A;  1KVK A;  1ZXN A;  2BM1 A;  2UUA I;  1N32 I;  4DR1 E;  4I3H A;  2UUA E;  1N32 E;  4NXN I;  2GQ0 A;  4X62 I;  2Q2E B;  1KTV A;  4NXN E;  3B8H A;  1VIS A;  4X62 E;  3J7A M;  2PNL A;  4ZVI A;  4DV6 I;  2X36 A;  4DV2 I;  4DV6 E;  1ZM2 A;  4DV2 E;  2Z5C A;  4JI1 I;  2Z5C B;  2VQF I;  4JI1 E;  1MU5 A;  2VQF E;  1N33 I;  1N33 E;  1MX0 A;  4NXM I;  2VF3 A;  3H4L A;  4NXM E;  1Y4U A;  3K17 A;  4LFC I;  2NPF A;  2HFU A;  1H74 A;  4LFC E;  2O1V A;  1Z59 A;  1EA6 A;  3J7A G;  1N36 I;  4DR6 I;  2O1T A;  2V8P A;  1N36 E;  3T1H I;  4DR6 E;  3J81 Q;  3T1H E;  4MYT A;  3T1Y I;  3J80 Q;  1Z0T A;  3T1Y E;  3QT5 A;  2ZIT A;  1KKH A;  2IOQ A;  1FKA E;  3M6A A;  2E5L I;  4X65 I;  4X65 E;  2UXD I;  2UXD E;  1N34 I;  2VQE I;  1H72 C;  3WU5 A;  1N34 E;  2VQE E;  1OJ4 A;  2HK3 A;  4FW9 A;  4FN5 A;  2UXC I;  2UXC E;  1HNW I;  4IZK B;  1HNW E;  3QT6 A;  3PYG A;  4N3O A;  1FI4 A;  2X7I A;  3Q6M A;  1Z5A A;  3PYD A;  3CWV A;  4B3T I;  4B3T E;  4B3M I;  1IBK I;  4B3M E;  4LF4 I;  4GKK I;  5LMN I;  1IBK E;  4LF4 E;  4GKK E;  2LJP A;  5LMN E;  4DV3 I;  3ZZU A;  3QT8 A;  4DPY A;  4HYM A;  3JAM C;  4DXL A;  3ZM7 A;  4EMD A;  2HK2 A;  2OI2 A;  3LPS A;  1Z5C A;  1FJG I;  2F4V I;  1FJG E;  2F4V E;  3ZZ0 A;  4PRV A;  1XMQ I;  1S16 A;  4LF6 I;  1XMQ E;  2BV3 A;  4LF6 E;  3B82 A;  1HNX I;  1B62 A;  1Z0G A;  1HNX E;  3D4J A;  4JI2 I;  4JI2 E;  3LTO A;  2R3V A;  2GS8 A;  2HHH I;  2HHH E;  1NHJ A;  4JI8 I;  4FWG A;  4JI8 E;  4HXZ A;  4DR7 I;  4DR7 E;  3V5R A;  3PRY A;  1HNZ I;  1MG7 A;  4DPW A;  5LL6 R;  2HKJ A;  2R42 A;  1HNZ E;  1J5E I;  1HR0 I;  3ZZT A;  4Z7C A;  1J5E E;  1Z0W A;  1HR0 E;  4DPU A;  4DPX A;  4USK A;  3HJC A;  4XTJ A;  1XHK A;  3JAM Q;  1H7S A;  3Q1Q A;  1XMO I;  4JI5 I;  4DV5 I;  1NHI A;  4HY1 A;  1XMO E;  4MYU A;  4JI5 E;  4DV5 E;  3K85 A;  1ELO A;  4KQV A;  4HAC A;  2AJ4 A;  4HAC B;  2E5L E;  4JI0 I;  1N0U A;  4JI0 E;  2O1U A;  2CGE A;  4DR3 I;  4DV1 I;  4DR3 E;  4DV1 E;  4PU9 A;  3OTO I;  3QT7 A;  1ZM4 A;  3OTO E;  1WUU A;  1XNQ I;  5IT9 Q;  1XNQ E;  2V34 A;  4K0K I;  3WU3 A;  4K0K E;  4DUZ I;  4DUZ E;  5GMD A;  1U2R A;  2A2D A;  2V2V A;  2HKE A;  1S4E A;  1USU A;  1Z0C A;  3WU6 A;  2DEI A;  4R1F A;  4DV3 E;  1K47 A;  1HK7 A;  1KIJ A;  4WUC A;  3V2U C;  5BR8 I;  2V2Q A;  5BR8 E;  1UEK A;  2ZBK B;  4P52 A;  5LMU I;  4IZJ A;  5LMU E;  4IZJ B;  4P7A A;  4Z7Y A;  4PRX A;  3K1J A;  2XEX A;  1B63 A;  3GON A;  3ZKD A;  2V2Z A;  3WU4 A;  4X66 I;  4LFB I;  4FWH A;  1N0V C;  4X66 E;  4LFB E;  1Y4S A;  2UUC I;  4DU7 A;  5FWK A;  4ED4 A;  2UUC E;  3B78 A;  5L3J A;  4KHP I;  2J7K A;  1PKP A;  4KHP E;  5IT9 C;  1USV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...