3T1HI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1hI00
1D6TA 3T1HI 4UT4A 2UU9I 4DR6I 3T1YI 1KVKA 4X64E 1Z0TA 2V2VA 1WUUA 4JI0E 4OX9I 1N32E 4DR3E 5A2QQ 1PKPA 2UU9E 2VQEI 1N34E 4LF9I 3PYGA 4B3RI 3QT7A 1FJGE 4B3ME 3ZZ0A 4KHPE 4JI8E 4DV3I 5LMNE 2Q2EB 3ZZTA 2VQFI 3ZM7A 4DV1E 5IT9Q 2DEJA 4DR7I 2R42A 1HNWI 4LF4I 4DUYE 4NXME 1PIEA 3JAMQ 4GKJI 2E1RA 1IBKE 4B3MI 4URLA 3ZKBA 3B82A 4JYAI 1ZXNA 4DUZI 1PVGA 4LF8I 1KIJA 4JI7E 4K0KE 3J81Q 4LFBE 4DUYI 4LF4E 1A6FA 4HACA 2WW4A 4UTGA 2UUAI 2UUCI 2CZ9A 4XTJA 2BM0A 1N36E 4DR3I 4ZVIA 4X64I 4JI3I 2UXCI 4DV5E 1BKNA 4DXLA 3QT8A 3B8HA 5L3JA 2LJPA 2EFGA 2GS8A 3M6AA 1ZM2A 4LFCE 3B78A 1N34I 2XEXA 2UUBE 4Z7CA 1H7SA 1S4EA 4DV6I 2UXCE 4P7AA 4DPXA 4JI4E 1NZ0A 1Z0BA 4GKJE 1HNZE 3J7AG 1I94E 4DPYA 4USMA 1NHIA 2HKJA 4JV5I 4PRVA 1N0VC 2HHHE 1K47A 2V2QA 4DV2E 1IBMI 4YY3E 2NPFA 4DU8A 5GMEA 4NXNI 2ZITA 4DR5I 2UXDI 5IWAI 4YHHE 4LF7I 3ZZUA 4DV2I 2UUCE 4DPWA 4DR1I 4X66E 5LMNI 2HFUA 3F0NA 3V5RA 1MG7A 3QT5A 5BR8I 2X36A 4DR5E 1Z0EA 4JI6I 1RREA 1ZM9A 4WUBA 3LNUA 1ZM3A 4B3TE 1FNMA 4JI7I 4LF5I 4USKA 1HNZI 4HY1A 1IBLE 4PRXA 4MYUA 1QZRA 3PYFA 2VQEE 4MYTA 2F4VI 1N0UA 3V2UC 4B3SI 2HHHI 1Z5AA 4GKKI 4DV1I 4FW9A 1XNRE 1XMQI 4LFAE 4EMDA 2V8PA 1B63A 1HR0E 4PU9A 4DV5I 4LFBI 3PYDA 5LL6R 1NHJA 2UXBE 1H7UA 3K1JA 2ZM6E 4DPUA 1FI4A 1FWKA 5IWAE 4LF7E 4RPFA 4X62I 1H73A 4LF8E 1Z5BA 2A2CA 4WUDA 4X66I 2UUAE 2HFSA 3OTOI 4JI5E 4KQVA 1ELOA 4AQYI 4KHPI 4M1KA 4JI6E 2A2DA 4DPTA 4DV4E 4DR6E 1HNXE 1ZXMA 3PYEA 2DEIA 2UUBI 2UXDE 2R3VA 1KKHA 4DR2E 4DR7E 2ZBKB 4JI2I 1XNQI 4WUCA 3OTOE 2V34A 1XMQE 1KTVA 1XHKA 3WU3A 1I94I 4YHHI 4DV7I 4HYMA 1UEKA 4B3RE 1Z0WA 1MU5A 3LTOA 5A2QC 5IT9C 5BR8E 4HXZA 2BV3A 1N33E 1Z59A 4DV3E 1ZM4A 4DV7E 3WU5A 4X65I 1HNWE 1IBLI 4R1FA 4GKKE 1B62A 1EA6A 4DU7A 3LPSA 3T1YE 2F4VE 4JYAE 1XMOI 4DUZE 2AJ4A 3ZKDA 1FKAE 1MX0A 3J81C 3HULA 1OJ4A 4I3HA 2HKEA 4OX9E 1N32I 4FWHA 4B3TI 4JI8I 2BM1A 4LF9E 1N36I 2E5LE 1NHHA 4JI2E 4X62E 4DR4E 1J5EE 2UXBI 1Z5CA 1H72C 3K17A 2ZM6I 1IBKI 4YY3I 4LF6E 2HK3A 3T1HE 3CWVA 1S16A 5GMDA 3WU4A 4DV4I 4JI4I 3JAMC 1H74A 2OI2A 3J7AM 1XNRI 2X7IA 4LFAI 4JI1I 5FLXQ 1RR9A 1HR0I 1XMOE 3J80Q 3Q1QA 2VQFE 4Z7YA 1XNQE 1DARA 1FJGI 5LMUE 4LF5E 1FWLA 2J7KA 4JI1E 4FWDA 4P52A 4DV0E 4LFCI 4JI3E 4JI5I 2E5LI 1Z0CA 4B3SE 5LMUI 4K0KI 4DR1E 4LF6I 1EI1A 4JI0I 1VISA 4DV6E 5FLXC 4X65E 4DR4I 1Z0GA 1HNXI 2HK2A 1J5EI 4FWGA 4FN5A 3J80C 4DR2I 3GONA 3H4LA 1IBME 4NXMI 4JG4A 4HACB 1U2RA 4JV5E 2V2ZA 2VF3A 3D4JA 3WU6A 3QT6A 4NXNE 1Z0VA 1N33I 4DV0I 4ED4A 4AQYE
chains in the Genus database with same CATH superfamily
1D6TA 5DRQA 3T1HI 2CG9A 4UT4A 3P3GA 2UU9I 4DR6I 5JEAE 3T1YI 2O1VA 2BA0G 1KVKA 4IZKB 4X64E 3L7ZA 1Z0TA 3P3EA 2JEAA 2V2VA 5C0XC 1WUUA 2PO0A 3P06A 4JI0E 4GQUA 4OX9I 1N32E 4DR3E 5A2QQ 1PKPA 2UU9E 2IOQA 2VQEI 5C0XE 1N34E 4LF9I 3PYGA 4B3RI 2O1UA 3QT7A 2IOPA 4IFDE 1FJGE 2O1WA 2CVEA 1E3HA 4B3ME 3ZZ0A 4KHPE 4JI8E 5DNLA 4DV3I 5LMNE 2Q2EB 3ZZTA 2VQFI 2O1TA 2Z5BA 1Y5YA 3ZM7A 5DNXA 4QNJA 4DV1E 5IT9Q 2DEJA 4DR7I 2R42A 1HNWI 4DUYE 4LF4I 4NXME 1Y4UA 1PIEA 3JAMQ 4GKJI 2E1RA 1IBKE 2J65A 3UHMA 4B3MI 4URLA 5C0XD 3ZKBA 3HJCA 3B82A 2Z5CB 4JYAI 4FW5A 1ZXNA 4BA1B 4DUZI 1PVGA 4LF8I 1KIJA 4JI7E 4K0KE 3J81Q 4U3BA 3DD6A 4LFBE 4DUYI 4LF4E 5K36F 1A6FA 4HACA 2WW4A 4U3DA 4UTGA 2PO1A 4FW6A 2UUAI 2UUCI 2CZ9A 4XTJA 4BA2B 2BM0A 4OO1D 1N36E 4DR3I 4ZVIA 4X64I 3L7ZB 4LCFA 4JI3I 2UXCI 1UDNA 5K36A 4OO1C 2BR2B 4DV5E 1BKNA 4DXLA 3QT8A 1VI7A 1YH8A 3B8HA 5L3JA 3KRNA 2LJPA 3U1YA 2EFGA 4IFDF 2GS8A 3M6AA 1ZM2A 4LFCE 3B78A 1N34I 2XEXA 2UUBE 4Z7CA 1H7SA 1S4EA 2NN6B 4DV6I 2UXCE 3M7ND 4P7AA 4DPXA 3CDJA 4JI4E 2C38B 1NZ0A 4OO1F 1Z0BA 2NN6A 5K36B 4GKJE 1HNZE 3J7AG 1I94E 5K36C 4DPYA 4USMA 3P76A 1NHIA 2HKJA 4JV5I 4PRVA 1N0VC 4QNKA 2HHHE 1K47A 3PS1A 2V2QA 4DV2E 1OYRA 2JE6A 1IBMI 4YY3E 2NPFA 4AIMA 4DU8A 3K85A 3M85D 5GMEA 4NXNI 3PS3A 3PS2A 5JEAD 2ZITA 4DR5I 2UXDI 2NN6D 2WP8A 5IWAI 4YHHE 4LF7I 3ZZUA 2JEAB 4DV2I 2UUCE 4DPWA 4DR1I 5DRPA 4X66E 5LMNI 2HFUA 3F0NA 3V5RA 1MG7A 3QT5A 5BR8I 2X36A 4DR5E 5JEAB 1Z0EA 2Z5EA 4JI6I 3GMEA 4MQYA 1RREA 1ZM9A 2C39B 4WUBA 1OYSA 3LNUA 3U1KA 1ZM3A 4IZJA 4B3TE 1FNMA 4JI7I 4LF5I 5FWKA 4N3OA 4USKA 1HNZI 3M7NG 4HY1A 1IBLE 4PRXA 4MYUA 4OKGA 4IS9A 2WNRB 1QZRA 2PO2B 4IZJD 3PYFA 2JEBB 2VQEE 2JE6B 4MYTA 4IFDD 2F4VI 1N0UA 3V2UC 4BA2A 2PNMA 2WNRA 4B3SI 2HHHI 1Z5AA 4GKKI 4DV1I 4FW9A 1XNRE 1XMQI 4LFAE 4EMDA 2GQ0A 3HKMA 5C0XA 4FW4A 4MU3A 2V8PA 1B63A 4LCHA 4PU9A 1HR0E 4BA1A 4DV5I 4MU4A 4IZKA 4LFBI 3PYDA 5LL6R 1XXEA 1NHJA 2NN6F 1H7UA 2UXBE 2C39A 3K1JA 2ZM6E 4DPUA 1FI4A 1FWKA 3P3CA 5IWAE 5JEAA 4LF7E 4RPFA 4X62I 4OO1B 1H73A 3GLLA 4LF8E 1Z5BA 2WP8B 2A2CA 3PRYA 4WUDA 4X66I 2UUAE 2HFSA 3OTOI 4JI5E 1P42A 4KQVA 1ELOA 2GO3A 4AQYI 4KHPI 4M1KA 4JI6E 2A2DA 4DPTA 4DV4E 4DR6E 1HNXE 1ZXMA 3PYEA 2DEIA 2UUBI 3Q6NA 2UXDE 2R3VA 1KKHA 4DR2E 4DR7E 2IESA 2ZBKB 2BA0D 1YHCA 2PNLA 4JI2I 4MDTA 2F1DA 1XNQI 4WUCA 3OTOE 2V34A 1XMQE 1KTVA 1XHKA 4FW7A 3WU3A 1OYPA 1RHYA 1I94I 4YHHI 4DV7I 4HYMA 1UEKA 2JT2A 4B3RE 1Z0WA 1MU5A 4IZJB 3LTOA 5A2QC 5JEAF 5EL9A 4LOMA 2Z5BB 5IT9C 5BR8E 4HXZA 4AM3A 2BV3A 1N33E 1Z59A 4DV3E 1ZM4A 2BR2A 4DV7E 3WU5A 2CGEA 4X65I 1HNWE 1IBLI 4R1FA 4GKKE 1B62A 1EA6A 3CDIA 5K36D 4DU7A 3LPSA 3T1YE 2PNZB 2F4VE 2NN6C 4JYAE 1XMOI 2Z5CA 4DUZE 2AJ4A 3ZKDA 1FKAE 1MX0A 3J81C 3HULA 3NZKA 1OJ4A 4I3HA 2HKEA 4MU1A 4OX9E 1N32I 4FWHA 4B3TI 5EKWA 4JI8I 1HK7A 2BM1A 1UDQA 4LF9E 1N36I 2E5LE 1NHHA 2C37A 4JI2E 4X62E 4DR4E 4IFDC 1J5EE 2UXBI 1Z5CA 3GCMA 1H72C 3K17A 2ZM6I 1IBKI 4YY3I 4LF6E 2HK3A 3T1HE 5DRRA 1Y6ZA 3CWVA 1S16A 5GMDA 2AE8A 5K36E 1E3PA 4ISAA 3WU4A 4DV4I 4JI4I 4LCGA 2O3ZA 2IERA 3JAMC 1H74A 1Y4SA 2OI2A 3J7AM 2PNZA 1XNRI 2X7IA 4LFAI 2GO4A 4JI1I 5FLXQ 1RR9A 2PO1B 1USVA 1HR0I 1XMOE 1R6LA 3J80Q 3Q1QA 2VQFE 4Z7YA 1XNQE 5C0XF 5JEAC 1DARA 1FJGI 5LMUE 2BA1D 4LF5E 1FWLA 2J7KA 4JI1E 4FWDA 4P52A 1R6MA 4DV0E 2NN6E 4AIDA 4LFCI 4OO1A 4JI3E 4JI5I 4J3DA 2E5LI 5ELWA 4OO1E 1Z0CA 4B3SE 1UDSA 5LMUI 4NBQA 4K0KI 5C0XB 4DR1E 2BA1G 4LF6I 1EI1A 1USUA 4JI0I 1VISA 4OZEA 4DV6E 5FLXC 4X65E 4DR4I 1Z0GA 1HNXI 2HK2A 1J5EI 2VESA 4FWGA 5DROA 4FN5A 2JEBA 3J80C 1Y60A 4DR2I 3GONA 3H1CA 2PO2A 3H4LA 3Q6MA 1IBME 4NXMI 4JG4A 4HACB 1U2RA 4JV5E 2V2ZA 2PO0B 3B4TA 4IFDB 3M85G 2C38A 2VF3A 3D4JA 1UDOA 3WU6A 3QT6A 2C37B 4LPFA 4MU0A 4NXNE 1Z0VA 4IFDA 4FW3A 1N33I 4DV0I 4ED4A 4AQYE
chains in the Genus database with same CATH topology
1D6TA 3T1HI 2CG9A 4UT4A 2UU9I 4DR6I 3T1YI 2O1VA 1KVKA 4IZKB 4X64E 1Z0TA 2V2VA 1WUUA 3P06A 4JI0E 4OX9I 1N32E 4DR3E 5A2QQ 1PKPA 2UU9E 2IOQA 2VQEI 1N34E 4LF9I 3PYGA 4B3RI 2O1UA 3QT7A 2IOPA 1FJGE 2O1WA 4B3ME 3ZZ0A 4KHPE 4JI8E 4DV3I 5LMNE 2Q2EB 3ZZTA 2VQFI 2O1TA 2Z5BA 3ZM7A 4DV1E 5IT9Q 2DEJA 4DR7I 2R42A 1HNWI 4DUYE 4LF4I 4NXME 1Y4UA 1PIEA 3JAMQ 4GKJI 2E1RA 1IBKE 4B3MI 4URLA 3ZKBA 3HJCA 3B82A 2Z5CB 4JYAI 1ZXNA 4DUZI 1PVGA 4LF8I 1KIJA 4JI7E 4K0KE 3J81Q 4LFBE 4DUYI 4LF4E 1A6FA 4HACA 2WW4A 4UTGA 2UUAI 2UUCI 2CZ9A 4XTJA 2BM0A 1N36E 4DR3I 4ZVIA 4X64I 4JI3I 2UXCI 4DV5E 1BKNA 4DXLA 3QT8A 3B8HA 5L3JA 2LJPA 2EFGA 2GS8A 3M6AA 1ZM2A 4LFCE 3B78A 1N34I 2XEXA 2UUBE 4Z7CA 1H7SA 1S4EA 4DV6I 2UXCE 4P7AA 4DPXA 4JI4E 1NZ0A 1Z0BA 4GKJE 1HNZE 3J7AG 1I94E 4DPYA 4USMA 1NHIA 2HKJA 4JV5I 4PRVA 1N0VC 2HHHE 1K47A 2V2QA 4DV2E 1IBMI 4YY3E 2NPFA 4DU8A 3K85A 5GMEA 4NXNI 2ZITA 4DR5I 2UXDI 5IWAI 4YHHE 4LF7I 3ZZUA 4DV2I 2UUCE 4DPWA 4DR1I 4X66E 5LMNI 2HFUA 3F0NA 3V5RA 1MG7A 3QT5A 5BR8I 2X36A 4DR5E 1Z0EA 2Z5EA 4JI6I 1RREA 1ZM9A 4WUBA 3LNUA 1ZM3A 4IZJA 4B3TE 1FNMA 4JI7I 4LF5I 5FWKA 4N3OA 4USKA 1HNZI 4HY1A 1IBLE 4PRXA 4MYUA 1QZRA 4IZJD 3PYFA 2VQEE 4MYTA 2F4VI 1N0UA 3V2UC 2PNMA 4B3SI 2HHHI 1Z5AA 4GKKI 4DV1I 4FW9A 1XNRE 1XMQI 4LFAE 4EMDA 2GQ0A 2V8PA 1B63A 1HR0E 4PU9A 4DV5I 4IZKA 4LFBI 3PYDA 5LL6R 1NHJA 2UXBE 1H7UA 3K1JA 2ZM6E 4DPUA 1FI4A 1FWKA 5IWAE 4LF7E 4RPFA 4X62I 1H73A 4LF8E 1Z5BA 2A2CA 3PRYA 4WUDA 4X66I 2UUAE 2HFSA 3OTOI 4JI5E 4KQVA 1ELOA 4AQYI 4KHPI 4M1KA 4JI6E 2A2DA 4DPTA 4DV4E 4DR6E 1HNXE 1ZXMA 3PYEA 2DEIA 2UUBI 3Q6NA 2UXDE 2R3VA 1KKHA 4DR2E 4DR7E 2ZBKB 2PNLA 4JI2I 1XNQI 4WUCA 3OTOE 2V34A 1XMQE 1KTVA 1XHKA 3WU3A 1I94I 4YHHI 4DV7I 4HYMA 1UEKA 4B3RE 1Z0WA 1MU5A 4IZJB 3LTOA 5A2QC 2Z5BB 5IT9C 5BR8E 4HXZA 2BV3A 1N33E 1Z59A 4DV3E 1ZM4A 4DV7E 3WU5A 2CGEA 4X65I 1HNWE 1IBLI 4R1FA 4GKKE 1B62A 1EA6A 4DU7A 3LPSA 3T1YE 2F4VE 4JYAE 1XMOI 2Z5CA 4DUZE 2AJ4A 3ZKDA 1FKAE 1MX0A 3J81C 3HULA 1OJ4A 4I3HA 2HKEA 4OX9E 1N32I 4FWHA 4B3TI 4JI8I 1HK7A 2BM1A 4LF9E 1N36I 2E5LE 1NHHA 4JI2E 4X62E 4DR4E 1J5EE 2UXBI 1Z5CA 1H72C 3K17A 2ZM6I 1IBKI 4YY3I 4LF6E 2HK3A 3T1HE 1Y6ZA 3CWVA 1S16A 5GMDA 3WU4A 4DV4I 4JI4I 3JAMC 1H74A 1Y4SA 2OI2A 3J7AM 1XNRI 2X7IA 4LFAI 4JI1I 5FLXQ 1RR9A 1USVA 1HR0I 1XMOE 3J80Q 3Q1QA 2VQFE 4Z7YA 1XNQE 1DARA 1FJGI 5LMUE 4LF5E 1FWLA 2J7KA 4JI1E 4FWDA 4P52A 4DV0E 4LFCI 4JI3E 4JI5I 2E5LI 1Z0CA 4B3SE 5LMUI 4K0KI 4DR1E 4LF6I 1EI1A 1USUA 4JI0I 1VISA 4DV6E 5FLXC 4X65E 4DR4I 1Z0GA 1HNXI 2HK2A 1J5EI 4FWGA 4FN5A 3J80C 4DR2I 3GONA 3H4LA 3Q6MA 1IBME 4NXMI 4JG4A 4HACB 1U2RA 4JV5E 2V2ZA 2VF3A 3D4JA 3WU6A 3QT6A 4NXNE 1Z0VA 1N33I 4DV0I 4ED4A 4AQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6T A;  3T1H I;  4UT4 A;  2UU9 I;  4DR6 I;  3T1Y I;  1KVK A;  4X64 E;  1Z0T A;  2V2V A;  1WUU A;  4JI0 E;  4OX9 I;  1N32 E;  4DR3 E;  5A2Q Q;  1PKP A;  2UU9 E;  2VQE I;  1N34 E;  4LF9 I;  3PYG A;  4B3R I;  3QT7 A;  1FJG E;  4B3M E;  3ZZ0 A;  4KHP E;  4JI8 E;  4DV3 I;  5LMN E;  2Q2E B;  3ZZT A;  2VQF I;  3ZM7 A;  4DV1 E;  5IT9 Q;  2DEJ A;  4DR7 I;  2R42 A;  1HNW I;  4LF4 I;  4DUY E;  4NXM E;  1PIE A;  3JAM Q;  4GKJ I;  2E1R A;  1IBK E;  4B3M I;  4URL A;  3ZKB A;  3B82 A;  4JYA I;  1ZXN A;  4DUZ I;  1PVG A;  4LF8 I;  1KIJ A;  4JI7 E;  4K0K E;  3J81 Q;  4LFB E;  4DUY I;  4LF4 E;  1A6F A;  4HAC A;  2WW4 A;  4UTG A;  2UUA I;  2UUC I;  2CZ9 A;  4XTJ A;  2BM0 A;  1N36 E;  4DR3 I;  4ZVI A;  4X64 I;  4JI3 I;  2UXC I;  4DV5 E;  1BKN A;  4DXL A;  3QT8 A;  3B8H A;  5L3J A;  2LJP A;  2EFG A;  2GS8 A;  3M6A A;  1ZM2 A;  4LFC E;  3B78 A;  1N34 I;  2XEX A;  2UUB E;  4Z7C A;  1H7S A;  1S4E A;  4DV6 I;  2UXC E;  4P7A A;  4DPX A;  4JI4 E;  1NZ0 A;  1Z0B A;  4GKJ E;  1HNZ E;  3J7A G;  1I94 E;  4DPY A;  4USM A;  1NHI A;  2HKJ A;  4JV5 I;  4PRV A;  1N0V C;  2HHH E;  1K47 A;  2V2Q A;  4DV2 E;  1IBM I;  4YY3 E;  2NPF A;  4DU8 A;  5GME A;  4NXN I;  2ZIT A;  4DR5 I;  2UXD I;  5IWA I;  4YHH E;  4LF7 I;  3ZZU A;  4DV2 I;  2UUC E;  4DPW A;  4DR1 I;  4X66 E;  5LMN I;  2HFU A;  3F0N A;  3V5R A;  1MG7 A;  3QT5 A;  5BR8 I;  2X36 A;  4DR5 E;  1Z0E A;  4JI6 I;  1RRE A;  1ZM9 A;  4WUB A;  3LNU A;  1ZM3 A;  4B3T E;  1FNM A;  4JI7 I;  4LF5 I;  4USK A;  1HNZ I;  4HY1 A;  1IBL E;  4PRX A;  4MYU A;  1QZR A;  3PYF A;  2VQE E;  4MYT A;  2F4V I;  1N0U A;  3V2U C;  4B3S I;  2HHH I;  1Z5A A;  4GKK I;  4DV1 I;  4FW9 A;  1XNR E;  1XMQ I;  4LFA E;  4EMD A;  2V8P A;  1B63 A;  1HR0 E;  4PU9 A;  4DV5 I;  4LFB I;  3PYD A;  5LL6 R;  1NHJ A;  2UXB E;  1H7U A;  3K1J A;  2ZM6 E;  4DPU A;  1FI4 A;  1FWK A;  5IWA E;  4LF7 E;  4RPF A;  4X62 I;  1H73 A;  4LF8 E;  1Z5B A;  2A2C A;  4WUD A;  4X66 I;  2UUA E;  2HFS A;  3OTO I;  4JI5 E;  4KQV A;  1ELO A;  4AQY I;  4KHP I;  4M1K A;  4JI6 E;  2A2D A;  4DPT A;  4DV4 E;  4DR6 E;  1HNX E;  1ZXM A;  3PYE A;  2DEI A;  2UUB I;  2UXD E;  2R3V A;  1KKH A;  4DR2 E;  4DR7 E;  2ZBK B;  4JI2 I;  1XNQ I;  4WUC A;  3OTO E;  2V34 A;  1XMQ E;  1KTV A;  1XHK A;  3WU3 A;  1I94 I;  4YHH I;  4DV7 I;  4HYM A;  1UEK A;  4B3R E;  1Z0W A;  1MU5 A;  3LTO A;  5A2Q C;  5IT9 C;  5BR8 E;  4HXZ A;  2BV3 A;  1N33 E;  1Z59 A;  4DV3 E;  1ZM4 A;  4DV7 E;  3WU5 A;  4X65 I;  1HNW E;  1IBL I;  4R1F A;  4GKK E;  1B62 A;  1EA6 A;  4DU7 A;  3LPS A;  3T1Y E;  2F4V E;  4JYA E;  1XMO I;  4DUZ E;  2AJ4 A;  3ZKD A;  1FKA E;  1MX0 A;  3J81 C;  3HUL A;  1OJ4 A;  4I3H A;  2HKE A;  4OX9 E;  1N32 I;  4FWH A;  4B3T I;  4JI8 I;  2BM1 A;  4LF9 E;  1N36 I;  2E5L E;  1NHH A;  4JI2 E;  4X62 E;  4DR4 E;  1J5E E;  2UXB I;  1Z5C A;  1H72 C;  3K17 A;  2ZM6 I;  1IBK I;  4YY3 I;  4LF6 E;  2HK3 A;  3T1H E;  3CWV A;  1S16 A;  5GMD A;  3WU4 A;  4DV4 I;  4JI4 I;  3JAM C;  1H74 A;  2OI2 A;  3J7A M;  1XNR I;  2X7I A;  4LFA I;  4JI1 I;  5FLX Q;  1RR9 A;  1HR0 I;  1XMO E;  3J80 Q;  3Q1Q A;  2VQF E;  4Z7Y A;  1XNQ E;  1DAR A;  1FJG I;  5LMU E;  4LF5 E;  1FWL A;  2J7K A;  4JI1 E;  4FWD A;  4P52 A;  4DV0 E;  4LFC I;  4JI3 E;  4JI5 I;  2E5L I;  1Z0C A;  4B3S E;  5LMU I;  4K0K I;  4DR1 E;  4LF6 I;  1EI1 A;  4JI0 I;  1VIS A;  4DV6 E;  5FLX C;  4X65 E;  4DR4 I;  1Z0G A;  1HNX I;  2HK2 A;  1J5E I;  4FWG A;  4FN5 A;  3J80 C;  4DR2 I;  3GON A;  3H4L A;  1IBM E;  4NXM I;  4JG4 A;  4HAC B;  1U2R A;  4JV5 E;  2V2Z A;  2VF3 A;  3D4J A;  3WU6 A;  3QT6 A;  4NXN E;  1Z0V A;  1N33 I;  4DV0 I;  4ED4 A;  4AQY E; 
#chains in the Genus database with same CATH topology
 1D6T A;  5DRQ A;  3T1H I;  2CG9 A;  4UT4 A;  3P3G A;  2UU9 I;  4DR6 I;  5JEA E;  3T1Y I;  2O1V A;  2BA0 G;  1KVK A;  4IZK B;  4X64 E;  3L7Z A;  1Z0T A;  3P3E A;  2JEA A;  2V2V A;  5C0X C;  1WUU A;  2PO0 A;  3P06 A;  4JI0 E;  4GQU A;  4OX9 I;  1N32 E;  4DR3 E;  5A2Q Q;  1PKP A;  2UU9 E;  2IOQ A;  2VQE I;  5C0X E;  1N34 E;  4LF9 I;  3PYG A;  4B3R I;  2O1U A;  3QT7 A;  2IOP A;  4IFD E;  1FJG E;  2O1W A;  2CVE A;  1E3H A;  4B3M E;  3ZZ0 A;  4KHP E;  4JI8 E;  5DNL A;  4DV3 I;  5LMN E;  2Q2E B;  3ZZT A;  2VQF I;  2O1T A;  2Z5B A;  1Y5Y A;  3ZM7 A;  5DNX A;  4QNJ A;  4DV1 E;  5IT9 Q;  2DEJ A;  4DR7 I;  2R42 A;  1HNW I;  4DUY E;  4LF4 I;  4NXM E;  1Y4U A;  1PIE A;  3JAM Q;  4GKJ I;  2E1R A;  1IBK E;  2J65 A;  3UHM A;  4B3M I;  4URL A;  5C0X D;  3ZKB A;  3HJC A;  3B82 A;  2Z5C B;  4JYA I;  4FW5 A;  1ZXN A;  4BA1 B;  4DUZ I;  1PVG A;  4LF8 I;  1KIJ A;  4JI7 E;  4K0K E;  3J81 Q;  4U3B A;  3DD6 A;  4LFB E;  4DUY I;  4LF4 E;  5K36 F;  1A6F A;  4HAC A;  2WW4 A;  4U3D A;  4UTG A;  2PO1 A;  4FW6 A;  2UUA I;  2UUC I;  2CZ9 A;  4XTJ A;  4BA2 B;  2BM0 A;  4OO1 D;  1N36 E;  4DR3 I;  4ZVI A;  4X64 I;  3L7Z B;  4LCF A;  4JI3 I;  2UXC I;  1UDN A;  5K36 A;  4OO1 C;  2BR2 B;  4DV5 E;  1BKN A;  4DXL A;  3QT8 A;  1VI7 A;  1YH8 A;  3B8H A;  5L3J A;  3KRN A;  2LJP A;  3U1Y A;  2EFG A;  4IFD F;  2GS8 A;  3M6A A;  1ZM2 A;  4LFC E;  3B78 A;  1N34 I;  2XEX A;  2UUB E;  4Z7C A;  1H7S A;  1S4E A;  2NN6 B;  4DV6 I;  2UXC E;  3M7N D;  4P7A A;  4DPX A;  3CDJ A;  4JI4 E;  2C38 B;  1NZ0 A;  4OO1 F;  1Z0B A;  2NN6 A;  5K36 B;  4GKJ E;  1HNZ E;  3J7A G;  1I94 E;  5K36 C;  4DPY A;  4USM A;  3P76 A;  1NHI A;  2HKJ A;  4JV5 I;  4PRV A;  1N0V C;  4QNK A;  2HHH E;  1K47 A;  3PS1 A;  2V2Q A;  4DV2 E;  1OYR A;  2JE6 A;  1IBM I;  4YY3 E;  2NPF A;  4AIM A;  4DU8 A;  3K85 A;  3M85 D;  5GME A;  4NXN I;  3PS3 A;  3PS2 A;  5JEA D;  2ZIT A;  4DR5 I;  2UXD I;  2NN6 D;  2WP8 A;  5IWA I;  4YHH E;  4LF7 I;  3ZZU A;  2JEA B;  4DV2 I;  2UUC E;  4DPW A;  4DR1 I;  5DRP A;  4X66 E;  5LMN I;  2HFU A;  3F0N A;  3V5R A;  1MG7 A;  3QT5 A;  5BR8 I;  2X36 A;  4DR5 E;  5JEA B;  1Z0E A;  2Z5E A;  4JI6 I;  3GME A;  4MQY A;  1RRE A;  1ZM9 A;  2C39 B;  4WUB A;  1OYS A;  3LNU A;  3U1K A;  1ZM3 A;  4IZJ A;  4B3T E;  1FNM A;  4JI7 I;  4LF5 I;  5FWK A;  4N3O A;  4USK A;  1HNZ I;  3M7N G;  4HY1 A;  1IBL E;  4PRX A;  4MYU A;  4OKG A;  4IS9 A;  2WNR B;  1QZR A;  2PO2 B;  4IZJ D;  3PYF A;  2JEB B;  2VQE E;  2JE6 B;  4MYT A;  4IFD D;  2F4V I;  1N0U A;  3V2U C;  4BA2 A;  2PNM A;  2WNR A;  4B3S I;  2HHH I;  1Z5A A;  4GKK I;  4DV1 I;  4FW9 A;  1XNR E;  1XMQ I;  4LFA E;  4EMD A;  2GQ0 A;  3HKM A;  5C0X A;  4FW4 A;  4MU3 A;  2V8P A;  1B63 A;  4LCH A;  4PU9 A;  1HR0 E;  4BA1 A;  4DV5 I;  4MU4 A;  4IZK A;  4LFB I;  3PYD A;  5LL6 R;  1XXE A;  1NHJ A;  2NN6 F;  1H7U A;  2UXB E;  2C39 A;  3K1J A;  2ZM6 E;  4DPU A;  1FI4 A;  1FWK A;  3P3C A;  5IWA E;  5JEA A;  4LF7 E;  4RPF A;  4X62 I;  4OO1 B;  1H73 A;  3GLL A;  4LF8 E;  1Z5B A;  2WP8 B;  2A2C A;  3PRY A;  4WUD A;  4X66 I;  2UUA E;  2HFS A;  3OTO I;  4JI5 E;  1P42 A;  4KQV A;  1ELO A;  2GO3 A;  4AQY I;  4KHP I;  4M1K A;  4JI6 E;  2A2D A;  4DPT A;  4DV4 E;  4DR6 E;  1HNX E;  1ZXM A;  3PYE A;  2DEI A;  2UUB I;  3Q6N A;  2UXD E;  2R3V A;  1KKH A;  4DR2 E;  4DR7 E;  2IES A;  2ZBK B;  2BA0 D;  1YHC A;  2PNL A;  4JI2 I;  4MDT A;  2F1D A;  1XNQ I;  4WUC A;  3OTO E;  2V34 A;  1XMQ E;  1KTV A;  1XHK A;  4FW7 A;  3WU3 A;  1OYP A;  1RHY A;  1I94 I;  4YHH I;  4DV7 I;  4HYM A;  1UEK A;  2JT2 A;  4B3R E;  1Z0W A;  1MU5 A;  4IZJ B;  3LTO A;  5A2Q C;  5JEA F;  5EL9 A;  4LOM A;  2Z5B B;  5IT9 C;  5BR8 E;  4HXZ A;  4AM3 A;  2BV3 A;  1N33 E;  1Z59 A;  4DV3 E;  1ZM4 A;  2BR2 A;  4DV7 E;  3WU5 A;  2CGE A;  4X65 I;  1HNW E;  1IBL I;  4R1F A;  4GKK E;  1B62 A;  1EA6 A;  3CDI A;  5K36 D;  4DU7 A;  3LPS A;  3T1Y E;  2PNZ B;  2F4V E;  2NN6 C;  4JYA E;  1XMO I;  2Z5C A;  4DUZ E;  2AJ4 A;  3ZKD A;  1FKA E;  1MX0 A;  3J81 C;  3HUL A;  3NZK A;  1OJ4 A;  4I3H A;  2HKE A;  4MU1 A;  4OX9 E;  1N32 I;  4FWH A;  4B3T I;  5EKW A;  4JI8 I;  1HK7 A;  2BM1 A;  1UDQ A;  4LF9 E;  1N36 I;  2E5L E;  1NHH A;  2C37 A;  4JI2 E;  4X62 E;  4DR4 E;  4IFD C;  1J5E E;  2UXB I;  1Z5C A;  3GCM A;  1H72 C;  3K17 A;  2ZM6 I;  1IBK I;  4YY3 I;  4LF6 E;  2HK3 A;  3T1H E;  5DRR A;  1Y6Z A;  3CWV A;  1S16 A;  5GMD A;  2AE8 A;  5K36 E;  1E3P A;  4ISA A;  3WU4 A;  4DV4 I;  4JI4 I;  4LCG A;  2O3Z A;  2IER A;  3JAM C;  1H74 A;  1Y4S A;  2OI2 A;  3J7A M;  2PNZ A;  1XNR I;  2X7I A;  4LFA I;  2GO4 A;  4JI1 I;  5FLX Q;  1RR9 A;  2PO1 B;  1USV A;  1HR0 I;  1XMO E;  1R6L A;  3J80 Q;  3Q1Q A;  2VQF E;  4Z7Y A;  1XNQ E;  5C0X F;  5JEA C;  1DAR A;  1FJG I;  5LMU E;  2BA1 D;  4LF5 E;  1FWL A;  2J7K A;  4JI1 E;  4FWD A;  4P52 A;  1R6M A;  4DV0 E;  2NN6 E;  4AID A;  4LFC I;  4OO1 A;  4JI3 E;  4JI5 I;  4J3D A;  2E5L I;  5ELW A;  4OO1 E;  1Z0C A;  4B3S E;  1UDS A;  5LMU I;  4NBQ A;  4K0K I;  5C0X B;  4DR1 E;  2BA1 G;  4LF6 I;  1EI1 A;  1USU A;  4JI0 I;  1VIS A;  4OZE A;  4DV6 E;  5FLX C;  4X65 E;  4DR4 I;  1Z0G A;  1HNX I;  2HK2 A;  1J5E I;  2VES A;  4FWG A;  5DRO A;  4FN5 A;  2JEB A;  3J80 C;  1Y60 A;  4DR2 I;  3GON A;  3H1C A;  2PO2 A;  3H4L A;  3Q6M A;  1IBM E;  4NXM I;  4JG4 A;  4HAC B;  1U2R A;  4JV5 E;  2V2Z A;  2PO0 B;  3B4T A;  4IFD B;  3M85 G;  2C38 A;  2VF3 A;  3D4J A;  1UDO A;  3WU6 A;  3QT6 A;  2C37 B;  4LPF A;  4MU0 A;  4NXN E;  1Z0V A;  4IFD A;  4FW3 A;  1N33 I;  4DV0 I;  4ED4 A;  4AQY E; 
#chains in the Genus database with same CATH homology
 1D6T A;  3T1H I;  2CG9 A;  4UT4 A;  2UU9 I;  4DR6 I;  3T1Y I;  2O1V A;  1KVK A;  4IZK B;  4X64 E;  1Z0T A;  2V2V A;  1WUU A;  3P06 A;  4JI0 E;  4OX9 I;  1N32 E;  4DR3 E;  5A2Q Q;  1PKP A;  2UU9 E;  2IOQ A;  2VQE I;  1N34 E;  4LF9 I;  3PYG A;  4B3R I;  2O1U A;  3QT7 A;  2IOP A;  1FJG E;  2O1W A;  4B3M E;  3ZZ0 A;  4KHP E;  4JI8 E;  4DV3 I;  5LMN E;  2Q2E B;  3ZZT A;  2VQF I;  2O1T A;  2Z5B A;  3ZM7 A;  4DV1 E;  5IT9 Q;  2DEJ A;  4DR7 I;  2R42 A;  1HNW I;  4DUY E;  4LF4 I;  4NXM E;  1Y4U A;  1PIE A;  3JAM Q;  4GKJ I;  2E1R A;  1IBK E;  4B3M I;  4URL A;  3ZKB A;  3HJC A;  3B82 A;  2Z5C B;  4JYA I;  1ZXN A;  4DUZ I;  1PVG A;  4LF8 I;  1KIJ A;  4JI7 E;  4K0K E;  3J81 Q;  4LFB E;  4DUY I;  4LF4 E;  1A6F A;  4HAC A;  2WW4 A;  4UTG A;  2UUA I;  2UUC I;  2CZ9 A;  4XTJ A;  2BM0 A;  1N36 E;  4DR3 I;  4ZVI A;  4X64 I;  4JI3 I;  2UXC I;  4DV5 E;  1BKN A;  4DXL A;  3QT8 A;  3B8H A;  5L3J A;  2LJP A;  2EFG A;  2GS8 A;  3M6A A;  1ZM2 A;  4LFC E;  3B78 A;  1N34 I;  2XEX A;  2UUB E;  4Z7C A;  1H7S A;  1S4E A;  4DV6 I;  2UXC E;  4P7A A;  4DPX A;  4JI4 E;  1NZ0 A;  1Z0B A;  4GKJ E;  1HNZ E;  3J7A G;  1I94 E;  4DPY A;  4USM A;  1NHI A;  2HKJ A;  4JV5 I;  4PRV A;  1N0V C;  2HHH E;  1K47 A;  2V2Q A;  4DV2 E;  1IBM I;  4YY3 E;  2NPF A;  4DU8 A;  3K85 A;  5GME A;  4NXN I;  2ZIT A;  4DR5 I;  2UXD I;  5IWA I;  4YHH E;  4LF7 I;  3ZZU A;  4DV2 I;  2UUC E;  4DPW A;  4DR1 I;  4X66 E;  5LMN I;  2HFU A;  3F0N A;  3V5R A;  1MG7 A;  3QT5 A;  5BR8 I;  2X36 A;  4DR5 E;  1Z0E A;  2Z5E A;  4JI6 I;  1RRE A;  1ZM9 A;  4WUB A;  3LNU A;  1ZM3 A;  4IZJ A;  4B3T E;  1FNM A;  4JI7 I;  4LF5 I;  5FWK A;  4N3O A;  4USK A;  1HNZ I;  4HY1 A;  1IBL E;  4PRX A;  4MYU A;  1QZR A;  4IZJ D;  3PYF A;  2VQE E;  4MYT A;  2F4V I;  1N0U A;  3V2U C;  2PNM A;  4B3S I;  2HHH I;  1Z5A A;  4GKK I;  4DV1 I;  4FW9 A;  1XNR E;  1XMQ I;  4LFA E;  4EMD A;  2GQ0 A;  2V8P A;  1B63 A;  1HR0 E;  4PU9 A;  4DV5 I;  4IZK A;  4LFB I;  3PYD A;  5LL6 R;  1NHJ A;  2UXB E;  1H7U A;  3K1J A;  2ZM6 E;  4DPU A;  1FI4 A;  1FWK A;  5IWA E;  4LF7 E;  4RPF A;  4X62 I;  1H73 A;  4LF8 E;  1Z5B A;  2A2C A;  3PRY A;  4WUD A;  4X66 I;  2UUA E;  2HFS A;  3OTO I;  4JI5 E;  4KQV A;  1ELO A;  4AQY I;  4KHP I;  4M1K A;  4JI6 E;  2A2D A;  4DPT A;  4DV4 E;  4DR6 E;  1HNX E;  1ZXM A;  3PYE A;  2DEI A;  2UUB I;  3Q6N A;  2UXD E;  2R3V A;  1KKH A;  4DR2 E;  4DR7 E;  2ZBK B;  2PNL A;  4JI2 I;  1XNQ I;  4WUC A;  3OTO E;  2V34 A;  1XMQ E;  1KTV A;  1XHK A;  3WU3 A;  1I94 I;  4YHH I;  4DV7 I;  4HYM A;  1UEK A;  4B3R E;  1Z0W A;  1MU5 A;  4IZJ B;  3LTO A;  5A2Q C;  2Z5B B;  5IT9 C;  5BR8 E;  4HXZ A;  2BV3 A;  1N33 E;  1Z59 A;  4DV3 E;  1ZM4 A;  4DV7 E;  3WU5 A;  2CGE A;  4X65 I;  1HNW E;  1IBL I;  4R1F A;  4GKK E;  1B62 A;  1EA6 A;  4DU7 A;  3LPS A;  3T1Y E;  2F4V E;  4JYA E;  1XMO I;  2Z5C A;  4DUZ E;  2AJ4 A;  3ZKD A;  1FKA E;  1MX0 A;  3J81 C;  3HUL A;  1OJ4 A;  4I3H A;  2HKE A;  4OX9 E;  1N32 I;  4FWH A;  4B3T I;  4JI8 I;  1HK7 A;  2BM1 A;  4LF9 E;  1N36 I;  2E5L E;  1NHH A;  4JI2 E;  4X62 E;  4DR4 E;  1J5E E;  2UXB I;  1Z5C A;  1H72 C;  3K17 A;  2ZM6 I;  1IBK I;  4YY3 I;  4LF6 E;  2HK3 A;  3T1H E;  1Y6Z A;  3CWV A;  1S16 A;  5GMD A;  3WU4 A;  4DV4 I;  4JI4 I;  3JAM C;  1H74 A;  1Y4S A;  2OI2 A;  3J7A M;  1XNR I;  2X7I A;  4LFA I;  4JI1 I;  5FLX Q;  1RR9 A;  1USV A;  1HR0 I;  1XMO E;  3J80 Q;  3Q1Q A;  2VQF E;  4Z7Y A;  1XNQ E;  1DAR A;  1FJG I;  5LMU E;  4LF5 E;  1FWL A;  2J7K A;  4JI1 E;  4FWD A;  4P52 A;  4DV0 E;  4LFC I;  4JI3 E;  4JI5 I;  2E5L I;  1Z0C A;  4B3S E;  5LMU I;  4K0K I;  4DR1 E;  4LF6 I;  1EI1 A;  1USU A;  4JI0 I;  1VIS A;  4DV6 E;  5FLX C;  4X65 E;  4DR4 I;  1Z0G A;  1HNX I;  2HK2 A;  1J5E I;  4FWG A;  4FN5 A;  3J80 C;  4DR2 I;  3GON A;  3H4L A;  3Q6M A;  1IBM E;  4NXM I;  4JG4 A;  4HAC B;  1U2R A;  4JV5 E;  2V2Z A;  2VF3 A;  3D4J A;  3WU6 A;  3QT6 A;  4NXN E;  1Z0V A;  1N33 I;  4DV0 I;  4ED4 A;  4AQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...