3T1HI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
molecule tags Ribosome/antibiotic
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1hI00
4NXME 3PYDA 3D4JA 4KHPE 4JI5I 2E1RA 4JI5E 4Z7YA 1N0VC 4B3SI 1HNXE 4B3SE 2ZM6E 4B3TI 4K0KI 4I3HA 1Z59A 4JI1I 4LF4E 4DV4I 1XMOE 2J7KA 3QT6A 4DV4E 1Z0VA 3J80C 1HR0I 1K47A 4GKJE 4DV7I 3H4LA 4JI7I 4DV7E 5LMNE 4DR5I 2UXDI 2HHHI 2UUBE 2BV3A 2V34A 4MYTA 4NXMI 2A2CA 4DV1I 4YHHE 4DUYE 3HULA 5BR8I 2VQEE 4DUYI 4KQVA 3Q1QA 1FWLA 4R1FA 4ED4A 4FWHA 3LTOA 4DU7A 4LF9I 2V8PA 4DR7I 5IWAI 5IT9C 3V5RA 1U2RA 1IBKI 4LFCI 1HNZI 1NHJA 3K1JA 4WUDA 4GKJI 3B8HA 1HNZE 4LFCE 1ZM4A 1I94I 2HK2A 1IBLI 2UU9I 1RR9A 3B82A 3F0NA 3M6AA 1QZRA 1VISA 4DV2E 4LF5I 3T1YI 4DV1E 4JI1E 1ZXNA 4DU8A 1NZ0A 1XMOI 5GMEA 2UUCI 2WW4A 1H72C 1HR0E 1KVKA 4B3ME 4UT4A 1H7SA 4NXNI 1EA6A 1KKHA 4NXNE 1D6TA 1UEKA 4KHPI 1IBKE 2V2ZA 4LFAI 4LF6E 1XNQI 1ZM2A 2E5LI 4M1KA 2AJ4A 5FLXQ 2GS8A 4URLA 1OJ4A 2HKEA 1FKAE 4DPXA 1N33I 4USMA 4USKA 1ZM9A 3J81Q 4WUCA 4DPWA 4Z7CA 2UXDE 5LMUE 3PYEA 5BR8E 2BM1A 4B3MI 2E5LE 4B3TE 4K0KE 4MYUA 4DR6I 1J5EI 1FJGE 1KIJA 1HNWI 1XHKA 4DR4I 1Z0TA 4JI8I 4UTGA 2HFUA 4JI2I 1XMQI 2HKJA 1PIEA 1B63A 3JAMC 2LJPA 4OX9I 2VF3A 1N32I 4RPFA 3ZZUA 1A6FA 3WU3A 4PRXA 3QT7A 4DR1I 2UXBI 4LF8I 1KTVA 3WU5A 4X66E 3WU4A 4LF8E 4DR7E 4GKKI 4DR2I 4HYMA 4DPUA 1N34I 3PYGA 5GMDA 5LMUI 1N34E 3ZKDA 3T1HI 1IBME 4JI6E 1NHHA 2UUAI 1HNXI 4LF5E 2R42A 4OX9E 4JI4E 4LF7I 4FWGA 1N33E 4LF4I 1S4EA 4AQYE 3J7AM 4X65I 4DV6E 4DR1E 4LFBI 3ZZTA 1XMQE 4LFBE 3QT5A 1MU5A 4FW9A 4DV0I 2HHHE 2UUBI 4JI3I 1XNRE 4HY1A 4DV0E 4JI3E 1Z0BA 1Z0CA 2A2DA 4LF6I 1MX0A 2OI2A 4LF9E 2DEJA 1FJGI 4FN5A 1FWKA 4DUZE 2NPFA 1N36E 4DR3I 3V2UC 2ZM6I 4DUZI 4P52A 3K17A 5IWAE 4YY3E 4B3RE 3OTOI 4EMDA 1Z5CA 5FLXC 1H74A 1XNRI 2X7IA 2UUAE 4JYAI 3QT8A 3ZKBA 1Z0GA 2VQEI 4JI4I 4LF7E 4DPYA 4YHHI 4JG4A 4DPTA 1S16A 2ZITA 4AQYI 4DV3E 4X62E 1NHIA 4GKKE 2UXBE 4X62I 1ZM3A 1Z0WA 4DR2E 4DR4E 4YY3I 1Z5AA 3GONA 3OTOE 3ZM7A 3J7AG 4DV5E 2F4VE 4DV2I 3PYFA 2EFGA 2X36A 3T1YE 3CWVA 4DR3E 2BM0A 4HACB 4X65E 4DV6I 2Q2EB 3LNUA 4HACA 4X64I 3J80Q 5IT9Q 4X66I 3J81C 2ZBKB 4X64E 2V2VA 1H73A 2DEIA 3WU6A 1WUUA 5LL6R 2HFSA 2F4VI 4LFAE 4XTJA 4PU9A 1XNQE 1ZXMA 3LPSA 3ZZ0A 1N36I 1FI4A 5L3JA 1DARA 1N0UA 4B3RI 2HK3A 1HNWE 4FWDA 4WUBA 2CZ9A 1Z0EA 2VQFI 2VQFE 1FNMA 4JV5I 4JI2E 1IBLE 4JI7E 4JV5E 3B78A 3JAMQ 4JYAE 4PRVA 1ELOA 2UUCE 1H7UA 1N32E 4P7AA 4JI0E 4DR6E 1Z5BA 1MG7A 5A2QC 1J5EE 2V2QA 2R3VA 4HXZA 1I94E 1RREA 1BKNA 4JI8E 1B62A 4JI6I 1IBMI 3T1HE 4DV5I 2XEXA 2UU9E 2UXCE 2UXCI 4ZVIA 1PVGA 1PKPA 4JI0I 1EI1A 4DV3I 5A2QQ 5LMNI 4DR5E 4DXLA
chains in the Genus database with same CATH superfamily
2JEAA 5C0XC 4NXME 4BA2B 3PYDA 3D4JA 4KHPE 2Z5BA 4JI5I 3M7ND 2E1RA 3HJCA 4JI5E 4Z7YA 4BA2A 4AIMA 1UDQA 4AM3A 1N0VC 3HKMA 4B3SI 1HNXE 4B3SE 2ZM6E 1Y6ZA 3DD6A 4B3TI 4K0KI 4I3HA 1Y4SA 1Z59A 4LCFA 4JI1I 4LF4E 5EKWA 4DV4I 1XMOE 2J7KA 3QT6A 4DV4E 1Z0VA 3J80C 1HR0I 1K47A 4GKJE 4DV7I 3H4LA 4JI7I 4DV7E 5LMNE 4DR5I 2UXDI 4MU4A 4IFDB 2HHHI 2UUBE 2BV3A 2V34A 4MYTA 4NXMI 2A2CA 4DV1I 4YHHE 4DUYE 3Q6NA 3HULA 5BR8I 2VQEE 4DUYI 4KQVA 5JEAF 5JEAD 2IOQA 3Q1QA 1FWLA 5JEAA 4R1FA 4ED4A 3PRYA 4FWHA 3LTOA 4DU7A 4LF9I 2V8PA 4DR7I 5IWAI 5IT9C 3V5RA 1U2RA 1IBKI 4LFCI 1HNZI 1NHJA 3K1JA 4WUDA 4GKJI 3B8HA 1HNZE 4LFCE 1ZM4A 3P3GA 3PS2A 1I94I 2HK2A 5C0XE 1IBLI 2UU9I 1RR9A 3P76A 3B82A 3F0NA 3M6AA 1QZRA 1VISA 2Z5EA 5K36E 4DV2E 4FW5A 4LF5I 3T1YI 5K36C 4DV1E 1YHCA 4JI1E 1ZXNA 4DU8A 1NZ0A 4MU0A 1XMOI 5GMEA 2UUCI 2WW4A 1USUA 1H72C 1HR0E 1KVKA 4B3ME 4UT4A 1H7SA 4NXNI 1EA6A 1KKHA 4IZJA 4NXNE 2Z5CA 1D6TA 1UEKA 4KHPI 1IBKE 2WNRA 4IFDF 3NZKA 2V2ZA 4LFAI 4LF6E 4IFDA 2JEBB 3U1YA 1XNQI 4IFDE 3PS3A 2PNZA 1ZM2A 2E5LI 4M1KA 2AJ4A 1HK7A 5FLXQ 2GS8A 2GO3A 4URLA 5DRRA 1OJ4A 2HKEA 1FKAE 1VI7A 2CG9A 4DPXA 1N33I 4USMA 2PO1A 1UDOA 4USKA 1ZM9A 3J81Q 4WUCA 4QNKA 2IERA 4DPWA 1RHYA 4Z7CA 5DRPA 2AE8A 2UXDE 1XXEA 1YH8A 5LMUE 3PYEA 5BR8E 2BM1A 1R6MA 2NN6D 3P06A 4B3MI 2F1DA 4IZJB 2IESA 2E5LE 4B3TE 4K0KE 4MYUA 5K36B 4DR6I 1J5EI 1FJGE 3Q6MA 2NN6B 2WP8A 1KIJA 2J65A 1XHKA 1HNWI 4DR4I 1Z0TA 4JI8I 1E3HA 2C39A 4UTGA 3U1KA 2HFUA 2NN6A 2Z5CB 5EL9A 4JI2I 1XMQI 2BA1G 2HKJA 1Y60A 1OYSA 1PIEA 1B63A 3JAMC 3P3EA 4IFDC 5DROA 2O1WA 2LJPA 4OX9I 2VF3A 2VESA 1N32I 4RPFA 3ZZUA 3WU3A 1A6FA 2PNZB 2NN6F 2O1UA 4PRXA 3QT7A 4DR1I 2UXBI 4FW7A 5K36F 4LF8I 1KTVA 2CVEA 2NN6C 3WU5A 4X66E 3WU4A 4LF8E 3M7NG 4GKKI 5JEAE 4DR7E 4DR2I 3PS1A 4HYMA 2C37B 4DPUA 1N34I 3PYGA 5GMDA 1P42A 5LMUI 4J3DA 1N34E 4LCGA 3ZKDA 3T1HI 1IBME 5K36A 4JI6E 1NHHA 2UUAI 1HNXI 4LF5E 2R42A 5C0XA 2WP8B 2BR2B 3KRNA 4OX9E 4JI4E 4LF7I 4FWGA 4FW4A 1N33E 4LF4I 1S4EA 2CGEA 3CDIA 4AQYE 2BA0D 4IS9A 3J7AM 4X65I 4DV6E 4DR1E 4LFBI 2NN6E 3ZZTA 1XMQE 4LFBE 3QT5A 1MU5A 4FW9A 4DV0I 2HHHE 2UUBI 4JI3I 1XNRE 4HY1A 4DV0E 4JI3E 2C39B 1Z0BA 2O3ZA 3P3CA 1Z0CA 4LCHA 2A2DA 4LF6I 2WNRB 1MX0A 2C38B 2OI2A 4LF9E 2PO2A 2JEBA 2DEJA 3K85A 4QNJA 1FJGI 4IZKA 4FN5A 1FWKA 1R6LA 4DUZE 2NPFA 1N36E 4DR3I 2PO0A 3V2UC 2ZM6I 4LPFA 4P52A 4DUZI 2PO2B 3K17A 5IWAE 4IZKB 5C0XD 2PO0B 2JT2A 4YY3E 4B3RE 1OYRA 4OO1C 3OTOI 1UDSA 5ELWA 4U3DA 4EMDA 1Z5CA 2C37A 5FLXC 1H74A 1XNRI 2X7IA 2UUAE 4JYAI 1USVA 3QT8A 3ZKBA 2JE6B 1Z0GA 2BR2A 2IOPA 2VQEI 4JI4I 4LF7E 4DPYA 4YHHI 4JG4A 4OKGA 4DPTA 1S16A 2ZITA 4AQYI 3CDJA 4DV3E 2O1VA 4X62E 1NHIA 5C0XB 4GKKE 2UXBE 4X62I 3L7ZB 1ZM3A 1Z0WA 4OO1B 4DR2E 4DR4E 4YY3I 1Z5AA 3GONA 3L7ZA 3OTOE 3ZM7A 2PNMA 3J7AG 1UDNA 4DV5E 4ISAA 4MU1A 5JEAC 2F4VE 4DV2I 4BA1A 4FW6A 1E3PA 3PYFA 2EFGA 4MQYA 2X36A 3T1YE 3CWVA 4DR3E 3H1CA 2BM0A 4HACB 5K36D 2C38A 4X65E 4DV6I 4OO1E 2Q2EB 3LNUA 4HACA 4MU3A 4X64I 3J80Q 5IT9Q 2O1TA 5C0XF 4X66I 2GQ0A 3J81C 2ZBKB 4X64E 2V2VA 4MDTA 3M85G 5FWKA 3GMEA 4OO1F 4OO1D 2GO4A 1H73A 4N3OA 5JEAB 2DEIA 3WU6A 3M85D 1WUUA 5LL6R 2HFSA 2F4VI 4LFAE 4XTJA 4PU9A 1XNQE 1ZXMA 3LPSA 3ZZ0A 1N36I 1FI4A 5L3JA 4OO1A 1DARA 1N0UA 4B3RI 2HK3A 1HNWE 4FWDA 4WUBA 3GCMA 2CZ9A 1Z0EA 2Z5BB 2VQFI 4NBQA 2PNLA 2VQFE 1FNMA 4JV5I 4JI2E 1IBLE 4IFDD 4BA1B 4JI7E 4JV5E 3B78A 3JAMQ 1Y4UA 3B4TA 4JYAE 4U3BA 4PRVA 1ELOA 2UUCE 1H7UA 1N32E 4P7AA 1OYPA 4JI0E 4IZJD 4DR6E 1Y5YA 1Z5BA 1MG7A 5A2QC 1J5EE 2V2QA 2R3VA 4GQUA 5DNXA 4HXZA 1I94E 4OZEA 1RREA 1BKNA 4JI8E 1B62A 5DNLA 4FW3A 4JI6I 3T1HE 4DV5I 2XEXA 2BA0G 1IBMI 2UU9E 2UXCE 2UXCI 4ZVIA 3UHMA 2JE6A 1PVGA 2PO1B 5DRQA 2BA1D 1PKPA 4AIDA 4JI0I 1EI1A 4DV3I 2JEAB 4LOMA 5A2QQ 5LMNI 4DR5E 4DXLA 3GLLA
chains in the Genus database with same CATH topology
4NXME 3PYDA 3D4JA 4KHPE 2Z5BA 4JI5I 2E1RA 3HJCA 4JI5E 4Z7YA 1N0VC 4B3SI 1HNXE 4B3SE 2ZM6E 1Y6ZA 4B3TI 4K0KI 4I3HA 1Y4SA 1Z59A 4JI1I 4LF4E 4DV4I 1XMOE 2J7KA 3QT6A 4DV4E 1Z0VA 3J80C 1HR0I 1K47A 4GKJE 4DV7I 3H4LA 4JI7I 4DV7E 5LMNE 4DR5I 2UXDI 2UUBE 2HHHI 2BV3A 2V34A 4MYTA 4NXMI 2A2CA 4DV1I 4YHHE 4DUYE 3Q6NA 3HULA 5BR8I 2VQEE 4DUYI 4KQVA 3Q1QA 2IOQA 1FWLA 4R1FA 4ED4A 3PRYA 4FWHA 3LTOA 4DU7A 4LF9I 2V8PA 4DR7I 5IWAI 5IT9C 3V5RA 1U2RA 1IBKI 4LFCI 1HNZI 1NHJA 3K1JA 4WUDA 4GKJI 3B8HA 1HNZE 4LFCE 1ZM4A 1I94I 2HK2A 1IBLI 2UU9I 1RR9A 3B82A 3F0NA 3M6AA 1QZRA 1VISA 2Z5EA 4DV2E 4LF5I 3T1YI 4DV1E 4JI1E 1ZXNA 4DU8A 1NZ0A 1XMOI 5GMEA 2UUCI 2WW4A 1USUA 1H72C 1HR0E 1KVKA 4B3ME 4UT4A 1H7SA 4NXNI 1EA6A 1KKHA 4IZJA 4NXNE 2Z5CA 1D6TA 1UEKA 4KHPI 1IBKE 2V2ZA 4LFAI 4LF6E 1XNQI 1ZM2A 2E5LI 4M1KA 2AJ4A 1HK7A 5FLXQ 2GS8A 4URLA 1OJ4A 2HKEA 1FKAE 2CG9A 4DPXA 1N33I 4USMA 4USKA 1ZM9A 3J81Q 4WUCA 4DPWA 4Z7CA 2UXDE 5LMUE 3PYEA 5BR8E 2BM1A 3P06A 4B3MI 4IZJB 2E5LE 4B3TE 4K0KE 4MYUA 4DR6I 1J5EI 1FJGE 3Q6MA 1KIJA 1HNWI 1XHKA 4DR4I 1Z0TA 4JI8I 4UTGA 2HFUA 2Z5CB 4JI2I 1XMQI 2HKJA 1PIEA 1B63A 3JAMC 2O1WA 2LJPA 4OX9I 2VF3A 1N32I 4RPFA 3ZZUA 1A6FA 3WU3A 2O1UA 4PRXA 3QT7A 4DR1I 2UXBI 4LF8I 1KTVA 3WU5A 4X66E 3WU4A 4LF8E 4DR7E 4GKKI 4DR2I 4HYMA 4DPUA 1N34I 3PYGA 5GMDA 5LMUI 1N34E 3ZKDA 3T1HI 1IBME 4JI6E 1NHHA 2UUAI 1HNXI 4LF5E 2R42A 4OX9E 4JI4E 4LF7I 4FWGA 1N33E 4LF4I 1S4EA 2CGEA 4AQYE 3J7AM 4X65I 4DV6E 4DR1E 4LFBI 3ZZTA 1XMQE 4LFBE 3QT5A 1MU5A 4FW9A 4DV0I 2HHHE 2UUBI 4JI3I 1XNRE 4HY1A 4DV0E 4JI3E 1Z0BA 1Z0CA 2A2DA 4LF6I 1MX0A 2OI2A 4LF9E 2DEJA 3K85A 1FJGI 4IZKA 4FN5A 1FWKA 4DUZE 2NPFA 1N36E 4DR3I 3V2UC 2ZM6I 4DUZI 4P52A 3K17A 5IWAE 4IZKB 4YY3E 4B3RE 3OTOI 4EMDA 1Z5CA 5FLXC 1H74A 1XNRI 2X7IA 2UUAE 4JYAI 1USVA 3QT8A 3ZKBA 1Z0GA 2IOPA 2VQEI 4JI4I 4LF7E 4DPYA 4YHHI 4JG4A 4DPTA 1S16A 2ZITA 4AQYI 4DV3E 2O1VA 4X62E 1NHIA 4GKKE 2UXBE 4X62I 1ZM3A 1Z0WA 4DR2E 4DR4E 4YY3I 1Z5AA 3GONA 3OTOE 3ZM7A 2PNMA 3J7AG 4DV5E 2F4VE 4DV2I 3PYFA 2EFGA 2X36A 3T1YE 3CWVA 4DR3E 2BM0A 4HACB 4X65E 4DV6I 2Q2EB 3LNUA 4HACA 4X64I 3J80Q 5IT9Q 2O1TA 4X66I 3J81C 2GQ0A 2ZBKB 4X64E 2V2VA 5FWKA 1H73A 4N3OA 2DEIA 3WU6A 1WUUA 5LL6R 2HFSA 2F4VI 4LFAE 4XTJA 4PU9A 1XNQE 1ZXMA 3LPSA 3ZZ0A 1N36I 1FI4A 5L3JA 1DARA 1N0UA 4B3RI 2HK3A 1HNWE 4FWDA 4WUBA 2CZ9A 1Z0EA 2Z5BB 2VQFI 2PNLA 2VQFE 1FNMA 4JV5I 4JI2E 1IBLE 4JI7E 4JV5E 3B78A 3JAMQ 1Y4UA 4JYAE 4PRVA 1ELOA 2UUCE 1H7UA 1N32E 4P7AA 4JI0E 4IZJD 4DR6E 1Z5BA 1MG7A 5A2QC 1J5EE 2V2QA 2R3VA 4HXZA 1I94E 1RREA 1BKNA 4JI8E 1B62A 4JI6I 1IBMI 3T1HE 4DV5I 2XEXA 2UU9E 2UXCE 2UXCI 4ZVIA 1PVGA 1PKPA 4JI0I 1EI1A 4DV3I 5A2QQ 5LMNI 4DR5E 4DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM E;  3PYD A;  3D4J A;  4KHP E;  4JI5 I;  2E1R A;  4JI5 E;  4Z7Y A;  1N0V C;  4B3S I;  1HNX E;  4B3S E;  2ZM6 E;  4B3T I;  4K0K I;  4I3H A;  1Z59 A;  4JI1 I;  4LF4 E;  4DV4 I;  1XMO E;  2J7K A;  3QT6 A;  4DV4 E;  1Z0V A;  3J80 C;  1HR0 I;  1K47 A;  4GKJ E;  4DV7 I;  3H4L A;  4JI7 I;  4DV7 E;  5LMN E;  4DR5 I;  2UXD I;  2HHH I;  2UUB E;  2BV3 A;  2V34 A;  4MYT A;  4NXM I;  2A2C A;  4DV1 I;  4YHH E;  4DUY E;  3HUL A;  5BR8 I;  2VQE E;  4DUY I;  4KQV A;  3Q1Q A;  1FWL A;  4R1F A;  4ED4 A;  4FWH A;  3LTO A;  4DU7 A;  4LF9 I;  2V8P A;  4DR7 I;  5IWA I;  5IT9 C;  3V5R A;  1U2R A;  1IBK I;  4LFC I;  1HNZ I;  1NHJ A;  3K1J A;  4WUD A;  4GKJ I;  3B8H A;  1HNZ E;  4LFC E;  1ZM4 A;  1I94 I;  2HK2 A;  1IBL I;  2UU9 I;  1RR9 A;  3B82 A;  3F0N A;  3M6A A;  1QZR A;  1VIS A;  4DV2 E;  4LF5 I;  3T1Y I;  4DV1 E;  4JI1 E;  1ZXN A;  4DU8 A;  1NZ0 A;  1XMO I;  5GME A;  2UUC I;  2WW4 A;  1H72 C;  1HR0 E;  1KVK A;  4B3M E;  4UT4 A;  1H7S A;  4NXN I;  1EA6 A;  1KKH A;  4NXN E;  1D6T A;  1UEK A;  4KHP I;  1IBK E;  2V2Z A;  4LFA I;  4LF6 E;  1XNQ I;  1ZM2 A;  2E5L I;  4M1K A;  2AJ4 A;  5FLX Q;  2GS8 A;  4URL A;  1OJ4 A;  2HKE A;  1FKA E;  4DPX A;  1N33 I;  4USM A;  4USK A;  1ZM9 A;  3J81 Q;  4WUC A;  4DPW A;  4Z7C A;  2UXD E;  5LMU E;  3PYE A;  5BR8 E;  2BM1 A;  4B3M I;  2E5L E;  4B3T E;  4K0K E;  4MYU A;  4DR6 I;  1J5E I;  1FJG E;  1KIJ A;  1HNW I;  1XHK A;  4DR4 I;  1Z0T A;  4JI8 I;  4UTG A;  2HFU A;  4JI2 I;  1XMQ I;  2HKJ A;  1PIE A;  1B63 A;  3JAM C;  2LJP A;  4OX9 I;  2VF3 A;  1N32 I;  4RPF A;  3ZZU A;  1A6F A;  3WU3 A;  4PRX A;  3QT7 A;  4DR1 I;  2UXB I;  4LF8 I;  1KTV A;  3WU5 A;  4X66 E;  3WU4 A;  4LF8 E;  4DR7 E;  4GKK I;  4DR2 I;  4HYM A;  4DPU A;  1N34 I;  3PYG A;  5GMD A;  5LMU I;  1N34 E;  3ZKD A;  3T1H I;  1IBM E;  4JI6 E;  1NHH A;  2UUA I;  1HNX I;  4LF5 E;  2R42 A;  4OX9 E;  4JI4 E;  4LF7 I;  4FWG A;  1N33 E;  4LF4 I;  1S4E A;  4AQY E;  3J7A M;  4X65 I;  4DV6 E;  4DR1 E;  4LFB I;  3ZZT A;  1XMQ E;  4LFB E;  3QT5 A;  1MU5 A;  4FW9 A;  4DV0 I;  2HHH E;  2UUB I;  4JI3 I;  1XNR E;  4HY1 A;  4DV0 E;  4JI3 E;  1Z0B A;  1Z0C A;  2A2D A;  4LF6 I;  1MX0 A;  2OI2 A;  4LF9 E;  2DEJ A;  1FJG I;  4FN5 A;  1FWK A;  4DUZ E;  2NPF A;  1N36 E;  4DR3 I;  3V2U C;  2ZM6 I;  4DUZ I;  4P52 A;  3K17 A;  5IWA E;  4YY3 E;  4B3R E;  3OTO I;  4EMD A;  1Z5C A;  5FLX C;  1H74 A;  1XNR I;  2X7I A;  2UUA E;  4JYA I;  3QT8 A;  3ZKB A;  1Z0G A;  2VQE I;  4JI4 I;  4LF7 E;  4DPY A;  4YHH I;  4JG4 A;  4DPT A;  1S16 A;  2ZIT A;  4AQY I;  4DV3 E;  4X62 E;  1NHI A;  4GKK E;  2UXB E;  4X62 I;  1ZM3 A;  1Z0W A;  4DR2 E;  4DR4 E;  4YY3 I;  1Z5A A;  3GON A;  3OTO E;  3ZM7 A;  3J7A G;  4DV5 E;  2F4V E;  4DV2 I;  3PYF A;  2EFG A;  2X36 A;  3T1Y E;  3CWV A;  4DR3 E;  2BM0 A;  4HAC B;  4X65 E;  4DV6 I;  2Q2E B;  3LNU A;  4HAC A;  4X64 I;  3J80 Q;  5IT9 Q;  4X66 I;  3J81 C;  2ZBK B;  4X64 E;  2V2V A;  1H73 A;  2DEI A;  3WU6 A;  1WUU A;  5LL6 R;  2HFS A;  2F4V I;  4LFA E;  4XTJ A;  4PU9 A;  1XNQ E;  1ZXM A;  3LPS A;  3ZZ0 A;  1N36 I;  1FI4 A;  5L3J A;  1DAR A;  1N0U A;  4B3R I;  2HK3 A;  1HNW E;  4FWD A;  4WUB A;  2CZ9 A;  1Z0E A;  2VQF I;  2VQF E;  1FNM A;  4JV5 I;  4JI2 E;  1IBL E;  4JI7 E;  4JV5 E;  3B78 A;  3JAM Q;  4JYA E;  4PRV A;  1ELO A;  2UUC E;  1H7U A;  1N32 E;  4P7A A;  4JI0 E;  4DR6 E;  1Z5B A;  1MG7 A;  5A2Q C;  1J5E E;  2V2Q A;  2R3V A;  4HXZ A;  1I94 E;  1RRE A;  1BKN A;  4JI8 E;  1B62 A;  4JI6 I;  1IBM I;  3T1H E;  4DV5 I;  2XEX A;  2UU9 E;  2UXC E;  2UXC I;  4ZVI A;  1PVG A;  1PKP A;  4JI0 I;  1EI1 A;  4DV3 I;  5A2Q Q;  5LMN I;  4DR5 E;  4DXL A; 
#chains in the Genus database with same CATH topology
 2JEA A;  5C0X C;  4NXM E;  4BA2 B;  3PYD A;  3D4J A;  4KHP E;  2Z5B A;  4JI5 I;  3M7N D;  2E1R A;  3HJC A;  4JI5 E;  4Z7Y A;  4BA2 A;  4AIM A;  1UDQ A;  4AM3 A;  1N0V C;  3HKM A;  4B3S I;  1HNX E;  4B3S E;  2ZM6 E;  1Y6Z A;  3DD6 A;  4B3T I;  4K0K I;  4I3H A;  1Y4S A;  1Z59 A;  4LCF A;  4JI1 I;  4LF4 E;  5EKW A;  4DV4 I;  1XMO E;  2J7K A;  3QT6 A;  4DV4 E;  1Z0V A;  3J80 C;  1HR0 I;  1K47 A;  4GKJ E;  4DV7 I;  3H4L A;  4JI7 I;  4DV7 E;  5LMN E;  4DR5 I;  2UXD I;  4MU4 A;  4IFD B;  2HHH I;  2UUB E;  2BV3 A;  2V34 A;  4MYT A;  4NXM I;  2A2C A;  4DV1 I;  4YHH E;  4DUY E;  3Q6N A;  3HUL A;  5BR8 I;  2VQE E;  4DUY I;  4KQV A;  5JEA F;  5JEA D;  2IOQ A;  3Q1Q A;  1FWL A;  5JEA A;  4R1F A;  4ED4 A;  3PRY A;  4FWH A;  3LTO A;  4DU7 A;  4LF9 I;  2V8P A;  4DR7 I;  5IWA I;  5IT9 C;  3V5R A;  1U2R A;  1IBK I;  4LFC I;  1HNZ I;  1NHJ A;  3K1J A;  4WUD A;  4GKJ I;  3B8H A;  1HNZ E;  4LFC E;  1ZM4 A;  3P3G A;  3PS2 A;  1I94 I;  2HK2 A;  5C0X E;  1IBL I;  2UU9 I;  1RR9 A;  3P76 A;  3B82 A;  3F0N A;  3M6A A;  1QZR A;  1VIS A;  2Z5E A;  5K36 E;  4DV2 E;  4FW5 A;  4LF5 I;  3T1Y I;  5K36 C;  4DV1 E;  1YHC A;  4JI1 E;  1ZXN A;  4DU8 A;  1NZ0 A;  4MU0 A;  1XMO I;  5GME A;  2UUC I;  2WW4 A;  1USU A;  1H72 C;  1HR0 E;  1KVK A;  4B3M E;  4UT4 A;  1H7S A;  4NXN I;  1EA6 A;  1KKH A;  4IZJ A;  4NXN E;  2Z5C A;  1D6T A;  1UEK A;  4KHP I;  1IBK E;  2WNR A;  4IFD F;  3NZK A;  2V2Z A;  4LFA I;  4LF6 E;  4IFD A;  2JEB B;  3U1Y A;  1XNQ I;  4IFD E;  3PS3 A;  2PNZ A;  1ZM2 A;  2E5L I;  4M1K A;  2AJ4 A;  1HK7 A;  5FLX Q;  2GS8 A;  2GO3 A;  4URL A;  5DRR A;  1OJ4 A;  2HKE A;  1FKA E;  1VI7 A;  2CG9 A;  4DPX A;  1N33 I;  4USM A;  2PO1 A;  1UDO A;  4USK A;  1ZM9 A;  3J81 Q;  4WUC A;  4QNK A;  2IER A;  4DPW A;  1RHY A;  4Z7C A;  5DRP A;  2AE8 A;  2UXD E;  1XXE A;  1YH8 A;  5LMU E;  3PYE A;  5BR8 E;  2BM1 A;  1R6M A;  2NN6 D;  3P06 A;  4B3M I;  2F1D A;  4IZJ B;  2IES A;  2E5L E;  4B3T E;  4K0K E;  4MYU A;  5K36 B;  4DR6 I;  1J5E I;  1FJG E;  3Q6M A;  2NN6 B;  2WP8 A;  1KIJ A;  2J65 A;  1XHK A;  1HNW I;  4DR4 I;  1Z0T A;  4JI8 I;  1E3H A;  2C39 A;  4UTG A;  3U1K A;  2HFU A;  2NN6 A;  2Z5C B;  5EL9 A;  4JI2 I;  1XMQ I;  2BA1 G;  2HKJ A;  1Y60 A;  1OYS A;  1PIE A;  1B63 A;  3JAM C;  3P3E A;  4IFD C;  5DRO A;  2O1W A;  2LJP A;  4OX9 I;  2VF3 A;  2VES A;  1N32 I;  4RPF A;  3ZZU A;  3WU3 A;  1A6F A;  2PNZ B;  2NN6 F;  2O1U A;  4PRX A;  3QT7 A;  4DR1 I;  2UXB I;  4FW7 A;  5K36 F;  4LF8 I;  1KTV A;  2CVE A;  2NN6 C;  3WU5 A;  4X66 E;  3WU4 A;  4LF8 E;  3M7N G;  4GKK I;  5JEA E;  4DR7 E;  4DR2 I;  3PS1 A;  4HYM A;  2C37 B;  4DPU A;  1N34 I;  3PYG A;  5GMD A;  1P42 A;  5LMU I;  4J3D A;  1N34 E;  4LCG A;  3ZKD A;  3T1H I;  1IBM E;  5K36 A;  4JI6 E;  1NHH A;  2UUA I;  1HNX I;  4LF5 E;  2R42 A;  5C0X A;  2WP8 B;  2BR2 B;  3KRN A;  4OX9 E;  4JI4 E;  4LF7 I;  4FWG A;  4FW4 A;  1N33 E;  4LF4 I;  1S4E A;  2CGE A;  3CDI A;  4AQY E;  2BA0 D;  4IS9 A;  3J7A M;  4X65 I;  4DV6 E;  4DR1 E;  4LFB I;  2NN6 E;  3ZZT A;  1XMQ E;  4LFB E;  3QT5 A;  1MU5 A;  4FW9 A;  4DV0 I;  2HHH E;  2UUB I;  4JI3 I;  1XNR E;  4HY1 A;  4DV0 E;  4JI3 E;  2C39 B;  1Z0B A;  2O3Z A;  3P3C A;  1Z0C A;  4LCH A;  2A2D A;  4LF6 I;  2WNR B;  1MX0 A;  2C38 B;  2OI2 A;  4LF9 E;  2PO2 A;  2JEB A;  2DEJ A;  3K85 A;  4QNJ A;  1FJG I;  4IZK A;  4FN5 A;  1FWK A;  1R6L A;  4DUZ E;  2NPF A;  1N36 E;  4DR3 I;  2PO0 A;  3V2U C;  2ZM6 I;  4LPF A;  4P52 A;  4DUZ I;  2PO2 B;  3K17 A;  5IWA E;  4IZK B;  5C0X D;  2PO0 B;  2JT2 A;  4YY3 E;  4B3R E;  1OYR A;  4OO1 C;  3OTO I;  1UDS A;  5ELW A;  4U3D A;  4EMD A;  1Z5C A;  2C37 A;  5FLX C;  1H74 A;  1XNR I;  2X7I A;  2UUA E;  4JYA I;  1USV A;  3QT8 A;  3ZKB A;  2JE6 B;  1Z0G A;  2BR2 A;  2IOP A;  2VQE I;  4JI4 I;  4LF7 E;  4DPY A;  4YHH I;  4JG4 A;  4OKG A;  4DPT A;  1S16 A;  2ZIT A;  4AQY I;  3CDJ A;  4DV3 E;  2O1V A;  4X62 E;  1NHI A;  5C0X B;  4GKK E;  2UXB E;  4X62 I;  3L7Z B;  1ZM3 A;  1Z0W A;  4OO1 B;  4DR2 E;  4DR4 E;  4YY3 I;  1Z5A A;  3GON A;  3L7Z A;  3OTO E;  3ZM7 A;  2PNM A;  3J7A G;  1UDN A;  4DV5 E;  4ISA A;  4MU1 A;  5JEA C;  2F4V E;  4DV2 I;  4BA1 A;  4FW6 A;  1E3P A;  3PYF A;  2EFG A;  4MQY A;  2X36 A;  3T1Y E;  3CWV A;  4DR3 E;  3H1C A;  2BM0 A;  4HAC B;  5K36 D;  2C38 A;  4X65 E;  4DV6 I;  4OO1 E;  2Q2E B;  3LNU A;  4HAC A;  4MU3 A;  4X64 I;  3J80 Q;  5IT9 Q;  2O1T A;  5C0X F;  4X66 I;  2GQ0 A;  3J81 C;  2ZBK B;  4X64 E;  2V2V A;  4MDT A;  3M85 G;  5FWK A;  3GME A;  4OO1 F;  4OO1 D;  2GO4 A;  1H73 A;  4N3O A;  5JEA B;  2DEI A;  3WU6 A;  3M85 D;  1WUU A;  5LL6 R;  2HFS A;  2F4V I;  4LFA E;  4XTJ A;  4PU9 A;  1XNQ E;  1ZXM A;  3LPS A;  3ZZ0 A;  1N36 I;  1FI4 A;  5L3J A;  4OO1 A;  1DAR A;  1N0U A;  4B3R I;  2HK3 A;  1HNW E;  4FWD A;  4WUB A;  3GCM A;  2CZ9 A;  1Z0E A;  2Z5B B;  2VQF I;  4NBQ A;  2PNL A;  2VQF E;  1FNM A;  4JV5 I;  4JI2 E;  1IBL E;  4IFD D;  4BA1 B;  4JI7 E;  4JV5 E;  3B78 A;  3JAM Q;  1Y4U A;  3B4T A;  4JYA E;  4U3B A;  4PRV A;  1ELO A;  2UUC E;  1H7U A;  1N32 E;  4P7A A;  1OYP A;  4JI0 E;  4IZJ D;  4DR6 E;  1Y5Y A;  1Z5B A;  1MG7 A;  5A2Q C;  1J5E E;  2V2Q A;  2R3V A;  4GQU A;  5DNX A;  4HXZ A;  1I94 E;  4OZE A;  1RRE A;  1BKN A;  4JI8 E;  1B62 A;  5DNL A;  4FW3 A;  4JI6 I;  3T1H E;  4DV5 I;  2XEX A;  2BA0 G;  1IBM I;  2UU9 E;  2UXC E;  2UXC I;  4ZVI A;  3UHM A;  2JE6 A;  1PVG A;  2PO1 B;  5DRQ A;  2BA1 D;  1PKP A;  4AID A;  4JI0 I;  1EI1 A;  4DV3 I;  2JEA B;  4LOM A;  5A2Q Q;  5LMN I;  4DR5 E;  4DXL A;  3GLL A; 
#chains in the Genus database with same CATH homology
 4NXM E;  3PYD A;  3D4J A;  4KHP E;  2Z5B A;  4JI5 I;  2E1R A;  3HJC A;  4JI5 E;  4Z7Y A;  1N0V C;  4B3S I;  1HNX E;  4B3S E;  2ZM6 E;  1Y6Z A;  4B3T I;  4K0K I;  4I3H A;  1Y4S A;  1Z59 A;  4JI1 I;  4LF4 E;  4DV4 I;  1XMO E;  2J7K A;  3QT6 A;  4DV4 E;  1Z0V A;  3J80 C;  1HR0 I;  1K47 A;  4GKJ E;  4DV7 I;  3H4L A;  4JI7 I;  4DV7 E;  5LMN E;  4DR5 I;  2UXD I;  2UUB E;  2HHH I;  2BV3 A;  2V34 A;  4MYT A;  4NXM I;  2A2C A;  4DV1 I;  4YHH E;  4DUY E;  3Q6N A;  3HUL A;  5BR8 I;  2VQE E;  4DUY I;  4KQV A;  3Q1Q A;  2IOQ A;  1FWL A;  4R1F A;  4ED4 A;  3PRY A;  4FWH A;  3LTO A;  4DU7 A;  4LF9 I;  2V8P A;  4DR7 I;  5IWA I;  5IT9 C;  3V5R A;  1U2R A;  1IBK I;  4LFC I;  1HNZ I;  1NHJ A;  3K1J A;  4WUD A;  4GKJ I;  3B8H A;  1HNZ E;  4LFC E;  1ZM4 A;  1I94 I;  2HK2 A;  1IBL I;  2UU9 I;  1RR9 A;  3B82 A;  3F0N A;  3M6A A;  1QZR A;  1VIS A;  2Z5E A;  4DV2 E;  4LF5 I;  3T1Y I;  4DV1 E;  4JI1 E;  1ZXN A;  4DU8 A;  1NZ0 A;  1XMO I;  5GME A;  2UUC I;  2WW4 A;  1USU A;  1H72 C;  1HR0 E;  1KVK A;  4B3M E;  4UT4 A;  1H7S A;  4NXN I;  1EA6 A;  1KKH A;  4IZJ A;  4NXN E;  2Z5C A;  1D6T A;  1UEK A;  4KHP I;  1IBK E;  2V2Z A;  4LFA I;  4LF6 E;  1XNQ I;  1ZM2 A;  2E5L I;  4M1K A;  2AJ4 A;  1HK7 A;  5FLX Q;  2GS8 A;  4URL A;  1OJ4 A;  2HKE A;  1FKA E;  2CG9 A;  4DPX A;  1N33 I;  4USM A;  4USK A;  1ZM9 A;  3J81 Q;  4WUC A;  4DPW A;  4Z7C A;  2UXD E;  5LMU E;  3PYE A;  5BR8 E;  2BM1 A;  3P06 A;  4B3M I;  4IZJ B;  2E5L E;  4B3T E;  4K0K E;  4MYU A;  4DR6 I;  1J5E I;  1FJG E;  3Q6M A;  1KIJ A;  1HNW I;  1XHK A;  4DR4 I;  1Z0T A;  4JI8 I;  4UTG A;  2HFU A;  2Z5C B;  4JI2 I;  1XMQ I;  2HKJ A;  1PIE A;  1B63 A;  3JAM C;  2O1W A;  2LJP A;  4OX9 I;  2VF3 A;  1N32 I;  4RPF A;  3ZZU A;  1A6F A;  3WU3 A;  2O1U A;  4PRX A;  3QT7 A;  4DR1 I;  2UXB I;  4LF8 I;  1KTV A;  3WU5 A;  4X66 E;  3WU4 A;  4LF8 E;  4DR7 E;  4GKK I;  4DR2 I;  4HYM A;  4DPU A;  1N34 I;  3PYG A;  5GMD A;  5LMU I;  1N34 E;  3ZKD A;  3T1H I;  1IBM E;  4JI6 E;  1NHH A;  2UUA I;  1HNX I;  4LF5 E;  2R42 A;  4OX9 E;  4JI4 E;  4LF7 I;  4FWG A;  1N33 E;  4LF4 I;  1S4E A;  2CGE A;  4AQY E;  3J7A M;  4X65 I;  4DV6 E;  4DR1 E;  4LFB I;  3ZZT A;  1XMQ E;  4LFB E;  3QT5 A;  1MU5 A;  4FW9 A;  4DV0 I;  2HHH E;  2UUB I;  4JI3 I;  1XNR E;  4HY1 A;  4DV0 E;  4JI3 E;  1Z0B A;  1Z0C A;  2A2D A;  4LF6 I;  1MX0 A;  2OI2 A;  4LF9 E;  2DEJ A;  3K85 A;  1FJG I;  4IZK A;  4FN5 A;  1FWK A;  4DUZ E;  2NPF A;  1N36 E;  4DR3 I;  3V2U C;  2ZM6 I;  4DUZ I;  4P52 A;  3K17 A;  5IWA E;  4IZK B;  4YY3 E;  4B3R E;  3OTO I;  4EMD A;  1Z5C A;  5FLX C;  1H74 A;  1XNR I;  2X7I A;  2UUA E;  4JYA I;  1USV A;  3QT8 A;  3ZKB A;  1Z0G A;  2IOP A;  2VQE I;  4JI4 I;  4LF7 E;  4DPY A;  4YHH I;  4JG4 A;  4DPT A;  1S16 A;  2ZIT A;  4AQY I;  4DV3 E;  2O1V A;  4X62 E;  1NHI A;  4GKK E;  2UXB E;  4X62 I;  1ZM3 A;  1Z0W A;  4DR2 E;  4DR4 E;  4YY3 I;  1Z5A A;  3GON A;  3OTO E;  3ZM7 A;  2PNM A;  3J7A G;  4DV5 E;  2F4V E;  4DV2 I;  3PYF A;  2EFG A;  2X36 A;  3T1Y E;  3CWV A;  4DR3 E;  2BM0 A;  4HAC B;  4X65 E;  4DV6 I;  2Q2E B;  3LNU A;  4HAC A;  4X64 I;  3J80 Q;  5IT9 Q;  2O1T A;  4X66 I;  3J81 C;  2GQ0 A;  2ZBK B;  4X64 E;  2V2V A;  5FWK A;  1H73 A;  4N3O A;  2DEI A;  3WU6 A;  1WUU A;  5LL6 R;  2HFS A;  2F4V I;  4LFA E;  4XTJ A;  4PU9 A;  1XNQ E;  1ZXM A;  3LPS A;  3ZZ0 A;  1N36 I;  1FI4 A;  5L3J A;  1DAR A;  1N0U A;  4B3R I;  2HK3 A;  1HNW E;  4FWD A;  4WUB A;  2CZ9 A;  1Z0E A;  2Z5B B;  2VQF I;  2PNL A;  2VQF E;  1FNM A;  4JV5 I;  4JI2 E;  1IBL E;  4JI7 E;  4JV5 E;  3B78 A;  3JAM Q;  1Y4U A;  4JYA E;  4PRV A;  1ELO A;  2UUC E;  1H7U A;  1N32 E;  4P7A A;  4JI0 E;  4IZJ D;  4DR6 E;  1Z5B A;  1MG7 A;  5A2Q C;  1J5E E;  2V2Q A;  2R3V A;  4HXZ A;  1I94 E;  1RRE A;  1BKN A;  4JI8 E;  1B62 A;  4JI6 I;  1IBM I;  3T1H E;  4DV5 I;  2XEX A;  2UU9 E;  2UXC E;  2UXC I;  4ZVI A;  1PVG A;  1PKP A;  4JI0 I;  1EI1 A;  4DV3 I;  5A2Q Q;  5LMN I;  4DR5 E;  4DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...