4JI6I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6I00
4HACA 1N32I 4X65E 4RPFA 1HNXI 4GKJI 4XTJA 2OI2A 4OX9E 2UXCI 4LF4I 4NXNI 4JI4E 1RR9A 3PYEA 3B8HA 1MX0A 1Z5BA 4M1KA 3LNUA 4DV6E 3PYDA 4DR3E 4X62I 1I94I 2BM1A 2ZM6I 1ZM4A 4JI0I 4URLA 4DV1I 1ELOA 3WU3A 2V2QA 5BR8I 4LFCI 3ZKDA 2LJPA 1HR0I 5LL6R 1N32E 4B3TI 1Z0EA 1Z0VA 4PU9A 2UXCE 4LF4E 4NXNE 2UUCI 4DV3I 2HK2A 3J80Q 3V5RA 2ZBKB 4HXZA 4GKKI 4X62E 4JI0E 1FJGI 2HHHI 5BR8E 2A2CA 4JI7I 2E5LI 4LFCE 2F4VI 1HR0E 4B3TE 1U2RA 4LF5I 1OJ4A 1K47A 1PKPA 1RREA 4EMDA 4WUCA 4NXMI 2UUCE 1HNWI 4P7AA 4DV3E 4JYAE 4I3HA 4DV5I 4PRXA 2X7IA 4DR4I 1XMQI 5FLXQ 2UUBI 3V2UC 5IT9Q 2HK3A 1FJGE 4JI7E 4DPUA 1Z0CA 2F4VE 2XEXA 4UT4A 4LF5E 4HYMA 1KIJA 3QT6A 4USMA 1XNRI 4JI3I 4DV7I 4DR7I 4JI8I 4NXME 1HNWE 3ZZTA 3T1YI 3ZM7A 1BKNA 4ED4A 1N34I 4YY3I 3QT5A 2VF3A 4DR4E 1KVKA 1XMQE 2VQFI 1QZRA 2UUBE 2Q2EB 2R3VA 1XNQI 1J5EI 4DXLA 1IBLI 3F0NA 4X64E 3J80C 1KKHA 1ZXMA 5IWAI 4DV0I 2V8PA 3PYFA 1S16A 1XNRE 4JI3E 2E1RA 4DV7E 4DR7E 4JI8E 2V34A 3ZZUA 2UUAI 4JI1E 2DEJA 4B3RE 4K0KI 1Z59A 4UTGA 1N34E 4YY3E 1HNZI 3K17A 1IBKI 4FN5A 2HKEA 2VQFE 2DEIA 4DR2I 4DV4I 3JAMQ 3GONA 1XNQE 1IBLE 1HNXE 4GKJE 1WUUA 3QT7A 5IWAE 4DV0E 4JI2I 1N0UA 5FLXC 1IBMI 1H7SA 5LMUI 5A2QQ 5IT9C 4DV2I 1B62A 2UUAE 4K0KE 3WU4A 1HNZE 1I94E 1EA6A 4AQYI 4FWHA 2ZM6E 5GMDA 4FW9A 4DV1E 4LF6I 4MYUA 4DR2E 1MU5A 3LTOA 5LMNI 4DV4E 4JI5I 2A2DA 2HFUA 1A6FA 1DARA 1N33I 4WUDA 4DUYI 1NHIA 4DPWA 4DR6I 1N0VC 1IBME 5LMUE 1EI1A 4DV2E 4JI6I 4GKKE 4AQYE 4LF6E 2HHHE 2E5LE 3K1JA 2V2ZA 2HFSA 5LMNE 4JI5E 2VQEI 1H72C 2CZ9A 1N33E 1PIEA 1ZM9A 4DUYE 4DR6E 4LF8I 3LPSA 2GS8A 4LFBI 4DV5E 1B63A 4DPTA 1FNMA 3JAMC 4YHHI 3D4JA 4LF7I 1H74A 1XHKA 5A2QC 4DR1I 3CWVA 4LF9I 3J81Q 1D6TA 1H73A 3J7AM 4LF8E 4MYTA 3T1HI 3T1YE 1Z0WA 1FI4A 3M6AA 2R42A 4X66I 4YHHE 1ZXNA 3ZZ0A 4JV5I 2EFGA 1Z0GA 1FKAE 4LF7E 2J7KA 4DU7A 4USKA 1J5EE 4Z7CA 4DR1E 4DUZI 2V2VA 4DPYA 1XMOI 1Z5AA 4LF9E 4HY1A 1PVGA 3T1HE 4ZVIA 5L3JA 2UU9I 1Z0TA 4KHPI 2X36A 4X66E 1IBKE 4FWDA 4B3MI 2BV3A 1ZM2A 4JV5E 1FWKA 1H7UA 2UXBI 4B3SI 1S4EA 4JYAI 1VISA 3OTOI 4DPXA 4LFAI 4DUZE 4JI2E 1XMOE 4P52A 3Q1QA 1FWLA 4HACB 4DR5I 3HULA 2UU9E 2AJ4A 4KHPE 1N36I 4B3ME 1NHJA 3B82A 3J81C 2UXBE 4B3SE 4Z7YA 2UXDI 4FWGA 3OTOE 4LFAE 1NHHA 3J7AG 4DU8A 3H4LA 1KTVA 2ZITA 1Z0BA 4DR5E 4JI6E 4JG4A 4PRVA 4X65I 4X64I 1UEKA 3WU5A 1N36E 4OX9I 2NPFA 4JI4I 4JI1I 1Z5CA 2VQEE 4B3RI 3ZKBA 2UXDE 5GMEA 1NZ0A 4DV6I 4DR3I 2HKJA 3B78A 3WU6A 4R1FA 2BM0A 2WW4A 1ZM3A 3QT8A 4LFBE 4WUBA 3PYGA 4KQVA 1MG7A
chains in the Genus database with same CATH superfamily
4HACA 1N32I 4IZJD 4X65E 4RPFA 1HNXI 4LCGA 4GKJI 4XTJA 2OI2A 2C39A 4OX9E 2UXCI 4LF4I 4NXNI 2J65A 4FW5A 4JI4E 2Z5CA 1RR9A 3PS3A 3PYEA 4IZJA 5K36C 3B8HA 4FW7A 1MX0A 1Z5BA 4M1KA 3LNUA 3M85D 4IFDF 4DV6E 3PYDA 4DR3E 2O3ZA 4X62I 1I94I 2NN6B 2BM1A 2ZM6I 1ZM4A 4JI0I 4URLA 4DV1I 1ELOA 5DNXA 3WU3A 2V2QA 5BR8I 2PO0B 4J3DA 4LFCI 3ZKDA 2LJPA 4MU1A 1HR0I 5LL6R 1N32E 4B3TI 3NZKA 1Z0EA 1Z0VA 4PU9A 1Y4UA 3M7ND 2JEAA 2UXCE 3U1YA 4LF4E 4NXNE 3K85A 2UUCI 4QNJA 4DV3I 2HK2A 2O1UA 3J80Q 3V5RA 2IOQA 2ZBKB 4HXZA 2JEBB 4GKKI 1YH8A 1Y4SA 3Q6MA 3UHMA 2GQ0A 4X62E 2JE6B 5K36D 4LOMA 3P3GA 4JI0E 1FJGI 2HHHI 5BR8E 2A2CA 4JI7I 2E5LI 4LFCE 2F4VI 2BA0D 2GO3A 1HR0E 1OYRA 4B3TE 1U2RA 2IOPA 4LF5I 1OJ4A 1K47A 1PKPA 1RREA 2Z5CB 4EMDA 1HK7A 4WUCA 5JEAF 4NXMI 3PS1A 2UUCE 1HNWI 4P7AA 2NN6D 4QNKA 4DV3E 4JYAE 4I3HA 4DV5I 4PRXA 4AIMA 2X7IA 4OO1A 3GMEA 4DR4I 1XMQI 4MU4A 3P3CA 5FLXQ 2UUBI 2PNLA 3V2UC 1Y6ZA 5IT9Q 3CDIA 2HK3A 1FJGE 4FW6A 4JI7E 4DPUA 4LCHA 1Z0CA 2F4VE 2XEXA 4MDTA 4UT4A 4LF5E 4HYMA 1KIJA 3QT6A 4USMA 1XNRI 5C0XF 4JI3I 4DV7I 4DR7I 4JI8I 4NXME 1HNWE 3ZZTA 3T1YI 3ZM7A 1BKNA 4ED4A 1N34I 4YY3I 3QT5A 4OZEA 2VF3A 4OKGA 4FW4A 4DR4E 1KVKA 1XMQE 4IS9A 2VQFI 1QZRA 2UUBE 1E3HA 3KRNA 5FWKA 2Q2EB 2R3VA 1XNQI 1J5EI 4DXLA 1IBLI 3F0NA 4ISAA 4X64E 2AE8A 1Y60A 3J80C 5K36E 1KKHA 1ZXMA 5IWAI 4DV0I 5K36F 4MU0A 2V8PA 3PYFA 1S16A 1XNRE 4JI3E 2PO2B 2E1RA 1RHYA 4DV7E 4DR7E 4JI8E 2V34A 3ZZUA 4OO1B 2UUAI 4JI1E 2DEJA 4B3RE 4K0KI 1Z59A 4UTGA 1N34E 4YY3E 1HNZI 3K17A 1IBKI 4FN5A 2HKEA 2VQFE 3Q6NA 3HKMA 2DEIA 2NN6E 2NN6F 5DNLA 4DR2I 2PNZB 4DV4I 3JAMQ 3GONA 4U3DA 1XNQE 1IBLE 1HNXE 3PRYA 2C38B 4GKJE 4IFDB 2NN6C 1WUUA 3QT7A 5IWAE 4DV0E 4JI2I 4U3BA 1YHCA 3U1KA 2VESA 1N0UA 2WP8A 5FLXC 1IBMI 1H7SA 5LMUI 5A2QQ 5IT9C 4DV2I 1B62A 2UUAE 4K0KE 4BA2A 3PS2A 3WU4A 3GLLA 1HNZE 1I94E 1EA6A 2Z5EA 4AQYI 4FWHA 2ZM6E 5GMDA 4FW9A 4LCFA 4DV1E 4LF6I 4MYUA 4DR2E 2WNRA 1MU5A 3LTOA 5LMNI 4DV4E 4JI5I 2A2DA 2HFUA 5DROA 1A6FA 1UDSA 1DARA 1N33I 4OO1D 4WUDA 4DUYI 1NHIA 4DPWA 4DR6I 1N0VC 1IBME 5LMUE 1EI1A 4DV2E 2PO2A 4JI6I 4GKKE 4AQYE 1Y5YA 2Z5BB 5JEAB 4LF6E 4IFDD 3B4TA 2HHHE 3P06A 2E5LE 2JT2A 3K1JA 2V2ZA 2HFSA 2O1VA 4AM3A 5LMNE 4JI5E 2VQEI 1H72C 2BA1G 2CZ9A 2BR2A 2PNZA 2WP8B 3P76A 1N33E 1PIEA 4BA1A 1ZM9A 2C38A 4DUYE 4IFDA 4DR6E 4BA2B 4LF8I 3LPSA 1VI7A 2GS8A 4LFBI 4N3OA 1E3PA 4AIDA 4DV5E 1B63A 4DPTA 1FNMA 2PO1B 3JAMC 4YHHI 3D4JA 2CG9A 3L7ZB 2WNRB 5C0XB 2C37B 4LF7I 1USVA 1UDNA 1P42A 1H74A 1XHKA 1UDOA 5A2QC 4DR1I 3CWVA 2IESA 4LF9I 3GCMA 3J81Q 1D6TA 1H73A 3CDJA 3J7AM 4NBQA 4LF8E 4MYTA 3T1HI 3T1YE 1Z0WA 1FI4A 3M6AA 4OO1E 5JEAD 2R42A 4X66I 1USUA 5K36B 5DRRA 4YHHE 3H1CA 4IZKA 1ZXNA 3ZZ0A 4JV5I 4OO1C 2EFGA 1Z0GA 1FKAE 4LF7E 2J7KA 2BR2B 5EKWA 4DU7A 4USKA 2Z5BA 5JEAA 1J5EE 4Z7CA 4BA1B 4DR1E 4DUZI 2V2VA 4DPYA 1XMOI 4IFDE 1Z5AA 4LF9E 4HY1A 1PVGA 3T1HE 4ZVIA 5L3JA 2UU9I 4IFDC 5C0XD 1Z0TA 4KHPI 2X36A 4X66E 1IBKE 5EL9A 4FWDA 2PO1A 4B3MI 2BV3A 2BA1D 1ZM2A 4JV5E 4MQYA 1FWKA 1H7UA 2UXBI 3L7ZA 5C0XA 2C37A 4B3SI 2O1TA 2PNMA 5ELWA 1S4EA 4JYAI 1VISA 3OTOI 4DPXA 4LFAI 4DUZE 4JI2E 1XMOE 4P52A 1R6LA 3Q1QA 1FWLA 4HACB 3M85G 4DR5I 3HULA 2UU9E 3DD6A 2AJ4A 2O1WA 4KHPE 4IZKB 2C39B 5DRPA 1N36I 2CGEA 4B3ME 1NHJA 5K36A 3B82A 4IZJB 5JEAE 3J81C 2UXBE 4B3SE 4Z7YA 2UXDI 4FWGA 2IERA 3M7NG 3OTOE 4LFAE 2GO4A 1NHHA 5JEAC 1R6MA 3P3EA 1UDQA 3J7AG 5DRQA 4DU8A 3H4LA 1KTVA 2NN6A 1XXEA 2ZITA 2CVEA 1Z0BA 4FW3A 4DR5E 4JI6E 4JG4A 4PRVA 4X65I 2F1DA 3HJCA 4X64I 2PO0A 2JEAB 1UEKA 3WU5A 1N36E 4OX9I 4LPFA 1OYSA 2BA0G 2NPFA 5C0XE 4GQUA 4JI4I 4JI1I 1Z5CA 2VQEE 4B3RI 3ZKBA 2UXDE 5GMEA 1NZ0A 1OYPA 4DV6I 4DR3I 2HKJA 4MU3A 5C0XC 3B78A 3WU6A 4R1FA 2BM0A 2WW4A 2JEBA 1ZM3A 3QT8A 4LFBE 4WUBA 2JE6A 3PYGA 4OO1F 4KQVA 1MG7A
chains in the Genus database with same CATH topology
4HACA 1N32I 4IZJD 4X65E 4RPFA 1HNXI 4GKJI 4XTJA 2OI2A 4OX9E 2UXCI 4LF4I 4NXNI 4JI4E 2Z5CA 1RR9A 3PYEA 4IZJA 3B8HA 1MX0A 1Z5BA 4M1KA 3LNUA 4DV6E 3PYDA 4DR3E 4X62I 1I94I 2BM1A 2ZM6I 1ZM4A 4JI0I 4URLA 4DV1I 1ELOA 3WU3A 2V2QA 5BR8I 4LFCI 3ZKDA 2LJPA 1HR0I 5LL6R 1N32E 4B3TI 1Z0EA 1Z0VA 4PU9A 1Y4UA 2UXCE 4LF4E 4NXNE 3K85A 2UUCI 4DV3I 2HK2A 2O1UA 3J80Q 3V5RA 2IOQA 2ZBKB 4HXZA 4GKKI 1Y4SA 3Q6MA 4X62E 2GQ0A 4JI0E 1FJGI 2HHHI 5BR8E 2A2CA 4JI7I 2E5LI 4LFCE 2F4VI 1HR0E 4B3TE 1U2RA 2IOPA 4LF5I 1OJ4A 1K47A 1PKPA 1RREA 2Z5CB 4EMDA 1HK7A 4WUCA 4NXMI 2UUCE 1HNWI 4P7AA 4DV3E 4JYAE 4I3HA 4DV5I 4PRXA 2X7IA 4DR4I 1XMQI 5FLXQ 2UUBI 2PNLA 3V2UC 1Y6ZA 5IT9Q 2HK3A 1FJGE 4JI7E 4DPUA 1Z0CA 2F4VE 2XEXA 4UT4A 4LF5E 4HYMA 1KIJA 3QT6A 4USMA 1XNRI 4JI3I 4DV7I 4DR7I 4JI8I 4NXME 1HNWE 3ZZTA 3T1YI 3ZM7A 1BKNA 4ED4A 1N34I 4YY3I 3QT5A 2VF3A 4DR4E 1KVKA 1XMQE 2VQFI 1QZRA 2UUBE 5FWKA 2Q2EB 2R3VA 1XNQI 1J5EI 4DXLA 1IBLI 3F0NA 4X64E 3J80C 1KKHA 1ZXMA 5IWAI 4DV0I 2V8PA 3PYFA 1S16A 1XNRE 4JI3E 2E1RA 4DV7E 4DR7E 4JI8E 2V34A 3ZZUA 2UUAI 4JI1E 2DEJA 4B3RE 4K0KI 1Z59A 4UTGA 1N34E 4YY3E 1HNZI 3K17A 1IBKI 4FN5A 2HKEA 2VQFE 3Q6NA 2DEIA 4DR2I 4DV4I 3JAMQ 3GONA 1XNQE 1IBLE 1HNXE 3PRYA 4GKJE 1WUUA 3QT7A 5IWAE 4DV0E 4JI2I 1N0UA 5FLXC 1IBMI 1H7SA 5LMUI 5A2QQ 5IT9C 4DV2I 1B62A 2UUAE 4K0KE 3WU4A 1HNZE 1I94E 1EA6A 2Z5EA 4AQYI 4FWHA 2ZM6E 5GMDA 4FW9A 4DV1E 4LF6I 4MYUA 4DR2E 1MU5A 3LTOA 5LMNI 4DV4E 4JI5I 2A2DA 2HFUA 1A6FA 1DARA 1N33I 4WUDA 4DUYI 1NHIA 4DPWA 4DR6I 1N0VC 1IBME 5LMUE 1EI1A 4DV2E 4JI6I 4GKKE 4AQYE 2Z5BB 4LF6E 2HHHE 3P06A 2E5LE 3K1JA 2V2ZA 2HFSA 2O1VA 5LMNE 4JI5E 2VQEI 1H72C 2CZ9A 1N33E 1PIEA 1ZM9A 4DUYE 4DR6E 4LF8I 3LPSA 2GS8A 4LFBI 4N3OA 4DV5E 1B63A 4DPTA 1FNMA 3JAMC 4YHHI 3D4JA 2CG9A 4LF7I 1USVA 1H74A 1XHKA 5A2QC 4DR1I 3CWVA 4LF9I 3J81Q 1D6TA 1H73A 3J7AM 4LF8E 4MYTA 3T1HI 3T1YE 1Z0WA 1FI4A 3M6AA 2R42A 4X66I 1USUA 4YHHE 4IZKA 1ZXNA 3ZZ0A 4JV5I 2EFGA 1Z0GA 1FKAE 4LF7E 2J7KA 4DU7A 4USKA 2Z5BA 1J5EE 4Z7CA 4DR1E 4DUZI 2V2VA 4DPYA 1XMOI 1Z5AA 4LF9E 4HY1A 1PVGA 3T1HE 4ZVIA 5L3JA 2UU9I 1Z0TA 4KHPI 2X36A 4X66E 1IBKE 4FWDA 4B3MI 2BV3A 1ZM2A 4JV5E 1FWKA 1H7UA 2UXBI 4B3SI 2O1TA 2PNMA 1S4EA 4JYAI 1VISA 3OTOI 4DPXA 4LFAI 4DUZE 4JI2E 1XMOE 4P52A 3Q1QA 1FWLA 4HACB 4DR5I 3HULA 2UU9E 2AJ4A 2O1WA 4KHPE 4IZKB 1N36I 2CGEA 4B3ME 1NHJA 3B82A 4IZJB 3J81C 2UXBE 4B3SE 4Z7YA 2UXDI 4FWGA 3OTOE 4LFAE 1NHHA 3J7AG 4DU8A 3H4LA 1KTVA 2ZITA 1Z0BA 4DR5E 4JI6E 4JG4A 4PRVA 4X65I 3HJCA 4X64I 1UEKA 3WU5A 1N36E 4OX9I 2NPFA 4JI4I 4JI1I 1Z5CA 2VQEE 4B3RI 3ZKBA 2UXDE 5GMEA 1NZ0A 4DV6I 4DR3I 2HKJA 3B78A 3WU6A 4R1FA 2BM0A 2WW4A 1ZM3A 3QT8A 4LFBE 4WUBA 3PYGA 4KQVA 1MG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAC A;  1N32 I;  4X65 E;  4RPF A;  1HNX I;  4GKJ I;  4XTJ A;  2OI2 A;  4OX9 E;  2UXC I;  4LF4 I;  4NXN I;  4JI4 E;  1RR9 A;  3PYE A;  3B8H A;  1MX0 A;  1Z5B A;  4M1K A;  3LNU A;  4DV6 E;  3PYD A;  4DR3 E;  4X62 I;  1I94 I;  2BM1 A;  2ZM6 I;  1ZM4 A;  4JI0 I;  4URL A;  4DV1 I;  1ELO A;  3WU3 A;  2V2Q A;  5BR8 I;  4LFC I;  3ZKD A;  2LJP A;  1HR0 I;  5LL6 R;  1N32 E;  4B3T I;  1Z0E A;  1Z0V A;  4PU9 A;  2UXC E;  4LF4 E;  4NXN E;  2UUC I;  4DV3 I;  2HK2 A;  3J80 Q;  3V5R A;  2ZBK B;  4HXZ A;  4GKK I;  4X62 E;  4JI0 E;  1FJG I;  2HHH I;  5BR8 E;  2A2C A;  4JI7 I;  2E5L I;  4LFC E;  2F4V I;  1HR0 E;  4B3T E;  1U2R A;  4LF5 I;  1OJ4 A;  1K47 A;  1PKP A;  1RRE A;  4EMD A;  4WUC A;  4NXM I;  2UUC E;  1HNW I;  4P7A A;  4DV3 E;  4JYA E;  4I3H A;  4DV5 I;  4PRX A;  2X7I A;  4DR4 I;  1XMQ I;  5FLX Q;  2UUB I;  3V2U C;  5IT9 Q;  2HK3 A;  1FJG E;  4JI7 E;  4DPU A;  1Z0C A;  2F4V E;  2XEX A;  4UT4 A;  4LF5 E;  4HYM A;  1KIJ A;  3QT6 A;  4USM A;  1XNR I;  4JI3 I;  4DV7 I;  4DR7 I;  4JI8 I;  4NXM E;  1HNW E;  3ZZT A;  3T1Y I;  3ZM7 A;  1BKN A;  4ED4 A;  1N34 I;  4YY3 I;  3QT5 A;  2VF3 A;  4DR4 E;  1KVK A;  1XMQ E;  2VQF I;  1QZR A;  2UUB E;  2Q2E B;  2R3V A;  1XNQ I;  1J5E I;  4DXL A;  1IBL I;  3F0N A;  4X64 E;  3J80 C;  1KKH A;  1ZXM A;  5IWA I;  4DV0 I;  2V8P A;  3PYF A;  1S16 A;  1XNR E;  4JI3 E;  2E1R A;  4DV7 E;  4DR7 E;  4JI8 E;  2V34 A;  3ZZU A;  2UUA I;  4JI1 E;  2DEJ A;  4B3R E;  4K0K I;  1Z59 A;  4UTG A;  1N34 E;  4YY3 E;  1HNZ I;  3K17 A;  1IBK I;  4FN5 A;  2HKE A;  2VQF E;  2DEI A;  4DR2 I;  4DV4 I;  3JAM Q;  3GON A;  1XNQ E;  1IBL E;  1HNX E;  4GKJ E;  1WUU A;  3QT7 A;  5IWA E;  4DV0 E;  4JI2 I;  1N0U A;  5FLX C;  1IBM I;  1H7S A;  5LMU I;  5A2Q Q;  5IT9 C;  4DV2 I;  1B62 A;  2UUA E;  4K0K E;  3WU4 A;  1HNZ E;  1I94 E;  1EA6 A;  4AQY I;  4FWH A;  2ZM6 E;  5GMD A;  4FW9 A;  4DV1 E;  4LF6 I;  4MYU A;  4DR2 E;  1MU5 A;  3LTO A;  5LMN I;  4DV4 E;  4JI5 I;  2A2D A;  2HFU A;  1A6F A;  1DAR A;  1N33 I;  4WUD A;  4DUY I;  1NHI A;  4DPW A;  4DR6 I;  1N0V C;  1IBM E;  5LMU E;  1EI1 A;  4DV2 E;  4JI6 I;  4GKK E;  4AQY E;  4LF6 E;  2HHH E;  2E5L E;  3K1J A;  2V2Z A;  2HFS A;  5LMN E;  4JI5 E;  2VQE I;  1H72 C;  2CZ9 A;  1N33 E;  1PIE A;  1ZM9 A;  4DUY E;  4DR6 E;  4LF8 I;  3LPS A;  2GS8 A;  4LFB I;  4DV5 E;  1B63 A;  4DPT A;  1FNM A;  3JAM C;  4YHH I;  3D4J A;  4LF7 I;  1H74 A;  1XHK A;  5A2Q C;  4DR1 I;  3CWV A;  4LF9 I;  3J81 Q;  1D6T A;  1H73 A;  3J7A M;  4LF8 E;  4MYT A;  3T1H I;  3T1Y E;  1Z0W A;  1FI4 A;  3M6A A;  2R42 A;  4X66 I;  4YHH E;  1ZXN A;  3ZZ0 A;  4JV5 I;  2EFG A;  1Z0G A;  1FKA E;  4LF7 E;  2J7K A;  4DU7 A;  4USK A;  1J5E E;  4Z7C A;  4DR1 E;  4DUZ I;  2V2V A;  4DPY A;  1XMO I;  1Z5A A;  4LF9 E;  4HY1 A;  1PVG A;  3T1H E;  4ZVI A;  5L3J A;  2UU9 I;  1Z0T A;  4KHP I;  2X36 A;  4X66 E;  1IBK E;  4FWD A;  4B3M I;  2BV3 A;  1ZM2 A;  4JV5 E;  1FWK A;  1H7U A;  2UXB I;  4B3S I;  1S4E A;  4JYA I;  1VIS A;  3OTO I;  4DPX A;  4LFA I;  4DUZ E;  4JI2 E;  1XMO E;  4P52 A;  3Q1Q A;  1FWL A;  4HAC B;  4DR5 I;  3HUL A;  2UU9 E;  2AJ4 A;  4KHP E;  1N36 I;  4B3M E;  1NHJ A;  3B82 A;  3J81 C;  2UXB E;  4B3S E;  4Z7Y A;  2UXD I;  4FWG A;  3OTO E;  4LFA E;  1NHH A;  3J7A G;  4DU8 A;  3H4L A;  1KTV A;  2ZIT A;  1Z0B A;  4DR5 E;  4JI6 E;  4JG4 A;  4PRV A;  4X65 I;  4X64 I;  1UEK A;  3WU5 A;  1N36 E;  4OX9 I;  2NPF A;  4JI4 I;  4JI1 I;  1Z5C A;  2VQE E;  4B3R I;  3ZKB A;  2UXD E;  5GME A;  1NZ0 A;  4DV6 I;  4DR3 I;  2HKJ A;  3B78 A;  3WU6 A;  4R1F A;  2BM0 A;  2WW4 A;  1ZM3 A;  3QT8 A;  4LFB E;  4WUB A;  3PYG A;  4KQV A;  1MG7 A; 
#chains in the Genus database with same CATH topology
 4HAC A;  1N32 I;  4IZJ D;  4X65 E;  4RPF A;  1HNX I;  4LCG A;  4GKJ I;  4XTJ A;  2OI2 A;  2C39 A;  4OX9 E;  2UXC I;  4LF4 I;  4NXN I;  2J65 A;  4FW5 A;  4JI4 E;  2Z5C A;  1RR9 A;  3PS3 A;  3PYE A;  4IZJ A;  5K36 C;  3B8H A;  4FW7 A;  1MX0 A;  1Z5B A;  4M1K A;  3LNU A;  3M85 D;  4IFD F;  4DV6 E;  3PYD A;  4DR3 E;  2O3Z A;  4X62 I;  1I94 I;  2NN6 B;  2BM1 A;  2ZM6 I;  1ZM4 A;  4JI0 I;  4URL A;  4DV1 I;  1ELO A;  5DNX A;  3WU3 A;  2V2Q A;  5BR8 I;  2PO0 B;  4J3D A;  4LFC I;  3ZKD A;  2LJP A;  4MU1 A;  1HR0 I;  5LL6 R;  1N32 E;  4B3T I;  3NZK A;  1Z0E A;  1Z0V A;  4PU9 A;  1Y4U A;  3M7N D;  2JEA A;  2UXC E;  3U1Y A;  4LF4 E;  4NXN E;  3K85 A;  2UUC I;  4QNJ A;  4DV3 I;  2HK2 A;  2O1U A;  3J80 Q;  3V5R A;  2IOQ A;  2ZBK B;  4HXZ A;  2JEB B;  4GKK I;  1YH8 A;  1Y4S A;  3Q6M A;  3UHM A;  2GQ0 A;  4X62 E;  2JE6 B;  5K36 D;  4LOM A;  3P3G A;  4JI0 E;  1FJG I;  2HHH I;  5BR8 E;  2A2C A;  4JI7 I;  2E5L I;  4LFC E;  2F4V I;  2BA0 D;  2GO3 A;  1HR0 E;  1OYR A;  4B3T E;  1U2R A;  2IOP A;  4LF5 I;  1OJ4 A;  1K47 A;  1PKP A;  1RRE A;  2Z5C B;  4EMD A;  1HK7 A;  4WUC A;  5JEA F;  4NXM I;  3PS1 A;  2UUC E;  1HNW I;  4P7A A;  2NN6 D;  4QNK A;  4DV3 E;  4JYA E;  4I3H A;  4DV5 I;  4PRX A;  4AIM A;  2X7I A;  4OO1 A;  3GME A;  4DR4 I;  1XMQ I;  4MU4 A;  3P3C A;  5FLX Q;  2UUB I;  2PNL A;  3V2U C;  1Y6Z A;  5IT9 Q;  3CDI A;  2HK3 A;  1FJG E;  4FW6 A;  4JI7 E;  4DPU A;  4LCH A;  1Z0C A;  2F4V E;  2XEX A;  4MDT A;  4UT4 A;  4LF5 E;  4HYM A;  1KIJ A;  3QT6 A;  4USM A;  1XNR I;  5C0X F;  4JI3 I;  4DV7 I;  4DR7 I;  4JI8 I;  4NXM E;  1HNW E;  3ZZT A;  3T1Y I;  3ZM7 A;  1BKN A;  4ED4 A;  1N34 I;  4YY3 I;  3QT5 A;  4OZE A;  2VF3 A;  4OKG A;  4FW4 A;  4DR4 E;  1KVK A;  1XMQ E;  4IS9 A;  2VQF I;  1QZR A;  2UUB E;  1E3H A;  3KRN A;  5FWK A;  2Q2E B;  2R3V A;  1XNQ I;  1J5E I;  4DXL A;  1IBL I;  3F0N A;  4ISA A;  4X64 E;  2AE8 A;  1Y60 A;  3J80 C;  5K36 E;  1KKH A;  1ZXM A;  5IWA I;  4DV0 I;  5K36 F;  4MU0 A;  2V8P A;  3PYF A;  1S16 A;  1XNR E;  4JI3 E;  2PO2 B;  2E1R A;  1RHY A;  4DV7 E;  4DR7 E;  4JI8 E;  2V34 A;  3ZZU A;  4OO1 B;  2UUA I;  4JI1 E;  2DEJ A;  4B3R E;  4K0K I;  1Z59 A;  4UTG A;  1N34 E;  4YY3 E;  1HNZ I;  3K17 A;  1IBK I;  4FN5 A;  2HKE A;  2VQF E;  3Q6N A;  3HKM A;  2DEI A;  2NN6 E;  2NN6 F;  5DNL A;  4DR2 I;  2PNZ B;  4DV4 I;  3JAM Q;  3GON A;  4U3D A;  1XNQ E;  1IBL E;  1HNX E;  3PRY A;  2C38 B;  4GKJ E;  4IFD B;  2NN6 C;  1WUU A;  3QT7 A;  5IWA E;  4DV0 E;  4JI2 I;  4U3B A;  1YHC A;  3U1K A;  2VES A;  1N0U A;  2WP8 A;  5FLX C;  1IBM I;  1H7S A;  5LMU I;  5A2Q Q;  5IT9 C;  4DV2 I;  1B62 A;  2UUA E;  4K0K E;  4BA2 A;  3PS2 A;  3WU4 A;  3GLL A;  1HNZ E;  1I94 E;  1EA6 A;  2Z5E A;  4AQY I;  4FWH A;  2ZM6 E;  5GMD A;  4FW9 A;  4LCF A;  4DV1 E;  4LF6 I;  4MYU A;  4DR2 E;  2WNR A;  1MU5 A;  3LTO A;  5LMN I;  4DV4 E;  4JI5 I;  2A2D A;  2HFU A;  5DRO A;  1A6F A;  1UDS A;  1DAR A;  1N33 I;  4OO1 D;  4WUD A;  4DUY I;  1NHI A;  4DPW A;  4DR6 I;  1N0V C;  1IBM E;  5LMU E;  1EI1 A;  4DV2 E;  2PO2 A;  4JI6 I;  4GKK E;  4AQY E;  1Y5Y A;  2Z5B B;  5JEA B;  4LF6 E;  4IFD D;  3B4T A;  2HHH E;  3P06 A;  2E5L E;  2JT2 A;  3K1J A;  2V2Z A;  2HFS A;  2O1V A;  4AM3 A;  5LMN E;  4JI5 E;  2VQE I;  1H72 C;  2BA1 G;  2CZ9 A;  2BR2 A;  2PNZ A;  2WP8 B;  3P76 A;  1N33 E;  1PIE A;  4BA1 A;  1ZM9 A;  2C38 A;  4DUY E;  4IFD A;  4DR6 E;  4BA2 B;  4LF8 I;  3LPS A;  1VI7 A;  2GS8 A;  4LFB I;  4N3O A;  1E3P A;  4AID A;  4DV5 E;  1B63 A;  4DPT A;  1FNM A;  2PO1 B;  3JAM C;  4YHH I;  3D4J A;  2CG9 A;  3L7Z B;  2WNR B;  5C0X B;  2C37 B;  4LF7 I;  1USV A;  1UDN A;  1P42 A;  1H74 A;  1XHK A;  1UDO A;  5A2Q C;  4DR1 I;  3CWV A;  2IES A;  4LF9 I;  3GCM A;  3J81 Q;  1D6T A;  1H73 A;  3CDJ A;  3J7A M;  4NBQ A;  4LF8 E;  4MYT A;  3T1H I;  3T1Y E;  1Z0W A;  1FI4 A;  3M6A A;  4OO1 E;  5JEA D;  2R42 A;  4X66 I;  1USU A;  5K36 B;  5DRR A;  4YHH E;  3H1C A;  4IZK A;  1ZXN A;  3ZZ0 A;  4JV5 I;  4OO1 C;  2EFG A;  1Z0G A;  1FKA E;  4LF7 E;  2J7K A;  2BR2 B;  5EKW A;  4DU7 A;  4USK A;  2Z5B A;  5JEA A;  1J5E E;  4Z7C A;  4BA1 B;  4DR1 E;  4DUZ I;  2V2V A;  4DPY A;  1XMO I;  4IFD E;  1Z5A A;  4LF9 E;  4HY1 A;  1PVG A;  3T1H E;  4ZVI A;  5L3J A;  2UU9 I;  4IFD C;  5C0X D;  1Z0T A;  4KHP I;  2X36 A;  4X66 E;  1IBK E;  5EL9 A;  4FWD A;  2PO1 A;  4B3M I;  2BV3 A;  2BA1 D;  1ZM2 A;  4JV5 E;  4MQY A;  1FWK A;  1H7U A;  2UXB I;  3L7Z A;  5C0X A;  2C37 A;  4B3S I;  2O1T A;  2PNM A;  5ELW A;  1S4E A;  4JYA I;  1VIS A;  3OTO I;  4DPX A;  4LFA I;  4DUZ E;  4JI2 E;  1XMO E;  4P52 A;  1R6L A;  3Q1Q A;  1FWL A;  4HAC B;  3M85 G;  4DR5 I;  3HUL A;  2UU9 E;  3DD6 A;  2AJ4 A;  2O1W A;  4KHP E;  4IZK B;  2C39 B;  5DRP A;  1N36 I;  2CGE A;  4B3M E;  1NHJ A;  5K36 A;  3B82 A;  4IZJ B;  5JEA E;  3J81 C;  2UXB E;  4B3S E;  4Z7Y A;  2UXD I;  4FWG A;  2IER A;  3M7N G;  3OTO E;  4LFA E;  2GO4 A;  1NHH A;  5JEA C;  1R6M A;  3P3E A;  1UDQ A;  3J7A G;  5DRQ A;  4DU8 A;  3H4L A;  1KTV A;  2NN6 A;  1XXE A;  2ZIT A;  2CVE A;  1Z0B A;  4FW3 A;  4DR5 E;  4JI6 E;  4JG4 A;  4PRV A;  4X65 I;  2F1D A;  3HJC A;  4X64 I;  2PO0 A;  2JEA B;  1UEK A;  3WU5 A;  1N36 E;  4OX9 I;  4LPF A;  1OYS A;  2BA0 G;  2NPF A;  5C0X E;  4GQU A;  4JI4 I;  4JI1 I;  1Z5C A;  2VQE E;  4B3R I;  3ZKB A;  2UXD E;  5GME A;  1NZ0 A;  1OYP A;  4DV6 I;  4DR3 I;  2HKJ A;  4MU3 A;  5C0X C;  3B78 A;  3WU6 A;  4R1F A;  2BM0 A;  2WW4 A;  2JEB A;  1ZM3 A;  3QT8 A;  4LFB E;  4WUB A;  2JE6 A;  3PYG A;  4OO1 F;  4KQV A;  1MG7 A; 
#chains in the Genus database with same CATH homology
 4HAC A;  1N32 I;  4IZJ D;  4X65 E;  4RPF A;  1HNX I;  4GKJ I;  4XTJ A;  2OI2 A;  4OX9 E;  2UXC I;  4LF4 I;  4NXN I;  4JI4 E;  2Z5C A;  1RR9 A;  3PYE A;  4IZJ A;  3B8H A;  1MX0 A;  1Z5B A;  4M1K A;  3LNU A;  4DV6 E;  3PYD A;  4DR3 E;  4X62 I;  1I94 I;  2BM1 A;  2ZM6 I;  1ZM4 A;  4JI0 I;  4URL A;  4DV1 I;  1ELO A;  3WU3 A;  2V2Q A;  5BR8 I;  4LFC I;  3ZKD A;  2LJP A;  1HR0 I;  5LL6 R;  1N32 E;  4B3T I;  1Z0E A;  1Z0V A;  4PU9 A;  1Y4U A;  2UXC E;  4LF4 E;  4NXN E;  3K85 A;  2UUC I;  4DV3 I;  2HK2 A;  2O1U A;  3J80 Q;  3V5R A;  2IOQ A;  2ZBK B;  4HXZ A;  4GKK I;  1Y4S A;  3Q6M A;  4X62 E;  2GQ0 A;  4JI0 E;  1FJG I;  2HHH I;  5BR8 E;  2A2C A;  4JI7 I;  2E5L I;  4LFC E;  2F4V I;  1HR0 E;  4B3T E;  1U2R A;  2IOP A;  4LF5 I;  1OJ4 A;  1K47 A;  1PKP A;  1RRE A;  2Z5C B;  4EMD A;  1HK7 A;  4WUC A;  4NXM I;  2UUC E;  1HNW I;  4P7A A;  4DV3 E;  4JYA E;  4I3H A;  4DV5 I;  4PRX A;  2X7I A;  4DR4 I;  1XMQ I;  5FLX Q;  2UUB I;  2PNL A;  3V2U C;  1Y6Z A;  5IT9 Q;  2HK3 A;  1FJG E;  4JI7 E;  4DPU A;  1Z0C A;  2F4V E;  2XEX A;  4UT4 A;  4LF5 E;  4HYM A;  1KIJ A;  3QT6 A;  4USM A;  1XNR I;  4JI3 I;  4DV7 I;  4DR7 I;  4JI8 I;  4NXM E;  1HNW E;  3ZZT A;  3T1Y I;  3ZM7 A;  1BKN A;  4ED4 A;  1N34 I;  4YY3 I;  3QT5 A;  2VF3 A;  4DR4 E;  1KVK A;  1XMQ E;  2VQF I;  1QZR A;  2UUB E;  5FWK A;  2Q2E B;  2R3V A;  1XNQ I;  1J5E I;  4DXL A;  1IBL I;  3F0N A;  4X64 E;  3J80 C;  1KKH A;  1ZXM A;  5IWA I;  4DV0 I;  2V8P A;  3PYF A;  1S16 A;  1XNR E;  4JI3 E;  2E1R A;  4DV7 E;  4DR7 E;  4JI8 E;  2V34 A;  3ZZU A;  2UUA I;  4JI1 E;  2DEJ A;  4B3R E;  4K0K I;  1Z59 A;  4UTG A;  1N34 E;  4YY3 E;  1HNZ I;  3K17 A;  1IBK I;  4FN5 A;  2HKE A;  2VQF E;  3Q6N A;  2DEI A;  4DR2 I;  4DV4 I;  3JAM Q;  3GON A;  1XNQ E;  1IBL E;  1HNX E;  3PRY A;  4GKJ E;  1WUU A;  3QT7 A;  5IWA E;  4DV0 E;  4JI2 I;  1N0U A;  5FLX C;  1IBM I;  1H7S A;  5LMU I;  5A2Q Q;  5IT9 C;  4DV2 I;  1B62 A;  2UUA E;  4K0K E;  3WU4 A;  1HNZ E;  1I94 E;  1EA6 A;  2Z5E A;  4AQY I;  4FWH A;  2ZM6 E;  5GMD A;  4FW9 A;  4DV1 E;  4LF6 I;  4MYU A;  4DR2 E;  1MU5 A;  3LTO A;  5LMN I;  4DV4 E;  4JI5 I;  2A2D A;  2HFU A;  1A6F A;  1DAR A;  1N33 I;  4WUD A;  4DUY I;  1NHI A;  4DPW A;  4DR6 I;  1N0V C;  1IBM E;  5LMU E;  1EI1 A;  4DV2 E;  4JI6 I;  4GKK E;  4AQY E;  2Z5B B;  4LF6 E;  2HHH E;  3P06 A;  2E5L E;  3K1J A;  2V2Z A;  2HFS A;  2O1V A;  5LMN E;  4JI5 E;  2VQE I;  1H72 C;  2CZ9 A;  1N33 E;  1PIE A;  1ZM9 A;  4DUY E;  4DR6 E;  4LF8 I;  3LPS A;  2GS8 A;  4LFB I;  4N3O A;  4DV5 E;  1B63 A;  4DPT A;  1FNM A;  3JAM C;  4YHH I;  3D4J A;  2CG9 A;  4LF7 I;  1USV A;  1H74 A;  1XHK A;  5A2Q C;  4DR1 I;  3CWV A;  4LF9 I;  3J81 Q;  1D6T A;  1H73 A;  3J7A M;  4LF8 E;  4MYT A;  3T1H I;  3T1Y E;  1Z0W A;  1FI4 A;  3M6A A;  2R42 A;  4X66 I;  1USU A;  4YHH E;  4IZK A;  1ZXN A;  3ZZ0 A;  4JV5 I;  2EFG A;  1Z0G A;  1FKA E;  4LF7 E;  2J7K A;  4DU7 A;  4USK A;  2Z5B A;  1J5E E;  4Z7C A;  4DR1 E;  4DUZ I;  2V2V A;  4DPY A;  1XMO I;  1Z5A A;  4LF9 E;  4HY1 A;  1PVG A;  3T1H E;  4ZVI A;  5L3J A;  2UU9 I;  1Z0T A;  4KHP I;  2X36 A;  4X66 E;  1IBK E;  4FWD A;  4B3M I;  2BV3 A;  1ZM2 A;  4JV5 E;  1FWK A;  1H7U A;  2UXB I;  4B3S I;  2O1T A;  2PNM A;  1S4E A;  4JYA I;  1VIS A;  3OTO I;  4DPX A;  4LFA I;  4DUZ E;  4JI2 E;  1XMO E;  4P52 A;  3Q1Q A;  1FWL A;  4HAC B;  4DR5 I;  3HUL A;  2UU9 E;  2AJ4 A;  2O1W A;  4KHP E;  4IZK B;  1N36 I;  2CGE A;  4B3M E;  1NHJ A;  3B82 A;  4IZJ B;  3J81 C;  2UXB E;  4B3S E;  4Z7Y A;  2UXD I;  4FWG A;  3OTO E;  4LFA E;  1NHH A;  3J7A G;  4DU8 A;  3H4L A;  1KTV A;  2ZIT A;  1Z0B A;  4DR5 E;  4JI6 E;  4JG4 A;  4PRV A;  4X65 I;  3HJC A;  4X64 I;  1UEK A;  3WU5 A;  1N36 E;  4OX9 I;  2NPF A;  4JI4 I;  4JI1 I;  1Z5C A;  2VQE E;  4B3R I;  3ZKB A;  2UXD E;  5GME A;  1NZ0 A;  4DV6 I;  4DR3 I;  2HKJ A;  3B78 A;  3WU6 A;  4R1F A;  2BM0 A;  2WW4 A;  1ZM3 A;  3QT8 A;  4LFB E;  4WUB A;  3PYG A;  4KQV A;  1MG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...