4JI6I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6I00
4DR3I 3ZZUA 4X64I 4LF6I 1XNRE 4DR4E 4KHPE 1Z5CA 4DV2E 1Z5BA 4B3TE 4GKJE 3D4JA 2UUBI 1K47A 4ZVIA 1FI4A 5L3JA 3ZZTA 3PYGA 2F4VE 1MX0A 1IBME 2J7KA 1B63A 4NXME 5IWAI 4FWDA 4YHHI 4DPXA 1NHIA 1DARA 4NXNI 4DV1E 5LL6R 4DPUA 4FW9A 4B3ME 1S16A 3M6AA 5LMNE 4JI4E 4JI6E 4JI4I 2E5LI 1HNWI 1ZXMA 1NHJA 4JV5I 4DU7A 2HK3A 1FJGE 2VQFE 4DPTA 3T1YI 4DPYA 4DV6E 1OJ4A 3WU6A 1Z0EA 2HKEA 5FLXC 2HFUA 5A2QC 4RPFA 4HACA 4LF9E 4PU9A 1Z0GA 2X36A 4HXZA 4ED4A 1KTVA 1S4EA 2UUCI 1XHKA 5IT9Q 1FWKA 4LFAE 4AQYE 4DV7E 1Z5AA 4JI2E 4GKKI 4JI2I 1KVKA 4JI5E 4DR6E 4DR6I 1H73A 2HK2A 3J80C 4JYAE 2BV3A 1MU5A 4X66I 3PYFA 1U2RA 4LFBE 3F0NA 4MYTA 3ZM7A 2R42A 4LF5I 4X65I 4JI0E 2ZM6E 1HR0E 1RREA 4JI7E 4FWGA 4LFCE 1IBLI 3H4LA 1H74A 1NHHA 3ZZ0A 1ZM2A 4P52A 2UXCI 2GS8A 4DR3E 1I94I 4X64E 4LF6E 4WUDA 4DR7I 2UUBE 3CWVA 3JAMQ 1A6FA 1EA6A 1Z0CA 3B82A 2UUAI 3OTOE 3OTOI 5IWAE 4YHHE 3ZKDA 3WU3A 4NXNE 2EFGA 4B3SI 4I3HA 3PYDA 1XNQE 1XNQI 4JI3I 2R3VA 2VF3A 5IT9C 4DR5I 3QT5A 2E5LE 1HNWE 1MG7A 4JV5E 1N36I 1Z0TA 2V2ZA 1J5EI 3WU5A 1N33E 4LF4I 1NZ0A 1N33I 3T1YE 4JI8I 2X7IA 4JI1I 1PIEA 2ZBKB 5LMUI 3B78A 2V34A 1KKHA 2BM1A 2UXBI 4PRVA 2UXDI 3K1JA 4UT4A 2UUCE 4WUBA 3QT6A 4DV0I 1H7UA 4DUYI 4LF7I 4GKKE 2HKJA 1QZRA 2ZITA 4X62I 4DV5I 2NPFA 3J81C 2A2DA 4X66E 4HYMA 4DUZE 4DU8A 4DUZI 4B3RI 1B62A 4DPWA 1N34E 1N34I 4FWHA 4URLA 1N32I 3JAMC 4YY3I 2UU9E 4M1KA 2UU9I 4HY1A 1H7SA 2DEJA 4P7AA 1Z59A 4LF5E 4X65E 1ZM9A 4LF8I 3LPSA 3QT7A 4Z7CA 2HFSA 2V2VA 5FLXQ 1IBLE 1KIJA 2V8PA 4WUCA 4K0KI 2A2CA 3ZKBA 2HHHI 2UXCE 1I94E 3B8HA 4FN5A 3T1HI 4DR7E 4Z7YA 2BM0A 4DV4I 2UUAE 5BR8I 1HNZI 1XMOI 1H72C 4DR2E 4DR2I 1UEKA 4B3SE 1XNRI 4DR4I 4KHPI 4DV2I 4B3TI 4GKJI 4JI3E 2OI2A 4DV3E 4DV3I 2LJPA 3J7AM 2F4VI 1IBMI 4DR5E 4DXLA 4NXMI 1FNMA 1HNXE 1HNXI 1N36E 4HACB 4DV1I 4XTJA 1J5EE 3LTOA 4LF4E 4B3MI 3K17A 4DR1E 2VQEE 1N0VC 4JI8E 2VQEI 4UTGA 4DR1I 2DEIA 4JI1E 2V2QA 5LMNI 5LMUE 1RR9A 3V5RA 1EI1A 1FWLA 1ZM3A 4JI6I 2UXBE 4MYUA 2UXDE 4PRXA 1WUUA 3LNUA 3GONA 1FJGI 2VQFI 4DV0E 4EMDA 4DUYE 4LF7E 4DV6I 4X62E 2XEXA 4OX9E 4OX9I 4DV5E 4LF9I 1PKPA 1ZM4A 4KQVA 1Z0WA 2AJ4A 3QT8A 1PVGA 4LFAI 4B3RE 3Q1QA 4AQYI 3PYEA 4DV7I 4JI5I 1N32E 5GMEA 3J7AG 1ELOA 4YY3E 2Q2EB 1IBKE 4JYAI 1IBKI 3WU4A 4LF8E 1Z0BA 4R1FA 5A2QQ 4LFBI 4K0KE 2E1RA 2WW4A 1FKAE 2HHHE 2CZ9A 1XMQE 1ZXNA 1XMQI 3HULA 1Z0VA 3T1HE 4JI0I 2ZM6I 1HR0I 4USMA 4JI7I 3V2UC 4USKA 4LFCI 4DV4E 1BKNA 4JG4A 5GMDA 5BR8E 1N0UA 3J80Q 1D6TA 3J81Q 1HNZE 1XMOE 1VISA
chains in the Genus database with same CATH superfamily
4DR3I 3ZZUA 3GLLA 4X64I 4J3DA 4LF6I 1XNRE 2PO1A 4IFDC 3P3EA 4DR4E 4KHPE 1Z5CA 4DV2E 1Z5BA 4B3TE 4GKJE 4MU0A 3D4JA 2UUBI 1K47A 5C0XB 3DD6A 4ZVIA 1FI4A 5L3JA 3ZZTA 3PYGA 5EKWA 4FW3A 2F4VE 1MX0A 1IBME 2J7KA 2JE6A 1B63A 4NXME 4LOMA 5IWAI 4FWDA 1UDOA 4YHHI 5DRRA 4DPXA 2NN6C 1NHIA 1DARA 2PNLA 4NXNI 4DV1E 5LL6R 2WNRA 2WP8A 4FW9A 4DPUA 4B3ME 5K36D 1S16A 5JEAF 3M6AA 5LMNE 2CGEA 4JI4E 4JI6E 4JI4I 1Y4SA 2E5LI 1HNWI 1ZXMA 1NHJA 4JV5I 3P3GA 4DU7A 2HK3A 4IFDD 1FJGE 2VQFE 4DPTA 3T1YI 4DPYA 2BA0G 4DV6E 1OJ4A 3WU6A 4IS9A 4AIMA 1Z0EA 2HKEA 5FLXC 2HFUA 5A2QC 4RPFA 2NN6D 4HACA 4LF9E 4PU9A 1Z0GA 2X36A 4HXZA 4ED4A 5DNXA 1KTVA 1S4EA 2UUCI 1XHKA 5IT9Q 4NBQA 1FWKA 3KRNA 4LFAE 5C0XC 4AQYE 4DV7E 4FW6A 1Z5AA 4JI2E 4GKKI 4JI2I 1KVKA 4JI5E 4DR6E 2C37A 4DR6I 1H73A 2HK2A 3PS3A 3J80C 3P76A 4JYAE 2GO4A 2BV3A 1MU5A 4X66I 5JEAB 3PYFA 5EL9A 1U2RA 4LFBE 3Q6NA 3F0NA 4IFDE 4MU1A 2CVEA 4MYTA 3ZM7A 1USUA 2O1UA 4MDTA 3GMEA 2R42A 4LF5I 4X65I 4JI0E 2ZM6E 1HR0E 1RREA 4JI7E 4FWGA 4FW5A 5C0XD 4LFCE 1IBLI 3L7ZB 3NZKA 3H4LA 2O1WA 1H74A 1NHHA 2BA1D 2IOQA 3ZZ0A 1ZM2A 4P52A 2UXCI 2GS8A 4DR3E 1I94I 4X64E 4LF6E 3P3CA 2O1VA 1USVA 4WUDA 2PO0A 4OZEA 4BA2B 4DR7I 2UUBE 3CWVA 5JEAA 3JAMQ 1A6FA 1UDQA 1EA6A 5DROA 1Z0CA 3B82A 2UUAI 4GQUA 3OTOE 2J65A 3OTOI 5IWAE 4YHHE 3ZKDA 3WU3A 4OKGA 4NXNE 2EFGA 4B3SI 4I3HA 2IESA 3PYDA 1R6LA 4MU4A 1XNQE 1XNQI 4JI3I 3L7ZA 5JEAC 2R3VA 2VF3A 5IT9C 4DR5I 5ELWA 3QT5A 2JEAB 2E5LE 2C38B 4OO1F 1HNWE 4LCHA 4FW4A 1MG7A 4JV5E 5C0XE 1Z0TA 1N36I 2V2ZA 2O3ZA 1J5EI 3WU5A 1N33E 4LF4I 1NZ0A 1N33I 5C0XA 4MU3A 1XXEA 3Q6MA 4JI8I 3T1YE 2X7IA 2PNZB 4JI1I 1PIEA 2ZBKB 1E3HA 5LMUI 3B78A 2V34A 1KKHA 2BM1A 2UXBI 4PRVA 2UXDI 2IOPA 2Z5EA 3K1JA 3U1KA 4LPFA 4UT4A 2UUCE 4WUBA 3GCMA 3QT6A 4DV0I 5JEAD 1H7UA 2AE8A 4DUYI 3CDIA 3M85G 2HKJA 4LF7I 4GKKE 1QZRA 2JEAA 2ZITA 3PS2A 4X62I 4DV5I 2NPFA 3J81C 4QNJA 2Z5CB 2VESA 2A2DA 1P42A 4X66E 4HYMA 4DUZE 2BA1G 4DU8A 4DUZI 4B3RI 4BA1B 4U3DA 1B62A 4DPWA 1N34E 2PNMA 1N34I 4FWHA 4URLA 1N32I 4OO1B 4N3OA 3JAMC 4YY3I 2NN6B 4M1KA 2UU9E 2UU9I 1OYRA 4HY1A 1H7SA 2DEJA 2C39B 4P7AA 1Z59A 4LF5E 4X65E 1ZM9A 4LF8I 3LPSA 3QT7A 4Z7CA 4ISAA 2HFSA 2V2VA 5FLXQ 1IBLE 1KIJA 2Z5BB 2V8PA 4WUCA 4K0KI 2A2CA 2JE6B 4IZJB 3ZKBA 2HHHI 2UXCE 1I94E 5JEAE 3B8HA 5K36F 2JT2A 4FN5A 3T1HI 4DR7E 4Z7YA 2BM0A 4BA1A 4DV4I 2UUAE 5BR8I 4AIDA 1HNZI 1XMOI 1H72C 4DR2E 4DR2I 1UEKA 2C39A 4B3SE 4IFDF 4AM3A 1XNRI 5DRQA 4DR4I 4KHPI 3B4TA 4DV2I 4B3TI 4GKJI 3M7ND 3H1CA 5DRPA 3HKMA 4JI3E 1YH8A 2OI2A 5DNLA 2Z5BA 4DV3E 4DV3I 2LJPA 3J7AM 2F4VI 1IBMI 4DR5E 4IZJA 4DXLA 4NXMI 1OYPA 1FNMA 2NN6F 2PO2B 3U1YA 4OO1C 2O1TA 1HNXE 1HNXI 4LCFA 1N36E 4HACB 4DV1I 1UDNA 4XTJA 1J5EE 3LTOA 4BA2A 4LF4E 4B3MI 3PRYA 3K17A 4DR1E 2VQEE 1N0VC 4JI8E 2VQEI 4UTGA 4DR1I 2DEIA 3PS1A 4LCGA 4JI1E 2V2QA 5LMNI 5LMUE 1RR9A 3V5RA 1EI1A 1FWLA 1ZM3A 2C37B 4JI6I 2UXBE 4MYUA 2UXDE 1Y4UA 4PRXA 1Y6ZA 3HJCA 1WUUA 3LNUA 5K36B 3GONA 1FJGI 2BR2B 2VQFI 4DV0E 4EMDA 3K85A 4DUYE 4LF7E 4MQYA 4DV6I 2C38A 2PO2A 4OO1D 4IZKB 4X62E 2XEXA 4OX9E 4OX9I 4DV5E 4LF9I 3P06A 4IFDB 2JEBB 1PKPA 1ZM4A 4KQVA 1Z0WA 2AJ4A 3QT8A 2PNZA 5C0XF 2CG9A 1PVGA 4LFAI 4B3RE 2F1DA 3Q1QA 4AQYI 3PYEA 3UHMA 4DV7I 1Y5YA 4JI5I 1N32E 1HK7A 5GMEA 3J7AG 1ELOA 4U3BA 4IZJD 4YY3E 5K36E 2BA0D 1UDSA 1Y60A 2Q2EB 1RHYA 1IBKE 4JYAI 1IBKI 2PO1B 5K36A 2PO0B 3WU4A 1OYSA 4LF8E 1Z0BA 2BR2A 2GO3A 2GQ0A 4R1FA 4QNKA 5A2QQ 4LFBI 4K0KE 2E1RA 2WW4A 4IZKA 1FKAE 1E3PA 2HHHE 2CZ9A 3M85D 1XMQE 5FWKA 1ZXNA 1XMQI 3M7NG 2JEBA 3HULA 4IFDA 1YHCA 2IERA 2Z5CA 1Z0VA 3T1HE 3CDJA 5K36C 4JI0I 2WNRB 2WP8B 2ZM6I 1HR0I 4USMA 4JI7I 4OO1E 3V2UC 4USKA 2NN6E 4LFCI 4FW7A 4DV4E 1BKNA 4JG4A 5GMDA 5BR8E 1N0UA 3J80Q 4OO1A 1D6TA 3J81Q 2NN6A 1XMOE 1VI7A 1HNZE 1VISA 1R6MA
chains in the Genus database with same CATH topology
4DR3I 3ZZUA 4X64I 4LF6I 1XNRE 4DR4E 4KHPE 1Z5CA 4DV2E 1Z5BA 4B3TE 4GKJE 3D4JA 2UUBI 1K47A 4ZVIA 1FI4A 5L3JA 3ZZTA 3PYGA 2F4VE 1MX0A 1IBME 2J7KA 1B63A 4NXME 5IWAI 4FWDA 4YHHI 4DPXA 1NHIA 1DARA 2PNLA 4NXNI 4DV1E 5LL6R 4DPUA 4FW9A 4B3ME 1S16A 3M6AA 5LMNE 2CGEA 4JI4E 4JI6E 4JI4I 1Y4SA 2E5LI 1HNWI 1ZXMA 1NHJA 4JV5I 4DU7A 2HK3A 1FJGE 2VQFE 4DPTA 3T1YI 4DPYA 4DV6E 1OJ4A 3WU6A 1Z0EA 2HKEA 5FLXC 2HFUA 5A2QC 4RPFA 4HACA 4LF9E 4PU9A 1Z0GA 2X36A 4HXZA 4ED4A 1KTVA 1S4EA 2UUCI 1XHKA 5IT9Q 1FWKA 4LFAE 4AQYE 4DV7E 1Z5AA 4JI2E 4GKKI 4JI2I 1KVKA 4JI5E 4DR6E 4DR6I 1H73A 2HK2A 3J80C 4JYAE 2BV3A 1MU5A 4X66I 3PYFA 1U2RA 4LFBE 3Q6NA 3F0NA 4MYTA 3ZM7A 1USUA 2O1UA 2R42A 4LF5I 4X65I 4JI0E 2ZM6E 1HR0E 1RREA 4JI7E 4FWGA 4LFCE 1IBLI 3H4LA 2O1WA 1H74A 1NHHA 2IOQA 3ZZ0A 1ZM2A 4P52A 2UXCI 2GS8A 4DR3E 1I94I 4X64E 4LF6E 2O1VA 1USVA 4WUDA 4DR7I 2UUBE 3CWVA 3JAMQ 1A6FA 1EA6A 1Z0CA 3B82A 2UUAI 3OTOE 3OTOI 5IWAE 4YHHE 3ZKDA 3WU3A 4NXNE 2EFGA 4B3SI 4I3HA 3PYDA 1XNQE 1XNQI 4JI3I 2R3VA 2VF3A 5IT9C 4DR5I 3QT5A 2E5LE 1HNWE 1MG7A 4JV5E 1N36I 1Z0TA 2V2ZA 1J5EI 3WU5A 1N33E 4LF4I 1NZ0A 1N33I 3Q6MA 4JI8I 3T1YE 2X7IA 4JI1I 1PIEA 2ZBKB 5LMUI 3B78A 2V34A 1KKHA 2BM1A 2UXBI 4PRVA 2UXDI 2IOPA 2Z5EA 3K1JA 4UT4A 2UUCE 4WUBA 3QT6A 4DV0I 1H7UA 4DUYI 4LF7I 4GKKE 2HKJA 1QZRA 2ZITA 4X62I 4DV5I 2NPFA 3J81C 2Z5CB 2A2DA 4X66E 4HYMA 4DUZE 4DU8A 4DUZI 4B3RI 1B62A 4DPWA 1N34E 2PNMA 1N34I 4FWHA 4URLA 1N32I 4N3OA 3JAMC 4YY3I 2UU9E 4M1KA 2UU9I 4HY1A 1H7SA 2DEJA 4P7AA 1Z59A 4LF5E 4X65E 1ZM9A 4LF8I 3LPSA 3QT7A 4Z7CA 2HFSA 2V2VA 5FLXQ 1IBLE 1KIJA 2Z5BB 2V8PA 4WUCA 4K0KI 2A2CA 4IZJB 3ZKBA 2HHHI 2UXCE 1I94E 3B8HA 4FN5A 3T1HI 4DR7E 4Z7YA 2BM0A 4DV4I 2UUAE 5BR8I 1HNZI 1XMOI 1H72C 4DR2E 4DR2I 1UEKA 4B3SE 1XNRI 4DR4I 4KHPI 4DV2I 4B3TI 4GKJI 4JI3E 2OI2A 2Z5BA 4DV3E 4DV3I 2LJPA 3J7AM 2F4VI 1IBMI 4DR5E 4IZJA 4DXLA 4NXMI 1FNMA 2O1TA 1HNXE 1HNXI 1N36E 4HACB 4DV1I 4XTJA 1J5EE 3LTOA 4LF4E 4B3MI 3PRYA 3K17A 4DR1E 2VQEE 1N0VC 4JI8E 2VQEI 4UTGA 4DR1I 2DEIA 4JI1E 2V2QA 5LMNI 5LMUE 1RR9A 3V5RA 1EI1A 1FWLA 1ZM3A 4JI6I 2UXBE 4MYUA 2UXDE 1Y4UA 4PRXA 1Y6ZA 3HJCA 1WUUA 3LNUA 3GONA 1FJGI 2VQFI 4DV0E 4EMDA 3K85A 4DUYE 4LF7E 4DV6I 4IZKB 4X62E 2XEXA 4OX9E 4OX9I 4DV5E 4LF9I 3P06A 1PKPA 1ZM4A 4KQVA 1Z0WA 2AJ4A 3QT8A 2CG9A 1PVGA 4LFAI 4B3RE 3Q1QA 4AQYI 3PYEA 4DV7I 4JI5I 1N32E 1HK7A 5GMEA 3J7AG 1ELOA 4IZJD 4YY3E 2Q2EB 1IBKE 4JYAI 1IBKI 3WU4A 4LF8E 1Z0BA 2GQ0A 4R1FA 5A2QQ 4LFBI 4K0KE 2E1RA 2WW4A 4IZKA 1FKAE 2HHHE 2CZ9A 1XMQE 5FWKA 1ZXNA 1XMQI 3HULA 2Z5CA 1Z0VA 3T1HE 4JI0I 2ZM6I 1HR0I 4USMA 4JI7I 3V2UC 4USKA 4LFCI 4DV4E 1BKNA 4JG4A 5GMDA 5BR8E 1N0UA 3J80Q 1D6TA 3J81Q 1HNZE 1XMOE 1VISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 I;  3ZZU A;  4X64 I;  4LF6 I;  1XNR E;  4DR4 E;  4KHP E;  1Z5C A;  4DV2 E;  1Z5B A;  4B3T E;  4GKJ E;  3D4J A;  2UUB I;  1K47 A;  4ZVI A;  1FI4 A;  5L3J A;  3ZZT A;  3PYG A;  2F4V E;  1MX0 A;  1IBM E;  2J7K A;  1B63 A;  4NXM E;  5IWA I;  4FWD A;  4YHH I;  4DPX A;  1NHI A;  1DAR A;  4NXN I;  4DV1 E;  5LL6 R;  4DPU A;  4FW9 A;  4B3M E;  1S16 A;  3M6A A;  5LMN E;  4JI4 E;  4JI6 E;  4JI4 I;  2E5L I;  1HNW I;  1ZXM A;  1NHJ A;  4JV5 I;  4DU7 A;  2HK3 A;  1FJG E;  2VQF E;  4DPT A;  3T1Y I;  4DPY A;  4DV6 E;  1OJ4 A;  3WU6 A;  1Z0E A;  2HKE A;  5FLX C;  2HFU A;  5A2Q C;  4RPF A;  4HAC A;  4LF9 E;  4PU9 A;  1Z0G A;  2X36 A;  4HXZ A;  4ED4 A;  1KTV A;  1S4E A;  2UUC I;  1XHK A;  5IT9 Q;  1FWK A;  4LFA E;  4AQY E;  4DV7 E;  1Z5A A;  4JI2 E;  4GKK I;  4JI2 I;  1KVK A;  4JI5 E;  4DR6 E;  4DR6 I;  1H73 A;  2HK2 A;  3J80 C;  4JYA E;  2BV3 A;  1MU5 A;  4X66 I;  3PYF A;  1U2R A;  4LFB E;  3F0N A;  4MYT A;  3ZM7 A;  2R42 A;  4LF5 I;  4X65 I;  4JI0 E;  2ZM6 E;  1HR0 E;  1RRE A;  4JI7 E;  4FWG A;  4LFC E;  1IBL I;  3H4L A;  1H74 A;  1NHH A;  3ZZ0 A;  1ZM2 A;  4P52 A;  2UXC I;  2GS8 A;  4DR3 E;  1I94 I;  4X64 E;  4LF6 E;  4WUD A;  4DR7 I;  2UUB E;  3CWV A;  3JAM Q;  1A6F A;  1EA6 A;  1Z0C A;  3B82 A;  2UUA I;  3OTO E;  3OTO I;  5IWA E;  4YHH E;  3ZKD A;  3WU3 A;  4NXN E;  2EFG A;  4B3S I;  4I3H A;  3PYD A;  1XNQ E;  1XNQ I;  4JI3 I;  2R3V A;  2VF3 A;  5IT9 C;  4DR5 I;  3QT5 A;  2E5L E;  1HNW E;  1MG7 A;  4JV5 E;  1N36 I;  1Z0T A;  2V2Z A;  1J5E I;  3WU5 A;  1N33 E;  4LF4 I;  1NZ0 A;  1N33 I;  3T1Y E;  4JI8 I;  2X7I A;  4JI1 I;  1PIE A;  2ZBK B;  5LMU I;  3B78 A;  2V34 A;  1KKH A;  2BM1 A;  2UXB I;  4PRV A;  2UXD I;  3K1J A;  4UT4 A;  2UUC E;  4WUB A;  3QT6 A;  4DV0 I;  1H7U A;  4DUY I;  4LF7 I;  4GKK E;  2HKJ A;  1QZR A;  2ZIT A;  4X62 I;  4DV5 I;  2NPF A;  3J81 C;  2A2D A;  4X66 E;  4HYM A;  4DUZ E;  4DU8 A;  4DUZ I;  4B3R I;  1B62 A;  4DPW A;  1N34 E;  1N34 I;  4FWH A;  4URL A;  1N32 I;  3JAM C;  4YY3 I;  2UU9 E;  4M1K A;  2UU9 I;  4HY1 A;  1H7S A;  2DEJ A;  4P7A A;  1Z59 A;  4LF5 E;  4X65 E;  1ZM9 A;  4LF8 I;  3LPS A;  3QT7 A;  4Z7C A;  2HFS A;  2V2V A;  5FLX Q;  1IBL E;  1KIJ A;  2V8P A;  4WUC A;  4K0K I;  2A2C A;  3ZKB A;  2HHH I;  2UXC E;  1I94 E;  3B8H A;  4FN5 A;  3T1H I;  4DR7 E;  4Z7Y A;  2BM0 A;  4DV4 I;  2UUA E;  5BR8 I;  1HNZ I;  1XMO I;  1H72 C;  4DR2 E;  4DR2 I;  1UEK A;  4B3S E;  1XNR I;  4DR4 I;  4KHP I;  4DV2 I;  4B3T I;  4GKJ I;  4JI3 E;  2OI2 A;  4DV3 E;  4DV3 I;  2LJP A;  3J7A M;  2F4V I;  1IBM I;  4DR5 E;  4DXL A;  4NXM I;  1FNM A;  1HNX E;  1HNX I;  1N36 E;  4HAC B;  4DV1 I;  4XTJ A;  1J5E E;  3LTO A;  4LF4 E;  4B3M I;  3K17 A;  4DR1 E;  2VQE E;  1N0V C;  4JI8 E;  2VQE I;  4UTG A;  4DR1 I;  2DEI A;  4JI1 E;  2V2Q A;  5LMN I;  5LMU E;  1RR9 A;  3V5R A;  1EI1 A;  1FWL A;  1ZM3 A;  4JI6 I;  2UXB E;  4MYU A;  2UXD E;  4PRX A;  1WUU A;  3LNU A;  3GON A;  1FJG I;  2VQF I;  4DV0 E;  4EMD A;  4DUY E;  4LF7 E;  4DV6 I;  4X62 E;  2XEX A;  4OX9 E;  4OX9 I;  4DV5 E;  4LF9 I;  1PKP A;  1ZM4 A;  4KQV A;  1Z0W A;  2AJ4 A;  3QT8 A;  1PVG A;  4LFA I;  4B3R E;  3Q1Q A;  4AQY I;  3PYE A;  4DV7 I;  4JI5 I;  1N32 E;  5GME A;  3J7A G;  1ELO A;  4YY3 E;  2Q2E B;  1IBK E;  4JYA I;  1IBK I;  3WU4 A;  4LF8 E;  1Z0B A;  4R1F A;  5A2Q Q;  4LFB I;  4K0K E;  2E1R A;  2WW4 A;  1FKA E;  2HHH E;  2CZ9 A;  1XMQ E;  1ZXN A;  1XMQ I;  3HUL A;  1Z0V A;  3T1H E;  4JI0 I;  2ZM6 I;  1HR0 I;  4USM A;  4JI7 I;  3V2U C;  4USK A;  4LFC I;  4DV4 E;  1BKN A;  4JG4 A;  5GMD A;  5BR8 E;  1N0U A;  3J80 Q;  1D6T A;  3J81 Q;  1HNZ E;  1XMO E;  1VIS A; 
#chains in the Genus database with same CATH topology
 4DR3 I;  3ZZU A;  3GLL A;  4X64 I;  4J3D A;  4LF6 I;  1XNR E;  2PO1 A;  4IFD C;  3P3E A;  4DR4 E;  4KHP E;  1Z5C A;  4DV2 E;  1Z5B A;  4B3T E;  4GKJ E;  4MU0 A;  3D4J A;  2UUB I;  1K47 A;  5C0X B;  3DD6 A;  4ZVI A;  1FI4 A;  5L3J A;  3ZZT A;  3PYG A;  5EKW A;  4FW3 A;  2F4V E;  1MX0 A;  1IBM E;  2J7K A;  2JE6 A;  1B63 A;  4NXM E;  4LOM A;  5IWA I;  4FWD A;  1UDO A;  4YHH I;  5DRR A;  4DPX A;  2NN6 C;  1NHI A;  1DAR A;  2PNL A;  4NXN I;  4DV1 E;  5LL6 R;  2WNR A;  2WP8 A;  4FW9 A;  4DPU A;  4B3M E;  5K36 D;  1S16 A;  5JEA F;  3M6A A;  5LMN E;  2CGE A;  4JI4 E;  4JI6 E;  4JI4 I;  1Y4S A;  2E5L I;  1HNW I;  1ZXM A;  1NHJ A;  4JV5 I;  3P3G A;  4DU7 A;  2HK3 A;  4IFD D;  1FJG E;  2VQF E;  4DPT A;  3T1Y I;  4DPY A;  2BA0 G;  4DV6 E;  1OJ4 A;  3WU6 A;  4IS9 A;  4AIM A;  1Z0E A;  2HKE A;  5FLX C;  2HFU A;  5A2Q C;  4RPF A;  2NN6 D;  4HAC A;  4LF9 E;  4PU9 A;  1Z0G A;  2X36 A;  4HXZ A;  4ED4 A;  5DNX A;  1KTV A;  1S4E A;  2UUC I;  1XHK A;  5IT9 Q;  4NBQ A;  1FWK A;  3KRN A;  4LFA E;  5C0X C;  4AQY E;  4DV7 E;  4FW6 A;  1Z5A A;  4JI2 E;  4GKK I;  4JI2 I;  1KVK A;  4JI5 E;  4DR6 E;  2C37 A;  4DR6 I;  1H73 A;  2HK2 A;  3PS3 A;  3J80 C;  3P76 A;  4JYA E;  2GO4 A;  2BV3 A;  1MU5 A;  4X66 I;  5JEA B;  3PYF A;  5EL9 A;  1U2R A;  4LFB E;  3Q6N A;  3F0N A;  4IFD E;  4MU1 A;  2CVE A;  4MYT A;  3ZM7 A;  1USU A;  2O1U A;  4MDT A;  3GME A;  2R42 A;  4LF5 I;  4X65 I;  4JI0 E;  2ZM6 E;  1HR0 E;  1RRE A;  4JI7 E;  4FWG A;  4FW5 A;  5C0X D;  4LFC E;  1IBL I;  3L7Z B;  3NZK A;  3H4L A;  2O1W A;  1H74 A;  1NHH A;  2BA1 D;  2IOQ A;  3ZZ0 A;  1ZM2 A;  4P52 A;  2UXC I;  2GS8 A;  4DR3 E;  1I94 I;  4X64 E;  4LF6 E;  3P3C A;  2O1V A;  1USV A;  4WUD A;  2PO0 A;  4OZE A;  4BA2 B;  4DR7 I;  2UUB E;  3CWV A;  5JEA A;  3JAM Q;  1A6F A;  1UDQ A;  1EA6 A;  5DRO A;  1Z0C A;  3B82 A;  2UUA I;  4GQU A;  3OTO E;  2J65 A;  3OTO I;  5IWA E;  4YHH E;  3ZKD A;  3WU3 A;  4OKG A;  4NXN E;  2EFG A;  4B3S I;  4I3H A;  2IES A;  3PYD A;  1R6L A;  4MU4 A;  1XNQ E;  1XNQ I;  4JI3 I;  3L7Z A;  5JEA C;  2R3V A;  2VF3 A;  5IT9 C;  4DR5 I;  5ELW A;  3QT5 A;  2JEA B;  2E5L E;  2C38 B;  4OO1 F;  1HNW E;  4LCH A;  4FW4 A;  1MG7 A;  4JV5 E;  5C0X E;  1Z0T A;  1N36 I;  2V2Z A;  2O3Z A;  1J5E I;  3WU5 A;  1N33 E;  4LF4 I;  1NZ0 A;  1N33 I;  5C0X A;  4MU3 A;  1XXE A;  3Q6M A;  4JI8 I;  3T1Y E;  2X7I A;  2PNZ B;  4JI1 I;  1PIE A;  2ZBK B;  1E3H A;  5LMU I;  3B78 A;  2V34 A;  1KKH A;  2BM1 A;  2UXB I;  4PRV A;  2UXD I;  2IOP A;  2Z5E A;  3K1J A;  3U1K A;  4LPF A;  4UT4 A;  2UUC E;  4WUB A;  3GCM A;  3QT6 A;  4DV0 I;  5JEA D;  1H7U A;  2AE8 A;  4DUY I;  3CDI A;  3M85 G;  2HKJ A;  4LF7 I;  4GKK E;  1QZR A;  2JEA A;  2ZIT A;  3PS2 A;  4X62 I;  4DV5 I;  2NPF A;  3J81 C;  4QNJ A;  2Z5C B;  2VES A;  2A2D A;  1P42 A;  4X66 E;  4HYM A;  4DUZ E;  2BA1 G;  4DU8 A;  4DUZ I;  4B3R I;  4BA1 B;  4U3D A;  1B62 A;  4DPW A;  1N34 E;  2PNM A;  1N34 I;  4FWH A;  4URL A;  1N32 I;  4OO1 B;  4N3O A;  3JAM C;  4YY3 I;  2NN6 B;  4M1K A;  2UU9 E;  2UU9 I;  1OYR A;  4HY1 A;  1H7S A;  2DEJ A;  2C39 B;  4P7A A;  1Z59 A;  4LF5 E;  4X65 E;  1ZM9 A;  4LF8 I;  3LPS A;  3QT7 A;  4Z7C A;  4ISA A;  2HFS A;  2V2V A;  5FLX Q;  1IBL E;  1KIJ A;  2Z5B B;  2V8P A;  4WUC A;  4K0K I;  2A2C A;  2JE6 B;  4IZJ B;  3ZKB A;  2HHH I;  2UXC E;  1I94 E;  5JEA E;  3B8H A;  5K36 F;  2JT2 A;  4FN5 A;  3T1H I;  4DR7 E;  4Z7Y A;  2BM0 A;  4BA1 A;  4DV4 I;  2UUA E;  5BR8 I;  4AID A;  1HNZ I;  1XMO I;  1H72 C;  4DR2 E;  4DR2 I;  1UEK A;  2C39 A;  4B3S E;  4IFD F;  4AM3 A;  1XNR I;  5DRQ A;  4DR4 I;  4KHP I;  3B4T A;  4DV2 I;  4B3T I;  4GKJ I;  3M7N D;  3H1C A;  5DRP A;  3HKM A;  4JI3 E;  1YH8 A;  2OI2 A;  5DNL A;  2Z5B A;  4DV3 E;  4DV3 I;  2LJP A;  3J7A M;  2F4V I;  1IBM I;  4DR5 E;  4IZJ A;  4DXL A;  4NXM I;  1OYP A;  1FNM A;  2NN6 F;  2PO2 B;  3U1Y A;  4OO1 C;  2O1T A;  1HNX E;  1HNX I;  4LCF A;  1N36 E;  4HAC B;  4DV1 I;  1UDN A;  4XTJ A;  1J5E E;  3LTO A;  4BA2 A;  4LF4 E;  4B3M I;  3PRY A;  3K17 A;  4DR1 E;  2VQE E;  1N0V C;  4JI8 E;  2VQE I;  4UTG A;  4DR1 I;  2DEI A;  3PS1 A;  4LCG A;  4JI1 E;  2V2Q A;  5LMN I;  5LMU E;  1RR9 A;  3V5R A;  1EI1 A;  1FWL A;  1ZM3 A;  2C37 B;  4JI6 I;  2UXB E;  4MYU A;  2UXD E;  1Y4U A;  4PRX A;  1Y6Z A;  3HJC A;  1WUU A;  3LNU A;  5K36 B;  3GON A;  1FJG I;  2BR2 B;  2VQF I;  4DV0 E;  4EMD A;  3K85 A;  4DUY E;  4LF7 E;  4MQY A;  4DV6 I;  2C38 A;  2PO2 A;  4OO1 D;  4IZK B;  4X62 E;  2XEX A;  4OX9 E;  4OX9 I;  4DV5 E;  4LF9 I;  3P06 A;  4IFD B;  2JEB B;  1PKP A;  1ZM4 A;  4KQV A;  1Z0W A;  2AJ4 A;  3QT8 A;  2PNZ A;  5C0X F;  2CG9 A;  1PVG A;  4LFA I;  4B3R E;  2F1D A;  3Q1Q A;  4AQY I;  3PYE A;  3UHM A;  4DV7 I;  1Y5Y A;  4JI5 I;  1N32 E;  1HK7 A;  5GME A;  3J7A G;  1ELO A;  4U3B A;  4IZJ D;  4YY3 E;  5K36 E;  2BA0 D;  1UDS A;  1Y60 A;  2Q2E B;  1RHY A;  1IBK E;  4JYA I;  1IBK I;  2PO1 B;  5K36 A;  2PO0 B;  3WU4 A;  1OYS A;  4LF8 E;  1Z0B A;  2BR2 A;  2GO3 A;  2GQ0 A;  4R1F A;  4QNK A;  5A2Q Q;  4LFB I;  4K0K E;  2E1R A;  2WW4 A;  4IZK A;  1FKA E;  1E3P A;  2HHH E;  2CZ9 A;  3M85 D;  1XMQ E;  5FWK A;  1ZXN A;  1XMQ I;  3M7N G;  2JEB A;  3HUL A;  4IFD A;  1YHC A;  2IER A;  2Z5C A;  1Z0V A;  3T1H E;  3CDJ A;  5K36 C;  4JI0 I;  2WNR B;  2WP8 B;  2ZM6 I;  1HR0 I;  4USM A;  4JI7 I;  4OO1 E;  3V2U C;  4USK A;  2NN6 E;  4LFC I;  4FW7 A;  4DV4 E;  1BKN A;  4JG4 A;  5GMD A;  5BR8 E;  1N0U A;  3J80 Q;  4OO1 A;  1D6T A;  3J81 Q;  2NN6 A;  1XMO E;  1VI7 A;  1HNZ E;  1VIS A;  1R6M A; 
#chains in the Genus database with same CATH homology
 4DR3 I;  3ZZU A;  4X64 I;  4LF6 I;  1XNR E;  4DR4 E;  4KHP E;  1Z5C A;  4DV2 E;  1Z5B A;  4B3T E;  4GKJ E;  3D4J A;  2UUB I;  1K47 A;  4ZVI A;  1FI4 A;  5L3J A;  3ZZT A;  3PYG A;  2F4V E;  1MX0 A;  1IBM E;  2J7K A;  1B63 A;  4NXM E;  5IWA I;  4FWD A;  4YHH I;  4DPX A;  1NHI A;  1DAR A;  2PNL A;  4NXN I;  4DV1 E;  5LL6 R;  4DPU A;  4FW9 A;  4B3M E;  1S16 A;  3M6A A;  5LMN E;  2CGE A;  4JI4 E;  4JI6 E;  4JI4 I;  1Y4S A;  2E5L I;  1HNW I;  1ZXM A;  1NHJ A;  4JV5 I;  4DU7 A;  2HK3 A;  1FJG E;  2VQF E;  4DPT A;  3T1Y I;  4DPY A;  4DV6 E;  1OJ4 A;  3WU6 A;  1Z0E A;  2HKE A;  5FLX C;  2HFU A;  5A2Q C;  4RPF A;  4HAC A;  4LF9 E;  4PU9 A;  1Z0G A;  2X36 A;  4HXZ A;  4ED4 A;  1KTV A;  1S4E A;  2UUC I;  1XHK A;  5IT9 Q;  1FWK A;  4LFA E;  4AQY E;  4DV7 E;  1Z5A A;  4JI2 E;  4GKK I;  4JI2 I;  1KVK A;  4JI5 E;  4DR6 E;  4DR6 I;  1H73 A;  2HK2 A;  3J80 C;  4JYA E;  2BV3 A;  1MU5 A;  4X66 I;  3PYF A;  1U2R A;  4LFB E;  3Q6N A;  3F0N A;  4MYT A;  3ZM7 A;  1USU A;  2O1U A;  2R42 A;  4LF5 I;  4X65 I;  4JI0 E;  2ZM6 E;  1HR0 E;  1RRE A;  4JI7 E;  4FWG A;  4LFC E;  1IBL I;  3H4L A;  2O1W A;  1H74 A;  1NHH A;  2IOQ A;  3ZZ0 A;  1ZM2 A;  4P52 A;  2UXC I;  2GS8 A;  4DR3 E;  1I94 I;  4X64 E;  4LF6 E;  2O1V A;  1USV A;  4WUD A;  4DR7 I;  2UUB E;  3CWV A;  3JAM Q;  1A6F A;  1EA6 A;  1Z0C A;  3B82 A;  2UUA I;  3OTO E;  3OTO I;  5IWA E;  4YHH E;  3ZKD A;  3WU3 A;  4NXN E;  2EFG A;  4B3S I;  4I3H A;  3PYD A;  1XNQ E;  1XNQ I;  4JI3 I;  2R3V A;  2VF3 A;  5IT9 C;  4DR5 I;  3QT5 A;  2E5L E;  1HNW E;  1MG7 A;  4JV5 E;  1N36 I;  1Z0T A;  2V2Z A;  1J5E I;  3WU5 A;  1N33 E;  4LF4 I;  1NZ0 A;  1N33 I;  3Q6M A;  4JI8 I;  3T1Y E;  2X7I A;  4JI1 I;  1PIE A;  2ZBK B;  5LMU I;  3B78 A;  2V34 A;  1KKH A;  2BM1 A;  2UXB I;  4PRV A;  2UXD I;  2IOP A;  2Z5E A;  3K1J A;  4UT4 A;  2UUC E;  4WUB A;  3QT6 A;  4DV0 I;  1H7U A;  4DUY I;  4LF7 I;  4GKK E;  2HKJ A;  1QZR A;  2ZIT A;  4X62 I;  4DV5 I;  2NPF A;  3J81 C;  2Z5C B;  2A2D A;  4X66 E;  4HYM A;  4DUZ E;  4DU8 A;  4DUZ I;  4B3R I;  1B62 A;  4DPW A;  1N34 E;  2PNM A;  1N34 I;  4FWH A;  4URL A;  1N32 I;  4N3O A;  3JAM C;  4YY3 I;  2UU9 E;  4M1K A;  2UU9 I;  4HY1 A;  1H7S A;  2DEJ A;  4P7A A;  1Z59 A;  4LF5 E;  4X65 E;  1ZM9 A;  4LF8 I;  3LPS A;  3QT7 A;  4Z7C A;  2HFS A;  2V2V A;  5FLX Q;  1IBL E;  1KIJ A;  2Z5B B;  2V8P A;  4WUC A;  4K0K I;  2A2C A;  4IZJ B;  3ZKB A;  2HHH I;  2UXC E;  1I94 E;  3B8H A;  4FN5 A;  3T1H I;  4DR7 E;  4Z7Y A;  2BM0 A;  4DV4 I;  2UUA E;  5BR8 I;  1HNZ I;  1XMO I;  1H72 C;  4DR2 E;  4DR2 I;  1UEK A;  4B3S E;  1XNR I;  4DR4 I;  4KHP I;  4DV2 I;  4B3T I;  4GKJ I;  4JI3 E;  2OI2 A;  2Z5B A;  4DV3 E;  4DV3 I;  2LJP A;  3J7A M;  2F4V I;  1IBM I;  4DR5 E;  4IZJ A;  4DXL A;  4NXM I;  1FNM A;  2O1T A;  1HNX E;  1HNX I;  1N36 E;  4HAC B;  4DV1 I;  4XTJ A;  1J5E E;  3LTO A;  4LF4 E;  4B3M I;  3PRY A;  3K17 A;  4DR1 E;  2VQE E;  1N0V C;  4JI8 E;  2VQE I;  4UTG A;  4DR1 I;  2DEI A;  4JI1 E;  2V2Q A;  5LMN I;  5LMU E;  1RR9 A;  3V5R A;  1EI1 A;  1FWL A;  1ZM3 A;  4JI6 I;  2UXB E;  4MYU A;  2UXD E;  1Y4U A;  4PRX A;  1Y6Z A;  3HJC A;  1WUU A;  3LNU A;  3GON A;  1FJG I;  2VQF I;  4DV0 E;  4EMD A;  3K85 A;  4DUY E;  4LF7 E;  4DV6 I;  4IZK B;  4X62 E;  2XEX A;  4OX9 E;  4OX9 I;  4DV5 E;  4LF9 I;  3P06 A;  1PKP A;  1ZM4 A;  4KQV A;  1Z0W A;  2AJ4 A;  3QT8 A;  2CG9 A;  1PVG A;  4LFA I;  4B3R E;  3Q1Q A;  4AQY I;  3PYE A;  4DV7 I;  4JI5 I;  1N32 E;  1HK7 A;  5GME A;  3J7A G;  1ELO A;  4IZJ D;  4YY3 E;  2Q2E B;  1IBK E;  4JYA I;  1IBK I;  3WU4 A;  4LF8 E;  1Z0B A;  2GQ0 A;  4R1F A;  5A2Q Q;  4LFB I;  4K0K E;  2E1R A;  2WW4 A;  4IZK A;  1FKA E;  2HHH E;  2CZ9 A;  1XMQ E;  5FWK A;  1ZXN A;  1XMQ I;  3HUL A;  2Z5C A;  1Z0V A;  3T1H E;  4JI0 I;  2ZM6 I;  1HR0 I;  4USM A;  4JI7 I;  3V2U C;  4USK A;  4LFC I;  4DV4 E;  1BKN A;  4JG4 A;  5GMD A;  5BR8 E;  1N0U A;  3J80 Q;  1D6T A;  3J81 Q;  1HNZ E;  1XMO E;  1VIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...