4JI6I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6I00
4LF9I 3T1YI 2Q2EB 2VQEE 1NHHA 3ZZTA 4DV0E 4HACA 5LMUE 1N36E 4DUZI 2R3VA 4YHHE 4DV5I 4K0KI 1XHKA 4LF9E 4DV4I 1KIJA 3ZM7A 1B62A 5LL6R 1XNRI 4DV3I 2ZM6I 4LF4E 5BR8I 4JI3I 1IBMI 3B8HA 3CWVA 5L3JA 4DV3E 4Z7CA 4DU8A 1Z5BA 4OX9I 1BKNA 1Z0VA 2HFUA 1XMQE 3GONA 4JI3E 1UEKA 4X66I 3M6AA 4JI7E 2E5LE 4HXZA 3HULA 4ED4A 4HACB 4NXNI 4KHPE 3J80Q 1NHJA 2UUAI 4X66E 3OTOE 4DV2I 1N33I 4LF5I 1FNMA 4P52A 2UXCI 1U2RA 2A2CA 5LMNE 2V34A 3QT6A 4X64E 4DPWA 2WW4A 3WU5A 4LF6I 2ZBKB 4B3RI 4JI6E 1ZM3A 1HNZI 4LFCI 4R1FA 2HK2A 4DPXA 1N0UA 1IBKI 4X65I 3WU3A 3LTOA 3QT7A 1HNXI 4PRVA 3PYDA 4DV6I 3QT8A 1EA6A 1HNWI 1D6TA 4JV5I 4B3TI 4JI8E 4FWDA 1ZXNA 2V2VA 4RPFA 4JV5E 1KTVA 2X7IA 4EMDA 1XMOE 5FLXC 2UUCI 4DR6I 1I94I 1HR0E 1H7SA 1IBLI 3F0NA 5IWAI 2UU9I 4DV1E 4WUDA 1Z0EA 4NXME 1IBLE 2VQFI 4YY3I 4JI0I 3PYEA 5A2QQ 1J5EE 2OI2A 4B3ME 5FLXQ 2BM0A 4JI0E 1Z0BA 2UUBE 4UTGA 4DR3I 2VF3A 4DUYI 4B3SE 2F4VE 2HFSA 1S16A 2UXBI 3T1YE 1A6FA 3JAMC 3T1HI 1ZXMA 1Z0TA 4DUZE 4USKA 4DV5E 4K0KE 3ZZ0A 1FJGI 4DV4E 3K17A 4PU9A 3LNUA 1RREA 3ZKBA 1XNRE 2ZM6E 5BR8E 1IBME 3QT5A 4JG4A 1B63A 1KKHA 4OX9E 3WU6A 3J7AM 3WU4A 4GKKI 1XNQI 4PRXA 2J7KA 1WUUA 4NXNE 3LPSA 2UUAE 4LF7I 4DV2E 1N33E 4LF5E 2UXCE 1Z0CA 1S4EA 3H4LA 2HHHI 4FW9A 4JI5I 1ZM4A 1ELOA 2UXDI 4LF6E 4B3RE 1HNZE 4ZVIA 4LFCE 4JI1I 4AQYI 4X62I 5GMEA 1IBKE 2X36A 3K1JA 4DXLA 4X65E 4KQVA 1MX0A 4XTJA 4JI1E 1FI4A 1HNXE 4DV6E 4JI2I 4HY1A 1HNWE 4DV7I 4B3TE 1OJ4A 1VISA 4DR7I 4JI2E 2ZITA 4WUBA 1DARA 4DR4I 4LFBI 2UUCE 4JYAI 4DR6E 3J81C 1I94E 3B82A 4FWHA 5IWAE 4FWGA 2UU9E 1N34I 1N32I 4JI4I 4LFBE 2EFGA 4LF8I 1PIEA 1Z5AA 1FKAE 2VQFE 4YY3E 1QZRA 4Z7YA 3V2UC 2BM1A 4DPUA 1RR9A 4FN5A 2CZ9A 1H7UA 4DR3E 4HYMA 2V2QA 4DV0I 5LMUI 4DUYE 1PKPA 1N36I 2UXBE 4YHHI 1K47A 2XEXA 3T1HE 3PYFA 4LF4I 2V2ZA 3V5RA 1MG7A 4GKJI 1NHIA 1FJGE 3D4JA 1FWKA 3JAMQ 4GKJE 1NZ0A 3J80C 4I3HA 1Z59A 2HKJA 2R42A 1XMQI 4URLA 2GS8A 1PVGA 1KVKA 2E5LI 4JI7I 4DU7A 1MU5A 4KHPI 1Z0WA 4GKKE 1XNQE 1N0VC 5IT9C 3OTOI 2NPFA 1EI1A 5LMNI 4LF7E 2AJ4A 4MYTA 4X64I 1ZM9A 2HHHE 1Z5CA 4JI5E 4JI6I 3ZKDA 2A2DA 4DR5I 2UXDE 3B78A 2V8PA 4MYUA 1ZM2A 5IT9Q 2LJPA 4AQYE 1FWLA 4DR5E 4P7AA 4DR2I 4X62E 4LFAI 4WUCA 2E1RA 4JI8I 4DR2E 1H74A 4LFAE 4UT4A 4DV7E 3ZZUA 4M1KA 1XMOI 4DR7E 3PYGA 1HR0I 3Q1QA 5A2QC 1H73A 4DR4E 4JYAE 4DV1I 4USMA 4NXMI 5GMDA 1N34E 1N32E 4JI4E 2DEIA 1Z0GA 3J7AG 4LF8E 2DEJA 1J5EI 4DPTA 4B3MI 3J81Q 2BV3A 4DR1I 2HK3A 2UUBI 2VQEI 4DPYA 2HKEA 4B3SI 4DR1E 2F4VI 1H72C
chains in the Genus database with same CATH superfamily
2F1DA 4LF9I 3T1YI 2Q2EB 2VQEE 5K36B 1E3HA 1NHHA 3ZZTA 4DV0E 4HACA 5LMUE 1N36E 3U1KA 4DUZI 2R3VA 4YHHE 4DV5I 4K0KI 1XHKA 4LF9E 4DV4I 1KIJA 4IS9A 3ZM7A 1B62A 5LL6R 1XNRI 4DV3I 2ZM6I 4LF4E 3Q6NA 5BR8I 4OO1D 1UDNA 4JI3I 1IBMI 2Z5EA 3B8HA 3CWVA 5L3JA 4DV3E 1OYPA 5K36D 2BR2B 4Z7CA 4DU8A 1Z5BA 4OX9I 1BKNA 1Z0VA 2HFUA 1XMQE 3GONA 1Y5YA 4JI3E 4FW5A 5JEAA 4OO1C 1UEKA 4X66I 3M6AA 4JI7E 2J65A 2E5LE 4HXZA 3HULA 4FW3A 2BA1D 4ED4A 4HACB 4NXNI 4KHPE 4LCGA 3J80Q 1NHJA 4MU3A 1UDSA 2NN6F 2UUAI 4X66E 3OTOE 5DRRA 4DV2I 1N33I 4LF5I 1FNMA 4P52A 2UXCI 1U2RA 2C39B 2A2CA 5DROA 5LMNE 2V34A 2Z5BA 4J3DA 3QT6A 4X64E 2PO1A 4AIMA 4DPWA 5C0XF 2WW4A 3WU5A 4LF6I 2ZBKB 5ELWA 4QNKA 4B3RI 2C38B 3P06A 4JI6E 1ZM3A 1HNZI 4LFCI 4R1FA 2BA0G 2HK2A 4DPXA 1N0UA 1IBKI 2JE6A 3HKMA 4X65I 2O1VA 4IFDE 3WU3A 3LTOA 3QT7A 1R6LA 1HNXI 4PRVA 3PYDA 4DV6I 3QT8A 1EA6A 1HNWI 1D6TA 4JV5I 5C0XA 2JEAB 4B3TI 4JI8E 4FWDA 1ZXNA 2PNZA 5K36A 2IESA 2V2VA 4ISAA 4RPFA 4JV5E 4FW4A 2Z5BB 1KTVA 2PO2A 2X7IA 4EMDA 2Z5CB 1XMOE 5FLXC 2UUCI 5DNLA 4DR6I 3CDIA 1I94I 1HR0E 3PS2A 1H7SA 1IBLI 3F0NA 5IWAI 2UU9I 4DV1E 4WUDA 3PS3A 1Z0EA 3L7ZB 4NXME 2NN6B 2JE6B 1IBLE 2VQFI 5JEAC 4YY3I 4U3DA 2IERA 2BR2A 4JI0I 3PYEA 4N3OA 4MU1A 5A2QQ 1J5EE 2OI2A 4B3ME 5FLXQ 2BM0A 5C0XB 1Y6ZA 3P3CA 3P3EA 3DD6A 4JI0E 1Z0BA 2UUBE 2PNZB 4UTGA 4DR3I 2VF3A 4DUYI 4B3SE 2NN6D 2F4VE 2HFSA 2PO2B 1S16A 2UXBI 3M7NG 3T1YE 1A6FA 3GMEA 3JAMC 2C39A 1Y4UA 3T1HI 1ZXMA 1Z0TA 4DUZE 4USKA 4DV5E 4K0KE 3ZZ0A 1FJGI 5C0XD 4DV4E 3K17A 4MQYA 4PU9A 3M7ND 3LNUA 1RREA 3ZKBA 1XNRE 3Q6MA 2C38A 2ZM6E 2IOQA 5BR8E 1UDQA 4MU0A 1OYRA 5DRPA 2GQ0A 1IBME 2O1UA 3QT5A 4JG4A 5C0XC 1B63A 1KKHA 4OX9E 5K36C 3WU6A 3J7AM 4MDTA 2JEAA 3WU4A 4GKKI 1XNQI 4PRXA 5DNXA 2J7KA 1WUUA 4NXNE 1R6MA 3LPSA 2UUAE 4LF7I 2O1TA 2Z5CA 4DV2E 1N33E 4LF5E 3H1CA 2UXCE 4AM3A 1Z0CA 1S4EA 2PNMA 3H4LA 2C37A 2HHHI 4FW9A 4JI5I 1ZM4A 1ELOA 2UXDI 3L7ZA 4LF6E 2NN6A 4B3RE 1HNZE 4ZVIA 4LFCE 2WNRB 4JI1I 4AQYI 1YHCA 4X62I 5JEAE 3NZKA 5GMEA 2BA0D 4DXLA 2X36A 3K1JA 1IBKE 4X65E 4KQVA 3KRNA 1XXEA 2AE8A 1MX0A 4XTJA 4JI1E 1FI4A 1HNXE 2PNLA 4IFDB 4DV6E 4JI2I 4HY1A 1HNWE 4DV7I 3K85A 4B3TE 1OJ4A 1VISA 4OKGA 1YH8A 4DR7I 4JI2E 2C37B 5FWKA 3M85G 2ZITA 4WUBA 1DARA 2GO3A 4DR4I 4AIDA 2JEBB 4LFBI 2UUCE 4JYAI 4DR6E 4FW6A 3J81C 1I94E 2VESA 3B82A 4FWHA 4IFDD 4MU4A 5IWAE 3CDJA 4FWGA 2UU9E 1N34I 1N32I 4JI4I 3M85D 1E3PA 1USUA 2EFGA 4LF8I 1PIEA 1Z5AA 4LFBE 1FKAE 2VQFE 4YY3E 1QZRA 4Z7YA 3V2UC 2BM1A 4QNJA 4OO1E 4DPUA 4LCFA 4BA2B 1RR9A 2WP8A 4FN5A 5K36E 2CZ9A 1H7UA 4DR3E 4HYMA 2V2QA 4DV0I 5LMUI 4DUYE 1PKPA 1N36I 2UXBE 4YHHI 4IZKA 1K47A 2NN6C 2XEXA 3T1HE 4IFDF 3PYFA 4LF4I 2V2ZA 3V5RA 1MG7A 5JEAF 4GKJI 1NHIA 1FJGE 3D4JA 1P42A 1FWKA 2JT2A 2WNRA 3JAMQ 3PS1A 4GKJE 1NZ0A 4BA1B 3J80C 4I3HA 4FW7A 1Z59A 2HKJA 2R42A 4LPFA 1XMQI 2WP8B 4URLA 2GS8A 1PVGA 1KVKA 3P76A 2E5LI 4JI7I 4IFDA 4DU7A 2BA1G 1MU5A 4KHPI 1Z0WA 4GKKE 1XNQE 1USVA 1N0VC 5IT9C 3OTOI 2NPFA 4IZKB 2IOPA 2O3ZA 4IZJA 1EI1A 5LMNI 4LF7E 2AJ4A 4MYTA 4X64I 2JEBA 1ZM9A 2HHHE 4LOMA 4NBQA 1Z5CA 4JI5E 4JI6I 3ZKDA 2A2DA 4DR5I 4OO1F 2UXDE 3B78A 3GLLA 2V8PA 4MYUA 1ZM2A 5IT9Q 2LJPA 5K36F 4AQYE 1FWLA 4DR5E 4P7AA 4DR2I 4X62E 4LFAI 4BA2A 1VI7A 4LCHA 5JEAB 4WUCA 2E1RA 3P3GA 5DRQA 2PO0A 4JI8I 1UDOA 4DR2E 1H74A 5EKWA 4LFAE 4U3BA 4OO1A 2GO4A 4IZJB 4UT4A 4DV7E 2CG9A 3ZZUA 3PRYA 3UHMA 1Y60A 4GQUA 4M1KA 3B4TA 3U1YA 1XMOI 3GCMA 4DR7E 1RHYA 3PYGA 4OZEA 1HR0I 3Q1QA 5A2QC 1H73A 4DR4E 2NN6E 2CVEA 2PO1B 5JEAD 4JYAE 4DV1I 4USMA 4NXMI 1HK7A 2CGEA 5GMDA 1N34E 1N32E 4JI4E 2DEIA 1Z0GA 3J7AG 4IZJD 4LF8E 4BA1A 4IFDC 2DEJA 1J5EI 5C0XE 4DPTA 4B3MI 1Y4SA 5EL9A 3J81Q 2BV3A 4DR1I 2HK3A 2PO0B 1OYSA 2O1WA 3HJCA 2VQEI 2UUBI 4DPYA 4OO1B 2HKEA 4B3SI 4DR1E 2F4VI 1H72C
chains in the Genus database with same CATH topology
4LF9I 3T1YI 2Q2EB 2VQEE 1NHHA 3ZZTA 4DV0E 4HACA 5LMUE 1N36E 4DUZI 2R3VA 4YHHE 4DV5I 4K0KI 1XHKA 4LF9E 4DV4I 1KIJA 3ZM7A 1B62A 5LL6R 1XNRI 4DV3I 2ZM6I 4LF4E 3Q6NA 5BR8I 4JI3I 1IBMI 2Z5EA 3B8HA 3CWVA 5L3JA 4DV3E 4Z7CA 4DU8A 1Z5BA 4OX9I 1BKNA 1Z0VA 2HFUA 1XMQE 3GONA 4JI3E 1UEKA 4X66I 3M6AA 4JI7E 2E5LE 4HXZA 3HULA 4ED4A 4HACB 4NXNI 4KHPE 3J80Q 1NHJA 2UUAI 4X66E 3OTOE 4DV2I 1N33I 4LF5I 1FNMA 4P52A 2UXCI 1U2RA 2A2CA 5LMNE 2V34A 2Z5BA 3QT6A 4X64E 4DPWA 2WW4A 3WU5A 4LF6I 2ZBKB 4B3RI 3P06A 4JI6E 1ZM3A 1HNZI 4LFCI 4R1FA 2HK2A 4DPXA 1N0UA 1IBKI 4X65I 2O1VA 3WU3A 3LTOA 3QT7A 1HNXI 4PRVA 3PYDA 4DV6I 3QT8A 1EA6A 1HNWI 1D6TA 4JV5I 4B3TI 4JI8E 4FWDA 1ZXNA 2V2VA 4RPFA 4JV5E 2Z5BB 1KTVA 2X7IA 4EMDA 2Z5CB 1XMOE 5FLXC 2UUCI 4DR6I 1I94I 1HR0E 1H7SA 1IBLI 3F0NA 5IWAI 2UU9I 4DV1E 4WUDA 1Z0EA 4NXME 1IBLE 2VQFI 4YY3I 4JI0I 3PYEA 4N3OA 5A2QQ 1J5EE 2OI2A 4B3ME 5FLXQ 2BM0A 1Y6ZA 4JI0E 1Z0BA 2UUBE 4UTGA 4DR3I 2VF3A 4DUYI 4B3SE 2F4VE 2HFSA 1S16A 2UXBI 3T1YE 1A6FA 3JAMC 1Y4UA 3T1HI 1ZXMA 1Z0TA 4DUZE 4USKA 4DV5E 4K0KE 3ZZ0A 1FJGI 4DV4E 3K17A 4PU9A 3LNUA 1RREA 3ZKBA 1XNRE 3Q6MA 2ZM6E 2IOQA 5BR8E 2GQ0A 1IBME 2O1UA 3QT5A 4JG4A 1B63A 1KKHA 4OX9E 3WU6A 3J7AM 3WU4A 4GKKI 1XNQI 4PRXA 2J7KA 1WUUA 4NXNE 3LPSA 2UUAE 4LF7I 2O1TA 2Z5CA 4DV2E 1N33E 4LF5E 2UXCE 1Z0CA 1S4EA 2PNMA 3H4LA 2HHHI 4FW9A 4JI5I 1ZM4A 1ELOA 2UXDI 4LF6E 4B3RE 1HNZE 4ZVIA 4LFCE 4JI1I 4AQYI 4X62I 5GMEA 4DXLA 2X36A 3K1JA 1IBKE 4X65E 4KQVA 1MX0A 4XTJA 4JI1E 1FI4A 1HNXE 2PNLA 4DV6E 4JI2I 4HY1A 1HNWE 4DV7I 3K85A 4B3TE 1OJ4A 1VISA 4DR7I 4JI2E 5FWKA 2ZITA 4WUBA 1DARA 4DR4I 4LFBI 2UUCE 4JYAI 4DR6E 3J81C 1I94E 3B82A 4FWHA 5IWAE 4FWGA 2UU9E 1N34I 1N32I 4JI4I 1USUA 2EFGA 4LF8I 1PIEA 1Z5AA 4LFBE 1FKAE 2VQFE 4YY3E 1QZRA 4Z7YA 3V2UC 2BM1A 4DPUA 1RR9A 4FN5A 2CZ9A 1H7UA 4DR3E 4HYMA 2V2QA 4DV0I 5LMUI 4DUYE 1PKPA 1N36I 2UXBE 4YHHI 4IZKA 1K47A 2XEXA 3T1HE 3PYFA 4LF4I 2V2ZA 3V5RA 1MG7A 4GKJI 1NHIA 1FJGE 3D4JA 1FWKA 3JAMQ 4GKJE 1NZ0A 3J80C 4I3HA 1Z59A 2HKJA 2R42A 1XMQI 4URLA 2GS8A 1PVGA 1KVKA 2E5LI 4JI7I 4DU7A 1MU5A 4KHPI 1Z0WA 4GKKE 1XNQE 1USVA 1N0VC 5IT9C 3OTOI 2NPFA 4IZKB 2IOPA 4IZJA 1EI1A 5LMNI 4LF7E 2AJ4A 4MYTA 4X64I 1ZM9A 2HHHE 1Z5CA 4JI5E 4JI6I 3ZKDA 2A2DA 4DR5I 2UXDE 3B78A 2V8PA 4MYUA 1ZM2A 5IT9Q 2LJPA 4AQYE 1FWLA 4DR5E 4P7AA 4DR2I 4X62E 4LFAI 4WUCA 2E1RA 4JI8I 4DR2E 1H74A 4LFAE 4IZJB 4UT4A 4DV7E 2CG9A 3ZZUA 3PRYA 4M1KA 1XMOI 4DR7E 3PYGA 1HR0I 3Q1QA 5A2QC 1H73A 4DR4E 4JYAE 4DV1I 4USMA 4NXMI 1HK7A 2CGEA 5GMDA 1N34E 1N32E 4JI4E 2DEIA 1Z0GA 3J7AG 4IZJD 4LF8E 2DEJA 1J5EI 4DPTA 4B3MI 1Y4SA 3J81Q 2BV3A 4DR1I 2HK3A 2O1WA 3HJCA 2VQEI 2UUBI 4DPYA 2HKEA 4B3SI 4DR1E 2F4VI 1H72C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 I;  3T1Y I;  2Q2E B;  2VQE E;  1NHH A;  3ZZT A;  4DV0 E;  4HAC A;  5LMU E;  1N36 E;  4DUZ I;  2R3V A;  4YHH E;  4DV5 I;  4K0K I;  1XHK A;  4LF9 E;  4DV4 I;  1KIJ A;  3ZM7 A;  1B62 A;  5LL6 R;  1XNR I;  4DV3 I;  2ZM6 I;  4LF4 E;  5BR8 I;  4JI3 I;  1IBM I;  3B8H A;  3CWV A;  5L3J A;  4DV3 E;  4Z7C A;  4DU8 A;  1Z5B A;  4OX9 I;  1BKN A;  1Z0V A;  2HFU A;  1XMQ E;  3GON A;  4JI3 E;  1UEK A;  4X66 I;  3M6A A;  4JI7 E;  2E5L E;  4HXZ A;  3HUL A;  4ED4 A;  4HAC B;  4NXN I;  4KHP E;  3J80 Q;  1NHJ A;  2UUA I;  4X66 E;  3OTO E;  4DV2 I;  1N33 I;  4LF5 I;  1FNM A;  4P52 A;  2UXC I;  1U2R A;  2A2C A;  5LMN E;  2V34 A;  3QT6 A;  4X64 E;  4DPW A;  2WW4 A;  3WU5 A;  4LF6 I;  2ZBK B;  4B3R I;  4JI6 E;  1ZM3 A;  1HNZ I;  4LFC I;  4R1F A;  2HK2 A;  4DPX A;  1N0U A;  1IBK I;  4X65 I;  3WU3 A;  3LTO A;  3QT7 A;  1HNX I;  4PRV A;  3PYD A;  4DV6 I;  3QT8 A;  1EA6 A;  1HNW I;  1D6T A;  4JV5 I;  4B3T I;  4JI8 E;  4FWD A;  1ZXN A;  2V2V A;  4RPF A;  4JV5 E;  1KTV A;  2X7I A;  4EMD A;  1XMO E;  5FLX C;  2UUC I;  4DR6 I;  1I94 I;  1HR0 E;  1H7S A;  1IBL I;  3F0N A;  5IWA I;  2UU9 I;  4DV1 E;  4WUD A;  1Z0E A;  4NXM E;  1IBL E;  2VQF I;  4YY3 I;  4JI0 I;  3PYE A;  5A2Q Q;  1J5E E;  2OI2 A;  4B3M E;  5FLX Q;  2BM0 A;  4JI0 E;  1Z0B A;  2UUB E;  4UTG A;  4DR3 I;  2VF3 A;  4DUY I;  4B3S E;  2F4V E;  2HFS A;  1S16 A;  2UXB I;  3T1Y E;  1A6F A;  3JAM C;  3T1H I;  1ZXM A;  1Z0T A;  4DUZ E;  4USK A;  4DV5 E;  4K0K E;  3ZZ0 A;  1FJG I;  4DV4 E;  3K17 A;  4PU9 A;  3LNU A;  1RRE A;  3ZKB A;  1XNR E;  2ZM6 E;  5BR8 E;  1IBM E;  3QT5 A;  4JG4 A;  1B63 A;  1KKH A;  4OX9 E;  3WU6 A;  3J7A M;  3WU4 A;  4GKK I;  1XNQ I;  4PRX A;  2J7K A;  1WUU A;  4NXN E;  3LPS A;  2UUA E;  4LF7 I;  4DV2 E;  1N33 E;  4LF5 E;  2UXC E;  1Z0C A;  1S4E A;  3H4L A;  2HHH I;  4FW9 A;  4JI5 I;  1ZM4 A;  1ELO A;  2UXD I;  4LF6 E;  4B3R E;  1HNZ E;  4ZVI A;  4LFC E;  4JI1 I;  4AQY I;  4X62 I;  5GME A;  1IBK E;  2X36 A;  3K1J A;  4DXL A;  4X65 E;  4KQV A;  1MX0 A;  4XTJ A;  4JI1 E;  1FI4 A;  1HNX E;  4DV6 E;  4JI2 I;  4HY1 A;  1HNW E;  4DV7 I;  4B3T E;  1OJ4 A;  1VIS A;  4DR7 I;  4JI2 E;  2ZIT A;  4WUB A;  1DAR A;  4DR4 I;  4LFB I;  2UUC E;  4JYA I;  4DR6 E;  3J81 C;  1I94 E;  3B82 A;  4FWH A;  5IWA E;  4FWG A;  2UU9 E;  1N34 I;  1N32 I;  4JI4 I;  4LFB E;  2EFG A;  4LF8 I;  1PIE A;  1Z5A A;  1FKA E;  2VQF E;  4YY3 E;  1QZR A;  4Z7Y A;  3V2U C;  2BM1 A;  4DPU A;  1RR9 A;  4FN5 A;  2CZ9 A;  1H7U A;  4DR3 E;  4HYM A;  2V2Q A;  4DV0 I;  5LMU I;  4DUY E;  1PKP A;  1N36 I;  2UXB E;  4YHH I;  1K47 A;  2XEX A;  3T1H E;  3PYF A;  4LF4 I;  2V2Z A;  3V5R A;  1MG7 A;  4GKJ I;  1NHI A;  1FJG E;  3D4J A;  1FWK A;  3JAM Q;  4GKJ E;  1NZ0 A;  3J80 C;  4I3H A;  1Z59 A;  2HKJ A;  2R42 A;  1XMQ I;  4URL A;  2GS8 A;  1PVG A;  1KVK A;  2E5L I;  4JI7 I;  4DU7 A;  1MU5 A;  4KHP I;  1Z0W A;  4GKK E;  1XNQ E;  1N0V C;  5IT9 C;  3OTO I;  2NPF A;  1EI1 A;  5LMN I;  4LF7 E;  2AJ4 A;  4MYT A;  4X64 I;  1ZM9 A;  2HHH E;  1Z5C A;  4JI5 E;  4JI6 I;  3ZKD A;  2A2D A;  4DR5 I;  2UXD E;  3B78 A;  2V8P A;  4MYU A;  1ZM2 A;  5IT9 Q;  2LJP A;  4AQY E;  1FWL A;  4DR5 E;  4P7A A;  4DR2 I;  4X62 E;  4LFA I;  4WUC A;  2E1R A;  4JI8 I;  4DR2 E;  1H74 A;  4LFA E;  4UT4 A;  4DV7 E;  3ZZU A;  4M1K A;  1XMO I;  4DR7 E;  3PYG A;  1HR0 I;  3Q1Q A;  5A2Q C;  1H73 A;  4DR4 E;  4JYA E;  4DV1 I;  4USM A;  4NXM I;  5GMD A;  1N34 E;  1N32 E;  4JI4 E;  2DEI A;  1Z0G A;  3J7A G;  4LF8 E;  2DEJ A;  1J5E I;  4DPT A;  4B3M I;  3J81 Q;  2BV3 A;  4DR1 I;  2HK3 A;  2UUB I;  2VQE I;  4DPY A;  2HKE A;  4B3S I;  4DR1 E;  2F4V I;  1H72 C; 
#chains in the Genus database with same CATH topology
 2F1D A;  4LF9 I;  3T1Y I;  2Q2E B;  2VQE E;  5K36 B;  1E3H A;  1NHH A;  3ZZT A;  4DV0 E;  4HAC A;  5LMU E;  1N36 E;  3U1K A;  4DUZ I;  2R3V A;  4YHH E;  4DV5 I;  4K0K I;  1XHK A;  4LF9 E;  4DV4 I;  1KIJ A;  4IS9 A;  3ZM7 A;  1B62 A;  5LL6 R;  1XNR I;  4DV3 I;  2ZM6 I;  4LF4 E;  3Q6N A;  5BR8 I;  4OO1 D;  1UDN A;  4JI3 I;  1IBM I;  2Z5E A;  3B8H A;  3CWV A;  5L3J A;  4DV3 E;  1OYP A;  5K36 D;  2BR2 B;  4Z7C A;  4DU8 A;  1Z5B A;  4OX9 I;  1BKN A;  1Z0V A;  2HFU A;  1XMQ E;  3GON A;  1Y5Y A;  4JI3 E;  4FW5 A;  5JEA A;  4OO1 C;  1UEK A;  4X66 I;  3M6A A;  4JI7 E;  2J65 A;  2E5L E;  4HXZ A;  3HUL A;  4FW3 A;  2BA1 D;  4ED4 A;  4HAC B;  4NXN I;  4KHP E;  4LCG A;  3J80 Q;  1NHJ A;  4MU3 A;  1UDS A;  2NN6 F;  2UUA I;  4X66 E;  3OTO E;  5DRR A;  4DV2 I;  1N33 I;  4LF5 I;  1FNM A;  4P52 A;  2UXC I;  1U2R A;  2C39 B;  2A2C A;  5DRO A;  5LMN E;  2V34 A;  2Z5B A;  4J3D A;  3QT6 A;  4X64 E;  2PO1 A;  4AIM A;  4DPW A;  5C0X F;  2WW4 A;  3WU5 A;  4LF6 I;  2ZBK B;  5ELW A;  4QNK A;  4B3R I;  2C38 B;  3P06 A;  4JI6 E;  1ZM3 A;  1HNZ I;  4LFC I;  4R1F A;  2BA0 G;  2HK2 A;  4DPX A;  1N0U A;  1IBK I;  2JE6 A;  3HKM A;  4X65 I;  2O1V A;  4IFD E;  3WU3 A;  3LTO A;  3QT7 A;  1R6L A;  1HNX I;  4PRV A;  3PYD A;  4DV6 I;  3QT8 A;  1EA6 A;  1HNW I;  1D6T A;  4JV5 I;  5C0X A;  2JEA B;  4B3T I;  4JI8 E;  4FWD A;  1ZXN A;  2PNZ A;  5K36 A;  2IES A;  2V2V A;  4ISA A;  4RPF A;  4JV5 E;  4FW4 A;  2Z5B B;  1KTV A;  2PO2 A;  2X7I A;  4EMD A;  2Z5C B;  1XMO E;  5FLX C;  2UUC I;  5DNL A;  4DR6 I;  3CDI A;  1I94 I;  1HR0 E;  3PS2 A;  1H7S A;  1IBL I;  3F0N A;  5IWA I;  2UU9 I;  4DV1 E;  4WUD A;  3PS3 A;  1Z0E A;  3L7Z B;  4NXM E;  2NN6 B;  2JE6 B;  1IBL E;  2VQF I;  5JEA C;  4YY3 I;  4U3D A;  2IER A;  2BR2 A;  4JI0 I;  3PYE A;  4N3O A;  4MU1 A;  5A2Q Q;  1J5E E;  2OI2 A;  4B3M E;  5FLX Q;  2BM0 A;  5C0X B;  1Y6Z A;  3P3C A;  3P3E A;  3DD6 A;  4JI0 E;  1Z0B A;  2UUB E;  2PNZ B;  4UTG A;  4DR3 I;  2VF3 A;  4DUY I;  4B3S E;  2NN6 D;  2F4V E;  2HFS A;  2PO2 B;  1S16 A;  2UXB I;  3M7N G;  3T1Y E;  1A6F A;  3GME A;  3JAM C;  2C39 A;  1Y4U A;  3T1H I;  1ZXM A;  1Z0T A;  4DUZ E;  4USK A;  4DV5 E;  4K0K E;  3ZZ0 A;  1FJG I;  5C0X D;  4DV4 E;  3K17 A;  4MQY A;  4PU9 A;  3M7N D;  3LNU A;  1RRE A;  3ZKB A;  1XNR E;  3Q6M A;  2C38 A;  2ZM6 E;  2IOQ A;  5BR8 E;  1UDQ A;  4MU0 A;  1OYR A;  5DRP A;  2GQ0 A;  1IBM E;  2O1U A;  3QT5 A;  4JG4 A;  5C0X C;  1B63 A;  1KKH A;  4OX9 E;  5K36 C;  3WU6 A;  3J7A M;  4MDT A;  2JEA A;  3WU4 A;  4GKK I;  1XNQ I;  4PRX A;  5DNX A;  2J7K A;  1WUU A;  4NXN E;  1R6M A;  3LPS A;  2UUA E;  4LF7 I;  2O1T A;  2Z5C A;  4DV2 E;  1N33 E;  4LF5 E;  3H1C A;  2UXC E;  4AM3 A;  1Z0C A;  1S4E A;  2PNM A;  3H4L A;  2C37 A;  2HHH I;  4FW9 A;  4JI5 I;  1ZM4 A;  1ELO A;  2UXD I;  3L7Z A;  4LF6 E;  2NN6 A;  4B3R E;  1HNZ E;  4ZVI A;  4LFC E;  2WNR B;  4JI1 I;  4AQY I;  1YHC A;  4X62 I;  5JEA E;  3NZK A;  5GME A;  2BA0 D;  4DXL A;  2X36 A;  3K1J A;  1IBK E;  4X65 E;  4KQV A;  3KRN A;  1XXE A;  2AE8 A;  1MX0 A;  4XTJ A;  4JI1 E;  1FI4 A;  1HNX E;  2PNL A;  4IFD B;  4DV6 E;  4JI2 I;  4HY1 A;  1HNW E;  4DV7 I;  3K85 A;  4B3T E;  1OJ4 A;  1VIS A;  4OKG A;  1YH8 A;  4DR7 I;  4JI2 E;  2C37 B;  5FWK A;  3M85 G;  2ZIT A;  4WUB A;  1DAR A;  2GO3 A;  4DR4 I;  4AID A;  2JEB B;  4LFB I;  2UUC E;  4JYA I;  4DR6 E;  4FW6 A;  3J81 C;  1I94 E;  2VES A;  3B82 A;  4FWH A;  4IFD D;  4MU4 A;  5IWA E;  3CDJ A;  4FWG A;  2UU9 E;  1N34 I;  1N32 I;  4JI4 I;  3M85 D;  1E3P A;  1USU A;  2EFG A;  4LF8 I;  1PIE A;  1Z5A A;  4LFB E;  1FKA E;  2VQF E;  4YY3 E;  1QZR A;  4Z7Y A;  3V2U C;  2BM1 A;  4QNJ A;  4OO1 E;  4DPU A;  4LCF A;  4BA2 B;  1RR9 A;  2WP8 A;  4FN5 A;  5K36 E;  2CZ9 A;  1H7U A;  4DR3 E;  4HYM A;  2V2Q A;  4DV0 I;  5LMU I;  4DUY E;  1PKP A;  1N36 I;  2UXB E;  4YHH I;  4IZK A;  1K47 A;  2NN6 C;  2XEX A;  3T1H E;  4IFD F;  3PYF A;  4LF4 I;  2V2Z A;  3V5R A;  1MG7 A;  5JEA F;  4GKJ I;  1NHI A;  1FJG E;  3D4J A;  1P42 A;  1FWK A;  2JT2 A;  2WNR A;  3JAM Q;  3PS1 A;  4GKJ E;  1NZ0 A;  4BA1 B;  3J80 C;  4I3H A;  4FW7 A;  1Z59 A;  2HKJ A;  2R42 A;  4LPF A;  1XMQ I;  2WP8 B;  4URL A;  2GS8 A;  1PVG A;  1KVK A;  3P76 A;  2E5L I;  4JI7 I;  4IFD A;  4DU7 A;  2BA1 G;  1MU5 A;  4KHP I;  1Z0W A;  4GKK E;  1XNQ E;  1USV A;  1N0V C;  5IT9 C;  3OTO I;  2NPF A;  4IZK B;  2IOP A;  2O3Z A;  4IZJ A;  1EI1 A;  5LMN I;  4LF7 E;  2AJ4 A;  4MYT A;  4X64 I;  2JEB A;  1ZM9 A;  2HHH E;  4LOM A;  4NBQ A;  1Z5C A;  4JI5 E;  4JI6 I;  3ZKD A;  2A2D A;  4DR5 I;  4OO1 F;  2UXD E;  3B78 A;  3GLL A;  2V8P A;  4MYU A;  1ZM2 A;  5IT9 Q;  2LJP A;  5K36 F;  4AQY E;  1FWL A;  4DR5 E;  4P7A A;  4DR2 I;  4X62 E;  4LFA I;  4BA2 A;  1VI7 A;  4LCH A;  5JEA B;  4WUC A;  2E1R A;  3P3G A;  5DRQ A;  2PO0 A;  4JI8 I;  1UDO A;  4DR2 E;  1H74 A;  5EKW A;  4LFA E;  4U3B A;  4OO1 A;  2GO4 A;  4IZJ B;  4UT4 A;  4DV7 E;  2CG9 A;  3ZZU A;  3PRY A;  3UHM A;  1Y60 A;  4GQU A;  4M1K A;  3B4T A;  3U1Y A;  1XMO I;  3GCM A;  4DR7 E;  1RHY A;  3PYG A;  4OZE A;  1HR0 I;  3Q1Q A;  5A2Q C;  1H73 A;  4DR4 E;  2NN6 E;  2CVE A;  2PO1 B;  5JEA D;  4JYA E;  4DV1 I;  4USM A;  4NXM I;  1HK7 A;  2CGE A;  5GMD A;  1N34 E;  1N32 E;  4JI4 E;  2DEI A;  1Z0G A;  3J7A G;  4IZJ D;  4LF8 E;  4BA1 A;  4IFD C;  2DEJ A;  1J5E I;  5C0X E;  4DPT A;  4B3M I;  1Y4S A;  5EL9 A;  3J81 Q;  2BV3 A;  4DR1 I;  2HK3 A;  2PO0 B;  1OYS A;  2O1W A;  3HJC A;  2VQE I;  2UUB I;  4DPY A;  4OO1 B;  2HKE A;  4B3S I;  4DR1 E;  2F4V I;  1H72 C; 
#chains in the Genus database with same CATH homology
 4LF9 I;  3T1Y I;  2Q2E B;  2VQE E;  1NHH A;  3ZZT A;  4DV0 E;  4HAC A;  5LMU E;  1N36 E;  4DUZ I;  2R3V A;  4YHH E;  4DV5 I;  4K0K I;  1XHK A;  4LF9 E;  4DV4 I;  1KIJ A;  3ZM7 A;  1B62 A;  5LL6 R;  1XNR I;  4DV3 I;  2ZM6 I;  4LF4 E;  3Q6N A;  5BR8 I;  4JI3 I;  1IBM I;  2Z5E A;  3B8H A;  3CWV A;  5L3J A;  4DV3 E;  4Z7C A;  4DU8 A;  1Z5B A;  4OX9 I;  1BKN A;  1Z0V A;  2HFU A;  1XMQ E;  3GON A;  4JI3 E;  1UEK A;  4X66 I;  3M6A A;  4JI7 E;  2E5L E;  4HXZ A;  3HUL A;  4ED4 A;  4HAC B;  4NXN I;  4KHP E;  3J80 Q;  1NHJ A;  2UUA I;  4X66 E;  3OTO E;  4DV2 I;  1N33 I;  4LF5 I;  1FNM A;  4P52 A;  2UXC I;  1U2R A;  2A2C A;  5LMN E;  2V34 A;  2Z5B A;  3QT6 A;  4X64 E;  4DPW A;  2WW4 A;  3WU5 A;  4LF6 I;  2ZBK B;  4B3R I;  3P06 A;  4JI6 E;  1ZM3 A;  1HNZ I;  4LFC I;  4R1F A;  2HK2 A;  4DPX A;  1N0U A;  1IBK I;  4X65 I;  2O1V A;  3WU3 A;  3LTO A;  3QT7 A;  1HNX I;  4PRV A;  3PYD A;  4DV6 I;  3QT8 A;  1EA6 A;  1HNW I;  1D6T A;  4JV5 I;  4B3T I;  4JI8 E;  4FWD A;  1ZXN A;  2V2V A;  4RPF A;  4JV5 E;  2Z5B B;  1KTV A;  2X7I A;  4EMD A;  2Z5C B;  1XMO E;  5FLX C;  2UUC I;  4DR6 I;  1I94 I;  1HR0 E;  1H7S A;  1IBL I;  3F0N A;  5IWA I;  2UU9 I;  4DV1 E;  4WUD A;  1Z0E A;  4NXM E;  1IBL E;  2VQF I;  4YY3 I;  4JI0 I;  3PYE A;  4N3O A;  5A2Q Q;  1J5E E;  2OI2 A;  4B3M E;  5FLX Q;  2BM0 A;  1Y6Z A;  4JI0 E;  1Z0B A;  2UUB E;  4UTG A;  4DR3 I;  2VF3 A;  4DUY I;  4B3S E;  2F4V E;  2HFS A;  1S16 A;  2UXB I;  3T1Y E;  1A6F A;  3JAM C;  1Y4U A;  3T1H I;  1ZXM A;  1Z0T A;  4DUZ E;  4USK A;  4DV5 E;  4K0K E;  3ZZ0 A;  1FJG I;  4DV4 E;  3K17 A;  4PU9 A;  3LNU A;  1RRE A;  3ZKB A;  1XNR E;  3Q6M A;  2ZM6 E;  2IOQ A;  5BR8 E;  2GQ0 A;  1IBM E;  2O1U A;  3QT5 A;  4JG4 A;  1B63 A;  1KKH A;  4OX9 E;  3WU6 A;  3J7A M;  3WU4 A;  4GKK I;  1XNQ I;  4PRX A;  2J7K A;  1WUU A;  4NXN E;  3LPS A;  2UUA E;  4LF7 I;  2O1T A;  2Z5C A;  4DV2 E;  1N33 E;  4LF5 E;  2UXC E;  1Z0C A;  1S4E A;  2PNM A;  3H4L A;  2HHH I;  4FW9 A;  4JI5 I;  1ZM4 A;  1ELO A;  2UXD I;  4LF6 E;  4B3R E;  1HNZ E;  4ZVI A;  4LFC E;  4JI1 I;  4AQY I;  4X62 I;  5GME A;  4DXL A;  2X36 A;  3K1J A;  1IBK E;  4X65 E;  4KQV A;  1MX0 A;  4XTJ A;  4JI1 E;  1FI4 A;  1HNX E;  2PNL A;  4DV6 E;  4JI2 I;  4HY1 A;  1HNW E;  4DV7 I;  3K85 A;  4B3T E;  1OJ4 A;  1VIS A;  4DR7 I;  4JI2 E;  5FWK A;  2ZIT A;  4WUB A;  1DAR A;  4DR4 I;  4LFB I;  2UUC E;  4JYA I;  4DR6 E;  3J81 C;  1I94 E;  3B82 A;  4FWH A;  5IWA E;  4FWG A;  2UU9 E;  1N34 I;  1N32 I;  4JI4 I;  1USU A;  2EFG A;  4LF8 I;  1PIE A;  1Z5A A;  4LFB E;  1FKA E;  2VQF E;  4YY3 E;  1QZR A;  4Z7Y A;  3V2U C;  2BM1 A;  4DPU A;  1RR9 A;  4FN5 A;  2CZ9 A;  1H7U A;  4DR3 E;  4HYM A;  2V2Q A;  4DV0 I;  5LMU I;  4DUY E;  1PKP A;  1N36 I;  2UXB E;  4YHH I;  4IZK A;  1K47 A;  2XEX A;  3T1H E;  3PYF A;  4LF4 I;  2V2Z A;  3V5R A;  1MG7 A;  4GKJ I;  1NHI A;  1FJG E;  3D4J A;  1FWK A;  3JAM Q;  4GKJ E;  1NZ0 A;  3J80 C;  4I3H A;  1Z59 A;  2HKJ A;  2R42 A;  1XMQ I;  4URL A;  2GS8 A;  1PVG A;  1KVK A;  2E5L I;  4JI7 I;  4DU7 A;  1MU5 A;  4KHP I;  1Z0W A;  4GKK E;  1XNQ E;  1USV A;  1N0V C;  5IT9 C;  3OTO I;  2NPF A;  4IZK B;  2IOP A;  4IZJ A;  1EI1 A;  5LMN I;  4LF7 E;  2AJ4 A;  4MYT A;  4X64 I;  1ZM9 A;  2HHH E;  1Z5C A;  4JI5 E;  4JI6 I;  3ZKD A;  2A2D A;  4DR5 I;  2UXD E;  3B78 A;  2V8P A;  4MYU A;  1ZM2 A;  5IT9 Q;  2LJP A;  4AQY E;  1FWL A;  4DR5 E;  4P7A A;  4DR2 I;  4X62 E;  4LFA I;  4WUC A;  2E1R A;  4JI8 I;  4DR2 E;  1H74 A;  4LFA E;  4IZJ B;  4UT4 A;  4DV7 E;  2CG9 A;  3ZZU A;  3PRY A;  4M1K A;  1XMO I;  4DR7 E;  3PYG A;  1HR0 I;  3Q1Q A;  5A2Q C;  1H73 A;  4DR4 E;  4JYA E;  4DV1 I;  4USM A;  4NXM I;  1HK7 A;  2CGE A;  5GMD A;  1N34 E;  1N32 E;  4JI4 E;  2DEI A;  1Z0G A;  3J7A G;  4IZJ D;  4LF8 E;  2DEJ A;  1J5E I;  4DPT A;  4B3M I;  1Y4S A;  3J81 Q;  2BV3 A;  4DR1 I;  2HK3 A;  2O1W A;  3HJC A;  2VQE I;  2UUB I;  4DPY A;  2HKE A;  4B3S I;  4DR1 E;  2F4V I;  1H72 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...