4JI6I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6I00
1Z0EA 1IBKI 3WU3A 4DR2E 4JI1E 4JYAE 4LFCE 4NXME 4GKKI 4LF6E 5FLXQ 4HYMA 2HHHI 3J81C 5IT9Q 4DR4E 1OJ4A 2GS8A 1XMOE 4UTGA 4LF5I 3J7AM 3T1YE 4LF8I 5L3JA 4DV0I 4DV5I 3CWVA 2R3VA 4FWDA 4DV7E 3B78A 4JI8E 1HNWE 4X62E 2UXCE 1H72C 2NPFA 4R1FA 1FJGE 1K47A 1KVKA 4UT4A 4B3TE 4DUYI 4DR6E 4X65E 2BM1A 4DV1I 4P52A 1HNZE 2HKEA 4HACB 4LF5E 4DU7A 2E5LI 4B3SE 4LF4E 1FWLA 1Z0CA 4MYTA 1U2RA 1HNWI 4OX9E 3QT6A 4WUCA 4KHPE 4JV5I 2WW4A 1S4EA 4DPXA 4X64I 1Z0TA 4DPWA 1PIEA 3LPSA 1N0UA 4DV4I 3PYGA 2HHHE 4JI2E 4JI6I 2VQFE 4B3SI 5A2QC 3M6AA 5BR8I 2BV3A 2UXDE 4PU9A 1XMOI 2UXBE 1N36E 1XNQE 4DUZE 4DU8A 1HNXI 1I94I 1Z0WA 2OI2A 5LMUI 4NXNE 4JI3I 5LMNE 2XEXA 2A2CA 1ZXNA 1PKPA 1N33I 4JI4E 2CZ9A 1HNZI 1N36I 1XNQI 1MX0A 4WUDA 4HY1A 1EI1A 3LTOA 4NXNI 4DR1I 3J80Q 3ZM7A 3J7AG 2F4VE 2E1RA 1HR0I 4DPYA 4Z7CA 3WU5A 4JI2I 1B62A 1UEKA 3ZZTA 2ZBKB 4USMA 1ZM4A 4PRXA 3J80C 2UXBI 4DV2I 4X62I 4DV6I 2LJPA 4RPFA 1Z5AA 1I94E 4LFCI 4EMDA 4YY3E 2X7IA 1NHJA 1J5EI 5LMNI 1ZM2A 3QT8A 4ZVIA 4DR4I 4GKJI 1RREA 4DPUA 1H7UA 1N32E 3J81Q 1XMQE 1PVGA 1FNMA 4KQVA 1A6FA 4JV5E 3H4LA 2HKJA 2DEJA 1S16A 4DV0E 4X64E 4DV5E 3WU6A 4FWGA 1KTVA 4JI8I 4DR1E 1J5EE 4HXZA 4DR5I 3QT5A 3WU4A 2UUBI 4DR3I 4DUYE 4K0KE 2UXDI 4DV3E 4DV1E 5LL6R 4LFAI 5GMEA 4I3HA 2UU9I 3K1JA 1H7SA 4LF4I 1XNRI 1B63A 4FN5A 4JG4A 3PYDA 1FWKA 1Z0BA 4AQYE 1IBLI 4DV6E 4M1KA 1MU5A 4DR5E 1BKNA 2UUAI 2HK3A 2UUBE 2VQEE 3D4JA 1N33E 4FW9A 1IBMI 1NHIA 4PRVA 4WUBA 2ZM6E 2VQFI 4JI6E 4HACA 4GKJE 2ZITA 1VISA 4JI0E 3JAMC 5FLXC 3LNUA 4DPTA 1Z59A 3T1HI 4JI1I 4JYAI 2VQEI 4USKA 4FWHA 3PYEA 3HULA 4YHHI 1NHHA 3ZKBA 3V2UC 4P7AA 2ZM6I 4B3MI 5A2QQ 1EA6A 4K0KI 4JI4I 4ED4A 4LFAE 1H74A 2UU9E 3T1YI 4LF8E 3V5RA 1N0VC 1H73A 4LF7E 1Z0GA 1DARA 1N34I 1ZXMA 2V2ZA 3QT7A 1IBLE 4DV7I 4AQYI 2AJ4A 4YY3I 2UXCI 2EFGA 2V2VA 2V34A 1FJGI 1KKHA 2J7KA 1MG7A 4B3ME 3JAMQ 4DR6I 2F4VI 4JI7I 3ZZUA 1IBME 2VF3A 1HR0E 1N32I 1XMQI 2E5LE 2BM0A 1ZM9A 4LFBE 4MYUA 3Q1QA 4OX9I 2X36A 4KHPI 1KIJA 3T1HE 1FKAE 2V8PA 2UUCE 2HFSA 4B3RE 4X66E 4JI7E 1RR9A 1NZ0A 1ELOA 4Z7YA 5BR8E 1Z5CA 5IT9C 4X65I 5IWAE 4DR7I 4LFBI 1Z0VA 3K17A 2R42A 4DXLA 1WUUA 2V2QA 1IBKE 4DR2I 4LF7I 3ZZ0A 3PYFA 4GKKE 5LMUE 4B3RI 3OTOI 5GMDA 4JI3E 1FI4A 4XTJA 2HK2A 3B82A 4DR3E 4JI5I 3GONA 4JI0I 4DV3I 4DV4E 1QZRA 3ZKDA 1XNRE 4LF9E 1Z5BA 2A2DA 3OTOE 4DUZI 4YHHE 3B8HA 1HNXE 1D6TA 2UUAE 4NXMI 2UUCI 4LF6I 4JI5E 4B3TI 1ZM3A 2DEIA 4X66I 1XHKA 3F0NA 4LF9I 5IWAI 4URLA 4DR7E 1N34E 2Q2EB 4DV2E 2HFUA
chains in the Genus database with same CATH superfamily
5EL9A 1Z0EA 1IBKI 3WU3A 4DR2E 1XXEA 4JI1E 4JYAE 1E3PA 4LFCE 4NXME 4GKKI 4LF6E 3P76A 5FLXQ 2IERA 4HYMA 2HHHI 3J81C 5IT9Q 4DR4E 5ELWA 2NN6F 1OJ4A 4BA1B 5FWKA 1OYRA 2GS8A 1XMOE 2GQ0A 4UTGA 3PRYA 4LF5I 3J7AM 5DRQA 3T1YE 4LF8I 5L3JA 2CG9A 4DV0I 2GO3A 4DV5I 3CWVA 1Y5YA 2R3VA 4FWDA 2JEBB 4DV7E 4GQUA 3B78A 4JI8E 5C0XF 1HNWE 4X62E 2IOPA 2UXCE 1H72C 4N3OA 2NPFA 4R1FA 1FJGE 1K47A 1KVKA 4IFDE 2Z5BA 4UT4A 2WP8A 4B3TE 4DUYI 4DR6E 4X65E 3P06A 2BM1A 4IZJA 3KRNA 4DV1I 4P52A 3P3GA 2C39A 2HKEA 1HNZE 4HACB 4LF5E 4DU7A 2E5LI 4B3SE 1OYPA 1E3HA 4LF4E 1FWLA 2C38A 3GCMA 1Z0CA 4OZEA 4MYTA 1U2RA 1HNWI 4OX9E 3QT6A 4WUCA 4KHPE 4JV5I 2WW4A 1S4EA 4DPXA 3B4TA 4ISAA 2PO1A 4X64I 1Z0TA 1Y4SA 4DPWA 3NZKA 1PIEA 3LPSA 3HJCA 1N0UA 1Y4UA 4DV4I 3PYGA 2HHHE 4JI2E 3Q6NA 2VQFE 4JI6I 4B3SI 5A2QC 3M6AA 2PO2A 2O1WA 2BV3A 1YHCA 1R6MA 5BR8I 2UXDE 4PU9A 1XMOI 2UXBE 1N36E 1XNQE 4DUZE 4DU8A 3P3CA 2JE6A 1HNXI 1I94I 2C37B 1Z0WA 2O3ZA 2OI2A 5JEAB 2NN6B 5LMUI 3L7ZB 4NXNE 4OO1E 1OYSA 4JI3I 5LMNE 2XEXA 2A2CA 2GO4A 1ZXNA 5JEAD 1PKPA 2NN6C 1N33I 4JI4E 5JEAC 2CZ9A 2JEAB 1HNZI 2JT2A 1N36I 1MX0A 1XNQI 2Z5BB 4IFDD 5C0XD 4IFDC 4OO1D 4WUDA 4HY1A 4OO1C 4IS9A 1EI1A 2JEBA 5JEAE 3LTOA 2PNMA 4NXNI 4DR1I 4OO1B 2PO0A 3J80Q 3Q6MA 3ZM7A 3J7AG 3GMEA 2F4VE 2E1RA 1HR0I 4DPYA 4Z7CA 3WU5A 3PS3A 4JI2I 5DRPA 1B62A 1UEKA 3ZZTA 2ZBKB 4USMA 1ZM4A 1UDSA 4MU3A 4PRXA 3J80C 2UXBI 4DV2I 4X62I 3UHMA 4DV6I 3M7ND 2LJPA 4RPFA 1Z5AA 1I94E 4LFCI 2C37A 4EMDA 4QNJA 4LOMA 4YY3E 2X7IA 1NHJA 1J5EI 5LMNI 1ZM2A 2O1TA 5K36A 3QT8A 2BA1D 2PNLA 4ZVIA 4DR4I 4GKJI 4U3DA 1RREA 3M85D 4DPUA 1H7UA 3J81Q 1N32E 1HK7A 3M85G 1XMQE 1PVGA 1FNMA 4KQVA 1A6FA 4JV5E 3H4LA 1UDOA 2HKJA 2DEJA 1S16A 4DV0E 4X64E 4DV5E 3WU6A 4IFDF 4FWGA 1KTVA 4JI8I 2PNZA 5C0XE 4DR1E 1J5EE 4HXZA 4DR5I 3QT5A 3WU4A 2UUBI 3M7NG 4DR3I 4DUYE 4K0KE 2UXDI 5K36B 4DV3E 4DV1E 4LCGA 2Z5CB 5LL6R 4LFAI 5GMEA 4I3HA 2UU9I 3K1JA 4FW3A 1RHYA 1H7SA 4LF4I 1XNRI 1B63A 4FN5A 4JG4A 3PYDA 1FWKA 2PO1B 1Z0BA 4U3BA 4AQYE 1IBLI 5K36D 3PS2A 4LCHA 4M1KA 4DV6E 2PNZB 4AM3A 1MU5A 4DR5E 1BKNA 2UUAI 2C38B 2HK3A 2UUBE 2VQEE 3D4JA 1N33E 4FW9A 1IBMI 1NHIA 4PRVA 2Z5CA 4WUBA 2ZM6E 2VQFI 4JI6E 4HACA 4MQYA 4GKJE 4AIMA 2ZITA 1VISA 4JI0E 3JAMC 1Y60A 2IESA 5FLXC 3LNUA 4DPTA 4MU4A 1Z59A 4J3DA 3T1HI 4JI1I 4JYAI 3GLLA 5K36C 2IOQA 2VQEI 4USKA 4FWHA 3PYEA 4MU0A 3HULA 4IZJD 4YHHI 1NHHA 5K36F 3ZKBA 3V2UC 4P7AA 2BA0G 2ZM6I 4BA2B 3CDIA 4FW5A 4B3MI 5A2QQ 1EA6A 2O1UA 4IZKA 4K0KI 4JI4I 2BR2A 1UDNA 2J65A 4BA2A 4ED4A 3U1KA 4LFAE 1H74A 3HKMA 2UU9E 3T1YI 4LF8E 3V5RA 1N0VC 2CGEA 1H73A 4IFDA 4LF7E 1Z0GA 1DARA 4OO1A 1N34I 1ZXMA 2V2ZA 3QT7A 4DV7I 4AQYI 1IBLE 2AJ4A 5DRRA 4QNKA 5JEAA 4YY3I 4LPFA 1P42A 5C0XB 2UXCI 2EFGA 2V2VA 2V34A 1FJGI 1KKHA 2J7KA 5EKWA 1MG7A 4B3ME 4IFDB 2BA1G 3JAMQ 4DR6I 2F4VI 4JI7I 4BA1A 2BA0D 3ZZUA 1IBME 2VF3A 2WNRB 1HR0E 2NN6D 1N32I 1XMQI 4IZKB 2E5LE 2BM0A 1ZM9A 3PS1A 5DNLA 4LFBE 4MYUA 2PO0B 3Q1QA 2NN6A 4OX9I 2X36A 3L7ZA 4KHPI 1KIJA 4AIDA 3T1HE 2NN6E 1FKAE 2V8PA 2CVEA 2Z5EA 2UUCE 2VESA 2HFSA 4B3RE 4X66E 2JE6B 4NBQA 4JI7E 1RR9A 1NZ0A 2C39B 2JEAA 1ELOA 4Z7YA 5BR8E 1Z5CA 2F1DA 4X65I 5IT9C 5IWAE 4DR7I 4LFBI 1Z0VA 3P3EA 3K17A 2R42A 4LCFA 4DXLA 1WUUA 2V2QA 4MDTA 1IBKE 4FW4A 4DR2I 4LF7I 3ZZ0A 3PYFA 4GKKE 5LMUE 3U1YA 4B3RI 4MU1A 3OTOI 5GMDA 4OO1F 1VI7A 4JI3E 1UDQA 3DD6A 1FI4A 1YH8A 4XTJA 2HK2A 3B82A 4DR3E 4JI5I 2PO2B 2BR2B 3GONA 4IZJB 4JI0I 4DV3I 4DV4E 2WP8B 2WNRA 1QZRA 3K85A 3ZKDA 1XNRE 4LF9E 5C0XA 4OKGA 2O1VA 1Z5BA 4FW6A 5DROA 2A2DA 1USUA 5C0XC 3OTOE 4DUZI 4YHHE 3B8HA 1HNXE 3H1CA 1D6TA 1USVA 2UUAE 4NXMI 2UUCI 4LF6I 1ZM3A 4B3TI 4JI5E 2DEIA 4X66I 4FW7A 1R6LA 1XHKA 5DNXA 5K36E 3F0NA 4LF9I 5IWAI 4URLA 4DR7E 5JEAF 2AE8A 1N34E 1Y6ZA 2Q2EB 4DV2E 3CDJA 2HFUA
chains in the Genus database with same CATH topology
1Z0EA 1IBKI 3WU3A 4DR2E 4JI1E 4JYAE 4LFCE 4NXME 4GKKI 4LF6E 5FLXQ 4HYMA 2HHHI 3J81C 5IT9Q 4DR4E 1OJ4A 5FWKA 2GS8A 1XMOE 2GQ0A 4UTGA 3PRYA 4LF5I 3J7AM 3T1YE 4LF8I 5L3JA 2CG9A 4DV0I 4DV5I 3CWVA 2R3VA 4FWDA 4DV7E 3B78A 4JI8E 1HNWE 4X62E 2IOPA 2UXCE 1H72C 4N3OA 2NPFA 4R1FA 1FJGE 1K47A 1KVKA 2Z5BA 4UT4A 4B3TE 4DUYI 4DR6E 4X65E 3P06A 2BM1A 4IZJA 4DV1I 4P52A 1HNZE 2HKEA 4HACB 4LF5E 4DU7A 2E5LI 4B3SE 4LF4E 1FWLA 1Z0CA 4MYTA 1U2RA 1HNWI 4OX9E 3QT6A 4WUCA 4KHPE 4JV5I 2WW4A 1S4EA 4DPXA 4X64I 1Z0TA 1Y4SA 4DPWA 1PIEA 3LPSA 3HJCA 1N0UA 1Y4UA 4DV4I 3PYGA 2HHHE 4JI2E 3Q6NA 2VQFE 4JI6I 4B3SI 5A2QC 3M6AA 5BR8I 2O1WA 2BV3A 2UXDE 4PU9A 1XMOI 2UXBE 1N36E 1XNQE 4DUZE 4DU8A 1HNXI 1I94I 1Z0WA 2OI2A 5LMUI 4NXNE 4JI3I 5LMNE 2XEXA 2A2CA 1ZXNA 1PKPA 1N33I 4JI4E 2CZ9A 1HNZI 1N36I 1XNQI 1MX0A 2Z5BB 4WUDA 4HY1A 1EI1A 3LTOA 2PNMA 4NXNI 4DR1I 3J80Q 3Q6MA 3ZM7A 3J7AG 2F4VE 2E1RA 1HR0I 4DPYA 4Z7CA 3WU5A 4JI2I 1B62A 1UEKA 3ZZTA 2ZBKB 4USMA 1ZM4A 4PRXA 3J80C 2UXBI 4DV2I 4X62I 4DV6I 2LJPA 4RPFA 1Z5AA 1I94E 4LFCI 4EMDA 4YY3E 2X7IA 1NHJA 1J5EI 5LMNI 1ZM2A 2O1TA 3QT8A 4ZVIA 2PNLA 4DR4I 4GKJI 1RREA 4DPUA 1H7UA 3J81Q 1N32E 1HK7A 1XMQE 1PVGA 1FNMA 4KQVA 1A6FA 4JV5E 3H4LA 2HKJA 2DEJA 1S16A 4DV0E 4X64E 4DV5E 3WU6A 4FWGA 1KTVA 4JI8I 4DR1E 1J5EE 4HXZA 4DR5I 3QT5A 3WU4A 2UUBI 4DR3I 4DUYE 4K0KE 2UXDI 4DV3E 4DV1E 2Z5CB 5LL6R 4LFAI 5GMEA 4I3HA 2UU9I 3K1JA 1H7SA 4LF4I 1XNRI 1B63A 4FN5A 4JG4A 3PYDA 1FWKA 1Z0BA 4AQYE 1IBLI 4DV6E 4M1KA 1MU5A 4DR5E 1BKNA 2UUAI 2HK3A 2UUBE 2VQEE 3D4JA 1N33E 4FW9A 1IBMI 1NHIA 4PRVA 2Z5CA 4WUBA 2ZM6E 2VQFI 4JI6E 4HACA 4GKJE 2ZITA 1VISA 4JI0E 3JAMC 5FLXC 3LNUA 4DPTA 1Z59A 3T1HI 4JI1I 4JYAI 2IOQA 2VQEI 4USKA 4FWHA 3PYEA 3HULA 4IZJD 4YHHI 1NHHA 3ZKBA 3V2UC 4P7AA 2ZM6I 4B3MI 5A2QQ 1EA6A 2O1UA 4IZKA 4K0KI 4JI4I 4ED4A 4LFAE 1H74A 2UU9E 3T1YI 4LF8E 3V5RA 1N0VC 2CGEA 1H73A 4LF7E 1Z0GA 1DARA 1N34I 1ZXMA 2V2ZA 3QT7A 1IBLE 4DV7I 4AQYI 2AJ4A 4YY3I 2UXCI 2EFGA 2V2VA 2V34A 1FJGI 1KKHA 2J7KA 1MG7A 4B3ME 3JAMQ 4DR6I 2F4VI 4JI7I 3ZZUA 1IBME 2VF3A 1HR0E 1N32I 1XMQI 2E5LE 4IZKB 2BM0A 1ZM9A 4LFBE 4MYUA 3Q1QA 4OX9I 2X36A 4KHPI 1KIJA 3T1HE 1FKAE 2V8PA 2Z5EA 2UUCE 2HFSA 4B3RE 4X66E 4JI7E 1RR9A 1NZ0A 1ELOA 4Z7YA 5BR8E 1Z5CA 5IT9C 4X65I 5IWAE 4DR7I 4LFBI 1Z0VA 3K17A 2R42A 4DXLA 1WUUA 2V2QA 1IBKE 4DR2I 4LF7I 3ZZ0A 3PYFA 4GKKE 5LMUE 4B3RI 3OTOI 5GMDA 4JI3E 1FI4A 4XTJA 2HK2A 3B82A 4DR3E 4JI5I 3GONA 4IZJB 4JI0I 4DV3I 4DV4E 1QZRA 3K85A 3ZKDA 1XNRE 4LF9E 2O1VA 1Z5BA 2A2DA 1USUA 3OTOE 4DUZI 4YHHE 3B8HA 1HNXE 1D6TA 1USVA 2UUAE 4NXMI 2UUCI 4LF6I 1ZM3A 4B3TI 4JI5E 2DEIA 4X66I 1XHKA 3F0NA 4LF9I 5IWAI 4URLA 4DR7E 1N34E 1Y6ZA 2Q2EB 4DV2E 2HFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0E A;  1IBK I;  3WU3 A;  4DR2 E;  4JI1 E;  4JYA E;  4LFC E;  4NXM E;  4GKK I;  4LF6 E;  5FLX Q;  4HYM A;  2HHH I;  3J81 C;  5IT9 Q;  4DR4 E;  1OJ4 A;  2GS8 A;  1XMO E;  4UTG A;  4LF5 I;  3J7A M;  3T1Y E;  4LF8 I;  5L3J A;  4DV0 I;  4DV5 I;  3CWV A;  2R3V A;  4FWD A;  4DV7 E;  3B78 A;  4JI8 E;  1HNW E;  4X62 E;  2UXC E;  1H72 C;  2NPF A;  4R1F A;  1FJG E;  1K47 A;  1KVK A;  4UT4 A;  4B3T E;  4DUY I;  4DR6 E;  4X65 E;  2BM1 A;  4DV1 I;  4P52 A;  1HNZ E;  2HKE A;  4HAC B;  4LF5 E;  4DU7 A;  2E5L I;  4B3S E;  4LF4 E;  1FWL A;  1Z0C A;  4MYT A;  1U2R A;  1HNW I;  4OX9 E;  3QT6 A;  4WUC A;  4KHP E;  4JV5 I;  2WW4 A;  1S4E A;  4DPX A;  4X64 I;  1Z0T A;  4DPW A;  1PIE A;  3LPS A;  1N0U A;  4DV4 I;  3PYG A;  2HHH E;  4JI2 E;  4JI6 I;  2VQF E;  4B3S I;  5A2Q C;  3M6A A;  5BR8 I;  2BV3 A;  2UXD E;  4PU9 A;  1XMO I;  2UXB E;  1N36 E;  1XNQ E;  4DUZ E;  4DU8 A;  1HNX I;  1I94 I;  1Z0W A;  2OI2 A;  5LMU I;  4NXN E;  4JI3 I;  5LMN E;  2XEX A;  2A2C A;  1ZXN A;  1PKP A;  1N33 I;  4JI4 E;  2CZ9 A;  1HNZ I;  1N36 I;  1XNQ I;  1MX0 A;  4WUD A;  4HY1 A;  1EI1 A;  3LTO A;  4NXN I;  4DR1 I;  3J80 Q;  3ZM7 A;  3J7A G;  2F4V E;  2E1R A;  1HR0 I;  4DPY A;  4Z7C A;  3WU5 A;  4JI2 I;  1B62 A;  1UEK A;  3ZZT A;  2ZBK B;  4USM A;  1ZM4 A;  4PRX A;  3J80 C;  2UXB I;  4DV2 I;  4X62 I;  4DV6 I;  2LJP A;  4RPF A;  1Z5A A;  1I94 E;  4LFC I;  4EMD A;  4YY3 E;  2X7I A;  1NHJ A;  1J5E I;  5LMN I;  1ZM2 A;  3QT8 A;  4ZVI A;  4DR4 I;  4GKJ I;  1RRE A;  4DPU A;  1H7U A;  1N32 E;  3J81 Q;  1XMQ E;  1PVG A;  1FNM A;  4KQV A;  1A6F A;  4JV5 E;  3H4L A;  2HKJ A;  2DEJ A;  1S16 A;  4DV0 E;  4X64 E;  4DV5 E;  3WU6 A;  4FWG A;  1KTV A;  4JI8 I;  4DR1 E;  1J5E E;  4HXZ A;  4DR5 I;  3QT5 A;  3WU4 A;  2UUB I;  4DR3 I;  4DUY E;  4K0K E;  2UXD I;  4DV3 E;  4DV1 E;  5LL6 R;  4LFA I;  5GME A;  4I3H A;  2UU9 I;  3K1J A;  1H7S A;  4LF4 I;  1XNR I;  1B63 A;  4FN5 A;  4JG4 A;  3PYD A;  1FWK A;  1Z0B A;  4AQY E;  1IBL I;  4DV6 E;  4M1K A;  1MU5 A;  4DR5 E;  1BKN A;  2UUA I;  2HK3 A;  2UUB E;  2VQE E;  3D4J A;  1N33 E;  4FW9 A;  1IBM I;  1NHI A;  4PRV A;  4WUB A;  2ZM6 E;  2VQF I;  4JI6 E;  4HAC A;  4GKJ E;  2ZIT A;  1VIS A;  4JI0 E;  3JAM C;  5FLX C;  3LNU A;  4DPT A;  1Z59 A;  3T1H I;  4JI1 I;  4JYA I;  2VQE I;  4USK A;  4FWH A;  3PYE A;  3HUL A;  4YHH I;  1NHH A;  3ZKB A;  3V2U C;  4P7A A;  2ZM6 I;  4B3M I;  5A2Q Q;  1EA6 A;  4K0K I;  4JI4 I;  4ED4 A;  4LFA E;  1H74 A;  2UU9 E;  3T1Y I;  4LF8 E;  3V5R A;  1N0V C;  1H73 A;  4LF7 E;  1Z0G A;  1DAR A;  1N34 I;  1ZXM A;  2V2Z A;  3QT7 A;  1IBL E;  4DV7 I;  4AQY I;  2AJ4 A;  4YY3 I;  2UXC I;  2EFG A;  2V2V A;  2V34 A;  1FJG I;  1KKH A;  2J7K A;  1MG7 A;  4B3M E;  3JAM Q;  4DR6 I;  2F4V I;  4JI7 I;  3ZZU A;  1IBM E;  2VF3 A;  1HR0 E;  1N32 I;  1XMQ I;  2E5L E;  2BM0 A;  1ZM9 A;  4LFB E;  4MYU A;  3Q1Q A;  4OX9 I;  2X36 A;  4KHP I;  1KIJ A;  3T1H E;  1FKA E;  2V8P A;  2UUC E;  2HFS A;  4B3R E;  4X66 E;  4JI7 E;  1RR9 A;  1NZ0 A;  1ELO A;  4Z7Y A;  5BR8 E;  1Z5C A;  5IT9 C;  4X65 I;  5IWA E;  4DR7 I;  4LFB I;  1Z0V A;  3K17 A;  2R42 A;  4DXL A;  1WUU A;  2V2Q A;  1IBK E;  4DR2 I;  4LF7 I;  3ZZ0 A;  3PYF A;  4GKK E;  5LMU E;  4B3R I;  3OTO I;  5GMD A;  4JI3 E;  1FI4 A;  4XTJ A;  2HK2 A;  3B82 A;  4DR3 E;  4JI5 I;  3GON A;  4JI0 I;  4DV3 I;  4DV4 E;  1QZR A;  3ZKD A;  1XNR E;  4LF9 E;  1Z5B A;  2A2D A;  3OTO E;  4DUZ I;  4YHH E;  3B8H A;  1HNX E;  1D6T A;  2UUA E;  4NXM I;  2UUC I;  4LF6 I;  4JI5 E;  4B3T I;  1ZM3 A;  2DEI A;  4X66 I;  1XHK A;  3F0N A;  4LF9 I;  5IWA I;  4URL A;  4DR7 E;  1N34 E;  2Q2E B;  4DV2 E;  2HFU A; 
#chains in the Genus database with same CATH topology
 5EL9 A;  1Z0E A;  1IBK I;  3WU3 A;  4DR2 E;  1XXE A;  4JI1 E;  4JYA E;  1E3P A;  4LFC E;  4NXM E;  4GKK I;  4LF6 E;  3P76 A;  5FLX Q;  2IER A;  4HYM A;  2HHH I;  3J81 C;  5IT9 Q;  4DR4 E;  5ELW A;  2NN6 F;  1OJ4 A;  4BA1 B;  5FWK A;  1OYR A;  2GS8 A;  1XMO E;  2GQ0 A;  4UTG A;  3PRY A;  4LF5 I;  3J7A M;  5DRQ A;  3T1Y E;  4LF8 I;  5L3J A;  2CG9 A;  4DV0 I;  2GO3 A;  4DV5 I;  3CWV A;  1Y5Y A;  2R3V A;  4FWD A;  2JEB B;  4DV7 E;  4GQU A;  3B78 A;  4JI8 E;  5C0X F;  1HNW E;  4X62 E;  2IOP A;  2UXC E;  1H72 C;  4N3O A;  2NPF A;  4R1F A;  1FJG E;  1K47 A;  1KVK A;  4IFD E;  2Z5B A;  4UT4 A;  2WP8 A;  4B3T E;  4DUY I;  4DR6 E;  4X65 E;  3P06 A;  2BM1 A;  4IZJ A;  3KRN A;  4DV1 I;  4P52 A;  3P3G A;  2C39 A;  2HKE A;  1HNZ E;  4HAC B;  4LF5 E;  4DU7 A;  2E5L I;  4B3S E;  1OYP A;  1E3H A;  4LF4 E;  1FWL A;  2C38 A;  3GCM A;  1Z0C A;  4OZE A;  4MYT A;  1U2R A;  1HNW I;  4OX9 E;  3QT6 A;  4WUC A;  4KHP E;  4JV5 I;  2WW4 A;  1S4E A;  4DPX A;  3B4T A;  4ISA A;  2PO1 A;  4X64 I;  1Z0T A;  1Y4S A;  4DPW A;  3NZK A;  1PIE A;  3LPS A;  3HJC A;  1N0U A;  1Y4U A;  4DV4 I;  3PYG A;  2HHH E;  4JI2 E;  3Q6N A;  2VQF E;  4JI6 I;  4B3S I;  5A2Q C;  3M6A A;  2PO2 A;  2O1W A;  2BV3 A;  1YHC A;  1R6M A;  5BR8 I;  2UXD E;  4PU9 A;  1XMO I;  2UXB E;  1N36 E;  1XNQ E;  4DUZ E;  4DU8 A;  3P3C A;  2JE6 A;  1HNX I;  1I94 I;  2C37 B;  1Z0W A;  2O3Z A;  2OI2 A;  5JEA B;  2NN6 B;  5LMU I;  3L7Z B;  4NXN E;  4OO1 E;  1OYS A;  4JI3 I;  5LMN E;  2XEX A;  2A2C A;  2GO4 A;  1ZXN A;  5JEA D;  1PKP A;  2NN6 C;  1N33 I;  4JI4 E;  5JEA C;  2CZ9 A;  2JEA B;  1HNZ I;  2JT2 A;  1N36 I;  1MX0 A;  1XNQ I;  2Z5B B;  4IFD D;  5C0X D;  4IFD C;  4OO1 D;  4WUD A;  4HY1 A;  4OO1 C;  4IS9 A;  1EI1 A;  2JEB A;  5JEA E;  3LTO A;  2PNM A;  4NXN I;  4DR1 I;  4OO1 B;  2PO0 A;  3J80 Q;  3Q6M A;  3ZM7 A;  3J7A G;  3GME A;  2F4V E;  2E1R A;  1HR0 I;  4DPY A;  4Z7C A;  3WU5 A;  3PS3 A;  4JI2 I;  5DRP A;  1B62 A;  1UEK A;  3ZZT A;  2ZBK B;  4USM A;  1ZM4 A;  1UDS A;  4MU3 A;  4PRX A;  3J80 C;  2UXB I;  4DV2 I;  4X62 I;  3UHM A;  4DV6 I;  3M7N D;  2LJP A;  4RPF A;  1Z5A A;  1I94 E;  4LFC I;  2C37 A;  4EMD A;  4QNJ A;  4LOM A;  4YY3 E;  2X7I A;  1NHJ A;  1J5E I;  5LMN I;  1ZM2 A;  2O1T A;  5K36 A;  3QT8 A;  2BA1 D;  2PNL A;  4ZVI A;  4DR4 I;  4GKJ I;  4U3D A;  1RRE A;  3M85 D;  4DPU A;  1H7U A;  3J81 Q;  1N32 E;  1HK7 A;  3M85 G;  1XMQ E;  1PVG A;  1FNM A;  4KQV A;  1A6F A;  4JV5 E;  3H4L A;  1UDO A;  2HKJ A;  2DEJ A;  1S16 A;  4DV0 E;  4X64 E;  4DV5 E;  3WU6 A;  4IFD F;  4FWG A;  1KTV A;  4JI8 I;  2PNZ A;  5C0X E;  4DR1 E;  1J5E E;  4HXZ A;  4DR5 I;  3QT5 A;  3WU4 A;  2UUB I;  3M7N G;  4DR3 I;  4DUY E;  4K0K E;  2UXD I;  5K36 B;  4DV3 E;  4DV1 E;  4LCG A;  2Z5C B;  5LL6 R;  4LFA I;  5GME A;  4I3H A;  2UU9 I;  3K1J A;  4FW3 A;  1RHY A;  1H7S A;  4LF4 I;  1XNR I;  1B63 A;  4FN5 A;  4JG4 A;  3PYD A;  1FWK A;  2PO1 B;  1Z0B A;  4U3B A;  4AQY E;  1IBL I;  5K36 D;  3PS2 A;  4LCH A;  4M1K A;  4DV6 E;  2PNZ B;  4AM3 A;  1MU5 A;  4DR5 E;  1BKN A;  2UUA I;  2C38 B;  2HK3 A;  2UUB E;  2VQE E;  3D4J A;  1N33 E;  4FW9 A;  1IBM I;  1NHI A;  4PRV A;  2Z5C A;  4WUB A;  2ZM6 E;  2VQF I;  4JI6 E;  4HAC A;  4MQY A;  4GKJ E;  4AIM A;  2ZIT A;  1VIS A;  4JI0 E;  3JAM C;  1Y60 A;  2IES A;  5FLX C;  3LNU A;  4DPT A;  4MU4 A;  1Z59 A;  4J3D A;  3T1H I;  4JI1 I;  4JYA I;  3GLL A;  5K36 C;  2IOQ A;  2VQE I;  4USK A;  4FWH A;  3PYE A;  4MU0 A;  3HUL A;  4IZJ D;  4YHH I;  1NHH A;  5K36 F;  3ZKB A;  3V2U C;  4P7A A;  2BA0 G;  2ZM6 I;  4BA2 B;  3CDI A;  4FW5 A;  4B3M I;  5A2Q Q;  1EA6 A;  2O1U A;  4IZK A;  4K0K I;  4JI4 I;  2BR2 A;  1UDN A;  2J65 A;  4BA2 A;  4ED4 A;  3U1K A;  4LFA E;  1H74 A;  3HKM A;  2UU9 E;  3T1Y I;  4LF8 E;  3V5R A;  1N0V C;  2CGE A;  1H73 A;  4IFD A;  4LF7 E;  1Z0G A;  1DAR A;  4OO1 A;  1N34 I;  1ZXM A;  2V2Z A;  3QT7 A;  4DV7 I;  4AQY I;  1IBL E;  2AJ4 A;  5DRR A;  4QNK A;  5JEA A;  4YY3 I;  4LPF A;  1P42 A;  5C0X B;  2UXC I;  2EFG A;  2V2V A;  2V34 A;  1FJG I;  1KKH A;  2J7K A;  5EKW A;  1MG7 A;  4B3M E;  4IFD B;  2BA1 G;  3JAM Q;  4DR6 I;  2F4V I;  4JI7 I;  4BA1 A;  2BA0 D;  3ZZU A;  1IBM E;  2VF3 A;  2WNR B;  1HR0 E;  2NN6 D;  1N32 I;  1XMQ I;  4IZK B;  2E5L E;  2BM0 A;  1ZM9 A;  3PS1 A;  5DNL A;  4LFB E;  4MYU A;  2PO0 B;  3Q1Q A;  2NN6 A;  4OX9 I;  2X36 A;  3L7Z A;  4KHP I;  1KIJ A;  4AID A;  3T1H E;  2NN6 E;  1FKA E;  2V8P A;  2CVE A;  2Z5E A;  2UUC E;  2VES A;  2HFS A;  4B3R E;  4X66 E;  2JE6 B;  4NBQ A;  4JI7 E;  1RR9 A;  1NZ0 A;  2C39 B;  2JEA A;  1ELO A;  4Z7Y A;  5BR8 E;  1Z5C A;  2F1D A;  4X65 I;  5IT9 C;  5IWA E;  4DR7 I;  4LFB I;  1Z0V A;  3P3E A;  3K17 A;  2R42 A;  4LCF A;  4DXL A;  1WUU A;  2V2Q A;  4MDT A;  1IBK E;  4FW4 A;  4DR2 I;  4LF7 I;  3ZZ0 A;  3PYF A;  4GKK E;  5LMU E;  3U1Y A;  4B3R I;  4MU1 A;  3OTO I;  5GMD A;  4OO1 F;  1VI7 A;  4JI3 E;  1UDQ A;  3DD6 A;  1FI4 A;  1YH8 A;  4XTJ A;  2HK2 A;  3B82 A;  4DR3 E;  4JI5 I;  2PO2 B;  2BR2 B;  3GON A;  4IZJ B;  4JI0 I;  4DV3 I;  4DV4 E;  2WP8 B;  2WNR A;  1QZR A;  3K85 A;  3ZKD A;  1XNR E;  4LF9 E;  5C0X A;  4OKG A;  2O1V A;  1Z5B A;  4FW6 A;  5DRO A;  2A2D A;  1USU A;  5C0X C;  3OTO E;  4DUZ I;  4YHH E;  3B8H A;  1HNX E;  3H1C A;  1D6T A;  1USV A;  2UUA E;  4NXM I;  2UUC I;  4LF6 I;  1ZM3 A;  4B3T I;  4JI5 E;  2DEI A;  4X66 I;  4FW7 A;  1R6L A;  1XHK A;  5DNX A;  5K36 E;  3F0N A;  4LF9 I;  5IWA I;  4URL A;  4DR7 E;  5JEA F;  2AE8 A;  1N34 E;  1Y6Z A;  2Q2E B;  4DV2 E;  3CDJ A;  2HFU A; 
#chains in the Genus database with same CATH homology
 1Z0E A;  1IBK I;  3WU3 A;  4DR2 E;  4JI1 E;  4JYA E;  4LFC E;  4NXM E;  4GKK I;  4LF6 E;  5FLX Q;  4HYM A;  2HHH I;  3J81 C;  5IT9 Q;  4DR4 E;  1OJ4 A;  5FWK A;  2GS8 A;  1XMO E;  2GQ0 A;  4UTG A;  3PRY A;  4LF5 I;  3J7A M;  3T1Y E;  4LF8 I;  5L3J A;  2CG9 A;  4DV0 I;  4DV5 I;  3CWV A;  2R3V A;  4FWD A;  4DV7 E;  3B78 A;  4JI8 E;  1HNW E;  4X62 E;  2IOP A;  2UXC E;  1H72 C;  4N3O A;  2NPF A;  4R1F A;  1FJG E;  1K47 A;  1KVK A;  2Z5B A;  4UT4 A;  4B3T E;  4DUY I;  4DR6 E;  4X65 E;  3P06 A;  2BM1 A;  4IZJ A;  4DV1 I;  4P52 A;  1HNZ E;  2HKE A;  4HAC B;  4LF5 E;  4DU7 A;  2E5L I;  4B3S E;  4LF4 E;  1FWL A;  1Z0C A;  4MYT A;  1U2R A;  1HNW I;  4OX9 E;  3QT6 A;  4WUC A;  4KHP E;  4JV5 I;  2WW4 A;  1S4E A;  4DPX A;  4X64 I;  1Z0T A;  1Y4S A;  4DPW A;  1PIE A;  3LPS A;  3HJC A;  1N0U A;  1Y4U A;  4DV4 I;  3PYG A;  2HHH E;  4JI2 E;  3Q6N A;  2VQF E;  4JI6 I;  4B3S I;  5A2Q C;  3M6A A;  5BR8 I;  2O1W A;  2BV3 A;  2UXD E;  4PU9 A;  1XMO I;  2UXB E;  1N36 E;  1XNQ E;  4DUZ E;  4DU8 A;  1HNX I;  1I94 I;  1Z0W A;  2OI2 A;  5LMU I;  4NXN E;  4JI3 I;  5LMN E;  2XEX A;  2A2C A;  1ZXN A;  1PKP A;  1N33 I;  4JI4 E;  2CZ9 A;  1HNZ I;  1N36 I;  1XNQ I;  1MX0 A;  2Z5B B;  4WUD A;  4HY1 A;  1EI1 A;  3LTO A;  2PNM A;  4NXN I;  4DR1 I;  3J80 Q;  3Q6M A;  3ZM7 A;  3J7A G;  2F4V E;  2E1R A;  1HR0 I;  4DPY A;  4Z7C A;  3WU5 A;  4JI2 I;  1B62 A;  1UEK A;  3ZZT A;  2ZBK B;  4USM A;  1ZM4 A;  4PRX A;  3J80 C;  2UXB I;  4DV2 I;  4X62 I;  4DV6 I;  2LJP A;  4RPF A;  1Z5A A;  1I94 E;  4LFC I;  4EMD A;  4YY3 E;  2X7I A;  1NHJ A;  1J5E I;  5LMN I;  1ZM2 A;  2O1T A;  3QT8 A;  4ZVI A;  2PNL A;  4DR4 I;  4GKJ I;  1RRE A;  4DPU A;  1H7U A;  3J81 Q;  1N32 E;  1HK7 A;  1XMQ E;  1PVG A;  1FNM A;  4KQV A;  1A6F A;  4JV5 E;  3H4L A;  2HKJ A;  2DEJ A;  1S16 A;  4DV0 E;  4X64 E;  4DV5 E;  3WU6 A;  4FWG A;  1KTV A;  4JI8 I;  4DR1 E;  1J5E E;  4HXZ A;  4DR5 I;  3QT5 A;  3WU4 A;  2UUB I;  4DR3 I;  4DUY E;  4K0K E;  2UXD I;  4DV3 E;  4DV1 E;  2Z5C B;  5LL6 R;  4LFA I;  5GME A;  4I3H A;  2UU9 I;  3K1J A;  1H7S A;  4LF4 I;  1XNR I;  1B63 A;  4FN5 A;  4JG4 A;  3PYD A;  1FWK A;  1Z0B A;  4AQY E;  1IBL I;  4DV6 E;  4M1K A;  1MU5 A;  4DR5 E;  1BKN A;  2UUA I;  2HK3 A;  2UUB E;  2VQE E;  3D4J A;  1N33 E;  4FW9 A;  1IBM I;  1NHI A;  4PRV A;  2Z5C A;  4WUB A;  2ZM6 E;  2VQF I;  4JI6 E;  4HAC A;  4GKJ E;  2ZIT A;  1VIS A;  4JI0 E;  3JAM C;  5FLX C;  3LNU A;  4DPT A;  1Z59 A;  3T1H I;  4JI1 I;  4JYA I;  2IOQ A;  2VQE I;  4USK A;  4FWH A;  3PYE A;  3HUL A;  4IZJ D;  4YHH I;  1NHH A;  3ZKB A;  3V2U C;  4P7A A;  2ZM6 I;  4B3M I;  5A2Q Q;  1EA6 A;  2O1U A;  4IZK A;  4K0K I;  4JI4 I;  4ED4 A;  4LFA E;  1H74 A;  2UU9 E;  3T1Y I;  4LF8 E;  3V5R A;  1N0V C;  2CGE A;  1H73 A;  4LF7 E;  1Z0G A;  1DAR A;  1N34 I;  1ZXM A;  2V2Z A;  3QT7 A;  1IBL E;  4DV7 I;  4AQY I;  2AJ4 A;  4YY3 I;  2UXC I;  2EFG A;  2V2V A;  2V34 A;  1FJG I;  1KKH A;  2J7K A;  1MG7 A;  4B3M E;  3JAM Q;  4DR6 I;  2F4V I;  4JI7 I;  3ZZU A;  1IBM E;  2VF3 A;  1HR0 E;  1N32 I;  1XMQ I;  2E5L E;  4IZK B;  2BM0 A;  1ZM9 A;  4LFB E;  4MYU A;  3Q1Q A;  4OX9 I;  2X36 A;  4KHP I;  1KIJ A;  3T1H E;  1FKA E;  2V8P A;  2Z5E A;  2UUC E;  2HFS A;  4B3R E;  4X66 E;  4JI7 E;  1RR9 A;  1NZ0 A;  1ELO A;  4Z7Y A;  5BR8 E;  1Z5C A;  5IT9 C;  4X65 I;  5IWA E;  4DR7 I;  4LFB I;  1Z0V A;  3K17 A;  2R42 A;  4DXL A;  1WUU A;  2V2Q A;  1IBK E;  4DR2 I;  4LF7 I;  3ZZ0 A;  3PYF A;  4GKK E;  5LMU E;  4B3R I;  3OTO I;  5GMD A;  4JI3 E;  1FI4 A;  4XTJ A;  2HK2 A;  3B82 A;  4DR3 E;  4JI5 I;  3GON A;  4IZJ B;  4JI0 I;  4DV3 I;  4DV4 E;  1QZR A;  3K85 A;  3ZKD A;  1XNR E;  4LF9 E;  2O1V A;  1Z5B A;  2A2D A;  1USU A;  3OTO E;  4DUZ I;  4YHH E;  3B8H A;  1HNX E;  1D6T A;  1USV A;  2UUA E;  4NXM I;  2UUC I;  4LF6 I;  1ZM3 A;  4B3T I;  4JI5 E;  2DEI A;  4X66 I;  1XHK A;  3F0N A;  4LF9 I;  5IWA I;  4URL A;  4DR7 E;  1N34 E;  1Y6Z A;  2Q2E B;  4DV2 E;  2HFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...