4DV3E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv3E02
4JYAE 3WU5A 1QZRA 1NHIA 4JI0E 1N0VC 1Z0GA 1MG7A 4DPWA 4B3RI 1XNRI 2RTXA 4DR3E 4DXLA 3OTOE 1HNXI 2L2KB 4JI2E 4DV0I 4DR1E 5LMUI 1FJGI 2VQFI 4LF9I 1J26A 1FWLA 1B62A 3T1YE 2UXCE 1RR9A 1I94I 1HR0E 2DIXA 3ADJA 1MU5A 2RSMA 4MYTA 1QU6A 1Z0WA 3JAMC 4DV3E 4B3SI 1RC7A 3WU3A 2HHHI 4DV6I 5BR8E 1YZ9A 2VQEI 1N32E 5A2QQ 2LJPA 1HNZE 1ELOA 4X62E 3J81Q 1XMQI 1RQ0A 4YHHE 4DKKA 2IHR1 5GMDA 4FWHA 2UXDE 2X7IA 4WUCA 2LTRA 1XNQE 2V34A 4FWGA 5CFFE 4JI3I 1GQEA 1S16A 3M6AA 2A2DA 4JI7I 2GS8A 4B3RE 4DU7A 1H7UA 1MX0A 2ZBKB 1N36E 3K1JA 4DPYA 4DR7I 1IBLI 5FLXC 2DMYA 4M2ZA 4DV0E 2E1RA 2JVAA 4DV2I 4GKJE 1FJGE 2VQFE 1IBMI 3LLHA 1HNWI 4LF9E 4R1FA 4WUDA 2HKJA 2Q2EB 4X64I 2LBSB 1FI4A 2X36A 4EMDA 3GONA 1J5EI 2NUEA 5IT9C 1KTVA 1X48A 4GKKE 3D4JA 4JI1I 4JV5I 4DUZE 3WU4A 2F4VI 4HACB 4LF8I 2V2ZA 3C4BA 1IBKE 4P52A 2CZ9A 4OX9I 4DR5E 1XMOI 2HHHE 4LF7I 3K17A 4K0KE 2L2NA 1EI1A 1UHZA 3HULA 2UUAI 4X66I 1T4OA 4LF6I 3B78A 4JI8E 4X65E 4HY1A 5LMNI 5IWAI 2L3JA 4AQYE 3ZZ0A 3QT7A 2V2QA 2DEIA 1ZXMA 2B7VA 4LF5I 2NUFA 3ADGA 2B3TB 4FWDA 3C4TA 4DUYI 4DR2I 1ZM9A 4LFAI 2N3HA 4JI6I 3ZZTA 4LF4E 1FWKA 3PYFA 2E5LI 4KHPE 2HKEA 1PVGA 4JI4I 4DR4I 4DR6I 3JAMQ 1IBLE 1NHHA 2XEXA 2UUBI 4DV2E 4NXNE 3J80Q 1IBME 4URLA 4DV4E 1DARA 1FNMA 4LFBI 4DV1I 1NHJA 2WW4A 4NXMI 2R42A 2BM1A 2HFUA 4JI5I 1H7SA 2L3CA 4JG4A 4WUBA 1J5EE 1N33E 4JV5E 1Z0TA 1K47A 3V5RA 4DV5E 1Z0BA 1X49A 4LF8E 4JYAI 2RS6A 1Z5AA 1BKNA 4OX9E 4YY3I 1ZBTA 1FKAE 1A6FA 4KQVA 4JI0I 3WU6A 5A2QC 4Z7YA 2UU9I 3PYGA 4DU8A 4UT4A 4X66E 2EZ6A 4DR3I 4LF6E 3OTOI 3J81C 1XNRE 4JI2I 5LMNE 5FLXQ 5IWAE 1T4NA 1HNXE 1ZM3A 3LPSA 4FN5A 4I3HA 1YYOA 1X47A 5LMUE 1Z0EA 2HFSA 2J7KA 4DV7I 2UXCI 3QT6A 2L2MA 1Z0VA 4FW9A 4LFAE 4WFTA 1HR0I 1YYWA 4ED4A 4P7AA 4USMA 2R3VA 2YT4A 1I94E 3PYDA 2DEJA 3J7AM 3LNUA 4JI4E 4PU9A 4HXZA 4MYUA 2UUCI 1KIJA 1H72C 1UILA 3ZKDA 2NA2A 4B3TI 4B3SE 3T1HI 1U2RA 1T4LB 4DV6E 4XTJA 1Z5CA 2CPNA 4LFCI 1HNZI 4PRVA 2VQEE 3QT8A 2ZITA 2B7TA 4X8WA 4JI5E 1XMQE 1EA6A 3PYEA 1ZM2A 2UXDI 1XNQI 2UXBI 4HYMA 3CWVA 4USKA 2LJHA 1N34I 2A2CA 2V2VA 1ZM4A 1YYKA 3F0NA 4YY3E 3VYXA 4JI3E 1NZ0A 2N3GA 2KHXA 4DPXA 2UU9E 4M30A 4JI7E 1N36I 4M1KA 4DPUA 3ADLA 4OOGC 4B3MI 3HTXA 2OI2A 4DR7E 4GKJI 2LUPB 1H74A 1HNWE 2L33A 4DV7E 4HACA 4X64E 3H4LA 4Z7CA 2ZM6I 3J7AG 5LL6R 1DI2A 4GKKI 4RPFA 4DUZI 2MDRA 1RREA 3B82A 2V8PA 4JI1E 2F4VE 1IBKI 3J7Yp 2VF3A 2RS7A 2UUCE 3ZKBA 2LUQA 4DR5I 1KVKA 4B3TE 1N0UA 2BV3A 1XHKA 3V2UC 3J80C 1WHNA 4K0KI 3T1HE 1WUUA 1S4EA 1XMOE 4LF7E 1H73A 1OJ4A 2BM0A 4LFCE 1UEKA 2AJ4A 2UUAE 4JI8I 4X65I 3LTOA 1D6TA 2EFGA 4UTGA 3P1XA 3ZZUA 4AQYI 1WHQA 2JY9A 4DR1I 3QT5A 2UXBE 1KKHA 4ZVIA 1N34E 2HK3A 4LF5E 1ZXNA 3ZM7A 3T1YI 1Z5BA 2NUGA 2DB2A 4LF4I 4DUYE 3VYYA 4DR2E 1VISA 4KHPI 4JI6E 4WYQB 1PIEA 2E5LE 5IT9Q 2LRSA 4B3ME 4DR4E 4DR6E 4DV3I 4NXNI 2UUBE 5GMEA 4DV4I 5BR8I 2HK2A 1B63A 5L3JA 1N32I 4PRXA 1Z0CA 4LFBE 4DV1E 2ZM6E 4X62I 1O0WA 2NPFA 4NXME 4YHHI 1Z59A 1N33I 1STUA 4DV5I 3B8HA 3ADIA 3Q1QA 2LTSA 4DPTA 1PKPA 1EKZA
chains in the Genus database with same CATH superfamily
2EL6A 4JYAE 1ZAAC 4BHCA 5JEAB 3WU5A 2EMGA 1QZRA 2YTQA 2EPMX 2MKNA 2YTFA 1NHIA 4JI0E 2EM5A 2PNZA 3H09A 1N0VC 2YTNA 5ADZA 1Z0GA 1MG7A 4DPWA 4ZYDA 3PS2A 4B3RI 1R6MA 1XNRI 1T38A 2RTXA 2EN4A 4DR3E 4DXLA 2IOQA 2YU8A 3OTOE 1HNXI 1UDQA 2L2KB 4IS1C 4JI2E 4BA2A 4DV0I 2EP3A 1WJPA 2EL4A 4WSPA 4DR1E 4R2PA 4LPFA 5LMUI 1FJGI 2VQFI 3B4TA 4LF9I 1VI7A 2EN8A 1J26A 1FWLA 1B62A 2EMIA 3CDIA 5A69A 2WZOA 3T1YE 2UXCE 1YH8A 4IZKA 4IJDA 5C0XA 1RR9A 3HPSA 2JYAA 1I94I 1HR0E 2YRKA 2WBSA 4GKKI 2DIXA 4DMIA 2EMLA 2EOXA 4IFDC 3ADJA 1E3PA 4MLQA 1MU5A 2RSMA 4MYTA 1QU6A 1Z0WA 2ADRA 3VK6A 3JAMC 2ODRC 4DV3E 4MDTA 2I13A 1WXRA 4B3SI 1RC7A 2EE8A 2Z5BA 2DLQA 2O1TA 3WU3A 2YRHA 2VF1A 3U1YA 2HHHI 1AAYA 2EM3A 4DV6I 2JOXA 5BR8E 4MQYA 4ZYEA 2BA0D 1YZ9A 2NABA 2VQEI 1N32E 2BA1G 5A2QQ 4IFDB 2EMBA 3THNA 2LJPA 1HNZE 2O1VA 2EQ0A 2J7JA 2R76A 2HGHA 4R2AA 4BA1A 1ELOA 2EN6A 2LE2A 2ODRD 4X62E 1F2IG 3J81Q 1RQ0A 3EPJA 1A1IA 1XMQI 4LU9A 1BB8A 2BV3A 4YHHE 2O1WA 2EQ3A 2EOQA 4DKKA 1HK7A 2Z5CB 1EH7A 5DNXA 2IHR1 2JWOA 5GMDA 1TF3A 2JOBA 2HJJA 4R8OA 4F2JC 4FWHA 2UXDE 4MU4A 2X7IA 4WUCA 2LTRA 1XNQE 2K7IA 2V34A 4WSGA 2EM7A 4FWGA 2Q8UA 5CFFE 4JI3I 2EPOA 1SR9A 1GQEA 2YTEA 2M4IA 1S16A 2LMZA 4IS9A 3M6AA 2A2DA 4JI7I 3BIDA 1ZR9A 2EM6A 2GS8A 2HC5A 2LV2A 4B3RE 1TF6A 4DU7A 1H7UA 1MX0A 2FGGA 1N3GA 2BBGA 5T6JA 2ZBKB 1N36E 3K1JA 4DPYA 2EM2A 2EN2A 2ENAA 4DR7I 1PJQA 1IBLI 5DRRA 5FLXC 2DMYA 3PS3A 3PRYA 4M2ZA 2JEBA 2I9IA 1X3CA 3DF6A 4DV0E 1G2DC 2E1RA 2JVAA 2NN6A 2GLIA 4DV2I 4GKJE 1FJGE 2JE6A 2GO3A 2VQFE 1IBMI 3LLHA 1HNWI 4LF9E 2NN6E 4R1FA 1QNTA 1OYRA 2EOMA 4R2DA 4WUDA 5C0XC 2HKJA 2Q2EB 4O24A 5KL5A 4X64I 4BA2B 4I8OA 4HEIA 2BB8A 2EMAA 3K85A 4LTYA 2LBSB 4NBQA 1FI4A 2X36A 3KRNA 4EMDA 3GONA 1J5EI 2NUEA 5IT9C 1KTVA 1X48A 2EOFA 4GKKE 3D4JA 4JI1I 4DUZE 4JV5I 3WU4A 2F4VI 2M7QA 2B9DA 5C0XD 3HXLA 4IZKB 4HACB 1AH5A 4WXDA 5A6AA 4LF8I 2V2ZA 2WBTA 5DRPA 2LCEA 2L92A 3C4BA 4R03A 1IBKE 4P52A 2CZ9A 4AIDA 5C0XF 4OX9I 2L8TA 4P78A 4DR5E 2AE8A 2A25A 4ZYGA 1XMOI 4O5GA 2HHHE 4LF7I 3K17A 4K0KE 2L2NA 1EI1A 2LT7A 1UHZA 2D9HA 1A1KA 3HULA 2UUAI 2M1SA 1Y4UA 2EPZA 3MSWA 1TN9A 2E1MA 1X5WA 4X66I 2J65A 3GCMA 1T4OA 1X6HA 4LF6I 2CG9A 3B78A 4JI8E 2JR1A 2EM0A 2V89A 4X65E 3M85D 2FTXB 4HY1A 1PDAA 5LMNI 5IWAI 3L7ZA 4Q35B 2L3JA 2GQ0A 4AQYE 2O3ZA 3ZZ0A 4BC9A 5LLQA 4FW3A 2WCC3 4BHBA 3QG5C 3P3EA 2V83A 2V2QA 2DEIA 3QT7A 1ZXMA 2EM9A 2GO4A 3EPKA 1DGCA 2B7VA 4F6MA 4LF5I 2NUFA 3ADGA 2B3TB 3DJWA 4FWDA 3BF2A 3C4TA 2RPCA 4MU0A 2YPNA 2ENCA 1GZ6A 4DUYI 2PO2B 4DR2I 4F54A 1ZM9A 4LFAI 2Z5EA 2N3HA 3PS1A 2EPNA 1IQOA 4JI6I 3ZZTA 5EL9A 4LF4E 1FWKA 3KWRA 3PYFA 2E5LI 4J8ZA 4KHPE 4OKGA 2HKEA 1PVGA 5C0XE 2V86A 4JI4I 4DR4I 4DR6I 2NN6C 4NZVA 2EMFA 3JAMQ 1IBLE 4F9BB 4HTGA 1NHHA 2EMZA 4FW4A 4OO1A 2XEXA 2UUBI 1SFEA 4DV2E 4NXNE 3J80Q 2LO3A 3MHSC 2MC6A 2WP8A 4J3DA 2C37B 4OO1E 1IBME 4URLA 3HKMA 3IWCA 4DV4E 1DARA 1FNMA 4NHRA 2F8BA 4LFBI 3U1KA 3ECRA 1BBOA 4DV1I 4IZJA 2CVEA 2NN6D 1Y60A 3P06A 2NN6B 1NHJA 2WW4A 4NXMI 3TQMA 3IWDA 2YTPA 1P42A 2BM1A 2JE6B 2HFUA 2NN6F 1USUA 2R42A 2YU5A 1H7SA 2L3CA 1OYSA 4OZEA 5JEAA 4KZSA 4JG4A 4JI5I 5DNLA 4WUBA 3UK3C 1J5EE 1N33E 1T39A 3RMPA 4JV5E 5KL3A 1Z0TA 5KL2A 1K47A 3V5RA 4DV5E 4MLVA 1P47A 1Z0BA 1X49A 4LF8E 2JT2A 2WBUA 3GLLA 4JYAI 2RS6A 4BMJA 1Z5AA 4N3OA 1A1GA 3EPHA 2EPUA 4R2RA 1BKNA 4OX9E 3EQ1A 4BBYA 2JP9A 1XXEA 4YY3I 1ZBTA 2EM8A 5TSEA 1FKAE 2EORA 2MC5A 2FV4B 1A6FA 4KQVA 4BCAA 3H1CA 4JI0I 3WU6A 5A2QC 4LCFA 1KJKA 4Z7YA 2UU9I 3PYGA 4DU8A 4QNJA 4UT4A 2YTIA 2R1FA 4X66E 2EZ6A 4DR3I 3HQ1A 4LF6E 3OTOI 3MHHC 3J81C 4LOMA 2V8QB 1XNRE 4GQUA 2DMIA 2PO0A 4JI2I 2EMYA 3M7ND 5LMNE 1UDSA 5IWAE 1T4NA 5FLXQ 1HNXE 1ZM3A 3LPSA 1UBDC 2JEAA 4FN5A 4BC7A 2PNZB 4N4RB 4QNKA 3C6KA 2CT1A 4I3HA 2EOIA 2V88A 3IWBA 1YYOA 1X47A 5LMUE 1Z0EA 2HFSA 5ELWA 2J7KA 3LMLA 2RSIA 4DV7I 2UXCI 3QT6A 2VRDA 2L2MA 3BBGA 1Z0VA 4FW9A 2YWQA 4LFAE 4WFTA 1HR0I 2EPCA 1YYWA 2V85A 4P7AA 4ED4A 4USMA 1NCSA 2EMWA 2R3VA 3CDJA 3UHMA 4KWYA 2YT4A 1I94E 3PYDA 2EOEA 2YTJA 4OO1C 2DEJA 3J7AM 3LNUA 4X9JA 3P76A 4JI4E 4PU9A 4M0VA 2H36X 4HXZA 4MYUA 4IFDA 5K36F 3KZYA 4P7DA 2UUCI 2EOSA 1EH8A 5C0XB 1KIJA 1JK2A 1UILA 1H72C 3ZKDA 4ZYHA 2NA2A 4B3TI 2EOZA 2BR2A 4B3SE 1ZBQA 2EOYA 4WPYA 3T1HI 4WX9A 2PRTA 1U2RA 1T4LB 4DV6E 4XTJA 1Z5CA 2CPNA 3Q6NA 4LFCI 4LCHA 1HNZI 4OO1D 4PRVA 4OO1B 1YUIA 2VQEE 3OMLA 5JEAC 4O43A 2EJ4A 3QT8A 4OO1F 2V87A 2Z5BB 2WP8B 2C39A 2B7TA 4X8WA 2ZITA 3HJCA 4U3BA 1X6FA 4JI5E 1XMQE 1DQ3A 2WNRA 4MU3A 4AIMA 4IZJD 1YPNA 2EPXA 1EA6A 2F1DA 4IZJB 2BA0G 1ZM2A 3PYEA 2EOHA 5DROA 2UXDI 4RH8A 4MU1A 2DLKA 1XNQI 2UXBI 2EMXA 4RHBB 4HYMA 3CWVA 4USKA 5JEAD 2LJHA 4BA1B 1N34I 2A2CA 5AASA 2YSPA 3ZOQB 1ZM4A 2V2VA 3P3CA 1B69A 1A1FA 1YYKA 5JEAF 2YTGA 2YRMA 1MEYC 2C38A 1UDOA 3F0NA 3Q6MA 1IQSA 4YY3E 2G7HA 3VYXA 5K36A 5DNYA 1YSAC 4JI3E 5A6JA 3VHTB 1NZ0A 2N3GA 2KHXA 4DPXA 2UU9E 2MDGA 1IMUA 4M30A 5K36E 2ENHA 2EN7A 5AE1A 1L4SA 4JI7E 1UN6B 2VESA 1ZU1A 4FW5A 1N36I 4AM3A 3JU0A 4ISAA 4M1KA 4DPUA 4GEQB 4FW6A 3ADLA 4OOGC 4L8NA 1A1HA 2IOPA 4B3MI 3HTXA 4Q28A 2OI2A 4DR7E 4WXCA 5A6BA 4GKJI 3NZKA 2LUPB 5FWKA 2YTDA 2EMKA 4U3DA 2EN3A 2PNLA 2PO0B 4O4KA 2O1UA 1H74A 1PJSA 1HNWE 2PO1A 5KL4A 2PNMA 4R2SA 2L33A 4DV7E 1UDNA 3M7NG 2EQ1A 1R6LA 2JEAB 4HACA 4X64E 3H4LA 2JEBB 4Z7CA 5A6KA 3J7AG 2ZM6I 5LL6R 2M9AA 1DI2A 2LJUA 1PJTA 4L5NC 2EM4A 2K4VA 2KONA 1NEIA 3FIGA 2MDRA 1RREA 4RPFA 4DUZI 2EMHA 5F3WA 3B82A 3JTZA 4GZNC 2JPAA 2V8PA 2EL5A 4JI1E 3F6HA 2F4VE 3J7Yp 5JEAE 1IBKI 2VF3A 2RS7A 2UUCE 3ZKBA 2LUQA 4DR5I 1KYQA 2N8XA 1KVKA 4B3TE 1N0UA 2EOJA 1Z1BA 2EPPA 1XHKA 2EPLX 3J80C 1WHNA 4F9AB 4K0KI 3T1HE 1WUUA 1S4EA 4IFDD 2IERA 1XMOE 4LF7E 1H73A 1OJ4A 2YZTA 2BM0A 4LFCE 3KZZA 1UEKA 2AJ4A 4IFDF 4F9CB 2UUAE 4JI8I 1YUJA 4X65I 3LTOA 2BR2B 1D6TA 1YHCA 2CTDA 2EPAA 2EOOA 2MKDA 2EFGA 4UTGA 1BBGA 3P1XA 3ZZUA 1JK1A 1GTKA 3AUZA 2GPIA 3AV0A 4FK5C 4AQYI 3P3GA 5EKWA 2PO2A 1WHQA 2YSOA 1LLMC 3K6QA 2JY9A 4TUIA 3QT5A 5DRQA 4DR1I 1Y6ZA 3GMEA 2UXBE 3M99B 1YFHA 2C39B 3L00A 3EPLA 2ELYA 1KKHA 1Y5YA 1N34E 4ZVIA 5K36C 3V2UC 4F6NA 2HK3A 4LF5E 3M85G 1ZXNA 2WNRB 3ZM7A 1Y4SA 1Z5BA 3L7ZB 3T1YI 1WRJA 2NUGA 2DB2A 1X6EA 4LF4I 5AE3A 4DUYE 3VYYA 2VE7C 4DR2E 1VISA 3DD6A 4KHPI 4JI6E 1E3HA 2YTOA 4WYQB 1PIEA 2E5LE 5IT9Q 5AC4A 2C37A 4M9VC 4FW7A 2C38B 2LRSA 4R2QA 5K36D 3C6MA 1RHYA 5K36B 2DSYA 2BA1D 4B3ME 4DR4E 3BGHA 2EPRA 1G2FC 4DR6E 4DV3I 2E72A 4NXNI 2JXPA 4BS9A 4IFDE 2UUBE 2EMCA 4LCGA 3HPZA 1EH6A 2ELZA 5GMEA 4DV4I 2DRPA 5BR8I 2HK2A 2RQLA 1B63A 5L3JA 3THOB 1N32I 2Z5CA 5IV8B 4R2EA 2CSHA 5A6BD 2KOUA 2LVHA 4PRXA 1Z0CA 2GHFA 4LFBE 4R2CA 2IESA 4DV1E 2ZM6E 1RMDA 2L6MA 4TUGA 4X62I 1O0WA 2NPFA 4NXME 4YHHI 1Z59A 2EN1A 1N33I 1STUA 2PO1B 4DV5I 3B8HA 5AC5A 1A1LA 1MGTA 3ADIA 2LTSA 3Q1QA 4DPTA 3F6GA 1PKPA 5AE2A 2EPKX 5KL6A 5KL7A 1EKZA 2DGCA 1OYPA 2CGEA 1USVA 1A1JA 5IXMB 2EWLA
chains in the Genus database with same CATH topology
4JYAE 3WU5A 1QZRA 1NHIA 4JI0E 3H09A 1N0VC 5ADZA 1Z0GA 1MG7A 4DPWA 4B3RI 1XNRI 2RTXA 4DR3E 4DXLA 2IOQA 3OTOE 1HNXI 2L2KB 4JI2E 4DV0I 4WSPA 4DR1E 5LMUI 1FJGI 2VQFI 4LF9I 1J26A 1FWLA 1B62A 2WZOA 3T1YE 2UXCE 4IZKA 1RR9A 3HPSA 1I94I 1HR0E 2DIXA 4DMIA 3ADJA 1MU5A 2RSMA 4MYTA 1QU6A 1Z0WA 3VK6A 3JAMC 2ODRC 4DV3E 1WXRA 4B3SI 1RC7A 2Z5BA 2O1TA 3WU3A 2VF1A 2HHHI 4DV6I 2JOXA 5BR8E 1YZ9A 2VQEI 1N32E 5A2QQ 2LJPA 1HNZE 2O1VA 1ELOA 2LE2A 2ODRD 4X62E 3J81Q 1XMQI 1RQ0A 4LU9A 4YHHE 2O1WA 4DKKA 1HK7A 2Z5CB 2IHR1 2JWOA 5GMDA 2JOBA 4R8OA 4FWHA 2UXDE 2X7IA 4WUCA 2LTRA 1XNQE 2V34A 4FWGA 5CFFE 4JI3I 1SR9A 1GQEA 2M4IA 1S16A 2LMZA 3M6AA 2A2DA 4JI7I 2GS8A 4B3RE 4DU7A 1H7UA 1MX0A 2FGGA 5T6JA 2ZBKB 1N36E 3K1JA 4DPYA 4DR7I 1IBLI 5FLXC 2DMYA 3PRYA 4M2ZA 4DV0E 3DF6A 2E1RA 2JVAA 4DV2I 4GKJE 1FJGE 2VQFE 1IBMI 3LLHA 1HNWI 4LF9E 4R1FA 4WUDA 2HKJA 2Q2EB 4X64I 4I8OA 3K85A 4LTYA 2LBSB 1FI4A 2X36A 4EMDA 3GONA 1J5EI 2NUEA 5IT9C 1KTVA 1X48A 4GKKE 3D4JA 4JI1I 4JV5I 4DUZE 3WU4A 2F4VI 2M7QA 2B9DA 3HXLA 4IZKB 4HACB 4LF8I 2V2ZA 3C4BA 2L92A 4R03A 1IBKE 4P52A 2CZ9A 4OX9I 2L8TA 4P78A 4DR5E 1XMOI 2HHHE 4LF7I 3K17A 4K0KE 2L2NA 1EI1A 1UHZA 3HULA 2UUAI 2M1SA 1Y4UA 3MSWA 2E1MA 4X66I 1T4OA 4LF6I 2CG9A 3B78A 4JI8E 2JR1A 2V89A 4X65E 2FTXB 4HY1A 5LMNI 5IWAI 2L3JA 2GQ0A 4AQYE 3ZZ0A 4BC9A 3QT7A 2V83A 2V2QA 2DEIA 1ZXMA 2B7VA 4LF5I 2NUFA 3ADGA 2B3TB 3DJWA 4FWDA 3C4TA 1GZ6A 4DUYI 4DR2I 4F54A 1ZM9A 4LFAI 2Z5EA 2N3HA 4JI6I 3ZZTA 4LF4E 1FWKA 3KWRA 3PYFA 2E5LI 4J8ZA 4KHPE 2HKEA 1PVGA 2V86A 4JI4I 4DR4I 4DR6I 3JAMQ 1IBLE 4F9BB 1NHHA 2XEXA 2UUBI 4DV2E 4NXNE 3J80Q 2MC6A 1IBME 4URLA 3IWCA 4DV4E 1DARA 1FNMA 2F8BA 4LFBI 4DV1I 4IZJA 3P06A 1NHJA 2WW4A 4NXMI 3IWDA 2R42A 2BM1A 2HFUA 1USUA 4JI5I 1H7SA 2L3CA 4KZSA 4JG4A 4WUBA 1J5EE 1N33E 4JV5E 3RMPA 1Z0TA 1K47A 3V5RA 4DV5E 1Z0BA 1X49A 4LF8E 4JYAI 2RS6A 4BMJA 1Z5AA 4N3OA 1BKNA 4OX9E 4BBYA 4YY3I 1ZBTA 1FKAE 1A6FA 2MC5A 2FV4B 4KQVA 4JI0I 4BCAA 3WU6A 5A2QC 4Z7YA 2UU9I 3PYGA 4DU8A 4UT4A 4X66E 2EZ6A 4DR3I 3HQ1A 4LF6E 3OTOI 3J81C 2V8QB 1XNRE 4JI2I 5LMNE 5FLXQ 5IWAE 1T4NA 1HNXE 1ZM3A 3LPSA 4FN5A 4BC7A 4I3HA 2V88A 3IWBA 1YYOA 1X47A 5LMUE 1Z0EA 2HFSA 2J7KA 3LMLA 4DV7I 2UXCI 3QT6A 2L2MA 1Z0VA 4FW9A 4LFAE 4WFTA 1HR0I 1YYWA 4ED4A 2V85A 4P7AA 4USMA 2R3VA 2YT4A 1I94E 3PYDA 2DEJA 3J7AM 3LNUA 4JI4E 4PU9A 4M0VA 2H36X 4HXZA 4MYUA 2UUCI 4P7DA 1KIJA 1H72C 1UILA 3ZKDA 2NA2A 4B3TI 4B3SE 1ZBQA 4WPYA 3T1HI 1U2RA 1T4LB 4DV6E 4XTJA 1Z5CA 2CPNA 3Q6NA 4LFCI 1HNZI 4PRVA 2VQEE 3OMLA 3QT8A 2V87A 2Z5BB 2ZITA 2B7TA 4X8WA 3HJCA 4JI5E 1XMQE 1DQ3A 4IZJD 1EA6A 4IZJB 3PYEA 1ZM2A 2UXDI 1XNQI 2UXBI 4HYMA 3CWVA 4USKA 2LJHA 1N34I 2A2CA 5AASA 2V2VA 3ZOQB 1ZM4A 1YYKA 3Q6MA 3F0NA 4YY3E 2G7HA 3VYXA 5DNYA 4JI3E 1NZ0A 2N3GA 2KHXA 4DPXA 2UU9E 4M30A 5AE1A 4JI7E 1N36I 3JU0A 4M1KA 4DPUA 4GEQB 3ADLA 4OOGC 4L8NA 2IOPA 4B3MI 3HTXA 4Q28A 2OI2A 4DR7E 4GKJI 2LUPB 5FWKA 2PNLA 2O1UA 1H74A 1HNWE 2PNMA 2L33A 4DV7E 4HACA 4X64E 3H4LA 4Z7CA 2ZM6I 3J7AG 5LL6R 1DI2A 4L5NC 4GKKI 2K4VA 2KONA 3FIGA 4RPFA 2MDRA 1RREA 4DUZI 3B82A 5F3WA 3JTZA 2V8PA 4JI1E 3F6HA 2F4VE 3J7Yp 1IBKI 2VF3A 2RS7A 2UUCE 3ZKBA 2LUQA 4DR5I 1KVKA 4B3TE 1N0UA 2BV3A 1XHKA 3V2UC 3J80C 1WHNA 4F9AB 4K0KI 3T1HE 1WUUA 1S4EA 1XMOE 4LF7E 1H73A 1OJ4A 2YZTA 2BM0A 4LFCE 1UEKA 2AJ4A 4F9CB 2UUAE 4JI8I 4X65I 3LTOA 1D6TA 2EFGA 4UTGA 3P1XA 3ZZUA 3AUZA 4AQYI 3AV0A 1WHQA 3K6QA 2JY9A 4TUIA 3QT5A 4DR1I 1Y6ZA 2UXBE 1KKHA 4ZVIA 1N34E 2HK3A 4LF5E 1ZXNA 3ZM7A 1Y4SA 1Z5BA 3T1YI 2NUGA 2DB2A 4LF4I 5AE3A 4DUYE 3VYYA 2VE7C 4DR2E 1VISA 4KHPI 4JI6E 4WYQB 1PIEA 2E5LE 5IT9Q 2LRSA 2DSYA 4B3ME 4DR4E 4DR6E 4DV3I 4NXNI 4BS9A 2UUBE 3HPZA 5GMEA 4DV4I 5BR8I 2HK2A 1B63A 5L3JA 1N32I 2Z5CA 4PRXA 2KOUA 1Z0CA 4LFBE 4DV1E 2ZM6E 4TUGA 2L6MA 4X62I 1O0WA 2NPFA 4NXME 4YHHI 1Z59A 1N33I 1STUA 4DV5I 3B8HA 3ADIA 3Q1QA 2LTSA 4DPTA 3F6GA 1PKPA 5AE2A 1EKZA 2CGEA 1USVA 2EWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA E;  3WU5 A;  1QZR A;  1NHI A;  4JI0 E;  1N0V C;  1Z0G A;  1MG7 A;  4DPW A;  4B3R I;  1XNR I;  2RTX A;  4DR3 E;  4DXL A;  3OTO E;  1HNX I;  2L2K B;  4JI2 E;  4DV0 I;  4DR1 E;  5LMU I;  1FJG I;  2VQF I;  4LF9 I;  1J26 A;  1FWL A;  1B62 A;  3T1Y E;  2UXC E;  1RR9 A;  1I94 I;  1HR0 E;  2DIX A;  3ADJ A;  1MU5 A;  2RSM A;  4MYT A;  1QU6 A;  1Z0W A;  3JAM C;  4DV3 E;  4B3S I;  1RC7 A;  3WU3 A;  2HHH I;  4DV6 I;  5BR8 E;  1YZ9 A;  2VQE I;  1N32 E;  5A2Q Q;  2LJP A;  1HNZ E;  1ELO A;  4X62 E;  3J81 Q;  1XMQ I;  1RQ0 A;  4YHH E;  4DKK A;  2IHR 1;  5GMD A;  4FWH A;  2UXD E;  2X7I A;  4WUC A;  2LTR A;  1XNQ E;  2V34 A;  4FWG A;  5CFF E;  4JI3 I;  1GQE A;  1S16 A;  3M6A A;  2A2D A;  4JI7 I;  2GS8 A;  4B3R E;  4DU7 A;  1H7U A;  1MX0 A;  2ZBK B;  1N36 E;  3K1J A;  4DPY A;  4DR7 I;  1IBL I;  5FLX C;  2DMY A;  4M2Z A;  4DV0 E;  2E1R A;  2JVA A;  4DV2 I;  4GKJ E;  1FJG E;  2VQF E;  1IBM I;  3LLH A;  1HNW I;  4LF9 E;  4R1F A;  4WUD A;  2HKJ A;  2Q2E B;  4X64 I;  2LBS B;  1FI4 A;  2X36 A;  4EMD A;  3GON A;  1J5E I;  2NUE A;  5IT9 C;  1KTV A;  1X48 A;  4GKK E;  3D4J A;  4JI1 I;  4JV5 I;  4DUZ E;  3WU4 A;  2F4V I;  4HAC B;  4LF8 I;  2V2Z A;  3C4B A;  1IBK E;  4P52 A;  2CZ9 A;  4OX9 I;  4DR5 E;  1XMO I;  2HHH E;  4LF7 I;  3K17 A;  4K0K E;  2L2N A;  1EI1 A;  1UHZ A;  3HUL A;  2UUA I;  4X66 I;  1T4O A;  4LF6 I;  3B78 A;  4JI8 E;  4X65 E;  4HY1 A;  5LMN I;  5IWA I;  2L3J A;  4AQY E;  3ZZ0 A;  3QT7 A;  2V2Q A;  2DEI A;  1ZXM A;  2B7V A;  4LF5 I;  2NUF A;  3ADG A;  2B3T B;  4FWD A;  3C4T A;  4DUY I;  4DR2 I;  1ZM9 A;  4LFA I;  2N3H A;  4JI6 I;  3ZZT A;  4LF4 E;  1FWK A;  3PYF A;  2E5L I;  4KHP E;  2HKE A;  1PVG A;  4JI4 I;  4DR4 I;  4DR6 I;  3JAM Q;  1IBL E;  1NHH A;  2XEX A;  2UUB I;  4DV2 E;  4NXN E;  3J80 Q;  1IBM E;  4URL A;  4DV4 E;  1DAR A;  1FNM A;  4LFB I;  4DV1 I;  1NHJ A;  2WW4 A;  4NXM I;  2R42 A;  2BM1 A;  2HFU A;  4JI5 I;  1H7S A;  2L3C A;  4JG4 A;  4WUB A;  1J5E E;  1N33 E;  4JV5 E;  1Z0T A;  1K47 A;  3V5R A;  4DV5 E;  1Z0B A;  1X49 A;  4LF8 E;  4JYA I;  2RS6 A;  1Z5A A;  1BKN A;  4OX9 E;  4YY3 I;  1ZBT A;  1FKA E;  1A6F A;  4KQV A;  4JI0 I;  3WU6 A;  5A2Q C;  4Z7Y A;  2UU9 I;  3PYG A;  4DU8 A;  4UT4 A;  4X66 E;  2EZ6 A;  4DR3 I;  4LF6 E;  3OTO I;  3J81 C;  1XNR E;  4JI2 I;  5LMN E;  5FLX Q;  5IWA E;  1T4N A;  1HNX E;  1ZM3 A;  3LPS A;  4FN5 A;  4I3H A;  1YYO A;  1X47 A;  5LMU E;  1Z0E A;  2HFS A;  2J7K A;  4DV7 I;  2UXC I;  3QT6 A;  2L2M A;  1Z0V A;  4FW9 A;  4LFA E;  4WFT A;  1HR0 I;  1YYW A;  4ED4 A;  4P7A A;  4USM A;  2R3V A;  2YT4 A;  1I94 E;  3PYD A;  2DEJ A;  3J7A M;  3LNU A;  4JI4 E;  4PU9 A;  4HXZ A;  4MYU A;  2UUC I;  1KIJ A;  1H72 C;  1UIL A;  3ZKD A;  2NA2 A;  4B3T I;  4B3S E;  3T1H I;  1U2R A;  1T4L B;  4DV6 E;  4XTJ A;  1Z5C A;  2CPN A;  4LFC I;  1HNZ I;  4PRV A;  2VQE E;  3QT8 A;  2ZIT A;  2B7T A;  4X8W A;  4JI5 E;  1XMQ E;  1EA6 A;  3PYE A;  1ZM2 A;  2UXD I;  1XNQ I;  2UXB I;  4HYM A;  3CWV A;  4USK A;  2LJH A;  1N34 I;  2A2C A;  2V2V A;  1ZM4 A;  1YYK A;  3F0N A;  4YY3 E;  3VYX A;  4JI3 E;  1NZ0 A;  2N3G A;  2KHX A;  4DPX A;  2UU9 E;  4M30 A;  4JI7 E;  1N36 I;  4M1K A;  4DPU A;  3ADL A;  4OOG C;  4B3M I;  3HTX A;  2OI2 A;  4DR7 E;  4GKJ I;  2LUP B;  1H74 A;  1HNW E;  2L33 A;  4DV7 E;  4HAC A;  4X64 E;  3H4L A;  4Z7C A;  2ZM6 I;  3J7A G;  5LL6 R;  1DI2 A;  4GKK I;  4RPF A;  4DUZ I;  2MDR A;  1RRE A;  3B82 A;  2V8P A;  4JI1 E;  2F4V E;  1IBK I;  3J7Y p;  2VF3 A;  2RS7 A;  2UUC E;  3ZKB A;  2LUQ A;  4DR5 I;  1KVK A;  4B3T E;  1N0U A;  2BV3 A;  1XHK A;  3V2U C;  3J80 C;  1WHN A;  4K0K I;  3T1H E;  1WUU A;  1S4E A;  1XMO E;  4LF7 E;  1H73 A;  1OJ4 A;  2BM0 A;  4LFC E;  1UEK A;  2AJ4 A;  2UUA E;  4JI8 I;  4X65 I;  3LTO A;  1D6T A;  2EFG A;  4UTG A;  3P1X A;  3ZZU A;  4AQY I;  1WHQ A;  2JY9 A;  4DR1 I;  3QT5 A;  2UXB E;  1KKH A;  4ZVI A;  1N34 E;  2HK3 A;  4LF5 E;  1ZXN A;  3ZM7 A;  3T1Y I;  1Z5B A;  2NUG A;  2DB2 A;  4LF4 I;  4DUY E;  3VYY A;  4DR2 E;  1VIS A;  4KHP I;  4JI6 E;  4WYQ B;  1PIE A;  2E5L E;  5IT9 Q;  2LRS A;  4B3M E;  4DR4 E;  4DR6 E;  4DV3 I;  4NXN I;  2UUB E;  5GME A;  4DV4 I;  5BR8 I;  2HK2 A;  1B63 A;  5L3J A;  1N32 I;  4PRX A;  1Z0C A;  4LFB E;  4DV1 E;  2ZM6 E;  4X62 I;  1O0W A;  2NPF A;  4NXM E;  4YHH I;  1Z59 A;  1N33 I;  1STU A;  4DV5 I;  3B8H A;  3ADI A;  3Q1Q A;  2LTS A;  4DPT A;  1PKP A;  1EKZ A; 
#chains in the Genus database with same CATH topology
 2EL6 A;  4JYA E;  1ZAA C;  4BHC A;  5JEA B;  3WU5 A;  2EMG A;  1QZR A;  2YTQ A;  2EPM X;  2MKN A;  2YTF A;  1NHI A;  4JI0 E;  2EM5 A;  2PNZ A;  3H09 A;  1N0V C;  2YTN A;  5ADZ A;  1Z0G A;  1MG7 A;  4DPW A;  4ZYD A;  3PS2 A;  4B3R I;  1R6M A;  1XNR I;  1T38 A;  2RTX A;  2EN4 A;  4DR3 E;  4DXL A;  2IOQ A;  2YU8 A;  3OTO E;  1HNX I;  1UDQ A;  2L2K B;  4IS1 C;  4JI2 E;  4BA2 A;  4DV0 I;  2EP3 A;  1WJP A;  2EL4 A;  4WSP A;  4DR1 E;  4R2P A;  4LPF A;  5LMU I;  1FJG I;  2VQF I;  3B4T A;  4LF9 I;  1VI7 A;  2EN8 A;  1J26 A;  1FWL A;  1B62 A;  2EMI A;  3CDI A;  5A69 A;  2WZO A;  3T1Y E;  2UXC E;  1YH8 A;  4IZK A;  4IJD A;  5C0X A;  1RR9 A;  3HPS A;  2JYA A;  1I94 I;  1HR0 E;  2YRK A;  2WBS A;  4GKK I;  2DIX A;  4DMI A;  2EML A;  2EOX A;  4IFD C;  3ADJ A;  1E3P A;  4MLQ A;  1MU5 A;  2RSM A;  4MYT A;  1QU6 A;  1Z0W A;  2ADR A;  3VK6 A;  3JAM C;  2ODR C;  4DV3 E;  4MDT A;  2I13 A;  1WXR A;  4B3S I;  1RC7 A;  2EE8 A;  2Z5B A;  2DLQ A;  2O1T A;  3WU3 A;  2YRH A;  2VF1 A;  3U1Y A;  2HHH I;  1AAY A;  2EM3 A;  4DV6 I;  2JOX A;  5BR8 E;  4MQY A;  4ZYE A;  2BA0 D;  1YZ9 A;  2NAB A;  2VQE I;  1N32 E;  2BA1 G;  5A2Q Q;  4IFD B;  2EMB A;  3THN A;  2LJP A;  1HNZ E;  2O1V A;  2EQ0 A;  2J7J A;  2R76 A;  2HGH A;  4R2A A;  4BA1 A;  1ELO A;  2EN6 A;  2LE2 A;  2ODR D;  4X62 E;  1F2I G;  3J81 Q;  1RQ0 A;  3EPJ A;  1A1I A;  1XMQ I;  4LU9 A;  1BB8 A;  2BV3 A;  4YHH E;  2O1W A;  2EQ3 A;  2EOQ A;  4DKK A;  1HK7 A;  2Z5C B;  1EH7 A;  5DNX A;  2IHR 1;  2JWO A;  5GMD A;  1TF3 A;  2JOB A;  2HJJ A;  4R8O A;  4F2J C;  4FWH A;  2UXD E;  4MU4 A;  2X7I A;  4WUC A;  2LTR A;  1XNQ E;  2K7I A;  2V34 A;  4WSG A;  2EM7 A;  4FWG A;  2Q8U A;  5CFF E;  4JI3 I;  2EPO A;  1SR9 A;  1GQE A;  2YTE A;  2M4I A;  1S16 A;  2LMZ A;  4IS9 A;  3M6A A;  2A2D A;  4JI7 I;  3BID A;  1ZR9 A;  2EM6 A;  2GS8 A;  2HC5 A;  2LV2 A;  4B3R E;  1TF6 A;  4DU7 A;  1H7U A;  1MX0 A;  2FGG A;  1N3G A;  2BBG A;  5T6J A;  2ZBK B;  1N36 E;  3K1J A;  4DPY A;  2EM2 A;  2EN2 A;  2ENA A;  4DR7 I;  1PJQ A;  1IBL I;  5DRR A;  5FLX C;  2DMY A;  3PS3 A;  3PRY A;  4M2Z A;  2JEB A;  2I9I A;  1X3C A;  3DF6 A;  4DV0 E;  1G2D C;  2E1R A;  2JVA A;  2NN6 A;  2GLI A;  4DV2 I;  4GKJ E;  1FJG E;  2JE6 A;  2GO3 A;  2VQF E;  1IBM I;  3LLH A;  1HNW I;  4LF9 E;  2NN6 E;  4R1F A;  1QNT A;  1OYR A;  2EOM A;  4R2D A;  4WUD A;  5C0X C;  2HKJ A;  2Q2E B;  4O24 A;  5KL5 A;  4X64 I;  4BA2 B;  4I8O A;  4HEI A;  2BB8 A;  2EMA A;  3K85 A;  4LTY A;  2LBS B;  4NBQ A;  1FI4 A;  2X36 A;  3KRN A;  4EMD A;  3GON A;  1J5E I;  2NUE A;  5IT9 C;  1KTV A;  1X48 A;  2EOF A;  4GKK E;  3D4J A;  4JI1 I;  4DUZ E;  4JV5 I;  3WU4 A;  2F4V I;  2M7Q A;  2B9D A;  5C0X D;  3HXL A;  4IZK B;  4HAC B;  1AH5 A;  4WXD A;  5A6A A;  4LF8 I;  2V2Z A;  2WBT A;  5DRP A;  2LCE A;  2L92 A;  3C4B A;  4R03 A;  1IBK E;  4P52 A;  2CZ9 A;  4AID A;  5C0X F;  4OX9 I;  2L8T A;  4P78 A;  4DR5 E;  2AE8 A;  2A25 A;  4ZYG A;  1XMO I;  4O5G A;  2HHH E;  4LF7 I;  3K17 A;  4K0K E;  2L2N A;  1EI1 A;  2LT7 A;  1UHZ A;  2D9H A;  1A1K A;  3HUL A;  2UUA I;  2M1S A;  1Y4U A;  2EPZ A;  3MSW A;  1TN9 A;  2E1M A;  1X5W A;  4X66 I;  2J65 A;  3GCM A;  1T4O A;  1X6H A;  4LF6 I;  2CG9 A;  3B78 A;  4JI8 E;  2JR1 A;  2EM0 A;  2V89 A;  4X65 E;  3M85 D;  2FTX B;  4HY1 A;  1PDA A;  5LMN I;  5IWA I;  3L7Z A;  4Q35 B;  2L3J A;  2GQ0 A;  4AQY E;  2O3Z A;  3ZZ0 A;  4BC9 A;  5LLQ A;  4FW3 A;  2WCC 3;  4BHB A;  3QG5 C;  3P3E A;  2V83 A;  2V2Q A;  2DEI A;  3QT7 A;  1ZXM A;  2EM9 A;  2GO4 A;  3EPK A;  1DGC A;  2B7V A;  4F6M A;  4LF5 I;  2NUF A;  3ADG A;  2B3T B;  3DJW A;  4FWD A;  3BF2 A;  3C4T A;  2RPC A;  4MU0 A;  2YPN A;  2ENC A;  1GZ6 A;  4DUY I;  2PO2 B;  4DR2 I;  4F54 A;  1ZM9 A;  4LFA I;  2Z5E A;  2N3H A;  3PS1 A;  2EPN A;  1IQO A;  4JI6 I;  3ZZT A;  5EL9 A;  4LF4 E;  1FWK A;  3KWR A;  3PYF A;  2E5L I;  4J8Z A;  4KHP E;  4OKG A;  2HKE A;  1PVG A;  5C0X E;  2V86 A;  4JI4 I;  4DR4 I;  4DR6 I;  2NN6 C;  4NZV A;  2EMF A;  3JAM Q;  1IBL E;  4F9B B;  4HTG A;  1NHH A;  2EMZ A;  4FW4 A;  4OO1 A;  2XEX A;  2UUB I;  1SFE A;  4DV2 E;  4NXN E;  3J80 Q;  2LO3 A;  3MHS C;  2MC6 A;  2WP8 A;  4J3D A;  2C37 B;  4OO1 E;  1IBM E;  4URL A;  3HKM A;  3IWC A;  4DV4 E;  1DAR A;  1FNM A;  4NHR A;  2F8B A;  4LFB I;  3U1K A;  3ECR A;  1BBO A;  4DV1 I;  4IZJ A;  2CVE A;  2NN6 D;  1Y60 A;  3P06 A;  2NN6 B;  1NHJ A;  2WW4 A;  4NXM I;  3TQM A;  3IWD A;  2YTP A;  1P42 A;  2BM1 A;  2JE6 B;  2HFU A;  2NN6 F;  1USU A;  2R42 A;  2YU5 A;  1H7S A;  2L3C A;  1OYS A;  4OZE A;  5JEA A;  4KZS A;  4JG4 A;  4JI5 I;  5DNL A;  4WUB A;  3UK3 C;  1J5E E;  1N33 E;  1T39 A;  3RMP A;  4JV5 E;  5KL3 A;  1Z0T A;  5KL2 A;  1K47 A;  3V5R A;  4DV5 E;  4MLV A;  1P47 A;  1Z0B A;  1X49 A;  4LF8 E;  2JT2 A;  2WBU A;  3GLL A;  4JYA I;  2RS6 A;  4BMJ A;  1Z5A A;  4N3O A;  1A1G A;  3EPH A;  2EPU A;  4R2R A;  1BKN A;  4OX9 E;  3EQ1 A;  4BBY A;  2JP9 A;  1XXE A;  4YY3 I;  1ZBT A;  2EM8 A;  5TSE A;  1FKA E;  2EOR A;  2MC5 A;  2FV4 B;  1A6F A;  4KQV A;  4BCA A;  3H1C A;  4JI0 I;  3WU6 A;  5A2Q C;  4LCF A;  1KJK A;  4Z7Y A;  2UU9 I;  3PYG A;  4DU8 A;  4QNJ A;  4UT4 A;  2YTI A;  2R1F A;  4X66 E;  2EZ6 A;  4DR3 I;  3HQ1 A;  4LF6 E;  3OTO I;  3MHH C;  3J81 C;  4LOM A;  2V8Q B;  1XNR E;  4GQU A;  2DMI A;  2PO0 A;  4JI2 I;  2EMY A;  3M7N D;  5LMN E;  1UDS A;  5IWA E;  1T4N A;  5FLX Q;  1HNX E;  1ZM3 A;  3LPS A;  1UBD C;  2JEA A;  4FN5 A;  4BC7 A;  2PNZ B;  4N4R B;  4QNK A;  3C6K A;  2CT1 A;  4I3H A;  2EOI A;  2V88 A;  3IWB A;  1YYO A;  1X47 A;  5LMU E;  1Z0E A;  2HFS A;  5ELW A;  2J7K A;  3LML A;  2RSI A;  4DV7 I;  2UXC I;  3QT6 A;  2VRD A;  2L2M A;  3BBG A;  1Z0V A;  4FW9 A;  2YWQ A;  4LFA E;  4WFT A;  1HR0 I;  2EPC A;  1YYW A;  2V85 A;  4P7A A;  4ED4 A;  4USM A;  1NCS A;  2EMW A;  2R3V A;  3CDJ A;  3UHM A;  4KWY A;  2YT4 A;  1I94 E;  3PYD A;  2EOE A;  2YTJ A;  4OO1 C;  2DEJ A;  3J7A M;  3LNU A;  4X9J A;  3P76 A;  4JI4 E;  4PU9 A;  4M0V A;  2H36 X;  4HXZ A;  4MYU A;  4IFD A;  5K36 F;  3KZY A;  4P7D A;  2UUC I;  2EOS A;  1EH8 A;  5C0X B;  1KIJ A;  1JK2 A;  1UIL A;  1H72 C;  3ZKD A;  4ZYH A;  2NA2 A;  4B3T I;  2EOZ A;  2BR2 A;  4B3S E;  1ZBQ A;  2EOY A;  4WPY A;  3T1H I;  4WX9 A;  2PRT A;  1U2R A;  1T4L B;  4DV6 E;  4XTJ A;  1Z5C A;  2CPN A;  3Q6N A;  4LFC I;  4LCH A;  1HNZ I;  4OO1 D;  4PRV A;  4OO1 B;  1YUI A;  2VQE E;  3OML A;  5JEA C;  4O43 A;  2EJ4 A;  3QT8 A;  4OO1 F;  2V87 A;  2Z5B B;  2WP8 B;  2C39 A;  2B7T A;  4X8W A;  2ZIT A;  3HJC A;  4U3B A;  1X6F A;  4JI5 E;  1XMQ E;  1DQ3 A;  2WNR A;  4MU3 A;  4AIM A;  4IZJ D;  1YPN A;  2EPX A;  1EA6 A;  2F1D A;  4IZJ B;  2BA0 G;  1ZM2 A;  3PYE A;  2EOH A;  5DRO A;  2UXD I;  4RH8 A;  4MU1 A;  2DLK A;  1XNQ I;  2UXB I;  2EMX A;  4RHB B;  4HYM A;  3CWV A;  4USK A;  5JEA D;  2LJH A;  4BA1 B;  1N34 I;  2A2C A;  5AAS A;  2YSP A;  3ZOQ B;  1ZM4 A;  2V2V A;  3P3C A;  1B69 A;  1A1F A;  1YYK A;  5JEA F;  2YTG A;  2YRM A;  1MEY C;  2C38 A;  1UDO A;  3F0N A;  3Q6M A;  1IQS A;  4YY3 E;  2G7H A;  3VYX A;  5K36 A;  5DNY A;  1YSA C;  4JI3 E;  5A6J A;  3VHT B;  1NZ0 A;  2N3G A;  2KHX A;  4DPX A;  2UU9 E;  2MDG A;  1IMU A;  4M30 A;  5K36 E;  2ENH A;  2EN7 A;  5AE1 A;  1L4S A;  4JI7 E;  1UN6 B;  2VES A;  1ZU1 A;  4FW5 A;  1N36 I;  4AM3 A;  3JU0 A;  4ISA A;  4M1K A;  4DPU A;  4GEQ B;  4FW6 A;  3ADL A;  4OOG C;  4L8N A;  1A1H A;  2IOP A;  4B3M I;  3HTX A;  4Q28 A;  2OI2 A;  4DR7 E;  4WXC A;  5A6B A;  4GKJ I;  3NZK A;  2LUP B;  5FWK A;  2YTD A;  2EMK A;  4U3D A;  2EN3 A;  2PNL A;  2PO0 B;  4O4K A;  2O1U A;  1H74 A;  1PJS A;  1HNW E;  2PO1 A;  5KL4 A;  2PNM A;  4R2S A;  2L33 A;  4DV7 E;  1UDN A;  3M7N G;  2EQ1 A;  1R6L A;  2JEA B;  4HAC A;  4X64 E;  3H4L A;  2JEB B;  4Z7C A;  5A6K A;  3J7A G;  2ZM6 I;  5LL6 R;  2M9A A;  1DI2 A;  2LJU A;  1PJT A;  4L5N C;  2EM4 A;  2K4V A;  2KON A;  1NEI A;  3FIG A;  2MDR A;  1RRE A;  4RPF A;  4DUZ I;  2EMH A;  5F3W A;  3B82 A;  3JTZ A;  4GZN C;  2JPA A;  2V8P A;  2EL5 A;  4JI1 E;  3F6H A;  2F4V E;  3J7Y p;  5JEA E;  1IBK I;  2VF3 A;  2RS7 A;  2UUC E;  3ZKB A;  2LUQ A;  4DR5 I;  1KYQ A;  2N8X A;  1KVK A;  4B3T E;  1N0U A;  2EOJ A;  1Z1B A;  2EPP A;  1XHK A;  2EPL X;  3J80 C;  1WHN A;  4F9A B;  4K0K I;  3T1H E;  1WUU A;  1S4E A;  4IFD D;  2IER A;  1XMO E;  4LF7 E;  1H73 A;  1OJ4 A;  2YZT A;  2BM0 A;  4LFC E;  3KZZ A;  1UEK A;  2AJ4 A;  4IFD F;  4F9C B;  2UUA E;  4JI8 I;  1YUJ A;  4X65 I;  3LTO A;  2BR2 B;  1D6T A;  1YHC A;  2CTD A;  2EPA A;  2EOO A;  2MKD A;  2EFG A;  4UTG A;  1BBG A;  3P1X A;  3ZZU A;  1JK1 A;  1GTK A;  3AUZ A;  2GPI A;  3AV0 A;  4FK5 C;  4AQY I;  3P3G A;  5EKW A;  2PO2 A;  1WHQ A;  2YSO A;  1LLM C;  3K6Q A;  2JY9 A;  4TUI A;  3QT5 A;  5DRQ A;  4DR1 I;  1Y6Z A;  3GME A;  2UXB E;  3M99 B;  1YFH A;  2C39 B;  3L00 A;  3EPL A;  2ELY A;  1KKH A;  1Y5Y A;  1N34 E;  4ZVI A;  5K36 C;  3V2U C;  4F6N A;  2HK3 A;  4LF5 E;  3M85 G;  1ZXN A;  2WNR B;  3ZM7 A;  1Y4S A;  1Z5B A;  3L7Z B;  3T1Y I;  1WRJ A;  2NUG A;  2DB2 A;  1X6E A;  4LF4 I;  5AE3 A;  4DUY E;  3VYY A;  2VE7 C;  4DR2 E;  1VIS A;  3DD6 A;  4KHP I;  4JI6 E;  1E3H A;  2YTO A;  4WYQ B;  1PIE A;  2E5L E;  5IT9 Q;  5AC4 A;  2C37 A;  4M9V C;  4FW7 A;  2C38 B;  2LRS A;  4R2Q A;  5K36 D;  3C6M A;  1RHY A;  5K36 B;  2DSY A;  2BA1 D;  4B3M E;  4DR4 E;  3BGH A;  2EPR A;  1G2F C;  4DR6 E;  4DV3 I;  2E72 A;  4NXN I;  2JXP A;  4BS9 A;  4IFD E;  2UUB E;  2EMC A;  4LCG A;  3HPZ A;  1EH6 A;  2ELZ A;  5GME A;  4DV4 I;  2DRP A;  5BR8 I;  2HK2 A;  2RQL A;  1B63 A;  5L3J A;  3THO B;  1N32 I;  2Z5C A;  5IV8 B;  4R2E A;  2CSH A;  5A6B D;  2KOU A;  2LVH A;  4PRX A;  1Z0C A;  2GHF A;  4LFB E;  4R2C A;  2IES A;  4DV1 E;  2ZM6 E;  1RMD A;  2L6M A;  4TUG A;  4X62 I;  1O0W A;  2NPF A;  4NXM E;  4YHH I;  1Z59 A;  2EN1 A;  1N33 I;  1STU A;  2PO1 B;  4DV5 I;  3B8H A;  5AC5 A;  1A1L A;  1MGT A;  3ADI A;  2LTS A;  3Q1Q A;  4DPT A;  3F6G A;  1PKP A;  5AE2 A;  2EPK X;  5KL6 A;  5KL7 A;  1EKZ A;  2DGC A;  1OYP A;  2CGE A;  1USV A;  1A1J A;  5IXM B;  2EWL A; 
#chains in the Genus database with same CATH homology
 4JYA E;  3WU5 A;  1QZR A;  1NHI A;  4JI0 E;  3H09 A;  1N0V C;  5ADZ A;  1Z0G A;  1MG7 A;  4DPW A;  4B3R I;  1XNR I;  2RTX A;  4DR3 E;  4DXL A;  2IOQ A;  3OTO E;  1HNX I;  2L2K B;  4JI2 E;  4DV0 I;  4WSP A;  4DR1 E;  5LMU I;  1FJG I;  2VQF I;  4LF9 I;  1J26 A;  1FWL A;  1B62 A;  2WZO A;  3T1Y E;  2UXC E;  4IZK A;  1RR9 A;  3HPS A;  1I94 I;  1HR0 E;  2DIX A;  4DMI A;  3ADJ A;  1MU5 A;  2RSM A;  4MYT A;  1QU6 A;  1Z0W A;  3VK6 A;  3JAM C;  2ODR C;  4DV3 E;  1WXR A;  4B3S I;  1RC7 A;  2Z5B A;  2O1T A;  3WU3 A;  2VF1 A;  2HHH I;  4DV6 I;  2JOX A;  5BR8 E;  1YZ9 A;  2VQE I;  1N32 E;  5A2Q Q;  2LJP A;  1HNZ E;  2O1V A;  1ELO A;  2LE2 A;  2ODR D;  4X62 E;  3J81 Q;  1XMQ I;  1RQ0 A;  4LU9 A;  4YHH E;  2O1W A;  4DKK A;  1HK7 A;  2Z5C B;  2IHR 1;  2JWO A;  5GMD A;  2JOB A;  4R8O A;  4FWH A;  2UXD E;  2X7I A;  4WUC A;  2LTR A;  1XNQ E;  2V34 A;  4FWG A;  5CFF E;  4JI3 I;  1SR9 A;  1GQE A;  2M4I A;  1S16 A;  2LMZ A;  3M6A A;  2A2D A;  4JI7 I;  2GS8 A;  4B3R E;  4DU7 A;  1H7U A;  1MX0 A;  2FGG A;  5T6J A;  2ZBK B;  1N36 E;  3K1J A;  4DPY A;  4DR7 I;  1IBL I;  5FLX C;  2DMY A;  3PRY A;  4M2Z A;  4DV0 E;  3DF6 A;  2E1R A;  2JVA A;  4DV2 I;  4GKJ E;  1FJG E;  2VQF E;  1IBM I;  3LLH A;  1HNW I;  4LF9 E;  4R1F A;  4WUD A;  2HKJ A;  2Q2E B;  4X64 I;  4I8O A;  3K85 A;  4LTY A;  2LBS B;  1FI4 A;  2X36 A;  4EMD A;  3GON A;  1J5E I;  2NUE A;  5IT9 C;  1KTV A;  1X48 A;  4GKK E;  3D4J A;  4JI1 I;  4JV5 I;  4DUZ E;  3WU4 A;  2F4V I;  2M7Q A;  2B9D A;  3HXL A;  4IZK B;  4HAC B;  4LF8 I;  2V2Z A;  3C4B A;  2L92 A;  4R03 A;  1IBK E;  4P52 A;  2CZ9 A;  4OX9 I;  2L8T A;  4P78 A;  4DR5 E;  1XMO I;  2HHH E;  4LF7 I;  3K17 A;  4K0K E;  2L2N A;  1EI1 A;  1UHZ A;  3HUL A;  2UUA I;  2M1S A;  1Y4U A;  3MSW A;  2E1M A;  4X66 I;  1T4O A;  4LF6 I;  2CG9 A;  3B78 A;  4JI8 E;  2JR1 A;  2V89 A;  4X65 E;  2FTX B;  4HY1 A;  5LMN I;  5IWA I;  2L3J A;  2GQ0 A;  4AQY E;  3ZZ0 A;  4BC9 A;  3QT7 A;  2V83 A;  2V2Q A;  2DEI A;  1ZXM A;  2B7V A;  4LF5 I;  2NUF A;  3ADG A;  2B3T B;  3DJW A;  4FWD A;  3C4T A;  1GZ6 A;  4DUY I;  4DR2 I;  4F54 A;  1ZM9 A;  4LFA I;  2Z5E A;  2N3H A;  4JI6 I;  3ZZT A;  4LF4 E;  1FWK A;  3KWR A;  3PYF A;  2E5L I;  4J8Z A;  4KHP E;  2HKE A;  1PVG A;  2V86 A;  4JI4 I;  4DR4 I;  4DR6 I;  3JAM Q;  1IBL E;  4F9B B;  1NHH A;  2XEX A;  2UUB I;  4DV2 E;  4NXN E;  3J80 Q;  2MC6 A;  1IBM E;  4URL A;  3IWC A;  4DV4 E;  1DAR A;  1FNM A;  2F8B A;  4LFB I;  4DV1 I;  4IZJ A;  3P06 A;  1NHJ A;  2WW4 A;  4NXM I;  3IWD A;  2R42 A;  2BM1 A;  2HFU A;  1USU A;  4JI5 I;  1H7S A;  2L3C A;  4KZS A;  4JG4 A;  4WUB A;  1J5E E;  1N33 E;  4JV5 E;  3RMP A;  1Z0T A;  1K47 A;  3V5R A;  4DV5 E;  1Z0B A;  1X49 A;  4LF8 E;  4JYA I;  2RS6 A;  4BMJ A;  1Z5A A;  4N3O A;  1BKN A;  4OX9 E;  4BBY A;  4YY3 I;  1ZBT A;  1FKA E;  1A6F A;  2MC5 A;  2FV4 B;  4KQV A;  4JI0 I;  4BCA A;  3WU6 A;  5A2Q C;  4Z7Y A;  2UU9 I;  3PYG A;  4DU8 A;  4UT4 A;  4X66 E;  2EZ6 A;  4DR3 I;  3HQ1 A;  4LF6 E;  3OTO I;  3J81 C;  2V8Q B;  1XNR E;  4JI2 I;  5LMN E;  5FLX Q;  5IWA E;  1T4N A;  1HNX E;  1ZM3 A;  3LPS A;  4FN5 A;  4BC7 A;  4I3H A;  2V88 A;  3IWB A;  1YYO A;  1X47 A;  5LMU E;  1Z0E A;  2HFS A;  2J7K A;  3LML A;  4DV7 I;  2UXC I;  3QT6 A;  2L2M A;  1Z0V A;  4FW9 A;  4LFA E;  4WFT A;  1HR0 I;  1YYW A;  4ED4 A;  2V85 A;  4P7A A;  4USM A;  2R3V A;  2YT4 A;  1I94 E;  3PYD A;  2DEJ A;  3J7A M;  3LNU A;  4JI4 E;  4PU9 A;  4M0V A;  2H36 X;  4HXZ A;  4MYU A;  2UUC I;  4P7D A;  1KIJ A;  1H72 C;  1UIL A;  3ZKD A;  2NA2 A;  4B3T I;  4B3S E;  1ZBQ A;  4WPY A;  3T1H I;  1U2R A;  1T4L B;  4DV6 E;  4XTJ A;  1Z5C A;  2CPN A;  3Q6N A;  4LFC I;  1HNZ I;  4PRV A;  2VQE E;  3OML A;  3QT8 A;  2V87 A;  2Z5B B;  2ZIT A;  2B7T A;  4X8W A;  3HJC A;  4JI5 E;  1XMQ E;  1DQ3 A;  4IZJ D;  1EA6 A;  4IZJ B;  3PYE A;  1ZM2 A;  2UXD I;  1XNQ I;  2UXB I;  4HYM A;  3CWV A;  4USK A;  2LJH A;  1N34 I;  2A2C A;  5AAS A;  2V2V A;  3ZOQ B;  1ZM4 A;  1YYK A;  3Q6M A;  3F0N A;  4YY3 E;  2G7H A;  3VYX A;  5DNY A;  4JI3 E;  1NZ0 A;  2N3G A;  2KHX A;  4DPX A;  2UU9 E;  4M30 A;  5AE1 A;  4JI7 E;  1N36 I;  3JU0 A;  4M1K A;  4DPU A;  4GEQ B;  3ADL A;  4OOG C;  4L8N A;  2IOP A;  4B3M I;  3HTX A;  4Q28 A;  2OI2 A;  4DR7 E;  4GKJ I;  2LUP B;  5FWK A;  2PNL A;  2O1U A;  1H74 A;  1HNW E;  2PNM A;  2L33 A;  4DV7 E;  4HAC A;  4X64 E;  3H4L A;  4Z7C A;  2ZM6 I;  3J7A G;  5LL6 R;  1DI2 A;  4L5N C;  4GKK I;  2K4V A;  2KON A;  3FIG A;  4RPF A;  2MDR A;  1RRE A;  4DUZ I;  3B82 A;  5F3W A;  3JTZ A;  2V8P A;  4JI1 E;  3F6H A;  2F4V E;  3J7Y p;  1IBK I;  2VF3 A;  2RS7 A;  2UUC E;  3ZKB A;  2LUQ A;  4DR5 I;  1KVK A;  4B3T E;  1N0U A;  2BV3 A;  1XHK A;  3V2U C;  3J80 C;  1WHN A;  4F9A B;  4K0K I;  3T1H E;  1WUU A;  1S4E A;  1XMO E;  4LF7 E;  1H73 A;  1OJ4 A;  2YZT A;  2BM0 A;  4LFC E;  1UEK A;  2AJ4 A;  4F9C B;  2UUA E;  4JI8 I;  4X65 I;  3LTO A;  1D6T A;  2EFG A;  4UTG A;  3P1X A;  3ZZU A;  3AUZ A;  4AQY I;  3AV0 A;  1WHQ A;  3K6Q A;  2JY9 A;  4TUI A;  3QT5 A;  4DR1 I;  1Y6Z A;  2UXB E;  1KKH A;  4ZVI A;  1N34 E;  2HK3 A;  4LF5 E;  1ZXN A;  3ZM7 A;  1Y4S A;  1Z5B A;  3T1Y I;  2NUG A;  2DB2 A;  4LF4 I;  5AE3 A;  4DUY E;  3VYY A;  2VE7 C;  4DR2 E;  1VIS A;  4KHP I;  4JI6 E;  4WYQ B;  1PIE A;  2E5L E;  5IT9 Q;  2LRS A;  2DSY A;  4B3M E;  4DR4 E;  4DR6 E;  4DV3 I;  4NXN I;  4BS9 A;  2UUB E;  3HPZ A;  5GME A;  4DV4 I;  5BR8 I;  2HK2 A;  1B63 A;  5L3J A;  1N32 I;  2Z5C A;  4PRX A;  2KOU A;  1Z0C A;  4LFB E;  4DV1 E;  2ZM6 E;  4TUG A;  2L6M A;  4X62 I;  1O0W A;  2NPF A;  4NXM E;  4YHH I;  1Z59 A;  1N33 I;  1STU A;  4DV5 I;  3B8H A;  3ADI A;  3Q1Q A;  2LTS A;  4DPT A;  3F6G A;  1PKP A;  5AE2 A;  1EKZ A;  2CGE A;  1USV A;  2EWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...