4DV3E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv3E02
3OTOI 1WHNA 1I94E 2BM0A 3QT8A 5IT9Q 3V2UC 2V2VA 2CZ9A 2X36A 4LFAE 2F4VE 3JAMQ 1ZXMA 2LBSB 1NHJA 4LFCI 4DPXA 1WHQA 2L33A 1Z0WA 4DV6I 1XNQE 2NUEA 3PYGA 1N36I 1Z0CA 1Z5BA 3JAMC 4K0KI 2AJ4A 3ZZ0A 1NZ0A 5LL6R 1NHIA 1H72C 1X49A 2NPFA 1UILA 4B3TE 4JI8I 3PYEA 3PYDA 2A2CA 2E1RA 1FWLA 1N32E 2N3HA 3J81C 3P1XA 5GMDA 3J7AM 4LFBE 2HKJA 2HHHI 4X64I 1X48A 4DUYE 4JI6E 2R42A 4HACB 4LF6I 2UUAI 4DR2I 3LNUA 4DXLA 4DR2E 4DU8A 2XEXA 1N32I 4JYAI 2E5LI 4JI8E 1A6FA 1HNWE 2Q2EB 1EI1A 4HXZA 4DUZI 4NXMI 5A2QQ 4DUYI 1X47A 3Q1QA 1FWKA 4LFBI 2JVAA 4FWHA 2V34A 1ZM3A 3QT6A 2JY9A 3LTOA 4LF5I 4B3SI 4DR5I 2UUCI 4B3MI 2LJHA 4JI1I 3QT7A 2UUBE 4DV1I 4NXNE 4MYUA 4YY3I 2B7VA 4URLA 4Z7YA 3H4LA 4K0KE 4HACA 4LF4I 3K17A 3T1YE 5BR8E 1YYWA 1MU5A 2L3JA 3HTXA 4DU7A 1KIJA 3PYFA 4P52A 2DB2A 5L3JA 3J80C 3J7Yp 1KTVA 2VQEE 1N33E 4DPTA 2V2ZA 4I3HA 2DEIA 1D6TA 3LLHA 4DR4E 1FJGI 1J5EI 3ADJA 4DV1E 3VYXA 4WUDA 4KHPE 4MYTA 3B8HA 2L3CA 4DR5E 4DV3E 3T1YI 4USKA 4LF4E 3ADLA 4GKKE 1BKNA 3ZZTA 1T4NA 4JI4I 1HR0I 4DR7I 4WUBA 4DV5E 4USMA 4NXNI 1N34I 2ZBKB 4DR3I 4DV7I 4DR1I 2EZ6A 2HK3A 4DV7E 2A2DA 3J81Q 1YYKA 2UUAE 1IBME 2IHR1 5FLXC 1S4EA 4JI6I 2L2KB 2OI2A 5A2QC 2EFGA 4X62E 2HHHE 2ZITA 3B82A 1T4OA 1HNWI 4UT4A 3LPSA 1XMOE 2LUQA 1HNZE 4B3RI 1EKZA 4GKJI 4P7AA 3ZKBA 4DV4E 1RC7A 4Z7CA 2NUGA 1Z0EA 1WUUA 3B78A 3CWVA 4WUCA 2LRSA 4WYQB 1PVGA 4GKKI 4ZVIA 4X65E 2NA2A 1S16A 1Z5CA 2N3GA 4FWDA 1H74A 2V8PA 4YHHI 4X66E 2KHXA 3D4JA 3WU5A 1Z0TA 3ADGA 1N33I 2MDRA 2VQEI 4LF9I 1J26A 1Z0BA 4DV0E 1PKPA 3ZZUA 1MG7A 4HY1A 1IBLI 4JI5I 4YHHE 5LMUE 1B63A 5LMUI 1IBKE 1DARA 4AQYE 5LMNI 5FLXQ 3C4BA 4FN5A 2YT4A 1ZM2A 1ZBTA 5BR8I 4UTGA 2NUFA 4XTJA 2RS6A 3VYYA 4LF8E 2UXDE 1N0VC 2UUBI 1RQ0A 1HNXE 2UXCE 1Z0VA 2E5LE 4DR6I 5IT9C 2RSMA 2UUCE 4B3ME 4LF7E 4JI7E 5IWAE 4PRXA 4X65I 1UEKA 2ZM6E 4JI2I 5GMEA 4JG4A 2VF3A 4X64E 2HFUA 4JI0E 1UHZA 1FNMA 4JI2E 1QZRA 2B3TB 2BM1A 1OJ4A 4JYAE 4M30A 5IWAI 4JI7I 2LTSA 1XMOI 1HNZI 4KQVA 2UXCI 2WW4A 1HNXI 3HULA 3WU4A 2UXBE 2HKEA 4JI4E 2LUPB 4DPYA 3K1JA 3ZM7A 3WU3A 1H7SA 3QT5A 2RTXA 4LF7I 2LTRA 1FI4A 1YZ9A 2V2QA 4DR1E 2HK2A 2R3VA 4JV5I 5LMNE 4AQYI 1KKHA 1VISA 1FJGE 4DR4I 2DIXA 4LF8I 1GQEA 3J80Q 1N36E 1O0WA 3OTOE 4OOGC 4PU9A 2UU9E 1PIEA 4X66I 4HYMA 3WU6A 1IBKI 3M6AA 3T1HI 1ZXNA 3T1HE 1XMQE 4LFAI 2F4VI 1XHKA 2UU9I 4DV0I 1MX0A 4FW9A 4JI3E 2B7TA 4LF9E 4DKKA 1NHHA 4JI3I 2J7KA 1I94I 1K47A 3J7AG 1STUA 4DV2I 2VQFE 2L2NA 4YY3E 4EMDA 1RR9A 1KVKA 4GKJE 1QU6A 4FWGA 4RPFA 4JI1E 4OX9I 1DI2A 1Z0GA 1ZM4A 2X7IA 2RS7A 1XNRE 1H7UA 2DEJA 2HFSA 1RREA 4DV4I 4ED4A 1T4LB 1IBLE 4JV5E 1B62A 1N0UA 3ADIA 4B3RE 2DMYA 1ELOA 4B3SE 4LF5E 4DPWA 3GONA 1YYOA 1U2RA 4DV5I 1H73A 4X62I 2UXBI 5CFFE 4DUZE 4NXME 3ZKDA 4WFTA 1IBMI 4DV3I 2BV3A 3F0NA 3V5RA 1EA6A 4DR3E 4LF6E 4B3TI 1N34E 2CPNA 1Z5AA 1J5EE 2GS8A 4M1KA 2VQFI 1HR0E 4DR7E 4JI0I 1FKAE 4X8WA 4M2ZA 2ZM6I 1XNRI 1Z59A 4PRVA 4R1FA 2L2MA 4DR6E 4OX9E 1XNQI 3C4TA 4DV6E 4KHPI 2UXDI 4DPUA 1XMQI 4LFCE 2LJPA 1ZM9A 4JI5E 4DV2E
chains in the Genus database with same CATH superfamily
2Z5BB 4BS9A 4F9AB 3OTOI 2YU8A 3QG5C 1WHNA 1I94E 1R6MA 2BM0A 3QT8A 5IT9Q 4BHBA 3V2UC 2V2VA 2CZ9A 2X36A 2M9AA 4LFAE 2F4VE 3JAMQ 1ZXMA 4U3BA 2NN6D 3MSWA 1Y4UA 3H1CA 2MKDA 2LBSB 5AASA 1NHJA 1UDQA 4LFCI 4DPXA 1WHQA 5JEAF 2L33A 3LMLA 1YUJA 1Z0WA 2JR1A 2NN6A 2ELZA 4DV6I 1XNQE 2V89A 2NUEA 3JTZA 3PYGA 1N36I 5F3WA 1P47A 3Q6MA 1Z0CA 2EL5A 2YTOA 1Z5BA 3JAMC 2EE8A 2EMZA 2EJ4A 3MHSC 4K0KI 1GZ6A 2AJ4A 3ZZ0A 4L5NC 5LL6R 1NZ0A 3RMPA 4IS1C 4FW4A 4MU1A 1NHIA 1H72C 1WXRA 1X49A 5JEAD 2F4VI 4DMIA 2EM4A 4NZVA 4FW5A 2NPFA 1UILA 4B3TE 4JI8I 3PYDA 3PYEA 2A2CA 2E1RA 2WP8B 1FWLA 5A6JA 1N32E 2YTDA 5DNXA 2N3HA 1KYQA 4F54A 3J81C 2BB8A 4OO1C 5A6BD 5FWKA 3P1XA 5GMDA 1L4SA 3J7AM 3KRNA 2C37B 4LFBE 1TN9A 2HKJA 1PDAA 2HHHI 4BCAA 3EPJA 4X64I 1X48A 4R2EA 5JEAC 4DUYE 2PNZB 4JI6E 2R42A 3M85D 4HACB 2DLKA 4LF6I 3VHTB 2UUAI 3P06A 4BC9A 4IFDD 4MU4A 4DR2I 2PNMA 2L8TA 3LNUA 4R2AA 4DXLA 2BR2A 2EQ0A 2EN6A 4ZYGA 4DR2E 2WP8A 2XEXA 4IZKA 4DU8A 4JYAI 1N32I 2E5LI 4OO1B 4JI8E 1A6FA 1HNWE 2GO4A 1PJTA 1EI1A 2Q2EB 2YTFA 4HXZA 4DUZI 3B4TA 4NXMI 2EMCA 4F6NA 5A2QQ 4DUYI 1X47A 5DNLA 3Q1QA 4OO1F 4TUIA 2YU5A 1Y5YA 1FWKA 2FV4B 1A1GA 4LFBI 2JVAA 4FWHA 2V34A 2GO3A 4IZJA 2JOXA 2YTPA 1ZM3A 3QT6A 4IFDB 2JY9A 2K4VA 3LTOA 3THOB 3K85A 4LF5I 4B3SI 3THNA 4DR5I 2UUCI 4B3MI 2LJHA 1E3PA 4JI1I 5DRQA 2MDGA 3QT7A 2YTEA 1UBDC 2UUBE 4N3OA 4MLQA 4DV1I 4BA2B 3EPLA 4NXNE 2JEAA 4MYUA 4YY3I 2HC5A 5C0XF 2B7VA 4URLA 5IXMB 4BMJA 4IFDC 4Z7YA 3H4LA 4K0KE 3HQ1A 2EL6A 1BBGA 2ELYA 4HACA 4LF4I 3K17A 4HTGA 3T1YE 1A1FA 5BR8E 2EM5A 1YYWA 1DQ3A 3MHHC 2Z5EA 2O1UA 1MU5A 3HJCA 4KWYA 2PO2A 2BA0D 5KL2A 2L3JA 3U1YA 2MC5A 3HTXA 4DU7A 1KIJA 4O5GA 3PYFA 4P52A 2JP9A 2DB2A 1X3CA 2PO1B 1MGTA 3J80C 2EPMX 5L3JA 2M1SA 3KZZA 3J7Yp 1KTVA 5C0XE 2R76A 2V86A 2VQEE 1N33E 2L92A 2VE7C 4DPTA 4QNKA 2EOIA 5AE3A 2V2ZA 4I3HA 2DEIA 1D6TA 2JYAA 2LO3A 2O3ZA 2IOQA 3LLHA 2BA1D 4DR4E 1FJGI 4RHBB 3GLLA 2EQ3A 3ADJA 3AV0A 4DV1E 2EPUA 1Y4SA 3VYXA 2EPOA 4F2JC 3HKMA 4WUDA 4KHPE 4BA1B 4MYTA 5DRPA 3B8HA 2CTDA 1YFHA 3NZKA 2KONA 2L3CA 3CDJA 2GQ0A 4DR5E 4DV3E 3T1YI 2EL4A 4OO1E 4USKA 2BA1G 2V88A 4LF4E 2O1TA 3ADLA 5JEAA 2NN6F 1MEYC 4GKKE 1BKNA 2BBGA 2C39B 5A6KA 2EPLX 4J8ZA 1ZAAC 1BB8A 1Y6ZA 4LCFA 3ZZTA 4AM3A 2V8QB 1T4NA 2EPCA 1YH8A 1HR0I 2EPRA 4JI4I 1HK7A 4DR7I 2ADRA 4WUBA 4DV5E 3Q6NA 4NXNI 4USMA 2EMXA 4IFDE 2DSYA 1UN6B 4OZEA 1N34I 2ZBKB 3CDIA 2M7QA 2ODRC 4DR3I 2EMFA 4DV7I 4OO1A 2EOZA 3ZOQB 4DR1I 1NCSA 2EZ6A 2HK3A 2CGEA 2EMGA 2V85A 2LV2A 4DV7E 2A2DA 1YYKA 3J81Q 2UUAE 1IBME 2K7IA 2IHR1 1A1IA 5EKWA 2B9DA 1Y60A 5FLXC 4R2QA 1S4EA 1T39A 4JI6I 2L2KB 5A2QC 1AAYA 2OI2A 5K36F 2JWOA 2YRMA 2FTXB 2BR2B 2PO2B 3M85G 2C38A 4X62E 4R2PA 2HHHE 2EFGA 2ZITA 1JK1A 2PO0A 5IV8B 1G2FC 3B82A 1T4OA 2YSPA 3DF6A 5TSEA 4UT4A 1HNWI 2LT7A 4R03A 3LPSA 4QNJA 1XMOE 2LUQA 1HNZE 4R2RA 2KOUA 4X9JA 1J5EI 2F1DA 4B3RI 1EKZA 2F8BA 4J3DA 4BC7A 2EMYA 2JOBA 2NABA 1E3HA 4FW3A 4GKJI 3KZYA 4P7AA 3ZKBA 2EPKX 4DV4E 2WCC3 2PRTA 1EH6A 1RC7A 4Z7CA 2YPNA 2NUGA 2EN4A 1Z0EA 3L00A 5AC4A 1YSAC 4O24A 1WUUA 2CG9A 2D9HA 2LRSA 4WYQB 3B78A 3CWVA 1PVGA 4WUCA 4GKKI 3K6QA 4ZVIA 4LTYA 4O4KA 4X65E 4R2CA 2IERA 5KL7A 2EMWA 4KZSA 4IZJB 2NA2A 5DNYA 1IQOA 1S16A 2J65A 1Z5CA 2MC6A 2EM9A 2LJUA 2N3GA 5AE1A 2C39A 4FWDA 1H74A 1ZU1A 3P3GA 2V8PA 3HPZA 1USUA 2HGHA 1TF3A 4YHHI 3M7ND 4X66E 2KHXA 3D4JA 3WU5A 4WX9A 2ENHA 3PS3A 2EN3A 1Z0TA 3ADGA 2EM8A 1DGCA 3EPHA 1N33I 2MDRA 3FIGA 2CVEA 2VQEI 4LF9I 1J26A 5C0XA 1Z0BA 3U1KA 4IFDF 2EM7A 3PRYA 4IS9A 4DV0E 4IJDA 1PKPA 3ZZUA 2PO1A 1MG7A 4HY1A 2V87A 1IBLI 4JI5I 4YHHE 5LMUE 2YTGA 2EOYA 1B63A 1USVA 2PNZA 1IBKE 5LMUI 2WNRB 1DARA 4AQYE 3KWRA 1IMUA 2VF1A 2PO0B 5FLXQ 5LMNI 1PJSA 3EPKA 3C4BA 4GZNC 2NN6C 3M99B 4MQYA 4FN5A 2EMLA 2YT4A 2ENCA 3DJWA 2Z5CA 2DGCA 1ZBTA 1ZM2A 5BR8I 5K36E 4UTGA 2EMAA 4BA1A 4N4RB 5KL5A 2NUFA 1T38A 1RHYA 3DD6A 4WXDA 2HJJA 4XTJA 2RS6A 3VYYA 4TUGA 5AE2A 4LF8E 5K36C 4WSGA 1SR9A 4BA2A 2CSHA 4OO1D 2E72A 2UXDE 1N0VC 2UUBI 1RQ0A 1HNXE 2WBUA 2UXCE 5K36A 1Z0VA 2CT1A 2E5LE 1EH7A 2ENAA 4IZKB 4DR6I 5IT9C 3IWDA 2RSMA 1F2IG 2UUCE 4B3ME 4ISAA 4LF7E 4JI7E 5IWAE 1A1JA 4PRXA 4X65I 2IESA 1UEKA 2H36X 1RMDA 2O1WA 2ZM6E 4R8OA 1YHCA 2Z5CB 1VI7A 4JG4A 5GMEA 4JI2I 2VF3A 2EM0A 2EOJA 2YWQA 2FGGA 4X64E 2HFUA 2E1MA 3EQ1A 4JI0E 1IQSA 4F9CB 2EM6A 2I9IA 1UHZA 1EH8A 2BA0G 1FNMA 4JI2E 1QZRA 2B3TB 2GHFA 2BM1A 1P42A 1OJ4A 2RSIA 4JYAE 4M30A 3P3EA 5IWAI 4JI7I 2LTSA 2EPNA 2EOHA 2WBTA 3IWBA 1XMOI 4F6MA 1XXEA 4P78A 1HNZI 5C0XB 3HPSA 2JE6A 4KQVA 2EM3A 4U3DA 2V83A 2UXCI 2WW4A 1LLMC 1HNXI 5JEAB 3HULA 2NN6E 2ODRD 3WU4A 2UXBE 2WZOA 2EMBA 1A1LA 2WBSA 2HKEA 3OMLA 4JI4E 2EPXA 2R1FA 2EOXA 3VK6A 1X5WA 2LUPB 4DPYA 2N8XA 3K1JA 3P3CA 3ZM7A 5DRRA 4LCGA 5K36B 3WU3A 2EORA 3H09A 1H7SA 3QT5A 4FK5C 2RTXA 2MKNA 1R6LA 4LF7I 2LTRA 1FI4A 1YZ9A 2V2QA 4DR1E 4F9BB 4GQUA 3BIDA 2HK2A 2R3VA 2EP3A 4JV5I 2LMZA 4MU3A 2JXPA 5LMNE 4AQYI 1KKHA 1WJPA 1VISA 3M7NG 1X6HA 5A69A 1FJGE 4DR4I 5DROA 2DIXA 3PS2A 4LF8I 2C38B 2YTQA 5AC5A 4ZYEA 4M0VA 3AUZA 5A6AA 1GQEA 3C6KA 2JEAB 2EPPA 4BBYA 3J80Q 4FW6A 4NBQA 1N36E 3F6GA 2VESA 1O0WA 3OTOE 4OOGC 1QNTA 2C37A 2UU9E 1PIEA 2JE6B 1WRJA 4PU9A 4X66I 4HYMA 3WU6A 2EMKA 2EMIA 2LCEA 4AIMA 4WPYA 3M6AA 3T1HI 5C0XC 1IBKI 1OYRA 1ZXNA 3T1HE 2RQLA 3UK3C 1XMQE 3GMEA 4LFAI 1XHKA 4O43A 5LLQA 1G2DC 2AE8A 1MX0A 4DV0I 2UU9I 2L6MA 3P76A 4FW9A 4LCHA 2YTNA 2J7JA 4JI3E 4LU9A 2B7TA 4LF9E 4DKKA 3IWCA 1X6FA 1NHHA 4JI3I 2J7KA 1I94I 2A25A 1K47A 2JPAA 3J7AG 1STUA 2EN1A 3JU0A 2EOEA 4MU0A 2GPIA 4DV2I 1SFEA 2L2NA 2VQFE 4FW7A 5K36D 4YY3E 4EMDA 5KL4A 1RR9A 4IFDA 1KVKA 1N3GA 4GKJE 1NEIA 1QU6A 1ZR9A 5ADZA 1JK2A 1B69A 4FWGA 4RPFA 4JI1E 4OX9I 2EWLA 1DI2A 1Z0GA 3F6HA 1ZM4A 2EN8A 2X7IA 1X6EA 1UDOA 2RS7A 4IZJD 1TF6A 1XNRE 5JEAE 3PS1A 2EOFA 4RH8A 1H7UA 2DEJA 2EMHA 2YTJA 2HFSA 3C6MA 4ZYHA 1RREA 3BGHA 5A6BA 4R2DA 1YUIA 2LVHA 2I13A 2RPCA 4DV4I 2DRPA 4AIDA 4ED4A 2VRDA 1T4LB 4L8NA 1A1KA 4WXCA 5T6JA 2EOSA 4JV5E 1KJKA 1B62A 1N0UA 3ADIA 4B3RE 2O1VA 2DMYA 2LE2A 2YTIA 1UDSA 1ELOA 4B3SE 4LF5E 1ZBQA 2EOMA 3BF2A 4DPWA 4I8OA 2EPAA 3GONA 3L7ZA 2JEBA 1YYOA 1UDNA 2EM2A 1U2RA 2IOPA 4DV5I 4GEQB 1H73A 4MLVA 1OYSA 4X62I 2EN2A 2G7HA 4LOMA 2Z5BA 5C0XD 3L7ZB 2YRKA 2JT2A 5CFFE 4DUZE 4NXME 2UXBI 2WNRA 5EL9A 3ZKDA 4WFTA 2Q8UA 4Q28A 1IBMI 2DMIA 4DV3I 2BV3A 3F0NA 5KL6A 3V5RA 1EA6A 2EOQA 4DR3E 2PNLA 4LF6E 1PJQA 2EQ1A 5ELWA 4B3TI 1N34E 3BBGA 2CPNA 4R2SA 4OKGA 2EPZA 1Z5AA 1J5EE 3TQMA 4ZYDA 2GS8A 4M1KA 2DLQA 1OYPA 2VQFI 1HR0E 4DR7E 4JI0I 4MDTA 3GCMA 1AH5A 1BBOA 2EN7A 2YSOA 1A1HA 4JI5E 1FKAE 4X8WA 2GLIA 2M4IA 4P7DA 4M2ZA 2ZM6I 3HXLA 2EOOA 1XNRI 2YRHA 1Z59A 1GTKA 4WSPA 4PRVA 4R1FA 4BHCA 4NHRA 2L2MA 4DR6E 4OX9E 4HEIA 1XNQI 1YPNA 2YZTA 4LPFA 3C4TA 4DV6E 2JEBB 4KHPI 4Q35B 1Z1BA 5KL3A 4DPUA 2UXDI 1XMQI 4LFCE 2NN6B 3UHMA 3ECRA 4M9VC 2LJPA 1ZM9A 1IBLE 4DV2E
chains in the Genus database with same CATH topology
2Z5BB 4BS9A 4F9AB 3OTOI 1WHNA 1I94E 2BM0A 3QT8A 5IT9Q 3V2UC 2V2VA 2CZ9A 2X36A 4LFAE 2F4VE 3JAMQ 1ZXMA 3MSWA 1Y4UA 2LBSB 5AASA 1NHJA 4LFCI 4DPXA 1WHQA 2L33A 3LMLA 1Z0WA 2JR1A 4DV6I 1XNQE 2V89A 2NUEA 3JTZA 3PYGA 1N36I 5F3WA 3Q6MA 1Z0CA 1Z5BA 3JAMC 4K0KI 1GZ6A 2AJ4A 3ZZ0A 4L5NC 5LL6R 1NZ0A 3RMPA 1NHIA 1H72C 1WXRA 1X49A 4DMIA 2NPFA 1UILA 4B3TE 4JI8I 3PYDA 3PYEA 2A2CA 2E1RA 1FWLA 1N32E 2N3HA 4F54A 3J81C 5FWKA 3P1XA 5GMDA 3J7AM 4LFBE 2HKJA 2HHHI 4BCAA 4X64I 1X48A 4DUYE 4JI6E 2R42A 4HACB 4LF6I 2UUAI 3P06A 4BC9A 4DR2I 2PNMA 2L8TA 3LNUA 4DXLA 4DR2E 4IZKA 4DU8A 2XEXA 1N32I 4JYAI 2E5LI 4JI8E 1A6FA 1HNWE 2Q2EB 1EI1A 4HXZA 4DUZI 4NXMI 5A2QQ 4DUYI 1X47A 3Q1QA 4TUIA 1FWKA 2FV4B 4LFBI 2JVAA 4FWHA 2V34A 4IZJA 2JOXA 1ZM3A 3QT6A 2JY9A 2K4VA 3LTOA 4LF5I 3K85A 4B3SI 4DR5I 2UUCI 4B3MI 2LJHA 4JI1I 3QT7A 2UUBE 4N3OA 4DV1I 4NXNE 4MYUA 4YY3I 2B7VA 4URLA 4BMJA 4Z7YA 3H4LA 4K0KE 3HQ1A 4HACA 4LF4I 3K17A 3T1YE 5BR8E 1YYWA 1DQ3A 2Z5EA 2O1UA 1MU5A 3HJCA 2L3JA 2MC5A 3HTXA 4DU7A 1KIJA 3PYFA 4P52A 2DB2A 3J80C 5L3JA 2M1SA 3J7Yp 1KTVA 2V86A 2VQEE 1N33E 2L92A 2VE7C 4DPTA 5AE3A 2V2ZA 4I3HA 2DEIA 1D6TA 2IOQA 3LLHA 4DR4E 1FJGI 1J5EI 3ADJA 3AV0A 4DV1E 1Y4SA 3VYXA 4WUDA 4KHPE 4MYTA 3B8HA 2KONA 2L3CA 2GQ0A 4DR5E 4DV3E 3T1YI 4USKA 2V88A 4LF4E 2O1TA 3ADLA 4GKKE 1BKNA 4J8ZA 1Y6ZA 3ZZTA 2V8QB 1T4NA 4JI4I 1HR0I 4DR7I 1HK7A 4WUBA 4DV5E 3Q6NA 4NXNI 4USMA 2DSYA 1N34I 2ZBKB 2M7QA 2ODRC 4DR3I 4DV7I 3ZOQB 4DR1I 2EZ6A 2HK3A 2CGEA 2V85A 4DV7E 2A2DA 3J81Q 1YYKA 2UUAE 1IBME 2IHR1 2B9DA 5FLXC 1S4EA 4JI6I 2L2KB 5A2QC 2OI2A 2JWOA 2FTXB 2EFGA 4X62E 2HHHE 2ZITA 3B82A 1T4OA 3DF6A 1HNWI 4UT4A 4R03A 3LPSA 1XMOE 2LUQA 1HNZE 2KOUA 4B3RI 1EKZA 2F8BA 4BC7A 2JOBA 4GKJI 4P7AA 3ZKBA 4DV4E 1RC7A 4Z7CA 2NUGA 1Z0EA 1WUUA 2CG9A 3B78A 3CWVA 4WUCA 2LRSA 4WYQB 1PVGA 4GKKI 3K6QA 4ZVIA 4LTYA 4X65E 4KZSA 4IZJB 2NA2A 5DNYA 1S16A 1Z5CA 2MC6A 2N3GA 5AE1A 4FWDA 1H74A 2V8PA 3HPZA 1USUA 4YHHI 4X66E 2KHXA 3D4JA 3WU5A 1Z0TA 3ADGA 1N33I 2MDRA 3FIGA 2VQEI 4LF9I 1J26A 1Z0BA 3PRYA 4DV0E 1PKPA 3ZZUA 1MG7A 4HY1A 2V87A 1IBLI 4JI5I 4YHHE 5LMUE 1B63A 1USVA 5LMUI 1IBKE 1DARA 4AQYE 3KWRA 5LMNI 2VF1A 5FLXQ 3C4BA 4FN5A 2YT4A 3DJWA 2Z5CA 1ZM2A 1ZBTA 5BR8I 4UTGA 2NUFA 4XTJA 2RS6A 3VYYA 4TUGA 5AE2A 4LF8E 1SR9A 2UXDE 1N0VC 2UUBI 1RQ0A 1HNXE 2UXCE 1Z0VA 2E5LE 4IZKB 4DR6I 5IT9C 3IWDA 2RSMA 2UUCE 4B3ME 4LF7E 4JI7E 5IWAE 4PRXA 4X65I 1UEKA 2H36X 2O1WA 2ZM6E 4R8OA 5GMEA 2Z5CB 4JI2I 4JG4A 2VF3A 2FGGA 4X64E 2HFUA 2E1MA 4JI0E 4F9CB 1UHZA 1FNMA 4JI2E 1QZRA 2B3TB 2BM1A 1OJ4A 4JYAE 4M30A 5IWAI 4JI7I 2LTSA 3IWBA 1XMOI 1HNZI 4P78A 3HPSA 4KQVA 2UXCI 2V83A 2WW4A 1HNXI 3HULA 2ODRD 3WU4A 2UXBE 2WZOA 2HKEA 3OMLA 4JI4E 3VK6A 2LUPB 4DPYA 3K1JA 3ZM7A 3WU3A 3H09A 1H7SA 3QT5A 2RTXA 4LF7I 2LTRA 1FI4A 1YZ9A 2V2QA 4DR1E 4F9BB 2HK2A 2R3VA 4JV5I 2LMZA 5LMNE 4AQYI 1KKHA 1VISA 1FJGE 4DR4I 2DIXA 4LF8I 4M0VA 3AUZA 1GQEA 4BBYA 3J80Q 1N36E 3F6GA 1O0WA 3OTOE 4OOGC 4PU9A 2UU9E 1PIEA 4X66I 4HYMA 3WU6A 1IBKI 4WPYA 3M6AA 3T1HI 1ZXNA 3T1HE 1XMQE 4LFAI 2F4VI 1XHKA 2UU9I 4DV0I 1MX0A 2L6MA 4FW9A 4JI3E 4LU9A 2B7TA 4LF9E 4DKKA 3IWCA 1NHHA 4JI3I 2J7KA 1I94I 1K47A 3J7AG 1STUA 3JU0A 4DV2I 2L2NA 2VQFE 4YY3E 4EMDA 1RR9A 1KVKA 4GKJE 1QU6A 5ADZA 4FWGA 4RPFA 4JI1E 4OX9I 2EWLA 1DI2A 1Z0GA 3F6HA 1ZM4A 2X7IA 2RS7A 4IZJD 1XNRE 1H7UA 2DEJA 2HFSA 1RREA 4DV4I 4ED4A 1T4LB 4L8NA 1IBLE 5T6JA 4JV5E 1B62A 1N0UA 3ADIA 4B3RE 2O1VA 2DMYA 2LE2A 1ELOA 4B3SE 4LF5E 1ZBQA 4DPWA 4I8OA 3GONA 1YYOA 1U2RA 2IOPA 4DV5I 4GEQB 1H73A 4X62I 2G7HA 2Z5BA 2UXBI 5CFFE 4DUZE 4NXME 3ZKDA 4WFTA 4Q28A 1IBMI 4DV3I 2BV3A 3F0NA 3V5RA 1EA6A 4DR3E 2PNLA 4LF6E 4B3TI 1N34E 2CPNA 1Z5AA 1J5EE 2GS8A 4M1KA 2VQFI 1HR0E 4DR7E 4JI0I 1FKAE 4X8WA 4M2ZA 2M4IA 4P7DA 2ZM6I 3HXLA 1XNRI 1Z59A 4WSPA 4PRVA 4R1FA 2L2MA 4DR6E 4OX9E 1XNQI 2YZTA 3C4TA 4DV6E 4KHPI 2UXDI 4DPUA 1XMQI 4LFCE 2LJPA 1ZM9A 4JI5E 4DV2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO I;  1WHN A;  1I94 E;  2BM0 A;  3QT8 A;  5IT9 Q;  3V2U C;  2V2V A;  2CZ9 A;  2X36 A;  4LFA E;  2F4V E;  3JAM Q;  1ZXM A;  2LBS B;  1NHJ A;  4LFC I;  4DPX A;  1WHQ A;  2L33 A;  1Z0W A;  4DV6 I;  1XNQ E;  2NUE A;  3PYG A;  1N36 I;  1Z0C A;  1Z5B A;  3JAM C;  4K0K I;  2AJ4 A;  3ZZ0 A;  1NZ0 A;  5LL6 R;  1NHI A;  1H72 C;  1X49 A;  2NPF A;  1UIL A;  4B3T E;  4JI8 I;  3PYE A;  3PYD A;  2A2C A;  2E1R A;  1FWL A;  1N32 E;  2N3H A;  3J81 C;  3P1X A;  5GMD A;  3J7A M;  4LFB E;  2HKJ A;  2HHH I;  4X64 I;  1X48 A;  4DUY E;  4JI6 E;  2R42 A;  4HAC B;  4LF6 I;  2UUA I;  4DR2 I;  3LNU A;  4DXL A;  4DR2 E;  4DU8 A;  2XEX A;  1N32 I;  4JYA I;  2E5L I;  4JI8 E;  1A6F A;  1HNW E;  2Q2E B;  1EI1 A;  4HXZ A;  4DUZ I;  4NXM I;  5A2Q Q;  4DUY I;  1X47 A;  3Q1Q A;  1FWK A;  4LFB I;  2JVA A;  4FWH A;  2V34 A;  1ZM3 A;  3QT6 A;  2JY9 A;  3LTO A;  4LF5 I;  4B3S I;  4DR5 I;  2UUC I;  4B3M I;  2LJH A;  4JI1 I;  3QT7 A;  2UUB E;  4DV1 I;  4NXN E;  4MYU A;  4YY3 I;  2B7V A;  4URL A;  4Z7Y A;  3H4L A;  4K0K E;  4HAC A;  4LF4 I;  3K17 A;  3T1Y E;  5BR8 E;  1YYW A;  1MU5 A;  2L3J A;  3HTX A;  4DU7 A;  1KIJ A;  3PYF A;  4P52 A;  2DB2 A;  5L3J A;  3J80 C;  3J7Y p;  1KTV A;  2VQE E;  1N33 E;  4DPT A;  2V2Z A;  4I3H A;  2DEI A;  1D6T A;  3LLH A;  4DR4 E;  1FJG I;  1J5E I;  3ADJ A;  4DV1 E;  3VYX A;  4WUD A;  4KHP E;  4MYT A;  3B8H A;  2L3C A;  4DR5 E;  4DV3 E;  3T1Y I;  4USK A;  4LF4 E;  3ADL A;  4GKK E;  1BKN A;  3ZZT A;  1T4N A;  4JI4 I;  1HR0 I;  4DR7 I;  4WUB A;  4DV5 E;  4USM A;  4NXN I;  1N34 I;  2ZBK B;  4DR3 I;  4DV7 I;  4DR1 I;  2EZ6 A;  2HK3 A;  4DV7 E;  2A2D A;  3J81 Q;  1YYK A;  2UUA E;  1IBM E;  2IHR 1;  5FLX C;  1S4E A;  4JI6 I;  2L2K B;  2OI2 A;  5A2Q C;  2EFG A;  4X62 E;  2HHH E;  2ZIT A;  3B82 A;  1T4O A;  1HNW I;  4UT4 A;  3LPS A;  1XMO E;  2LUQ A;  1HNZ E;  4B3R I;  1EKZ A;  4GKJ I;  4P7A A;  3ZKB A;  4DV4 E;  1RC7 A;  4Z7C A;  2NUG A;  1Z0E A;  1WUU A;  3B78 A;  3CWV A;  4WUC A;  2LRS A;  4WYQ B;  1PVG A;  4GKK I;  4ZVI A;  4X65 E;  2NA2 A;  1S16 A;  1Z5C A;  2N3G A;  4FWD A;  1H74 A;  2V8P A;  4YHH I;  4X66 E;  2KHX A;  3D4J A;  3WU5 A;  1Z0T A;  3ADG A;  1N33 I;  2MDR A;  2VQE I;  4LF9 I;  1J26 A;  1Z0B A;  4DV0 E;  1PKP A;  3ZZU A;  1MG7 A;  4HY1 A;  1IBL I;  4JI5 I;  4YHH E;  5LMU E;  1B63 A;  5LMU I;  1IBK E;  1DAR A;  4AQY E;  5LMN I;  5FLX Q;  3C4B A;  4FN5 A;  2YT4 A;  1ZM2 A;  1ZBT A;  5BR8 I;  4UTG A;  2NUF A;  4XTJ A;  2RS6 A;  3VYY A;  4LF8 E;  2UXD E;  1N0V C;  2UUB I;  1RQ0 A;  1HNX E;  2UXC E;  1Z0V A;  2E5L E;  4DR6 I;  5IT9 C;  2RSM A;  2UUC E;  4B3M E;  4LF7 E;  4JI7 E;  5IWA E;  4PRX A;  4X65 I;  1UEK A;  2ZM6 E;  4JI2 I;  5GME A;  4JG4 A;  2VF3 A;  4X64 E;  2HFU A;  4JI0 E;  1UHZ A;  1FNM A;  4JI2 E;  1QZR A;  2B3T B;  2BM1 A;  1OJ4 A;  4JYA E;  4M30 A;  5IWA I;  4JI7 I;  2LTS A;  1XMO I;  1HNZ I;  4KQV A;  2UXC I;  2WW4 A;  1HNX I;  3HUL A;  3WU4 A;  2UXB E;  2HKE A;  4JI4 E;  2LUP B;  4DPY A;  3K1J A;  3ZM7 A;  3WU3 A;  1H7S A;  3QT5 A;  2RTX A;  4LF7 I;  2LTR A;  1FI4 A;  1YZ9 A;  2V2Q A;  4DR1 E;  2HK2 A;  2R3V A;  4JV5 I;  5LMN E;  4AQY I;  1KKH A;  1VIS A;  1FJG E;  4DR4 I;  2DIX A;  4LF8 I;  1GQE A;  3J80 Q;  1N36 E;  1O0W A;  3OTO E;  4OOG C;  4PU9 A;  2UU9 E;  1PIE A;  4X66 I;  4HYM A;  3WU6 A;  1IBK I;  3M6A A;  3T1H I;  1ZXN A;  3T1H E;  1XMQ E;  4LFA I;  2F4V I;  1XHK A;  2UU9 I;  4DV0 I;  1MX0 A;  4FW9 A;  4JI3 E;  2B7T A;  4LF9 E;  4DKK A;  1NHH A;  4JI3 I;  2J7K A;  1I94 I;  1K47 A;  3J7A G;  1STU A;  4DV2 I;  2VQF E;  2L2N A;  4YY3 E;  4EMD A;  1RR9 A;  1KVK A;  4GKJ E;  1QU6 A;  4FWG A;  4RPF A;  4JI1 E;  4OX9 I;  1DI2 A;  1Z0G A;  1ZM4 A;  2X7I A;  2RS7 A;  1XNR E;  1H7U A;  2DEJ A;  2HFS A;  1RRE A;  4DV4 I;  4ED4 A;  1T4L B;  1IBL E;  4JV5 E;  1B62 A;  1N0U A;  3ADI A;  4B3R E;  2DMY A;  1ELO A;  4B3S E;  4LF5 E;  4DPW A;  3GON A;  1YYO A;  1U2R A;  4DV5 I;  1H73 A;  4X62 I;  2UXB I;  5CFF E;  4DUZ E;  4NXM E;  3ZKD A;  4WFT A;  1IBM I;  4DV3 I;  2BV3 A;  3F0N A;  3V5R A;  1EA6 A;  4DR3 E;  4LF6 E;  4B3T I;  1N34 E;  2CPN A;  1Z5A A;  1J5E E;  2GS8 A;  4M1K A;  2VQF I;  1HR0 E;  4DR7 E;  4JI0 I;  1FKA E;  4X8W A;  4M2Z A;  2ZM6 I;  1XNR I;  1Z59 A;  4PRV A;  4R1F A;  2L2M A;  4DR6 E;  4OX9 E;  1XNQ I;  3C4T A;  4DV6 E;  4KHP I;  2UXD I;  4DPU A;  1XMQ I;  4LFC E;  2LJP A;  1ZM9 A;  4JI5 E;  4DV2 E; 
#chains in the Genus database with same CATH topology
 2Z5B B;  4BS9 A;  4F9A B;  3OTO I;  2YU8 A;  3QG5 C;  1WHN A;  1I94 E;  1R6M A;  2BM0 A;  3QT8 A;  5IT9 Q;  4BHB A;  3V2U C;  2V2V A;  2CZ9 A;  2X36 A;  2M9A A;  4LFA E;  2F4V E;  3JAM Q;  1ZXM A;  4U3B A;  2NN6 D;  3MSW A;  1Y4U A;  3H1C A;  2MKD A;  2LBS B;  5AAS A;  1NHJ A;  1UDQ A;  4LFC I;  4DPX A;  1WHQ A;  5JEA F;  2L33 A;  3LML A;  1YUJ A;  1Z0W A;  2JR1 A;  2NN6 A;  2ELZ A;  4DV6 I;  1XNQ E;  2V89 A;  2NUE A;  3JTZ A;  3PYG A;  1N36 I;  5F3W A;  1P47 A;  3Q6M A;  1Z0C A;  2EL5 A;  2YTO A;  1Z5B A;  3JAM C;  2EE8 A;  2EMZ A;  2EJ4 A;  3MHS C;  4K0K I;  1GZ6 A;  2AJ4 A;  3ZZ0 A;  4L5N C;  5LL6 R;  1NZ0 A;  3RMP A;  4IS1 C;  4FW4 A;  4MU1 A;  1NHI A;  1H72 C;  1WXR A;  1X49 A;  5JEA D;  2F4V I;  4DMI A;  2EM4 A;  4NZV A;  4FW5 A;  2NPF A;  1UIL A;  4B3T E;  4JI8 I;  3PYD A;  3PYE A;  2A2C A;  2E1R A;  2WP8 B;  1FWL A;  5A6J A;  1N32 E;  2YTD A;  5DNX A;  2N3H A;  1KYQ A;  4F54 A;  3J81 C;  2BB8 A;  4OO1 C;  5A6B D;  5FWK A;  3P1X A;  5GMD A;  1L4S A;  3J7A M;  3KRN A;  2C37 B;  4LFB E;  1TN9 A;  2HKJ A;  1PDA A;  2HHH I;  4BCA A;  3EPJ A;  4X64 I;  1X48 A;  4R2E A;  5JEA C;  4DUY E;  2PNZ B;  4JI6 E;  2R42 A;  3M85 D;  4HAC B;  2DLK A;  4LF6 I;  3VHT B;  2UUA I;  3P06 A;  4BC9 A;  4IFD D;  4MU4 A;  4DR2 I;  2PNM A;  2L8T A;  3LNU A;  4R2A A;  4DXL A;  2BR2 A;  2EQ0 A;  2EN6 A;  4ZYG A;  4DR2 E;  2WP8 A;  2XEX A;  4IZK A;  4DU8 A;  4JYA I;  1N32 I;  2E5L I;  4OO1 B;  4JI8 E;  1A6F A;  1HNW E;  2GO4 A;  1PJT A;  1EI1 A;  2Q2E B;  2YTF A;  4HXZ A;  4DUZ I;  3B4T A;  4NXM I;  2EMC A;  4F6N A;  5A2Q Q;  4DUY I;  1X47 A;  5DNL A;  3Q1Q A;  4OO1 F;  4TUI A;  2YU5 A;  1Y5Y A;  1FWK A;  2FV4 B;  1A1G A;  4LFB I;  2JVA A;  4FWH A;  2V34 A;  2GO3 A;  4IZJ A;  2JOX A;  2YTP A;  1ZM3 A;  3QT6 A;  4IFD B;  2JY9 A;  2K4V A;  3LTO A;  3THO B;  3K85 A;  4LF5 I;  4B3S I;  3THN A;  4DR5 I;  2UUC I;  4B3M I;  2LJH A;  1E3P A;  4JI1 I;  5DRQ A;  2MDG A;  3QT7 A;  2YTE A;  1UBD C;  2UUB E;  4N3O A;  4MLQ A;  4DV1 I;  4BA2 B;  3EPL A;  4NXN E;  2JEA A;  4MYU A;  4YY3 I;  2HC5 A;  5C0X F;  2B7V A;  4URL A;  5IXM B;  4BMJ A;  4IFD C;  4Z7Y A;  3H4L A;  4K0K E;  3HQ1 A;  2EL6 A;  1BBG A;  2ELY A;  4HAC A;  4LF4 I;  3K17 A;  4HTG A;  3T1Y E;  1A1F A;  5BR8 E;  2EM5 A;  1YYW A;  1DQ3 A;  3MHH C;  2Z5E A;  2O1U A;  1MU5 A;  3HJC A;  4KWY A;  2PO2 A;  2BA0 D;  5KL2 A;  2L3J A;  3U1Y A;  2MC5 A;  3HTX A;  4DU7 A;  1KIJ A;  4O5G A;  3PYF A;  4P52 A;  2JP9 A;  2DB2 A;  1X3C A;  2PO1 B;  1MGT A;  3J80 C;  2EPM X;  5L3J A;  2M1S A;  3KZZ A;  3J7Y p;  1KTV A;  5C0X E;  2R76 A;  2V86 A;  2VQE E;  1N33 E;  2L92 A;  2VE7 C;  4DPT A;  4QNK A;  2EOI A;  5AE3 A;  2V2Z A;  4I3H A;  2DEI A;  1D6T A;  2JYA A;  2LO3 A;  2O3Z A;  2IOQ A;  3LLH A;  2BA1 D;  4DR4 E;  1FJG I;  4RHB B;  3GLL A;  2EQ3 A;  3ADJ A;  3AV0 A;  4DV1 E;  2EPU A;  1Y4S A;  3VYX A;  2EPO A;  4F2J C;  3HKM A;  4WUD A;  4KHP E;  4BA1 B;  4MYT A;  5DRP A;  3B8H A;  2CTD A;  1YFH A;  3NZK A;  2KON A;  2L3C A;  3CDJ A;  2GQ0 A;  4DR5 E;  4DV3 E;  3T1Y I;  2EL4 A;  4OO1 E;  4USK A;  2BA1 G;  2V88 A;  4LF4 E;  2O1T A;  3ADL A;  5JEA A;  2NN6 F;  1MEY C;  4GKK E;  1BKN A;  2BBG A;  2C39 B;  5A6K A;  2EPL X;  4J8Z A;  1ZAA C;  1BB8 A;  1Y6Z A;  4LCF A;  3ZZT A;  4AM3 A;  2V8Q B;  1T4N A;  2EPC A;  1YH8 A;  1HR0 I;  2EPR A;  4JI4 I;  1HK7 A;  4DR7 I;  2ADR A;  4WUB A;  4DV5 E;  3Q6N A;  4NXN I;  4USM A;  2EMX A;  4IFD E;  2DSY A;  1UN6 B;  4OZE A;  1N34 I;  2ZBK B;  3CDI A;  2M7Q A;  2ODR C;  4DR3 I;  2EMF A;  4DV7 I;  4OO1 A;  2EOZ A;  3ZOQ B;  4DR1 I;  1NCS A;  2EZ6 A;  2HK3 A;  2CGE A;  2EMG A;  2V85 A;  2LV2 A;  4DV7 E;  2A2D A;  1YYK A;  3J81 Q;  2UUA E;  1IBM E;  2K7I A;  2IHR 1;  1A1I A;  5EKW A;  2B9D A;  1Y60 A;  5FLX C;  4R2Q A;  1S4E A;  1T39 A;  4JI6 I;  2L2K B;  5A2Q C;  1AAY A;  2OI2 A;  5K36 F;  2JWO A;  2YRM A;  2FTX B;  2BR2 B;  2PO2 B;  3M85 G;  2C38 A;  4X62 E;  4R2P A;  2HHH E;  2EFG A;  2ZIT A;  1JK1 A;  2PO0 A;  5IV8 B;  1G2F C;  3B82 A;  1T4O A;  2YSP A;  3DF6 A;  5TSE A;  4UT4 A;  1HNW I;  2LT7 A;  4R03 A;  3LPS A;  4QNJ A;  1XMO E;  2LUQ A;  1HNZ E;  4R2R A;  2KOU A;  4X9J A;  1J5E I;  2F1D A;  4B3R I;  1EKZ A;  2F8B A;  4J3D A;  4BC7 A;  2EMY A;  2JOB A;  2NAB A;  1E3H A;  4FW3 A;  4GKJ I;  3KZY A;  4P7A A;  3ZKB A;  2EPK X;  4DV4 E;  2WCC 3;  2PRT A;  1EH6 A;  1RC7 A;  4Z7C A;  2YPN A;  2NUG A;  2EN4 A;  1Z0E A;  3L00 A;  5AC4 A;  1YSA C;  4O24 A;  1WUU A;  2CG9 A;  2D9H A;  2LRS A;  4WYQ B;  3B78 A;  3CWV A;  1PVG A;  4WUC A;  4GKK I;  3K6Q A;  4ZVI A;  4LTY A;  4O4K A;  4X65 E;  4R2C A;  2IER A;  5KL7 A;  2EMW A;  4KZS A;  4IZJ B;  2NA2 A;  5DNY A;  1IQO A;  1S16 A;  2J65 A;  1Z5C A;  2MC6 A;  2EM9 A;  2LJU A;  2N3G A;  5AE1 A;  2C39 A;  4FWD A;  1H74 A;  1ZU1 A;  3P3G A;  2V8P A;  3HPZ A;  1USU A;  2HGH A;  1TF3 A;  4YHH I;  3M7N D;  4X66 E;  2KHX A;  3D4J A;  3WU5 A;  4WX9 A;  2ENH A;  3PS3 A;  2EN3 A;  1Z0T A;  3ADG A;  2EM8 A;  1DGC A;  3EPH A;  1N33 I;  2MDR A;  3FIG A;  2CVE A;  2VQE I;  4LF9 I;  1J26 A;  5C0X A;  1Z0B A;  3U1K A;  4IFD F;  2EM7 A;  3PRY A;  4IS9 A;  4DV0 E;  4IJD A;  1PKP A;  3ZZU A;  2PO1 A;  1MG7 A;  4HY1 A;  2V87 A;  1IBL I;  4JI5 I;  4YHH E;  5LMU E;  2YTG A;  2EOY A;  1B63 A;  1USV A;  2PNZ A;  1IBK E;  5LMU I;  2WNR B;  1DAR A;  4AQY E;  3KWR A;  1IMU A;  2VF1 A;  2PO0 B;  5FLX Q;  5LMN I;  1PJS A;  3EPK A;  3C4B A;  4GZN C;  2NN6 C;  3M99 B;  4MQY A;  4FN5 A;  2EML A;  2YT4 A;  2ENC A;  3DJW A;  2Z5C A;  2DGC A;  1ZBT A;  1ZM2 A;  5BR8 I;  5K36 E;  4UTG A;  2EMA A;  4BA1 A;  4N4R B;  5KL5 A;  2NUF A;  1T38 A;  1RHY A;  3DD6 A;  4WXD A;  2HJJ A;  4XTJ A;  2RS6 A;  3VYY A;  4TUG A;  5AE2 A;  4LF8 E;  5K36 C;  4WSG A;  1SR9 A;  4BA2 A;  2CSH A;  4OO1 D;  2E72 A;  2UXD E;  1N0V C;  2UUB I;  1RQ0 A;  1HNX E;  2WBU A;  2UXC E;  5K36 A;  1Z0V A;  2CT1 A;  2E5L E;  1EH7 A;  2ENA A;  4IZK B;  4DR6 I;  5IT9 C;  3IWD A;  2RSM A;  1F2I G;  2UUC E;  4B3M E;  4ISA A;  4LF7 E;  4JI7 E;  5IWA E;  1A1J A;  4PRX A;  4X65 I;  2IES A;  1UEK A;  2H36 X;  1RMD A;  2O1W A;  2ZM6 E;  4R8O A;  1YHC A;  2Z5C B;  1VI7 A;  4JG4 A;  5GME A;  4JI2 I;  2VF3 A;  2EM0 A;  2EOJ A;  2YWQ A;  2FGG A;  4X64 E;  2HFU A;  2E1M A;  3EQ1 A;  4JI0 E;  1IQS A;  4F9C B;  2EM6 A;  2I9I A;  1UHZ A;  1EH8 A;  2BA0 G;  1FNM A;  4JI2 E;  1QZR A;  2B3T B;  2GHF A;  2BM1 A;  1P42 A;  1OJ4 A;  2RSI A;  4JYA E;  4M30 A;  3P3E A;  5IWA I;  4JI7 I;  2LTS A;  2EPN A;  2EOH A;  2WBT A;  3IWB A;  1XMO I;  4F6M A;  1XXE A;  4P78 A;  1HNZ I;  5C0X B;  3HPS A;  2JE6 A;  4KQV A;  2EM3 A;  4U3D A;  2V83 A;  2UXC I;  2WW4 A;  1LLM C;  1HNX I;  5JEA B;  3HUL A;  2NN6 E;  2ODR D;  3WU4 A;  2UXB E;  2WZO A;  2EMB A;  1A1L A;  2WBS A;  2HKE A;  3OML A;  4JI4 E;  2EPX A;  2R1F A;  2EOX A;  3VK6 A;  1X5W A;  2LUP B;  4DPY A;  2N8X A;  3K1J A;  3P3C A;  3ZM7 A;  5DRR A;  4LCG A;  5K36 B;  3WU3 A;  2EOR A;  3H09 A;  1H7S A;  3QT5 A;  4FK5 C;  2RTX A;  2MKN A;  1R6L A;  4LF7 I;  2LTR A;  1FI4 A;  1YZ9 A;  2V2Q A;  4DR1 E;  4F9B B;  4GQU A;  3BID A;  2HK2 A;  2R3V A;  2EP3 A;  4JV5 I;  2LMZ A;  4MU3 A;  2JXP A;  5LMN E;  4AQY I;  1KKH A;  1WJP A;  1VIS A;  3M7N G;  1X6H A;  5A69 A;  1FJG E;  4DR4 I;  5DRO A;  2DIX A;  3PS2 A;  4LF8 I;  2C38 B;  2YTQ A;  5AC5 A;  4ZYE A;  4M0V A;  3AUZ A;  5A6A A;  1GQE A;  3C6K A;  2JEA B;  2EPP A;  4BBY A;  3J80 Q;  4FW6 A;  4NBQ A;  1N36 E;  3F6G A;  2VES A;  1O0W A;  3OTO E;  4OOG C;  1QNT A;  2C37 A;  2UU9 E;  1PIE A;  2JE6 B;  1WRJ A;  4PU9 A;  4X66 I;  4HYM A;  3WU6 A;  2EMK A;  2EMI A;  2LCE A;  4AIM A;  4WPY A;  3M6A A;  3T1H I;  5C0X C;  1IBK I;  1OYR A;  1ZXN A;  3T1H E;  2RQL A;  3UK3 C;  1XMQ E;  3GME A;  4LFA I;  1XHK A;  4O43 A;  5LLQ A;  1G2D C;  2AE8 A;  1MX0 A;  4DV0 I;  2UU9 I;  2L6M A;  3P76 A;  4FW9 A;  4LCH A;  2YTN A;  2J7J A;  4JI3 E;  4LU9 A;  2B7T A;  4LF9 E;  4DKK A;  3IWC A;  1X6F A;  1NHH A;  4JI3 I;  2J7K A;  1I94 I;  2A25 A;  1K47 A;  2JPA A;  3J7A G;  1STU A;  2EN1 A;  3JU0 A;  2EOE A;  4MU0 A;  2GPI A;  4DV2 I;  1SFE A;  2L2N A;  2VQF E;  4FW7 A;  5K36 D;  4YY3 E;  4EMD A;  5KL4 A;  1RR9 A;  4IFD A;  1KVK A;  1N3G A;  4GKJ E;  1NEI A;  1QU6 A;  1ZR9 A;  5ADZ A;  1JK2 A;  1B69 A;  4FWG A;  4RPF A;  4JI1 E;  4OX9 I;  2EWL A;  1DI2 A;  1Z0G A;  3F6H A;  1ZM4 A;  2EN8 A;  2X7I A;  1X6E A;  1UDO A;  2RS7 A;  4IZJ D;  1TF6 A;  1XNR E;  5JEA E;  3PS1 A;  2EOF A;  4RH8 A;  1H7U A;  2DEJ A;  2EMH A;  2YTJ A;  2HFS A;  3C6M A;  4ZYH A;  1RRE A;  3BGH A;  5A6B A;  4R2D A;  1YUI A;  2LVH A;  2I13 A;  2RPC A;  4DV4 I;  2DRP A;  4AID A;  4ED4 A;  2VRD A;  1T4L B;  4L8N A;  1A1K A;  4WXC A;  5T6J A;  2EOS A;  4JV5 E;  1KJK A;  1B62 A;  1N0U A;  3ADI A;  4B3R E;  2O1V A;  2DMY A;  2LE2 A;  2YTI A;  1UDS A;  1ELO A;  4B3S E;  4LF5 E;  1ZBQ A;  2EOM A;  3BF2 A;  4DPW A;  4I8O A;  2EPA A;  3GON A;  3L7Z A;  2JEB A;  1YYO A;  1UDN A;  2EM2 A;  1U2R A;  2IOP A;  4DV5 I;  4GEQ B;  1H73 A;  4MLV A;  1OYS A;  4X62 I;  2EN2 A;  2G7H A;  4LOM A;  2Z5B A;  5C0X D;  3L7Z B;  2YRK A;  2JT2 A;  5CFF E;  4DUZ E;  4NXM E;  2UXB I;  2WNR A;  5EL9 A;  3ZKD A;  4WFT A;  2Q8U A;  4Q28 A;  1IBM I;  2DMI A;  4DV3 I;  2BV3 A;  3F0N A;  5KL6 A;  3V5R A;  1EA6 A;  2EOQ A;  4DR3 E;  2PNL A;  4LF6 E;  1PJQ A;  2EQ1 A;  5ELW A;  4B3T I;  1N34 E;  3BBG A;  2CPN A;  4R2S A;  4OKG A;  2EPZ A;  1Z5A A;  1J5E E;  3TQM A;  4ZYD A;  2GS8 A;  4M1K A;  2DLQ A;  1OYP A;  2VQF I;  1HR0 E;  4DR7 E;  4JI0 I;  4MDT A;  3GCM A;  1AH5 A;  1BBO A;  2EN7 A;  2YSO A;  1A1H A;  4JI5 E;  1FKA E;  4X8W A;  2GLI A;  2M4I A;  4P7D A;  4M2Z A;  2ZM6 I;  3HXL A;  2EOO A;  1XNR I;  2YRH A;  1Z59 A;  1GTK A;  4WSP A;  4PRV A;  4R1F A;  4BHC A;  4NHR A;  2L2M A;  4DR6 E;  4OX9 E;  4HEI A;  1XNQ I;  1YPN A;  2YZT A;  4LPF A;  3C4T A;  4DV6 E;  2JEB B;  4KHP I;  4Q35 B;  1Z1B A;  5KL3 A;  4DPU A;  2UXD I;  1XMQ I;  4LFC E;  2NN6 B;  3UHM A;  3ECR A;  4M9V C;  2LJP A;  1ZM9 A;  1IBL E;  4DV2 E; 
#chains in the Genus database with same CATH homology
 2Z5B B;  4BS9 A;  4F9A B;  3OTO I;  1WHN A;  1I94 E;  2BM0 A;  3QT8 A;  5IT9 Q;  3V2U C;  2V2V A;  2CZ9 A;  2X36 A;  4LFA E;  2F4V E;  3JAM Q;  1ZXM A;  3MSW A;  1Y4U A;  2LBS B;  5AAS A;  1NHJ A;  4LFC I;  4DPX A;  1WHQ A;  2L33 A;  3LML A;  1Z0W A;  2JR1 A;  4DV6 I;  1XNQ E;  2V89 A;  2NUE A;  3JTZ A;  3PYG A;  1N36 I;  5F3W A;  3Q6M A;  1Z0C A;  1Z5B A;  3JAM C;  4K0K I;  1GZ6 A;  2AJ4 A;  3ZZ0 A;  4L5N C;  5LL6 R;  1NZ0 A;  3RMP A;  1NHI A;  1H72 C;  1WXR A;  1X49 A;  4DMI A;  2NPF A;  1UIL A;  4B3T E;  4JI8 I;  3PYD A;  3PYE A;  2A2C A;  2E1R A;  1FWL A;  1N32 E;  2N3H A;  4F54 A;  3J81 C;  5FWK A;  3P1X A;  5GMD A;  3J7A M;  4LFB E;  2HKJ A;  2HHH I;  4BCA A;  4X64 I;  1X48 A;  4DUY E;  4JI6 E;  2R42 A;  4HAC B;  4LF6 I;  2UUA I;  3P06 A;  4BC9 A;  4DR2 I;  2PNM A;  2L8T A;  3LNU A;  4DXL A;  4DR2 E;  4IZK A;  4DU8 A;  2XEX A;  1N32 I;  4JYA I;  2E5L I;  4JI8 E;  1A6F A;  1HNW E;  2Q2E B;  1EI1 A;  4HXZ A;  4DUZ I;  4NXM I;  5A2Q Q;  4DUY I;  1X47 A;  3Q1Q A;  4TUI A;  1FWK A;  2FV4 B;  4LFB I;  2JVA A;  4FWH A;  2V34 A;  4IZJ A;  2JOX A;  1ZM3 A;  3QT6 A;  2JY9 A;  2K4V A;  3LTO A;  4LF5 I;  3K85 A;  4B3S I;  4DR5 I;  2UUC I;  4B3M I;  2LJH A;  4JI1 I;  3QT7 A;  2UUB E;  4N3O A;  4DV1 I;  4NXN E;  4MYU A;  4YY3 I;  2B7V A;  4URL A;  4BMJ A;  4Z7Y A;  3H4L A;  4K0K E;  3HQ1 A;  4HAC A;  4LF4 I;  3K17 A;  3T1Y E;  5BR8 E;  1YYW A;  1DQ3 A;  2Z5E A;  2O1U A;  1MU5 A;  3HJC A;  2L3J A;  2MC5 A;  3HTX A;  4DU7 A;  1KIJ A;  3PYF A;  4P52 A;  2DB2 A;  3J80 C;  5L3J A;  2M1S A;  3J7Y p;  1KTV A;  2V86 A;  2VQE E;  1N33 E;  2L92 A;  2VE7 C;  4DPT A;  5AE3 A;  2V2Z A;  4I3H A;  2DEI A;  1D6T A;  2IOQ A;  3LLH A;  4DR4 E;  1FJG I;  1J5E I;  3ADJ A;  3AV0 A;  4DV1 E;  1Y4S A;  3VYX A;  4WUD A;  4KHP E;  4MYT A;  3B8H A;  2KON A;  2L3C A;  2GQ0 A;  4DR5 E;  4DV3 E;  3T1Y I;  4USK A;  2V88 A;  4LF4 E;  2O1T A;  3ADL A;  4GKK E;  1BKN A;  4J8Z A;  1Y6Z A;  3ZZT A;  2V8Q B;  1T4N A;  4JI4 I;  1HR0 I;  4DR7 I;  1HK7 A;  4WUB A;  4DV5 E;  3Q6N A;  4NXN I;  4USM A;  2DSY A;  1N34 I;  2ZBK B;  2M7Q A;  2ODR C;  4DR3 I;  4DV7 I;  3ZOQ B;  4DR1 I;  2EZ6 A;  2HK3 A;  2CGE A;  2V85 A;  4DV7 E;  2A2D A;  3J81 Q;  1YYK A;  2UUA E;  1IBM E;  2IHR 1;  2B9D A;  5FLX C;  1S4E A;  4JI6 I;  2L2K B;  5A2Q C;  2OI2 A;  2JWO A;  2FTX B;  2EFG A;  4X62 E;  2HHH E;  2ZIT A;  3B82 A;  1T4O A;  3DF6 A;  1HNW I;  4UT4 A;  4R03 A;  3LPS A;  1XMO E;  2LUQ A;  1HNZ E;  2KOU A;  4B3R I;  1EKZ A;  2F8B A;  4BC7 A;  2JOB A;  4GKJ I;  4P7A A;  3ZKB A;  4DV4 E;  1RC7 A;  4Z7C A;  2NUG A;  1Z0E A;  1WUU A;  2CG9 A;  3B78 A;  3CWV A;  4WUC A;  2LRS A;  4WYQ B;  1PVG A;  4GKK I;  3K6Q A;  4ZVI A;  4LTY A;  4X65 E;  4KZS A;  4IZJ B;  2NA2 A;  5DNY A;  1S16 A;  1Z5C A;  2MC6 A;  2N3G A;  5AE1 A;  4FWD A;  1H74 A;  2V8P A;  3HPZ A;  1USU A;  4YHH I;  4X66 E;  2KHX A;  3D4J A;  3WU5 A;  1Z0T A;  3ADG A;  1N33 I;  2MDR A;  3FIG A;  2VQE I;  4LF9 I;  1J26 A;  1Z0B A;  3PRY A;  4DV0 E;  1PKP A;  3ZZU A;  1MG7 A;  4HY1 A;  2V87 A;  1IBL I;  4JI5 I;  4YHH E;  5LMU E;  1B63 A;  1USV A;  5LMU I;  1IBK E;  1DAR A;  4AQY E;  3KWR A;  5LMN I;  2VF1 A;  5FLX Q;  3C4B A;  4FN5 A;  2YT4 A;  3DJW A;  2Z5C A;  1ZM2 A;  1ZBT A;  5BR8 I;  4UTG A;  2NUF A;  4XTJ A;  2RS6 A;  3VYY A;  4TUG A;  5AE2 A;  4LF8 E;  1SR9 A;  2UXD E;  1N0V C;  2UUB I;  1RQ0 A;  1HNX E;  2UXC E;  1Z0V A;  2E5L E;  4IZK B;  4DR6 I;  5IT9 C;  3IWD A;  2RSM A;  2UUC E;  4B3M E;  4LF7 E;  4JI7 E;  5IWA E;  4PRX A;  4X65 I;  1UEK A;  2H36 X;  2O1W A;  2ZM6 E;  4R8O A;  5GME A;  2Z5C B;  4JI2 I;  4JG4 A;  2VF3 A;  2FGG A;  4X64 E;  2HFU A;  2E1M A;  4JI0 E;  4F9C B;  1UHZ A;  1FNM A;  4JI2 E;  1QZR A;  2B3T B;  2BM1 A;  1OJ4 A;  4JYA E;  4M30 A;  5IWA I;  4JI7 I;  2LTS A;  3IWB A;  1XMO I;  1HNZ I;  4P78 A;  3HPS A;  4KQV A;  2UXC I;  2V83 A;  2WW4 A;  1HNX I;  3HUL A;  2ODR D;  3WU4 A;  2UXB E;  2WZO A;  2HKE A;  3OML A;  4JI4 E;  3VK6 A;  2LUP B;  4DPY A;  3K1J A;  3ZM7 A;  3WU3 A;  3H09 A;  1H7S A;  3QT5 A;  2RTX A;  4LF7 I;  2LTR A;  1FI4 A;  1YZ9 A;  2V2Q A;  4DR1 E;  4F9B B;  2HK2 A;  2R3V A;  4JV5 I;  2LMZ A;  5LMN E;  4AQY I;  1KKH A;  1VIS A;  1FJG E;  4DR4 I;  2DIX A;  4LF8 I;  4M0V A;  3AUZ A;  1GQE A;  4BBY A;  3J80 Q;  1N36 E;  3F6G A;  1O0W A;  3OTO E;  4OOG C;  4PU9 A;  2UU9 E;  1PIE A;  4X66 I;  4HYM A;  3WU6 A;  1IBK I;  4WPY A;  3M6A A;  3T1H I;  1ZXN A;  3T1H E;  1XMQ E;  4LFA I;  2F4V I;  1XHK A;  2UU9 I;  4DV0 I;  1MX0 A;  2L6M A;  4FW9 A;  4JI3 E;  4LU9 A;  2B7T A;  4LF9 E;  4DKK A;  3IWC A;  1NHH A;  4JI3 I;  2J7K A;  1I94 I;  1K47 A;  3J7A G;  1STU A;  3JU0 A;  4DV2 I;  2L2N A;  2VQF E;  4YY3 E;  4EMD A;  1RR9 A;  1KVK A;  4GKJ E;  1QU6 A;  5ADZ A;  4FWG A;  4RPF A;  4JI1 E;  4OX9 I;  2EWL A;  1DI2 A;  1Z0G A;  3F6H A;  1ZM4 A;  2X7I A;  2RS7 A;  4IZJ D;  1XNR E;  1H7U A;  2DEJ A;  2HFS A;  1RRE A;  4DV4 I;  4ED4 A;  1T4L B;  4L8N A;  1IBL E;  5T6J A;  4JV5 E;  1B62 A;  1N0U A;  3ADI A;  4B3R E;  2O1V A;  2DMY A;  2LE2 A;  1ELO A;  4B3S E;  4LF5 E;  1ZBQ A;  4DPW A;  4I8O A;  3GON A;  1YYO A;  1U2R A;  2IOP A;  4DV5 I;  4GEQ B;  1H73 A;  4X62 I;  2G7H A;  2Z5B A;  2UXB I;  5CFF E;  4DUZ E;  4NXM E;  3ZKD A;  4WFT A;  4Q28 A;  1IBM I;  4DV3 I;  2BV3 A;  3F0N A;  3V5R A;  1EA6 A;  4DR3 E;  2PNL A;  4LF6 E;  4B3T I;  1N34 E;  2CPN A;  1Z5A A;  1J5E E;  2GS8 A;  4M1K A;  2VQF I;  1HR0 E;  4DR7 E;  4JI0 I;  1FKA E;  4X8W A;  4M2Z A;  2M4I A;  4P7D A;  2ZM6 I;  3HXL A;  1XNR I;  1Z59 A;  4WSP A;  4PRV A;  4R1F A;  2L2M A;  4DR6 E;  4OX9 E;  1XNQ I;  2YZT A;  3C4T A;  4DV6 E;  4KHP I;  2UXD I;  4DPU A;  1XMQ I;  4LFC E;  2LJP A;  1ZM9 A;  4JI5 E;  4DV2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...