4DV3E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv3E02
4LF6I 4DV6E 1XMOE 2A2DA 3HTXA 4Z7YA 3ZKDA 2WW4A 4LFBI 4B3SI 4JI6I 4X62E 4M2ZA 2E5LE 3LLHA 2RTXA 2L2NA 2UUCE 4KQVA 2LJPA 4DV4E 2B3TB 4WYQB 4LFCE 2VF3A 4DR4I 4JI4E 3LPSA 2UXCI 3PYFA 1IBME 1HNXI 2RS6A 2HHHI 2ZBKB 3WU5A 2DB2A 4JYAI 2RSMA 2AJ4A 1QU6A 2XEXA 2LJHA 1WUUA 3K1JA 2R42A 3JAMQ 4X65I 4YY3I 3QT8A 4DR4E 4HY1A 2LUQA 4LFAI 4ED4A 3VYYA 4JI3I 2GS8A 2EZ6A 4DV5I 1XNQI 4LF4I 1FI4A 1H72C 4DR7I 1N34E 1IBKI 4DR3I 1FNMA 4JI7I 3CWVA 4DR2I 1A6FA 4DV3I 4X65E 4B3RE 3WU6A 4I3HA 1K47A 4YHHI 3C4BA 3J81Q 5IT9Q 5IWAI 1NHIA 2UXDI 2N3GA 1EA6A 1Z0TA 3J7AM 4DV5E 1XNQE 3C4TA 1PIEA 1YYOA 4LF7E 1VISA 4UTGA 2VQFI 2L3JA 4JI5E 1RQ0A 1IBKE 4DR7E 2BV3A 3V2UC 4DR3E 5FLXQ 3ZZUA 1XMOI 2J7KA 4JI1I 1XMQI 4DKKA 1HR0I 1ELOA 2EFGA 1ZXMA 1Z5AA 3QT6A 1MX0A 4R1FA 4HXZA 4HACB 2E5LI 3VYXA 4DR5I 1UILA 4WUDA 4M30A 2Q2EB 3JAMC 4YHHE 2HFSA 1HNWI 1T4NA 2V2ZA 3V5RA 4X8WA 5IWAE 4LFCI 2VQEI 4JI4I 1IBMI 2L2MA 1UHZA 4LF8I 2LTRA 2VQFE 4KHPI 1Z0EA 3Q1QA 4JI1E 4DUZI 5L3JA 1XMQE 1ZXNA 4NXMI 1HR0E 2HKJA 3J7Yp 1H73A 2NUGA 4DR5E 1KTVA 4PRVA 4DR6E 2UUAI 2V2QA 1B62A 3ADGA 2LBSB 1HNWE 1J26A 3J81C 2L3CA 3M6AA 2LRSA 5IT9C 2VQEE 1Z0VA 2KHXA 1NHHA 1Z5CA 1MU5A 1STUA 4LF8E 3QT5A 3WU3A 4KHPE 4DV0E 2UUBI 1N36I 5FLXC 1N34I 4DUZE 1Z0GA 3GONA 4NXME 3ADLA 2MDRA 5LMNI 2HFUA 4PRXA 1J5EI 3T1HI 1IBLI 1NHJA 2L2KB 2V34A 2UUAE 4EMDA 3D4JA 4JI0E 2HK2A 4GKKE 4B3RI 1X49A 4X64E 5LL6R 1ZM4A 4USMA 4OX9I 2V2VA 1X48A 3QT7A 1RC7A 4HYMA 4LF7I 2UUBE 4WFTA 1N36E 1YZ9A 4JI5I 1O0WA 2DEIA 4DR1E 5CFFE 4DU7A 5LMNE 1PVGA 4GKJI 1N32I 1J5EE 3T1HE 1IBLE 1WHQA 3ZZTA 2DIXA 4DV2I 2NUFA 4WUBA 3T1YE 2NA2A 3PYDA 1T4OA 4WUCA 4OX9E 4FN5A 1FKAE 2HKEA 4DUYI 4HACA 4NXNE 4JI2I 4DXLA 1XNRI 1N32E 4GKJE 1EKZA 2V8PA 2YT4A 4ZVIA 3J7AG 4DR6I 4FWGA 1N0UA 4DV2E 2A2CA 4B3TI 2CZ9A 1Z0WA 3ZZ0A 3LNUA 4FW9A 4B3MI 1H7SA 4AQYI 1X47A 3H4LA 1N33E 4UT4A 4P7AA 4DV7I 4LF9I 4DUYE 4DV0I 1RR9A 3ADIA 1DI2A 4JI2E 4Z7CA 2F4VI 4DV1I 1XNRE 1RREA 1ZM9A 4LF5E 4DPYA 1KKHA 4DPXA 3PYGA 1NZ0A 1YYWA 4JI0I 3J80Q 4B3TE 4GKKI 1ZM3A 4DPTA 4X64I 4JI8E 1WHNA 5GMEA 2B7VA 4B3ME 3F0NA 2ZITA 4AQYE 2L33A 2DMYA 1FJGI 1KIJA 2BM0A 3LTOA 4DV7E 4LF9E 2N3HA 4K0KE 1H7UA 5LMUE 1T4LB 2ZM6I 1QZRA 2NUEA 4USKA 1ZM2A 4DR1I 2F4VE 3ADJA 1U2RA 4DV1E 1I94E 1Z0CA 3OTOI 3ZM7A 3B8HA 4XTJA 1S16A 4X66I 2LTSA 4FWHA 1UEKA 2CPNA 4LF6E 1Z59A 3T1YI 2R3VA 3HULA 1FJGE 4P52A 4LFBE 2OI2A 4B3SE 4JI6E 1EI1A 2ZM6E 1DARA 1ZBTA 4NXNI 2LUPB 2JY9A 2X7IA 1PKPA 5A2QQ 3OTOE 1MG7A 4M1KA 2UXCE 1Z5BA 2RS7A 1Z0BA 1HNXE 3J80C 2HHHE 2UU9I 4X66E 2E1RA 3WU4A 4JYAE 4JG4A 4JV5I 1XHKA 1H74A 2DEJA 2HK3A 1N33I 2UXBI 1FWKA 1BKNA 1OJ4A 4MYUA 3B82A 3ZKBA 1N0VC 5BR8I 1GQEA 1YYKA 4LF5I 2X36A 4YY3E 1HNZI 3PYEA 4LFAE 4JI3E 2UU9E 1D6TA 4DPUA 4LF4E 3P1XA 1B63A 4JI8I 4DV6I 4JI7E 4DPWA 4JV5E 2UXBE 3B78A 1KVKA 4PU9A 4K0KI 1FWLA 3K17A 4X62I 5LMUI 4DR2E 2B7TA 4DV3E 2UUCI 4URLA 4OOGC 2IHR1 5BR8E 2JVAA 5A2QC 1I94I 2NPFA 4RPFA 4DV4I 1HNZE 4FWDA 4DU8A 1S4EA 4MYTA 2UXDE 2BM1A 5GMDA
chains in the Genus database with same CATH superfamily
4LF6I 2ELZA 1P42A 4DV6E 5AE3A 2Q8UA 4BA2B 1XMOE 2A2DA 3HTXA 3GCMA 3Q6NA 1T39A 4Z7YA 4BHBA 2EM7A 3ZKDA 5KL5A 3HXLA 2WW4A 4LFBI 4B3SI 1RHYA 4JI6I 5FWKA 2RQLA 4X62E 4M2ZA 1WJPA 2E5LE 2Z5CA 4O5GA 3LLHA 2RTXA 2L2NA 4OZEA 2UUCE 4AIDA 3M7ND 4OO1C 4BC9A 4TUGA 4KQVA 2EPAA 5ELWA 2LJPA 5EKWA 3THOB 2WNRA 2WBTA 3EPHA 1DQ3A 2JEAB 4AIMA 2EM0A 4DV4E 2B3TB 2KONA 5JEAE 4WYQB 1PJSA 4LFCE 4NBQA 2G7HA 2VF3A 2M7QA 4F54A 4DR4I 4JI4E 2IERA 3LPSA 2UXCI 4FK5C 3PYFA 1IBME 5KL2A 3L7ZB 1HNXI 2RS6A 4IJDA 2HHHI 5DROA 1OYRA 1X6FA 2ZBKB 2WZOA 3ZOQB 4MU1A 1E3HA 4N3OA 3WU5A 2DB2A 2EPXA 5JEAF 2O3ZA 2EOMA 3THNA 2EOHA 4BS9A 1YSAC 2VESA 4NZVA 4JYAI 2RSMA 2AJ4A 1QU6A 2O1VA 1NEIA 2FGGA 2LVHA 2VE7C 2EM2A 4FW4A 2MKNA 2XEXA 4ZYGA 2LJHA 2ODRC 4R2CA 2DLKA 4R2SA 1X3CA 3MHHC 2YPNA 1WUUA 2EOIA 2C37B 3K1JA 2R42A 1E3PA 3DF6A 3JAMQ 1IMUA 4X65I 4OKGA 2RSIA 1UBDC 4IFDB 2YTQA 5IV8B 2BR2B 2FTXB 4YY3I 2EL5A 2EMGA 3QT8A 4DR4E 4HY1A 2LUQA 4P7DA 4LFAI 4ED4A 3VYYA 4JI3I 2GS8A 2EOZA 2EZ6A 4DV5I 1XNQI 2EM5A 4LF4I 2EPLX 2YWQA 1FI4A 2EMHA 4WPYA 1H72C 5C0XA 4DR7I 1N34E 1IQOA 3BBGA 1IBKI 2EQ1A 4DR3I 1FNMA 2ENHA 4JI7I 2EOFA 1EH6A 4WSGA 2YSPA 1WXRA 1UDSA 3IWBA 2GQ0A 4IZKB 5DRQA 2YSOA 3CWVA 2BB8A 3JU0A 2O1UA 1ZU1A 2EOOA 2EP3A 1A1IA 1UN6B 1A6FA 1R6MA 4DR2I 3NZKA 4DV3I 2BA0D 4QNKA 4X65E 1BB8A 3BGHA 4B3RE 3WU6A 4I3HA 1K47A 4YHHI 2KOUA 3C4BA 1AAYA 3J81Q 2EL4A 3RMPA 4IS9A 3C6KA 4MQYA 5IT9Q 5A6KA 2EN8A 5JEAC 5IWAI 2PO1A 3C6MA 1NHIA 2UXDI 2N3GA 2EJ4A 1EA6A 1USVA 4DV5E 1Z0TA 1XNQE 3C4TA 3P3GA 2JEBB 3J7AM 1DGCA 2AE8A 1PIEA 2EM4A 2YTIA 1YYOA 4LF7E 2EMCA 1VISA 2WP8B 2Z5BB 4UTGA 2VQFI 2L3JA 4JI5E 1RQ0A 1IBKE 4DR7E 2BV3A 2PNZA 4DR3E 4L8NA 3HJCA 5EL9A 3ZZUA 5FLXQ 1XMOI 2J7KA 4JI1I 1XMQI 4DKKA 1HR0I 2D9HA 1ELOA 2EFGA 1YPNA 1ZXMA 4RH8A 4KWYA 1Z5AA 2ELYA 1MX0A 3QT6A 1AH5A 4R1FA 4HXZA 1KYQA 4HACB 2E5LI 2J7JA 3VYXA 4DR5I 1UILA 1Y4SA 4WUDA 4M30A 2EPRA 3JAMC 2Q2EB 4YHHE 2HFSA 1HNWI 2GLIA 4FW3A 5IXMB 2EE8A 1T4NA 2A25A 4N4RB 2V2ZA 3V5RA 2ENAA 2HC5A 2CVEA 4X8WA 2EOQA 4BA2A 5IWAE 4LFCI 1B69A 3V2UC 2VQEI 3M7NG 5DRRA 2L8TA 4JI4I 2EL6A 2EPPA 3HPSA 2L2MA 5KL7A 1UHZA 1IBMI 4LF8I 4F6NA 2LTRA 4BC7A 2VQFE 4KHPI 4NHRA 4GZNC 3KWRA 4LOMA 2E1MA 1Z0EA 5K36B 4BMJA 3Q1QA 2YU8A 4JI1E 1BBGA 5L3JA 1XMQE 1ZXNA 4DUZI 1HR0E 4NXMI 2HKJA 2K4VA 3PS3A 2EOEA 2YU5A 3J7Yp 1H73A 2JEAA 2MKDA 2NUGA 2V89A 4P78A 4J3DA 4DR5E 1KTVA 1L4SA 4PRVA 5F3WA 5C0XE 4DR6E 5KL6A 3PRYA 2UUAI 2V2QA 3L7ZA 2M4IA 2IOPA 1B62A 3ADGA 2LBSB 2MC5A 1HNWE 3OMLA 3J81C 4R2QA 4WXCA 1J26A 4BBYA 5AC5A 2L3CA 3M6AA 3UHMA 2LRSA 4M9VC 3PS2A 4TUIA 5IT9C 2Z5EA 2VQEE 1Z0VA 2GO3A 2KHXA 2L6MA 5C0XF 1P47A 1NHHA 1Z5CA 1MU5A 1STUA 1QNTA 2DMIA 4LF8E 3FIGA 3QT5A 3WU3A 4LCHA 4Q28A 2EM9A 4KHPE 3KRNA 4DV0E 2UUBI 1OYSA 3MHSC 1N36I 5FLXC 2EM6A 3EPLA 1N34I 2EN1A 1YH8A 4DUZE 1Z0GA 2C37A 3GONA 4NXME 4R8OA 1LLMC 3LMLA 3P3CA 3ADLA 2LJUA 2MDRA 5LMNI 2HFUA 2EMKA 4IFDA 4PRXA 4ZYDA 2BR2A 3U1KA 4MU4A 2PNLA 1J5EI 3T1HI 1IBLI 4F9CB 5K36D 5A6AA 1NHJA 2LO3A 3H1CA 2YTFA 5AC4A 2V83A 2L2KB 2UUAE 5KL3A 2V34A 3D4JA 4EMDA 4JI0E 2HK2A 4GKKE 4B3RI 4MU3A 2EPKX 1X49A 2HJJA 1ZR9A 5AASA 4X64E 2BA1D 3DD6A 5LL6R 2O1WA 1ZM4A 4GQUA 4USMA 2BA0G 4OX9I 2V2VA 1X5WA 2LT7A 1X48A 3QT7A 2EMWA 3L00A 2EMFA 2I13A 2EPCA 1RC7A 3CDJA 4IZKA 4HYMA 4LF7I 1WRJA 2CSHA 2UUBE 3GLLA 4WFTA 1N36E 2VRDA 1YZ9A 4JI5I 1Y60A 1O0WA 2DEIA 4I8OA 4DR1E 2GHFA 4R03A 2F8BA 2V8QB 5LLQA 3UK3C 5CFFE 4DU7A 2EMXA 5LMNE 1PVGA 2MDGA 1UDOA 2WBSA 4GKJI 1N32I 1PJTA 1J5EE 3T1HE 1IBLE 3VHTB 1A1GA 1WHQA 4IFDD 5C0XC 2EPMX 3ZZTA 2E72A 2C39A 2JEBA 2DIXA 4DV2I 4F6MA 3B4TA 2WP8A 2NUFA 2Z5BA 1JK1A 4WUBA 3T1YE 2NA2A 3PYDA 1T4OA 2ADRA 4WUCA 4OX9E 2YZTA 3F6HA 1BBOA 4FN5A 3H09A 2JWOA 1FKAE 4FW5A 4U3BA 2C39B 2HKEA 4DUYI 2JP9A 2EPNA 2EPZA 1YUJA 4HACA 1GZ6A 2JE6B 2JPAA 4NXNE 4JI2I 2EMZA 2ODRD 4DXLA 1XNRI 2YTNA 1YFHA 2PRTA 2GPIA 1ZAAC 1N32E 2LV2A 1EKZA 1IQSA 4GKJE 5JEAB 3VK6A 2V8PA 1MGTA 2LMZA 2YT4A 4L5NC 4BCAA 3J7AG 4ZVIA 4DR6I 4FWGA 1N0UA 1NCSA 4J8ZA 4BHCA 4DV2E 2A2CA 2EOXA 4B3TI 2L92A 2MC6A 2CGEA 2YRKA 1USUA 4HTGA 2CZ9A 5K36A 4IFDE 2EORA 1Z0WA 3ZZ0A 3LNUA 4FW9A 4B3MI 1H7SA 4AQYI 1X47A 3H4LA 1N33E 2GO4A 1EH8A 4UT4A 4GEQB 4P7AA 4DV7I 4DUYE 1PDAA 1KJKA 2EMLA 2FV4B 2F1DA 2NN6B 4QNJA 4DV0I 4RHBB 1RR9A 4MDTA 4IFDF 4O43A 2EQ3A 1TF3A 1X6EA 3ADIA 1DI2A 2EPOA 2B9DA 2I9IA 4JI2E 2IOQA 4Z7CA 2F4VI 1ZBQA 2JR1A 4DV1I 1XNRE 1RREA 1A1KA 1ZM9A 4LPFA 4LF5E 4DPYA 1KKHA 4DPXA 2M9AA 2EWLA 4F9AB 2LCEA 3PYGA 1NZ0A 1N3GA 1YYWA 1GTKA 2V87A 4R2PA 2EOYA 4JI0I 3J80Q 2EMYA 4LU9A 4B3TE 4GKKI 2JT2A 1ZM3A 5JEAD 4ZYEA 4DPTA 4X64I 4JI8E 2PO0A 1WHNA 2YRHA 2B7VA 5GMEA 4B3ME 2C38A 1RMDA 2ZITA 4AQYE 3F0NA 2K7IA 2L33A 3EPJA 2DMYA 1FJGI 1KIJA 1A1JA 2BM0A 3LTOA 4IZJB 4DV7E 4LF9E 3PS1A 2N3HA 2BA1G 1SFEA 4K0KE 1H7UA 4LTYA 4OO1B 5LMUE 1A1HA 2EM3A 2EM8A 4ZYHA 1T4LB 3K85A 1A1LA 2ZM6I 2PO0B 2IESA 1QZRA 1EH7A 2NUEA 2C38B 2YRMA 1ZM2A 3P06A 2F4VE 4USKA 4DR1I 3ADJA 3HQ1A 1PJQA 3TQMA 4DV1E 1U2RA 4BA1A 3M85D 1I94E 2DRPA 1OYPA 3EPKA 1Z0CA 3U1YA 5A6JA 2NN6D 1X6HA 3OTOI 2Z5CB 3ZM7A 2EQ0A 4X9JA 4HEIA 5DRPA 2EOJA 2V86A 3B8HA 3BF2A 4XTJA 1S16A 4BA1B 3AV0A 4Q35B 4X66I 2LTSA 4FWHA 2EN4A 3BIDA 2CPNA 1UEKA 2WNRB 4LF6E 5KL4A 3K6QA 5A6BD 1Z59A 3T1YI 2WBUA 2R3VA 3HULA 4IFDC 4LCFA 3KZZA 1Y6ZA 2R1FA 2YTPA 3EQ1A 1FJGE 4P52A 2EPUA 4M0VA 4LFBE 4R2AA 2OI2A 4B3SE 2YTOA 4JI6E 1VI7A 4MU0A 1T38A 1EI1A 2ZM6E 2NN6E 1DARA 3JTZA 1ZBTA 5K36E 4NXNI 1UDQA 2LUPB 2JY9A 2X7IA 1Y5YA 1PKPA 1MEYC 1F2IG 3ECRA 2PO2A 4IZJD 5A2QQ 3MSWA 2DGCA 5DNLA 2CG9A 4OO1D 4WXDA 3OTOE 2NN6F 1MG7A 2EN7A 2YTJA 4M1KA 2UXCE 5K36F 1Z5BA 3P3EA 1JK2A 2RS7A 2JXPA 4WX9A 1Z0BA 1HNXE 4MLQA 2DSYA 3J80C 1TF6A 2HHHE 2UU9I 4X66E 2CT1A 4R2RA 1UDNA 2PO2B 3Q6MA 2J65A 2JOXA 4F9BB 2E1RA 5TSEA 4LCGA 2JE6A 3WU4A 1G2FC 4FW6A 4JYAE 4JG4A 4R2DA 4JV5I 1XHKA 1H74A 2DEJA 2HK3A 3GMEA 1N33I 2UXBI 5JEAA 2R76A 1FWKA 2ENCA 3CDIA 4R2EA 2LE2A 1BKNA 1OJ4A 5C0XB 2RPCA 4MYUA 4U3DA 4OO1E 3B82A 3ZKBA 2HGHA 3M99B 4MLVA 1N0VC 5BR8I 2CTDA 1GQEA 1YYKA 1YUIA 4FW7A 4LF5I 4F2JC 4IS1C 2X36A 3HPZA 4YY3E 1HNZI 4DMIA 3PYEA 4OO1F 2V88A 2N8XA 2DLQA 1XXEA 2M1SA 4LFAE 4LF9I 2YTEA 2EMAA 4JI3E 1R6LA 1Y4UA 5DNXA 2EOSA 2UU9E 2YTDA 3DJWA 1D6TA 4KZSA 2VF1A 5DNYA 2NN6A 4LF4E 5AE2A 3P1XA 4DPUA 1B63A 2BBGA 1YHCA 3P76A 2JOBA 4JI8I 4DV6I 4AM3A 4JI7E 4DPWA 2V85A 3IWCA 4JV5E 2PO1B 2PNMA 2EN6A 2UXBE 2EN2A 3HKMA 3B78A 1KVKA 5AE1A 4PU9A 4K0KI 5A6BA 1FWLA 3K17A 4X62I 5LMUI 3KZYA 4O4KA 1G2DC 2PNZB 4ISAA 4DR2E 2EMBA 2YTGA 4O24A 2B7TA 2NN6C 2JYAA 3QG5C 4DV3E 2UUCI 2EMIA 4URLA 5ADZA 5K36C 4OOGC 2H36X 2IHR1 2WCC3 5BR8E 5A69A 2JVAA 5A2QC 1I94I 4WSPA 1Z1BA 2NPFA 3IWDA 5T6JA 4RPFA 4DV4I 1HNZE 5C0XD 4FWDA 1SR9A 1S4EA 1A1FA 2EN3A 4DU8A 1HK7A 4MYTA 3M85G 2UXDE 3AUZA 3F6GA 2BM1A 5GMDA 2NABA 1TN9A 4IZJA 2O1TA 4OO1A
chains in the Genus database with same CATH topology
4LF6I 4DV6E 5AE3A 1XMOE 2A2DA 3HTXA 3Q6NA 4Z7YA 3ZKDA 3HXLA 2WW4A 4LFBI 4B3SI 4JI6I 5FWKA 4X62E 4M2ZA 2Z5CA 2E5LE 3LLHA 2RTXA 2L2NA 2UUCE 4BC9A 4TUGA 4KQVA 2LJPA 1DQ3A 4DV4E 2B3TB 2KONA 4WYQB 4LFCE 2G7HA 2VF3A 2M7QA 4F54A 4DR4I 4JI4E 3LPSA 2UXCI 3PYFA 1IBME 1HNXI 2RS6A 2HHHI 2ZBKB 2WZOA 3ZOQB 3WU5A 4N3OA 2DB2A 4BS9A 4JYAI 2RSMA 2AJ4A 1QU6A 2O1VA 2FGGA 2VE7C 2XEXA 2LJHA 2ODRC 1WUUA 3K1JA 2R42A 3DF6A 3JAMQ 4X65I 2FTXB 4YY3I 3QT8A 4DR4E 4HY1A 2LUQA 4P7DA 4LFAI 4ED4A 3VYYA 4JI3I 2GS8A 2EZ6A 4DV5I 1XNQI 4LF4I 1FI4A 1H72C 4WPYA 4DR7I 1N34E 1IBKI 4DR3I 1FNMA 4JI7I 1WXRA 2GQ0A 3IWBA 4IZKB 3CWVA 3JU0A 2O1UA 4DR2I 1A6FA 4DV3I 4X65E 4B3RE 3WU6A 4I3HA 1K47A 4YHHI 2KOUA 3C4BA 3J81Q 3RMPA 5IT9Q 5IWAI 1NHIA 2UXDI 2N3GA 1EA6A 1USVA 1Z0TA 4DV5E 3J7AM 1XNQE 3C4TA 1PIEA 1YYOA 4LF7E 1VISA 2Z5BB 4UTGA 2VQFI 2L3JA 4JI5E 1RQ0A 1IBKE 4DR7E 2BV3A 3HJCA 4DR3E 4L8NA 3V2UC 3ZZUA 5FLXQ 1XMOI 2J7KA 4JI1I 1XMQI 4DKKA 1HR0I 1ELOA 2EFGA 1ZXMA 1Z5AA 3QT6A 1MX0A 4R1FA 4HXZA 4HACB 2E5LI 3VYXA 4DR5I 1UILA 1Y4SA 4WUDA 4M30A 2Q2EB 3JAMC 4YHHE 2HFSA 1HNWI 1T4NA 2V2ZA 3V5RA 4X8WA 5IWAE 4LFCI 2VQEI 2L8TA 4JI4I 1IBMI 3HPSA 2L2MA 1UHZA 4LF8I 2LTRA 4BC7A 2VQFE 4KHPI 3KWRA 2E1MA 1Z0EA 4BMJA 3Q1QA 4JI1E 4DUZI 5L3JA 1XMQE 1ZXNA 4NXMI 1HR0E 2HKJA 2K4VA 3J7Yp 1H73A 2NUGA 2V89A 4P78A 4DR5E 1KTVA 4PRVA 5F3WA 4DR6E 3PRYA 2UUAI 2V2QA 2M4IA 2IOPA 1B62A 3ADGA 2LBSB 2MC5A 1HNWE 3OMLA 3J81C 1J26A 4BBYA 2L3CA 3M6AA 2LRSA 4TUIA 5IT9C 2Z5EA 2VQEE 1Z0VA 2KHXA 2L6MA 1NHHA 1Z5CA 1MU5A 1STUA 4LF8E 3FIGA 3QT5A 3WU3A 4Q28A 4KHPE 4DV0E 2UUBI 1N36I 5FLXC 1N34I 4DUZE 1Z0GA 3GONA 4NXME 4R8OA 3LMLA 3ADLA 2MDRA 5LMNI 2HFUA 4PRXA 1J5EI 2PNLA 3T1HI 1IBLI 4F9CB 1NHJA 2V83A 2L2KB 2UUAE 2V34A 4EMDA 3D4JA 4JI0E 2HK2A 4GKKE 4B3RI 1X49A 5AASA 4X64E 5LL6R 2O1WA 1ZM4A 4USMA 4OX9I 2V2VA 1X48A 3QT7A 4IZKA 1RC7A 4HYMA 4LF7I 2UUBE 1YZ9A 4WFTA 1N36E 4JI5I 1O0WA 2DEIA 4I8OA 4DR1E 4R03A 2F8BA 2V8QB 5CFFE 4DU7A 5LMNE 1PVGA 4GKJI 1N32I 1J5EE 3T1HE 1IBLE 1WHQA 3ZZTA 2DIXA 4DV2I 2NUFA 2Z5BA 4WUBA 3T1YE 2NA2A 3PYDA 1T4OA 4WUCA 4OX9E 2YZTA 3F6HA 4FN5A 3H09A 2JWOA 1FKAE 2HKEA 4DUYI 4HACA 1GZ6A 4NXNE 4JI2I 2ODRD 4DXLA 1XNRI 1N32E 4GKJE 1EKZA 3VK6A 2V8PA 2LMZA 2YT4A 4L5NC 4BCAA 3J7AG 4ZVIA 4DR6I 4FWGA 1N0UA 4J8ZA 4DV2E 2A2CA 4B3TI 2L92A 2MC6A 2CGEA 2CZ9A 1USUA 1Z0WA 3ZZ0A 3LNUA 4FW9A 4B3MI 1H7SA 4AQYI 1X47A 3H4LA 1N33E 4UT4A 4GEQB 4P7AA 4DV7I 4DUYE 4LF9I 2FV4B 4DV0I 1RR9A 3ADIA 2IOQA 1DI2A 2B9DA 4JI2E 4Z7CA 2F4VI 1ZBQA 2JR1A 4DV1I 1XNRE 1RREA 1ZM9A 4LF5E 4DPYA 1KKHA 4DPXA 2EWLA 4F9AB 3PYGA 1NZ0A 1YYWA 2V87A 4JI0I 3J80Q 4LU9A 4B3TE 4GKKI 1ZM3A 4DPTA 4X64I 4JI8E 1WHNA 5GMEA 2B7VA 4B3ME 3F0NA 2ZITA 4AQYE 2L33A 2DMYA 1FJGI 1KIJA 2BM0A 3LTOA 4IZJB 4DV7E 4LF9E 2N3HA 4K0KE 1H7UA 4LTYA 5LMUE 3K85A 1T4LB 2ZM6I 1QZRA 2NUEA 4USKA 1ZM2A 3P06A 2F4VE 4DR1I 3ADJA 3HQ1A 4DV1E 1U2RA 1I94E 1Z0CA 3OTOI 2Z5CB 3ZM7A 2V86A 3B8HA 4XTJA 1S16A 3AV0A 4X66I 2LTSA 4FWHA 1UEKA 2CPNA 4LF6E 3K6QA 1Z59A 3T1YI 2R3VA 3HULA 1Y6ZA 1FJGE 4P52A 4M0VA 4LFBE 2OI2A 4B3SE 4JI6E 1EI1A 2ZM6E 1DARA 3JTZA 1ZBTA 4NXNI 2LUPB 2JY9A 2X7IA 1PKPA 5A2QQ 4IZJD 3MSWA 2CG9A 3OTOE 1MG7A 4M1KA 2UXCE 1Z5BA 2RS7A 1Z0BA 1HNXE 3J80C 2DSYA 2HHHE 2UU9I 4X66E 3Q6MA 2JOXA 4F9BB 2E1RA 3WU4A 4JYAE 4JG4A 4JV5I 1XHKA 1H74A 2DEJA 2HK3A 1N33I 2UXBI 1FWKA 2LE2A 1BKNA 1OJ4A 4MYUA 3B82A 3ZKBA 1N0VC 5BR8I 1GQEA 1YYKA 4LF5I 2X36A 3HPZA 4YY3E 1HNZI 4DMIA 3PYEA 2V88A 2M1SA 4LFAE 4JI3E 1Y4UA 2UU9E 1D6TA 3DJWA 4KZSA 2VF1A 5DNYA 4DPUA 4LF4E 5AE2A 3P1XA 1B63A 2JOBA 4JI8I 4DV6I 4JI7E 4DPWA 2V85A 3IWCA 4JV5E 2PNMA 2UXBE 3B78A 1KVKA 5AE1A 4PU9A 4K0KI 1FWLA 3K17A 4X62I 5LMUI 4DR2E 2B7TA 4DV3E 2UUCI 4URLA 5ADZA 4OOGC 2H36X 2IHR1 5BR8E 2JVAA 5A2QC 1I94I 4WSPA 2NPFA 3IWDA 5T6JA 4RPFA 4DV4I 1HNZE 4FWDA 1SR9A 1S4EA 4DU8A 1HK7A 4MYTA 2UXDE 3AUZA 3F6GA 2BM1A 5GMDA 4IZJA 2O1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 I;  4DV6 E;  1XMO E;  2A2D A;  3HTX A;  4Z7Y A;  3ZKD A;  2WW4 A;  4LFB I;  4B3S I;  4JI6 I;  4X62 E;  4M2Z A;  2E5L E;  3LLH A;  2RTX A;  2L2N A;  2UUC E;  4KQV A;  2LJP A;  4DV4 E;  2B3T B;  4WYQ B;  4LFC E;  2VF3 A;  4DR4 I;  4JI4 E;  3LPS A;  2UXC I;  3PYF A;  1IBM E;  1HNX I;  2RS6 A;  2HHH I;  2ZBK B;  3WU5 A;  2DB2 A;  4JYA I;  2RSM A;  2AJ4 A;  1QU6 A;  2XEX A;  2LJH A;  1WUU A;  3K1J A;  2R42 A;  3JAM Q;  4X65 I;  4YY3 I;  3QT8 A;  4DR4 E;  4HY1 A;  2LUQ A;  4LFA I;  4ED4 A;  3VYY A;  4JI3 I;  2GS8 A;  2EZ6 A;  4DV5 I;  1XNQ I;  4LF4 I;  1FI4 A;  1H72 C;  4DR7 I;  1N34 E;  1IBK I;  4DR3 I;  1FNM A;  4JI7 I;  3CWV A;  4DR2 I;  1A6F A;  4DV3 I;  4X65 E;  4B3R E;  3WU6 A;  4I3H A;  1K47 A;  4YHH I;  3C4B A;  3J81 Q;  5IT9 Q;  5IWA I;  1NHI A;  2UXD I;  2N3G A;  1EA6 A;  1Z0T A;  3J7A M;  4DV5 E;  1XNQ E;  3C4T A;  1PIE A;  1YYO A;  4LF7 E;  1VIS A;  4UTG A;  2VQF I;  2L3J A;  4JI5 E;  1RQ0 A;  1IBK E;  4DR7 E;  2BV3 A;  3V2U C;  4DR3 E;  5FLX Q;  3ZZU A;  1XMO I;  2J7K A;  4JI1 I;  1XMQ I;  4DKK A;  1HR0 I;  1ELO A;  2EFG A;  1ZXM A;  1Z5A A;  3QT6 A;  1MX0 A;  4R1F A;  4HXZ A;  4HAC B;  2E5L I;  3VYX A;  4DR5 I;  1UIL A;  4WUD A;  4M30 A;  2Q2E B;  3JAM C;  4YHH E;  2HFS A;  1HNW I;  1T4N A;  2V2Z A;  3V5R A;  4X8W A;  5IWA E;  4LFC I;  2VQE I;  4JI4 I;  1IBM I;  2L2M A;  1UHZ A;  4LF8 I;  2LTR A;  2VQF E;  4KHP I;  1Z0E A;  3Q1Q A;  4JI1 E;  4DUZ I;  5L3J A;  1XMQ E;  1ZXN A;  4NXM I;  1HR0 E;  2HKJ A;  3J7Y p;  1H73 A;  2NUG A;  4DR5 E;  1KTV A;  4PRV A;  4DR6 E;  2UUA I;  2V2Q A;  1B62 A;  3ADG A;  2LBS B;  1HNW E;  1J26 A;  3J81 C;  2L3C A;  3M6A A;  2LRS A;  5IT9 C;  2VQE E;  1Z0V A;  2KHX A;  1NHH A;  1Z5C A;  1MU5 A;  1STU A;  4LF8 E;  3QT5 A;  3WU3 A;  4KHP E;  4DV0 E;  2UUB I;  1N36 I;  5FLX C;  1N34 I;  4DUZ E;  1Z0G A;  3GON A;  4NXM E;  3ADL A;  2MDR A;  5LMN I;  2HFU A;  4PRX A;  1J5E I;  3T1H I;  1IBL I;  1NHJ A;  2L2K B;  2V34 A;  2UUA E;  4EMD A;  3D4J A;  4JI0 E;  2HK2 A;  4GKK E;  4B3R I;  1X49 A;  4X64 E;  5LL6 R;  1ZM4 A;  4USM A;  4OX9 I;  2V2V A;  1X48 A;  3QT7 A;  1RC7 A;  4HYM A;  4LF7 I;  2UUB E;  4WFT A;  1N36 E;  1YZ9 A;  4JI5 I;  1O0W A;  2DEI A;  4DR1 E;  5CFF E;  4DU7 A;  5LMN E;  1PVG A;  4GKJ I;  1N32 I;  1J5E E;  3T1H E;  1IBL E;  1WHQ A;  3ZZT A;  2DIX A;  4DV2 I;  2NUF A;  4WUB A;  3T1Y E;  2NA2 A;  3PYD A;  1T4O A;  4WUC A;  4OX9 E;  4FN5 A;  1FKA E;  2HKE A;  4DUY I;  4HAC A;  4NXN E;  4JI2 I;  4DXL A;  1XNR I;  1N32 E;  4GKJ E;  1EKZ A;  2V8P A;  2YT4 A;  4ZVI A;  3J7A G;  4DR6 I;  4FWG A;  1N0U A;  4DV2 E;  2A2C A;  4B3T I;  2CZ9 A;  1Z0W A;  3ZZ0 A;  3LNU A;  4FW9 A;  4B3M I;  1H7S A;  4AQY I;  1X47 A;  3H4L A;  1N33 E;  4UT4 A;  4P7A A;  4DV7 I;  4LF9 I;  4DUY E;  4DV0 I;  1RR9 A;  3ADI A;  1DI2 A;  4JI2 E;  4Z7C A;  2F4V I;  4DV1 I;  1XNR E;  1RRE A;  1ZM9 A;  4LF5 E;  4DPY A;  1KKH A;  4DPX A;  3PYG A;  1NZ0 A;  1YYW A;  4JI0 I;  3J80 Q;  4B3T E;  4GKK I;  1ZM3 A;  4DPT A;  4X64 I;  4JI8 E;  1WHN A;  5GME A;  2B7V A;  4B3M E;  3F0N A;  2ZIT A;  4AQY E;  2L33 A;  2DMY A;  1FJG I;  1KIJ A;  2BM0 A;  3LTO A;  4DV7 E;  4LF9 E;  2N3H A;  4K0K E;  1H7U A;  5LMU E;  1T4L B;  2ZM6 I;  1QZR A;  2NUE A;  4USK A;  1ZM2 A;  4DR1 I;  2F4V E;  3ADJ A;  1U2R A;  4DV1 E;  1I94 E;  1Z0C A;  3OTO I;  3ZM7 A;  3B8H A;  4XTJ A;  1S16 A;  4X66 I;  2LTS A;  4FWH A;  1UEK A;  2CPN A;  4LF6 E;  1Z59 A;  3T1Y I;  2R3V A;  3HUL A;  1FJG E;  4P52 A;  4LFB E;  2OI2 A;  4B3S E;  4JI6 E;  1EI1 A;  2ZM6 E;  1DAR A;  1ZBT A;  4NXN I;  2LUP B;  2JY9 A;  2X7I A;  1PKP A;  5A2Q Q;  3OTO E;  1MG7 A;  4M1K A;  2UXC E;  1Z5B A;  2RS7 A;  1Z0B A;  1HNX E;  3J80 C;  2HHH E;  2UU9 I;  4X66 E;  2E1R A;  3WU4 A;  4JYA E;  4JG4 A;  4JV5 I;  1XHK A;  1H74 A;  2DEJ A;  2HK3 A;  1N33 I;  2UXB I;  1FWK A;  1BKN A;  1OJ4 A;  4MYU A;  3B82 A;  3ZKB A;  1N0V C;  5BR8 I;  1GQE A;  1YYK A;  4LF5 I;  2X36 A;  4YY3 E;  1HNZ I;  3PYE A;  4LFA E;  4JI3 E;  2UU9 E;  1D6T A;  4DPU A;  4LF4 E;  3P1X A;  1B63 A;  4JI8 I;  4DV6 I;  4JI7 E;  4DPW A;  4JV5 E;  2UXB E;  3B78 A;  1KVK A;  4PU9 A;  4K0K I;  1FWL A;  3K17 A;  4X62 I;  5LMU I;  4DR2 E;  2B7T A;  4DV3 E;  2UUC I;  4URL A;  4OOG C;  2IHR 1;  5BR8 E;  2JVA A;  5A2Q C;  1I94 I;  2NPF A;  4RPF A;  4DV4 I;  1HNZ E;  4FWD A;  4DU8 A;  1S4E A;  4MYT A;  2UXD E;  2BM1 A;  5GMD A; 
#chains in the Genus database with same CATH topology
 4LF6 I;  2ELZ A;  1P42 A;  4DV6 E;  5AE3 A;  2Q8U A;  4BA2 B;  1XMO E;  2A2D A;  3HTX A;  3GCM A;  3Q6N A;  1T39 A;  4Z7Y A;  4BHB A;  2EM7 A;  3ZKD A;  5KL5 A;  3HXL A;  2WW4 A;  4LFB I;  4B3S I;  1RHY A;  4JI6 I;  5FWK A;  2RQL A;  4X62 E;  4M2Z A;  1WJP A;  2E5L E;  2Z5C A;  4O5G A;  3LLH A;  2RTX A;  2L2N A;  4OZE A;  2UUC E;  4AID A;  3M7N D;  4OO1 C;  4BC9 A;  4TUG A;  4KQV A;  2EPA A;  5ELW A;  2LJP A;  5EKW A;  3THO B;  2WNR A;  2WBT A;  3EPH A;  1DQ3 A;  2JEA B;  4AIM A;  2EM0 A;  4DV4 E;  2B3T B;  2KON A;  5JEA E;  4WYQ B;  1PJS A;  4LFC E;  4NBQ A;  2G7H A;  2VF3 A;  2M7Q A;  4F54 A;  4DR4 I;  4JI4 E;  2IER A;  3LPS A;  2UXC I;  4FK5 C;  3PYF A;  1IBM E;  5KL2 A;  3L7Z B;  1HNX I;  2RS6 A;  4IJD A;  2HHH I;  5DRO A;  1OYR A;  1X6F A;  2ZBK B;  2WZO A;  3ZOQ B;  4MU1 A;  1E3H A;  4N3O A;  3WU5 A;  2DB2 A;  2EPX A;  5JEA F;  2O3Z A;  2EOM A;  3THN A;  2EOH A;  4BS9 A;  1YSA C;  2VES A;  4NZV A;  4JYA I;  2RSM A;  2AJ4 A;  1QU6 A;  2O1V A;  1NEI A;  2FGG A;  2LVH A;  2VE7 C;  2EM2 A;  4FW4 A;  2MKN A;  2XEX A;  4ZYG A;  2LJH A;  2ODR C;  4R2C A;  2DLK A;  4R2S A;  1X3C A;  3MHH C;  2YPN A;  1WUU A;  2EOI A;  2C37 B;  3K1J A;  2R42 A;  1E3P A;  3DF6 A;  3JAM Q;  1IMU A;  4X65 I;  4OKG A;  2RSI A;  1UBD C;  4IFD B;  2YTQ A;  5IV8 B;  2BR2 B;  2FTX B;  4YY3 I;  2EL5 A;  2EMG A;  3QT8 A;  4DR4 E;  4HY1 A;  2LUQ A;  4P7D A;  4LFA I;  4ED4 A;  3VYY A;  4JI3 I;  2GS8 A;  2EOZ A;  2EZ6 A;  4DV5 I;  1XNQ I;  2EM5 A;  4LF4 I;  2EPL X;  2YWQ A;  1FI4 A;  2EMH A;  4WPY A;  1H72 C;  5C0X A;  4DR7 I;  1N34 E;  1IQO A;  3BBG A;  1IBK I;  2EQ1 A;  4DR3 I;  1FNM A;  2ENH A;  4JI7 I;  2EOF A;  1EH6 A;  4WSG A;  2YSP A;  1WXR A;  1UDS A;  3IWB A;  2GQ0 A;  4IZK B;  5DRQ A;  2YSO A;  3CWV A;  2BB8 A;  3JU0 A;  2O1U A;  1ZU1 A;  2EOO A;  2EP3 A;  1A1I A;  1UN6 B;  1A6F A;  1R6M A;  4DR2 I;  3NZK A;  4DV3 I;  2BA0 D;  4QNK A;  4X65 E;  1BB8 A;  3BGH A;  4B3R E;  3WU6 A;  4I3H A;  1K47 A;  4YHH I;  2KOU A;  3C4B A;  1AAY A;  3J81 Q;  2EL4 A;  3RMP A;  4IS9 A;  3C6K A;  4MQY A;  5IT9 Q;  5A6K A;  2EN8 A;  5JEA C;  5IWA I;  2PO1 A;  3C6M A;  1NHI A;  2UXD I;  2N3G A;  2EJ4 A;  1EA6 A;  1USV A;  4DV5 E;  1Z0T A;  1XNQ E;  3C4T A;  3P3G A;  2JEB B;  3J7A M;  1DGC A;  2AE8 A;  1PIE A;  2EM4 A;  2YTI A;  1YYO A;  4LF7 E;  2EMC A;  1VIS A;  2WP8 B;  2Z5B B;  4UTG A;  2VQF I;  2L3J A;  4JI5 E;  1RQ0 A;  1IBK E;  4DR7 E;  2BV3 A;  2PNZ A;  4DR3 E;  4L8N A;  3HJC A;  5EL9 A;  3ZZU A;  5FLX Q;  1XMO I;  2J7K A;  4JI1 I;  1XMQ I;  4DKK A;  1HR0 I;  2D9H A;  1ELO A;  2EFG A;  1YPN A;  1ZXM A;  4RH8 A;  4KWY A;  1Z5A A;  2ELY A;  1MX0 A;  3QT6 A;  1AH5 A;  4R1F A;  4HXZ A;  1KYQ A;  4HAC B;  2E5L I;  2J7J A;  3VYX A;  4DR5 I;  1UIL A;  1Y4S A;  4WUD A;  4M30 A;  2EPR A;  3JAM C;  2Q2E B;  4YHH E;  2HFS A;  1HNW I;  2GLI A;  4FW3 A;  5IXM B;  2EE8 A;  1T4N A;  2A25 A;  4N4R B;  2V2Z A;  3V5R A;  2ENA A;  2HC5 A;  2CVE A;  4X8W A;  2EOQ A;  4BA2 A;  5IWA E;  4LFC I;  1B69 A;  3V2U C;  2VQE I;  3M7N G;  5DRR A;  2L8T A;  4JI4 I;  2EL6 A;  2EPP A;  3HPS A;  2L2M A;  5KL7 A;  1UHZ A;  1IBM I;  4LF8 I;  4F6N A;  2LTR A;  4BC7 A;  2VQF E;  4KHP I;  4NHR A;  4GZN C;  3KWR A;  4LOM A;  2E1M A;  1Z0E A;  5K36 B;  4BMJ A;  3Q1Q A;  2YU8 A;  4JI1 E;  1BBG A;  5L3J A;  1XMQ E;  1ZXN A;  4DUZ I;  1HR0 E;  4NXM I;  2HKJ A;  2K4V A;  3PS3 A;  2EOE A;  2YU5 A;  3J7Y p;  1H73 A;  2JEA A;  2MKD A;  2NUG A;  2V89 A;  4P78 A;  4J3D A;  4DR5 E;  1KTV A;  1L4S A;  4PRV A;  5F3W A;  5C0X E;  4DR6 E;  5KL6 A;  3PRY A;  2UUA I;  2V2Q A;  3L7Z A;  2M4I A;  2IOP A;  1B62 A;  3ADG A;  2LBS B;  2MC5 A;  1HNW E;  3OML A;  3J81 C;  4R2Q A;  4WXC A;  1J26 A;  4BBY A;  5AC5 A;  2L3C A;  3M6A A;  3UHM A;  2LRS A;  4M9V C;  3PS2 A;  4TUI A;  5IT9 C;  2Z5E A;  2VQE E;  1Z0V A;  2GO3 A;  2KHX A;  2L6M A;  5C0X F;  1P47 A;  1NHH A;  1Z5C A;  1MU5 A;  1STU A;  1QNT A;  2DMI A;  4LF8 E;  3FIG A;  3QT5 A;  3WU3 A;  4LCH A;  4Q28 A;  2EM9 A;  4KHP E;  3KRN A;  4DV0 E;  2UUB I;  1OYS A;  3MHS C;  1N36 I;  5FLX C;  2EM6 A;  3EPL A;  1N34 I;  2EN1 A;  1YH8 A;  4DUZ E;  1Z0G A;  2C37 A;  3GON A;  4NXM E;  4R8O A;  1LLM C;  3LML A;  3P3C A;  3ADL A;  2LJU A;  2MDR A;  5LMN I;  2HFU A;  2EMK A;  4IFD A;  4PRX A;  4ZYD A;  2BR2 A;  3U1K A;  4MU4 A;  2PNL A;  1J5E I;  3T1H I;  1IBL I;  4F9C B;  5K36 D;  5A6A A;  1NHJ A;  2LO3 A;  3H1C A;  2YTF A;  5AC4 A;  2V83 A;  2L2K B;  2UUA E;  5KL3 A;  2V34 A;  3D4J A;  4EMD A;  4JI0 E;  2HK2 A;  4GKK E;  4B3R I;  4MU3 A;  2EPK X;  1X49 A;  2HJJ A;  1ZR9 A;  5AAS A;  4X64 E;  2BA1 D;  3DD6 A;  5LL6 R;  2O1W A;  1ZM4 A;  4GQU A;  4USM A;  2BA0 G;  4OX9 I;  2V2V A;  1X5W A;  2LT7 A;  1X48 A;  3QT7 A;  2EMW A;  3L00 A;  2EMF A;  2I13 A;  2EPC A;  1RC7 A;  3CDJ A;  4IZK A;  4HYM A;  4LF7 I;  1WRJ A;  2CSH A;  2UUB E;  3GLL A;  4WFT A;  1N36 E;  2VRD A;  1YZ9 A;  4JI5 I;  1Y60 A;  1O0W A;  2DEI A;  4I8O A;  4DR1 E;  2GHF A;  4R03 A;  2F8B A;  2V8Q B;  5LLQ A;  3UK3 C;  5CFF E;  4DU7 A;  2EMX A;  5LMN E;  1PVG A;  2MDG A;  1UDO A;  2WBS A;  4GKJ I;  1N32 I;  1PJT A;  1J5E E;  3T1H E;  1IBL E;  3VHT B;  1A1G A;  1WHQ A;  4IFD D;  5C0X C;  2EPM X;  3ZZT A;  2E72 A;  2C39 A;  2JEB A;  2DIX A;  4DV2 I;  4F6M A;  3B4T A;  2WP8 A;  2NUF A;  2Z5B A;  1JK1 A;  4WUB A;  3T1Y E;  2NA2 A;  3PYD A;  1T4O A;  2ADR A;  4WUC A;  4OX9 E;  2YZT A;  3F6H A;  1BBO A;  4FN5 A;  3H09 A;  2JWO A;  1FKA E;  4FW5 A;  4U3B A;  2C39 B;  2HKE A;  4DUY I;  2JP9 A;  2EPN A;  2EPZ A;  1YUJ A;  4HAC A;  1GZ6 A;  2JE6 B;  2JPA A;  4NXN E;  4JI2 I;  2EMZ A;  2ODR D;  4DXL A;  1XNR I;  2YTN A;  1YFH A;  2PRT A;  2GPI A;  1ZAA C;  1N32 E;  2LV2 A;  1EKZ A;  1IQS A;  4GKJ E;  5JEA B;  3VK6 A;  2V8P A;  1MGT A;  2LMZ A;  2YT4 A;  4L5N C;  4BCA A;  3J7A G;  4ZVI A;  4DR6 I;  4FWG A;  1N0U A;  1NCS A;  4J8Z A;  4BHC A;  4DV2 E;  2A2C A;  2EOX A;  4B3T I;  2L92 A;  2MC6 A;  2CGE A;  2YRK A;  1USU A;  4HTG A;  2CZ9 A;  5K36 A;  4IFD E;  2EOR A;  1Z0W A;  3ZZ0 A;  3LNU A;  4FW9 A;  4B3M I;  1H7S A;  4AQY I;  1X47 A;  3H4L A;  1N33 E;  2GO4 A;  1EH8 A;  4UT4 A;  4GEQ B;  4P7A A;  4DV7 I;  4DUY E;  1PDA A;  1KJK A;  2EML A;  2FV4 B;  2F1D A;  2NN6 B;  4QNJ A;  4DV0 I;  4RHB B;  1RR9 A;  4MDT A;  4IFD F;  4O43 A;  2EQ3 A;  1TF3 A;  1X6E A;  3ADI A;  1DI2 A;  2EPO A;  2B9D A;  2I9I A;  4JI2 E;  2IOQ A;  4Z7C A;  2F4V I;  1ZBQ A;  2JR1 A;  4DV1 I;  1XNR E;  1RRE A;  1A1K A;  1ZM9 A;  4LPF A;  4LF5 E;  4DPY A;  1KKH A;  4DPX A;  2M9A A;  2EWL A;  4F9A B;  2LCE A;  3PYG A;  1NZ0 A;  1N3G A;  1YYW A;  1GTK A;  2V87 A;  4R2P A;  2EOY A;  4JI0 I;  3J80 Q;  2EMY A;  4LU9 A;  4B3T E;  4GKK I;  2JT2 A;  1ZM3 A;  5JEA D;  4ZYE A;  4DPT A;  4X64 I;  4JI8 E;  2PO0 A;  1WHN A;  2YRH A;  2B7V A;  5GME A;  4B3M E;  2C38 A;  1RMD A;  2ZIT A;  4AQY E;  3F0N A;  2K7I A;  2L33 A;  3EPJ A;  2DMY A;  1FJG I;  1KIJ A;  1A1J A;  2BM0 A;  3LTO A;  4IZJ B;  4DV7 E;  4LF9 E;  3PS1 A;  2N3H A;  2BA1 G;  1SFE A;  4K0K E;  1H7U A;  4LTY A;  4OO1 B;  5LMU E;  1A1H A;  2EM3 A;  2EM8 A;  4ZYH A;  1T4L B;  3K85 A;  1A1L A;  2ZM6 I;  2PO0 B;  2IES A;  1QZR A;  1EH7 A;  2NUE A;  2C38 B;  2YRM A;  1ZM2 A;  3P06 A;  2F4V E;  4USK A;  4DR1 I;  3ADJ A;  3HQ1 A;  1PJQ A;  3TQM A;  4DV1 E;  1U2R A;  4BA1 A;  3M85 D;  1I94 E;  2DRP A;  1OYP A;  3EPK A;  1Z0C A;  3U1Y A;  5A6J A;  2NN6 D;  1X6H A;  3OTO I;  2Z5C B;  3ZM7 A;  2EQ0 A;  4X9J A;  4HEI A;  5DRP A;  2EOJ A;  2V86 A;  3B8H A;  3BF2 A;  4XTJ A;  1S16 A;  4BA1 B;  3AV0 A;  4Q35 B;  4X66 I;  2LTS A;  4FWH A;  2EN4 A;  3BID A;  2CPN A;  1UEK A;  2WNR B;  4LF6 E;  5KL4 A;  3K6Q A;  5A6B D;  1Z59 A;  3T1Y I;  2WBU A;  2R3V A;  3HUL A;  4IFD C;  4LCF A;  3KZZ A;  1Y6Z A;  2R1F A;  2YTP A;  3EQ1 A;  1FJG E;  4P52 A;  2EPU A;  4M0V A;  4LFB E;  4R2A A;  2OI2 A;  4B3S E;  2YTO A;  4JI6 E;  1VI7 A;  4MU0 A;  1T38 A;  1EI1 A;  2ZM6 E;  2NN6 E;  1DAR A;  3JTZ A;  1ZBT A;  5K36 E;  4NXN I;  1UDQ A;  2LUP B;  2JY9 A;  2X7I A;  1Y5Y A;  1PKP A;  1MEY C;  1F2I G;  3ECR A;  2PO2 A;  4IZJ D;  5A2Q Q;  3MSW A;  2DGC A;  5DNL A;  2CG9 A;  4OO1 D;  4WXD A;  3OTO E;  2NN6 F;  1MG7 A;  2EN7 A;  2YTJ A;  4M1K A;  2UXC E;  5K36 F;  1Z5B A;  3P3E A;  1JK2 A;  2RS7 A;  2JXP A;  4WX9 A;  1Z0B A;  1HNX E;  4MLQ A;  2DSY A;  3J80 C;  1TF6 A;  2HHH E;  2UU9 I;  4X66 E;  2CT1 A;  4R2R A;  1UDN A;  2PO2 B;  3Q6M A;  2J65 A;  2JOX A;  4F9B B;  2E1R A;  5TSE A;  4LCG A;  2JE6 A;  3WU4 A;  1G2F C;  4FW6 A;  4JYA E;  4JG4 A;  4R2D A;  4JV5 I;  1XHK A;  1H74 A;  2DEJ A;  2HK3 A;  3GME A;  1N33 I;  2UXB I;  5JEA A;  2R76 A;  1FWK A;  2ENC A;  3CDI A;  4R2E A;  2LE2 A;  1BKN A;  1OJ4 A;  5C0X B;  2RPC A;  4MYU A;  4U3D A;  4OO1 E;  3B82 A;  3ZKB A;  2HGH A;  3M99 B;  4MLV A;  1N0V C;  5BR8 I;  2CTD A;  1GQE A;  1YYK A;  1YUI A;  4FW7 A;  4LF5 I;  4F2J C;  4IS1 C;  2X36 A;  3HPZ A;  4YY3 E;  1HNZ I;  4DMI A;  3PYE A;  4OO1 F;  2V88 A;  2N8X A;  2DLQ A;  1XXE A;  2M1S A;  4LFA E;  4LF9 I;  2YTE A;  2EMA A;  4JI3 E;  1R6L A;  1Y4U A;  5DNX A;  2EOS A;  2UU9 E;  2YTD A;  3DJW A;  1D6T A;  4KZS A;  2VF1 A;  5DNY A;  2NN6 A;  4LF4 E;  5AE2 A;  3P1X A;  4DPU A;  1B63 A;  2BBG A;  1YHC A;  3P76 A;  2JOB A;  4JI8 I;  4DV6 I;  4AM3 A;  4JI7 E;  4DPW A;  2V85 A;  3IWC A;  4JV5 E;  2PO1 B;  2PNM A;  2EN6 A;  2UXB E;  2EN2 A;  3HKM A;  3B78 A;  1KVK A;  5AE1 A;  4PU9 A;  4K0K I;  5A6B A;  1FWL A;  3K17 A;  4X62 I;  5LMU I;  3KZY A;  4O4K A;  1G2D C;  2PNZ B;  4ISA A;  4DR2 E;  2EMB A;  2YTG A;  4O24 A;  2B7T A;  2NN6 C;  2JYA A;  3QG5 C;  4DV3 E;  2UUC I;  2EMI A;  4URL A;  5ADZ A;  5K36 C;  4OOG C;  2H36 X;  2IHR 1;  2WCC 3;  5BR8 E;  5A69 A;  2JVA A;  5A2Q C;  1I94 I;  4WSP A;  1Z1B A;  2NPF A;  3IWD A;  5T6J A;  4RPF A;  4DV4 I;  1HNZ E;  5C0X D;  4FWD A;  1SR9 A;  1S4E A;  1A1F A;  2EN3 A;  4DU8 A;  1HK7 A;  4MYT A;  3M85 G;  2UXD E;  3AUZ A;  3F6G A;  2BM1 A;  5GMD A;  2NAB A;  1TN9 A;  4IZJ A;  2O1T A;  4OO1 A; 
#chains in the Genus database with same CATH homology
 4LF6 I;  4DV6 E;  5AE3 A;  1XMO E;  2A2D A;  3HTX A;  3Q6N A;  4Z7Y A;  3ZKD A;  3HXL A;  2WW4 A;  4LFB I;  4B3S I;  4JI6 I;  5FWK A;  4X62 E;  4M2Z A;  2Z5C A;  2E5L E;  3LLH A;  2RTX A;  2L2N A;  2UUC E;  4BC9 A;  4TUG A;  4KQV A;  2LJP A;  1DQ3 A;  4DV4 E;  2B3T B;  2KON A;  4WYQ B;  4LFC E;  2G7H A;  2VF3 A;  2M7Q A;  4F54 A;  4DR4 I;  4JI4 E;  3LPS A;  2UXC I;  3PYF A;  1IBM E;  1HNX I;  2RS6 A;  2HHH I;  2ZBK B;  2WZO A;  3ZOQ B;  3WU5 A;  4N3O A;  2DB2 A;  4BS9 A;  4JYA I;  2RSM A;  2AJ4 A;  1QU6 A;  2O1V A;  2FGG A;  2VE7 C;  2XEX A;  2LJH A;  2ODR C;  1WUU A;  3K1J A;  2R42 A;  3DF6 A;  3JAM Q;  4X65 I;  2FTX B;  4YY3 I;  3QT8 A;  4DR4 E;  4HY1 A;  2LUQ A;  4P7D A;  4LFA I;  4ED4 A;  3VYY A;  4JI3 I;  2GS8 A;  2EZ6 A;  4DV5 I;  1XNQ I;  4LF4 I;  1FI4 A;  1H72 C;  4WPY A;  4DR7 I;  1N34 E;  1IBK I;  4DR3 I;  1FNM A;  4JI7 I;  1WXR A;  2GQ0 A;  3IWB A;  4IZK B;  3CWV A;  3JU0 A;  2O1U A;  4DR2 I;  1A6F A;  4DV3 I;  4X65 E;  4B3R E;  3WU6 A;  4I3H A;  1K47 A;  4YHH I;  2KOU A;  3C4B A;  3J81 Q;  3RMP A;  5IT9 Q;  5IWA I;  1NHI A;  2UXD I;  2N3G A;  1EA6 A;  1USV A;  1Z0T A;  4DV5 E;  3J7A M;  1XNQ E;  3C4T A;  1PIE A;  1YYO A;  4LF7 E;  1VIS A;  2Z5B B;  4UTG A;  2VQF I;  2L3J A;  4JI5 E;  1RQ0 A;  1IBK E;  4DR7 E;  2BV3 A;  3HJC A;  4DR3 E;  4L8N A;  3V2U C;  3ZZU A;  5FLX Q;  1XMO I;  2J7K A;  4JI1 I;  1XMQ I;  4DKK A;  1HR0 I;  1ELO A;  2EFG A;  1ZXM A;  1Z5A A;  3QT6 A;  1MX0 A;  4R1F A;  4HXZ A;  4HAC B;  2E5L I;  3VYX A;  4DR5 I;  1UIL A;  1Y4S A;  4WUD A;  4M30 A;  2Q2E B;  3JAM C;  4YHH E;  2HFS A;  1HNW I;  1T4N A;  2V2Z A;  3V5R A;  4X8W A;  5IWA E;  4LFC I;  2VQE I;  2L8T A;  4JI4 I;  1IBM I;  3HPS A;  2L2M A;  1UHZ A;  4LF8 I;  2LTR A;  4BC7 A;  2VQF E;  4KHP I;  3KWR A;  2E1M A;  1Z0E A;  4BMJ A;  3Q1Q A;  4JI1 E;  4DUZ I;  5L3J A;  1XMQ E;  1ZXN A;  4NXM I;  1HR0 E;  2HKJ A;  2K4V A;  3J7Y p;  1H73 A;  2NUG A;  2V89 A;  4P78 A;  4DR5 E;  1KTV A;  4PRV A;  5F3W A;  4DR6 E;  3PRY A;  2UUA I;  2V2Q A;  2M4I A;  2IOP A;  1B62 A;  3ADG A;  2LBS B;  2MC5 A;  1HNW E;  3OML A;  3J81 C;  1J26 A;  4BBY A;  2L3C A;  3M6A A;  2LRS A;  4TUI A;  5IT9 C;  2Z5E A;  2VQE E;  1Z0V A;  2KHX A;  2L6M A;  1NHH A;  1Z5C A;  1MU5 A;  1STU A;  4LF8 E;  3FIG A;  3QT5 A;  3WU3 A;  4Q28 A;  4KHP E;  4DV0 E;  2UUB I;  1N36 I;  5FLX C;  1N34 I;  4DUZ E;  1Z0G A;  3GON A;  4NXM E;  4R8O A;  3LML A;  3ADL A;  2MDR A;  5LMN I;  2HFU A;  4PRX A;  1J5E I;  2PNL A;  3T1H I;  1IBL I;  4F9C B;  1NHJ A;  2V83 A;  2L2K B;  2UUA E;  2V34 A;  4EMD A;  3D4J A;  4JI0 E;  2HK2 A;  4GKK E;  4B3R I;  1X49 A;  5AAS A;  4X64 E;  5LL6 R;  2O1W A;  1ZM4 A;  4USM A;  4OX9 I;  2V2V A;  1X48 A;  3QT7 A;  4IZK A;  1RC7 A;  4HYM A;  4LF7 I;  2UUB E;  1YZ9 A;  4WFT A;  1N36 E;  4JI5 I;  1O0W A;  2DEI A;  4I8O A;  4DR1 E;  4R03 A;  2F8B A;  2V8Q B;  5CFF E;  4DU7 A;  5LMN E;  1PVG A;  4GKJ I;  1N32 I;  1J5E E;  3T1H E;  1IBL E;  1WHQ A;  3ZZT A;  2DIX A;  4DV2 I;  2NUF A;  2Z5B A;  4WUB A;  3T1Y E;  2NA2 A;  3PYD A;  1T4O A;  4WUC A;  4OX9 E;  2YZT A;  3F6H A;  4FN5 A;  3H09 A;  2JWO A;  1FKA E;  2HKE A;  4DUY I;  4HAC A;  1GZ6 A;  4NXN E;  4JI2 I;  2ODR D;  4DXL A;  1XNR I;  1N32 E;  4GKJ E;  1EKZ A;  3VK6 A;  2V8P A;  2LMZ A;  2YT4 A;  4L5N C;  4BCA A;  3J7A G;  4ZVI A;  4DR6 I;  4FWG A;  1N0U A;  4J8Z A;  4DV2 E;  2A2C A;  4B3T I;  2L92 A;  2MC6 A;  2CGE A;  2CZ9 A;  1USU A;  1Z0W A;  3ZZ0 A;  3LNU A;  4FW9 A;  4B3M I;  1H7S A;  4AQY I;  1X47 A;  3H4L A;  1N33 E;  4UT4 A;  4GEQ B;  4P7A A;  4DV7 I;  4DUY E;  4LF9 I;  2FV4 B;  4DV0 I;  1RR9 A;  3ADI A;  2IOQ A;  1DI2 A;  2B9D A;  4JI2 E;  4Z7C A;  2F4V I;  1ZBQ A;  2JR1 A;  4DV1 I;  1XNR E;  1RRE A;  1ZM9 A;  4LF5 E;  4DPY A;  1KKH A;  4DPX A;  2EWL A;  4F9A B;  3PYG A;  1NZ0 A;  1YYW A;  2V87 A;  4JI0 I;  3J80 Q;  4LU9 A;  4B3T E;  4GKK I;  1ZM3 A;  4DPT A;  4X64 I;  4JI8 E;  1WHN A;  5GME A;  2B7V A;  4B3M E;  3F0N A;  2ZIT A;  4AQY E;  2L33 A;  2DMY A;  1FJG I;  1KIJ A;  2BM0 A;  3LTO A;  4IZJ B;  4DV7 E;  4LF9 E;  2N3H A;  4K0K E;  1H7U A;  4LTY A;  5LMU E;  3K85 A;  1T4L B;  2ZM6 I;  1QZR A;  2NUE A;  4USK A;  1ZM2 A;  3P06 A;  2F4V E;  4DR1 I;  3ADJ A;  3HQ1 A;  4DV1 E;  1U2R A;  1I94 E;  1Z0C A;  3OTO I;  2Z5C B;  3ZM7 A;  2V86 A;  3B8H A;  4XTJ A;  1S16 A;  3AV0 A;  4X66 I;  2LTS A;  4FWH A;  1UEK A;  2CPN A;  4LF6 E;  3K6Q A;  1Z59 A;  3T1Y I;  2R3V A;  3HUL A;  1Y6Z A;  1FJG E;  4P52 A;  4M0V A;  4LFB E;  2OI2 A;  4B3S E;  4JI6 E;  1EI1 A;  2ZM6 E;  1DAR A;  3JTZ A;  1ZBT A;  4NXN I;  2LUP B;  2JY9 A;  2X7I A;  1PKP A;  5A2Q Q;  4IZJ D;  3MSW A;  2CG9 A;  3OTO E;  1MG7 A;  4M1K A;  2UXC E;  1Z5B A;  2RS7 A;  1Z0B A;  1HNX E;  3J80 C;  2DSY A;  2HHH E;  2UU9 I;  4X66 E;  3Q6M A;  2JOX A;  4F9B B;  2E1R A;  3WU4 A;  4JYA E;  4JG4 A;  4JV5 I;  1XHK A;  1H74 A;  2DEJ A;  2HK3 A;  1N33 I;  2UXB I;  1FWK A;  2LE2 A;  1BKN A;  1OJ4 A;  4MYU A;  3B82 A;  3ZKB A;  1N0V C;  5BR8 I;  1GQE A;  1YYK A;  4LF5 I;  2X36 A;  3HPZ A;  4YY3 E;  1HNZ I;  4DMI A;  3PYE A;  2V88 A;  2M1S A;  4LFA E;  4JI3 E;  1Y4U A;  2UU9 E;  1D6T A;  3DJW A;  4KZS A;  2VF1 A;  5DNY A;  4DPU A;  4LF4 E;  5AE2 A;  3P1X A;  1B63 A;  2JOB A;  4JI8 I;  4DV6 I;  4JI7 E;  4DPW A;  2V85 A;  3IWC A;  4JV5 E;  2PNM A;  2UXB E;  3B78 A;  1KVK A;  5AE1 A;  4PU9 A;  4K0K I;  1FWL A;  3K17 A;  4X62 I;  5LMU I;  4DR2 E;  2B7T A;  4DV3 E;  2UUC I;  4URL A;  5ADZ A;  4OOG C;  2H36 X;  2IHR 1;  5BR8 E;  2JVA A;  5A2Q C;  1I94 I;  4WSP A;  2NPF A;  3IWD A;  5T6J A;  4RPF A;  4DV4 I;  1HNZ E;  4FWD A;  1SR9 A;  1S4E A;  4DU8 A;  1HK7 A;  4MYT A;  2UXD E;  3AUZ A;  3F6G A;  2BM1 A;  5GMD A;  4IZJ A;  2O1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...