4DV3E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv3E02
4JI8E 1H7SA 5FLXQ 3J7AM 2LBSB 3K17A 4MYUA 2BV3A 5CFFE 1IBKI 4DV6I 4DR4I 1T4LB 2B7TA 1RREA 5IT9C 1EA6A 2N3HA 2JVAA 4PRVA 1NHHA 3ZKDA 4JYAE 2UUCI 2R3VA 1Z0EA 3B8HA 2NUEA 2HHHI 4B3MI 4DR5E 1WUUA 1FWLA 4JI3I 3QT5A 1STUA 1HNXE 4LFCI 4DR2I 2NUGA 3HTXA 3ZZTA 4NXMI 1K47A 5LMUI 2NA2A 1HNWE 3HULA 2L2MA 1XNRI 2E5LI 1N36E 3V5RA 1ZBTA 1Z0BA 1QU6A 2V34A 4YY3I 4DUYI 1YYWA 1UHZA 2DB2A 2CZ9A 1NHIA 4DV4I 4JI6I 4DUZE 1B63A 2V2QA 1S4EA 1O0WA 4K0KI 1KKHA 2NUFA 2X7IA 1IBKE 4DR4E 4B3RI 2L3CA 1KIJA 4LF4I 2L2KB 3ZKBA 2ZITA 2HKEA 2VQEI 4DU8A 1WHQA 2ZBKB 4JI7I 2UU9E 1GQEA 4X64I 4WUDA 1ZM3A 4LFBI 2N3GA 1A6FA 1BKNA 1Z5BA 2UUCE 4R1FA 1NZ0A 3WU4A 4B3ME 2HHHE 2HFUA 4JI3E 2CPNA 4FN5A 4HACA 2VQFI 1ZXNA 1Z5AA 3T1YE 4LFCE 4DR2E 2HK3A 1T4OA 1OJ4A 4NXME 5LMUE 4DR7I 1B62A 1XNRE 2UUBE 5LMNE 2E5LE 2DEJA 3QT7A 4DUYE 4YY3E 3B82A 4DV4E 1HR0I 4JI6E 3GONA 1X48A 2OI2A 2RTXA 3V2UC 4DKKA 4AQYI 4LF8I 1FWKA 1YYOA 1UEKA 4K0KE 2JY9A 4P7AA 1DI2A 2LUPB 2X36A 4WYQB 2B3TB 4M30A 4JI0I 4JV5I 4B3RE 3OTOI 4LF4E 4DR6E 2L2NA 1H72C 4WUCA 4FWHA 2UXDI 2A2CA 4URLA 2VQEE 1Z0VA 2V2VA 2V8PA 4X65I 3T1HI 4JI7E 3VYYA 4FWDA 4X64E 4JI5I 4LFBE 4USMA 1ZM9A 3J81Q 5A2QC 3ADJA 1YZ9A 4HXZA 2IHR1 4DV3E 3ADGA 3K1JA 1XMQI 1X49A 1J26A 2UXBE 2ZM6I 1IBME 1VISA 3WU6A 4JI4I 5L3JA 4OX9I 1N32I 1N34I 2LJPA 3QT6A 4I3HA 5IWAI 3WU3A 3J80Q 4LF7I 4DV1I 3ADLA 4DPUA 1UILA 3B78A 4B3TI 1N33I 4X66I 2BM1A 1HR0E 1J5EI 1PVGA 1DARA 4GKJI 4DU7A 3QT8A 2YT4A 4LF8E 4AQYE 4HYMA 4M2ZA 4DR3I 4UTGA 4DV6E 4JI0E 4JV5E 3PYEA 1MU5A 4DV5I 3OTOE 1XMOI 4Z7YA 4DPTA 2L3JA 4UT4A 2UXDE 1FNMA 3Q1QA 1MG7A 3T1HE 4X65E 1MX0A 4DR1I 2J7KA 3PYGA 1D6TA 4JI5E 4JI2I 4LFAI 1Z0GA 2DMYA 4USKA 2RS6A 1Z0TA 1EKZA 1H74A 2LUQA 5IT9Q 4FW9A 1N0VC 3H4LA 2BM0A 3LNUA 4JI1I 1XMQE 1ZM4A 1HNZI 2ZM6E 1Z0CA 1ZM2A 1RC7A 4DV7I 4JI4E 1N32E 1N34E 5IWAE 5A2QQ 4LF7E 4DV1E 2B7VA 1FJGI 4DXLA 4B3TE 1N33E 1U2RA 2E1RA 1T4NA 4X66E 1FKAE 2F4VI 2MDRA 1J5EE 4DV0I 4ZVIA 3F0NA 1S16A 4GKJE 1XNQI 1X47A 2EZ6A 3ZM7A 4GKKI 3ZZ0A 4KQVA 1PKPA 4DR3E 2AJ4A 4MYTA 4PRXA 4DV5E 1XMOE 1NHJA 1Z5CA 1QZRA 4Z7CA 3JAMC 4LF9I 2RS7A 1IBLI 1Z59A 3C4TA 2EFGA 1WHNA 4DR1E 4JI2E 4LFAE 4DPWA 2RSMA 4X62I 2UXCI 4HY1A 2UUAI 1RR9A 3P1XA 5GMEA 3ADIA 3J7Yp 2VQFE 4JI1E 4DPXA 4DV2I 1HNZE 4YHHI 1PIEA 5GMDA 2UU9I 5BR8I 4DV7E 2V2ZA 4DR7E 1ZXMA 3D4JA 1H73A 1I94I 3CWVA 1FJGE 4OOGC 2LJHA 2F4VE 2A2DA 2LRSA 3T1YI 4DV0E 3VYXA 2L33A 1EI1A 1XNQE 2HKJA 4LF5I 5FLXC 4X8WA 4GKKE 4LF6I 4JG4A 4KHPI 2WW4A 2UUBI 5LL6R 5LMNI 1H7UA 4B3SI 4NXNI 2VF3A 4RPFA 4LF9E 1IBLE 3LTOA 4JI8I 4M1KA 1Z0WA 4WUBA 1YYKA 4X62E 2UXCE 2HK2A 2LTSA 4DPYA 2HFSA 3J81C 4DR6I 2UUAE 3JAMQ 3J7AG 4FWGA 3LLHA 2DIXA 3ZZUA 4DV2E 4YHHE 1KTVA 2NPFA 1RQ0A 5BR8E 4EMDA 4OX9E 2Q2EB 4JYAI 2LTRA 3C4BA 3PYFA 4PU9A 3PYDA 1I94E 3J80C 4DR5I 4P52A 4WFTA 1KVKA 1FI4A 4DV3I 3LPSA 2DEIA 1HNXI 1XHKA 3WU5A 2UXBI 2KHXA 1N0UA 1IBMI 4LF5E 2R42A 2XEXA 1HNWI 4HACB 4LF6E 4ED4A 1ELOA 3M6AA 4KHPE 1N36I 2GS8A 4B3SE 4NXNE 4DUZI 4XTJA
chains in the Genus database with same CATH superfamily
4J8ZA 5A69A 2EOFA 5KL5A 2RPCA 2YRKA 4F2JC 4JI8E 2O1UA 1H7SA 5FLXQ 4LCHA 3J7AM 2LBSB 4RH8A 3K17A 4MYUA 1IQSA 3KZZA 2BV3A 2BA1G 5CFFE 2EORA 4DV4I 1IBKI 3BF2A 1MEYC 4DV6I 5IV8B 4DR4I 4IFDD 2EQ0A 2CGEA 2I13A 2LT7A 4IZKA 2BR2B 3UHMA 1T4LB 2B7TA 4P78A 1RREA 5IT9C 1EA6A 2EP3A 2N3HA 2V86A 3ECRA 1RHYA 2NN6C 2YTEA 2CG9A 2F1DA 1X3CA 3EQ1A 4R2DA 3EPLA 1T38A 1A1LA 2JVAA 1F2IG 4OO1E 3OMLA 2PNZA 4PRVA 2EM0A 2EPPA 1NHHA 1PJSA 2BBGA 2EM5A 1G2DC 3ZKDA 4JYAE 3F6HA 2UUCI 2JYAA 2JEAB 2EPRA 5JEAC 2R3VA 3NZKA 1Z0EA 3B8HA 2NUEA 2HHHI 4B3MI 4DR5E 1WUUA 4OO1C 1FWLA 1L4SA 4JI3I 4F6MA 2PO1A 3QT5A 1E3HA 3DJWA 1STUA 2EOEA 1KJKA 1HNXE 4LFCI 2EL6A 2EMYA 4MU4A 4DR2I 2YSOA 4ZYDA 2NUGA 3HTXA 3L7ZA 2ENAA 3ZZTA 2GO4A 5EL9A 3CDJA 4NXMI 4IZJB 3IWDA 1K47A 1WXRA 4HTGA 5A6JA 2NA2A 2JEBA 5DRPA 1HNWE 5LMUI 4FW6A 2J7JA 1DQ3A 3HULA 2KOUA 2EN4A 2L2MA 1XNRI 2Z5CB 3KZYA 2LCEA 4R03A 2E5LI 4OZEA 5C0XB 1N36E 3V5RA 1ZBTA 1Z0BA 1QU6A 2V34A 4YY3I 4DUYI 1YYWA 1UHZA 2DB2A 2V87A 1NHIA 2CVEA 2CZ9A 1N3GA 2JWOA 3K6QA 5C0XF 2JR1A 4DUZE 4N3OA 4NZVA 1B63A 1RMDA 4BMJA 5C0XD 4KZSA 1NCSA 1EH8A 2V2QA 3P3GA 2EE8A 2G7HA 1S4EA 2YZTA 1O0WA 4IFDC 4K0KI 2EN3A 1KKHA 2NUFA 1HK7A 5AC5A 1Y6ZA 2EPXA 3DD6A 5K36B 4F9AB 2X7IA 4FW7A 1IBKE 2LVHA 4JI6I 4U3BA 4DR4E 4B3RI 2L3CA 1KIJA 2C37B 4AM3A 4LF4I 2L2KB 4P7DA 4M9VC 1AAYA 3ZKBA 4MLQA 2EOOA 2WCC3 5EKWA 2ZITA 2WBUA 2HKEA 3HKMA 2EPCA 2VQEI 2NN6B 1WHQA 1R6LA 4DU8A 2WNRA 2ZBKB 4JI7I 2NN6F 2PO0A 2K7IA 3HPSA 2UU9E 3CDIA 1GQEA 4X64I 1YPNA 4WUDA 1ZM3A 2NN6D 4LFBI 2YTJA 2N3GA 1A6FA 5TSEA 1BKNA 1Z5BA 2EN1A 4F9BB 1USUA 2UUCE 2YTGA 4QNJA 3U1KA 5JEAB 4R1FA 2N8XA 1NZ0A 5DNLA 3WU4A 2HHHE 4B3ME 5JEAF 2HFUA 1AH5A 4JI3E 2CPNA 2VRDA 3M7ND 4FN5A 5JEAD 4HACA 4R2EA 2VQFI 1ZXNA 1GTKA 1Z5AA 5AE3A 4F6NA 3T1YE 2PNLA 3Q6NA 4LFCE 4DR2E 5F3WA 1T4OA 2EPOA 2HK3A 2V85A 2WBTA 4OO1F 1OJ4A 3L00A 4NXME 4IS9A 4OO1D 5LMUE 2EQ1A 4BC7A 5KL6A 1B62A 3H1CA 4DR7I 2CT1A 4AIMA 2ODRC 1XNRE 4R2RA 2UUBE 5LMNE 2E5LE 4LCGA 4R2QA 2DGCA 2DEJA 3QT7A 4DUYE 4YY3E 3B82A 4DV4E 1HR0I 5AASA 4JI6E 1UDNA 3M85D 3GONA 2MC6A 1X48A 2OI2A 3P06A 4Q35B 2DRPA 4BBYA 2EM8A 4L8NA 1Y60A 4GQUA 2YTQA 2RTXA 4U3DA 3V2UC 4DKKA 1ZAAC 4R2CA 2BR2A 4AQYI 1FWKA 4LF8I 2LV2A 1YYOA 2R76A 4GEQB 1UDSA 4K0KE 1JK2A 2JY9A 1P42A 1UEKA 4P7AA 1DGCA 1WJPA 1DI2A 2GHFA 2EN8A 5KL7A 2PNMA 4MU0A 4IFDF 2LUPB 2X36A 1OYRA 4FW3A 4WYQB 2B3TB 4M30A 4JI0I 4JV5I 2MKDA 4B3RE 4AIDA 4MQYA 3OTOI 4LF4E 1X6FA 4DR6E 2L2NA 2V8QB 1H72C 4WUCA 4FWHA 1IMUA 4MLVA 2M9AA 2JEAA 2UXDI 2A2CA 1PDAA 3MSWA 4URLA 2EMAA 2VQEE 1Z0VA 2EL5A 2DMIA 3THOB 3VHTB 2V2VA 2V8PA 4X65I 3T1HI 1UBDC 2YTNA 4JI7E 3VYYA 4FWDA 4X64E 1OYPA 4JI5I 4LFBE 3Q6MA 2YRMA 1EH7A 1Z1BA 2J65A 4BCAA 3KWRA 4USMA 1ZM9A 4LPFA 3J81Q 2LMZA 3K85A 4FW4A 1TF3A 5A2QC 3ADJA 2A25A 1YZ9A 4IZJA 4HXZA 1BBGA 2IHR1 3P3EA 4TUGA 2GO3A 4DV3E 1PJTA 1YUJA 4DMIA 3FIGA 3ADGA 5T6JA 1A1GA 3K1JA 3GLLA 2Z5CA 1XMQI 1X49A 1J26A 2UXBE 5C0XA 2ZM6I 2EOJA 1IBME 1VISA 3WU6A 4JI4I 5L3JA 4OX9I 5A6AA 4BA2B 2YU5A 1N32I 1PJQA 4WXDA 1N34I 2C39B 2LJPA 3QT6A 4I3HA 5A6KA 5IWAI 3WU3A 2RSIA 1G2FC 3J80Q 4LF7I 3LMLA 4DV1I 3ADLA 4DPUA 4TUIA 2I9IA 1UILA 4ZYEA 4RHBB 2EOIA 3B78A 2EOMA 4B3TI 4X66I 2BM1A 1N33I 1WRJA 1R6MA 2JT2A 1HR0E 2ODRD 1J5EI 4O4KA 2BB8A 1PVGA 5K36A 2JE6B 1GZ6A 1DARA 2EOZA 4GKJI 4DU7A 3BBGA 2C37A 3F6GA 5DRRA 2FV4B 3QT8A 2R1FA 2YT4A 4LF8E 4AQYE 1A1IA 5DNXA 1X6EA 4BC9A 2Z5BB 5A6BA 4HYMA 1P47A 2EOXA 2NN6A 4M2ZA 4DR3I 2EPUA 1E3PA 3PS2A 3U1YA 2KONA 4UTGA 4DV6E 4JI0E 1EH6A 4JV5E 3PYEA 4L5NC 1MU5A 4FW5A 3OTOE 4DV5I 2WBSA 1XMOI 1IQOA 1LLMC 2IOQA 3GMEA 4Z7YA 2IESA 2L3JA 3RMPA 4DPTA 4UT4A 4LTYA 2UXDE 5JEAA 1FNMA 3Q1QA 1MG7A 1YHCA 3JTZA 3HQ1A 4X65E 3T1HE 1MX0A 4DR1I 1X6HA 2J7KA 2E1MA 1X5WA 3HJCA 3PYGA 2EM6A 3IWCA 5DRQA 2EOSA 1D6TA 2DSYA 4JI5E 4LCFA 2CTDA 2YTPA 2C38B 4JI2I 4LFAI 3HXLA 1Z0GA 2DMYA 3MHSC 4USKA 2FGGA 2RS6A 1Z0TA 2V83A 2EM7A 1EKZA 1H74A 4FK5C 2LUQA 1Y5YA 2D9HA 2EMXA 4BHBA 5LLQA 5IT9Q 3H09A 4FW9A 2L92A 1N0VC 3H4LA 4OO1B 2BM0A 3LNUA 4JI1I 1XMQE 2M4IA 1ZM4A 2HGHA 2LJUA 2BA0D 4QNKA 1HNZI 2ZM6E 2EMWA 1Z0CA 1ZM2A 2LE2A 4N4RB 2EMLA 2L6MA 5ADZA 1RC7A 4JI4E 4DV7I 5KL3A 2WP8B 1N32E 2EPKX 1N34E 2EPAA 1OYSA 3VK6A 2E72A 5IWAE 3GCMA 5A2QQ 4LF7E 4DV1E 2B7VA 1FJGI 4WSPA 4DXLA 1ZR9A 2YRHA 2BA1D 4B3TE 1N33E 1U2RA 2E1RA 1T4NA 4X66E 2PO2B 4IFDA 1FKAE 2F4VI 2MDRA 1J5EE 5DNYA 1KYQA 5C0XE 2EMHA 2YSPA 4DV0I 4ZVIA 3F0NA 2EMGA 3ZOQB 1S16A 4BA1B 1JK1A 4GKJE 3EPJA 4MU3A 1XNQI 2EMZA 1VI7A 1X47A 3MHHC 2EZ6A 1XXEA 3ZM7A 2IOPA 4GKKI 3ZZ0A 4O5GA 4KQVA 3M7NG 1MGTA 4HEIA 1PKPA 5DROA 4O43A 4DR3E 2EPMX 2HJJA 2AJ4A 1BB8A 4MYTA 5FWKA 3IWBA 4MDTA 2RQLA 3JU0A 4PRXA 5K36E 4DV5E 1XMOE 1NHJA 1Z5CA 1QZRA 4Z7CA 3JAMC 4LF9I 2RS7A 1IBLI 3DF6A 3PRYA 4BHCA 2FTXB 1Z59A 3AUZA 3C4TA 4IJDA 2EFGA 1WHNA 2Q8UA 4DR1E 1TN9A 2MC5A 2NN6E 2YPNA 4KWYA 4NBQA 4WSGA 1NEIA 5AE2A 5IXMB 2K4VA 4JI2E 4LFAE 4DPWA 2RSMA 4X62I 1YH8A 3M85G 2UXCI 4ZYGA 4HY1A 4NHRA 5K36C 1QNTA 2EMFA 4R8OA 5JEAE 1RR9A 2UUAI 3P1XA 2EPLX 4BA2A 3KRNA 5GMEA 2C39A 3ADIA 3P76A 3J7Yp 2VQFE 4JI1E 4R2AA 4X9JA 4WX9A 2Z5EA 4DPXA 4DV2I 1HNZE 4YHHI 1PIEA 5GMDA 2UU9I 5BR8I 4DV7E 1A1FA 4IZKB 2EM3A 2EN6A 1A1JA 2V2ZA 4DR7E 1ZXMA 3P3CA 3D4JA 4LU9A 2IERA 2JE6A 2VF1A 1H73A 4R2PA 1I94I 3EPHA 1BBOA 3CWVA 2YWQA 2M1SA 3QG5C 5AE1A 2GQ0A 1FJGE 3TQMA 2F8BA 3B4TA 2PNZB 4GZNC 4OOGC 2EMKA 2LJHA 1USVA 2F4VE 2A2DA 2LRSA 2Z5BA 3THNA 4LOMA 2JPAA 2YU8A 3T1YI 4R2SA 4DV0E 2JOXA 4BS9A 4ISAA 3VYXA 2JXPA 4WXCA 2L33A 1UN6B 1EI1A 1XNQE 5KL4A 2HKJA 2V89A 4LF5I 2EMIA 2DLQA 5FLXC 4X8WA 4GKKE 1A1HA 2HC5A 2VESA 2YTDA 2PO1B 4LF6I 2EM9A 3EPKA 4JG4A 4KHPI 4IFDE 2WW4A 2UUBI 5LL6R 2O1TA 2O3ZA 2PRTA 2M7QA 3HPZA 1H7UA 1Y4UA 3L7ZB 4IZJD 2GLIA 5LMNI 4B3SI 2O1WA 3M99B 4NXNI 1SFEA 2VF3A 2JEBB 4RPFA 2C38A 4Q28A 4LF9E 3C6MA 1IBLE 2L8TA 3LTOA 4JI8I 4M1KA 2EN7A 2EMBA 2H36X 4M0VA 3BIDA 2WZOA 2JOBA 2EJ4A 2NABA 2YTFA 1YFHA 1Z0WA 1TF6A 4WUBA 4OO1A 4F9CB 1YYKA 4X62E 2UXCE 1UDQA 2EOHA 2AE8A 2HK2A 2EQ3A 2LTSA 4DPYA 2HFSA 2EPZA 3J81C 5K36F 4DR6I 2UUAE 3JAMQ 4OKGA 2WP8A 3J7AG 2ENHA 2YTIA 2EMCA 5K36D 4ZYHA 4FWGA 3LLHA 2DIXA 4I8OA 5ELWA 3ZZUA 2YTOA 2O1VA 1T39A 4DV2E 3PS1A 2EL4A 4YHHE 1KTVA 2PO2A 1RQ0A 5KL2A 2NPFA 1SR9A 5BR8E 4EMDA 5AC4A 5A6BD 2B9DA 1YSAC 4OX9E 2Q2EB 4JYAI 1B69A 2LTRA 3BGHA 3C4BA 2EN2A 3PYFA 4PU9A 3PYDA 1Y4SA 1I94E 2WNRB 4BA1A 3PS3A 3J80C 4DR5I 4P52A 1YUIA 2PO0B 4WFTA 1KVKA 1FI4A 4DV3I 3LPSA 4IS1C 1ZBQA 2DEIA 2VE7C 2CSHA 2DLKA 2EM2A 2MDGA 2MKNA 2EWLA 1XHKA 1HNXI 2ELYA 3UK3C 2ADRA 2ELZA 3WU5A 2UXBI 2EOYA 2KHXA 1N0UA 1IBMI 1A1KA 2GPIA 3AV0A 4LF5E 2R42A 2XEXA 1HNWI 2EPNA 4HACB 4LF6E 4ED4A 2V88A 1ELOA 2EM4A 3M6AA 4WPYA 4KHPE 1UDOA 2LO3A 2EOQA 1N36I 5C0XC 2GS8A 3C6KA 4B3SE 2BA0G 4MU1A 4NXNE 4J3DA 4F54A 4IFDB 1ZU1A 2ENCA 2JP9A 4O24A 4DUZI 4XTJA
chains in the Genus database with same CATH topology
4J8ZA 4JI8E 2O1UA 1H7SA 5FLXQ 3J7AM 2LBSB 3K17A 4MYUA 2BV3A 5CFFE 1IBKI 4DV6I 4DR4I 2CGEA 4IZKA 1T4LB 2B7TA 4P78A 1RREA 5IT9C 1EA6A 2N3HA 2V86A 2CG9A 2JVAA 3OMLA 4PRVA 1NHHA 3ZKDA 4JYAE 3F6HA 2UUCI 2R3VA 1Z0EA 3B8HA 2NUEA 2HHHI 4B3MI 4DR5E 1WUUA 1FWLA 4JI3I 3QT5A 3DJWA 1STUA 1HNXE 4LFCI 4DR2I 2NUGA 3HTXA 3ZZTA 4NXMI 4IZJB 3IWDA 1K47A 1WXRA 5LMUI 2NA2A 1HNWE 1DQ3A 3HULA 2KOUA 2L2MA 1XNRI 2Z5CB 4R03A 2E5LI 1N36E 3V5RA 1ZBTA 1Z0BA 1QU6A 2V34A 4YY3I 4DUYI 1YYWA 1UHZA 2DB2A 2V87A 1NHIA 2CZ9A 4DV4I 4JI6I 2JWOA 3K6QA 2JR1A 4DUZE 4N3OA 1B63A 4BMJA 4KZSA 2V2QA 2G7HA 1S4EA 2YZTA 1O0WA 4K0KI 1KKHA 2NUFA 1HK7A 1Y6ZA 4F9AB 2X7IA 1IBKE 4DR4E 4B3RI 2L3CA 1KIJA 4LF4I 2L2KB 4P7DA 3ZKBA 2ZITA 2HKEA 2VQEI 4DU8A 1WHQA 2ZBKB 4JI7I 3HPSA 2UU9E 1GQEA 4X64I 4WUDA 1ZM3A 4LFBI 2N3GA 1A6FA 1BKNA 1Z5BA 4F9BB 1USUA 2UUCE 4R1FA 1NZ0A 3WU4A 4B3ME 2HHHE 2HFUA 4JI3E 2CPNA 4FN5A 4HACA 2VQFI 1ZXNA 2PNLA 1Z5AA 5AE3A 3Q6NA 3T1YE 4LFCE 4DR2E 5F3WA 1T4OA 2HK3A 2V85A 1OJ4A 4NXME 5LMUE 4BC7A 4DR7I 1B62A 2ODRC 1XNRE 2UUBE 5LMNE 2E5LE 2DEJA 3QT7A 4DUYE 4YY3E 3B82A 4DV4E 1HR0I 5AASA 4JI6E 3GONA 2MC6A 1X48A 2OI2A 3P06A 4BBYA 4L8NA 2RTXA 3V2UC 4DKKA 4AQYI 4LF8I 1FWKA 1YYOA 4GEQB 1UEKA 4K0KE 2JY9A 4P7AA 1DI2A 2PNMA 2LUPB 2X36A 4WYQB 2B3TB 4M30A 4JI0I 4JV5I 4B3RE 3OTOI 4LF4E 4DR6E 2L2NA 2V8QB 1H72C 4WUCA 4FWHA 2UXDI 2A2CA 4URLA 3MSWA 2VQEE 1Z0VA 2V2VA 2V8PA 4X65I 3T1HI 4JI7E 3VYYA 4FWDA 4X64E 4JI5I 4LFBE 3Q6MA 4BCAA 3KWRA 4USMA 1ZM9A 3J81Q 2LMZA 3K85A 5A2QC 3ADJA 1YZ9A 4IZJA 4HXZA 2IHR1 4TUGA 4DV3E 4DMIA 3FIGA 3ADGA 5T6JA 3K1JA 1XMQI 2Z5CA 1X49A 1J26A 2UXBE 2ZM6I 1IBME 1VISA 3WU6A 4JI4I 5L3JA 4OX9I 1N32I 1N34I 2LJPA 3QT6A 4I3HA 5IWAI 3WU3A 3J80Q 4LF7I 3LMLA 4DV1I 3ADLA 4DPUA 4TUIA 1UILA 3B78A 4B3TI 1N33I 4X66I 2BM1A 1HR0E 2ODRD 1J5EI 1PVGA 1GZ6A 1DARA 4GKJI 4DU7A 3F6GA 2FV4B 3QT8A 2YT4A 4LF8E 4AQYE 4BC9A 2Z5BB 4HYMA 4M2ZA 4DR3I 2KONA 4UTGA 4DV6E 4JI0E 4JV5E 3PYEA 4L5NC 1MU5A 4DV5I 3OTOE 1XMOI 2IOQA 4Z7YA 4DPTA 2L3JA 3RMPA 4UT4A 4LTYA 2UXDE 1FNMA 3Q1QA 1MG7A 3JTZA 3HQ1A 4X65E 3T1HE 1MX0A 4DR1I 2J7KA 2E1MA 3HJCA 3PYGA 3IWCA 1D6TA 2DSYA 4JI5E 4JI2I 4LFAI 3HXLA 1Z0GA 2DMYA 4USKA 2FGGA 2RS6A 1Z0TA 2V83A 1EKZA 1H74A 2LUQA 5IT9Q 3H09A 4FW9A 2L92A 1N0VC 3H4LA 2BM0A 3LNUA 4JI1I 1XMQE 2M4IA 1ZM4A 1HNZI 2ZM6E 1Z0CA 1ZM2A 2LE2A 2L6MA 1RC7A 5ADZA 4DV7I 4JI4E 1N32E 1N34E 3VK6A 5IWAE 5A2QQ 4LF7E 4DV1E 2B7VA 1FJGI 4WSPA 4DXLA 4B3TE 1N33E 1U2RA 2E1RA 1T4NA 4X66E 1FKAE 2F4VI 2MDRA 1J5EE 5DNYA 4DV0I 4ZVIA 3F0NA 3ZOQB 1S16A 4GKJE 1XNQI 1X47A 2EZ6A 3ZM7A 2IOPA 4GKKI 3ZZ0A 4KQVA 1PKPA 4DR3E 2AJ4A 4MYTA 5FWKA 3IWBA 3JU0A 4PRXA 4DV5E 1XMOE 1NHJA 1Z5CA 1QZRA 4Z7CA 3JAMC 4LF9I 2RS7A 1IBLI 3DF6A 3PRYA 2FTXB 1Z59A 3AUZA 3C4TA 2EFGA 1WHNA 4DR1E 2MC5A 5AE2A 4JI2E 2K4VA 4LFAE 4DPWA 2RSMA 4X62I 2UXCI 4HY1A 4R8OA 2UUAI 1RR9A 3P1XA 5GMEA 3ADIA 3J7Yp 2VQFE 4JI1E 2Z5EA 4DPXA 4DV2I 1HNZE 4YHHI 1PIEA 5GMDA 2UU9I 5BR8I 4DV7E 4IZKB 2V2ZA 4DR7E 1ZXMA 3D4JA 4LU9A 2VF1A 1H73A 1I94I 3CWVA 2M1SA 5AE1A 2GQ0A 1FJGE 2F8BA 4OOGC 2LJHA 1USVA 2F4VE 2A2DA 2LRSA 2Z5BA 3T1YI 4DV0E 2JOXA 4BS9A 3VYXA 2L33A 1EI1A 1XNQE 2HKJA 2V89A 4LF5I 5FLXC 4X8WA 4GKKE 4LF6I 4JG4A 4KHPI 2WW4A 2UUBI 5LL6R 2O1TA 4IZJD 5LMNI 2M7QA 3HPZA 1H7UA 1Y4UA 4B3SI 2O1WA 4NXNI 2VF3A 4RPFA 4Q28A 4LF9E 1IBLE 2L8TA 3LTOA 4JI8I 4M1KA 4M0VA 2H36X 2WZOA 2JOBA 1Z0WA 4WUBA 4F9CB 1YYKA 2UXCE 4X62E 2HK2A 2LTSA 4DPYA 2HFSA 3J81C 4DR6I 2UUAE 3JAMQ 3J7AG 4FWGA 3LLHA 2DIXA 4I8OA 3ZZUA 2O1VA 4DV2E 4YHHE 1KTVA 2NPFA 1RQ0A 1SR9A 5BR8E 4EMDA 2B9DA 4OX9E 2Q2EB 4JYAI 2LTRA 3C4BA 3PYFA 4PU9A 3PYDA 1Y4SA 1I94E 3J80C 4DR5I 4P52A 4WFTA 1KVKA 1FI4A 4DV3I 3LPSA 1ZBQA 2DEIA 2VE7C 1HNXI 1XHKA 2EWLA 3WU5A 2UXBI 2KHXA 1N0UA 1IBMI 3AV0A 4LF5E 2R42A 2XEXA 1HNWI 4HACB 4LF6E 4ED4A 2V88A 1ELOA 3M6AA 4WPYA 4KHPE 1N36I 2GS8A 4B3SE 4NXNE 4F54A 4DUZI 4XTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 E;  1H7S A;  5FLX Q;  3J7A M;  2LBS B;  3K17 A;  4MYU A;  2BV3 A;  5CFF E;  1IBK I;  4DV6 I;  4DR4 I;  1T4L B;  2B7T A;  1RRE A;  5IT9 C;  1EA6 A;  2N3H A;  2JVA A;  4PRV A;  1NHH A;  3ZKD A;  4JYA E;  2UUC I;  2R3V A;  1Z0E A;  3B8H A;  2NUE A;  2HHH I;  4B3M I;  4DR5 E;  1WUU A;  1FWL A;  4JI3 I;  3QT5 A;  1STU A;  1HNX E;  4LFC I;  4DR2 I;  2NUG A;  3HTX A;  3ZZT A;  4NXM I;  1K47 A;  5LMU I;  2NA2 A;  1HNW E;  3HUL A;  2L2M A;  1XNR I;  2E5L I;  1N36 E;  3V5R A;  1ZBT A;  1Z0B A;  1QU6 A;  2V34 A;  4YY3 I;  4DUY I;  1YYW A;  1UHZ A;  2DB2 A;  2CZ9 A;  1NHI A;  4DV4 I;  4JI6 I;  4DUZ E;  1B63 A;  2V2Q A;  1S4E A;  1O0W A;  4K0K I;  1KKH A;  2NUF A;  2X7I A;  1IBK E;  4DR4 E;  4B3R I;  2L3C A;  1KIJ A;  4LF4 I;  2L2K B;  3ZKB A;  2ZIT A;  2HKE A;  2VQE I;  4DU8 A;  1WHQ A;  2ZBK B;  4JI7 I;  2UU9 E;  1GQE A;  4X64 I;  4WUD A;  1ZM3 A;  4LFB I;  2N3G A;  1A6F A;  1BKN A;  1Z5B A;  2UUC E;  4R1F A;  1NZ0 A;  3WU4 A;  4B3M E;  2HHH E;  2HFU A;  4JI3 E;  2CPN A;  4FN5 A;  4HAC A;  2VQF I;  1ZXN A;  1Z5A A;  3T1Y E;  4LFC E;  4DR2 E;  2HK3 A;  1T4O A;  1OJ4 A;  4NXM E;  5LMU E;  4DR7 I;  1B62 A;  1XNR E;  2UUB E;  5LMN E;  2E5L E;  2DEJ A;  3QT7 A;  4DUY E;  4YY3 E;  3B82 A;  4DV4 E;  1HR0 I;  4JI6 E;  3GON A;  1X48 A;  2OI2 A;  2RTX A;  3V2U C;  4DKK A;  4AQY I;  4LF8 I;  1FWK A;  1YYO A;  1UEK A;  4K0K E;  2JY9 A;  4P7A A;  1DI2 A;  2LUP B;  2X36 A;  4WYQ B;  2B3T B;  4M30 A;  4JI0 I;  4JV5 I;  4B3R E;  3OTO I;  4LF4 E;  4DR6 E;  2L2N A;  1H72 C;  4WUC A;  4FWH A;  2UXD I;  2A2C A;  4URL A;  2VQE E;  1Z0V A;  2V2V A;  2V8P A;  4X65 I;  3T1H I;  4JI7 E;  3VYY A;  4FWD A;  4X64 E;  4JI5 I;  4LFB E;  4USM A;  1ZM9 A;  3J81 Q;  5A2Q C;  3ADJ A;  1YZ9 A;  4HXZ A;  2IHR 1;  4DV3 E;  3ADG A;  3K1J A;  1XMQ I;  1X49 A;  1J26 A;  2UXB E;  2ZM6 I;  1IBM E;  1VIS A;  3WU6 A;  4JI4 I;  5L3J A;  4OX9 I;  1N32 I;  1N34 I;  2LJP A;  3QT6 A;  4I3H A;  5IWA I;  3WU3 A;  3J80 Q;  4LF7 I;  4DV1 I;  3ADL A;  4DPU A;  1UIL A;  3B78 A;  4B3T I;  1N33 I;  4X66 I;  2BM1 A;  1HR0 E;  1J5E I;  1PVG A;  1DAR A;  4GKJ I;  4DU7 A;  3QT8 A;  2YT4 A;  4LF8 E;  4AQY E;  4HYM A;  4M2Z A;  4DR3 I;  4UTG A;  4DV6 E;  4JI0 E;  4JV5 E;  3PYE A;  1MU5 A;  4DV5 I;  3OTO E;  1XMO I;  4Z7Y A;  4DPT A;  2L3J A;  4UT4 A;  2UXD E;  1FNM A;  3Q1Q A;  1MG7 A;  3T1H E;  4X65 E;  1MX0 A;  4DR1 I;  2J7K A;  3PYG A;  1D6T A;  4JI5 E;  4JI2 I;  4LFA I;  1Z0G A;  2DMY A;  4USK A;  2RS6 A;  1Z0T A;  1EKZ A;  1H74 A;  2LUQ A;  5IT9 Q;  4FW9 A;  1N0V C;  3H4L A;  2BM0 A;  3LNU A;  4JI1 I;  1XMQ E;  1ZM4 A;  1HNZ I;  2ZM6 E;  1Z0C A;  1ZM2 A;  1RC7 A;  4DV7 I;  4JI4 E;  1N32 E;  1N34 E;  5IWA E;  5A2Q Q;  4LF7 E;  4DV1 E;  2B7V A;  1FJG I;  4DXL A;  4B3T E;  1N33 E;  1U2R A;  2E1R A;  1T4N A;  4X66 E;  1FKA E;  2F4V I;  2MDR A;  1J5E E;  4DV0 I;  4ZVI A;  3F0N A;  1S16 A;  4GKJ E;  1XNQ I;  1X47 A;  2EZ6 A;  3ZM7 A;  4GKK I;  3ZZ0 A;  4KQV A;  1PKP A;  4DR3 E;  2AJ4 A;  4MYT A;  4PRX A;  4DV5 E;  1XMO E;  1NHJ A;  1Z5C A;  1QZR A;  4Z7C A;  3JAM C;  4LF9 I;  2RS7 A;  1IBL I;  1Z59 A;  3C4T A;  2EFG A;  1WHN A;  4DR1 E;  4JI2 E;  4LFA E;  4DPW A;  2RSM A;  4X62 I;  2UXC I;  4HY1 A;  2UUA I;  1RR9 A;  3P1X A;  5GME A;  3ADI A;  3J7Y p;  2VQF E;  4JI1 E;  4DPX A;  4DV2 I;  1HNZ E;  4YHH I;  1PIE A;  5GMD A;  2UU9 I;  5BR8 I;  4DV7 E;  2V2Z A;  4DR7 E;  1ZXM A;  3D4J A;  1H73 A;  1I94 I;  3CWV A;  1FJG E;  4OOG C;  2LJH A;  2F4V E;  2A2D A;  2LRS A;  3T1Y I;  4DV0 E;  3VYX A;  2L33 A;  1EI1 A;  1XNQ E;  2HKJ A;  4LF5 I;  5FLX C;  4X8W A;  4GKK E;  4LF6 I;  4JG4 A;  4KHP I;  2WW4 A;  2UUB I;  5LL6 R;  5LMN I;  1H7U A;  4B3S I;  4NXN I;  2VF3 A;  4RPF A;  4LF9 E;  1IBL E;  3LTO A;  4JI8 I;  4M1K A;  1Z0W A;  4WUB A;  1YYK A;  4X62 E;  2UXC E;  2HK2 A;  2LTS A;  4DPY A;  2HFS A;  3J81 C;  4DR6 I;  2UUA E;  3JAM Q;  3J7A G;  4FWG A;  3LLH A;  2DIX A;  3ZZU A;  4DV2 E;  4YHH E;  1KTV A;  2NPF A;  1RQ0 A;  5BR8 E;  4EMD A;  4OX9 E;  2Q2E B;  4JYA I;  2LTR A;  3C4B A;  3PYF A;  4PU9 A;  3PYD A;  1I94 E;  3J80 C;  4DR5 I;  4P52 A;  4WFT A;  1KVK A;  1FI4 A;  4DV3 I;  3LPS A;  2DEI A;  1HNX I;  1XHK A;  3WU5 A;  2UXB I;  2KHX A;  1N0U A;  1IBM I;  4LF5 E;  2R42 A;  2XEX A;  1HNW I;  4HAC B;  4LF6 E;  4ED4 A;  1ELO A;  3M6A A;  4KHP E;  1N36 I;  2GS8 A;  4B3S E;  4NXN E;  4DUZ I;  4XTJ A; 
#chains in the Genus database with same CATH topology
 4J8Z A;  5A69 A;  2EOF A;  5KL5 A;  2RPC A;  2YRK A;  4F2J C;  4JI8 E;  2O1U A;  1H7S A;  5FLX Q;  4LCH A;  3J7A M;  2LBS B;  4RH8 A;  3K17 A;  4MYU A;  1IQS A;  3KZZ A;  2BV3 A;  2BA1 G;  5CFF E;  2EOR A;  4DV4 I;  1IBK I;  3BF2 A;  1MEY C;  4DV6 I;  5IV8 B;  4DR4 I;  4IFD D;  2EQ0 A;  2CGE A;  2I13 A;  2LT7 A;  4IZK A;  2BR2 B;  3UHM A;  1T4L B;  2B7T A;  4P78 A;  1RRE A;  5IT9 C;  1EA6 A;  2EP3 A;  2N3H A;  2V86 A;  3ECR A;  1RHY A;  2NN6 C;  2YTE A;  2CG9 A;  2F1D A;  1X3C A;  3EQ1 A;  4R2D A;  3EPL A;  1T38 A;  1A1L A;  2JVA A;  1F2I G;  4OO1 E;  3OML A;  2PNZ A;  4PRV A;  2EM0 A;  2EPP A;  1NHH A;  1PJS A;  2BBG A;  2EM5 A;  1G2D C;  3ZKD A;  4JYA E;  3F6H A;  2UUC I;  2JYA A;  2JEA B;  2EPR A;  5JEA C;  2R3V A;  3NZK A;  1Z0E A;  3B8H A;  2NUE A;  2HHH I;  4B3M I;  4DR5 E;  1WUU A;  4OO1 C;  1FWL A;  1L4S A;  4JI3 I;  4F6M A;  2PO1 A;  3QT5 A;  1E3H A;  3DJW A;  1STU A;  2EOE A;  1KJK A;  1HNX E;  4LFC I;  2EL6 A;  2EMY A;  4MU4 A;  4DR2 I;  2YSO A;  4ZYD A;  2NUG A;  3HTX A;  3L7Z A;  2ENA A;  3ZZT A;  2GO4 A;  5EL9 A;  3CDJ A;  4NXM I;  4IZJ B;  3IWD A;  1K47 A;  1WXR A;  4HTG A;  5A6J A;  2NA2 A;  2JEB A;  5DRP A;  1HNW E;  5LMU I;  4FW6 A;  2J7J A;  1DQ3 A;  3HUL A;  2KOU A;  2EN4 A;  2L2M A;  1XNR I;  2Z5C B;  3KZY A;  2LCE A;  4R03 A;  2E5L I;  4OZE A;  5C0X B;  1N36 E;  3V5R A;  1ZBT A;  1Z0B A;  1QU6 A;  2V34 A;  4YY3 I;  4DUY I;  1YYW A;  1UHZ A;  2DB2 A;  2V87 A;  1NHI A;  2CVE A;  2CZ9 A;  1N3G A;  2JWO A;  3K6Q A;  5C0X F;  2JR1 A;  4DUZ E;  4N3O A;  4NZV A;  1B63 A;  1RMD A;  4BMJ A;  5C0X D;  4KZS A;  1NCS A;  1EH8 A;  2V2Q A;  3P3G A;  2EE8 A;  2G7H A;  1S4E A;  2YZT A;  1O0W A;  4IFD C;  4K0K I;  2EN3 A;  1KKH A;  2NUF A;  1HK7 A;  5AC5 A;  1Y6Z A;  2EPX A;  3DD6 A;  5K36 B;  4F9A B;  2X7I A;  4FW7 A;  1IBK E;  2LVH A;  4JI6 I;  4U3B A;  4DR4 E;  4B3R I;  2L3C A;  1KIJ A;  2C37 B;  4AM3 A;  4LF4 I;  2L2K B;  4P7D A;  4M9V C;  1AAY A;  3ZKB A;  4MLQ A;  2EOO A;  2WCC 3;  5EKW A;  2ZIT A;  2WBU A;  2HKE A;  3HKM A;  2EPC A;  2VQE I;  2NN6 B;  1WHQ A;  1R6L A;  4DU8 A;  2WNR A;  2ZBK B;  4JI7 I;  2NN6 F;  2PO0 A;  2K7I A;  3HPS A;  2UU9 E;  3CDI A;  1GQE A;  4X64 I;  1YPN A;  4WUD A;  1ZM3 A;  2NN6 D;  4LFB I;  2YTJ A;  2N3G A;  1A6F A;  5TSE A;  1BKN A;  1Z5B A;  2EN1 A;  4F9B B;  1USU A;  2UUC E;  2YTG A;  4QNJ A;  3U1K A;  5JEA B;  4R1F A;  2N8X A;  1NZ0 A;  5DNL A;  3WU4 A;  2HHH E;  4B3M E;  5JEA F;  2HFU A;  1AH5 A;  4JI3 E;  2CPN A;  2VRD A;  3M7N D;  4FN5 A;  5JEA D;  4HAC A;  4R2E A;  2VQF I;  1ZXN A;  1GTK A;  1Z5A A;  5AE3 A;  4F6N A;  3T1Y E;  2PNL A;  3Q6N A;  4LFC E;  4DR2 E;  5F3W A;  1T4O A;  2EPO A;  2HK3 A;  2V85 A;  2WBT A;  4OO1 F;  1OJ4 A;  3L00 A;  4NXM E;  4IS9 A;  4OO1 D;  5LMU E;  2EQ1 A;  4BC7 A;  5KL6 A;  1B62 A;  3H1C A;  4DR7 I;  2CT1 A;  4AIM A;  2ODR C;  1XNR E;  4R2R A;  2UUB E;  5LMN E;  2E5L E;  4LCG A;  4R2Q A;  2DGC A;  2DEJ A;  3QT7 A;  4DUY E;  4YY3 E;  3B82 A;  4DV4 E;  1HR0 I;  5AAS A;  4JI6 E;  1UDN A;  3M85 D;  3GON A;  2MC6 A;  1X48 A;  2OI2 A;  3P06 A;  4Q35 B;  2DRP A;  4BBY A;  2EM8 A;  4L8N A;  1Y60 A;  4GQU A;  2YTQ A;  2RTX A;  4U3D A;  3V2U C;  4DKK A;  1ZAA C;  4R2C A;  2BR2 A;  4AQY I;  1FWK A;  4LF8 I;  2LV2 A;  1YYO A;  2R76 A;  4GEQ B;  1UDS A;  4K0K E;  1JK2 A;  2JY9 A;  1P42 A;  1UEK A;  4P7A A;  1DGC A;  1WJP A;  1DI2 A;  2GHF A;  2EN8 A;  5KL7 A;  2PNM A;  4MU0 A;  4IFD F;  2LUP B;  2X36 A;  1OYR A;  4FW3 A;  4WYQ B;  2B3T B;  4M30 A;  4JI0 I;  4JV5 I;  2MKD A;  4B3R E;  4AID A;  4MQY A;  3OTO I;  4LF4 E;  1X6F A;  4DR6 E;  2L2N A;  2V8Q B;  1H72 C;  4WUC A;  4FWH A;  1IMU A;  4MLV A;  2M9A A;  2JEA A;  2UXD I;  2A2C A;  1PDA A;  3MSW A;  4URL A;  2EMA A;  2VQE E;  1Z0V A;  2EL5 A;  2DMI A;  3THO B;  3VHT B;  2V2V A;  2V8P A;  4X65 I;  3T1H I;  1UBD C;  2YTN A;  4JI7 E;  3VYY A;  4FWD A;  4X64 E;  1OYP A;  4JI5 I;  4LFB E;  3Q6M A;  2YRM A;  1EH7 A;  1Z1B A;  2J65 A;  4BCA A;  3KWR A;  4USM A;  1ZM9 A;  4LPF A;  3J81 Q;  2LMZ A;  3K85 A;  4FW4 A;  1TF3 A;  5A2Q C;  3ADJ A;  2A25 A;  1YZ9 A;  4IZJ A;  4HXZ A;  1BBG A;  2IHR 1;  3P3E A;  4TUG A;  2GO3 A;  4DV3 E;  1PJT A;  1YUJ A;  4DMI A;  3FIG A;  3ADG A;  5T6J A;  1A1G A;  3K1J A;  3GLL A;  2Z5C A;  1XMQ I;  1X49 A;  1J26 A;  2UXB E;  5C0X A;  2ZM6 I;  2EOJ A;  1IBM E;  1VIS A;  3WU6 A;  4JI4 I;  5L3J A;  4OX9 I;  5A6A A;  4BA2 B;  2YU5 A;  1N32 I;  1PJQ A;  4WXD A;  1N34 I;  2C39 B;  2LJP A;  3QT6 A;  4I3H A;  5A6K A;  5IWA I;  3WU3 A;  2RSI A;  1G2F C;  3J80 Q;  4LF7 I;  3LML A;  4DV1 I;  3ADL A;  4DPU A;  4TUI A;  2I9I A;  1UIL A;  4ZYE A;  4RHB B;  2EOI A;  3B78 A;  2EOM A;  4B3T I;  4X66 I;  2BM1 A;  1N33 I;  1WRJ A;  1R6M A;  2JT2 A;  1HR0 E;  2ODR D;  1J5E I;  4O4K A;  2BB8 A;  1PVG A;  5K36 A;  2JE6 B;  1GZ6 A;  1DAR A;  2EOZ A;  4GKJ I;  4DU7 A;  3BBG A;  2C37 A;  3F6G A;  5DRR A;  2FV4 B;  3QT8 A;  2R1F A;  2YT4 A;  4LF8 E;  4AQY E;  1A1I A;  5DNX A;  1X6E A;  4BC9 A;  2Z5B B;  5A6B A;  4HYM A;  1P47 A;  2EOX A;  2NN6 A;  4M2Z A;  4DR3 I;  2EPU A;  1E3P A;  3PS2 A;  3U1Y A;  2KON A;  4UTG A;  4DV6 E;  4JI0 E;  1EH6 A;  4JV5 E;  3PYE A;  4L5N C;  1MU5 A;  4FW5 A;  3OTO E;  4DV5 I;  2WBS A;  1XMO I;  1IQO A;  1LLM C;  2IOQ A;  3GME A;  4Z7Y A;  2IES A;  2L3J A;  3RMP A;  4DPT A;  4UT4 A;  4LTY A;  2UXD E;  5JEA A;  1FNM A;  3Q1Q A;  1MG7 A;  1YHC A;  3JTZ A;  3HQ1 A;  4X65 E;  3T1H E;  1MX0 A;  4DR1 I;  1X6H A;  2J7K A;  2E1M A;  1X5W A;  3HJC A;  3PYG A;  2EM6 A;  3IWC A;  5DRQ A;  2EOS A;  1D6T A;  2DSY A;  4JI5 E;  4LCF A;  2CTD A;  2YTP A;  2C38 B;  4JI2 I;  4LFA I;  3HXL A;  1Z0G A;  2DMY A;  3MHS C;  4USK A;  2FGG A;  2RS6 A;  1Z0T A;  2V83 A;  2EM7 A;  1EKZ A;  1H74 A;  4FK5 C;  2LUQ A;  1Y5Y A;  2D9H A;  2EMX A;  4BHB A;  5LLQ A;  5IT9 Q;  3H09 A;  4FW9 A;  2L92 A;  1N0V C;  3H4L A;  4OO1 B;  2BM0 A;  3LNU A;  4JI1 I;  1XMQ E;  2M4I A;  1ZM4 A;  2HGH A;  2LJU A;  2BA0 D;  4QNK A;  1HNZ I;  2ZM6 E;  2EMW A;  1Z0C A;  1ZM2 A;  2LE2 A;  4N4R B;  2EML A;  2L6M A;  5ADZ A;  1RC7 A;  4JI4 E;  4DV7 I;  5KL3 A;  2WP8 B;  1N32 E;  2EPK X;  1N34 E;  2EPA A;  1OYS A;  3VK6 A;  2E72 A;  5IWA E;  3GCM A;  5A2Q Q;  4LF7 E;  4DV1 E;  2B7V A;  1FJG I;  4WSP A;  4DXL A;  1ZR9 A;  2YRH A;  2BA1 D;  4B3T E;  1N33 E;  1U2R A;  2E1R A;  1T4N A;  4X66 E;  2PO2 B;  4IFD A;  1FKA E;  2F4V I;  2MDR A;  1J5E E;  5DNY A;  1KYQ A;  5C0X E;  2EMH A;  2YSP A;  4DV0 I;  4ZVI A;  3F0N A;  2EMG A;  3ZOQ B;  1S16 A;  4BA1 B;  1JK1 A;  4GKJ E;  3EPJ A;  4MU3 A;  1XNQ I;  2EMZ A;  1VI7 A;  1X47 A;  3MHH C;  2EZ6 A;  1XXE A;  3ZM7 A;  2IOP A;  4GKK I;  3ZZ0 A;  4O5G A;  4KQV A;  3M7N G;  1MGT A;  4HEI A;  1PKP A;  5DRO A;  4O43 A;  4DR3 E;  2EPM X;  2HJJ A;  2AJ4 A;  1BB8 A;  4MYT A;  5FWK A;  3IWB A;  4MDT A;  2RQL A;  3JU0 A;  4PRX A;  5K36 E;  4DV5 E;  1XMO E;  1NHJ A;  1Z5C A;  1QZR A;  4Z7C A;  3JAM C;  4LF9 I;  2RS7 A;  1IBL I;  3DF6 A;  3PRY A;  4BHC A;  2FTX B;  1Z59 A;  3AUZ A;  3C4T A;  4IJD A;  2EFG A;  1WHN A;  2Q8U A;  4DR1 E;  1TN9 A;  2MC5 A;  2NN6 E;  2YPN A;  4KWY A;  4NBQ A;  4WSG A;  1NEI A;  5AE2 A;  5IXM B;  2K4V A;  4JI2 E;  4LFA E;  4DPW A;  2RSM A;  4X62 I;  1YH8 A;  3M85 G;  2UXC I;  4ZYG A;  4HY1 A;  4NHR A;  5K36 C;  1QNT A;  2EMF A;  4R8O A;  5JEA E;  1RR9 A;  2UUA I;  3P1X A;  2EPL X;  4BA2 A;  3KRN A;  5GME A;  2C39 A;  3ADI A;  3P76 A;  3J7Y p;  2VQF E;  4JI1 E;  4R2A A;  4X9J A;  4WX9 A;  2Z5E A;  4DPX A;  4DV2 I;  1HNZ E;  4YHH I;  1PIE A;  5GMD A;  2UU9 I;  5BR8 I;  4DV7 E;  1A1F A;  4IZK B;  2EM3 A;  2EN6 A;  1A1J A;  2V2Z A;  4DR7 E;  1ZXM A;  3P3C A;  3D4J A;  4LU9 A;  2IER A;  2JE6 A;  2VF1 A;  1H73 A;  4R2P A;  1I94 I;  3EPH A;  1BBO A;  3CWV A;  2YWQ A;  2M1S A;  3QG5 C;  5AE1 A;  2GQ0 A;  1FJG E;  3TQM A;  2F8B A;  3B4T A;  2PNZ B;  4GZN C;  4OOG C;  2EMK A;  2LJH A;  1USV A;  2F4V E;  2A2D A;  2LRS A;  2Z5B A;  3THN A;  4LOM A;  2JPA A;  2YU8 A;  3T1Y I;  4R2S A;  4DV0 E;  2JOX A;  4BS9 A;  4ISA A;  3VYX A;  2JXP A;  4WXC A;  2L33 A;  1UN6 B;  1EI1 A;  1XNQ E;  5KL4 A;  2HKJ A;  2V89 A;  4LF5 I;  2EMI A;  2DLQ A;  5FLX C;  4X8W A;  4GKK E;  1A1H A;  2HC5 A;  2VES A;  2YTD A;  2PO1 B;  4LF6 I;  2EM9 A;  3EPK A;  4JG4 A;  4KHP I;  4IFD E;  2WW4 A;  2UUB I;  5LL6 R;  2O1T A;  2O3Z A;  2PRT A;  2M7Q A;  3HPZ A;  1H7U A;  1Y4U A;  3L7Z B;  4IZJ D;  2GLI A;  5LMN I;  4B3S I;  2O1W A;  3M99 B;  4NXN I;  1SFE A;  2VF3 A;  2JEB B;  4RPF A;  2C38 A;  4Q28 A;  4LF9 E;  3C6M A;  1IBL E;  2L8T A;  3LTO A;  4JI8 I;  4M1K A;  2EN7 A;  2EMB A;  2H36 X;  4M0V A;  3BID A;  2WZO A;  2JOB A;  2EJ4 A;  2NAB A;  2YTF A;  1YFH A;  1Z0W A;  1TF6 A;  4WUB A;  4OO1 A;  4F9C B;  1YYK A;  4X62 E;  2UXC E;  1UDQ A;  2EOH A;  2AE8 A;  2HK2 A;  2EQ3 A;  2LTS A;  4DPY A;  2HFS A;  2EPZ A;  3J81 C;  5K36 F;  4DR6 I;  2UUA E;  3JAM Q;  4OKG A;  2WP8 A;  3J7A G;  2ENH A;  2YTI A;  2EMC A;  5K36 D;  4ZYH A;  4FWG A;  3LLH A;  2DIX A;  4I8O A;  5ELW A;  3ZZU A;  2YTO A;  2O1V A;  1T39 A;  4DV2 E;  3PS1 A;  2EL4 A;  4YHH E;  1KTV A;  2PO2 A;  1RQ0 A;  5KL2 A;  2NPF A;  1SR9 A;  5BR8 E;  4EMD A;  5AC4 A;  5A6B D;  2B9D A;  1YSA C;  4OX9 E;  2Q2E B;  4JYA I;  1B69 A;  2LTR A;  3BGH A;  3C4B A;  2EN2 A;  3PYF A;  4PU9 A;  3PYD A;  1Y4S A;  1I94 E;  2WNR B;  4BA1 A;  3PS3 A;  3J80 C;  4DR5 I;  4P52 A;  1YUI A;  2PO0 B;  4WFT A;  1KVK A;  1FI4 A;  4DV3 I;  3LPS A;  4IS1 C;  1ZBQ A;  2DEI A;  2VE7 C;  2CSH A;  2DLK A;  2EM2 A;  2MDG A;  2MKN A;  2EWL A;  1XHK A;  1HNX I;  2ELY A;  3UK3 C;  2ADR A;  2ELZ A;  3WU5 A;  2UXB I;  2EOY A;  2KHX A;  1N0U A;  1IBM I;  1A1K A;  2GPI A;  3AV0 A;  4LF5 E;  2R42 A;  2XEX A;  1HNW I;  2EPN A;  4HAC B;  4LF6 E;  4ED4 A;  2V88 A;  1ELO A;  2EM4 A;  3M6A A;  4WPY A;  4KHP E;  1UDO A;  2LO3 A;  2EOQ A;  1N36 I;  5C0X C;  2GS8 A;  3C6K A;  4B3S E;  2BA0 G;  4MU1 A;  4NXN E;  4J3D A;  4F54 A;  4IFD B;  1ZU1 A;  2ENC A;  2JP9 A;  4O24 A;  4DUZ I;  4XTJ A; 
#chains in the Genus database with same CATH homology
 4J8Z A;  4JI8 E;  2O1U A;  1H7S A;  5FLX Q;  3J7A M;  2LBS B;  3K17 A;  4MYU A;  2BV3 A;  5CFF E;  1IBK I;  4DV6 I;  4DR4 I;  2CGE A;  4IZK A;  1T4L B;  2B7T A;  4P78 A;  1RRE A;  5IT9 C;  1EA6 A;  2N3H A;  2V86 A;  2CG9 A;  2JVA A;  3OML A;  4PRV A;  1NHH A;  3ZKD A;  4JYA E;  3F6H A;  2UUC I;  2R3V A;  1Z0E A;  3B8H A;  2NUE A;  2HHH I;  4B3M I;  4DR5 E;  1WUU A;  1FWL A;  4JI3 I;  3QT5 A;  3DJW A;  1STU A;  1HNX E;  4LFC I;  4DR2 I;  2NUG A;  3HTX A;  3ZZT A;  4NXM I;  4IZJ B;  3IWD A;  1K47 A;  1WXR A;  5LMU I;  2NA2 A;  1HNW E;  1DQ3 A;  3HUL A;  2KOU A;  2L2M A;  1XNR I;  2Z5C B;  4R03 A;  2E5L I;  1N36 E;  3V5R A;  1ZBT A;  1Z0B A;  1QU6 A;  2V34 A;  4YY3 I;  4DUY I;  1YYW A;  1UHZ A;  2DB2 A;  2V87 A;  1NHI A;  2CZ9 A;  4DV4 I;  4JI6 I;  2JWO A;  3K6Q A;  2JR1 A;  4DUZ E;  4N3O A;  1B63 A;  4BMJ A;  4KZS A;  2V2Q A;  2G7H A;  1S4E A;  2YZT A;  1O0W A;  4K0K I;  1KKH A;  2NUF A;  1HK7 A;  1Y6Z A;  4F9A B;  2X7I A;  1IBK E;  4DR4 E;  4B3R I;  2L3C A;  1KIJ A;  4LF4 I;  2L2K B;  4P7D A;  3ZKB A;  2ZIT A;  2HKE A;  2VQE I;  4DU8 A;  1WHQ A;  2ZBK B;  4JI7 I;  3HPS A;  2UU9 E;  1GQE A;  4X64 I;  4WUD A;  1ZM3 A;  4LFB I;  2N3G A;  1A6F A;  1BKN A;  1Z5B A;  4F9B B;  1USU A;  2UUC E;  4R1F A;  1NZ0 A;  3WU4 A;  4B3M E;  2HHH E;  2HFU A;  4JI3 E;  2CPN A;  4FN5 A;  4HAC A;  2VQF I;  1ZXN A;  2PNL A;  1Z5A A;  5AE3 A;  3Q6N A;  3T1Y E;  4LFC E;  4DR2 E;  5F3W A;  1T4O A;  2HK3 A;  2V85 A;  1OJ4 A;  4NXM E;  5LMU E;  4BC7 A;  4DR7 I;  1B62 A;  2ODR C;  1XNR E;  2UUB E;  5LMN E;  2E5L E;  2DEJ A;  3QT7 A;  4DUY E;  4YY3 E;  3B82 A;  4DV4 E;  1HR0 I;  5AAS A;  4JI6 E;  3GON A;  2MC6 A;  1X48 A;  2OI2 A;  3P06 A;  4BBY A;  4L8N A;  2RTX A;  3V2U C;  4DKK A;  4AQY I;  4LF8 I;  1FWK A;  1YYO A;  4GEQ B;  1UEK A;  4K0K E;  2JY9 A;  4P7A A;  1DI2 A;  2PNM A;  2LUP B;  2X36 A;  4WYQ B;  2B3T B;  4M30 A;  4JI0 I;  4JV5 I;  4B3R E;  3OTO I;  4LF4 E;  4DR6 E;  2L2N A;  2V8Q B;  1H72 C;  4WUC A;  4FWH A;  2UXD I;  2A2C A;  4URL A;  3MSW A;  2VQE E;  1Z0V A;  2V2V A;  2V8P A;  4X65 I;  3T1H I;  4JI7 E;  3VYY A;  4FWD A;  4X64 E;  4JI5 I;  4LFB E;  3Q6M A;  4BCA A;  3KWR A;  4USM A;  1ZM9 A;  3J81 Q;  2LMZ A;  3K85 A;  5A2Q C;  3ADJ A;  1YZ9 A;  4IZJ A;  4HXZ A;  2IHR 1;  4TUG A;  4DV3 E;  4DMI A;  3FIG A;  3ADG A;  5T6J A;  3K1J A;  1XMQ I;  2Z5C A;  1X49 A;  1J26 A;  2UXB E;  2ZM6 I;  1IBM E;  1VIS A;  3WU6 A;  4JI4 I;  5L3J A;  4OX9 I;  1N32 I;  1N34 I;  2LJP A;  3QT6 A;  4I3H A;  5IWA I;  3WU3 A;  3J80 Q;  4LF7 I;  3LML A;  4DV1 I;  3ADL A;  4DPU A;  4TUI A;  1UIL A;  3B78 A;  4B3T I;  1N33 I;  4X66 I;  2BM1 A;  1HR0 E;  2ODR D;  1J5E I;  1PVG A;  1GZ6 A;  1DAR A;  4GKJ I;  4DU7 A;  3F6G A;  2FV4 B;  3QT8 A;  2YT4 A;  4LF8 E;  4AQY E;  4BC9 A;  2Z5B B;  4HYM A;  4M2Z A;  4DR3 I;  2KON A;  4UTG A;  4DV6 E;  4JI0 E;  4JV5 E;  3PYE A;  4L5N C;  1MU5 A;  4DV5 I;  3OTO E;  1XMO I;  2IOQ A;  4Z7Y A;  4DPT A;  2L3J A;  3RMP A;  4UT4 A;  4LTY A;  2UXD E;  1FNM A;  3Q1Q A;  1MG7 A;  3JTZ A;  3HQ1 A;  4X65 E;  3T1H E;  1MX0 A;  4DR1 I;  2J7K A;  2E1M A;  3HJC A;  3PYG A;  3IWC A;  1D6T A;  2DSY A;  4JI5 E;  4JI2 I;  4LFA I;  3HXL A;  1Z0G A;  2DMY A;  4USK A;  2FGG A;  2RS6 A;  1Z0T A;  2V83 A;  1EKZ A;  1H74 A;  2LUQ A;  5IT9 Q;  3H09 A;  4FW9 A;  2L92 A;  1N0V C;  3H4L A;  2BM0 A;  3LNU A;  4JI1 I;  1XMQ E;  2M4I A;  1ZM4 A;  1HNZ I;  2ZM6 E;  1Z0C A;  1ZM2 A;  2LE2 A;  2L6M A;  1RC7 A;  5ADZ A;  4DV7 I;  4JI4 E;  1N32 E;  1N34 E;  3VK6 A;  5IWA E;  5A2Q Q;  4LF7 E;  4DV1 E;  2B7V A;  1FJG I;  4WSP A;  4DXL A;  4B3T E;  1N33 E;  1U2R A;  2E1R A;  1T4N A;  4X66 E;  1FKA E;  2F4V I;  2MDR A;  1J5E E;  5DNY A;  4DV0 I;  4ZVI A;  3F0N A;  3ZOQ B;  1S16 A;  4GKJ E;  1XNQ I;  1X47 A;  2EZ6 A;  3ZM7 A;  2IOP A;  4GKK I;  3ZZ0 A;  4KQV A;  1PKP A;  4DR3 E;  2AJ4 A;  4MYT A;  5FWK A;  3IWB A;  3JU0 A;  4PRX A;  4DV5 E;  1XMO E;  1NHJ A;  1Z5C A;  1QZR A;  4Z7C A;  3JAM C;  4LF9 I;  2RS7 A;  1IBL I;  3DF6 A;  3PRY A;  2FTX B;  1Z59 A;  3AUZ A;  3C4T A;  2EFG A;  1WHN A;  4DR1 E;  2MC5 A;  5AE2 A;  4JI2 E;  2K4V A;  4LFA E;  4DPW A;  2RSM A;  4X62 I;  2UXC I;  4HY1 A;  4R8O A;  2UUA I;  1RR9 A;  3P1X A;  5GME A;  3ADI A;  3J7Y p;  2VQF E;  4JI1 E;  2Z5E A;  4DPX A;  4DV2 I;  1HNZ E;  4YHH I;  1PIE A;  5GMD A;  2UU9 I;  5BR8 I;  4DV7 E;  4IZK B;  2V2Z A;  4DR7 E;  1ZXM A;  3D4J A;  4LU9 A;  2VF1 A;  1H73 A;  1I94 I;  3CWV A;  2M1S A;  5AE1 A;  2GQ0 A;  1FJG E;  2F8B A;  4OOG C;  2LJH A;  1USV A;  2F4V E;  2A2D A;  2LRS A;  2Z5B A;  3T1Y I;  4DV0 E;  2JOX A;  4BS9 A;  3VYX A;  2L33 A;  1EI1 A;  1XNQ E;  2HKJ A;  2V89 A;  4LF5 I;  5FLX C;  4X8W A;  4GKK E;  4LF6 I;  4JG4 A;  4KHP I;  2WW4 A;  2UUB I;  5LL6 R;  2O1T A;  4IZJ D;  5LMN I;  2M7Q A;  3HPZ A;  1H7U A;  1Y4U A;  4B3S I;  2O1W A;  4NXN I;  2VF3 A;  4RPF A;  4Q28 A;  4LF9 E;  1IBL E;  2L8T A;  3LTO A;  4JI8 I;  4M1K A;  4M0V A;  2H36 X;  2WZO A;  2JOB A;  1Z0W A;  4WUB A;  4F9C B;  1YYK A;  2UXC E;  4X62 E;  2HK2 A;  2LTS A;  4DPY A;  2HFS A;  3J81 C;  4DR6 I;  2UUA E;  3JAM Q;  3J7A G;  4FWG A;  3LLH A;  2DIX A;  4I8O A;  3ZZU A;  2O1V A;  4DV2 E;  4YHH E;  1KTV A;  2NPF A;  1RQ0 A;  1SR9 A;  5BR8 E;  4EMD A;  2B9D A;  4OX9 E;  2Q2E B;  4JYA I;  2LTR A;  3C4B A;  3PYF A;  4PU9 A;  3PYD A;  1Y4S A;  1I94 E;  3J80 C;  4DR5 I;  4P52 A;  4WFT A;  1KVK A;  1FI4 A;  4DV3 I;  3LPS A;  1ZBQ A;  2DEI A;  2VE7 C;  1HNX I;  1XHK A;  2EWL A;  3WU5 A;  2UXB I;  2KHX A;  1N0U A;  1IBM I;  3AV0 A;  4LF5 E;  2R42 A;  2XEX A;  1HNW I;  4HAC B;  4LF6 E;  4ED4 A;  2V88 A;  1ELO A;  3M6A A;  4WPY A;  4KHP E;  1N36 I;  2GS8 A;  4B3S E;  4NXN E;  4F54 A;  4DUZ I;  4XTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...