4B3MI

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mI00
2VF3A 2BM1A 3OTOE 1N32E 4PU9A 3WU5A 3J7AG 1Z0CA 4FWGA 1XNRI 1N0UA 4DV5I 3PYDA 2UUBI 1MX0A 1HNWI 4YHHE 4X65I 5A2QC 3H4LA 3T1HE 3Q1QA 4HXZA 2UU9I 1MU5A 4DV6E 3B78A 3T1HI 1FWLA 1HNXI 4OX9I 3HULA 4USKA 4EMDA 4X62E 4JI3E 2UUBE 3WU3A 4JG4A 1A6FA 1XNRE 2HK3A 2V2QA 4X62I 4JI3I 4B3RI 1RREA 4DR6I 2V2ZA 3F0NA 3OTOI 1N32I 2GS8A 4B3SI 3J80C 1VISA 4ZVIA 4JI8E 2HHHE 1B63A 4AQYI 4DV7I 4DU7A 4LF9I 4DPWA 2F4VI 4HACB 4DV5E 1PVGA 3J80Q 1XMQE 2R42A 4JYAI 2E5LI 2UUCI 5BR8I 1Z0EA 2DEIA 1ZXMA 1OJ4A 4LF8I 4X66E 3ZKDA 4NXNI 3JAMC 1QZRA 2UXDI 2A2DA 4YY3E 4NXME 4JI0E 4JI1E 4DPTA 2OI2A 2BV3A 4GKJE 4LFCE 2R3VA 2UXBE 3ZKBA 4FWDA 4JV5I 4LFBI 4K0KE 4PRXA 1N36E 5LMNE 4PRVA 5LMNI 3WU6A 1N36I 2HFSA 4DR1E 5IWAE 1Z59A 4K0KI 2XEXA 4JI7E 1HR0I 4FW9A 2HK2A 1XMOE 4DXLA 3ZZTA 1ZM4A 4DR7I 1H74A 1PIEA 3D4JA 1Z0VA 3LTOA 1S16A 2V2VA 4DR3E 4LF6E 4DU8A 1XHKA 4NXMI 4YY3I 5FLXQ 2BM0A 5IT9Q 1H7UA 3T1YI 4XTJA 1EA6A 4DV2E 2ZM6I 4LF5I 5FLXC 2X7IA 4X66I 4DV2I 3PYGA 1B62A 2CZ9A 2V34A 1NHIA 3J7AM 4DR3I 1ZM9A 4LF6I 4DR7E 1NHJA 1IBME 3LPSA 2F4VE 1HR0E 1ZM3A 4P7AA 2UUAI 3ZM7A 4JI7I 2HKEA 3J81Q 4DV7E 4AQYE 4JI8I 2HHHI 5IWAI 4DR1I 2EFGA 1N33E 4DUYI 3LNUA 4LFBE 4WUDA 4JV5E 4LFAI 5LMUI 2HFUA 2UXBI 4LFCI 4GKJI 1WUUA 1Z0WA 1S4EA 5GMDA 1ZXNA 3V2UC 1KIJA 4OX9E 4JI0I 1I94I 1HNXE 3QT6A 3ZZ0A 1XNQI 4M1KA 2UU9E 5A2QQ 4JI2I 3B82A 5IT9C 4JI5I 4JI6I 4X65E 2WW4A 1Z5AA 3CWVA 3GONA 2HKJA 4LF4I 4JYAE 1XMQI 1H72C 4LF4E 4RPFA 4KHPI 1Z0TA 1Z0GA 4UTGA 4DPXA 1HNZI 4X64E 1K47A 1Z5CA 2ZBKB 4X64I 4JI2E 1HNZE 1U2RA 1N34E 4B3SE 4KHPE 1ZM2A 1I94E 3J81C 2LJPA 4DR6E 1NHHA 4B3RE 4HACA 4DR4I 5LMUE 5LL6R 3K1JA 1MG7A 1FWKA 4B3TI 1H73A 4DV3I 4DR2I 1IBLI 4ED4A 1PKPA 4JI6E 4JI5E 1KTVA 4DR5E 4DV6I 4JI4E 1XNQE 4DV1I 1KVKA 2VQEI 4YHHI 2DEJA 4I3HA 3K17A 1UEKA 1HNWE 2E1RA 2UUAE 1N0VC 2VQFE 4GKKI 4HY1A 4LFAE 1NZ0A 4FWHA 1IBMI 4MYTA 3M6AA 1ELOA 4DUYE 4Z7CA 1DARA 4DV0I 1IBKI 1N33I 5GMEA 2ZM6E 4LF7I 2NPFA 1RR9A 4DV4I 1J5EE 3T1YE 1EI1A 2J7KA 2V8PA 2ZITA 1Z0BA 1H7SA 4B3MI 4URLA 2X36A 4HYMA 1J5EI 4DUZI 4WUBA 1FJGI 4USMA 2A2CA 4LF5E 2UXCE 3ZZUA 3B8HA 4DV0E 1IBKE 1BKNA 1KKHA 4KQVA 3V5RA 1FKAE 1XMOI 2VQFI 4GKKE 1FI4A 3QT8A 4DPYA 4FN5A 2VQEE 3PYEA 4DV1E 3JAMQ 1D6TA 4JI4I 2UXDE 3PYFA 4DR5I 2UXCI 4NXNE 1FJGE 4DV3E 4DR2E 1IBLE 4B3TE 4DUZE 4MYUA 4LF8E 3QT7A 4DR4E 4B3ME 5BR8E 4P52A 4JI1I 2E5LE 2UUCE 4UT4A 1Z5BA 3WU4A 2AJ4A 1N34I 1FNMA 4R1FA 4DV4E 4LF7E 4WUCA 4LF9E 4DPUA 3QT5A 2Q2EB 4Z7YA 5L3JA
chains in the Genus database with same CATH superfamily
4IZKA 2VF3A 2BM1A 3OTOE 1N32E 2O1VA 4PU9A 3WU5A 2C39B 3J7AG 4BA2A 4ISAA 1UDQA 1Z0CA 4FWGA 1E3HA 4IZKB 1XNRI 1N0UA 3GMEA 2Z5CB 4DV5I 5C0XD 3M7ND 3PYDA 3P3CA 2UUBI 2IERA 1HK7A 2PO0A 1MX0A 1HNWI 4YHHE 4X65I 5A2QC 3H4LA 3HJCA 3T1HE 3Q1QA 4HXZA 2UU9I 1MU5A 3U1KA 4DV6E 3B78A 2JEBA 4FW3A 2PO0B 2O1UA 3T1HI 1FWLA 5C0XF 1HNXI 4OX9I 3HULA 4USKA 4EMDA 2Z5EA 2JEAB 2GQ0A 4X62E 4JI3E 2UUBE 3WU3A 4OO1B 4JG4A 2Z5BB 4MU3A 3M85G 1A6FA 1XNRE 2HK3A 2V2QA 4X62I 4JI3I 4B3RI 5EL9A 1RREA 3PRYA 2WNRA 4DR6I 2V2ZA 3F0NA 4LCFA 3OTOI 3B4TA 2C37B 1N32I 2GS8A 4B3SI 3J80C 2BA1D 1VISA 4IFDC 4ZVIA 4JI8E 2HHHE 4J3DA 1B63A 4AQYI 4DV7I 2JEAA 4DU7A 4LF9I 2NN6B 4DPWA 3U1YA 4HACB 2F4VI 4LCHA 1Y4SA 4DV5E 1PVGA 3P06A 3J80Q 1XMQE 2R42A 4JYAI 4OO1A 2E5LI 2UUCI 4LCGA 4IFDB 5BR8I 3P3GA 1Z0EA 2DEIA 2F1DA 1ZXMA 5DNLA 1OJ4A 4LF8I 4X66E 5K36D 3ZKDA 4NXNI 3JAMC 5K36C 2IOQA 2BA0D 2CVEA 1QZRA 2UXDI 1USVA 2A2DA 1UDOA 4YY3E 4NXME 4JI0E 3Q6MA 4OO1C 4FW5A 2NN6A 4OO1D 4JI1E 4DPTA 2OI2A 2BV3A 3PS3A 4GKJE 4LFCE 2R3VA 2UXBE 1USUA 3ZKBA 5FWKA 4FWDA 4JV5I 4LFBI 4K0KE 5K36A 1Y5YA 3HKMA 4PRXA 1N36E 5LMNE 4PRVA 5LMNI 3WU6A 1N36I 2HFSA 2NN6C 4DR1E 5IWAE 2NN6D 1Z59A 3GLLA 4K0KI 2O1TA 2XEXA 4JI7E 1HR0I 4FW9A 2HK2A 2BA1G 1XMOE 4DXLA 3ZZTA 1ZM4A 4DR7I 1H74A 2JE6B 1PIEA 1XXEA 3D4JA 1Z0VA 3LTOA 1S16A 2V2VA 4DR3E 4LF6E 4DU8A 1XHKA 2JT2A 4YY3I 5FLXQ 2BM0A 4NXMI 5IT9Q 1H7UA 3T1YI 4XTJA 3PS1A 1EA6A 4DV2E 2ZM6I 4LOMA 4LF5I 5FLXC 4BA1A 4OKGA 2X7IA 4X66I 4DV2I 3PYGA 1B62A 2CZ9A 2V34A 1NHIA 3J7AM 2PNZA 1P42A 1ZM9A 4FW4A 4DR3I 4LF6I 1YH8A 4LPFA 4DR7E 1NHJA 2VESA 1IBME 2NN6F 3LPSA 5DRPA 2F4VE 4GQUA 4MQYA 2PNZB 1HR0E 1ZM3A 4P7AA 2UUAI 3ZM7A 4JI7I 2HKEA 3J81Q 4DV7E 4AQYE 4JI8I 2HHHI 5IWAI 4DR1I 2C39A 4IZJA 2EFGA 1N33E 1YHCA 1E3PA 4BA1B 4FW7A 4DUYI 3LNUA 4IS9A 4LFBE 4WUDA 4JV5E 4OO1E 3PS2A 4IZJD 4OO1F 4MU0A 4LFAI 5LMUI 2HFUA 2UXBI 4LFCI 4GKJI 1WUUA 1Z0WA 1S4EA 5GMDA 1ZXNA 2JEBB 3V2UC 1KIJA 4IFDA 4OX9E 4JI0I 4U3BA 1I94I 1HNXE 3P3EA 5DNXA 3QT6A 1Y60A 3ZZ0A 1XNQI 4AIMA 4QNJA 4M1KA 4NBQA 2UU9E 5A2QQ 5K36E 4JI2I 3B82A 2PO2A 5IT9C 4JI5I 4JI6I 1OYSA 4X65E 4IFDD 2WW4A 5EKWA 1Z5AA 2NN6E 4IFDE 3L7ZA 3DD6A 3CWVA 3GONA 1VI7A 2HKJA 4LF4I 4MU1A 4JYAE 1XMQI 1H72C 4LF4E 5C0XE 2PO1B 4RPFA 4KHPI 1UDNA 1Z0TA 1Z0GA 4UTGA 4AIDA 4DPXA 1HNZI 4X64E 2PO2B 4MU4A 1K47A 1Z5CA 2ZBKB 4N3OA 4X64I 4JI2E 1HNZE 1R6LA 1U2RA 1RHYA 1N34E 4IFDF 2IOPA 4B3SE 1R6MA 4KHPE 1Y4UA 1ZM2A 1I94E 3J81C 3CDJA 3Q6NA 2LJPA 4IZJB 4DR6E 1NHHA 4B3RE 4HACA 2PNMA 2WNRB 2O3ZA 4DR4I 5LMUE 5LL6R 3CDIA 3K1JA 2BA0G 1MG7A 1FWKA 4MDTA 4B3TI 1H73A 4DV3I 4DR2I 1IBLI 2PO1A 4ED4A 1PKPA 4JI6E 4JI5E 1KTVA 3M85D 4DR5E 4DV6I 4JI4E 1OYRA 2CGEA 1XNQE 4DV1I 1KVKA 2VQEI 4AM3A 4YHHI 2DEJA 4I3HA 3K17A 1UEKA 1HNWE 2E1RA 2UUAE 1N0VC 2VQFE 4GKKI 2Z5CA 4HY1A 2C38B 4LFAE 1NZ0A 4FWHA 1IBMI 5ELWA 4MYTA 3M6AA 1ELOA 4DUYE 1Y6ZA 4Z7CA 1DARA 2CG9A 4DV0I 1IBKI 1N33I 5DROA 5GMEA 4OZEA 2ZM6E 4LF7I 2NPFA 1RR9A 4DV4I 1J5EE 3NZKA 3T1YE 2Z5BA 1EI1A 2J7KA 3KRNA 2WP8B 5DRQA 2V8PA 2ZITA 1Z0BA 2C38A 1H7SA 4B3MI 2C37A 4URLA 2X36A 5JEAA 4QNKA 4HYMA 1J5EI 4DUZI 4WUBA 1FJGI 4USMA 1OYPA 2A2CA 4LF5E 2UXCE 5JEAC 3ZZUA 3M7NG 5JEAD 3B8HA 5DRRA 4DV0E 3K85A 5JEAE 1IBKE 5K36F 1BKNA 1KKHA 4KQVA 3V5RA 5K36B 1FKAE 1XMOI 1UDSA 2VQFI 4GKKE 5JEAB 1FI4A 3QT8A 3UHMA 4DPYA 4FN5A 2VQEE 3PYEA 4DV1E 3JAMQ 1D6TA 2BR2A 4JI4I 3PYFA 2UXDE 2O1WA 4DR5I 2UXCI 2IESA 4NXNE 5JEAF 1FJGE 4DV3E 4DR2E 2JE6A 1IBLE 4B3TE 4DUZE 4MYUA 3H1CA 4FW6A 4BA2B 2BR2B 4LF8E 3QT7A 4DR4E 4B3ME 2GO4A 5BR8E 5C0XC 4P52A 4JI1I 3P76A 2E5LE 2UUCE 2AE8A 4UT4A 3GCMA 3L7ZB 1Z5BA 3WU4A 2AJ4A 2WP8A 1N34I 5C0XA 1FNMA 4R1FA 4DV4E 4LF7E 4WUCA 4LF9E 4U3DA 4DPUA 2PNLA 3QT5A 2Q2EB 4Z7YA 2GO3A 5L3JA 2J65A 5C0XB
chains in the Genus database with same CATH topology
4IZKA 2VF3A 2BM1A 3OTOE 1N32E 2O1VA 4PU9A 3WU5A 3J7AG 1Z0CA 4FWGA 4IZKB 1XNRI 1N0UA 2Z5CB 4DV5I 3PYDA 2UUBI 1HK7A 1MX0A 1HNWI 4YHHE 4X65I 5A2QC 3H4LA 3HJCA 3T1HE 3Q1QA 4HXZA 2UU9I 1MU5A 4DV6E 3B78A 2O1UA 3T1HI 1FWLA 1HNXI 4OX9I 3HULA 4USKA 4EMDA 2Z5EA 2GQ0A 4X62E 4JI3E 2UUBE 3WU3A 4JG4A 2Z5BB 1A6FA 1XNRE 2HK3A 2V2QA 4X62I 4JI3I 4B3RI 1RREA 3PRYA 4DR6I 2V2ZA 3F0NA 3OTOI 1N32I 2GS8A 4B3SI 3J80C 1VISA 4ZVIA 4JI8E 2HHHE 1B63A 4AQYI 4DV7I 4DU7A 4LF9I 4DPWA 2F4VI 4HACB 1Y4SA 4DV5E 1PVGA 3P06A 3J80Q 1XMQE 2R42A 4JYAI 2E5LI 2UUCI 5BR8I 1Z0EA 2DEIA 1ZXMA 1OJ4A 4LF8I 4X66E 3ZKDA 4NXNI 3JAMC 2IOQA 1QZRA 2UXDI 1USVA 2A2DA 4YY3E 4NXME 4JI0E 3Q6MA 4JI1E 4DPTA 2OI2A 2BV3A 4GKJE 4LFCE 2R3VA 2UXBE 1USUA 3ZKBA 5FWKA 4FWDA 4JV5I 4LFBI 4K0KE 4PRXA 1N36E 5LMNE 4PRVA 5LMNI 3WU6A 1N36I 2HFSA 4DR1E 5IWAE 1Z59A 4K0KI 2O1TA 2XEXA 4JI7E 1HR0I 4FW9A 2HK2A 1XMOE 4DXLA 3ZZTA 1ZM4A 4DR7I 1H74A 1PIEA 3D4JA 1Z0VA 3LTOA 1S16A 2V2VA 4DR3E 4LF6E 5FLXQ 1XHKA 4DU8A 4YY3I 4NXMI 2BM0A 5IT9Q 1H7UA 3T1YI 4XTJA 1EA6A 4DV2E 2ZM6I 4LF5I 5FLXC 2X7IA 4X66I 4DV2I 3PYGA 1B62A 2CZ9A 2V34A 1NHIA 3J7AM 4DR3I 1ZM9A 4LF6I 4DR7E 1NHJA 1IBME 3LPSA 2F4VE 1HR0E 1ZM3A 4P7AA 2UUAI 3ZM7A 4JI7I 2HKEA 3J81Q 4DV7E 4AQYE 4JI8I 2HHHI 5IWAI 4DR1I 4IZJA 2EFGA 1N33E 4DUYI 3LNUA 4LFBE 4WUDA 4JV5E 4IZJD 4LFAI 5LMUI 2HFUA 2UXBI 4LFCI 4GKJI 1WUUA 1Z0WA 1S4EA 5GMDA 1ZXNA 3V2UC 1KIJA 4OX9E 4JI0I 1I94I 1HNXE 3QT6A 3ZZ0A 1XNQI 4M1KA 2UU9E 5A2QQ 4JI2I 3B82A 5IT9C 4JI5I 4JI6I 4X65E 2WW4A 1Z5AA 3CWVA 3GONA 2HKJA 4LF4I 4JYAE 1XMQI 1H72C 4LF4E 4RPFA 4KHPI 1Z0TA 1Z0GA 4UTGA 4DPXA 1HNZI 4X64E 1K47A 1Z5CA 2ZBKB 4N3OA 4X64I 4JI2E 1HNZE 1U2RA 1N34E 2IOPA 4B3SE 4KHPE 1Y4UA 1ZM2A 1I94E 3J81C 3Q6NA 2LJPA 4IZJB 4DR6E 1NHHA 4B3RE 4HACA 2PNMA 4DR4I 5LMUE 5LL6R 3K1JA 1MG7A 1FWKA 4B3TI 1H73A 4DV3I 4DR2I 1IBLI 4ED4A 1PKPA 4JI6E 4JI5E 1KTVA 4DR5E 4DV6I 4JI4E 2CGEA 1XNQE 4DV1I 1KVKA 2VQEI 4YHHI 2DEJA 4I3HA 3K17A 1UEKA 1HNWE 2E1RA 2UUAE 1N0VC 2VQFE 4GKKI 2Z5CA 4HY1A 4LFAE 1NZ0A 4FWHA 1IBMI 4MYTA 3M6AA 1ELOA 4DUYE 1Y6ZA 4Z7CA 1DARA 2CG9A 4DV0I 1IBKI 1N33I 5GMEA 2ZM6E 4LF7I 2NPFA 1RR9A 4DV4I 1J5EE 3T1YE 2Z5BA 1EI1A 2J7KA 2V8PA 2ZITA 1Z0BA 1H7SA 4B3MI 4URLA 2X36A 4HYMA 1J5EI 4DUZI 4WUBA 1FJGI 4USMA 2A2CA 4LF5E 2UXCE 3ZZUA 3B8HA 4DV0E 1IBKE 3K85A 1BKNA 1KKHA 4KQVA 3V5RA 1FKAE 1XMOI 2VQFI 4GKKE 1FI4A 3QT8A 4DPYA 4FN5A 2VQEE 3PYEA 4DV1E 3JAMQ 1D6TA 4JI4I 2UXDE 3PYFA 2O1WA 4DR5I 2UXCI 4NXNE 1FJGE 4DV3E 4DR2E 1IBLE 4B3TE 4DUZE 4MYUA 4LF8E 3QT7A 4DR4E 4B3ME 5BR8E 4P52A 4JI1I 2E5LE 2UUCE 4UT4A 1Z5BA 3WU4A 2AJ4A 1N34I 1FNMA 4R1FA 4DV4E 4LF7E 4WUCA 4LF9E 4DPUA 2PNLA 3QT5A 2Q2EB 4Z7YA 5L3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VF3 A;  2BM1 A;  3OTO E;  1N32 E;  4PU9 A;  3WU5 A;  3J7A G;  1Z0C A;  4FWG A;  1XNR I;  1N0U A;  4DV5 I;  3PYD A;  2UUB I;  1MX0 A;  1HNW I;  4YHH E;  4X65 I;  5A2Q C;  3H4L A;  3T1H E;  3Q1Q A;  4HXZ A;  2UU9 I;  1MU5 A;  4DV6 E;  3B78 A;  3T1H I;  1FWL A;  1HNX I;  4OX9 I;  3HUL A;  4USK A;  4EMD A;  4X62 E;  4JI3 E;  2UUB E;  3WU3 A;  4JG4 A;  1A6F A;  1XNR E;  2HK3 A;  2V2Q A;  4X62 I;  4JI3 I;  4B3R I;  1RRE A;  4DR6 I;  2V2Z A;  3F0N A;  3OTO I;  1N32 I;  2GS8 A;  4B3S I;  3J80 C;  1VIS A;  4ZVI A;  4JI8 E;  2HHH E;  1B63 A;  4AQY I;  4DV7 I;  4DU7 A;  4LF9 I;  4DPW A;  2F4V I;  4HAC B;  4DV5 E;  1PVG A;  3J80 Q;  1XMQ E;  2R42 A;  4JYA I;  2E5L I;  2UUC I;  5BR8 I;  1Z0E A;  2DEI A;  1ZXM A;  1OJ4 A;  4LF8 I;  4X66 E;  3ZKD A;  4NXN I;  3JAM C;  1QZR A;  2UXD I;  2A2D A;  4YY3 E;  4NXM E;  4JI0 E;  4JI1 E;  4DPT A;  2OI2 A;  2BV3 A;  4GKJ E;  4LFC E;  2R3V A;  2UXB E;  3ZKB A;  4FWD A;  4JV5 I;  4LFB I;  4K0K E;  4PRX A;  1N36 E;  5LMN E;  4PRV A;  5LMN I;  3WU6 A;  1N36 I;  2HFS A;  4DR1 E;  5IWA E;  1Z59 A;  4K0K I;  2XEX A;  4JI7 E;  1HR0 I;  4FW9 A;  2HK2 A;  1XMO E;  4DXL A;  3ZZT A;  1ZM4 A;  4DR7 I;  1H74 A;  1PIE A;  3D4J A;  1Z0V A;  3LTO A;  1S16 A;  2V2V A;  4DR3 E;  4LF6 E;  4DU8 A;  1XHK A;  4NXM I;  4YY3 I;  5FLX Q;  2BM0 A;  5IT9 Q;  1H7U A;  3T1Y I;  4XTJ A;  1EA6 A;  4DV2 E;  2ZM6 I;  4LF5 I;  5FLX C;  2X7I A;  4X66 I;  4DV2 I;  3PYG A;  1B62 A;  2CZ9 A;  2V34 A;  1NHI A;  3J7A M;  4DR3 I;  1ZM9 A;  4LF6 I;  4DR7 E;  1NHJ A;  1IBM E;  3LPS A;  2F4V E;  1HR0 E;  1ZM3 A;  4P7A A;  2UUA I;  3ZM7 A;  4JI7 I;  2HKE A;  3J81 Q;  4DV7 E;  4AQY E;  4JI8 I;  2HHH I;  5IWA I;  4DR1 I;  2EFG A;  1N33 E;  4DUY I;  3LNU A;  4LFB E;  4WUD A;  4JV5 E;  4LFA I;  5LMU I;  2HFU A;  2UXB I;  4LFC I;  4GKJ I;  1WUU A;  1Z0W A;  1S4E A;  5GMD A;  1ZXN A;  3V2U C;  1KIJ A;  4OX9 E;  4JI0 I;  1I94 I;  1HNX E;  3QT6 A;  3ZZ0 A;  1XNQ I;  4M1K A;  2UU9 E;  5A2Q Q;  4JI2 I;  3B82 A;  5IT9 C;  4JI5 I;  4JI6 I;  4X65 E;  2WW4 A;  1Z5A A;  3CWV A;  3GON A;  2HKJ A;  4LF4 I;  4JYA E;  1XMQ I;  1H72 C;  4LF4 E;  4RPF A;  4KHP I;  1Z0T A;  1Z0G A;  4UTG A;  4DPX A;  1HNZ I;  4X64 E;  1K47 A;  1Z5C A;  2ZBK B;  4X64 I;  4JI2 E;  1HNZ E;  1U2R A;  1N34 E;  4B3S E;  4KHP E;  1ZM2 A;  1I94 E;  3J81 C;  2LJP A;  4DR6 E;  1NHH A;  4B3R E;  4HAC A;  4DR4 I;  5LMU E;  5LL6 R;  3K1J A;  1MG7 A;  1FWK A;  4B3T I;  1H73 A;  4DV3 I;  4DR2 I;  1IBL I;  4ED4 A;  1PKP A;  4JI6 E;  4JI5 E;  1KTV A;  4DR5 E;  4DV6 I;  4JI4 E;  1XNQ E;  4DV1 I;  1KVK A;  2VQE I;  4YHH I;  2DEJ A;  4I3H A;  3K17 A;  1UEK A;  1HNW E;  2E1R A;  2UUA E;  1N0V C;  2VQF E;  4GKK I;  4HY1 A;  4LFA E;  1NZ0 A;  4FWH A;  1IBM I;  4MYT A;  3M6A A;  1ELO A;  4DUY E;  4Z7C A;  1DAR A;  4DV0 I;  1IBK I;  1N33 I;  5GME A;  2ZM6 E;  4LF7 I;  2NPF A;  1RR9 A;  4DV4 I;  1J5E E;  3T1Y E;  1EI1 A;  2J7K A;  2V8P A;  2ZIT A;  1Z0B A;  1H7S A;  4B3M I;  4URL A;  2X36 A;  4HYM A;  1J5E I;  4DUZ I;  4WUB A;  1FJG I;  4USM A;  2A2C A;  4LF5 E;  2UXC E;  3ZZU A;  3B8H A;  4DV0 E;  1IBK E;  1BKN A;  1KKH A;  4KQV A;  3V5R A;  1FKA E;  1XMO I;  2VQF I;  4GKK E;  1FI4 A;  3QT8 A;  4DPY A;  4FN5 A;  2VQE E;  3PYE A;  4DV1 E;  3JAM Q;  1D6T A;  4JI4 I;  2UXD E;  3PYF A;  4DR5 I;  2UXC I;  4NXN E;  1FJG E;  4DV3 E;  4DR2 E;  1IBL E;  4B3T E;  4DUZ E;  4MYU A;  4LF8 E;  3QT7 A;  4DR4 E;  4B3M E;  5BR8 E;  4P52 A;  4JI1 I;  2E5L E;  2UUC E;  4UT4 A;  1Z5B A;  3WU4 A;  2AJ4 A;  1N34 I;  1FNM A;  4R1F A;  4DV4 E;  4LF7 E;  4WUC A;  4LF9 E;  4DPU A;  3QT5 A;  2Q2E B;  4Z7Y A;  5L3J A; 
#chains in the Genus database with same CATH topology
 4IZK A;  2VF3 A;  2BM1 A;  3OTO E;  1N32 E;  2O1V A;  4PU9 A;  3WU5 A;  2C39 B;  3J7A G;  4BA2 A;  4ISA A;  1UDQ A;  1Z0C A;  4FWG A;  1E3H A;  4IZK B;  1XNR I;  1N0U A;  3GME A;  2Z5C B;  4DV5 I;  5C0X D;  3M7N D;  3PYD A;  3P3C A;  2UUB I;  2IER A;  1HK7 A;  2PO0 A;  1MX0 A;  1HNW I;  4YHH E;  4X65 I;  5A2Q C;  3H4L A;  3HJC A;  3T1H E;  3Q1Q A;  4HXZ A;  2UU9 I;  1MU5 A;  3U1K A;  4DV6 E;  3B78 A;  2JEB A;  4FW3 A;  2PO0 B;  2O1U A;  3T1H I;  1FWL A;  5C0X F;  1HNX I;  4OX9 I;  3HUL A;  4USK A;  4EMD A;  2Z5E A;  2JEA B;  2GQ0 A;  4X62 E;  4JI3 E;  2UUB E;  3WU3 A;  4OO1 B;  4JG4 A;  2Z5B B;  4MU3 A;  3M85 G;  1A6F A;  1XNR E;  2HK3 A;  2V2Q A;  4X62 I;  4JI3 I;  4B3R I;  5EL9 A;  1RRE A;  3PRY A;  2WNR A;  4DR6 I;  2V2Z A;  3F0N A;  4LCF A;  3OTO I;  3B4T A;  2C37 B;  1N32 I;  2GS8 A;  4B3S I;  3J80 C;  2BA1 D;  1VIS A;  4IFD C;  4ZVI A;  4JI8 E;  2HHH E;  4J3D A;  1B63 A;  4AQY I;  4DV7 I;  2JEA A;  4DU7 A;  4LF9 I;  2NN6 B;  4DPW A;  3U1Y A;  4HAC B;  2F4V I;  4LCH A;  1Y4S A;  4DV5 E;  1PVG A;  3P06 A;  3J80 Q;  1XMQ E;  2R42 A;  4JYA I;  4OO1 A;  2E5L I;  2UUC I;  4LCG A;  4IFD B;  5BR8 I;  3P3G A;  1Z0E A;  2DEI A;  2F1D A;  1ZXM A;  5DNL A;  1OJ4 A;  4LF8 I;  4X66 E;  5K36 D;  3ZKD A;  4NXN I;  3JAM C;  5K36 C;  2IOQ A;  2BA0 D;  2CVE A;  1QZR A;  2UXD I;  1USV A;  2A2D A;  1UDO A;  4YY3 E;  4NXM E;  4JI0 E;  3Q6M A;  4OO1 C;  4FW5 A;  2NN6 A;  4OO1 D;  4JI1 E;  4DPT A;  2OI2 A;  2BV3 A;  3PS3 A;  4GKJ E;  4LFC E;  2R3V A;  2UXB E;  1USU A;  3ZKB A;  5FWK A;  4FWD A;  4JV5 I;  4LFB I;  4K0K E;  5K36 A;  1Y5Y A;  3HKM A;  4PRX A;  1N36 E;  5LMN E;  4PRV A;  5LMN I;  3WU6 A;  1N36 I;  2HFS A;  2NN6 C;  4DR1 E;  5IWA E;  2NN6 D;  1Z59 A;  3GLL A;  4K0K I;  2O1T A;  2XEX A;  4JI7 E;  1HR0 I;  4FW9 A;  2HK2 A;  2BA1 G;  1XMO E;  4DXL A;  3ZZT A;  1ZM4 A;  4DR7 I;  1H74 A;  2JE6 B;  1PIE A;  1XXE A;  3D4J A;  1Z0V A;  3LTO A;  1S16 A;  2V2V A;  4DR3 E;  4LF6 E;  4DU8 A;  1XHK A;  2JT2 A;  4YY3 I;  5FLX Q;  2BM0 A;  4NXM I;  5IT9 Q;  1H7U A;  3T1Y I;  4XTJ A;  3PS1 A;  1EA6 A;  4DV2 E;  2ZM6 I;  4LOM A;  4LF5 I;  5FLX C;  4BA1 A;  4OKG A;  2X7I A;  4X66 I;  4DV2 I;  3PYG A;  1B62 A;  2CZ9 A;  2V34 A;  1NHI A;  3J7A M;  2PNZ A;  1P42 A;  1ZM9 A;  4FW4 A;  4DR3 I;  4LF6 I;  1YH8 A;  4LPF A;  4DR7 E;  1NHJ A;  2VES A;  1IBM E;  2NN6 F;  3LPS A;  5DRP A;  2F4V E;  4GQU A;  4MQY A;  2PNZ B;  1HR0 E;  1ZM3 A;  4P7A A;  2UUA I;  3ZM7 A;  4JI7 I;  2HKE A;  3J81 Q;  4DV7 E;  4AQY E;  4JI8 I;  2HHH I;  5IWA I;  4DR1 I;  2C39 A;  4IZJ A;  2EFG A;  1N33 E;  1YHC A;  1E3P A;  4BA1 B;  4FW7 A;  4DUY I;  3LNU A;  4IS9 A;  4LFB E;  4WUD A;  4JV5 E;  4OO1 E;  3PS2 A;  4IZJ D;  4OO1 F;  4MU0 A;  4LFA I;  5LMU I;  2HFU A;  2UXB I;  4LFC I;  4GKJ I;  1WUU A;  1Z0W A;  1S4E A;  5GMD A;  1ZXN A;  2JEB B;  3V2U C;  1KIJ A;  4IFD A;  4OX9 E;  4JI0 I;  4U3B A;  1I94 I;  1HNX E;  3P3E A;  5DNX A;  3QT6 A;  1Y60 A;  3ZZ0 A;  1XNQ I;  4AIM A;  4QNJ A;  4M1K A;  4NBQ A;  2UU9 E;  5A2Q Q;  5K36 E;  4JI2 I;  3B82 A;  2PO2 A;  5IT9 C;  4JI5 I;  4JI6 I;  1OYS A;  4X65 E;  4IFD D;  2WW4 A;  5EKW A;  1Z5A A;  2NN6 E;  4IFD E;  3L7Z A;  3DD6 A;  3CWV A;  3GON A;  1VI7 A;  2HKJ A;  4LF4 I;  4MU1 A;  4JYA E;  1XMQ I;  1H72 C;  4LF4 E;  5C0X E;  2PO1 B;  4RPF A;  4KHP I;  1UDN A;  1Z0T A;  1Z0G A;  4UTG A;  4AID A;  4DPX A;  1HNZ I;  4X64 E;  2PO2 B;  4MU4 A;  1K47 A;  1Z5C A;  2ZBK B;  4N3O A;  4X64 I;  4JI2 E;  1HNZ E;  1R6L A;  1U2R A;  1RHY A;  1N34 E;  4IFD F;  2IOP A;  4B3S E;  1R6M A;  4KHP E;  1Y4U A;  1ZM2 A;  1I94 E;  3J81 C;  3CDJ A;  3Q6N A;  2LJP A;  4IZJ B;  4DR6 E;  1NHH A;  4B3R E;  4HAC A;  2PNM A;  2WNR B;  2O3Z A;  4DR4 I;  5LMU E;  5LL6 R;  3CDI A;  3K1J A;  2BA0 G;  1MG7 A;  1FWK A;  4MDT A;  4B3T I;  1H73 A;  4DV3 I;  4DR2 I;  1IBL I;  2PO1 A;  4ED4 A;  1PKP A;  4JI6 E;  4JI5 E;  1KTV A;  3M85 D;  4DR5 E;  4DV6 I;  4JI4 E;  1OYR A;  2CGE A;  1XNQ E;  4DV1 I;  1KVK A;  2VQE I;  4AM3 A;  4YHH I;  2DEJ A;  4I3H A;  3K17 A;  1UEK A;  1HNW E;  2E1R A;  2UUA E;  1N0V C;  2VQF E;  4GKK I;  2Z5C A;  4HY1 A;  2C38 B;  4LFA E;  1NZ0 A;  4FWH A;  1IBM I;  5ELW A;  4MYT A;  3M6A A;  1ELO A;  4DUY E;  1Y6Z A;  4Z7C A;  1DAR A;  2CG9 A;  4DV0 I;  1IBK I;  1N33 I;  5DRO A;  5GME A;  4OZE A;  2ZM6 E;  4LF7 I;  2NPF A;  1RR9 A;  4DV4 I;  1J5E E;  3NZK A;  3T1Y E;  2Z5B A;  1EI1 A;  2J7K A;  3KRN A;  2WP8 B;  5DRQ A;  2V8P A;  2ZIT A;  1Z0B A;  2C38 A;  1H7S A;  4B3M I;  2C37 A;  4URL A;  2X36 A;  5JEA A;  4QNK A;  4HYM A;  1J5E I;  4DUZ I;  4WUB A;  1FJG I;  4USM A;  1OYP A;  2A2C A;  4LF5 E;  2UXC E;  5JEA C;  3ZZU A;  3M7N G;  5JEA D;  3B8H A;  5DRR A;  4DV0 E;  3K85 A;  5JEA E;  1IBK E;  5K36 F;  1BKN A;  1KKH A;  4KQV A;  3V5R A;  5K36 B;  1FKA E;  1XMO I;  1UDS A;  2VQF I;  4GKK E;  5JEA B;  1FI4 A;  3QT8 A;  3UHM A;  4DPY A;  4FN5 A;  2VQE E;  3PYE A;  4DV1 E;  3JAM Q;  1D6T A;  2BR2 A;  4JI4 I;  3PYF A;  2UXD E;  2O1W A;  4DR5 I;  2UXC I;  2IES A;  4NXN E;  5JEA F;  1FJG E;  4DV3 E;  4DR2 E;  2JE6 A;  1IBL E;  4B3T E;  4DUZ E;  4MYU A;  3H1C A;  4FW6 A;  4BA2 B;  2BR2 B;  4LF8 E;  3QT7 A;  4DR4 E;  4B3M E;  2GO4 A;  5BR8 E;  5C0X C;  4P52 A;  4JI1 I;  3P76 A;  2E5L E;  2UUC E;  2AE8 A;  4UT4 A;  3GCM A;  3L7Z B;  1Z5B A;  3WU4 A;  2AJ4 A;  2WP8 A;  1N34 I;  5C0X A;  1FNM A;  4R1F A;  4DV4 E;  4LF7 E;  4WUC A;  4LF9 E;  4U3D A;  4DPU A;  2PNL A;  3QT5 A;  2Q2E B;  4Z7Y A;  2GO3 A;  5L3J A;  2J65 A;  5C0X B; 
#chains in the Genus database with same CATH homology
 4IZK A;  2VF3 A;  2BM1 A;  3OTO E;  1N32 E;  2O1V A;  4PU9 A;  3WU5 A;  3J7A G;  1Z0C A;  4FWG A;  4IZK B;  1XNR I;  1N0U A;  2Z5C B;  4DV5 I;  3PYD A;  2UUB I;  1HK7 A;  1MX0 A;  1HNW I;  4YHH E;  4X65 I;  5A2Q C;  3H4L A;  3HJC A;  3T1H E;  3Q1Q A;  4HXZ A;  2UU9 I;  1MU5 A;  4DV6 E;  3B78 A;  2O1U A;  3T1H I;  1FWL A;  1HNX I;  4OX9 I;  3HUL A;  4USK A;  4EMD A;  2Z5E A;  2GQ0 A;  4X62 E;  4JI3 E;  2UUB E;  3WU3 A;  4JG4 A;  2Z5B B;  1A6F A;  1XNR E;  2HK3 A;  2V2Q A;  4X62 I;  4JI3 I;  4B3R I;  1RRE A;  3PRY A;  4DR6 I;  2V2Z A;  3F0N A;  3OTO I;  1N32 I;  2GS8 A;  4B3S I;  3J80 C;  1VIS A;  4ZVI A;  4JI8 E;  2HHH E;  1B63 A;  4AQY I;  4DV7 I;  4DU7 A;  4LF9 I;  4DPW A;  2F4V I;  4HAC B;  1Y4S A;  4DV5 E;  1PVG A;  3P06 A;  3J80 Q;  1XMQ E;  2R42 A;  4JYA I;  2E5L I;  2UUC I;  5BR8 I;  1Z0E A;  2DEI A;  1ZXM A;  1OJ4 A;  4LF8 I;  4X66 E;  3ZKD A;  4NXN I;  3JAM C;  2IOQ A;  1QZR A;  2UXD I;  1USV A;  2A2D A;  4YY3 E;  4NXM E;  4JI0 E;  3Q6M A;  4JI1 E;  4DPT A;  2OI2 A;  2BV3 A;  4GKJ E;  4LFC E;  2R3V A;  2UXB E;  1USU A;  3ZKB A;  5FWK A;  4FWD A;  4JV5 I;  4LFB I;  4K0K E;  4PRX A;  1N36 E;  5LMN E;  4PRV A;  5LMN I;  3WU6 A;  1N36 I;  2HFS A;  4DR1 E;  5IWA E;  1Z59 A;  4K0K I;  2O1T A;  2XEX A;  4JI7 E;  1HR0 I;  4FW9 A;  2HK2 A;  1XMO E;  4DXL A;  3ZZT A;  1ZM4 A;  4DR7 I;  1H74 A;  1PIE A;  3D4J A;  1Z0V A;  3LTO A;  1S16 A;  2V2V A;  4DR3 E;  4LF6 E;  5FLX Q;  1XHK A;  4DU8 A;  4YY3 I;  4NXM I;  2BM0 A;  5IT9 Q;  1H7U A;  3T1Y I;  4XTJ A;  1EA6 A;  4DV2 E;  2ZM6 I;  4LF5 I;  5FLX C;  2X7I A;  4X66 I;  4DV2 I;  3PYG A;  1B62 A;  2CZ9 A;  2V34 A;  1NHI A;  3J7A M;  4DR3 I;  1ZM9 A;  4LF6 I;  4DR7 E;  1NHJ A;  1IBM E;  3LPS A;  2F4V E;  1HR0 E;  1ZM3 A;  4P7A A;  2UUA I;  3ZM7 A;  4JI7 I;  2HKE A;  3J81 Q;  4DV7 E;  4AQY E;  4JI8 I;  2HHH I;  5IWA I;  4DR1 I;  4IZJ A;  2EFG A;  1N33 E;  4DUY I;  3LNU A;  4LFB E;  4WUD A;  4JV5 E;  4IZJ D;  4LFA I;  5LMU I;  2HFU A;  2UXB I;  4LFC I;  4GKJ I;  1WUU A;  1Z0W A;  1S4E A;  5GMD A;  1ZXN A;  3V2U C;  1KIJ A;  4OX9 E;  4JI0 I;  1I94 I;  1HNX E;  3QT6 A;  3ZZ0 A;  1XNQ I;  4M1K A;  2UU9 E;  5A2Q Q;  4JI2 I;  3B82 A;  5IT9 C;  4JI5 I;  4JI6 I;  4X65 E;  2WW4 A;  1Z5A A;  3CWV A;  3GON A;  2HKJ A;  4LF4 I;  4JYA E;  1XMQ I;  1H72 C;  4LF4 E;  4RPF A;  4KHP I;  1Z0T A;  1Z0G A;  4UTG A;  4DPX A;  1HNZ I;  4X64 E;  1K47 A;  1Z5C A;  2ZBK B;  4N3O A;  4X64 I;  4JI2 E;  1HNZ E;  1U2R A;  1N34 E;  2IOP A;  4B3S E;  4KHP E;  1Y4U A;  1ZM2 A;  1I94 E;  3J81 C;  3Q6N A;  2LJP A;  4IZJ B;  4DR6 E;  1NHH A;  4B3R E;  4HAC A;  2PNM A;  4DR4 I;  5LMU E;  5LL6 R;  3K1J A;  1MG7 A;  1FWK A;  4B3T I;  1H73 A;  4DV3 I;  4DR2 I;  1IBL I;  4ED4 A;  1PKP A;  4JI6 E;  4JI5 E;  1KTV A;  4DR5 E;  4DV6 I;  4JI4 E;  2CGE A;  1XNQ E;  4DV1 I;  1KVK A;  2VQE I;  4YHH I;  2DEJ A;  4I3H A;  3K17 A;  1UEK A;  1HNW E;  2E1R A;  2UUA E;  1N0V C;  2VQF E;  4GKK I;  2Z5C A;  4HY1 A;  4LFA E;  1NZ0 A;  4FWH A;  1IBM I;  4MYT A;  3M6A A;  1ELO A;  4DUY E;  1Y6Z A;  4Z7C A;  1DAR A;  2CG9 A;  4DV0 I;  1IBK I;  1N33 I;  5GME A;  2ZM6 E;  4LF7 I;  2NPF A;  1RR9 A;  4DV4 I;  1J5E E;  3T1Y E;  2Z5B A;  1EI1 A;  2J7K A;  2V8P A;  2ZIT A;  1Z0B A;  1H7S A;  4B3M I;  4URL A;  2X36 A;  4HYM A;  1J5E I;  4DUZ I;  4WUB A;  1FJG I;  4USM A;  2A2C A;  4LF5 E;  2UXC E;  3ZZU A;  3B8H A;  4DV0 E;  1IBK E;  3K85 A;  1BKN A;  1KKH A;  4KQV A;  3V5R A;  1FKA E;  1XMO I;  2VQF I;  4GKK E;  1FI4 A;  3QT8 A;  4DPY A;  4FN5 A;  2VQE E;  3PYE A;  4DV1 E;  3JAM Q;  1D6T A;  4JI4 I;  2UXD E;  3PYF A;  2O1W A;  4DR5 I;  2UXC I;  4NXN E;  1FJG E;  4DV3 E;  4DR2 E;  1IBL E;  4B3T E;  4DUZ E;  4MYU A;  4LF8 E;  3QT7 A;  4DR4 E;  4B3M E;  5BR8 E;  4P52 A;  4JI1 I;  2E5L E;  2UUC E;  4UT4 A;  1Z5B A;  3WU4 A;  2AJ4 A;  1N34 I;  1FNM A;  4R1F A;  4DV4 E;  4LF7 E;  4WUC A;  4LF9 E;  4DPU A;  2PNL A;  3QT5 A;  2Q2E B;  4Z7Y A;  5L3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...