4B3MI

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mI00
3ZKBA 4JI8I 2UUAE 1Z5CA 4JV5I 3K1JA 4JI8E 2BM0A 4JV5E 4HACA 4HACB 4R1FA 3JAMC 4WUCA 2HFUA 5A2QC 1H72C 4NXMI 2V2QA 4NXME 3GONA 4LF8I 4DR5I 4JI1I 2HFSA 1PKPA 3ZKDA 4LF8E 4DR5E 1HNXI 4JI1E 3ZZUA 2UUBI 4DV3I 4DUZI 2UUBE 1S16A 4DV3E 4DUZE 4HXZA 4YHHE 2V34A 1Z0VA 3PYEA 4JG4A 1PIEA 2ZBKB 1Z59A 4FW9A 3LTOA 4KQVA 1FWLA 4DV5I 1ZXMA 4JI5I 4DV5E 1NZ0A 4DV7I 4JI5E 4DV1I 4DV7E 1XNQI 2HKJA 4DV1E 5A2QQ 3T1YI 1ELOA 3T1YE 4LF7E 3H4LA 4LFCI 1Z5AA 4LFCE 4P52A 1D6TA 4GKKE 5BR8I 3HULA 4Z7CA 4USKA 2VQFI 2A2CA 2VQFE 2AJ4A 2HHHI 1A6FA 1FNMA 2HHHE 4JI7I 4PRXA 1I94I 4JI7E 2OI2A 1I94E 5LMUI 1FJGI 1IBLE 5LMUE 1FJGE 4UT4A 3QT7A 3LNUA 4LF4I 4LF4E 4HYMA 2V8PA 5LMNI 1RR9A 4DR1I 1K47A 5LMNE 4DR1E 4I3HA 4B3TI 4Z7YA 4B3TE 4PU9A 4X62I 4KHPI 4X65I 2VF3A 4X62E 4KHPE 4X65E 1KTVA 1FI4A 1OJ4A 1ZM3A 3WU4A 3J7AM 4LFAI 3QT8A 4DR4I 1KVKA 4LFAE 4DR4E 4EMDA 1S4EA 3K17A 5GMEA 2UU9I 1ZM9A 2R42A 2DEJA 1HNXE 1H7SA 2UU9E 3WU3A 4DPTA 4DU8A 3CWVA 4DR3I 4FWHA 4PRVA 4DR3E 3V5RA 4HY1A 1H7UA 1NHJA 5IT9C 3J81C 1J5EI 1J5EE 4DR6I 2X36A 2UUCI 1N33I 4DR6E 2UUCE 4URLA 1N33E 5L3JA 2HK3A 4JI3I 5IWAI 1XNQE 2HK2A 3WU6A 4JI3E 5IWAE 4FWDA 1MU5A 4K0KI 3OTOI 4K0KE 3OTOE 4GKJI 4ZVIA 4DV4I 1QZRA 4WUDA 4DV0I 4DV4E 4DV0E 4DU7A 4DPXA 1B62A 1XMQI 2VQEI 4MYTA 1XHKA 1MG7A 1XMQE 2VQEE 4DV6I 5IT9Q 4DV6E 2HKEA 3J81Q 5BR8E 5GMDA 1N36I 1N34I 2UXDI 3J7AG 1N36E 1N34E 2UXDE 2BV3A 1Z0WA 2BM1A 1HNWI 3D4JA 2E1RA 4B3SI 4JI4I 2GS8A 3ZZ0A 1HNWE 1KKHA 4B3SE 4JI4E 2XEXA 4M1KA 4DPUA 4JI2I 3Q1QA 3PYDA 4JI2E 1Z0CA 2X7IA 4JI0I 4LFBI 4JI0E 4DR7I 4LFBE 4DR7E 1RREA 1DARA 3WU5A 1ZXNA 2WW4A 4LF6I 4LF6E 3B78A 1PVGA 4P7AA 4MYUA 4JYAI 1XMOI 2NPFA 4JYAE 4RPFA 4DXLA 1BKNA 4B3RI 1N0UA 1B63A 4B3RE 3M6AA 2EFGA 1IBMI 1IBME 4USMA 4YY3I 2V2VA 2Q2EB 4YY3E 2E5LI 3PYGA 4FN5A 2E5LE 1VISA 1N0VC 3V2UC 2UXCI 4LF9I 1NHHA 2UXBI 1Z0GA 2V2ZA 1Z0TA 2UXCE 4LF9E 4DPWA 1HNZI 2UXBE 1HNZE 4DUYI 2A2DA 4YHHI 1EI1A 4DUYE 4AQYI 4JI6I 4AQYE 4X66I 4JI6E 4X66E 3QT5A 5FLXC 1H74A 4OX9I 1UEKA 1EA6A 1FWKA 4ED4A 4OX9E 4GKJE 4B3MI 4B3ME 3JAMQ 4FWGA 4LF5I 2F4VI 4LF5E 2F4VE 1MX0A 2ZITA 1N32I 2J7KA 4DPYA 1N32E 4XTJA 4LF7I 1FKAE 3ZM7A 3B8HA 3T1HI 3T1HE 5LL6R 2ZM6I 3J80C 2ZM6E 4X64I 1HR0I 2CZ9A 1HR0E 4X64E 4GKKI 1ZM2A 2LJPA 5FLXQ 1U2RA 2R3VA 4NXNI 3ZZTA 1NHIA 4NXNE 2DEIA 3F0NA 1IBKI 4DV2I 1IBKE 4DV2E 1XNRI 1H73A 1KIJA 3B82A 4WUBA 1XNRE 1IBLI 4DR2I 4DR2E 1Z0EA 4UTGA 1WUUA 1Z0BA 3PYFA 1XMOE 1Z5BA 3J80Q 1ZM4A 3QT6A 2UUAI 3LPSA
chains in the Genus database with same CATH superfamily
3ZKBA 4JI8I 2UUAE 1Z5CA 4JV5I 3K1JA 4JI8E 2BM0A 4JV5E 4HACA 3L7ZA 4HACB 4R1FA 3JAMC 4WUCA 2HFUA 5A2QC 1UDOA 1H72C 4NXMI 2PNZA 2O1VA 4OO1F 2V2QA 4NXME 3GONA 5C0XF 4LF8I 4DR5I 4JI1I 2HFSA 1PKPA 5DNXA 4FW5A 3ZKDA 5DROA 4DR5E 1HNXI 4JI1E 4LF8E 3P3CA 3P3GA 2BR2A 3ZZUA 2UUBI 2JEBB 2BR2B 2JE6A 4DV3I 4DUZI 2UUBE 1S16A 2JE6B 2PNMA 4DV3E 4DUZE 4HXZA 4YHHE 1XXEA 2V34A 1Z0VA 5EKWA 3PYEA 4JG4A 5DRRA 4U3BA 1PIEA 3CDIA 3GMEA 4LCHA 4MU1A 2ZBKB 5K36F 1Z59A 4FW9A 3LTOA 4KQVA 1FWLA 4DV5I 1R6MA 1ZXMA 4JI5I 4DV5E 1NZ0A 4DV7I 4JI5E 4DV1I 4DV7E 1XNQI 2HKJA 4DV1E 2F1DA 5A2QQ 3T1YI 1OYPA 5DRQA 4IFDE 1ELOA 3T1YE 4LF7E 4IFDA 3H4LA 4IFDB 2C37A 4LFCI 2BA0D 1Z5AA 2C37B 1UDQA 4LFCE 5FWKA 4P52A 4FW4A 1D6TA 3PRYA 2WNRA 4GKKE 5BR8I 2WNRB 3HULA 4ISAA 4Z7CA 1YH8A 1Y4SA 4N3OA 3HKMA 4USKA 2VQFI 2A2CA 4IFDD 3B4TA 2VQFE 2GO3A 2AJ4A 2HHHI 1A6FA 3GLLA 1FNMA 2HHHE 4JI7I 4PRXA 5DRPA 1I94I 1E3HA 4JI7E 2OI2A 2PO1A 4OKGA 1I94E 5LMUI 3Q6MA 2PO1B 1FJGI 1VI7A 1IBLE 5LMUE 1FJGE 4UT4A 3QT7A 3LNUA 4LF4I 1USUA 4LF4E 4HYMA 2V8PA 5LMNI 1RR9A 4DR1I 1K47A 2AE8A 5LMNE 2O1UA 4DR1E 4I3HA 5JEAF 4B3TI 2CG9A 4Z7YA 1UDNA 4B3TE 4PU9A 4MU3A 4X62I 4KHPI 4X65I 3L7ZB 2VF3A 4BA2A 4X62E 4KHPE 4X65E 4BA2B 2IOPA 1KTVA 1FI4A 1OJ4A 2NN6F 3KRNA 1ZM3A 3WU4A 4LPFA 3J7AM 4LFAI 3QT8A 4DR4I 4IZJD 1KVKA 2PNZB 4LFAE 3PS2A 4DR4E 4IFDC 4MU4A 4EMDA 1S4EA 3K17A 2BA0G 4FW7A 1ZM9A 5GMEA 2UU9I 2R42A 2DEJA 1HNXE 1H7SA 3U1KA 2UU9E 4QNKA 3WU3A 4DPTA 4DU8A 3M85D 3CWVA 4DR3I 4FWHA 4PRVA 4DR3E 2CGEA 3V5RA 4HY1A 1H7UA 1NHJA 5IT9C 3J81C 2CVEA 4IS9A 2C39A 1J5EI 4FW6A 3NZKA 1J5EE 4OO1E 4DR6I 2X36A 2UUCI 1N33I 5C0XE 2JT2A 4DR6E 2UUCE 4URLA 4U3DA 1N33E 5L3JA 4OO1A 2HK3A 4JI3I 2VESA 5IWAI 1XNQE 2HK2A 3WU6A 2BA1D 4JI3E 5IWAE 2IESA 4FWDA 1MU5A 4K0KI 5JEAD 3OTOI 4K0KE 2J65A 4NBQA 3OTOE 2PO2A 3DD6A 4BA1A 4GKJI 4ZVIA 4BA1B 4DV4I 1QZRA 4WUDA 3PS3A 4DV0I 4DV4E 4DU7A 4DV0E 4DPXA 5K36E 1B62A 1XMQI 2VQEI 4MYTA 1XHKA 1MG7A 1Y6ZA 5K36A 1XMQE 2VQEE 4OO1D 5K36B 5C0XD 4DV6I 1USVA 5IT9Q 4DV6E 2HKEA 3J81Q 5BR8E 3UHMA 3CDJA 5GMDA 1N36I 3M7NG 1N34I 2UXDI 3J7AG 1N36E 1N34E 2UXDE 2BV3A 1Z0WA 2BM1A 3M85G 5K36D 1Y5YA 1HNWI 3D4JA 2E1RA 4B3SI 4JI4I 2GS8A 3ZZ0A 1HNWE 1KKHA 4B3SE 4JI4E 2XEXA 4M1KA 2WP8A 4MU0A 4DPUA 4JI2I 2GQ0A 2WP8B 3Q1QA 3PYDA 4JI2E 1Z0CA 2X7IA 4JI0I 4LFBI 4AM3A 4IZJA 2Z5CA 4JI0E 4DR7I 4OZEA 4IZJB 2Z5CB 1UDSA 4LFBE 4DR7E 1RREA 2Z5BA 1DARA 2Z5BB 4LCFA 3WU5A 1ZXNA 2WW4A 4LF6I 2IOQA 4LF6E 4LOMA 4OO1C 3B78A 2BA1G 1PVGA 4P7AA 4MYUA 4JYAI 1XMOI 2NPFA 4JYAE 4RPFA 1Y60A 3P06A 4DXLA 1BKNA 3M7ND 4B3RI 1N0UA 1B63A 1P42A 4B3RE 3M6AA 2EFGA 1IBMI 1IBME 1HK7A 4USMA 4YY3I 2V2VA 2Q2EB 4YY3E 5K36C 5JEAE 3P3EA 4MQYA 2E5LI 3PYGA 5JEAA 4FN5A 2E5LE 5JEAB 4J3DA 1VISA 1N0VC 1RHYA 3V2UC 2NN6E 2UXCI 4LF9I 2C39B 2JEBA 1NHHA 2UXBI 1Z0GA 2V2ZA 1Z0TA 2UXCE 2NN6A 4DPWA 1HNZI 4LF9E 2UXBE 2NN6B 1HNZE 4QNJA 4DUYI 2A2DA 4YHHI 3U1YA 1EI1A 4DUYE 4IFDF 1E3PA 2Z5EA 5C0XA 4OO1B 4MDTA 4AQYI 4JI6I 5C0XB 4AQYE 4X66I 4JI6E 4X66E 3QT5A 5FLXC 2PO0A 1H74A 3PS1A 2PO0B 4OX9I 1UEKA 1EA6A 1FWKA 2PO2B 4ED4A 4OX9E 4GKJE 4B3MI 5ELWA 4AIDA 2IERA 3Q6NA 2NN6D 4B3ME 3JAMQ 4FWGA 4LF5I 2F4VI 2GO4A 4LF5E 2F4VE 1MX0A 2ZITA 1N32I 4GQUA 2J7KA 4DPYA 1N32E 1OYRA 3HJCA 4XTJA 4LF7I 1FKAE 3ZM7A 3B8HA 3T1HI 2PNLA 3T1HE 5LL6R 2ZM6I 2JEAA 3H1CA 2JEAB 2O1TA 5EL9A 3J80C 4X64I 2ZM6E 1HR0I 1OYSA 2CZ9A 1HR0E 4X64E 3GCMA 4GKKI 1ZM2A 2LJPA 5FLXQ 4FW3A 2C38A 1U2RA 4IZKA 2C38B 4IZKB 2R3VA 4NXNI 5JEAC 3ZZTA 1NHIA 4NXNE 4AIMA 2DEIA 3F0NA 1IBKI 4DV2I 1IBKE 4DV2E 1XNRI 1H73A 2O1WA 1KIJA 3B82A 4WUBA 3P76A 1XNRE 2NN6C 1IBLI 4DR2I 3K85A 4DR2E 1Y4UA 1Z0EA 1R6LA 2O3ZA 5C0XC 4UTGA 1YHCA 1WUUA 1Z0BA 3PYFA 1XMOE 1Z5BA 3J80Q 1ZM4A 3QT6A 5DNLA 2UUAI 4LCGA 3LPSA
chains in the Genus database with same CATH topology
3ZKBA 4JI8I 2UUAE 1Z5CA 4JV5I 3K1JA 4JI8E 2BM0A 4JV5E 4HACA 4HACB 4R1FA 3JAMC 4WUCA 2HFUA 5A2QC 1H72C 4NXMI 2O1VA 2V2QA 4NXME 3GONA 4LF8I 4DR5I 4JI1I 2HFSA 1PKPA 3ZKDA 4LF8E 4DR5E 1HNXI 4JI1E 3ZZUA 2UUBI 4DV3I 4DUZI 2UUBE 1S16A 2PNMA 4DV3E 4DUZE 4HXZA 4YHHE 2V34A 1Z0VA 3PYEA 4JG4A 1PIEA 2ZBKB 1Z59A 4FW9A 3LTOA 4KQVA 1FWLA 4DV5I 1ZXMA 4JI5I 4DV5E 1NZ0A 4DV7I 4JI5E 4DV1I 4DV7E 1XNQI 2HKJA 4DV1E 5A2QQ 3T1YI 1ELOA 3T1YE 4LF7E 3H4LA 4LFCI 1Z5AA 4LFCE 5FWKA 4P52A 1D6TA 3PRYA 4GKKE 5BR8I 3HULA 4Z7CA 1Y4SA 4N3OA 4USKA 2VQFI 2A2CA 2VQFE 2AJ4A 2HHHI 1A6FA 1FNMA 2HHHE 4JI7I 4PRXA 1I94I 4JI7E 2OI2A 1I94E 5LMUI 3Q6MA 1FJGI 1IBLE 5LMUE 1FJGE 4UT4A 3QT7A 3LNUA 4LF4I 1USUA 4LF4E 4HYMA 2V8PA 5LMNI 1RR9A 4DR1I 1K47A 5LMNE 2O1UA 4DR1E 4I3HA 4B3TI 2CG9A 4Z7YA 4B3TE 4PU9A 4X62I 4KHPI 4X65I 2VF3A 4X62E 4KHPE 4X65E 2IOPA 1KTVA 1FI4A 1OJ4A 1ZM3A 3WU4A 3J7AM 4LFAI 3QT8A 4DR4I 4IZJD 1KVKA 4LFAE 4DR4E 4EMDA 1S4EA 3K17A 5GMEA 2UU9I 1ZM9A 2R42A 2DEJA 1HNXE 1H7SA 2UU9E 3WU3A 4DPTA 4DU8A 3CWVA 4DR3I 4FWHA 4PRVA 4DR3E 2CGEA 3V5RA 4HY1A 1H7UA 1NHJA 5IT9C 3J81C 1J5EI 1J5EE 4DR6I 2X36A 2UUCI 1N33I 4DR6E 2UUCE 4URLA 1N33E 5L3JA 2HK3A 4JI3I 5IWAI 1XNQE 2HK2A 3WU6A 4JI3E 5IWAE 4FWDA 1MU5A 4K0KI 3OTOI 4K0KE 3OTOE 4GKJI 4ZVIA 4DV4I 1QZRA 4WUDA 4DV0I 4DV4E 4DV0E 4DU7A 4DPXA 1B62A 1XMQI 2VQEI 4MYTA 1XHKA 1MG7A 1Y6ZA 1XMQE 2VQEE 4DV6I 1USVA 5IT9Q 4DV6E 2HKEA 3J81Q 5BR8E 5GMDA 1N36I 1N34I 2UXDI 3J7AG 1N36E 1N34E 2UXDE 2BV3A 1Z0WA 2BM1A 1HNWI 3D4JA 2E1RA 4B3SI 4JI4I 2GS8A 3ZZ0A 1HNWE 1KKHA 4B3SE 4JI4E 2XEXA 4M1KA 4DPUA 4JI2I 2GQ0A 3Q1QA 3PYDA 4JI2E 1Z0CA 2X7IA 4JI0I 4LFBI 4IZJA 2Z5CA 4JI0E 4DR7I 4IZJB 2Z5CB 4LFBE 4DR7E 1RREA 2Z5BA 1DARA 2Z5BB 3WU5A 1ZXNA 2WW4A 4LF6I 2IOQA 4LF6E 3B78A 1PVGA 4P7AA 4MYUA 4JYAI 1XMOI 2NPFA 4JYAE 4RPFA 3P06A 4DXLA 1BKNA 4B3RI 1N0UA 1B63A 4B3RE 3M6AA 2EFGA 1IBMI 1IBME 1HK7A 4USMA 4YY3I 2V2VA 2Q2EB 4YY3E 2E5LI 3PYGA 4FN5A 2E5LE 1VISA 1N0VC 3V2UC 2UXCI 4LF9I 1NHHA 2UXBI 1Z0GA 2V2ZA 1Z0TA 2UXCE 4LF9E 4DPWA 1HNZI 2UXBE 1HNZE 4DUYI 2A2DA 4YHHI 1EI1A 4DUYE 2Z5EA 4AQYI 4JI6I 4AQYE 4X66I 4JI6E 4X66E 3QT5A 5FLXC 1H74A 4OX9I 1UEKA 1EA6A 1FWKA 4ED4A 4OX9E 4GKJE 4B3MI 3Q6NA 4B3ME 3JAMQ 4FWGA 4LF5I 2F4VI 4LF5E 2F4VE 1MX0A 2ZITA 1N32I 2J7KA 4DPYA 1N32E 3HJCA 4XTJA 4LF7I 1FKAE 3ZM7A 3B8HA 3T1HI 2PNLA 3T1HE 5LL6R 2ZM6I 2O1TA 3J80C 2ZM6E 4X64I 1HR0I 2CZ9A 1HR0E 4X64E 4GKKI 1ZM2A 2LJPA 5FLXQ 1U2RA 4IZKA 4IZKB 2R3VA 4NXNI 3ZZTA 1NHIA 4NXNE 2DEIA 3F0NA 1IBKI 4DV2I 1IBKE 4DV2E 1XNRI 1H73A 2O1WA 1KIJA 3B82A 4WUBA 1XNRE 1IBLI 4DR2I 3K85A 4DR2E 1Y4UA 1Z0EA 4UTGA 1WUUA 1Z0BA 3PYFA 1XMOE 1Z5BA 3J80Q 1ZM4A 3QT6A 2UUAI 3LPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZKB A;  4JI8 I;  2UUA E;  1Z5C A;  4JV5 I;  3K1J A;  4JI8 E;  2BM0 A;  4JV5 E;  4HAC A;  4HAC B;  4R1F A;  3JAM C;  4WUC A;  2HFU A;  5A2Q C;  1H72 C;  4NXM I;  2V2Q A;  4NXM E;  3GON A;  4LF8 I;  4DR5 I;  4JI1 I;  2HFS A;  1PKP A;  3ZKD A;  4LF8 E;  4DR5 E;  1HNX I;  4JI1 E;  3ZZU A;  2UUB I;  4DV3 I;  4DUZ I;  2UUB E;  1S16 A;  4DV3 E;  4DUZ E;  4HXZ A;  4YHH E;  2V34 A;  1Z0V A;  3PYE A;  4JG4 A;  1PIE A;  2ZBK B;  1Z59 A;  4FW9 A;  3LTO A;  4KQV A;  1FWL A;  4DV5 I;  1ZXM A;  4JI5 I;  4DV5 E;  1NZ0 A;  4DV7 I;  4JI5 E;  4DV1 I;  4DV7 E;  1XNQ I;  2HKJ A;  4DV1 E;  5A2Q Q;  3T1Y I;  1ELO A;  3T1Y E;  4LF7 E;  3H4L A;  4LFC I;  1Z5A A;  4LFC E;  4P52 A;  1D6T A;  4GKK E;  5BR8 I;  3HUL A;  4Z7C A;  4USK A;  2VQF I;  2A2C A;  2VQF E;  2AJ4 A;  2HHH I;  1A6F A;  1FNM A;  2HHH E;  4JI7 I;  4PRX A;  1I94 I;  4JI7 E;  2OI2 A;  1I94 E;  5LMU I;  1FJG I;  1IBL E;  5LMU E;  1FJG E;  4UT4 A;  3QT7 A;  3LNU A;  4LF4 I;  4LF4 E;  4HYM A;  2V8P A;  5LMN I;  1RR9 A;  4DR1 I;  1K47 A;  5LMN E;  4DR1 E;  4I3H A;  4B3T I;  4Z7Y A;  4B3T E;  4PU9 A;  4X62 I;  4KHP I;  4X65 I;  2VF3 A;  4X62 E;  4KHP E;  4X65 E;  1KTV A;  1FI4 A;  1OJ4 A;  1ZM3 A;  3WU4 A;  3J7A M;  4LFA I;  3QT8 A;  4DR4 I;  1KVK A;  4LFA E;  4DR4 E;  4EMD A;  1S4E A;  3K17 A;  5GME A;  2UU9 I;  1ZM9 A;  2R42 A;  2DEJ A;  1HNX E;  1H7S A;  2UU9 E;  3WU3 A;  4DPT A;  4DU8 A;  3CWV A;  4DR3 I;  4FWH A;  4PRV A;  4DR3 E;  3V5R A;  4HY1 A;  1H7U A;  1NHJ A;  5IT9 C;  3J81 C;  1J5E I;  1J5E E;  4DR6 I;  2X36 A;  2UUC I;  1N33 I;  4DR6 E;  2UUC E;  4URL A;  1N33 E;  5L3J A;  2HK3 A;  4JI3 I;  5IWA I;  1XNQ E;  2HK2 A;  3WU6 A;  4JI3 E;  5IWA E;  4FWD A;  1MU5 A;  4K0K I;  3OTO I;  4K0K E;  3OTO E;  4GKJ I;  4ZVI A;  4DV4 I;  1QZR A;  4WUD A;  4DV0 I;  4DV4 E;  4DV0 E;  4DU7 A;  4DPX A;  1B62 A;  1XMQ I;  2VQE I;  4MYT A;  1XHK A;  1MG7 A;  1XMQ E;  2VQE E;  4DV6 I;  5IT9 Q;  4DV6 E;  2HKE A;  3J81 Q;  5BR8 E;  5GMD A;  1N36 I;  1N34 I;  2UXD I;  3J7A G;  1N36 E;  1N34 E;  2UXD E;  2BV3 A;  1Z0W A;  2BM1 A;  1HNW I;  3D4J A;  2E1R A;  4B3S I;  4JI4 I;  2GS8 A;  3ZZ0 A;  1HNW E;  1KKH A;  4B3S E;  4JI4 E;  2XEX A;  4M1K A;  4DPU A;  4JI2 I;  3Q1Q A;  3PYD A;  4JI2 E;  1Z0C A;  2X7I A;  4JI0 I;  4LFB I;  4JI0 E;  4DR7 I;  4LFB E;  4DR7 E;  1RRE A;  1DAR A;  3WU5 A;  1ZXN A;  2WW4 A;  4LF6 I;  4LF6 E;  3B78 A;  1PVG A;  4P7A A;  4MYU A;  4JYA I;  1XMO I;  2NPF A;  4JYA E;  4RPF A;  4DXL A;  1BKN A;  4B3R I;  1N0U A;  1B63 A;  4B3R E;  3M6A A;  2EFG A;  1IBM I;  1IBM E;  4USM A;  4YY3 I;  2V2V A;  2Q2E B;  4YY3 E;  2E5L I;  3PYG A;  4FN5 A;  2E5L E;  1VIS A;  1N0V C;  3V2U C;  2UXC I;  4LF9 I;  1NHH A;  2UXB I;  1Z0G A;  2V2Z A;  1Z0T A;  2UXC E;  4LF9 E;  4DPW A;  1HNZ I;  2UXB E;  1HNZ E;  4DUY I;  2A2D A;  4YHH I;  1EI1 A;  4DUY E;  4AQY I;  4JI6 I;  4AQY E;  4X66 I;  4JI6 E;  4X66 E;  3QT5 A;  5FLX C;  1H74 A;  4OX9 I;  1UEK A;  1EA6 A;  1FWK A;  4ED4 A;  4OX9 E;  4GKJ E;  4B3M I;  4B3M E;  3JAM Q;  4FWG A;  4LF5 I;  2F4V I;  4LF5 E;  2F4V E;  1MX0 A;  2ZIT A;  1N32 I;  2J7K A;  4DPY A;  1N32 E;  4XTJ A;  4LF7 I;  1FKA E;  3ZM7 A;  3B8H A;  3T1H I;  3T1H E;  5LL6 R;  2ZM6 I;  3J80 C;  2ZM6 E;  4X64 I;  1HR0 I;  2CZ9 A;  1HR0 E;  4X64 E;  4GKK I;  1ZM2 A;  2LJP A;  5FLX Q;  1U2R A;  2R3V A;  4NXN I;  3ZZT A;  1NHI A;  4NXN E;  2DEI A;  3F0N A;  1IBK I;  4DV2 I;  1IBK E;  4DV2 E;  1XNR I;  1H73 A;  1KIJ A;  3B82 A;  4WUB A;  1XNR E;  1IBL I;  4DR2 I;  4DR2 E;  1Z0E A;  4UTG A;  1WUU A;  1Z0B A;  3PYF A;  1XMO E;  1Z5B A;  3J80 Q;  1ZM4 A;  3QT6 A;  2UUA I;  3LPS A; 
#chains in the Genus database with same CATH topology
 3ZKB A;  4JI8 I;  2UUA E;  1Z5C A;  4JV5 I;  3K1J A;  4JI8 E;  2BM0 A;  4JV5 E;  4HAC A;  3L7Z A;  4HAC B;  4R1F A;  3JAM C;  4WUC A;  2HFU A;  5A2Q C;  1UDO A;  1H72 C;  4NXM I;  2PNZ A;  2O1V A;  4OO1 F;  2V2Q A;  4NXM E;  3GON A;  5C0X F;  4LF8 I;  4DR5 I;  4JI1 I;  2HFS A;  1PKP A;  5DNX A;  4FW5 A;  3ZKD A;  5DRO A;  4DR5 E;  1HNX I;  4JI1 E;  4LF8 E;  3P3C A;  3P3G A;  2BR2 A;  3ZZU A;  2UUB I;  2JEB B;  2BR2 B;  2JE6 A;  4DV3 I;  4DUZ I;  2UUB E;  1S16 A;  2JE6 B;  2PNM A;  4DV3 E;  4DUZ E;  4HXZ A;  4YHH E;  1XXE A;  2V34 A;  1Z0V A;  5EKW A;  3PYE A;  4JG4 A;  5DRR A;  4U3B A;  1PIE A;  3CDI A;  3GME A;  4LCH A;  4MU1 A;  2ZBK B;  5K36 F;  1Z59 A;  4FW9 A;  3LTO A;  4KQV A;  1FWL A;  4DV5 I;  1R6M A;  1ZXM A;  4JI5 I;  4DV5 E;  1NZ0 A;  4DV7 I;  4JI5 E;  4DV1 I;  4DV7 E;  1XNQ I;  2HKJ A;  4DV1 E;  2F1D A;  5A2Q Q;  3T1Y I;  1OYP A;  5DRQ A;  4IFD E;  1ELO A;  3T1Y E;  4LF7 E;  4IFD A;  3H4L A;  4IFD B;  2C37 A;  4LFC I;  2BA0 D;  1Z5A A;  2C37 B;  1UDQ A;  4LFC E;  5FWK A;  4P52 A;  4FW4 A;  1D6T A;  3PRY A;  2WNR A;  4GKK E;  5BR8 I;  2WNR B;  3HUL A;  4ISA A;  4Z7C A;  1YH8 A;  1Y4S A;  4N3O A;  3HKM A;  4USK A;  2VQF I;  2A2C A;  4IFD D;  3B4T A;  2VQF E;  2GO3 A;  2AJ4 A;  2HHH I;  1A6F A;  3GLL A;  1FNM A;  2HHH E;  4JI7 I;  4PRX A;  5DRP A;  1I94 I;  1E3H A;  4JI7 E;  2OI2 A;  2PO1 A;  4OKG A;  1I94 E;  5LMU I;  3Q6M A;  2PO1 B;  1FJG I;  1VI7 A;  1IBL E;  5LMU E;  1FJG E;  4UT4 A;  3QT7 A;  3LNU A;  4LF4 I;  1USU A;  4LF4 E;  4HYM A;  2V8P A;  5LMN I;  1RR9 A;  4DR1 I;  1K47 A;  2AE8 A;  5LMN E;  2O1U A;  4DR1 E;  4I3H A;  5JEA F;  4B3T I;  2CG9 A;  4Z7Y A;  1UDN A;  4B3T E;  4PU9 A;  4MU3 A;  4X62 I;  4KHP I;  4X65 I;  3L7Z B;  2VF3 A;  4BA2 A;  4X62 E;  4KHP E;  4X65 E;  4BA2 B;  2IOP A;  1KTV A;  1FI4 A;  1OJ4 A;  2NN6 F;  3KRN A;  1ZM3 A;  3WU4 A;  4LPF A;  3J7A M;  4LFA I;  3QT8 A;  4DR4 I;  4IZJ D;  1KVK A;  2PNZ B;  4LFA E;  3PS2 A;  4DR4 E;  4IFD C;  4MU4 A;  4EMD A;  1S4E A;  3K17 A;  2BA0 G;  4FW7 A;  1ZM9 A;  5GME A;  2UU9 I;  2R42 A;  2DEJ A;  1HNX E;  1H7S A;  3U1K A;  2UU9 E;  4QNK A;  3WU3 A;  4DPT A;  4DU8 A;  3M85 D;  3CWV A;  4DR3 I;  4FWH A;  4PRV A;  4DR3 E;  2CGE A;  3V5R A;  4HY1 A;  1H7U A;  1NHJ A;  5IT9 C;  3J81 C;  2CVE A;  4IS9 A;  2C39 A;  1J5E I;  4FW6 A;  3NZK A;  1J5E E;  4OO1 E;  4DR6 I;  2X36 A;  2UUC I;  1N33 I;  5C0X E;  2JT2 A;  4DR6 E;  2UUC E;  4URL A;  4U3D A;  1N33 E;  5L3J A;  4OO1 A;  2HK3 A;  4JI3 I;  2VES A;  5IWA I;  1XNQ E;  2HK2 A;  3WU6 A;  2BA1 D;  4JI3 E;  5IWA E;  2IES A;  4FWD A;  1MU5 A;  4K0K I;  5JEA D;  3OTO I;  4K0K E;  2J65 A;  4NBQ A;  3OTO E;  2PO2 A;  3DD6 A;  4BA1 A;  4GKJ I;  4ZVI A;  4BA1 B;  4DV4 I;  1QZR A;  4WUD A;  3PS3 A;  4DV0 I;  4DV4 E;  4DU7 A;  4DV0 E;  4DPX A;  5K36 E;  1B62 A;  1XMQ I;  2VQE I;  4MYT A;  1XHK A;  1MG7 A;  1Y6Z A;  5K36 A;  1XMQ E;  2VQE E;  4OO1 D;  5K36 B;  5C0X D;  4DV6 I;  1USV A;  5IT9 Q;  4DV6 E;  2HKE A;  3J81 Q;  5BR8 E;  3UHM A;  3CDJ A;  5GMD A;  1N36 I;  3M7N G;  1N34 I;  2UXD I;  3J7A G;  1N36 E;  1N34 E;  2UXD E;  2BV3 A;  1Z0W A;  2BM1 A;  3M85 G;  5K36 D;  1Y5Y A;  1HNW I;  3D4J A;  2E1R A;  4B3S I;  4JI4 I;  2GS8 A;  3ZZ0 A;  1HNW E;  1KKH A;  4B3S E;  4JI4 E;  2XEX A;  4M1K A;  2WP8 A;  4MU0 A;  4DPU A;  4JI2 I;  2GQ0 A;  2WP8 B;  3Q1Q A;  3PYD A;  4JI2 E;  1Z0C A;  2X7I A;  4JI0 I;  4LFB I;  4AM3 A;  4IZJ A;  2Z5C A;  4JI0 E;  4DR7 I;  4OZE A;  4IZJ B;  2Z5C B;  1UDS A;  4LFB E;  4DR7 E;  1RRE A;  2Z5B A;  1DAR A;  2Z5B B;  4LCF A;  3WU5 A;  1ZXN A;  2WW4 A;  4LF6 I;  2IOQ A;  4LF6 E;  4LOM A;  4OO1 C;  3B78 A;  2BA1 G;  1PVG A;  4P7A A;  4MYU A;  4JYA I;  1XMO I;  2NPF A;  4JYA E;  4RPF A;  1Y60 A;  3P06 A;  4DXL A;  1BKN A;  3M7N D;  4B3R I;  1N0U A;  1B63 A;  1P42 A;  4B3R E;  3M6A A;  2EFG A;  1IBM I;  1IBM E;  1HK7 A;  4USM A;  4YY3 I;  2V2V A;  2Q2E B;  4YY3 E;  5K36 C;  5JEA E;  3P3E A;  4MQY A;  2E5L I;  3PYG A;  5JEA A;  4FN5 A;  2E5L E;  5JEA B;  4J3D A;  1VIS A;  1N0V C;  1RHY A;  3V2U C;  2NN6 E;  2UXC I;  4LF9 I;  2C39 B;  2JEB A;  1NHH A;  2UXB I;  1Z0G A;  2V2Z A;  1Z0T A;  2UXC E;  2NN6 A;  4DPW A;  1HNZ I;  4LF9 E;  2UXB E;  2NN6 B;  1HNZ E;  4QNJ A;  4DUY I;  2A2D A;  4YHH I;  3U1Y A;  1EI1 A;  4DUY E;  4IFD F;  1E3P A;  2Z5E A;  5C0X A;  4OO1 B;  4MDT A;  4AQY I;  4JI6 I;  5C0X B;  4AQY E;  4X66 I;  4JI6 E;  4X66 E;  3QT5 A;  5FLX C;  2PO0 A;  1H74 A;  3PS1 A;  2PO0 B;  4OX9 I;  1UEK A;  1EA6 A;  1FWK A;  2PO2 B;  4ED4 A;  4OX9 E;  4GKJ E;  4B3M I;  5ELW A;  4AID A;  2IER A;  3Q6N A;  2NN6 D;  4B3M E;  3JAM Q;  4FWG A;  4LF5 I;  2F4V I;  2GO4 A;  4LF5 E;  2F4V E;  1MX0 A;  2ZIT A;  1N32 I;  4GQU A;  2J7K A;  4DPY A;  1N32 E;  1OYR A;  3HJC A;  4XTJ A;  4LF7 I;  1FKA E;  3ZM7 A;  3B8H A;  3T1H I;  2PNL A;  3T1H E;  5LL6 R;  2ZM6 I;  2JEA A;  3H1C A;  2JEA B;  2O1T A;  5EL9 A;  3J80 C;  4X64 I;  2ZM6 E;  1HR0 I;  1OYS A;  2CZ9 A;  1HR0 E;  4X64 E;  3GCM A;  4GKK I;  1ZM2 A;  2LJP A;  5FLX Q;  4FW3 A;  2C38 A;  1U2R A;  4IZK A;  2C38 B;  4IZK B;  2R3V A;  4NXN I;  5JEA C;  3ZZT A;  1NHI A;  4NXN E;  4AIM A;  2DEI A;  3F0N A;  1IBK I;  4DV2 I;  1IBK E;  4DV2 E;  1XNR I;  1H73 A;  2O1W A;  1KIJ A;  3B82 A;  4WUB A;  3P76 A;  1XNR E;  2NN6 C;  1IBL I;  4DR2 I;  3K85 A;  4DR2 E;  1Y4U A;  1Z0E A;  1R6L A;  2O3Z A;  5C0X C;  4UTG A;  1YHC A;  1WUU A;  1Z0B A;  3PYF A;  1XMO E;  1Z5B A;  3J80 Q;  1ZM4 A;  3QT6 A;  5DNL A;  2UUA I;  4LCG A;  3LPS A; 
#chains in the Genus database with same CATH homology
 3ZKB A;  4JI8 I;  2UUA E;  1Z5C A;  4JV5 I;  3K1J A;  4JI8 E;  2BM0 A;  4JV5 E;  4HAC A;  4HAC B;  4R1F A;  3JAM C;  4WUC A;  2HFU A;  5A2Q C;  1H72 C;  4NXM I;  2O1V A;  2V2Q A;  4NXM E;  3GON A;  4LF8 I;  4DR5 I;  4JI1 I;  2HFS A;  1PKP A;  3ZKD A;  4LF8 E;  4DR5 E;  1HNX I;  4JI1 E;  3ZZU A;  2UUB I;  4DV3 I;  4DUZ I;  2UUB E;  1S16 A;  2PNM A;  4DV3 E;  4DUZ E;  4HXZ A;  4YHH E;  2V34 A;  1Z0V A;  3PYE A;  4JG4 A;  1PIE A;  2ZBK B;  1Z59 A;  4FW9 A;  3LTO A;  4KQV A;  1FWL A;  4DV5 I;  1ZXM A;  4JI5 I;  4DV5 E;  1NZ0 A;  4DV7 I;  4JI5 E;  4DV1 I;  4DV7 E;  1XNQ I;  2HKJ A;  4DV1 E;  5A2Q Q;  3T1Y I;  1ELO A;  3T1Y E;  4LF7 E;  3H4L A;  4LFC I;  1Z5A A;  4LFC E;  5FWK A;  4P52 A;  1D6T A;  3PRY A;  4GKK E;  5BR8 I;  3HUL A;  4Z7C A;  1Y4S A;  4N3O A;  4USK A;  2VQF I;  2A2C A;  2VQF E;  2AJ4 A;  2HHH I;  1A6F A;  1FNM A;  2HHH E;  4JI7 I;  4PRX A;  1I94 I;  4JI7 E;  2OI2 A;  1I94 E;  5LMU I;  3Q6M A;  1FJG I;  1IBL E;  5LMU E;  1FJG E;  4UT4 A;  3QT7 A;  3LNU A;  4LF4 I;  1USU A;  4LF4 E;  4HYM A;  2V8P A;  5LMN I;  1RR9 A;  4DR1 I;  1K47 A;  5LMN E;  2O1U A;  4DR1 E;  4I3H A;  4B3T I;  2CG9 A;  4Z7Y A;  4B3T E;  4PU9 A;  4X62 I;  4KHP I;  4X65 I;  2VF3 A;  4X62 E;  4KHP E;  4X65 E;  2IOP A;  1KTV A;  1FI4 A;  1OJ4 A;  1ZM3 A;  3WU4 A;  3J7A M;  4LFA I;  3QT8 A;  4DR4 I;  4IZJ D;  1KVK A;  4LFA E;  4DR4 E;  4EMD A;  1S4E A;  3K17 A;  5GME A;  2UU9 I;  1ZM9 A;  2R42 A;  2DEJ A;  1HNX E;  1H7S A;  2UU9 E;  3WU3 A;  4DPT A;  4DU8 A;  3CWV A;  4DR3 I;  4FWH A;  4PRV A;  4DR3 E;  2CGE A;  3V5R A;  4HY1 A;  1H7U A;  1NHJ A;  5IT9 C;  3J81 C;  1J5E I;  1J5E E;  4DR6 I;  2X36 A;  2UUC I;  1N33 I;  4DR6 E;  2UUC E;  4URL A;  1N33 E;  5L3J A;  2HK3 A;  4JI3 I;  5IWA I;  1XNQ E;  2HK2 A;  3WU6 A;  4JI3 E;  5IWA E;  4FWD A;  1MU5 A;  4K0K I;  3OTO I;  4K0K E;  3OTO E;  4GKJ I;  4ZVI A;  4DV4 I;  1QZR A;  4WUD A;  4DV0 I;  4DV4 E;  4DV0 E;  4DU7 A;  4DPX A;  1B62 A;  1XMQ I;  2VQE I;  4MYT A;  1XHK A;  1MG7 A;  1Y6Z A;  1XMQ E;  2VQE E;  4DV6 I;  1USV A;  5IT9 Q;  4DV6 E;  2HKE A;  3J81 Q;  5BR8 E;  5GMD A;  1N36 I;  1N34 I;  2UXD I;  3J7A G;  1N36 E;  1N34 E;  2UXD E;  2BV3 A;  1Z0W A;  2BM1 A;  1HNW I;  3D4J A;  2E1R A;  4B3S I;  4JI4 I;  2GS8 A;  3ZZ0 A;  1HNW E;  1KKH A;  4B3S E;  4JI4 E;  2XEX A;  4M1K A;  4DPU A;  4JI2 I;  2GQ0 A;  3Q1Q A;  3PYD A;  4JI2 E;  1Z0C A;  2X7I A;  4JI0 I;  4LFB I;  4IZJ A;  2Z5C A;  4JI0 E;  4DR7 I;  4IZJ B;  2Z5C B;  4LFB E;  4DR7 E;  1RRE A;  2Z5B A;  1DAR A;  2Z5B B;  3WU5 A;  1ZXN A;  2WW4 A;  4LF6 I;  2IOQ A;  4LF6 E;  3B78 A;  1PVG A;  4P7A A;  4MYU A;  4JYA I;  1XMO I;  2NPF A;  4JYA E;  4RPF A;  3P06 A;  4DXL A;  1BKN A;  4B3R I;  1N0U A;  1B63 A;  4B3R E;  3M6A A;  2EFG A;  1IBM I;  1IBM E;  1HK7 A;  4USM A;  4YY3 I;  2V2V A;  2Q2E B;  4YY3 E;  2E5L I;  3PYG A;  4FN5 A;  2E5L E;  1VIS A;  1N0V C;  3V2U C;  2UXC I;  4LF9 I;  1NHH A;  2UXB I;  1Z0G A;  2V2Z A;  1Z0T A;  2UXC E;  4LF9 E;  4DPW A;  1HNZ I;  2UXB E;  1HNZ E;  4DUY I;  2A2D A;  4YHH I;  1EI1 A;  4DUY E;  2Z5E A;  4AQY I;  4JI6 I;  4AQY E;  4X66 I;  4JI6 E;  4X66 E;  3QT5 A;  5FLX C;  1H74 A;  4OX9 I;  1UEK A;  1EA6 A;  1FWK A;  4ED4 A;  4OX9 E;  4GKJ E;  4B3M I;  3Q6N A;  4B3M E;  3JAM Q;  4FWG A;  4LF5 I;  2F4V I;  4LF5 E;  2F4V E;  1MX0 A;  2ZIT A;  1N32 I;  2J7K A;  4DPY A;  1N32 E;  3HJC A;  4XTJ A;  4LF7 I;  1FKA E;  3ZM7 A;  3B8H A;  3T1H I;  2PNL A;  3T1H E;  5LL6 R;  2ZM6 I;  2O1T A;  3J80 C;  2ZM6 E;  4X64 I;  1HR0 I;  2CZ9 A;  1HR0 E;  4X64 E;  4GKK I;  1ZM2 A;  2LJP A;  5FLX Q;  1U2R A;  4IZK A;  4IZK B;  2R3V A;  4NXN I;  3ZZT A;  1NHI A;  4NXN E;  2DEI A;  3F0N A;  1IBK I;  4DV2 I;  1IBK E;  4DV2 E;  1XNR I;  1H73 A;  2O1W A;  1KIJ A;  3B82 A;  4WUB A;  1XNR E;  1IBL I;  4DR2 I;  3K85 A;  4DR2 E;  1Y4U A;  1Z0E A;  4UTG A;  1WUU A;  1Z0B A;  3PYF A;  1XMO E;  1Z5B A;  3J80 Q;  1ZM4 A;  3QT6 A;  2UUA I;  3LPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...