4B3MI

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mI00
4UTGA 4JI6E 1FJGI 1N36I 4DR2I 4B3SI 1Z0TA 2HKJA 3WU4A 2VQFE 4JI6I 1ZM2A 4DU8A 3HULA 4B3RI 2GS8A 2EFGA 1PVGA 4HACB 2X7IA 4DV3I 2HFUA 1N33I 2DEIA 3ZM7A 4DR1I 4XTJA 1S4EA 2UUBE 4Z7YA 2NPFA 4WUBA 3J81Q 3WU6A 1Z0BA 1Z59A 5LMNE 1Z0WA 3T1HE 1EI1A 3T1HI 4LF4I 3OTOE 4JI7E 1J5EE 4DPXA 3JAMC 1K47A 1XMQE 4JI0E 1I94E 3OTOI 2UU9E 5A2QC 1NHIA 4EMDA 1B63A 1XMQI 1I94I 3ZKDA 3LTOA 2UU9I 1ELOA 1PIEA 4DV7E 4DV0I 4DV7I 4JI8I 1ZM3A 3WU3A 4DV1E 4DR5E 1N34E 1IBLI 3F0NA 1KIJA 1IBKI 4NXME 3GONA 5GMEA 4LF9E 4NXMI 5BR8E 4LFCI 4RPFA 4WUCA 1DARA 4DPUA 5BR8I 1HR0E 2J7KA 3LNUA 3K17A 5FLXC 4USKA 1HR0I 3ZKBA 3J7AM 2V2ZA 2UUCI 1U2RA 2E1RA 4DV5E 4DR4I 1FWLA 3J80C 1MX0A 4DV5I 2UXCI 3M6AA 4PRVA 4DPYA 1Z0CA 1ZM9A 1IBMI 3PYGA 4GKKE 2BV3A 4FWGA 3JAMQ 1N0VC 5A2QQ 4LF5I 2V34A 4DUYI 3QT7A 4MYTA 3T1YI 2UXDE 4FWDA 4DPWA 1HNWE 1FWKA 1NZ0A 1Z0EA 4ED4A 1HNXE 2UXDI 1HNWI 1XNRE 2VQFI 1XNRI 1RREA 2OI2A 4LFAE 4USMA 4LFAI 4DR3E 2V2QA 5FLXQ 2HK3A 3ZZ0A 2UUBI 4DR3I 4DR7E 4KHPE 1NHJA 1Z5AA 4DR7I 4KHPI 3WU5A 4DXLA 4FW9A 3J80Q 1A6FA 4JI2E 1FNMA 4HXZA 5LMNI 1NHHA 2X36A 4X64E 4B3ME 5IWAE 1H74A 4JG4A 4HY1A 4B3MI 4JI7I 1J5EI 4JI0I 2V8PA 3QT6A 2Q2EB 4JV5E 4DPTA 2LJPA 3CWVA 2HHHE 2A2CA 4GKJE 1QZRA 1PKPA 4JV5I 2HHHI 4GKJI 3QT5A 4FWHA 4LFBE 3K1JA 4DV1I 4DR5I 4PRXA 1N34I 4LFBI 4YY3E 4X65E 3Q1QA 4K0KE 4OX9E 3J7AG 2BM1A 2R3VA 4HACA 4K0KI 4OX9I 1D6TA 4LF9I 3V2UC 4LF6E 2R42A 4DR6E 1WUUA 4LF6I 4X66E 4MYUA 3PYEA 4X66I 4KQVA 3H4LA 4AQYE 1UEKA 1MU5A 3PYDA 4R1FA 3ZZTA 1XNQE 4X62E 4URLA 4GKKI 2VQEE 1Z0VA 1H72C 3QT8A 2F4VE 4JI3E 4M1KA 1H7UA 3PYFA 4FN5A 4DUZE 1KKHA 3ZZUA 4I3HA 4Z7CA 4DUZI 4P7AA 1HNXI 1HNZE 3D4JA 1HNZI 4HYMA 1FKAE 5IT9Q 1S16A 4JI4E 4B3RE 4P52A 4JI4I 5LL6R 4DV3E 3B82A 4WUDA 1BKNA 1N33E 4DV4E 4DR1E 2HFSA 1XMOE 4DV4I 4DU7A 2UXBE 1XMOI 4JI2I 4DV2E 2AJ4A 2UXBI 4X64I 4ZVIA 2E5LE 5IWAI 4DV2I 1VISA 2E5LI 4JI5E 1ZM4A 2HKEA 1N32E 5GMDA 4UT4A 4LF4E 1H73A 4JI5I 3B78A 1ZXNA 3B8HA 4LF7E 1N32I 5LMUE 4LF7I 2UUAE 5LMUI 4DV0E 4JYAE 2WW4A 2UUAI 1H7SA 4JYAI 4JI8E 5IT9C 4YY3I 4X65I 2HK2A 1IBLE 2CZ9A 1Z0GA 1IBKE 4NXNE 3LPSA 2V2VA 4LF8E 1ZXMA 1MG7A 4NXNI 4DR6I 4B3TE 4LFCE 4LF8I 2ZBKB 4PU9A 4B3TI 1KTVA 5L3JA 2A2DA 1B62A 4JI1E 2UUCE 4AQYI 2BM0A 1KVKA 4JI1I 4DR4E 1XNQI 1XHKA 3J81C 4X62I 2XEXA 2UXCE 1EA6A 2VQEI 1Z5BA 1IBME 2F4VI 4JI3I 4YHHE 1Z5CA 2ZM6E 1N0UA 4LF5E 3V5RA 1OJ4A 4YHHI 1RR9A 2ZITA 4DUYE 4DV6E 2ZM6I 2VF3A 3T1YE 4DV6I 1FJGE 2DEJA 1N36E 4DR2E 4B3SE 1FI4A
chains in the Genus database with same CATH superfamily
5JEAF 4UTGA 4JI6E 1FJGI 1N36I 4DR2I 4B3SI 1Z0TA 2HKJA 3WU4A 2VQFE 4JI6I 1ZM2A 4DU8A 4IFDA 3HULA 4B3RI 2NN6A 4IZKB 2GS8A 2EFGA 2VESA 1Y4UA 4FW3A 1PVGA 4IFDC 4HACB 4MQYA 2X7IA 4DV3I 2HFUA 2NN6C 5DNXA 1N33I 2DEIA 3ZM7A 4DR1I 5DNLA 4XTJA 1S4EA 3GCMA 2UUBE 1Y60A 4Z7YA 2PNMA 2NPFA 2WP8A 4WUBA 2BR2B 3J81Q 3WU6A 1Z0BA 1Z59A 5LMNE 1Z0WA 3T1HE 5ELWA 1EI1A 4AIDA 3PS3A 3T1HI 4LF4I 3OTOE 2JE6A 2IOQA 4JI7E 1J5EE 4DPXA 3JAMC 1K47A 1XMQE 4JI0E 2GO3A 1I94E 3OTOI 2UU9E 5A2QC 4IZJD 1NHIA 4EMDA 1B63A 1XMQI 1RHYA 2C39B 1I94I 3ZKDA 3LTOA 5C0XB 2UU9I 1ELOA 3L7ZA 1PIEA 4DV7E 3M7ND 4DV0I 4IS9A 5C0XF 4DV7I 2F1DA 4JI8I 2J65A 1ZM3A 3WU3A 5C0XE 4DV1E 4DR5E 1N34E 1IBLI 3F0NA 1KIJA 1IBKI 4NXME 3GONA 3U1KA 2AE8A 5GMEA 2O1UA 4LF9E 4NXMI 4QNKA 5BR8E 4LFCI 4RPFA 4IZJA 5K36D 4WUCA 1DARA 4AIMA 4DPUA 5BR8I 1HR0E 2J7KA 2Z5BA 3LNUA 3K17A 5FLXC 3PS2A 4USKA 1HR0I 3ZKBA 3J7AM 2V2ZA 2UUCI 3P3CA 1U2RA 4QNJA 2E1RA 4DV5E 4DR4I 5EKWA 1FWLA 3J80C 1MX0A 4GQUA 4OO1B 4DV5I 2UXCI 3M6AA 4PRVA 2IERA 4DPYA 1Z0CA 1ZM9A 2Z5EA 3PYGA 1IBMI 4GKKE 2BV3A 4FWGA 4OO1F 3JAMQ 5K36A 5DROA 1N0VC 5A2QQ 4LF5I 2PO2A 2V34A 5K36C 4DUYI 3Q6MA 3QT7A 4MYTA 4OZEA 1OYRA 3T1YI 2UXDE 4FWDA 4DPWA 1HNWE 1FWKA 1NZ0A 1Z0EA 4ED4A 1HNXE 2UXDI 1HNWI 1VI7A 1XNRE 4FW5A 2O3ZA 2VQFI 1XNRI 2PNZA 3H1CA 4LOMA 1RREA 4OO1D 4BA2B 2OI2A 4LFAE 2WNRB 2Z5CB 2C38B 4N3OA 3GLLA 4USMA 4LFAI 4DR3E 2V2QA 4FW7A 3M85D 2JEBA 5FLXQ 2HK3A 5JEAD 3ZZ0A 2CGEA 4DR3I 2UUBI 4DR7E 4KHPE 3PRYA 1NHJA 1Z5AA 2C37A 5DRQA 4DR7I 4KHPI 3WU5A 4DXLA 4FW9A 2BA1D 1XXEA 3J80Q 1A6FA 2PO0B 4JI2E 1FNMA 4HXZA 1Y5YA 5LMNI 4BA1B 1NHHA 2X36A 4OO1A 4X64E 4B3ME 1YHCA 5IWAE 1H74A 2PO1A 4JG4A 4HY1A 1HK7A 2IOPA 4B3MI 4JI7I 1UDNA 4OO1C 1J5EI 2O1VA 4JI0I 4LPFA 2V8PA 3QT6A 5JEAA 2JEAB 2Q2EB 4MU3A 4JV5E 4DPTA 2LJPA 3CWVA 2HHHE 4J3DA 2A2CA 4GKJE 1R6LA 5JEAC 3Q6NA 1QZRA 1PKPA 4JV5I 2HHHI 4GKJI 3QT5A 4FWHA 4LFBE 3K1JA 4NBQA 1UDQA 3B4TA 4MDTA 3UHMA 4DV1I 4DR5I 4PRXA 1N34I 4LFBI 3HKMA 4YY3E 4IZKA 4X65E 3Q1QA 4K0KE 4OX9E 2JT2A 3J7AG 2BM1A 2R3VA 4HACA 2O1WA 4OX9I 4K0KI 1D6TA 4LF9I 4IFDB 1R6MA 3V2UC 4LF6E 2R42A 2CVEA 2NN6B 3P76A 4DR6E 1WUUA 4MU4A 4IFDF 4LF6I 4X66E 4MYUA 5C0XD 2NN6F 3PYEA 4IFDE 4X66I 2BR2A 2NN6E 4KQVA 3H4LA 4AQYE 1UEKA 1MU5A 3PYDA 5DRRA 1YH8A 2WP8B 4R1FA 3ZZTA 4ISAA 4MU1A 1XNQE 4X62E 4URLA 3CDJA 4GKKI 3P3EA 2VQEE 4AM3A 1Z0VA 1UDOA 1H72C 2GQ0A 3QT8A 4JI3E 2F4VE 4M1KA 1H7UA 2C39A 1USUA 2JE6B 3PYFA 4FN5A 5C0XA 4DUZE 1KKHA 3ZZUA 4I3HA 2PNLA 4Z7CA 4DUZI 1Y6ZA 5C0XC 1P42A 4FW4A 5FWKA 4P7AA 1HNXI 3L7ZB 1HNZE 2BA0D 3D4JA 2IESA 2BA1G 1E3HA 1HNZI 4HYMA 1FKAE 5IT9Q 4U3DA 5JEAE 1S16A 4JI4E 3NZKA 4B3RE 1OYSA 4P52A 4LCGA 4JI4I 5LL6R 1OYPA 4DV3E 3B82A 4WUDA 1BKNA 1N33E 4IZJB 4DV4E 4DR1E 3M7NG 3P3GA 4FW6A 3KRNA 2HFSA 2Z5BB 3HJCA 1XMOE 4DV4I 4DU7A 2UXBE 4U3BA 1XMOI 4JI2I 2GO4A 4DV2E 2AJ4A 2UXBI 4X64I 4ZVIA 2E5LE 3GMEA 5IWAI 4DV2I 1VISA 3P06A 5DRPA 2E5LI 4JI5E 1ZM4A 2HKEA 1N32E 5GMDA 2O1TA 4UT4A 1H73A 3K85A 4LF4E 1USVA 4JI5I 3B78A 1ZXNA 3B8HA 4LF7E 1N32I 5K36B 5LMUE 4LCHA 2PO2B 4LF7I 2UUAE 5K36F 5LMUI 4DV0E 4JYAE 2WW4A 5K36E 2UUAI 1H7SA 3U1YA 4JYAI 4JI8E 5IT9C 4YY3I 4X65I 4BA2A 2HK2A 1IBLE 2CZ9A 1Z0GA 1IBKE 4NXNE 2WNRA 2Z5CA 3LPSA 2C38A 2V2VA 1Y4SA 1UDSA 2PNZB 4LF8E 1ZXMA 1MG7A 4NXNI 3PS1A 4DR6I 3CDIA 4B3TE 4LFCE 4LF8I 4MU0A 2ZBKB 4PU9A 4B3TI 5EL9A 2JEBB 1KTVA 5L3JA 2A2DA 1B62A 2PO0A 4JI1E 2UUCE 4AQYI 2BM0A 4BA1A 2C37B 1KVKA 3DD6A 4LCFA 4JI1I 4DR4E 1XNQI 2CG9A 1XHKA 2BA0G 3J81C 4X62I 2XEXA 2UXCE 4OKGA 1EA6A 2VQEI 1Z5BA 4IFDD 1IBME 2JEAA 2PO1B 2F4VI 4JI3I 2NN6D 1Z5CA 4YHHE 3M85G 2ZM6E 1N0UA 4LF5E 3V5RA 1OJ4A 4YHHI 1RR9A 2ZITA 4DUYE 4DV6E 4OO1E 2ZM6I 5JEAB 2VF3A 1E3PA 3T1YE 4DV6I 1FJGE 2DEJA 1N36E 4DR2E 4B3SE 1FI4A
chains in the Genus database with same CATH topology
4UTGA 4JI6E 1FJGI 1N36I 4DR2I 4B3SI 1Z0TA 2HKJA 3WU4A 2VQFE 4JI6I 1ZM2A 4DU8A 3HULA 4B3RI 4IZKB 2GS8A 2EFGA 1Y4UA 1PVGA 4HACB 2X7IA 4DV3I 2HFUA 1N33I 2DEIA 3ZM7A 4DR1I 4XTJA 1S4EA 2UUBE 4Z7YA 2PNMA 2NPFA 4WUBA 3J81Q 3WU6A 1Z0BA 1Z59A 5LMNE 1Z0WA 3T1HE 1EI1A 3T1HI 4LF4I 3OTOE 2IOQA 4JI7E 1J5EE 4DPXA 3JAMC 1K47A 1XMQE 4JI0E 1I94E 3OTOI 2UU9E 5A2QC 4IZJD 1NHIA 4EMDA 1B63A 1XMQI 1I94I 3ZKDA 3LTOA 2UU9I 1ELOA 1PIEA 4DV7E 4DV0I 4DV7I 4JI8I 1ZM3A 3WU3A 4DV1E 4DR5E 1N34E 1IBLI 3F0NA 1KIJA 1IBKI 4NXME 3GONA 5GMEA 2O1UA 4LF9E 4NXMI 5BR8E 4LFCI 4RPFA 4IZJA 4WUCA 1DARA 4DPUA 5BR8I 1HR0E 2J7KA 2Z5BA 3LNUA 3K17A 5FLXC 4USKA 1HR0I 3ZKBA 3J7AM 2V2ZA 2UUCI 1U2RA 2E1RA 4DV5E 4DR4I 1FWLA 3J80C 1MX0A 4DV5I 2UXCI 3M6AA 4PRVA 4DPYA 1Z0CA 1ZM9A 2Z5EA 3PYGA 1IBMI 4GKKE 2BV3A 4FWGA 3JAMQ 1N0VC 5A2QQ 4LF5I 2V34A 4DUYI 3Q6MA 3QT7A 4MYTA 3T1YI 2UXDE 4FWDA 4DPWA 1HNWE 1FWKA 1NZ0A 1Z0EA 4ED4A 1HNXE 2UXDI 1HNWI 1XNRE 2VQFI 1XNRI 1RREA 2OI2A 4LFAE 2Z5CB 4N3OA 4USMA 4LFAI 4DR3E 2V2QA 5FLXQ 2HK3A 3ZZ0A 2CGEA 4DR3I 2UUBI 4DR7E 4KHPE 3PRYA 1NHJA 1Z5AA 4DR7I 4KHPI 3WU5A 4DXLA 4FW9A 3J80Q 1A6FA 4JI2E 1FNMA 4HXZA 5LMNI 1NHHA 2X36A 4X64E 4B3ME 5IWAE 1H74A 4JG4A 4HY1A 1HK7A 2IOPA 4B3MI 4JI7I 1J5EI 2O1VA 4JI0I 2V8PA 3QT6A 2Q2EB 4JV5E 4DPTA 2LJPA 3CWVA 2HHHE 2A2CA 4GKJE 3Q6NA 1QZRA 1PKPA 4JV5I 2HHHI 4GKJI 3QT5A 4FWHA 4LFBE 3K1JA 4DV1I 4DR5I 4PRXA 1N34I 4LFBI 4YY3E 4IZKA 4X65E 3Q1QA 4K0KE 4OX9E 3J7AG 2BM1A 2R3VA 4HACA 2O1WA 4OX9I 4K0KI 1D6TA 4LF9I 3V2UC 4LF6E 2R42A 4DR6E 1WUUA 4LF6I 4X66E 4MYUA 3PYEA 4X66I 4KQVA 3H4LA 4AQYE 1UEKA 1MU5A 3PYDA 4R1FA 3ZZTA 1XNQE 4X62E 4URLA 4GKKI 2VQEE 1Z0VA 1H72C 2GQ0A 3QT8A 4JI3E 2F4VE 4M1KA 1H7UA 1USUA 3PYFA 4FN5A 4DUZE 1KKHA 3ZZUA 4I3HA 2PNLA 4Z7CA 4DUZI 1Y6ZA 5FWKA 4P7AA 1HNXI 1HNZE 3D4JA 1HNZI 4HYMA 1FKAE 5IT9Q 1S16A 4JI4E 4B3RE 4P52A 4JI4I 5LL6R 4DV3E 3B82A 4WUDA 1BKNA 1N33E 4IZJB 4DV4E 4DR1E 2HFSA 2Z5BB 3HJCA 1XMOE 4DV4I 4DU7A 2UXBE 1XMOI 4JI2I 4DV2E 2AJ4A 2UXBI 4X64I 4ZVIA 2E5LE 5IWAI 4DV2I 1VISA 3P06A 2E5LI 4JI5E 1ZM4A 2HKEA 1N32E 5GMDA 2O1TA 4UT4A 1H73A 3K85A 4LF4E 1USVA 4JI5I 3B78A 1ZXNA 3B8HA 4LF7E 1N32I 5LMUE 4LF7I 2UUAE 5LMUI 4DV0E 4JYAE 2WW4A 2UUAI 1H7SA 4JYAI 4JI8E 5IT9C 4YY3I 4X65I 2HK2A 1IBLE 2CZ9A 1Z0GA 1IBKE 4NXNE 2Z5CA 3LPSA 2V2VA 1Y4SA 4LF8E 1ZXMA 1MG7A 4NXNI 4DR6I 4B3TE 4LFCE 4LF8I 2ZBKB 4PU9A 4B3TI 1KTVA 5L3JA 2A2DA 1B62A 4JI1E 2UUCE 4AQYI 2BM0A 1KVKA 4JI1I 4DR4E 1XNQI 2CG9A 1XHKA 3J81C 4X62I 2XEXA 2UXCE 1EA6A 2VQEI 1Z5BA 1IBME 2F4VI 4JI3I 4YHHE 1Z5CA 2ZM6E 1N0UA 4LF5E 3V5RA 1OJ4A 4YHHI 1RR9A 2ZITA 4DUYE 4DV6E 2ZM6I 2VF3A 3T1YE 4DV6I 1FJGE 2DEJA 1N36E 4DR2E 4B3SE 1FI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UTG A;  4JI6 E;  1FJG I;  1N36 I;  4DR2 I;  4B3S I;  1Z0T A;  2HKJ A;  3WU4 A;  2VQF E;  4JI6 I;  1ZM2 A;  4DU8 A;  3HUL A;  4B3R I;  2GS8 A;  2EFG A;  1PVG A;  4HAC B;  2X7I A;  4DV3 I;  2HFU A;  1N33 I;  2DEI A;  3ZM7 A;  4DR1 I;  4XTJ A;  1S4E A;  2UUB E;  4Z7Y A;  2NPF A;  4WUB A;  3J81 Q;  3WU6 A;  1Z0B A;  1Z59 A;  5LMN E;  1Z0W A;  3T1H E;  1EI1 A;  3T1H I;  4LF4 I;  3OTO E;  4JI7 E;  1J5E E;  4DPX A;  3JAM C;  1K47 A;  1XMQ E;  4JI0 E;  1I94 E;  3OTO I;  2UU9 E;  5A2Q C;  1NHI A;  4EMD A;  1B63 A;  1XMQ I;  1I94 I;  3ZKD A;  3LTO A;  2UU9 I;  1ELO A;  1PIE A;  4DV7 E;  4DV0 I;  4DV7 I;  4JI8 I;  1ZM3 A;  3WU3 A;  4DV1 E;  4DR5 E;  1N34 E;  1IBL I;  3F0N A;  1KIJ A;  1IBK I;  4NXM E;  3GON A;  5GME A;  4LF9 E;  4NXM I;  5BR8 E;  4LFC I;  4RPF A;  4WUC A;  1DAR A;  4DPU A;  5BR8 I;  1HR0 E;  2J7K A;  3LNU A;  3K17 A;  5FLX C;  4USK A;  1HR0 I;  3ZKB A;  3J7A M;  2V2Z A;  2UUC I;  1U2R A;  2E1R A;  4DV5 E;  4DR4 I;  1FWL A;  3J80 C;  1MX0 A;  4DV5 I;  2UXC I;  3M6A A;  4PRV A;  4DPY A;  1Z0C A;  1ZM9 A;  1IBM I;  3PYG A;  4GKK E;  2BV3 A;  4FWG A;  3JAM Q;  1N0V C;  5A2Q Q;  4LF5 I;  2V34 A;  4DUY I;  3QT7 A;  4MYT A;  3T1Y I;  2UXD E;  4FWD A;  4DPW A;  1HNW E;  1FWK A;  1NZ0 A;  1Z0E A;  4ED4 A;  1HNX E;  2UXD I;  1HNW I;  1XNR E;  2VQF I;  1XNR I;  1RRE A;  2OI2 A;  4LFA E;  4USM A;  4LFA I;  4DR3 E;  2V2Q A;  5FLX Q;  2HK3 A;  3ZZ0 A;  2UUB I;  4DR3 I;  4DR7 E;  4KHP E;  1NHJ A;  1Z5A A;  4DR7 I;  4KHP I;  3WU5 A;  4DXL A;  4FW9 A;  3J80 Q;  1A6F A;  4JI2 E;  1FNM A;  4HXZ A;  5LMN I;  1NHH A;  2X36 A;  4X64 E;  4B3M E;  5IWA E;  1H74 A;  4JG4 A;  4HY1 A;  4B3M I;  4JI7 I;  1J5E I;  4JI0 I;  2V8P A;  3QT6 A;  2Q2E B;  4JV5 E;  4DPT A;  2LJP A;  3CWV A;  2HHH E;  2A2C A;  4GKJ E;  1QZR A;  1PKP A;  4JV5 I;  2HHH I;  4GKJ I;  3QT5 A;  4FWH A;  4LFB E;  3K1J A;  4DV1 I;  4DR5 I;  4PRX A;  1N34 I;  4LFB I;  4YY3 E;  4X65 E;  3Q1Q A;  4K0K E;  4OX9 E;  3J7A G;  2BM1 A;  2R3V A;  4HAC A;  4K0K I;  4OX9 I;  1D6T A;  4LF9 I;  3V2U C;  4LF6 E;  2R42 A;  4DR6 E;  1WUU A;  4LF6 I;  4X66 E;  4MYU A;  3PYE A;  4X66 I;  4KQV A;  3H4L A;  4AQY E;  1UEK A;  1MU5 A;  3PYD A;  4R1F A;  3ZZT A;  1XNQ E;  4X62 E;  4URL A;  4GKK I;  2VQE E;  1Z0V A;  1H72 C;  3QT8 A;  2F4V E;  4JI3 E;  4M1K A;  1H7U A;  3PYF A;  4FN5 A;  4DUZ E;  1KKH A;  3ZZU A;  4I3H A;  4Z7C A;  4DUZ I;  4P7A A;  1HNX I;  1HNZ E;  3D4J A;  1HNZ I;  4HYM A;  1FKA E;  5IT9 Q;  1S16 A;  4JI4 E;  4B3R E;  4P52 A;  4JI4 I;  5LL6 R;  4DV3 E;  3B82 A;  4WUD A;  1BKN A;  1N33 E;  4DV4 E;  4DR1 E;  2HFS A;  1XMO E;  4DV4 I;  4DU7 A;  2UXB E;  1XMO I;  4JI2 I;  4DV2 E;  2AJ4 A;  2UXB I;  4X64 I;  4ZVI A;  2E5L E;  5IWA I;  4DV2 I;  1VIS A;  2E5L I;  4JI5 E;  1ZM4 A;  2HKE A;  1N32 E;  5GMD A;  4UT4 A;  4LF4 E;  1H73 A;  4JI5 I;  3B78 A;  1ZXN A;  3B8H A;  4LF7 E;  1N32 I;  5LMU E;  4LF7 I;  2UUA E;  5LMU I;  4DV0 E;  4JYA E;  2WW4 A;  2UUA I;  1H7S A;  4JYA I;  4JI8 E;  5IT9 C;  4YY3 I;  4X65 I;  2HK2 A;  1IBL E;  2CZ9 A;  1Z0G A;  1IBK E;  4NXN E;  3LPS A;  2V2V A;  4LF8 E;  1ZXM A;  1MG7 A;  4NXN I;  4DR6 I;  4B3T E;  4LFC E;  4LF8 I;  2ZBK B;  4PU9 A;  4B3T I;  1KTV A;  5L3J A;  2A2D A;  1B62 A;  4JI1 E;  2UUC E;  4AQY I;  2BM0 A;  1KVK A;  4JI1 I;  4DR4 E;  1XNQ I;  1XHK A;  3J81 C;  4X62 I;  2XEX A;  2UXC E;  1EA6 A;  2VQE I;  1Z5B A;  1IBM E;  2F4V I;  4JI3 I;  4YHH E;  1Z5C A;  2ZM6 E;  1N0U A;  4LF5 E;  3V5R A;  1OJ4 A;  4YHH I;  1RR9 A;  2ZIT A;  4DUY E;  4DV6 E;  2ZM6 I;  2VF3 A;  3T1Y E;  4DV6 I;  1FJG E;  2DEJ A;  1N36 E;  4DR2 E;  4B3S E;  1FI4 A; 
#chains in the Genus database with same CATH topology
 5JEA F;  4UTG A;  4JI6 E;  1FJG I;  1N36 I;  4DR2 I;  4B3S I;  1Z0T A;  2HKJ A;  3WU4 A;  2VQF E;  4JI6 I;  1ZM2 A;  4DU8 A;  4IFD A;  3HUL A;  4B3R I;  2NN6 A;  4IZK B;  2GS8 A;  2EFG A;  2VES A;  1Y4U A;  4FW3 A;  1PVG A;  4IFD C;  4HAC B;  4MQY A;  2X7I A;  4DV3 I;  2HFU A;  2NN6 C;  5DNX A;  1N33 I;  2DEI A;  3ZM7 A;  4DR1 I;  5DNL A;  4XTJ A;  1S4E A;  3GCM A;  2UUB E;  1Y60 A;  4Z7Y A;  2PNM A;  2NPF A;  2WP8 A;  4WUB A;  2BR2 B;  3J81 Q;  3WU6 A;  1Z0B A;  1Z59 A;  5LMN E;  1Z0W A;  3T1H E;  5ELW A;  1EI1 A;  4AID A;  3PS3 A;  3T1H I;  4LF4 I;  3OTO E;  2JE6 A;  2IOQ A;  4JI7 E;  1J5E E;  4DPX A;  3JAM C;  1K47 A;  1XMQ E;  4JI0 E;  2GO3 A;  1I94 E;  3OTO I;  2UU9 E;  5A2Q C;  4IZJ D;  1NHI A;  4EMD A;  1B63 A;  1XMQ I;  1RHY A;  2C39 B;  1I94 I;  3ZKD A;  3LTO A;  5C0X B;  2UU9 I;  1ELO A;  3L7Z A;  1PIE A;  4DV7 E;  3M7N D;  4DV0 I;  4IS9 A;  5C0X F;  4DV7 I;  2F1D A;  4JI8 I;  2J65 A;  1ZM3 A;  3WU3 A;  5C0X E;  4DV1 E;  4DR5 E;  1N34 E;  1IBL I;  3F0N A;  1KIJ A;  1IBK I;  4NXM E;  3GON A;  3U1K A;  2AE8 A;  5GME A;  2O1U A;  4LF9 E;  4NXM I;  4QNK A;  5BR8 E;  4LFC I;  4RPF A;  4IZJ A;  5K36 D;  4WUC A;  1DAR A;  4AIM A;  4DPU A;  5BR8 I;  1HR0 E;  2J7K A;  2Z5B A;  3LNU A;  3K17 A;  5FLX C;  3PS2 A;  4USK A;  1HR0 I;  3ZKB A;  3J7A M;  2V2Z A;  2UUC I;  3P3C A;  1U2R A;  4QNJ A;  2E1R A;  4DV5 E;  4DR4 I;  5EKW A;  1FWL A;  3J80 C;  1MX0 A;  4GQU A;  4OO1 B;  4DV5 I;  2UXC I;  3M6A A;  4PRV A;  2IER A;  4DPY A;  1Z0C A;  1ZM9 A;  2Z5E A;  3PYG A;  1IBM I;  4GKK E;  2BV3 A;  4FWG A;  4OO1 F;  3JAM Q;  5K36 A;  5DRO A;  1N0V C;  5A2Q Q;  4LF5 I;  2PO2 A;  2V34 A;  5K36 C;  4DUY I;  3Q6M A;  3QT7 A;  4MYT A;  4OZE A;  1OYR A;  3T1Y I;  2UXD E;  4FWD A;  4DPW A;  1HNW E;  1FWK A;  1NZ0 A;  1Z0E A;  4ED4 A;  1HNX E;  2UXD I;  1HNW I;  1VI7 A;  1XNR E;  4FW5 A;  2O3Z A;  2VQF I;  1XNR I;  2PNZ A;  3H1C A;  4LOM A;  1RRE A;  4OO1 D;  4BA2 B;  2OI2 A;  4LFA E;  2WNR B;  2Z5C B;  2C38 B;  4N3O A;  3GLL A;  4USM A;  4LFA I;  4DR3 E;  2V2Q A;  4FW7 A;  3M85 D;  2JEB A;  5FLX Q;  2HK3 A;  5JEA D;  3ZZ0 A;  2CGE A;  4DR3 I;  2UUB I;  4DR7 E;  4KHP E;  3PRY A;  1NHJ A;  1Z5A A;  2C37 A;  5DRQ A;  4DR7 I;  4KHP I;  3WU5 A;  4DXL A;  4FW9 A;  2BA1 D;  1XXE A;  3J80 Q;  1A6F A;  2PO0 B;  4JI2 E;  1FNM A;  4HXZ A;  1Y5Y A;  5LMN I;  4BA1 B;  1NHH A;  2X36 A;  4OO1 A;  4X64 E;  4B3M E;  1YHC A;  5IWA E;  1H74 A;  2PO1 A;  4JG4 A;  4HY1 A;  1HK7 A;  2IOP A;  4B3M I;  4JI7 I;  1UDN A;  4OO1 C;  1J5E I;  2O1V A;  4JI0 I;  4LPF A;  2V8P A;  3QT6 A;  5JEA A;  2JEA B;  2Q2E B;  4MU3 A;  4JV5 E;  4DPT A;  2LJP A;  3CWV A;  2HHH E;  4J3D A;  2A2C A;  4GKJ E;  1R6L A;  5JEA C;  3Q6N A;  1QZR A;  1PKP A;  4JV5 I;  2HHH I;  4GKJ I;  3QT5 A;  4FWH A;  4LFB E;  3K1J A;  4NBQ A;  1UDQ A;  3B4T A;  4MDT A;  3UHM A;  4DV1 I;  4DR5 I;  4PRX A;  1N34 I;  4LFB I;  3HKM A;  4YY3 E;  4IZK A;  4X65 E;  3Q1Q A;  4K0K E;  4OX9 E;  2JT2 A;  3J7A G;  2BM1 A;  2R3V A;  4HAC A;  2O1W A;  4OX9 I;  4K0K I;  1D6T A;  4LF9 I;  4IFD B;  1R6M A;  3V2U C;  4LF6 E;  2R42 A;  2CVE A;  2NN6 B;  3P76 A;  4DR6 E;  1WUU A;  4MU4 A;  4IFD F;  4LF6 I;  4X66 E;  4MYU A;  5C0X D;  2NN6 F;  3PYE A;  4IFD E;  4X66 I;  2BR2 A;  2NN6 E;  4KQV A;  3H4L A;  4AQY E;  1UEK A;  1MU5 A;  3PYD A;  5DRR A;  1YH8 A;  2WP8 B;  4R1F A;  3ZZT A;  4ISA A;  4MU1 A;  1XNQ E;  4X62 E;  4URL A;  3CDJ A;  4GKK I;  3P3E A;  2VQE E;  4AM3 A;  1Z0V A;  1UDO A;  1H72 C;  2GQ0 A;  3QT8 A;  4JI3 E;  2F4V E;  4M1K A;  1H7U A;  2C39 A;  1USU A;  2JE6 B;  3PYF A;  4FN5 A;  5C0X A;  4DUZ E;  1KKH A;  3ZZU A;  4I3H A;  2PNL A;  4Z7C A;  4DUZ I;  1Y6Z A;  5C0X C;  1P42 A;  4FW4 A;  5FWK A;  4P7A A;  1HNX I;  3L7Z B;  1HNZ E;  2BA0 D;  3D4J A;  2IES A;  2BA1 G;  1E3H A;  1HNZ I;  4HYM A;  1FKA E;  5IT9 Q;  4U3D A;  5JEA E;  1S16 A;  4JI4 E;  3NZK A;  4B3R E;  1OYS A;  4P52 A;  4LCG A;  4JI4 I;  5LL6 R;  1OYP A;  4DV3 E;  3B82 A;  4WUD A;  1BKN A;  1N33 E;  4IZJ B;  4DV4 E;  4DR1 E;  3M7N G;  3P3G A;  4FW6 A;  3KRN A;  2HFS A;  2Z5B B;  3HJC A;  1XMO E;  4DV4 I;  4DU7 A;  2UXB E;  4U3B A;  1XMO I;  4JI2 I;  2GO4 A;  4DV2 E;  2AJ4 A;  2UXB I;  4X64 I;  4ZVI A;  2E5L E;  3GME A;  5IWA I;  4DV2 I;  1VIS A;  3P06 A;  5DRP A;  2E5L I;  4JI5 E;  1ZM4 A;  2HKE A;  1N32 E;  5GMD A;  2O1T A;  4UT4 A;  1H73 A;  3K85 A;  4LF4 E;  1USV A;  4JI5 I;  3B78 A;  1ZXN A;  3B8H A;  4LF7 E;  1N32 I;  5K36 B;  5LMU E;  4LCH A;  2PO2 B;  4LF7 I;  2UUA E;  5K36 F;  5LMU I;  4DV0 E;  4JYA E;  2WW4 A;  5K36 E;  2UUA I;  1H7S A;  3U1Y A;  4JYA I;  4JI8 E;  5IT9 C;  4YY3 I;  4X65 I;  4BA2 A;  2HK2 A;  1IBL E;  2CZ9 A;  1Z0G A;  1IBK E;  4NXN E;  2WNR A;  2Z5C A;  3LPS A;  2C38 A;  2V2V A;  1Y4S A;  1UDS A;  2PNZ B;  4LF8 E;  1ZXM A;  1MG7 A;  4NXN I;  3PS1 A;  4DR6 I;  3CDI A;  4B3T E;  4LFC E;  4LF8 I;  4MU0 A;  2ZBK B;  4PU9 A;  4B3T I;  5EL9 A;  2JEB B;  1KTV A;  5L3J A;  2A2D A;  1B62 A;  2PO0 A;  4JI1 E;  2UUC E;  4AQY I;  2BM0 A;  4BA1 A;  2C37 B;  1KVK A;  3DD6 A;  4LCF A;  4JI1 I;  4DR4 E;  1XNQ I;  2CG9 A;  1XHK A;  2BA0 G;  3J81 C;  4X62 I;  2XEX A;  2UXC E;  4OKG A;  1EA6 A;  2VQE I;  1Z5B A;  4IFD D;  1IBM E;  2JEA A;  2PO1 B;  2F4V I;  4JI3 I;  2NN6 D;  1Z5C A;  4YHH E;  3M85 G;  2ZM6 E;  1N0U A;  4LF5 E;  3V5R A;  1OJ4 A;  4YHH I;  1RR9 A;  2ZIT A;  4DUY E;  4DV6 E;  4OO1 E;  2ZM6 I;  5JEA B;  2VF3 A;  1E3P A;  3T1Y E;  4DV6 I;  1FJG E;  2DEJ A;  1N36 E;  4DR2 E;  4B3S E;  1FI4 A; 
#chains in the Genus database with same CATH homology
 4UTG A;  4JI6 E;  1FJG I;  1N36 I;  4DR2 I;  4B3S I;  1Z0T A;  2HKJ A;  3WU4 A;  2VQF E;  4JI6 I;  1ZM2 A;  4DU8 A;  3HUL A;  4B3R I;  4IZK B;  2GS8 A;  2EFG A;  1Y4U A;  1PVG A;  4HAC B;  2X7I A;  4DV3 I;  2HFU A;  1N33 I;  2DEI A;  3ZM7 A;  4DR1 I;  4XTJ A;  1S4E A;  2UUB E;  4Z7Y A;  2PNM A;  2NPF A;  4WUB A;  3J81 Q;  3WU6 A;  1Z0B A;  1Z59 A;  5LMN E;  1Z0W A;  3T1H E;  1EI1 A;  3T1H I;  4LF4 I;  3OTO E;  2IOQ A;  4JI7 E;  1J5E E;  4DPX A;  3JAM C;  1K47 A;  1XMQ E;  4JI0 E;  1I94 E;  3OTO I;  2UU9 E;  5A2Q C;  4IZJ D;  1NHI A;  4EMD A;  1B63 A;  1XMQ I;  1I94 I;  3ZKD A;  3LTO A;  2UU9 I;  1ELO A;  1PIE A;  4DV7 E;  4DV0 I;  4DV7 I;  4JI8 I;  1ZM3 A;  3WU3 A;  4DV1 E;  4DR5 E;  1N34 E;  1IBL I;  3F0N A;  1KIJ A;  1IBK I;  4NXM E;  3GON A;  5GME A;  2O1U A;  4LF9 E;  4NXM I;  5BR8 E;  4LFC I;  4RPF A;  4IZJ A;  4WUC A;  1DAR A;  4DPU A;  5BR8 I;  1HR0 E;  2J7K A;  2Z5B A;  3LNU A;  3K17 A;  5FLX C;  4USK A;  1HR0 I;  3ZKB A;  3J7A M;  2V2Z A;  2UUC I;  1U2R A;  2E1R A;  4DV5 E;  4DR4 I;  1FWL A;  3J80 C;  1MX0 A;  4DV5 I;  2UXC I;  3M6A A;  4PRV A;  4DPY A;  1Z0C A;  1ZM9 A;  2Z5E A;  3PYG A;  1IBM I;  4GKK E;  2BV3 A;  4FWG A;  3JAM Q;  1N0V C;  5A2Q Q;  4LF5 I;  2V34 A;  4DUY I;  3Q6M A;  3QT7 A;  4MYT A;  3T1Y I;  2UXD E;  4FWD A;  4DPW A;  1HNW E;  1FWK A;  1NZ0 A;  1Z0E A;  4ED4 A;  1HNX E;  2UXD I;  1HNW I;  1XNR E;  2VQF I;  1XNR I;  1RRE A;  2OI2 A;  4LFA E;  2Z5C B;  4N3O A;  4USM A;  4LFA I;  4DR3 E;  2V2Q A;  5FLX Q;  2HK3 A;  3ZZ0 A;  2CGE A;  4DR3 I;  2UUB I;  4DR7 E;  4KHP E;  3PRY A;  1NHJ A;  1Z5A A;  4DR7 I;  4KHP I;  3WU5 A;  4DXL A;  4FW9 A;  3J80 Q;  1A6F A;  4JI2 E;  1FNM A;  4HXZ A;  5LMN I;  1NHH A;  2X36 A;  4X64 E;  4B3M E;  5IWA E;  1H74 A;  4JG4 A;  4HY1 A;  1HK7 A;  2IOP A;  4B3M I;  4JI7 I;  1J5E I;  2O1V A;  4JI0 I;  2V8P A;  3QT6 A;  2Q2E B;  4JV5 E;  4DPT A;  2LJP A;  3CWV A;  2HHH E;  2A2C A;  4GKJ E;  3Q6N A;  1QZR A;  1PKP A;  4JV5 I;  2HHH I;  4GKJ I;  3QT5 A;  4FWH A;  4LFB E;  3K1J A;  4DV1 I;  4DR5 I;  4PRX A;  1N34 I;  4LFB I;  4YY3 E;  4IZK A;  4X65 E;  3Q1Q A;  4K0K E;  4OX9 E;  3J7A G;  2BM1 A;  2R3V A;  4HAC A;  2O1W A;  4OX9 I;  4K0K I;  1D6T A;  4LF9 I;  3V2U C;  4LF6 E;  2R42 A;  4DR6 E;  1WUU A;  4LF6 I;  4X66 E;  4MYU A;  3PYE A;  4X66 I;  4KQV A;  3H4L A;  4AQY E;  1UEK A;  1MU5 A;  3PYD A;  4R1F A;  3ZZT A;  1XNQ E;  4X62 E;  4URL A;  4GKK I;  2VQE E;  1Z0V A;  1H72 C;  2GQ0 A;  3QT8 A;  4JI3 E;  2F4V E;  4M1K A;  1H7U A;  1USU A;  3PYF A;  4FN5 A;  4DUZ E;  1KKH A;  3ZZU A;  4I3H A;  2PNL A;  4Z7C A;  4DUZ I;  1Y6Z A;  5FWK A;  4P7A A;  1HNX I;  1HNZ E;  3D4J A;  1HNZ I;  4HYM A;  1FKA E;  5IT9 Q;  1S16 A;  4JI4 E;  4B3R E;  4P52 A;  4JI4 I;  5LL6 R;  4DV3 E;  3B82 A;  4WUD A;  1BKN A;  1N33 E;  4IZJ B;  4DV4 E;  4DR1 E;  2HFS A;  2Z5B B;  3HJC A;  1XMO E;  4DV4 I;  4DU7 A;  2UXB E;  1XMO I;  4JI2 I;  4DV2 E;  2AJ4 A;  2UXB I;  4X64 I;  4ZVI A;  2E5L E;  5IWA I;  4DV2 I;  1VIS A;  3P06 A;  2E5L I;  4JI5 E;  1ZM4 A;  2HKE A;  1N32 E;  5GMD A;  2O1T A;  4UT4 A;  1H73 A;  3K85 A;  4LF4 E;  1USV A;  4JI5 I;  3B78 A;  1ZXN A;  3B8H A;  4LF7 E;  1N32 I;  5LMU E;  4LF7 I;  2UUA E;  5LMU I;  4DV0 E;  4JYA E;  2WW4 A;  2UUA I;  1H7S A;  4JYA I;  4JI8 E;  5IT9 C;  4YY3 I;  4X65 I;  2HK2 A;  1IBL E;  2CZ9 A;  1Z0G A;  1IBK E;  4NXN E;  2Z5C A;  3LPS A;  2V2V A;  1Y4S A;  4LF8 E;  1ZXM A;  1MG7 A;  4NXN I;  4DR6 I;  4B3T E;  4LFC E;  4LF8 I;  2ZBK B;  4PU9 A;  4B3T I;  1KTV A;  5L3J A;  2A2D A;  1B62 A;  4JI1 E;  2UUC E;  4AQY I;  2BM0 A;  1KVK A;  4JI1 I;  4DR4 E;  1XNQ I;  2CG9 A;  1XHK A;  3J81 C;  4X62 I;  2XEX A;  2UXC E;  1EA6 A;  2VQE I;  1Z5B A;  1IBM E;  2F4V I;  4JI3 I;  4YHH E;  1Z5C A;  2ZM6 E;  1N0U A;  4LF5 E;  3V5R A;  1OJ4 A;  4YHH I;  1RR9 A;  2ZIT A;  4DUY E;  4DV6 E;  2ZM6 I;  2VF3 A;  3T1Y E;  4DV6 I;  1FJG E;  2DEJ A;  1N36 E;  4DR2 E;  4B3S E;  1FI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...