4B3MI

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mI00
3F0NA 4EMDA 1PKPA 1RR9A 3B82A 4DPYA 4LFCI 4Z7CA 4HACB 4USKA 1HNXE 1S4EA 3B8HA 4KHPI 2BM1A 1HNWE 4JI5I 4X62E 4DV2I 1J5EE 4HACA 1ZM9A 3WU5A 3PYEA 4AQYI 2HKJA 3LPSA 4DR4I 1XNRE 1H74A 4DR6E 4DR5E 4K0KI 4DPTA 4B3SE 1RREA 4GKJI 4JYAI 3K1JA 3LTOA 4JI6I 5IT9C 1D6TA 2UU9I 3ZM7A 1B63A 4FWHA 4FWGA 1IBKE 4YHHI 4NXNE 1WUUA 4FWDA 4DPXA 4DU7A 1MG7A 3T1HI 4USMA 1NHIA 2HFSA 1XMOE 2HHHI 1H7UA 5BR8E 1Z59A 1KTVA 2Q2EB 4B3SI 2E1RA 2UUBI 3T1YE 2HHHE 4UTGA 4UT4A 1IBLI 4NXMI 1XNQE 1FKAE 1KIJA 4LF6E 2J7KA 1Z0GA 3CWVA 2UUAE 4KHPE 1I94I 4Z7YA 1Z5BA 1PIEA 2V2VA 4DV4E 4DV5I 4DR2I 4GKKI 4LF8I 2ZM6I 4B3MI 4X64E 2X7IA 5LMNE 1FNMA 3OTOI 4DV6I 4PU9A 4DR1E 4DUZE 2GS8A 4X66E 2UXDE 2UUCE 1Z0EA 3HULA 1KVKA 4X62I 1ELOA 3J7AG 4LF8E 3GONA 2VQEE 4LF7I 2R3VA 1XMQE 1K47A 1NHHA 2VQFI 1UEKA 3QT8A 4LFCE 1BKNA 1XHKA 4LF7E 2AJ4A 2UU9E 1H73A 4DV3I 2HK2A 3OTOE 3WU4A 4LFAE 4X64I 4DR7I 4JI2E 2UUBE 4DU8A 2E5LE 4DV6E 4AQYE 4JI4E 4LFBE 3ZKDA 4LF9E 1FWKA 1Z0VA 3J81Q 1HNZI 4DV2E 1J5EI 4URLA 4OX9I 4DV7E 3QT7A 5L3JA 2VQEI 1Z0WA 1U2RA 2ZITA 4DUYE 4JI8I 2BV3A 1XMQI 2HFUA 1I94E 4WUCA 2XEXA 2CZ9A 3ZZUA 1HNXI 3K17A 1IBKI 3J80Q 4B3RE 5LMNI 1VISA 2ZBKB 4P52A 4X66I 4LFAI 4DR1I 4JV5E 4YY3I 4ZVIA 4DV3E 1FJGE 5IWAI 2F4VI 3WU6A 4LF4I 4MYTA 1ZM2A 4DR6I 4K0KE 4DR3I 1ZM4A 4DV0I 1XMOI 3B78A 4R1FA 4JI0I 4ED4A 2VQFE 4X65I 1IBLE 2EFGA 4DV0E 4MYUA 4DR3E 2UXBE 1OJ4A 3D4JA 1PVGA 4JYAE 2R42A 1Z0CA 4JI1I 5A2QQ 4JI4I 4DV1E 3PYDA 4DR5I 2DEIA 1Z0TA 1XNRI 4DR4E 2V8PA 2A2CA 4DPWA 1FJGI 4B3RI 1N33I 1KKHA 4WUDA 3JAMQ 4M1KA 2UXBI 5FLXC 1IBMI 4JI7I 1DARA 4JI8E 1A6FA 1FI4A 2V34A 1NHJA 1S16A 4JI0E 1N33E 2BM0A 2VF3A 4LF9I 4HXZA 1EA6A 5IWAE 2F4VE 1N0VC 3ZKBA 4JI6E 1EI1A 5GMEA 3QT6A 4DXLA 4GKJE 3M6AA 5A2QC 4JV5I 1N34I 4PRVA 4LF5I 2ZM6E 4B3ME 1N32E 4DV1I 1HNWI 2X36A 4RPFA 3H4LA 2HKEA 1HR0I 4PRXA 2V2QA 4B3TE 3J7AM 3V5RA 5FLXQ 2UXCE 1H72C 4I3HA 1H7SA 2UUAI 1ZXNA 1IBME 4LFBI 4YY3E 1N36I 2UUCI 3T1YI 4LF4E 4DPUA 1ZXMA 4DUZI 4JG4A 1NZ0A 1B62A 4JI2I 2UXDI 5BR8I 4HYMA 3PYGA 4XTJA 1N36E 4FN5A 3ZZTA 4X65E 1ZM3A 3T1HE 2LJPA 4DV7I 1Z5AA 4OX9E 2V2ZA 5IT9Q 2NPFA 4DUYI 4FW9A 1HNZE 1HR0E 2UXCI 2WW4A 3WU3A 3Q1QA 1XNQI 5LMUI 3JAMC 2E5LI 4NXME 4JI3E 4DR7E 5GMDA 4LF5E 5LMUE 1N34E 4DR2E 4DV5E 2HK3A 4GKKE 3J81C 1FWLA 1Z5CA 4JI5E 3QT5A 4DV4I 2A2DA 4KQVA 4B3TI 4HY1A 4NXNI 4YHHE 2OI2A 4LF6I 3J80C 1MU5A 4JI7E 4WUBA 5LL6R 2DEJA 3ZZ0A 1N0UA 3V2UC 1N32I 1QZRA 4JI3I 1Z0BA 3PYFA 4P7AA 4JI1E 3LNUA 1MX0A
chains in the Genus database with same CATH superfamily
2NN6D 3F0NA 4EMDA 1PKPA 1RR9A 2BR2A 1E3PA 3K85A 3B82A 4DPYA 2JE6B 4LFCI 4Z7CA 4HACB 2J65A 4USKA 1HNXE 1S4EA 4BA1A 3B8HA 4KHPI 2BM1A 3GMEA 1HNWE 4JI5I 2Z5CB 4X62E 1YHCA 4DV2I 1J5EE 4HACA 1ZM9A 3WU5A 2PO1B 3PYEA 2C38B 2GQ0A 4AQYI 2HKJA 3L7ZB 3LPSA 4DR4I 1XNRE 1H74A 4DR6E 4DR5E 4K0KI 4MQYA 4DPTA 4B3SE 4OO1C 1RREA 4GKJI 4JYAI 3K1JA 3LTOA 3GCMA 4JI6I 5IT9C 1D6TA 1USUA 2C39A 4IS9A 2UU9I 2CG9A 4OO1F 4BA2B 3ZM7A 2JEAA 1B63A 3NZKA 4FWHA 4FWGA 1IBKE 4YHHI 4NXNE 1WUUA 4FWDA 3PRYA 4DPXA 4DU7A 1MG7A 2C39B 3T1HI 4USMA 2PO2A 1NHIA 4MU4A 2HFSA 5DRRA 2IESA 1R6MA 1XMOE 2HHHI 1H7UA 5BR8E 1Z59A 1R6LA 1KTVA 2Q2EB 4B3SI 3DD6A 1UDQA 4IFDD 2E1RA 2UUBI 3T1YE 2HHHE 1UDNA 4UTGA 1Y6ZA 4UT4A 5C0XE 1IBLI 4NXMI 1Y5YA 1XNQE 1FKAE 1KIJA 2JEAB 3UHMA 4LF6E 5JEAE 2J7KA 3P3GA 2Z5EA 3U1KA 2F1DA 1Z0GA 4FW5A 3CWVA 2UUAE 4KHPE 1I94I 2PO2B 4Z7YA 1Z5BA 1PIEA 2V2VA 4IFDB 4DV4E 4DV5I 3P3EA 2IOQA 4DR2I 4LCGA 4GKKI 4LF8I 3PS2A 2NN6F 2ZM6I 4B3MI 1Y60A 4X64E 2X7IA 5LMNE 2PO1A 1FNMA 4QNKA 3OTOI 4DV6I 4PU9A 2IOPA 4DR1E 4DUZE 2GS8A 4X66E 2C37B 2UXDE 2UUCE 1Z0EA 2O1VA 3HULA 1KVKA 4FW6A 2BA0G 4MU1A 4X62I 1ELOA 3J7AG 4LF8E 3GONA 2VQEE 4LF7I 2GO3A 2R3VA 4IZJB 1XMQE 1K47A 1NHHA 4AIMA 2VQFI 1UEKA 3QT8A 4IFDE 4LFCE 4OO1D 1BKNA 1XHKA 4LF7E 2O3ZA 2JE6A 2AJ4A 2UU9E 3P06A 1H73A 4IZKA 5FWKA 4DV3I 5JEAB 2HK2A 3OTOE 3WU4A 4LFAE 4X64I 3HJCA 4DR7I 4JI2E 2UUBE 5C0XB 3U1YA 4DU8A 2E5LE 2BA0D 4DV6E 4AQYE 4JI4E 4LFBE 3ZKDA 4LF9E 1FWKA 1Z0VA 3J81Q 2JEBA 1Y4UA 1HNZI 4DV2E 1J5EI 2AE8A 4URLA 4DV7E 4OX9I 2PNLA 3QT7A 5L3JA 5K36F 2VQEI 1Z0WA 2WNRB 1U2RA 2ZITA 4DUYE 4JI8I 2BV3A 2PO0A 1XMQI 2HFUA 1I94E 4WUCA 1OYSA 2XEXA 2CZ9A 3ZZUA 1HNXI 3CDJA 3K17A 1Y4SA 1IBKI 3J80Q 3M85G 4B3RE 4LOMA 5LMNI 5K36B 1VISA 2ZBKB 2IERA 4P52A 4X66I 4LFAI 4MU3A 4DR1I 4JV5E 4YY3I 4ZVIA 1OYRA 4DV3E 1FJGE 5IWAI 2F4VI 3WU6A 4LF4I 4MYTA 1ZM2A 4DR6I 4K0KE 4DR3I 1ZM4A 4DV0I 4LCFA 1XMOI 2O1TA 2WNRA 3B78A 4R1FA 4JI0I 4ED4A 4OKGA 1USVA 2GO4A 2VQFE 1OYPA 3P76A 3P3CA 3HKMA 4X65I 4AM3A 1IBLE 2PNMA 2EFGA 4DV0E 4MYUA 4DR3E 4LPFA 2UXBE 1OJ4A 3D4JA 1PVGA 4JYAE 2R42A 1Z0CA 4JI1I 5A2QQ 4JI4I 2PNZB 4DV1E 3PYDA 4DR5I 2DEIA 1Z0TA 1XNRI 4DR4E 2V8PA 2A2CA 4ISAA 4DPWA 1FJGI 4B3RI 5EKWA 1N33I 1KKHA 1UDOA 2PO0B 2NN6A 2O1WA 4WUDA 4FW4A 3JAMQ 4M1KA 2UXBI 5FLXC 1IBMI 2CVEA 4JI7I 1DARA 4JI8E 5JEAC 1A6FA 1FI4A 2NN6C 2V34A 1NHJA 1S16A 4JI0E 1P42A 1N33E 2BM0A 2VF3A 3Q6NA 3M7NG 4LCHA 4LF9I 4HXZA 5JEAA 1EA6A 5IWAE 2F4VE 1RHYA 1N0VC 3ZKBA 4JI6E 1EI1A 2VESA 5EL9A 5GMEA 5DRPA 3QT6A 1E3HA 4DXLA 4GKJE 3M6AA 4U3DA 5A2QC 4JV5I 1N34I 4PRVA 4LF5I 2ZM6E 4B3ME 1N32E 4DV1I 1HNWI 2WP8A 4AIDA 2X36A 4RPFA 2Z5CA 1HK7A 3H4LA 2HKEA 4GQUA 1HR0I 4MU0A 4PRXA 2V2QA 4B3TE 3J7AM 3V5RA 5K36C 3PS1A 5FLXQ 2UXCE 1H72C 4I3HA 1H7SA 5C0XF 2UUAI 3Q6MA 4FW3A 2O1UA 4BA1B 1ZXNA 4NBQA 2WP8B 4OO1A 3PS3A 2JEBB 1YH8A 1IBME 5JEAF 4IFDC 4LFBI 3CDIA 1VI7A 5K36A 4YY3E 1N36I 4IZJD 2UUCI 3T1YI 4LF4E 2CGEA 4DPUA 1ZXMA 4DUZI 4JG4A 1NZ0A 1B62A 4OO1B 4IFDA 4JI2I 4MDTA 2UXDI 5ELWA 2BR2B 4N3OA 5BR8I 2NN6E 4HYMA 3PYGA 4XTJA 5JEAD 1N36E 2Z5BB 4FN5A 3ZZTA 4X65E 1ZM3A 3T1HE 2LJPA 2C37A 1Z5AA 5C0XD 4DV7I 4OX9E 2V2ZA 5IT9Q 2NPFA 4DUYI 4FW9A 1HNZE 1HR0E 5DNLA 4FW7A 4QNJA 4U3BA 2UXCI 2WW4A 3WU3A 3Q1QA 1XNQI 2C38A 5LMUI 4OZEA 3JAMC 2E5LI 5DROA 4IFDF 4NXME 4JI3E 3M7ND 4DR7E 5GMDA 4LF5E 5LMUE 1N34E 5K36E 2Z5BA 4DR2E 4DV5E 2BA1D 4BA2A 3GLLA 5K36D 2HK3A 4GKKE 4IZJA 3J81C 1FWLA 1Z5CA 4JI5E 2JT2A 3QT5A 3M85D 4DV4I 2A2DA 4KQVA 4B3TI 4HY1A 3B4TA 4NXNI 4YHHE 2OI2A 2NN6B 4LF6I 5C0XC 3J80C 1MU5A 4JI7E 4OO1E 4J3DA 4IZKB 3H1CA 3KRNA 4WUBA 5LL6R 2DEJA 3ZZ0A 1N0UA 3V2UC 5C0XA 1N32I 1QZRA 1UDSA 4JI3I 1Z0BA 5DNXA 5DRQA 2PNZA 3PYFA 4P7AA 3L7ZA 1XXEA 4JI1E 3LNUA 1MX0A 2BA1G
chains in the Genus database with same CATH topology
3F0NA 4EMDA 1PKPA 1RR9A 3K85A 3B82A 4DPYA 4LFCI 4Z7CA 4HACB 4USKA 1HNXE 1S4EA 3B8HA 4KHPI 2BM1A 1HNWE 4JI5I 2Z5CB 4X62E 4DV2I 1J5EE 4HACA 1ZM9A 3WU5A 3PYEA 2GQ0A 4AQYI 2HKJA 3LPSA 4DR4I 1XNRE 1H74A 4DR6E 4DR5E 4K0KI 4DPTA 4B3SE 1RREA 4GKJI 4JYAI 3K1JA 3LTOA 4JI6I 5IT9C 1D6TA 1USUA 2UU9I 2CG9A 3ZM7A 1B63A 4FWHA 4FWGA 1IBKE 4YHHI 4NXNE 1WUUA 4FWDA 3PRYA 4DPXA 4DU7A 1MG7A 3T1HI 4USMA 1NHIA 2HFSA 1XMOE 2HHHI 1H7UA 5BR8E 1Z59A 1KTVA 2Q2EB 4B3SI 2E1RA 2UUBI 3T1YE 2HHHE 4UTGA 1Y6ZA 4UT4A 1IBLI 4NXMI 1XNQE 1FKAE 1KIJA 4LF6E 2J7KA 2Z5EA 1Z0GA 3CWVA 2UUAE 4KHPE 1I94I 4Z7YA 1Z5BA 1PIEA 2V2VA 4DV4E 4DV5I 2IOQA 4DR2I 4GKKI 4LF8I 2ZM6I 4B3MI 4X64E 2X7IA 5LMNE 1FNMA 3OTOI 4DV6I 4PU9A 2IOPA 4DR1E 4DUZE 2GS8A 4X66E 2UXDE 2UUCE 1Z0EA 2O1VA 3HULA 1KVKA 4X62I 1ELOA 3J7AG 4LF8E 3GONA 2VQEE 4LF7I 2R3VA 4IZJB 1XMQE 1K47A 1NHHA 2VQFI 1UEKA 3QT8A 4LFCE 1BKNA 1XHKA 4LF7E 2AJ4A 2UU9E 3P06A 1H73A 4IZKA 5FWKA 4DV3I 2HK2A 3OTOE 3WU4A 4LFAE 4X64I 3HJCA 4DR7I 4JI2E 2UUBE 4DU8A 2E5LE 4DV6E 4AQYE 4JI4E 4LFBE 3ZKDA 4LF9E 1FWKA 1Z0VA 3J81Q 1Y4UA 1HNZI 4DV2E 1J5EI 4URLA 4DV7E 4OX9I 2PNLA 3QT7A 5L3JA 2VQEI 1Z0WA 1U2RA 2ZITA 4DUYE 4JI8I 2BV3A 1XMQI 2HFUA 1I94E 4WUCA 2XEXA 2CZ9A 3ZZUA 1HNXI 3K17A 1Y4SA 1IBKI 3J80Q 4B3RE 5LMNI 1VISA 2ZBKB 4P52A 4X66I 4LFAI 4DR1I 4JV5E 4YY3I 4ZVIA 4DV3E 1FJGE 5IWAI 2F4VI 3WU6A 4LF4I 4MYTA 1ZM2A 4DR6I 4K0KE 4DR3I 1ZM4A 4DV0I 1XMOI 2O1TA 3B78A 4R1FA 4JI0I 4ED4A 1USVA 2VQFE 4X65I 1IBLE 2PNMA 2EFGA 4DV0E 4MYUA 4DR3E 2UXBE 1OJ4A 3D4JA 1PVGA 4JYAE 2R42A 1Z0CA 4JI1I 5A2QQ 4JI4I 4DV1E 3PYDA 4DR5I 2DEIA 1Z0TA 1XNRI 4DR4E 2V8PA 2A2CA 4DPWA 1FJGI 4B3RI 1N33I 1KKHA 2O1WA 4WUDA 3JAMQ 4M1KA 2UXBI 5FLXC 1IBMI 4JI7I 1DARA 4JI8E 1A6FA 1FI4A 2V34A 1NHJA 1S16A 4JI0E 1N33E 2BM0A 2VF3A 3Q6NA 4LF9I 4HXZA 1EA6A 5IWAE 2F4VE 1N0VC 3ZKBA 4JI6E 1EI1A 5GMEA 3QT6A 4DXLA 4GKJE 3M6AA 5A2QC 4JV5I 1N34I 4PRVA 4LF5I 2ZM6E 4B3ME 1N32E 4DV1I 1HNWI 2X36A 4RPFA 2Z5CA 1HK7A 3H4LA 2HKEA 1HR0I 4PRXA 2V2QA 4B3TE 3J7AM 3V5RA 5FLXQ 2UXCE 1H72C 4I3HA 1H7SA 2UUAI 3Q6MA 2O1UA 1ZXNA 1IBME 4LFBI 4YY3E 1N36I 4IZJD 2UUCI 3T1YI 4LF4E 2CGEA 4DPUA 1ZXMA 4DUZI 4JG4A 1NZ0A 1B62A 4JI2I 2UXDI 4N3OA 5BR8I 4HYMA 3PYGA 4XTJA 1N36E 2Z5BB 4FN5A 3ZZTA 4X65E 1ZM3A 3T1HE 2LJPA 4DV7I 1Z5AA 4OX9E 2V2ZA 5IT9Q 2NPFA 4DUYI 4FW9A 1HNZE 1HR0E 2UXCI 2WW4A 3WU3A 3Q1QA 1XNQI 5LMUI 3JAMC 2E5LI 4NXME 4JI3E 4DR7E 5GMDA 4LF5E 5LMUE 1N34E 2Z5BA 4DR2E 4DV5E 2HK3A 4GKKE 4IZJA 3J81C 1FWLA 1Z5CA 4JI5E 3QT5A 4DV4I 2A2DA 4KQVA 4B3TI 4HY1A 4NXNI 4YHHE 2OI2A 4LF6I 3J80C 1MU5A 4JI7E 4IZKB 4WUBA 5LL6R 2DEJA 3ZZ0A 1N0UA 3V2UC 1N32I 1QZRA 4JI3I 1Z0BA 3PYFA 4P7AA 4JI1E 3LNUA 1MX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0N A;  4EMD A;  1PKP A;  1RR9 A;  3B82 A;  4DPY A;  4LFC I;  4Z7C A;  4HAC B;  4USK A;  1HNX E;  1S4E A;  3B8H A;  4KHP I;  2BM1 A;  1HNW E;  4JI5 I;  4X62 E;  4DV2 I;  1J5E E;  4HAC A;  1ZM9 A;  3WU5 A;  3PYE A;  4AQY I;  2HKJ A;  3LPS A;  4DR4 I;  1XNR E;  1H74 A;  4DR6 E;  4DR5 E;  4K0K I;  4DPT A;  4B3S E;  1RRE A;  4GKJ I;  4JYA I;  3K1J A;  3LTO A;  4JI6 I;  5IT9 C;  1D6T A;  2UU9 I;  3ZM7 A;  1B63 A;  4FWH A;  4FWG A;  1IBK E;  4YHH I;  4NXN E;  1WUU A;  4FWD A;  4DPX A;  4DU7 A;  1MG7 A;  3T1H I;  4USM A;  1NHI A;  2HFS A;  1XMO E;  2HHH I;  1H7U A;  5BR8 E;  1Z59 A;  1KTV A;  2Q2E B;  4B3S I;  2E1R A;  2UUB I;  3T1Y E;  2HHH E;  4UTG A;  4UT4 A;  1IBL I;  4NXM I;  1XNQ E;  1FKA E;  1KIJ A;  4LF6 E;  2J7K A;  1Z0G A;  3CWV A;  2UUA E;  4KHP E;  1I94 I;  4Z7Y A;  1Z5B A;  1PIE A;  2V2V A;  4DV4 E;  4DV5 I;  4DR2 I;  4GKK I;  4LF8 I;  2ZM6 I;  4B3M I;  4X64 E;  2X7I A;  5LMN E;  1FNM A;  3OTO I;  4DV6 I;  4PU9 A;  4DR1 E;  4DUZ E;  2GS8 A;  4X66 E;  2UXD E;  2UUC E;  1Z0E A;  3HUL A;  1KVK A;  4X62 I;  1ELO A;  3J7A G;  4LF8 E;  3GON A;  2VQE E;  4LF7 I;  2R3V A;  1XMQ E;  1K47 A;  1NHH A;  2VQF I;  1UEK A;  3QT8 A;  4LFC E;  1BKN A;  1XHK A;  4LF7 E;  2AJ4 A;  2UU9 E;  1H73 A;  4DV3 I;  2HK2 A;  3OTO E;  3WU4 A;  4LFA E;  4X64 I;  4DR7 I;  4JI2 E;  2UUB E;  4DU8 A;  2E5L E;  4DV6 E;  4AQY E;  4JI4 E;  4LFB E;  3ZKD A;  4LF9 E;  1FWK A;  1Z0V A;  3J81 Q;  1HNZ I;  4DV2 E;  1J5E I;  4URL A;  4OX9 I;  4DV7 E;  3QT7 A;  5L3J A;  2VQE I;  1Z0W A;  1U2R A;  2ZIT A;  4DUY E;  4JI8 I;  2BV3 A;  1XMQ I;  2HFU A;  1I94 E;  4WUC A;  2XEX A;  2CZ9 A;  3ZZU A;  1HNX I;  3K17 A;  1IBK I;  3J80 Q;  4B3R E;  5LMN I;  1VIS A;  2ZBK B;  4P52 A;  4X66 I;  4LFA I;  4DR1 I;  4JV5 E;  4YY3 I;  4ZVI A;  4DV3 E;  1FJG E;  5IWA I;  2F4V I;  3WU6 A;  4LF4 I;  4MYT A;  1ZM2 A;  4DR6 I;  4K0K E;  4DR3 I;  1ZM4 A;  4DV0 I;  1XMO I;  3B78 A;  4R1F A;  4JI0 I;  4ED4 A;  2VQF E;  4X65 I;  1IBL E;  2EFG A;  4DV0 E;  4MYU A;  4DR3 E;  2UXB E;  1OJ4 A;  3D4J A;  1PVG A;  4JYA E;  2R42 A;  1Z0C A;  4JI1 I;  5A2Q Q;  4JI4 I;  4DV1 E;  3PYD A;  4DR5 I;  2DEI A;  1Z0T A;  1XNR I;  4DR4 E;  2V8P A;  2A2C A;  4DPW A;  1FJG I;  4B3R I;  1N33 I;  1KKH A;  4WUD A;  3JAM Q;  4M1K A;  2UXB I;  5FLX C;  1IBM I;  4JI7 I;  1DAR A;  4JI8 E;  1A6F A;  1FI4 A;  2V34 A;  1NHJ A;  1S16 A;  4JI0 E;  1N33 E;  2BM0 A;  2VF3 A;  4LF9 I;  4HXZ A;  1EA6 A;  5IWA E;  2F4V E;  1N0V C;  3ZKB A;  4JI6 E;  1EI1 A;  5GME A;  3QT6 A;  4DXL A;  4GKJ E;  3M6A A;  5A2Q C;  4JV5 I;  1N34 I;  4PRV A;  4LF5 I;  2ZM6 E;  4B3M E;  1N32 E;  4DV1 I;  1HNW I;  2X36 A;  4RPF A;  3H4L A;  2HKE A;  1HR0 I;  4PRX A;  2V2Q A;  4B3T E;  3J7A M;  3V5R A;  5FLX Q;  2UXC E;  1H72 C;  4I3H A;  1H7S A;  2UUA I;  1ZXN A;  1IBM E;  4LFB I;  4YY3 E;  1N36 I;  2UUC I;  3T1Y I;  4LF4 E;  4DPU A;  1ZXM A;  4DUZ I;  4JG4 A;  1NZ0 A;  1B62 A;  4JI2 I;  2UXD I;  5BR8 I;  4HYM A;  3PYG A;  4XTJ A;  1N36 E;  4FN5 A;  3ZZT A;  4X65 E;  1ZM3 A;  3T1H E;  2LJP A;  4DV7 I;  1Z5A A;  4OX9 E;  2V2Z A;  5IT9 Q;  2NPF A;  4DUY I;  4FW9 A;  1HNZ E;  1HR0 E;  2UXC I;  2WW4 A;  3WU3 A;  3Q1Q A;  1XNQ I;  5LMU I;  3JAM C;  2E5L I;  4NXM E;  4JI3 E;  4DR7 E;  5GMD A;  4LF5 E;  5LMU E;  1N34 E;  4DR2 E;  4DV5 E;  2HK3 A;  4GKK E;  3J81 C;  1FWL A;  1Z5C A;  4JI5 E;  3QT5 A;  4DV4 I;  2A2D A;  4KQV A;  4B3T I;  4HY1 A;  4NXN I;  4YHH E;  2OI2 A;  4LF6 I;  3J80 C;  1MU5 A;  4JI7 E;  4WUB A;  5LL6 R;  2DEJ A;  3ZZ0 A;  1N0U A;  3V2U C;  1N32 I;  1QZR A;  4JI3 I;  1Z0B A;  3PYF A;  4P7A A;  4JI1 E;  3LNU A;  1MX0 A; 
#chains in the Genus database with same CATH topology
 2NN6 D;  3F0N A;  4EMD A;  1PKP A;  1RR9 A;  2BR2 A;  1E3P A;  3K85 A;  3B82 A;  4DPY A;  2JE6 B;  4LFC I;  4Z7C A;  4HAC B;  2J65 A;  4USK A;  1HNX E;  1S4E A;  4BA1 A;  3B8H A;  4KHP I;  2BM1 A;  3GME A;  1HNW E;  4JI5 I;  2Z5C B;  4X62 E;  1YHC A;  4DV2 I;  1J5E E;  4HAC A;  1ZM9 A;  3WU5 A;  2PO1 B;  3PYE A;  2C38 B;  2GQ0 A;  4AQY I;  2HKJ A;  3L7Z B;  3LPS A;  4DR4 I;  1XNR E;  1H74 A;  4DR6 E;  4DR5 E;  4K0K I;  4MQY A;  4DPT A;  4B3S E;  4OO1 C;  1RRE A;  4GKJ I;  4JYA I;  3K1J A;  3LTO A;  3GCM A;  4JI6 I;  5IT9 C;  1D6T A;  1USU A;  2C39 A;  4IS9 A;  2UU9 I;  2CG9 A;  4OO1 F;  4BA2 B;  3ZM7 A;  2JEA A;  1B63 A;  3NZK A;  4FWH A;  4FWG A;  1IBK E;  4YHH I;  4NXN E;  1WUU A;  4FWD A;  3PRY A;  4DPX A;  4DU7 A;  1MG7 A;  2C39 B;  3T1H I;  4USM A;  2PO2 A;  1NHI A;  4MU4 A;  2HFS A;  5DRR A;  2IES A;  1R6M A;  1XMO E;  2HHH I;  1H7U A;  5BR8 E;  1Z59 A;  1R6L A;  1KTV A;  2Q2E B;  4B3S I;  3DD6 A;  1UDQ A;  4IFD D;  2E1R A;  2UUB I;  3T1Y E;  2HHH E;  1UDN A;  4UTG A;  1Y6Z A;  4UT4 A;  5C0X E;  1IBL I;  4NXM I;  1Y5Y A;  1XNQ E;  1FKA E;  1KIJ A;  2JEA B;  3UHM A;  4LF6 E;  5JEA E;  2J7K A;  3P3G A;  2Z5E A;  3U1K A;  2F1D A;  1Z0G A;  4FW5 A;  3CWV A;  2UUA E;  4KHP E;  1I94 I;  2PO2 B;  4Z7Y A;  1Z5B A;  1PIE A;  2V2V A;  4IFD B;  4DV4 E;  4DV5 I;  3P3E A;  2IOQ A;  4DR2 I;  4LCG A;  4GKK I;  4LF8 I;  3PS2 A;  2NN6 F;  2ZM6 I;  4B3M I;  1Y60 A;  4X64 E;  2X7I A;  5LMN E;  2PO1 A;  1FNM A;  4QNK A;  3OTO I;  4DV6 I;  4PU9 A;  2IOP A;  4DR1 E;  4DUZ E;  2GS8 A;  4X66 E;  2C37 B;  2UXD E;  2UUC E;  1Z0E A;  2O1V A;  3HUL A;  1KVK A;  4FW6 A;  2BA0 G;  4MU1 A;  4X62 I;  1ELO A;  3J7A G;  4LF8 E;  3GON A;  2VQE E;  4LF7 I;  2GO3 A;  2R3V A;  4IZJ B;  1XMQ E;  1K47 A;  1NHH A;  4AIM A;  2VQF I;  1UEK A;  3QT8 A;  4IFD E;  4LFC E;  4OO1 D;  1BKN A;  1XHK A;  4LF7 E;  2O3Z A;  2JE6 A;  2AJ4 A;  2UU9 E;  3P06 A;  1H73 A;  4IZK A;  5FWK A;  4DV3 I;  5JEA B;  2HK2 A;  3OTO E;  3WU4 A;  4LFA E;  4X64 I;  3HJC A;  4DR7 I;  4JI2 E;  2UUB E;  5C0X B;  3U1Y A;  4DU8 A;  2E5L E;  2BA0 D;  4DV6 E;  4AQY E;  4JI4 E;  4LFB E;  3ZKD A;  4LF9 E;  1FWK A;  1Z0V A;  3J81 Q;  2JEB A;  1Y4U A;  1HNZ I;  4DV2 E;  1J5E I;  2AE8 A;  4URL A;  4DV7 E;  4OX9 I;  2PNL A;  3QT7 A;  5L3J A;  5K36 F;  2VQE I;  1Z0W A;  2WNR B;  1U2R A;  2ZIT A;  4DUY E;  4JI8 I;  2BV3 A;  2PO0 A;  1XMQ I;  2HFU A;  1I94 E;  4WUC A;  1OYS A;  2XEX A;  2CZ9 A;  3ZZU A;  1HNX I;  3CDJ A;  3K17 A;  1Y4S A;  1IBK I;  3J80 Q;  3M85 G;  4B3R E;  4LOM A;  5LMN I;  5K36 B;  1VIS A;  2ZBK B;  2IER A;  4P52 A;  4X66 I;  4LFA I;  4MU3 A;  4DR1 I;  4JV5 E;  4YY3 I;  4ZVI A;  1OYR A;  4DV3 E;  1FJG E;  5IWA I;  2F4V I;  3WU6 A;  4LF4 I;  4MYT A;  1ZM2 A;  4DR6 I;  4K0K E;  4DR3 I;  1ZM4 A;  4DV0 I;  4LCF A;  1XMO I;  2O1T A;  2WNR A;  3B78 A;  4R1F A;  4JI0 I;  4ED4 A;  4OKG A;  1USV A;  2GO4 A;  2VQF E;  1OYP A;  3P76 A;  3P3C A;  3HKM A;  4X65 I;  4AM3 A;  1IBL E;  2PNM A;  2EFG A;  4DV0 E;  4MYU A;  4DR3 E;  4LPF A;  2UXB E;  1OJ4 A;  3D4J A;  1PVG A;  4JYA E;  2R42 A;  1Z0C A;  4JI1 I;  5A2Q Q;  4JI4 I;  2PNZ B;  4DV1 E;  3PYD A;  4DR5 I;  2DEI A;  1Z0T A;  1XNR I;  4DR4 E;  2V8P A;  2A2C A;  4ISA A;  4DPW A;  1FJG I;  4B3R I;  5EKW A;  1N33 I;  1KKH A;  1UDO A;  2PO0 B;  2NN6 A;  2O1W A;  4WUD A;  4FW4 A;  3JAM Q;  4M1K A;  2UXB I;  5FLX C;  1IBM I;  2CVE A;  4JI7 I;  1DAR A;  4JI8 E;  5JEA C;  1A6F A;  1FI4 A;  2NN6 C;  2V34 A;  1NHJ A;  1S16 A;  4JI0 E;  1P42 A;  1N33 E;  2BM0 A;  2VF3 A;  3Q6N A;  3M7N G;  4LCH A;  4LF9 I;  4HXZ A;  5JEA A;  1EA6 A;  5IWA E;  2F4V E;  1RHY A;  1N0V C;  3ZKB A;  4JI6 E;  1EI1 A;  2VES A;  5EL9 A;  5GME A;  5DRP A;  3QT6 A;  1E3H A;  4DXL A;  4GKJ E;  3M6A A;  4U3D A;  5A2Q C;  4JV5 I;  1N34 I;  4PRV A;  4LF5 I;  2ZM6 E;  4B3M E;  1N32 E;  4DV1 I;  1HNW I;  2WP8 A;  4AID A;  2X36 A;  4RPF A;  2Z5C A;  1HK7 A;  3H4L A;  2HKE A;  4GQU A;  1HR0 I;  4MU0 A;  4PRX A;  2V2Q A;  4B3T E;  3J7A M;  3V5R A;  5K36 C;  3PS1 A;  5FLX Q;  2UXC E;  1H72 C;  4I3H A;  1H7S A;  5C0X F;  2UUA I;  3Q6M A;  4FW3 A;  2O1U A;  4BA1 B;  1ZXN A;  4NBQ A;  2WP8 B;  4OO1 A;  3PS3 A;  2JEB B;  1YH8 A;  1IBM E;  5JEA F;  4IFD C;  4LFB I;  3CDI A;  1VI7 A;  5K36 A;  4YY3 E;  1N36 I;  4IZJ D;  2UUC I;  3T1Y I;  4LF4 E;  2CGE A;  4DPU A;  1ZXM A;  4DUZ I;  4JG4 A;  1NZ0 A;  1B62 A;  4OO1 B;  4IFD A;  4JI2 I;  4MDT A;  2UXD I;  5ELW A;  2BR2 B;  4N3O A;  5BR8 I;  2NN6 E;  4HYM A;  3PYG A;  4XTJ A;  5JEA D;  1N36 E;  2Z5B B;  4FN5 A;  3ZZT A;  4X65 E;  1ZM3 A;  3T1H E;  2LJP A;  2C37 A;  1Z5A A;  5C0X D;  4DV7 I;  4OX9 E;  2V2Z A;  5IT9 Q;  2NPF A;  4DUY I;  4FW9 A;  1HNZ E;  1HR0 E;  5DNL A;  4FW7 A;  4QNJ A;  4U3B A;  2UXC I;  2WW4 A;  3WU3 A;  3Q1Q A;  1XNQ I;  2C38 A;  5LMU I;  4OZE A;  3JAM C;  2E5L I;  5DRO A;  4IFD F;  4NXM E;  4JI3 E;  3M7N D;  4DR7 E;  5GMD A;  4LF5 E;  5LMU E;  1N34 E;  5K36 E;  2Z5B A;  4DR2 E;  4DV5 E;  2BA1 D;  4BA2 A;  3GLL A;  5K36 D;  2HK3 A;  4GKK E;  4IZJ A;  3J81 C;  1FWL A;  1Z5C A;  4JI5 E;  2JT2 A;  3QT5 A;  3M85 D;  4DV4 I;  2A2D A;  4KQV A;  4B3T I;  4HY1 A;  3B4T A;  4NXN I;  4YHH E;  2OI2 A;  2NN6 B;  4LF6 I;  5C0X C;  3J80 C;  1MU5 A;  4JI7 E;  4OO1 E;  4J3D A;  4IZK B;  3H1C A;  3KRN A;  4WUB A;  5LL6 R;  2DEJ A;  3ZZ0 A;  1N0U A;  3V2U C;  5C0X A;  1N32 I;  1QZR A;  1UDS A;  4JI3 I;  1Z0B A;  5DNX A;  5DRQ A;  2PNZ A;  3PYF A;  4P7A A;  3L7Z A;  1XXE A;  4JI1 E;  3LNU A;  1MX0 A;  2BA1 G; 
#chains in the Genus database with same CATH homology
 3F0N A;  4EMD A;  1PKP A;  1RR9 A;  3K85 A;  3B82 A;  4DPY A;  4LFC I;  4Z7C A;  4HAC B;  4USK A;  1HNX E;  1S4E A;  3B8H A;  4KHP I;  2BM1 A;  1HNW E;  4JI5 I;  2Z5C B;  4X62 E;  4DV2 I;  1J5E E;  4HAC A;  1ZM9 A;  3WU5 A;  3PYE A;  2GQ0 A;  4AQY I;  2HKJ A;  3LPS A;  4DR4 I;  1XNR E;  1H74 A;  4DR6 E;  4DR5 E;  4K0K I;  4DPT A;  4B3S E;  1RRE A;  4GKJ I;  4JYA I;  3K1J A;  3LTO A;  4JI6 I;  5IT9 C;  1D6T A;  1USU A;  2UU9 I;  2CG9 A;  3ZM7 A;  1B63 A;  4FWH A;  4FWG A;  1IBK E;  4YHH I;  4NXN E;  1WUU A;  4FWD A;  3PRY A;  4DPX A;  4DU7 A;  1MG7 A;  3T1H I;  4USM A;  1NHI A;  2HFS A;  1XMO E;  2HHH I;  1H7U A;  5BR8 E;  1Z59 A;  1KTV A;  2Q2E B;  4B3S I;  2E1R A;  2UUB I;  3T1Y E;  2HHH E;  4UTG A;  1Y6Z A;  4UT4 A;  1IBL I;  4NXM I;  1XNQ E;  1FKA E;  1KIJ A;  4LF6 E;  2J7K A;  2Z5E A;  1Z0G A;  3CWV A;  2UUA E;  4KHP E;  1I94 I;  4Z7Y A;  1Z5B A;  1PIE A;  2V2V A;  4DV4 E;  4DV5 I;  2IOQ A;  4DR2 I;  4GKK I;  4LF8 I;  2ZM6 I;  4B3M I;  4X64 E;  2X7I A;  5LMN E;  1FNM A;  3OTO I;  4DV6 I;  4PU9 A;  2IOP A;  4DR1 E;  4DUZ E;  2GS8 A;  4X66 E;  2UXD E;  2UUC E;  1Z0E A;  2O1V A;  3HUL A;  1KVK A;  4X62 I;  1ELO A;  3J7A G;  4LF8 E;  3GON A;  2VQE E;  4LF7 I;  2R3V A;  4IZJ B;  1XMQ E;  1K47 A;  1NHH A;  2VQF I;  1UEK A;  3QT8 A;  4LFC E;  1BKN A;  1XHK A;  4LF7 E;  2AJ4 A;  2UU9 E;  3P06 A;  1H73 A;  4IZK A;  5FWK A;  4DV3 I;  2HK2 A;  3OTO E;  3WU4 A;  4LFA E;  4X64 I;  3HJC A;  4DR7 I;  4JI2 E;  2UUB E;  4DU8 A;  2E5L E;  4DV6 E;  4AQY E;  4JI4 E;  4LFB E;  3ZKD A;  4LF9 E;  1FWK A;  1Z0V A;  3J81 Q;  1Y4U A;  1HNZ I;  4DV2 E;  1J5E I;  4URL A;  4DV7 E;  4OX9 I;  2PNL A;  3QT7 A;  5L3J A;  2VQE I;  1Z0W A;  1U2R A;  2ZIT A;  4DUY E;  4JI8 I;  2BV3 A;  1XMQ I;  2HFU A;  1I94 E;  4WUC A;  2XEX A;  2CZ9 A;  3ZZU A;  1HNX I;  3K17 A;  1Y4S A;  1IBK I;  3J80 Q;  4B3R E;  5LMN I;  1VIS A;  2ZBK B;  4P52 A;  4X66 I;  4LFA I;  4DR1 I;  4JV5 E;  4YY3 I;  4ZVI A;  4DV3 E;  1FJG E;  5IWA I;  2F4V I;  3WU6 A;  4LF4 I;  4MYT A;  1ZM2 A;  4DR6 I;  4K0K E;  4DR3 I;  1ZM4 A;  4DV0 I;  1XMO I;  2O1T A;  3B78 A;  4R1F A;  4JI0 I;  4ED4 A;  1USV A;  2VQF E;  4X65 I;  1IBL E;  2PNM A;  2EFG A;  4DV0 E;  4MYU A;  4DR3 E;  2UXB E;  1OJ4 A;  3D4J A;  1PVG A;  4JYA E;  2R42 A;  1Z0C A;  4JI1 I;  5A2Q Q;  4JI4 I;  4DV1 E;  3PYD A;  4DR5 I;  2DEI A;  1Z0T A;  1XNR I;  4DR4 E;  2V8P A;  2A2C A;  4DPW A;  1FJG I;  4B3R I;  1N33 I;  1KKH A;  2O1W A;  4WUD A;  3JAM Q;  4M1K A;  2UXB I;  5FLX C;  1IBM I;  4JI7 I;  1DAR A;  4JI8 E;  1A6F A;  1FI4 A;  2V34 A;  1NHJ A;  1S16 A;  4JI0 E;  1N33 E;  2BM0 A;  2VF3 A;  3Q6N A;  4LF9 I;  4HXZ A;  1EA6 A;  5IWA E;  2F4V E;  1N0V C;  3ZKB A;  4JI6 E;  1EI1 A;  5GME A;  3QT6 A;  4DXL A;  4GKJ E;  3M6A A;  5A2Q C;  4JV5 I;  1N34 I;  4PRV A;  4LF5 I;  2ZM6 E;  4B3M E;  1N32 E;  4DV1 I;  1HNW I;  2X36 A;  4RPF A;  2Z5C A;  1HK7 A;  3H4L A;  2HKE A;  1HR0 I;  4PRX A;  2V2Q A;  4B3T E;  3J7A M;  3V5R A;  5FLX Q;  2UXC E;  1H72 C;  4I3H A;  1H7S A;  2UUA I;  3Q6M A;  2O1U A;  1ZXN A;  1IBM E;  4LFB I;  4YY3 E;  1N36 I;  4IZJ D;  2UUC I;  3T1Y I;  4LF4 E;  2CGE A;  4DPU A;  1ZXM A;  4DUZ I;  4JG4 A;  1NZ0 A;  1B62 A;  4JI2 I;  2UXD I;  4N3O A;  5BR8 I;  4HYM A;  3PYG A;  4XTJ A;  1N36 E;  2Z5B B;  4FN5 A;  3ZZT A;  4X65 E;  1ZM3 A;  3T1H E;  2LJP A;  4DV7 I;  1Z5A A;  4OX9 E;  2V2Z A;  5IT9 Q;  2NPF A;  4DUY I;  4FW9 A;  1HNZ E;  1HR0 E;  2UXC I;  2WW4 A;  3WU3 A;  3Q1Q A;  1XNQ I;  5LMU I;  3JAM C;  2E5L I;  4NXM E;  4JI3 E;  4DR7 E;  5GMD A;  4LF5 E;  5LMU E;  1N34 E;  2Z5B A;  4DR2 E;  4DV5 E;  2HK3 A;  4GKK E;  4IZJ A;  3J81 C;  1FWL A;  1Z5C A;  4JI5 E;  3QT5 A;  4DV4 I;  2A2D A;  4KQV A;  4B3T I;  4HY1 A;  4NXN I;  4YHH E;  2OI2 A;  4LF6 I;  3J80 C;  1MU5 A;  4JI7 E;  4IZK B;  4WUB A;  5LL6 R;  2DEJ A;  3ZZ0 A;  1N0U A;  3V2U C;  1N32 I;  1QZR A;  4JI3 I;  1Z0B A;  3PYF A;  4P7A A;  4JI1 E;  3LNU A;  1MX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...