4B3MI

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mI00
4DV6I 4KQVA 2BM1A 4X65I 4DPWA 3HULA 1MG7A 4JI1E 1N34E 3LNUA 1N36I 4DV4I 5IT9Q 1UEKA 1FWKA 2UXDE 4LFBE 3B82A 3PYGA 4WUBA 1N0VC 3J81C 4FWGA 1WUUA 4FW9A 4DXLA 1Z5CA 4JI2I 3QT8A 1N33I 1Z0WA 1ZM9A 1ZM3A 2VQEI 1BKNA 5GMDA 2DEJA 2BV3A 4LF4I 4YHHI 3F0NA 4X64I 2HHHI 4LF5I 3GONA 1K47A 4DPXA 4DV6E 1Z59A 4DU8A 5L3JA 4X65E 2AJ4A 2ZM6I 4DR6I 4UTGA 2UUBI 3ZZTA 1N36E 1B63A 4DV4E 2ZBKB 3PYDA 4WUDA 4X66I 1ZM4A 3B78A 4JI3E 4DUZI 3V5RA 2CZ9A 4LF7I 4JI2E 4JYAI 1N33E 3H4LA 2UU9I 4LF9I 2J7KA 4USMA 2HK2A 2VQEE 2R3VA 1HNXI 1PIEA 2ZITA 4DUYI 4NXMI 4HACA 1NHHA 4LF4E 1DARA 4YHHE 4X64E 2HHHE 4JI0I 4B3TI 4LF5E 1Z0CA 4DR4E 3T1YI 2ZM6E 1Z5AA 4B3RI 5A2QC 4DR6E 1FKAE 1Z0EA 5LMNI 2EFGA 1Z0TA 4X66E 2OI2A 1KTVA 5BR8E 4Z7YA 1ELOA 4GKJE 2V2QA 1N32I 5FLXQ 3ZZUA 2UXCI 2E5LI 1NZ0A 1U2RA 3QT6A 4DR5I 2UUAI 4LF7E 4JYAE 4DV5I 1XMQI 1FNMA 4LFAI 2UU9E 4ED4A 4DV7I 1HNXE 2GS8A 1HNZI 4HXZA 2UXBI 4DR3I 1Z0GA 2VF3A 1FJGI 4JI8I 1IBMI 4JI0E 4LF6I 1IBLI 4B3TE 4DR2I 3T1YE 2NPFA 2UUCI 3J80C 4B3RE 4JV5E 4DV1I 5LMNE 1XMOI 2HK3A 5LMUI 4KHPI 1A6FA 4AQYI 3QT5A 1N32E 4JI7I 3LPSA 2UXCE 2E5LE 4DR5E 3K17A 2HKEA 4DV5E 4I3HA 1Z0VA 4EMDA 1Z5BA 4USKA 4DV7E 1HNZE 1D6TA 2UXBE 4DR7I 4DR3E 3J81Q 1XHKA 3PYFA 2WW4A 3D4JA 1FJGE 4JI8E 5LL6R 1MU5A 1IBME 3WU4A 4LF6E 1I94I 4B3SI 4GKKI 1XNRI 4DR2E 2F4VI 3J7AG 2UUCE 1EA6A 4DPYA 3QT7A 4M1KA 4JI4I 4DV1E 1S4EA 5LMUE 3ZZ0A 4KHPE 1HNWI 1KIJA 3K1JA 3WU6A 4DR1I 4AQYE 2DEIA 4UT4A 4JI7E 1HR0I 4FWHA 4X62I 3ZKBA 4K0KI 1ZM2A 2UUBE 4RPFA 4PU9A 1FI4A 2V2VA 4HY1A 1QZRA 2LJPA 4YY3I 4ZVIA 4GKKE 4DUZE 1I94E 4B3SE 1XNRE 3WU5A 4JG4A 2HFSA 1VISA 4LF8I 1ZXNA 4LF9E 4DV0I 4JI4E 4URLA 4DUYE 2V34A 4NXME 1HNWE 2V2ZA 3WU3A 4DR1E 4P52A 5A2QQ 1HR0E 1RR9A 3T1HI 4HACB 4MYTA 4X62E 3Q1QA 5IWAI 4K0KE 4JI6I 4DPTA 4JI3I 1NHIA 4YY3E 1H7UA 4OX9I 2UUAE 4LF8E 4MYUA 1XMQE 3ZM7A 4Z7CA 4DV2I 4LFAE 4DV0E 3B8HA 1IBKI 1PKPA 4B3MI 3J7AM 2E1RA 2VQFI 1MX0A 3LTOA 3J80Q 4NXNI 2R42A 1OJ4A 1IBLE 3T1HE 4DR4I 2BM0A 4LFCI 1N0UA 2A2DA 1ZXMA 4PRXA 2V8PA 1B62A 1S16A 4DV3I 5IWAE 1XNQI 2A2CA 4JI6E 1XMOE 1H74A 4PRVA 1H73A 5BR8I 4GKJI 3JAMC 5GMEA 2HKJA 1J5EI 2HFUA 3OTOI 3V2UC 4JI5I 3PYEA 4OX9E 1KKHA 5FLXC 3M6AA 4DV2E 4JI1I 3CWVA 1N34I 1KVKA 4R1FA 1IBKE 2Q2EB 4DR7E 4B3ME 2VQFE 2UXDI 4LFBI 4P7AA 1RREA 2XEXA 4XTJA 4NXNE 5IT9C 1FWLA 4LFCE 2F4VE 4JV5I 1NHJA 4WUCA 4FWDA 3JAMQ 1EI1A 4DPUA 1Z0BA 4DV3E 4DU7A 1XNQE 3ZKDA 4FN5A 2X36A 1H72C 1PVGA 1H7SA 2X7IA 4HYMA 1J5EE 3OTOE 4JI5E
chains in the Genus database with same CATH superfamily
4DV6I 3Q6NA 4KQVA 2BM1A 3DD6A 4DPWA 4X65I 3HULA 1MG7A 2JEBB 3GCMA 3U1KA 4FW3A 4FW7A 2BA1D 4IZKA 4JI1E 1N34E 2AE8A 4OO1F 3LNUA 1N36I 4DV4I 4OO1C 5IT9Q 4IZJA 1UEKA 1FWKA 3Q6MA 2IOPA 4LFBE 2UXDE 3B82A 3PYGA 4WUBA 1R6LA 1N0VC 3J81C 2PO1B 4FWGA 1WUUA 4FW9A 4DXLA 1Z5CA 4OZEA 4JI2I 3QT8A 1N33I 1Z0WA 1ZM9A 1ZM3A 2VQEI 3PS3A 1BKNA 5GMDA 2PNMA 5K36A 2DEJA 2BV3A 4LF4I 4YHHI 2NN6B 3M85G 3F0NA 4X64I 2HHHI 4LF5I 3GONA 1K47A 4DPXA 5DRPA 4DV6E 1UDSA 2O1VA 1Z59A 4DU8A 5L3JA 4X65E 2AJ4A 2ZM6I 2CG9A 2CGEA 4DR6I 4UTGA 3ZZTA 1N36E 2UUBI 2C39A 1B63A 4DV4E 2ZBKB 3PYDA 4QNJA 4WUDA 4X66I 1ZM4A 4IFDA 3B78A 1P42A 3PS1A 4JI3E 4DUZI 4LCFA 1Y4SA 3V5RA 2CZ9A 4LF7I 4JI2E 4JYAI 1N33E 1UDQA 3H4LA 2UU9I 4LF9I 2IESA 2J7KA 4USMA 2HK2A 2VQEE 2R3VA 3K85A 1HNXI 1PIEA 2ZITA 4DUYI 2PO0B 5DNXA 4NXMI 2BR2A 4AIDA 4HACA 2GO3A 2O1WA 4IZJD 1NHHA 4MU4A 4LF4E 1DARA 4YHHE 4X64E 2HHHE 4JI0I 4FW5A 4B3TI 4LF5E 1Z0CA 2O1TA 4DR4E 3T1YI 3P76A 2ZM6E 1Z5AA 1USVA 4B3RI 5A2QC 4DR6E 4BA1A 1FKAE 5JEAB 1Z0EA 4AIMA 5LMNI 2EFGA 1Z0TA 4X66E 1YH8A 4ISAA 5ELWA 2OI2A 1KTVA 5C0XE 5BR8E 5K36D 2PNZB 5JEAC 4Z7YA 1ELOA 4GKJE 2C39B 2WNRA 2V2QA 1N32I 5FLXQ 1R6MA 3ZZUA 2UXCI 2E5LI 1NZ0A 3M7NG 5DRQA 1U2RA 2Z5EA 3QT6A 4DR5I 2UUAI 4LF7E 4JYAE 4DV5I 2WP8B 1XMQI 1FNMA 2JE6B 4LFAI 2UU9E 4ED4A 1E3HA 3H1CA 4DV7I 1HNXE 2GS8A 1HNZI 4HXZA 4IS9A 3P3CA 2UXBI 4DR3I 3GMEA 2CVEA 2Z5BB 4OKGA 1Z0GA 3CDJA 5C0XD 1VI7A 4IFDD 2VF3A 3P3EA 4OO1E 1OYSA 4MDTA 1FJGI 4JI8I 1IBMI 4JI0E 4LF6I 1IBLI 4B3TE 3HJCA 4DR2I 1UDNA 3T1YE 2NPFA 4GQUA 2UUCI 3J80C 4B3RE 4JV5E 1OYRA 2JT2A 4LOMA 4DV1I 5LMNE 1XMOI 2HK3A 5LMUI 4KHPI 5EL9A 1A6FA 4FW4A 4U3BA 4OO1D 4AQYI 2JEAB 3QT5A 1N32E 4JI7I 3P06A 3LPSA 2UXCE 2E5LE 4DR5E 3K17A 2HKEA 4DV5E 2NN6F 4I3HA 1Z0VA 3L7ZA 3PS2A 2NN6C 4EMDA 1Z5BA 4USKA 4DV7E 1HNZE 1D6TA 2UXBE 4DR7I 4DR3E 3J81Q 2NN6E 1XHKA 5C0XA 3PYFA 2WW4A 4MU1A 2Z5CA 4QNKA 4IZKB 3CDIA 3D4JA 1FJGE 4JI8E 5LL6R 1MU5A 1IBME 3WU4A 4LF6E 1I94I 4B3SI 4IZJB 4GKKI 1XNRI 4DR2E 2F4VI 3J7AG 2VESA 3P3GA 3U1YA 2UUCE 1EA6A 4DPYA 3QT7A 4M1KA 4JI4I 4DV1E 1S4EA 1OYPA 2PO2A 3B4TA 5LMUE 3ZZ0A 2C38A 4KHPE 1HNWI 1KIJA 3K1JA 4OO1A 3WU6A 4DR1I 4AQYE 2BA0G 2DEIA 2JEBA 4UT4A 4JI7E 1HR0I 5K36B 4FWHA 5DROA 4X62I 5FWKA 3ZKBA 4MU0A 5K36C 2PO1A 4K0KI 1ZM2A 2UUBE 1UDOA 4RPFA 3M7ND 4PU9A 5JEAF 1FI4A 1Y60A 2V2VA 1QZRA 4HY1A 2LJPA 4YY3I 4AM3A 4ZVIA 5C0XB 4DUZE 1I94E 4B3SE 4GKKE 4IFDB 1XNRE 5JEAE 4LCGA 4JG4A 3WU5A 1USUA 2Z5CB 2HFSA 1VISA 4LF8I 1ZXNA 2F1DA 4LF9E 4BA2A 4DV0I 4IFDC 4JI4E 2NN6A 4URLA 4DUYE 2C37A 2V34A 4NXME 1HNWE 2V2ZA 3WU3A 4DR1E 4P52A 2GO4A 1Y6ZA 5A2QQ 4LCHA 1HR0E 1RR9A 2BR2B 3T1HI 4HACB 4OO1B 4MYTA 3GLLA 4X62E 3NZKA 4MU3A 3Q1QA 5IWAI 4K0KE 2IOQA 3M85D 4JI6I 1Y4UA 4DPTA 2BA1G 4BA1B 4JI3I 1NHIA 4YY3E 5DNLA 1H7UA 2PO0A 4OX9I 2UUAE 4LF8E 1YHCA 4MYUA 2PNLA 1XMQE 2WNRB 3ZM7A 4Z7CA 4DV2I 4LFAE 4DV0E 2IERA 5DRRA 3B8HA 1IBKI 1PKPA 4B3MI 3J7AM 1HK7A 2E1RA 2VQFI 4LPFA 4BA2B 1MX0A 3LTOA 3J80Q 2C37B 4NXNI 2R42A 4MQYA 5JEAA 1OJ4A 1IBLE 3T1HE 4DR4I 2BM0A 4LFCI 1N0UA 2A2DA 1ZXMA 2PNZA 4PRXA 2V8PA 1B62A 4N3OA 2BA0D 1S16A 4DV3I 5IWAE 1XNQI 2A2CA 2NN6D 3KRNA 4JI6E 1XMOE 1H74A 4PRVA 1H73A 5BR8I 3HKMA 2GQ0A 2WP8A 4GKJI 1Y5YA 3JAMC 5GMEA 2JE6A 2HKJA 2O1UA 1J5EI 1XXEA 2HFUA 3UHMA 3V2UC 3OTOI 4JI5I 3PYEA 4OX9E 4U3DA 2Z5BA 4FW6A 1KKHA 5FLXC 3M6AA 4DV2E 4JI1I 3CWVA 1N34I 5K36F 1KVKA 4R1FA 2O3ZA 1IBKE 2Q2EB 4DR7E 4B3ME 2VQFE 5EKWA 3L7ZB 4LFBI 2UXDI 1RHYA 5K36E 4P7AA 1RREA 2XEXA 4XTJA 4NXNE 5IT9C 1FWLA 4LFCE 2F4VE 4JV5I 4J3DA 1NHJA 4WUCA 4FWDA 5C0XF 3JAMQ 4IFDF 1EI1A 2JEAA 4DPUA 1Z0BA 5C0XC 4DV3E 4DU7A 1E3PA 1XNQE 3ZKDA 4FN5A 2X36A 1H72C 4IFDE 3PRYA 1PVGA 2J65A 1H7SA 2X7IA 4NBQA 4HYMA 1J5EE 2PO2B 3OTOE 2C38B 4JI5E 5JEAD
chains in the Genus database with same CATH topology
4DV6I 3Q6NA 4KQVA 2BM1A 4X65I 4DPWA 3HULA 1MG7A 4IZKA 4JI1E 1N34E 3LNUA 1N36I 4DV4I 5IT9Q 4IZJA 1UEKA 1FWKA 3Q6MA 2IOPA 4LFBE 2UXDE 3B82A 3PYGA 4WUBA 1N0VC 3J81C 4FWGA 1WUUA 4FW9A 4DXLA 1Z5CA 4JI2I 3QT8A 1N33I 1Z0WA 1ZM9A 1ZM3A 2VQEI 1BKNA 5GMDA 2PNMA 2DEJA 2BV3A 4LF4I 4YHHI 3F0NA 4X64I 2HHHI 4LF5I 3GONA 1K47A 4DPXA 4DV6E 2O1VA 1Z59A 4DU8A 5L3JA 4X65E 2AJ4A 2ZM6I 2CG9A 2CGEA 4DR6I 4UTGA 3ZZTA 1N36E 2UUBI 1B63A 4DV4E 2ZBKB 3PYDA 4WUDA 4X66I 1ZM4A 3B78A 4JI3E 4DUZI 1Y4SA 3V5RA 2CZ9A 4LF7I 4JI2E 4JYAI 1N33E 3H4LA 2UU9I 4LF9I 2J7KA 4USMA 2HK2A 2VQEE 2R3VA 3K85A 1HNXI 1PIEA 2ZITA 4DUYI 4NXMI 4HACA 2O1WA 4IZJD 1NHHA 4LF4E 1DARA 4YHHE 4X64E 2HHHE 4JI0I 4B3TI 4LF5E 1Z0CA 2O1TA 4DR4E 3T1YI 2ZM6E 1Z5AA 1USVA 4B3RI 5A2QC 4DR6E 1FKAE 1Z0EA 5LMNI 2EFGA 1Z0TA 4X66E 2OI2A 1KTVA 5BR8E 4Z7YA 1ELOA 4GKJE 2V2QA 1N32I 5FLXQ 3ZZUA 2UXCI 2E5LI 1NZ0A 1U2RA 2Z5EA 3QT6A 4DR5I 2UUAI 4LF7E 4JYAE 4DV5I 1XMQI 1FNMA 4LFAI 2UU9E 4ED4A 4DV7I 1HNXE 2GS8A 1HNZI 4HXZA 2UXBI 4DR3I 2Z5BB 1Z0GA 2VF3A 1FJGI 4JI8I 1IBMI 4JI0E 4LF6I 1IBLI 4B3TE 3HJCA 4DR2I 3T1YE 2NPFA 2UUCI 3J80C 4B3RE 4JV5E 4DV1I 5LMNE 1XMOI 2HK3A 5LMUI 4KHPI 1A6FA 4AQYI 3QT5A 1N32E 4JI7I 3P06A 3LPSA 2UXCE 2E5LE 4DR5E 3K17A 2HKEA 4DV5E 4I3HA 1Z0VA 4EMDA 1Z5BA 4USKA 4DV7E 1HNZE 1D6TA 2UXBE 4DR7I 4DR3E 3J81Q 1XHKA 3PYFA 2WW4A 2Z5CA 4IZKB 3D4JA 1FJGE 4JI8E 5LL6R 1MU5A 1IBME 3WU4A 4LF6E 1I94I 4B3SI 4IZJB 4GKKI 1XNRI 4DR2E 2F4VI 3J7AG 2UUCE 1EA6A 4DPYA 3QT7A 4M1KA 4JI4I 4DV1E 1S4EA 5LMUE 3ZZ0A 4KHPE 1HNWI 1KIJA 3K1JA 3WU6A 4DR1I 4AQYE 2DEIA 4UT4A 4JI7E 1HR0I 4FWHA 4X62I 5FWKA 3ZKBA 4K0KI 1ZM2A 2UUBE 4RPFA 4PU9A 1FI4A 2V2VA 4HY1A 1QZRA 2LJPA 4YY3I 4ZVIA 4GKKE 4DUZE 1I94E 4B3SE 1XNRE 3WU5A 4JG4A 1USUA 2Z5CB 2HFSA 1VISA 4LF8I 1ZXNA 4LF9E 4DV0I 4JI4E 4URLA 4DUYE 2V34A 4NXME 1HNWE 2V2ZA 3WU3A 4DR1E 4P52A 1Y6ZA 5A2QQ 1HR0E 1RR9A 3T1HI 4HACB 4MYTA 4X62E 3Q1QA 5IWAI 4K0KE 2IOQA 4JI6I 1Y4UA 4DPTA 4JI3I 1NHIA 4YY3E 1H7UA 4OX9I 2UUAE 4LF8E 4MYUA 2PNLA 1XMQE 3ZM7A 4Z7CA 4DV2I 4LFAE 4DV0E 3B8HA 1IBKI 1PKPA 4B3MI 3J7AM 1HK7A 2E1RA 2VQFI 1MX0A 3LTOA 3J80Q 4NXNI 2R42A 1OJ4A 1IBLE 3T1HE 4DR4I 2BM0A 4LFCI 1N0UA 2A2DA 1ZXMA 4PRXA 2V8PA 1B62A 4N3OA 1S16A 4DV3I 5IWAE 1XNQI 2A2CA 4JI6E 1XMOE 1H74A 4PRVA 1H73A 5BR8I 2GQ0A 4GKJI 3JAMC 5GMEA 2HKJA 2O1UA 1J5EI 2HFUA 3OTOI 3V2UC 4JI5I 3PYEA 4OX9E 2Z5BA 1KKHA 5FLXC 3M6AA 4DV2E 4JI1I 3CWVA 1N34I 1KVKA 4R1FA 1IBKE 2Q2EB 4DR7E 4B3ME 2VQFE 2UXDI 4LFBI 4P7AA 1RREA 2XEXA 4XTJA 4NXNE 5IT9C 1FWLA 4LFCE 2F4VE 4JV5I 1NHJA 4WUCA 4FWDA 3JAMQ 1EI1A 4DPUA 1Z0BA 4DV3E 4DU7A 1XNQE 3ZKDA 4FN5A 2X36A 1H72C 3PRYA 1PVGA 1H7SA 2X7IA 4HYMA 1J5EE 3OTOE 4JI5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 I;  4KQV A;  2BM1 A;  4X65 I;  4DPW A;  3HUL A;  1MG7 A;  4JI1 E;  1N34 E;  3LNU A;  1N36 I;  4DV4 I;  5IT9 Q;  1UEK A;  1FWK A;  2UXD E;  4LFB E;  3B82 A;  3PYG A;  4WUB A;  1N0V C;  3J81 C;  4FWG A;  1WUU A;  4FW9 A;  4DXL A;  1Z5C A;  4JI2 I;  3QT8 A;  1N33 I;  1Z0W A;  1ZM9 A;  1ZM3 A;  2VQE I;  1BKN A;  5GMD A;  2DEJ A;  2BV3 A;  4LF4 I;  4YHH I;  3F0N A;  4X64 I;  2HHH I;  4LF5 I;  3GON A;  1K47 A;  4DPX A;  4DV6 E;  1Z59 A;  4DU8 A;  5L3J A;  4X65 E;  2AJ4 A;  2ZM6 I;  4DR6 I;  4UTG A;  2UUB I;  3ZZT A;  1N36 E;  1B63 A;  4DV4 E;  2ZBK B;  3PYD A;  4WUD A;  4X66 I;  1ZM4 A;  3B78 A;  4JI3 E;  4DUZ I;  3V5R A;  2CZ9 A;  4LF7 I;  4JI2 E;  4JYA I;  1N33 E;  3H4L A;  2UU9 I;  4LF9 I;  2J7K A;  4USM A;  2HK2 A;  2VQE E;  2R3V A;  1HNX I;  1PIE A;  2ZIT A;  4DUY I;  4NXM I;  4HAC A;  1NHH A;  4LF4 E;  1DAR A;  4YHH E;  4X64 E;  2HHH E;  4JI0 I;  4B3T I;  4LF5 E;  1Z0C A;  4DR4 E;  3T1Y I;  2ZM6 E;  1Z5A A;  4B3R I;  5A2Q C;  4DR6 E;  1FKA E;  1Z0E A;  5LMN I;  2EFG A;  1Z0T A;  4X66 E;  2OI2 A;  1KTV A;  5BR8 E;  4Z7Y A;  1ELO A;  4GKJ E;  2V2Q A;  1N32 I;  5FLX Q;  3ZZU A;  2UXC I;  2E5L I;  1NZ0 A;  1U2R A;  3QT6 A;  4DR5 I;  2UUA I;  4LF7 E;  4JYA E;  4DV5 I;  1XMQ I;  1FNM A;  4LFA I;  2UU9 E;  4ED4 A;  4DV7 I;  1HNX E;  2GS8 A;  1HNZ I;  4HXZ A;  2UXB I;  4DR3 I;  1Z0G A;  2VF3 A;  1FJG I;  4JI8 I;  1IBM I;  4JI0 E;  4LF6 I;  1IBL I;  4B3T E;  4DR2 I;  3T1Y E;  2NPF A;  2UUC I;  3J80 C;  4B3R E;  4JV5 E;  4DV1 I;  5LMN E;  1XMO I;  2HK3 A;  5LMU I;  4KHP I;  1A6F A;  4AQY I;  3QT5 A;  1N32 E;  4JI7 I;  3LPS A;  2UXC E;  2E5L E;  4DR5 E;  3K17 A;  2HKE A;  4DV5 E;  4I3H A;  1Z0V A;  4EMD A;  1Z5B A;  4USK A;  4DV7 E;  1HNZ E;  1D6T A;  2UXB E;  4DR7 I;  4DR3 E;  3J81 Q;  1XHK A;  3PYF A;  2WW4 A;  3D4J A;  1FJG E;  4JI8 E;  5LL6 R;  1MU5 A;  1IBM E;  3WU4 A;  4LF6 E;  1I94 I;  4B3S I;  4GKK I;  1XNR I;  4DR2 E;  2F4V I;  3J7A G;  2UUC E;  1EA6 A;  4DPY A;  3QT7 A;  4M1K A;  4JI4 I;  4DV1 E;  1S4E A;  5LMU E;  3ZZ0 A;  4KHP E;  1HNW I;  1KIJ A;  3K1J A;  3WU6 A;  4DR1 I;  4AQY E;  2DEI A;  4UT4 A;  4JI7 E;  1HR0 I;  4FWH A;  4X62 I;  3ZKB A;  4K0K I;  1ZM2 A;  2UUB E;  4RPF A;  4PU9 A;  1FI4 A;  2V2V A;  4HY1 A;  1QZR A;  2LJP A;  4YY3 I;  4ZVI A;  4GKK E;  4DUZ E;  1I94 E;  4B3S E;  1XNR E;  3WU5 A;  4JG4 A;  2HFS A;  1VIS A;  4LF8 I;  1ZXN A;  4LF9 E;  4DV0 I;  4JI4 E;  4URL A;  4DUY E;  2V34 A;  4NXM E;  1HNW E;  2V2Z A;  3WU3 A;  4DR1 E;  4P52 A;  5A2Q Q;  1HR0 E;  1RR9 A;  3T1H I;  4HAC B;  4MYT A;  4X62 E;  3Q1Q A;  5IWA I;  4K0K E;  4JI6 I;  4DPT A;  4JI3 I;  1NHI A;  4YY3 E;  1H7U A;  4OX9 I;  2UUA E;  4LF8 E;  4MYU A;  1XMQ E;  3ZM7 A;  4Z7C A;  4DV2 I;  4LFA E;  4DV0 E;  3B8H A;  1IBK I;  1PKP A;  4B3M I;  3J7A M;  2E1R A;  2VQF I;  1MX0 A;  3LTO A;  3J80 Q;  4NXN I;  2R42 A;  1OJ4 A;  1IBL E;  3T1H E;  4DR4 I;  2BM0 A;  4LFC I;  1N0U A;  2A2D A;  1ZXM A;  4PRX A;  2V8P A;  1B62 A;  1S16 A;  4DV3 I;  5IWA E;  1XNQ I;  2A2C A;  4JI6 E;  1XMO E;  1H74 A;  4PRV A;  1H73 A;  5BR8 I;  4GKJ I;  3JAM C;  5GME A;  2HKJ A;  1J5E I;  2HFU A;  3OTO I;  3V2U C;  4JI5 I;  3PYE A;  4OX9 E;  1KKH A;  5FLX C;  3M6A A;  4DV2 E;  4JI1 I;  3CWV A;  1N34 I;  1KVK A;  4R1F A;  1IBK E;  2Q2E B;  4DR7 E;  4B3M E;  2VQF E;  2UXD I;  4LFB I;  4P7A A;  1RRE A;  2XEX A;  4XTJ A;  4NXN E;  5IT9 C;  1FWL A;  4LFC E;  2F4V E;  4JV5 I;  1NHJ A;  4WUC A;  4FWD A;  3JAM Q;  1EI1 A;  4DPU A;  1Z0B A;  4DV3 E;  4DU7 A;  1XNQ E;  3ZKD A;  4FN5 A;  2X36 A;  1H72 C;  1PVG A;  1H7S A;  2X7I A;  4HYM A;  1J5E E;  3OTO E;  4JI5 E; 
#chains in the Genus database with same CATH topology
 4DV6 I;  3Q6N A;  4KQV A;  2BM1 A;  3DD6 A;  4DPW A;  4X65 I;  3HUL A;  1MG7 A;  2JEB B;  3GCM A;  3U1K A;  4FW3 A;  4FW7 A;  2BA1 D;  4IZK A;  4JI1 E;  1N34 E;  2AE8 A;  4OO1 F;  3LNU A;  1N36 I;  4DV4 I;  4OO1 C;  5IT9 Q;  4IZJ A;  1UEK A;  1FWK A;  3Q6M A;  2IOP A;  4LFB E;  2UXD E;  3B82 A;  3PYG A;  4WUB A;  1R6L A;  1N0V C;  3J81 C;  2PO1 B;  4FWG A;  1WUU A;  4FW9 A;  4DXL A;  1Z5C A;  4OZE A;  4JI2 I;  3QT8 A;  1N33 I;  1Z0W A;  1ZM9 A;  1ZM3 A;  2VQE I;  3PS3 A;  1BKN A;  5GMD A;  2PNM A;  5K36 A;  2DEJ A;  2BV3 A;  4LF4 I;  4YHH I;  2NN6 B;  3M85 G;  3F0N A;  4X64 I;  2HHH I;  4LF5 I;  3GON A;  1K47 A;  4DPX A;  5DRP A;  4DV6 E;  1UDS A;  2O1V A;  1Z59 A;  4DU8 A;  5L3J A;  4X65 E;  2AJ4 A;  2ZM6 I;  2CG9 A;  2CGE A;  4DR6 I;  4UTG A;  3ZZT A;  1N36 E;  2UUB I;  2C39 A;  1B63 A;  4DV4 E;  2ZBK B;  3PYD A;  4QNJ A;  4WUD A;  4X66 I;  1ZM4 A;  4IFD A;  3B78 A;  1P42 A;  3PS1 A;  4JI3 E;  4DUZ I;  4LCF A;  1Y4S A;  3V5R A;  2CZ9 A;  4LF7 I;  4JI2 E;  4JYA I;  1N33 E;  1UDQ A;  3H4L A;  2UU9 I;  4LF9 I;  2IES A;  2J7K A;  4USM A;  2HK2 A;  2VQE E;  2R3V A;  3K85 A;  1HNX I;  1PIE A;  2ZIT A;  4DUY I;  2PO0 B;  5DNX A;  4NXM I;  2BR2 A;  4AID A;  4HAC A;  2GO3 A;  2O1W A;  4IZJ D;  1NHH A;  4MU4 A;  4LF4 E;  1DAR A;  4YHH E;  4X64 E;  2HHH E;  4JI0 I;  4FW5 A;  4B3T I;  4LF5 E;  1Z0C A;  2O1T A;  4DR4 E;  3T1Y I;  3P76 A;  2ZM6 E;  1Z5A A;  1USV A;  4B3R I;  5A2Q C;  4DR6 E;  4BA1 A;  1FKA E;  5JEA B;  1Z0E A;  4AIM A;  5LMN I;  2EFG A;  1Z0T A;  4X66 E;  1YH8 A;  4ISA A;  5ELW A;  2OI2 A;  1KTV A;  5C0X E;  5BR8 E;  5K36 D;  2PNZ B;  5JEA C;  4Z7Y A;  1ELO A;  4GKJ E;  2C39 B;  2WNR A;  2V2Q A;  1N32 I;  5FLX Q;  1R6M A;  3ZZU A;  2UXC I;  2E5L I;  1NZ0 A;  3M7N G;  5DRQ A;  1U2R A;  2Z5E A;  3QT6 A;  4DR5 I;  2UUA I;  4LF7 E;  4JYA E;  4DV5 I;  2WP8 B;  1XMQ I;  1FNM A;  2JE6 B;  4LFA I;  2UU9 E;  4ED4 A;  1E3H A;  3H1C A;  4DV7 I;  1HNX E;  2GS8 A;  1HNZ I;  4HXZ A;  4IS9 A;  3P3C A;  2UXB I;  4DR3 I;  3GME A;  2CVE A;  2Z5B B;  4OKG A;  1Z0G A;  3CDJ A;  5C0X D;  1VI7 A;  4IFD D;  2VF3 A;  3P3E A;  4OO1 E;  1OYS A;  4MDT A;  1FJG I;  4JI8 I;  1IBM I;  4JI0 E;  4LF6 I;  1IBL I;  4B3T E;  3HJC A;  4DR2 I;  1UDN A;  3T1Y E;  2NPF A;  4GQU A;  2UUC I;  3J80 C;  4B3R E;  4JV5 E;  1OYR A;  2JT2 A;  4LOM A;  4DV1 I;  5LMN E;  1XMO I;  2HK3 A;  5LMU I;  4KHP I;  5EL9 A;  1A6F A;  4FW4 A;  4U3B A;  4OO1 D;  4AQY I;  2JEA B;  3QT5 A;  1N32 E;  4JI7 I;  3P06 A;  3LPS A;  2UXC E;  2E5L E;  4DR5 E;  3K17 A;  2HKE A;  4DV5 E;  2NN6 F;  4I3H A;  1Z0V A;  3L7Z A;  3PS2 A;  2NN6 C;  4EMD A;  1Z5B A;  4USK A;  4DV7 E;  1HNZ E;  1D6T A;  2UXB E;  4DR7 I;  4DR3 E;  3J81 Q;  2NN6 E;  1XHK A;  5C0X A;  3PYF A;  2WW4 A;  4MU1 A;  2Z5C A;  4QNK A;  4IZK B;  3CDI A;  3D4J A;  1FJG E;  4JI8 E;  5LL6 R;  1MU5 A;  1IBM E;  3WU4 A;  4LF6 E;  1I94 I;  4B3S I;  4IZJ B;  4GKK I;  1XNR I;  4DR2 E;  2F4V I;  3J7A G;  2VES A;  3P3G A;  3U1Y A;  2UUC E;  1EA6 A;  4DPY A;  3QT7 A;  4M1K A;  4JI4 I;  4DV1 E;  1S4E A;  1OYP A;  2PO2 A;  3B4T A;  5LMU E;  3ZZ0 A;  2C38 A;  4KHP E;  1HNW I;  1KIJ A;  3K1J A;  4OO1 A;  3WU6 A;  4DR1 I;  4AQY E;  2BA0 G;  2DEI A;  2JEB A;  4UT4 A;  4JI7 E;  1HR0 I;  5K36 B;  4FWH A;  5DRO A;  4X62 I;  5FWK A;  3ZKB A;  4MU0 A;  5K36 C;  2PO1 A;  4K0K I;  1ZM2 A;  2UUB E;  1UDO A;  4RPF A;  3M7N D;  4PU9 A;  5JEA F;  1FI4 A;  1Y60 A;  2V2V A;  1QZR A;  4HY1 A;  2LJP A;  4YY3 I;  4AM3 A;  4ZVI A;  5C0X B;  4DUZ E;  1I94 E;  4B3S E;  4GKK E;  4IFD B;  1XNR E;  5JEA E;  4LCG A;  4JG4 A;  3WU5 A;  1USU A;  2Z5C B;  2HFS A;  1VIS A;  4LF8 I;  1ZXN A;  2F1D A;  4LF9 E;  4BA2 A;  4DV0 I;  4IFD C;  4JI4 E;  2NN6 A;  4URL A;  4DUY E;  2C37 A;  2V34 A;  4NXM E;  1HNW E;  2V2Z A;  3WU3 A;  4DR1 E;  4P52 A;  2GO4 A;  1Y6Z A;  5A2Q Q;  4LCH A;  1HR0 E;  1RR9 A;  2BR2 B;  3T1H I;  4HAC B;  4OO1 B;  4MYT A;  3GLL A;  4X62 E;  3NZK A;  4MU3 A;  3Q1Q A;  5IWA I;  4K0K E;  2IOQ A;  3M85 D;  4JI6 I;  1Y4U A;  4DPT A;  2BA1 G;  4BA1 B;  4JI3 I;  1NHI A;  4YY3 E;  5DNL A;  1H7U A;  2PO0 A;  4OX9 I;  2UUA E;  4LF8 E;  1YHC A;  4MYU A;  2PNL A;  1XMQ E;  2WNR B;  3ZM7 A;  4Z7C A;  4DV2 I;  4LFA E;  4DV0 E;  2IER A;  5DRR A;  3B8H A;  1IBK I;  1PKP A;  4B3M I;  3J7A M;  1HK7 A;  2E1R A;  2VQF I;  4LPF A;  4BA2 B;  1MX0 A;  3LTO A;  3J80 Q;  2C37 B;  4NXN I;  2R42 A;  4MQY A;  5JEA A;  1OJ4 A;  1IBL E;  3T1H E;  4DR4 I;  2BM0 A;  4LFC I;  1N0U A;  2A2D A;  1ZXM A;  2PNZ A;  4PRX A;  2V8P A;  1B62 A;  4N3O A;  2BA0 D;  1S16 A;  4DV3 I;  5IWA E;  1XNQ I;  2A2C A;  2NN6 D;  3KRN A;  4JI6 E;  1XMO E;  1H74 A;  4PRV A;  1H73 A;  5BR8 I;  3HKM A;  2GQ0 A;  2WP8 A;  4GKJ I;  1Y5Y A;  3JAM C;  5GME A;  2JE6 A;  2HKJ A;  2O1U A;  1J5E I;  1XXE A;  2HFU A;  3UHM A;  3V2U C;  3OTO I;  4JI5 I;  3PYE A;  4OX9 E;  4U3D A;  2Z5B A;  4FW6 A;  1KKH A;  5FLX C;  3M6A A;  4DV2 E;  4JI1 I;  3CWV A;  1N34 I;  5K36 F;  1KVK A;  4R1F A;  2O3Z A;  1IBK E;  2Q2E B;  4DR7 E;  4B3M E;  2VQF E;  5EKW A;  3L7Z B;  4LFB I;  2UXD I;  1RHY A;  5K36 E;  4P7A A;  1RRE A;  2XEX A;  4XTJ A;  4NXN E;  5IT9 C;  1FWL A;  4LFC E;  2F4V E;  4JV5 I;  4J3D A;  1NHJ A;  4WUC A;  4FWD A;  5C0X F;  3JAM Q;  4IFD F;  1EI1 A;  2JEA A;  4DPU A;  1Z0B A;  5C0X C;  4DV3 E;  4DU7 A;  1E3P A;  1XNQ E;  3ZKD A;  4FN5 A;  2X36 A;  1H72 C;  4IFD E;  3PRY A;  1PVG A;  2J65 A;  1H7S A;  2X7I A;  4NBQ A;  4HYM A;  1J5E E;  2PO2 B;  3OTO E;  2C38 B;  4JI5 E;  5JEA D; 
#chains in the Genus database with same CATH homology
 4DV6 I;  3Q6N A;  4KQV A;  2BM1 A;  4X65 I;  4DPW A;  3HUL A;  1MG7 A;  4IZK A;  4JI1 E;  1N34 E;  3LNU A;  1N36 I;  4DV4 I;  5IT9 Q;  4IZJ A;  1UEK A;  1FWK A;  3Q6M A;  2IOP A;  4LFB E;  2UXD E;  3B82 A;  3PYG A;  4WUB A;  1N0V C;  3J81 C;  4FWG A;  1WUU A;  4FW9 A;  4DXL A;  1Z5C A;  4JI2 I;  3QT8 A;  1N33 I;  1Z0W A;  1ZM9 A;  1ZM3 A;  2VQE I;  1BKN A;  5GMD A;  2PNM A;  2DEJ A;  2BV3 A;  4LF4 I;  4YHH I;  3F0N A;  4X64 I;  2HHH I;  4LF5 I;  3GON A;  1K47 A;  4DPX A;  4DV6 E;  2O1V A;  1Z59 A;  4DU8 A;  5L3J A;  4X65 E;  2AJ4 A;  2ZM6 I;  2CG9 A;  2CGE A;  4DR6 I;  4UTG A;  3ZZT A;  1N36 E;  2UUB I;  1B63 A;  4DV4 E;  2ZBK B;  3PYD A;  4WUD A;  4X66 I;  1ZM4 A;  3B78 A;  4JI3 E;  4DUZ I;  1Y4S A;  3V5R A;  2CZ9 A;  4LF7 I;  4JI2 E;  4JYA I;  1N33 E;  3H4L A;  2UU9 I;  4LF9 I;  2J7K A;  4USM A;  2HK2 A;  2VQE E;  2R3V A;  3K85 A;  1HNX I;  1PIE A;  2ZIT A;  4DUY I;  4NXM I;  4HAC A;  2O1W A;  4IZJ D;  1NHH A;  4LF4 E;  1DAR A;  4YHH E;  4X64 E;  2HHH E;  4JI0 I;  4B3T I;  4LF5 E;  1Z0C A;  2O1T A;  4DR4 E;  3T1Y I;  2ZM6 E;  1Z5A A;  1USV A;  4B3R I;  5A2Q C;  4DR6 E;  1FKA E;  1Z0E A;  5LMN I;  2EFG A;  1Z0T A;  4X66 E;  2OI2 A;  1KTV A;  5BR8 E;  4Z7Y A;  1ELO A;  4GKJ E;  2V2Q A;  1N32 I;  5FLX Q;  3ZZU A;  2UXC I;  2E5L I;  1NZ0 A;  1U2R A;  2Z5E A;  3QT6 A;  4DR5 I;  2UUA I;  4LF7 E;  4JYA E;  4DV5 I;  1XMQ I;  1FNM A;  4LFA I;  2UU9 E;  4ED4 A;  4DV7 I;  1HNX E;  2GS8 A;  1HNZ I;  4HXZ A;  2UXB I;  4DR3 I;  2Z5B B;  1Z0G A;  2VF3 A;  1FJG I;  4JI8 I;  1IBM I;  4JI0 E;  4LF6 I;  1IBL I;  4B3T E;  3HJC A;  4DR2 I;  3T1Y E;  2NPF A;  2UUC I;  3J80 C;  4B3R E;  4JV5 E;  4DV1 I;  5LMN E;  1XMO I;  2HK3 A;  5LMU I;  4KHP I;  1A6F A;  4AQY I;  3QT5 A;  1N32 E;  4JI7 I;  3P06 A;  3LPS A;  2UXC E;  2E5L E;  4DR5 E;  3K17 A;  2HKE A;  4DV5 E;  4I3H A;  1Z0V A;  4EMD A;  1Z5B A;  4USK A;  4DV7 E;  1HNZ E;  1D6T A;  2UXB E;  4DR7 I;  4DR3 E;  3J81 Q;  1XHK A;  3PYF A;  2WW4 A;  2Z5C A;  4IZK B;  3D4J A;  1FJG E;  4JI8 E;  5LL6 R;  1MU5 A;  1IBM E;  3WU4 A;  4LF6 E;  1I94 I;  4B3S I;  4IZJ B;  4GKK I;  1XNR I;  4DR2 E;  2F4V I;  3J7A G;  2UUC E;  1EA6 A;  4DPY A;  3QT7 A;  4M1K A;  4JI4 I;  4DV1 E;  1S4E A;  5LMU E;  3ZZ0 A;  4KHP E;  1HNW I;  1KIJ A;  3K1J A;  3WU6 A;  4DR1 I;  4AQY E;  2DEI A;  4UT4 A;  4JI7 E;  1HR0 I;  4FWH A;  4X62 I;  5FWK A;  3ZKB A;  4K0K I;  1ZM2 A;  2UUB E;  4RPF A;  4PU9 A;  1FI4 A;  2V2V A;  4HY1 A;  1QZR A;  2LJP A;  4YY3 I;  4ZVI A;  4GKK E;  4DUZ E;  1I94 E;  4B3S E;  1XNR E;  3WU5 A;  4JG4 A;  1USU A;  2Z5C B;  2HFS A;  1VIS A;  4LF8 I;  1ZXN A;  4LF9 E;  4DV0 I;  4JI4 E;  4URL A;  4DUY E;  2V34 A;  4NXM E;  1HNW E;  2V2Z A;  3WU3 A;  4DR1 E;  4P52 A;  1Y6Z A;  5A2Q Q;  1HR0 E;  1RR9 A;  3T1H I;  4HAC B;  4MYT A;  4X62 E;  3Q1Q A;  5IWA I;  4K0K E;  2IOQ A;  4JI6 I;  1Y4U A;  4DPT A;  4JI3 I;  1NHI A;  4YY3 E;  1H7U A;  4OX9 I;  2UUA E;  4LF8 E;  4MYU A;  2PNL A;  1XMQ E;  3ZM7 A;  4Z7C A;  4DV2 I;  4LFA E;  4DV0 E;  3B8H A;  1IBK I;  1PKP A;  4B3M I;  3J7A M;  1HK7 A;  2E1R A;  2VQF I;  1MX0 A;  3LTO A;  3J80 Q;  4NXN I;  2R42 A;  1OJ4 A;  1IBL E;  3T1H E;  4DR4 I;  2BM0 A;  4LFC I;  1N0U A;  2A2D A;  1ZXM A;  4PRX A;  2V8P A;  1B62 A;  4N3O A;  1S16 A;  4DV3 I;  5IWA E;  1XNQ I;  2A2C A;  4JI6 E;  1XMO E;  1H74 A;  4PRV A;  1H73 A;  5BR8 I;  2GQ0 A;  4GKJ I;  3JAM C;  5GME A;  2HKJ A;  2O1U A;  1J5E I;  2HFU A;  3OTO I;  3V2U C;  4JI5 I;  3PYE A;  4OX9 E;  2Z5B A;  1KKH A;  5FLX C;  3M6A A;  4DV2 E;  4JI1 I;  3CWV A;  1N34 I;  1KVK A;  4R1F A;  1IBK E;  2Q2E B;  4DR7 E;  4B3M E;  2VQF E;  2UXD I;  4LFB I;  4P7A A;  1RRE A;  2XEX A;  4XTJ A;  4NXN E;  5IT9 C;  1FWL A;  4LFC E;  2F4V E;  4JV5 I;  1NHJ A;  4WUC A;  4FWD A;  3JAM Q;  1EI1 A;  4DPU A;  1Z0B A;  4DV3 E;  4DU7 A;  1XNQ E;  3ZKD A;  4FN5 A;  2X36 A;  1H72 C;  3PRY A;  1PVG A;  1H7S A;  2X7I A;  4HYM A;  1J5E E;  3OTO E;  4JI5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...