2Z5BB

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
178
structure length
132
Chain Sequence
b'MISYEFQTHLPKENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELYRRVILPEQFSLLISMSSKIWSADDNDFGKLVFVLKCIKDMYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 31
structure length 132
sequence length 178
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5bB01
2Z5EA 2Z5CB 2Z5BB
chains in the Genus database with same CATH superfamily
2PNZA 1WUUA 2ZM6I 5JEAC 3HKMA 4DR2I 4JI8E 3K1JA 2UUCI 1HNXI 4DPTA 2V8PA 2E5LE 2UXDE 4WUBA 1FNMA 1HNWE 1NHJA 2O1WA 1N32I 4ED4A 2CG9A 4X66I 1E3HA 4DPUA 3P3EA 4B3RE 2VF3A 2X36A 1H7UA 4Z7YA 4HACA 1N36E 4PRXA 2E5LI 5C0XF 2BR2A 2AJ4A 4LCHA 4NXME 2HK2A 1KIJA 4IZJD 2PO1A 1VI7A 4FW7A 4OX9I 4OO1A 3PRYA 4LF7I 4DR7I 5L3JA 4USMA 1B62A 4DV5E 4IFDA 3CWVA 5K36A 2NN6D 2UUAE 3M85G 3OTOI 1FWLA 2BA0G 2JT2A 1N36I 2F4VE 5JEAD 4M1KA 4LCFA 4K0KI 3B82A 4DV3I 1Z0TA 3WU4A 1ZXMA 3H1CA 3GONA 1ELOA 1UDOA 3PYDA 3P3GA 2Z5EA 4OO1F 2F4VI 4LOMA 4FWDA 5JEAB 4IFDF 5DROA 5LMNE 4GKKI 1EA6A 5C0XC 5K36F 4NBQA 1ZM9A 2J65A 4HY1A 4YHHE 2C37A 4FW9A 4DV4I 2O1UA 4DV0E 1NHIA 1S4EA 3PYGA 1HR0I 4JI7I 2VQEI 4I3HA 1XNQI 1I94I 3ZZTA 1USUA 2PO0B 2NN6A 3WU5A 4LFCI 2ZITA 1DARA 1A6FA 2LJPA 3ZM7A 4U3DA 1Z0VA 4DV0I 4WUDA 4FN5A 2BM1A 4LFAI 3M6AA 2PNMA 4OO1C 2C38A 2JEBA 4IFDC 4B3ME 4JI3E 5K36C 4P52A 5C0XD 2BA1G 1Z0WA 3P76A 4DPYA 2IERA 3HULA 2IESA 1N34E 4JYAI 1OYRA 4JI0I 4JI5I 2WNRA 5BR8E 1J5EI 4AQYE 2CVEA 2NN6C 2C39A 1NHHA 2PNZB 4KHPE 1Y60A 1FJGE 1IBKI 2WP8A 4R1FA 3B4TA 4JV5I 2VQFI 4DR3E 2WW4A 3QT5A 1H74A 2Z5BA 1FWKA 1Z5BA 4USKA 4AQYI 3M85D 2BA0D 4IFDD 3WU6A 4WUCA 3T1HE 4DR4I 3U1YA 4JI1E 4KHPI 4KQVA 4DR1I 4HACB 5ELWA 5C0XA 1U2RA 4X65I 1PVGA 2BR2B 3JAMQ 4LF6E 4LFBI 2PO1B 4OO1E 4OO1B 1H73A 4DUYE 1RHYA 1VISA 4MU0A 4LF9E 2V2ZA 2OI2A 3PYFA 4MYTA 4IFDB 5K36E 1OJ4A 3T1HI 1UDSA 2O1TA 5GMDA 2PO2A 5K36B 2A2CA 3PS3A 4MU4A 4OKGA 3LPSA 4JI8I 2HKEA 2UXDI 2IOPA 2Q2EB 1HNWI 1KKHA 3B8HA 4LF4E 3J81Q 3JAMC 1ZM2A 4AIMA 1Z0BA 4YY3E 4GKJE 4B3RI 3DD6A 2F1DA 3Q6MA 4BA1B 1R6LA 1XMQE 1RREA 3PS2A 1Z59A 4DUZE 1ZXNA 4DR6E 2C37B 4NXMI 4IZJB 1MX0A 4BA2A 4LCGA 4DU7A 2DEJA 4GQUA 4XTJA 4GKJI 1ZM3A 4RPFA 4DV5I 5LL6R 2NN6E 2O3ZA 3J81C 2R42A 3CDJA 2NN6B 2BA1D 2UUAI 5JEAE 4DV6E 1S16A 4Z7CA 4JI2E 2IOQA 4IZKA 4DU8A 2Z5CA 1MG7A 1Z5AA 4X62E 2O1VA 2C38B 2JEBB 3V2UC 1UEKA 5LMUE 5LMNI 1OYPA 2HK3A 4YHHI 4B3TE 4FW4A 1FI4A 4DV1E 1XHKA 3D4JA 3V5RA 2BV3A 2WNRB 1B63A 3CDIA 1E3PA 3QT7A 2C39B 3B78A 3U1KA 2UU9E 2A2DA 2WP8B 2V2QA 2R3VA 4LF8E 4MDTA 2JEAA 5DNLA 4PU9A 4LF5E 1H72C 1Y6ZA 2X7IA 5DRPA 4X64E 1D6TA 3J7AG 2Z5BB 2HKJA 1HNZE 3L7ZA 3NZKA 2HHHE 1XMOE 2UUBE 4B3MI 5C0XE 5IWAE 1Z0CA 4JI3I 5C0XB 2V34A 4UT4A 1PIEA 4DPWA 3P3CA 1N34I 4HYMA 4JI6E 2CGEA 5BR8I 3K17A 3GLLA 2PO2B 3PS1A 1KTVA 3T1YE 4MYUA 4B3SE 1FJGI 5EKWA 2XEXA 4DV2E 4DR3I 2UXCE 4JI4E 2ZM6E 1N0VC 4DR2E 2UUCE 1HNXE 5DRRA 4IFDE 4MQYA 2JE6A 1BKNA 4JI1I 1N32E 4X66E 5FLXQ 1XXEA 4QNKA 1UDQA 1IBME 3ZZ0A 3UHMA 4LF6I 4BA2B 4URLA 3J7AM 4DUYI 1USVA 1Y4UA 2EFGA 4LF9I 2NPFA 4MU1A 4P7AA 1PKPA 3ZKDA 5IT9Q 4OX9E 2GO4A 4LF7E 3PYEA 1IBMI 4DR7E 4MU3A 3LTOA 4DV7E 4DXLA 1MU5A 5FLXC 4IZKB 3OTOE 2Z5CB 3K85A 4LF4I 4K0KE 4U3BA 4YY3I 4DV3E 3QT6A 4DR5E 1H7SA 3J80Q 1RR9A 2ZBKB 1XMQI 1Z0GA 2AE8A 2GO3A 3WU3A 4DV7I 2PNLA 5IT9C 1K47A 1FKAE 4DUZI 4PRVA 4FWGA 4DR6I 4EMDA 1Y5YA 3M7NG 4GKKE 2BM0A 3QT8A 1XNRE 1NZ0A 4DR5I 1Y4SA 2V2VA 4DV4E 3F0NA 3P06A 4UTGA 4OZEA 4DV6I 1HR0E 4JI2I 2DEIA 2J7KA 4JI7E 2VQEE 4FW6A 1XNQE 1I94E 3J80C 2JEAB 4JG4A 1YHCA 1N33E 4BA1A 4AIDA 4J3DA 5DRQA 1XNRI 4LFCE 4DPXA 4X62I 3HJCA 4IZJA 3L7ZB 5LMUI 2GQ0A 4LFAE 4HXZA 1N33I 4B3TI 5JEAA 4DV1I 2UXBE 4AM3A 2VESA 4FWHA 4QNJA 4ZVIA 4JYAE 1KVKA 2UU9I 4JI0E 4JI5E 1Z0EA 5DNXA 3ZZUA 5A2QQ 4LF8I 1J5EE 3ZKBA 2PO0A 4FW5A 1Z5CA 2GS8A 2UXBI 4LF5I 4X64I 2CZ9A 2NN6F 4FW3A 1IBKE 3LNUA 5JEAF 4JV5E 2VQFE 4NXNE 2HFUA 1ZM4A 3H4LA 1HNZI 3KRNA 5EL9A 2JE6B 1R6MA 1XMOI 2HHHI 1EI1A 2UUBI 5IWAI 1IBLE 4IS9A 1P42A 4ISAA 4DR4E 1YH8A 4LPFA 4DR1E 5A2QC 1HK7A 4X65E 4NXNI 1UDNA 3Q6NA 4JI6I 4LFBE 1OYSA 3Q1QA 3T1YI 1IBLI 4OO1D 4N3OA 1QZRA 3GMEA 4B3SI 1N0UA 2HFSA 2E1RA 3M7ND 5K36D 4DV2I 5FWKA 3GCMA 2UXCI 5GMEA 4JI4I
chains in the Genus database with same CATH topology
2ZM6I 1WUUA 4DR2I 4JI8E 3K1JA 2UUCI 1HNXI 4DPTA 2V8PA 2E5LE 2UXDE 4WUBA 1FNMA 1HNWE 1NHJA 2O1WA 1N32I 4ED4A 2CG9A 4X66I 4DPUA 4B3RE 2VF3A 2X36A 1H7UA 4Z7YA 4HACA 1N36E 4PRXA 2E5LI 2AJ4A 4NXME 2HK2A 1KIJA 4IZJD 4OX9I 3PRYA 4LF7I 4DR7I 5L3JA 4USMA 1B62A 4DV5E 3CWVA 2UUAE 3OTOI 1FWLA 1N36I 2F4VE 4M1KA 4K0KI 3B82A 4DV3I 1Z0TA 3WU4A 1ZXMA 3GONA 1ELOA 3PYDA 2Z5EA 2F4VI 4FWDA 5LMNE 4GKKI 1EA6A 1ZM9A 4HY1A 4YHHE 4FW9A 4DV4I 2O1UA 4DV0E 1NHIA 1S4EA 3PYGA 1HR0I 4JI7I 2VQEI 4I3HA 1XNQI 1I94I 3ZZTA 1USUA 3WU5A 4LFCI 2ZITA 1DARA 1A6FA 2LJPA 3ZM7A 1Z0VA 4DV0I 4WUDA 4FN5A 2BM1A 4LFAI 3M6AA 2PNMA 4B3ME 4JI3E 4P52A 1Z0WA 4DPYA 3HULA 1N34E 4JYAI 4JI0I 4JI5I 5BR8E 1J5EI 4AQYE 1NHHA 4KHPE 1FJGE 1IBKI 4R1FA 4JV5I 2VQFI 4DR3E 2WW4A 3QT5A 1H74A 2Z5BA 1FWKA 1Z5BA 4USKA 4AQYI 3WU6A 4WUCA 3T1HE 4DR4I 4JI1E 4KHPI 4KQVA 4DR1I 4HACB 1U2RA 4X65I 1PVGA 3JAMQ 4LF6E 4LFBI 1H73A 4DUYE 1VISA 4LF9E 2V2ZA 2OI2A 3PYFA 4MYTA 1OJ4A 3T1HI 2O1TA 5GMDA 2A2CA 4JI8I 3LPSA 2HKEA 2UXDI 2IOPA 2Q2EB 1HNWI 1KKHA 3B8HA 4LF4E 3J81Q 3JAMC 1ZM2A 1Z0BA 4YY3E 4GKJE 4B3RI 3Q6MA 1XMQE 1RREA 1Z59A 4DUZE 1ZXNA 4DR6E 4NXMI 4IZJB 1MX0A 4DU7A 2DEJA 4XTJA 4GKJI 1ZM3A 4RPFA 4DV5I 5LL6R 3J81C 2R42A 2UUAI 4DV6E 1S16A 4Z7CA 4JI2E 2IOQA 4IZKA 4DU8A 2Z5CA 1MG7A 1Z5AA 4X62E 2O1VA 3V2UC 1UEKA 5LMUE 5LMNI 2HK3A 4YHHI 4B3TE 1FI4A 4DV1E 1XHKA 3D4JA 3V5RA 2BV3A 1B63A 3QT7A 3B78A 2UU9E 2A2DA 2V2QA 2R3VA 4LF8E 4PU9A 4LF5E 1H72C 1Y6ZA 2X7IA 4X64E 1D6TA 3J7AG 2Z5BB 2HKJA 1HNZE 2HHHE 1XMOE 2UUBE 4B3MI 5IWAE 1Z0CA 4JI3I 2V34A 4UT4A 1PIEA 4DPWA 1N34I 4HYMA 4JI6E 2CGEA 5BR8I 3K17A 1KTVA 3T1YE 4MYUA 4B3SE 1FJGI 2XEXA 4DV2E 4DR3I 2UXCE 4JI4E 2ZM6E 1N0VC 4DR2E 2UUCE 1HNXE 1BKNA 4JI1I 1N32E 4X66E 5FLXQ 1IBME 3ZZ0A 4LF6I 4URLA 3J7AM 4DUYI 1USVA 1Y4UA 2EFGA 4LF9I 2NPFA 4P7AA 1PKPA 3ZKDA 5IT9Q 4OX9E 4LF7E 3PYEA 1IBMI 4DR7E 3LTOA 4DV7E 4DXLA 1MU5A 5FLXC 4IZKB 3OTOE 2Z5CB 3K85A 4LF4I 4K0KE 4YY3I 4DV3E 3QT6A 4DR5E 1H7SA 3J80Q 1RR9A 2ZBKB 1XMQI 1Z0GA 3WU3A 4DV7I 2PNLA 5IT9C 1K47A 1FKAE 4DUZI 4PRVA 4FWGA 4DR6I 4EMDA 4GKKE 2BM0A 3QT8A 1XNRE 1NZ0A 4DR5I 1Y4SA 2V2VA 4DV4E 3F0NA 3P06A 4UTGA 4DV6I 1HR0E 4JI2I 2DEIA 2J7KA 4JI7E 2VQEE 1XNQE 1I94E 3J80C 4JG4A 1N33E 1XNRI 4LFCE 4DPXA 4X62I 3HJCA 4IZJA 5LMUI 2GQ0A 4LFAE 4HXZA 1N33I 4B3TI 4DV1I 2UXBE 4FWHA 4ZVIA 4JYAE 1KVKA 2UU9I 4JI0E 4JI5E 1Z0EA 3ZZUA 5A2QQ 4LF8I 1J5EE 3ZKBA 1Z5CA 2GS8A 2UXBI 4LF5I 4X64I 2CZ9A 1IBKE 3LNUA 4JV5E 2VQFE 4NXNE 2HFUA 1ZM4A 3H4LA 1HNZI 2HHHI 1XMOI 2UUBI 1EI1A 5IWAI 1IBLE 4DR4E 4DR1E 5A2QC 1HK7A 4X65E 4NXNI 3Q6NA 4JI6I 4LFBE 3Q1QA 3T1YI 1IBLI 4N3OA 1QZRA 4B3SI 1N0UA 2HFSA 2E1RA 4DV2I 5FWKA 2UXCI 5GMEA 4JI4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5E A;  2Z5C B;  2Z5B B; 
#chains in the Genus database with same CATH topology
 2PNZ A;  1WUU A;  2ZM6 I;  5JEA C;  3HKM A;  4DR2 I;  4JI8 E;  3K1J A;  2UUC I;  1HNX I;  4DPT A;  2V8P A;  2E5L E;  2UXD E;  4WUB A;  1FNM A;  1HNW E;  1NHJ A;  2O1W A;  1N32 I;  4ED4 A;  2CG9 A;  4X66 I;  1E3H A;  4DPU A;  3P3E A;  4B3R E;  2VF3 A;  2X36 A;  1H7U A;  4Z7Y A;  4HAC A;  1N36 E;  4PRX A;  2E5L I;  5C0X F;  2BR2 A;  2AJ4 A;  4LCH A;  4NXM E;  2HK2 A;  1KIJ A;  4IZJ D;  2PO1 A;  1VI7 A;  4FW7 A;  4OX9 I;  4OO1 A;  3PRY A;  4LF7 I;  4DR7 I;  5L3J A;  4USM A;  1B62 A;  4DV5 E;  4IFD A;  3CWV A;  5K36 A;  2NN6 D;  2UUA E;  3M85 G;  3OTO I;  1FWL A;  2BA0 G;  2JT2 A;  1N36 I;  2F4V E;  5JEA D;  4M1K A;  4LCF A;  4K0K I;  3B82 A;  4DV3 I;  1Z0T A;  3WU4 A;  1ZXM A;  3H1C A;  3GON A;  1ELO A;  1UDO A;  3PYD A;  3P3G A;  2Z5E A;  4OO1 F;  2F4V I;  4LOM A;  4FWD A;  5JEA B;  4IFD F;  5DRO A;  5LMN E;  4GKK I;  1EA6 A;  5C0X C;  5K36 F;  4NBQ A;  1ZM9 A;  2J65 A;  4HY1 A;  4YHH E;  2C37 A;  4FW9 A;  4DV4 I;  2O1U A;  4DV0 E;  1NHI A;  1S4E A;  3PYG A;  1HR0 I;  4JI7 I;  2VQE I;  4I3H A;  1XNQ I;  1I94 I;  3ZZT A;  1USU A;  2PO0 B;  2NN6 A;  3WU5 A;  4LFC I;  2ZIT A;  1DAR A;  1A6F A;  2LJP A;  3ZM7 A;  4U3D A;  1Z0V A;  4DV0 I;  4WUD A;  4FN5 A;  2BM1 A;  4LFA I;  3M6A A;  2PNM A;  4OO1 C;  2C38 A;  2JEB A;  4IFD C;  4B3M E;  4JI3 E;  5K36 C;  4P52 A;  5C0X D;  2BA1 G;  1Z0W A;  3P76 A;  4DPY A;  2IER A;  3HUL A;  2IES A;  1N34 E;  4JYA I;  1OYR A;  4JI0 I;  4JI5 I;  2WNR A;  5BR8 E;  1J5E I;  4AQY E;  2CVE A;  2NN6 C;  2C39 A;  1NHH A;  2PNZ B;  4KHP E;  1Y60 A;  1FJG E;  1IBK I;  2WP8 A;  4R1F A;  3B4T A;  4JV5 I;  2VQF I;  4DR3 E;  2WW4 A;  3QT5 A;  1H74 A;  2Z5B A;  1FWK A;  1Z5B A;  4USK A;  4AQY I;  3M85 D;  2BA0 D;  4IFD D;  3WU6 A;  4WUC A;  3T1H E;  4DR4 I;  3U1Y A;  4JI1 E;  4KHP I;  4KQV A;  4DR1 I;  4HAC B;  5ELW A;  5C0X A;  1U2R A;  4X65 I;  1PVG A;  2BR2 B;  3JAM Q;  4LF6 E;  4LFB I;  2PO1 B;  4OO1 E;  4OO1 B;  1H73 A;  4DUY E;  1RHY A;  1VIS A;  4MU0 A;  4LF9 E;  2V2Z A;  2OI2 A;  3PYF A;  4MYT A;  4IFD B;  5K36 E;  1OJ4 A;  3T1H I;  1UDS A;  2O1T A;  5GMD A;  2PO2 A;  5K36 B;  2A2C A;  3PS3 A;  4MU4 A;  4OKG A;  3LPS A;  4JI8 I;  2HKE A;  2UXD I;  2IOP A;  2Q2E B;  1HNW I;  1KKH A;  3B8H A;  4LF4 E;  3J81 Q;  3JAM C;  1ZM2 A;  4AIM A;  1Z0B A;  4YY3 E;  4GKJ E;  4B3R I;  3DD6 A;  2F1D A;  3Q6M A;  4BA1 B;  1R6L A;  1XMQ E;  1RRE A;  3PS2 A;  1Z59 A;  4DUZ E;  1ZXN A;  4DR6 E;  2C37 B;  4NXM I;  4IZJ B;  1MX0 A;  4BA2 A;  4LCG A;  4DU7 A;  2DEJ A;  4GQU A;  4XTJ A;  4GKJ I;  1ZM3 A;  4RPF A;  4DV5 I;  5LL6 R;  2NN6 E;  2O3Z A;  3J81 C;  2R42 A;  3CDJ A;  2NN6 B;  2BA1 D;  2UUA I;  5JEA E;  4DV6 E;  1S16 A;  4Z7C A;  4JI2 E;  2IOQ A;  4IZK A;  4DU8 A;  2Z5C A;  1MG7 A;  1Z5A A;  4X62 E;  2O1V A;  2C38 B;  2JEB B;  3V2U C;  1UEK A;  5LMU E;  5LMN I;  1OYP A;  2HK3 A;  4YHH I;  4B3T E;  4FW4 A;  1FI4 A;  4DV1 E;  1XHK A;  3D4J A;  3V5R A;  2BV3 A;  2WNR B;  1B63 A;  3CDI A;  1E3P A;  3QT7 A;  2C39 B;  3B78 A;  3U1K A;  2UU9 E;  2A2D A;  2WP8 B;  2V2Q A;  2R3V A;  4LF8 E;  4MDT A;  2JEA A;  5DNL A;  4PU9 A;  4LF5 E;  1H72 C;  1Y6Z A;  2X7I A;  5DRP A;  4X64 E;  1D6T A;  3J7A G;  2Z5B B;  2HKJ A;  1HNZ E;  3L7Z A;  3NZK A;  2HHH E;  1XMO E;  2UUB E;  4B3M I;  5C0X E;  5IWA E;  1Z0C A;  4JI3 I;  5C0X B;  2V34 A;  4UT4 A;  1PIE A;  4DPW A;  3P3C A;  1N34 I;  4HYM A;  4JI6 E;  2CGE A;  5BR8 I;  3K17 A;  3GLL A;  2PO2 B;  3PS1 A;  1KTV A;  3T1Y E;  4MYU A;  4B3S E;  1FJG I;  5EKW A;  2XEX A;  4DV2 E;  4DR3 I;  2UXC E;  4JI4 E;  2ZM6 E;  1N0V C;  4DR2 E;  2UUC E;  1HNX E;  5DRR A;  4IFD E;  4MQY A;  2JE6 A;  1BKN A;  4JI1 I;  1N32 E;  4X66 E;  5FLX Q;  1XXE A;  4QNK A;  1UDQ A;  1IBM E;  3ZZ0 A;  3UHM A;  4LF6 I;  4BA2 B;  4URL A;  3J7A M;  4DUY I;  1USV A;  1Y4U A;  2EFG A;  4LF9 I;  2NPF A;  4MU1 A;  4P7A A;  1PKP A;  3ZKD A;  5IT9 Q;  4OX9 E;  2GO4 A;  4LF7 E;  3PYE A;  1IBM I;  4DR7 E;  4MU3 A;  3LTO A;  4DV7 E;  4DXL A;  1MU5 A;  5FLX C;  4IZK B;  3OTO E;  2Z5C B;  3K85 A;  4LF4 I;  4K0K E;  4U3B A;  4YY3 I;  4DV3 E;  3QT6 A;  4DR5 E;  1H7S A;  3J80 Q;  1RR9 A;  2ZBK B;  1XMQ I;  1Z0G A;  2AE8 A;  2GO3 A;  3WU3 A;  4DV7 I;  2PNL A;  5IT9 C;  1K47 A;  1FKA E;  4DUZ I;  4PRV A;  4FWG A;  4DR6 I;  4EMD A;  1Y5Y A;  3M7N G;  4GKK E;  2BM0 A;  3QT8 A;  1XNR E;  1NZ0 A;  4DR5 I;  1Y4S A;  2V2V A;  4DV4 E;  3F0N A;  3P06 A;  4UTG A;  4OZE A;  4DV6 I;  1HR0 E;  4JI2 I;  2DEI A;  2J7K A;  4JI7 E;  2VQE E;  4FW6 A;  1XNQ E;  1I94 E;  3J80 C;  2JEA B;  4JG4 A;  1YHC A;  1N33 E;  4BA1 A;  4AID A;  4J3D A;  5DRQ A;  1XNR I;  4LFC E;  4DPX A;  4X62 I;  3HJC A;  4IZJ A;  3L7Z B;  5LMU I;  2GQ0 A;  4LFA E;  4HXZ A;  1N33 I;  4B3T I;  5JEA A;  4DV1 I;  2UXB E;  4AM3 A;  2VES A;  4FWH A;  4QNJ A;  4ZVI A;  4JYA E;  1KVK A;  2UU9 I;  4JI0 E;  4JI5 E;  1Z0E A;  5DNX A;  3ZZU A;  5A2Q Q;  4LF8 I;  1J5E E;  3ZKB A;  2PO0 A;  4FW5 A;  1Z5C A;  2GS8 A;  2UXB I;  4LF5 I;  4X64 I;  2CZ9 A;  2NN6 F;  4FW3 A;  1IBK E;  3LNU A;  5JEA F;  4JV5 E;  2VQF E;  4NXN E;  2HFU A;  1ZM4 A;  3H4L A;  1HNZ I;  3KRN A;  5EL9 A;  2JE6 B;  1R6M A;  1XMO I;  2HHH I;  1EI1 A;  2UUB I;  5IWA I;  1IBL E;  4IS9 A;  1P42 A;  4ISA A;  4DR4 E;  1YH8 A;  4LPF A;  4DR1 E;  5A2Q C;  1HK7 A;  4X65 E;  4NXN I;  1UDN A;  3Q6N A;  4JI6 I;  4LFB E;  1OYS A;  3Q1Q A;  3T1Y I;  1IBL I;  4OO1 D;  4N3O A;  1QZR A;  3GME A;  4B3S I;  1N0U A;  2HFS A;  2E1R A;  3M7N D;  5K36 D;  4DV2 I;  5FWK A;  3GCM A;  2UXC I;  5GME A;  4JI4 I; 
#chains in the Genus database with same CATH homology
 2ZM6 I;  1WUU A;  4DR2 I;  4JI8 E;  3K1J A;  2UUC I;  1HNX I;  4DPT A;  2V8P A;  2E5L E;  2UXD E;  4WUB A;  1FNM A;  1HNW E;  1NHJ A;  2O1W A;  1N32 I;  4ED4 A;  2CG9 A;  4X66 I;  4DPU A;  4B3R E;  2VF3 A;  2X36 A;  1H7U A;  4Z7Y A;  4HAC A;  1N36 E;  4PRX A;  2E5L I;  2AJ4 A;  4NXM E;  2HK2 A;  1KIJ A;  4IZJ D;  4OX9 I;  3PRY A;  4LF7 I;  4DR7 I;  5L3J A;  4USM A;  1B62 A;  4DV5 E;  3CWV A;  2UUA E;  3OTO I;  1FWL A;  1N36 I;  2F4V E;  4M1K A;  4K0K I;  3B82 A;  4DV3 I;  1Z0T A;  3WU4 A;  1ZXM A;  3GON A;  1ELO A;  3PYD A;  2Z5E A;  2F4V I;  4FWD A;  5LMN E;  4GKK I;  1EA6 A;  1ZM9 A;  4HY1 A;  4YHH E;  4FW9 A;  4DV4 I;  2O1U A;  4DV0 E;  1NHI A;  1S4E A;  3PYG A;  1HR0 I;  4JI7 I;  2VQE I;  4I3H A;  1XNQ I;  1I94 I;  3ZZT A;  1USU A;  3WU5 A;  4LFC I;  2ZIT A;  1DAR A;  1A6F A;  2LJP A;  3ZM7 A;  1Z0V A;  4DV0 I;  4WUD A;  4FN5 A;  2BM1 A;  4LFA I;  3M6A A;  2PNM A;  4B3M E;  4JI3 E;  4P52 A;  1Z0W A;  4DPY A;  3HUL A;  1N34 E;  4JYA I;  4JI0 I;  4JI5 I;  5BR8 E;  1J5E I;  4AQY E;  1NHH A;  4KHP E;  1FJG E;  1IBK I;  4R1F A;  4JV5 I;  2VQF I;  4DR3 E;  2WW4 A;  3QT5 A;  1H74 A;  2Z5B A;  1FWK A;  1Z5B A;  4USK A;  4AQY I;  3WU6 A;  4WUC A;  3T1H E;  4DR4 I;  4JI1 E;  4KHP I;  4KQV A;  4DR1 I;  4HAC B;  1U2R A;  4X65 I;  1PVG A;  3JAM Q;  4LF6 E;  4LFB I;  1H73 A;  4DUY E;  1VIS A;  4LF9 E;  2V2Z A;  2OI2 A;  3PYF A;  4MYT A;  1OJ4 A;  3T1H I;  2O1T A;  5GMD A;  2A2C A;  4JI8 I;  3LPS A;  2HKE A;  2UXD I;  2IOP A;  2Q2E B;  1HNW I;  1KKH A;  3B8H A;  4LF4 E;  3J81 Q;  3JAM C;  1ZM2 A;  1Z0B A;  4YY3 E;  4GKJ E;  4B3R I;  3Q6M A;  1XMQ E;  1RRE A;  1Z59 A;  4DUZ E;  1ZXN A;  4DR6 E;  4NXM I;  4IZJ B;  1MX0 A;  4DU7 A;  2DEJ A;  4XTJ A;  4GKJ I;  1ZM3 A;  4RPF A;  4DV5 I;  5LL6 R;  3J81 C;  2R42 A;  2UUA I;  4DV6 E;  1S16 A;  4Z7C A;  4JI2 E;  2IOQ A;  4IZK A;  4DU8 A;  2Z5C A;  1MG7 A;  1Z5A A;  4X62 E;  2O1V A;  3V2U C;  1UEK A;  5LMU E;  5LMN I;  2HK3 A;  4YHH I;  4B3T E;  1FI4 A;  4DV1 E;  1XHK A;  3D4J A;  3V5R A;  2BV3 A;  1B63 A;  3QT7 A;  3B78 A;  2UU9 E;  2A2D A;  2V2Q A;  2R3V A;  4LF8 E;  4PU9 A;  4LF5 E;  1H72 C;  1Y6Z A;  2X7I A;  4X64 E;  1D6T A;  3J7A G;  2Z5B B;  2HKJ A;  1HNZ E;  2HHH E;  1XMO E;  2UUB E;  4B3M I;  5IWA E;  1Z0C A;  4JI3 I;  2V34 A;  4UT4 A;  1PIE A;  4DPW A;  1N34 I;  4HYM A;  4JI6 E;  2CGE A;  5BR8 I;  3K17 A;  1KTV A;  3T1Y E;  4MYU A;  4B3S E;  1FJG I;  2XEX A;  4DV2 E;  4DR3 I;  2UXC E;  4JI4 E;  2ZM6 E;  1N0V C;  4DR2 E;  2UUC E;  1HNX E;  1BKN A;  4JI1 I;  1N32 E;  4X66 E;  5FLX Q;  1IBM E;  3ZZ0 A;  4LF6 I;  4URL A;  3J7A M;  4DUY I;  1USV A;  1Y4U A;  2EFG A;  4LF9 I;  2NPF A;  4P7A A;  1PKP A;  3ZKD A;  5IT9 Q;  4OX9 E;  4LF7 E;  3PYE A;  1IBM I;  4DR7 E;  3LTO A;  4DV7 E;  4DXL A;  1MU5 A;  5FLX C;  4IZK B;  3OTO E;  2Z5C B;  3K85 A;  4LF4 I;  4K0K E;  4YY3 I;  4DV3 E;  3QT6 A;  4DR5 E;  1H7S A;  3J80 Q;  1RR9 A;  2ZBK B;  1XMQ I;  1Z0G A;  3WU3 A;  4DV7 I;  2PNL A;  5IT9 C;  1K47 A;  1FKA E;  4DUZ I;  4PRV A;  4FWG A;  4DR6 I;  4EMD A;  4GKK E;  2BM0 A;  3QT8 A;  1XNR E;  1NZ0 A;  4DR5 I;  1Y4S A;  2V2V A;  4DV4 E;  3F0N A;  3P06 A;  4UTG A;  4DV6 I;  1HR0 E;  4JI2 I;  2DEI A;  2J7K A;  4JI7 E;  2VQE E;  1XNQ E;  1I94 E;  3J80 C;  4JG4 A;  1N33 E;  1XNR I;  4LFC E;  4DPX A;  4X62 I;  3HJC A;  4IZJ A;  5LMU I;  2GQ0 A;  4LFA E;  4HXZ A;  1N33 I;  4B3T I;  4DV1 I;  2UXB E;  4FWH A;  4ZVI A;  4JYA E;  1KVK A;  2UU9 I;  4JI0 E;  4JI5 E;  1Z0E A;  3ZZU A;  5A2Q Q;  4LF8 I;  1J5E E;  3ZKB A;  1Z5C A;  2GS8 A;  2UXB I;  4LF5 I;  4X64 I;  2CZ9 A;  1IBK E;  3LNU A;  4JV5 E;  2VQF E;  4NXN E;  2HFU A;  1ZM4 A;  3H4L A;  1HNZ I;  2HHH I;  1XMO I;  2UUB I;  1EI1 A;  5IWA I;  1IBL E;  4DR4 E;  4DR1 E;  5A2Q C;  1HK7 A;  4X65 E;  4NXN I;  3Q6N A;  4JI6 I;  4LFB E;  3Q1Q A;  3T1Y I;  1IBL I;  4N3O A;  1QZR A;  4B3S I;  1N0U A;  2HFS A;  2E1R A;  4DV2 I;  5FWK A;  2UXC I;  5GME A;  4JI4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...