2Z5BB

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
178
structure length
132
Chain Sequence
MISYEFQTHLPKENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELYRRVILPEQFSLLISMSSKIWSADDNDFGKLVFVLKCIKDMYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Protein YPL144W
total genus 31
structure length 132
sequence length 178
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5bB01
2Z5BB 2Z5EA 2Z5CB
chains in the Genus database with same CATH superfamily
1R6LA 2IERA 3PYEA 2A2CA 4J3DA 2VQFE 3GONA 1DARA 1XNRI 4K0KI 1S16A 4LFBE 4DR2I 2WP8A 4USKA 4AIDA 4JI4I 3HJCA 1VISA 1Y5YA 2Z5BB 1N34E 3M6AA 4ISAA 2C39A 2BV3A 4DV2E 2Z5CA 4IZKA 4DPWA 3ZZTA 4JI8I 3J81Q 4KHPI 4P52A 4AQYI 2UXBI 1FKAE 2BA1D 4LF7E 1S4EA 4OZEA 5A2QC 4FW6A 4FW4A 3P06A 3UHMA 1Z0CA 4OO1C 4DR7E 3PS2A 2V8PA 5EKWA 4FN5A 3J80Q 1HNWI 4JI6E 4MYTA 2EFGA 4LFAI 3HULA 1E3HA 1KKHA 1OYRA 2O1WA 1IBME 4JI4E 1E3PA 3T1YE 4BA1B 1UDNA 4AM3A 4KQVA 3B78A 1J5EE 2X36A 4DPXA 4LF4E 4FWDA 4OO1A 4GKKE 4DR6I 1Z0EA 3CWVA 2IESA 2C37A 5C0XA 4LF5E 2JE6A 2GO4A 3L7ZA 2PO0A 3P3EA 2PO2B 2UXDE 1FNMA 4Z7YA 1PKPA 2HFUA 1HNZE 4OO1F 1MG7A 4DV5I 2UU9E 1HNWE 4DV3I 1RR9A 4LF9I 4LFBI 4DR7I 4JI2E 4JI6I 2Z5BA 4XTJA 2WNRB 3H4LA 3JAMC 3M85D 1I94I 2UUAI 4MQYA 3JAMQ 1FI4A 4IZKB 4JV5E 2PNLA 1NHIA 5IWAE 2E1RA 4LFCI 4FWGA 2O1UA 3OTOE 4DR6E 2O3ZA 4IZJA 4JI8E 2BA0D 3Q6NA 4FW3A 5A2QQ 2UUBE 2O1TA 1FWLA 2PO2A 3GLLA 1Y60A 4X66I 2UUCE 4EMDA 4DV3E 1N36E 1IBKI 3KRNA 3M7ND 2X7IA 2XEXA 1HNZI 1QZRA 3Q1QA 3QT7A 1XNQI 4DU8A 2UXCI 4N3OA 4JYAI 1Z0TA 2J7KA 1J5EI 4LF4I 4U3DA 4GKKI 1MU5A 3GCMA 1Z0GA 4OO1B 3K85A 2R3VA 5EL9A 4JV5I 5FWKA 4X62I 3J81C 2PNMA 1Z59A 5JEAC 4HY1A 2PO0B 1XHKA 4FWHA 2PNZB 2IOQA 1XNRE 2ZITA 4HYMA 4MU4A 3ZZ0A 4LCHA 3ZZUA 1XMOI 4JI0I 2HFSA 2WNRA 1I94E 4JI0E 4HXZA 4DV2I 4DU7A 4IFDB 1B62A 1P42A 4DV4I 4OO1E 1K47A 3P3GA 3PYGA 4PU9A 1IBLI 5K36C 2UUBI 4IZJB 4LF6E 2AE8A 2WW4A 1FWKA 4U3BA 1KTVA 3P3CA 3CDJA 3LPSA 1Z5CA 4JG4A 5K36E 1OJ4A 5FLXQ 1N32I 1HK7A 1XNQE 1N32E 1N36I 2HHHI 2C38A 3PRYA 1RREA 4LF9E 4DPYA 1USUA 1IBMI 4LCGA 1ZM2A 1VI7A 2JEBB 4DV4E 3WU5A 5C0XF 1HR0E 1N34I 3HKMA 2ZM6I 4DR5I 4LF5I 1Y4SA 3K1JA 2C37B 2NN6C 3K17A 4X62E 5DNLA 4NXME 2UXDI 3L7ZB 4ED4A 3WU6A 2V2VA 1MX0A 4DV0I 4Z7CA 2V2ZA 3PYFA 5JEAE 1XMOE 3WU3A 4IFDC 4MU1A 4DUZE 4IFDE 4JI2I 1ZXNA 2Z5EA 3GMEA 1UDSA 2BM1A 5C0XD 1YHCA 5IWAI 2WP8B 1RHYA 1Z5BA 4DR3E 4LOMA 4P7AA 2ZBKB 3J7AM 2JT2A 3OTOI 2CZ9A 2Z5CB 5L3JA 1D6TA 3PYDA 4IFDD 1IBLE 2VQEI 3D4JA 2UUCI 4NXMI 4LF6I 4LPFA 4MYUA 4WUDA 1B63A 3M7NG 2NN6D 3P76A 5FLXC 4OO1D 1ZM3A 4OKGA 5LMNI 2V2QA 2UU9I 4X65E 1XXEA 5LL6R 4DUZI 1Z0BA 4NXNI 4B3MI 2BM0A 4PRVA 5BR8E 4DR1I 4QNKA 3T1HE 4B3ME 3B82A 3QT5A 2C39B 3V5RA 4DR1E 1PIEA 3B4TA 1PVGA 4DV6E 4DR3I 1HR0I 4B3TE 4IFDF 3LNUA 2NN6B 4DV1I 4B3SI 1XMQI 1Y6ZA 3DD6A 1UDQA 2JE6B 2NN6E 2BA1G 2GS8A 4MU3A 1NHJA 2NN6F 2JEAB 4LF8E 2HK3A 5LMNE 4DV0E 5DRQA 2LJPA 4GKJI 5GMEA 2BR2B 4UT4A 4B3RE 2HHHE 4DPTA 1Y4UA 3T1HI 2VF3A 1H7SA 4NXNE 4IFDA 4JYAE 5IT9C 4BA2B 4I3HA 1EI1A 2PO1B 4WUBA 1N0UA 1H7UA 1OYPA 4RPFA 1KIJA 4NBQA 2NPFA 3U1YA 2ZM6E 5C0XB 4DR4E 3LTOA 4DV1E 2CVEA 4B3SE 1EA6A 3WU4A 2VQEE 4DUYE 2CGEA 4R1FA 5K36F 4PRXA 4HACB 1H74A 3B8HA 4B3RI 3Q6MA 1R6MA 1UDOA 2DEJA 4JI7I 3PS3A 4DR5E 1Z0VA 2VESA 1OYSA 4AIMA 3F0NA 4UTGA 4URLA 1ZXMA 4FW5A 2NN6A 3QT8A 1Z0WA 4X64I 1ELOA 4USMA 3V2UC 5K36A 2E5LE 4JI3E 4DUYI 4YHHI 5K36D 5ELWA 4JI1E 2E5LI 4JI3I 2UXBE 1ZM9A 5JEAF 3J80C 2BR2A 2PNZA 4JI5I 3QT6A 4HACA 2F4VI 4GKJE 1HNXE 1A6FA 1N33I 4JI5E 4DR2E 1UEKA 5DRPA 2OI2A 2HK2A 4IZJD 2F4VE 1N0VC 2PO1A 2A2DA 5GMDA 2V34A 4JI7E 3PS1A 5C0XE 2DEIA 4FW9A 5C0XC 5LMUE 4YY3I 4LFCE 4AQYE 4B3TI 5DNXA 2BA0G 4GQUA 5JEAA 4LF7I 4JI1I 5JEAD 1H73A 4DV7E 4X66E 2VQFI 1IBKE 4X65I 4MDTA 4LF8I 2F1DA 1ZM4A 4LFAE 3J7AG 4MU0A 3ZKDA 3CDIA 2Q2EB 3NZKA 1YH8A 5IT9Q 1HNXI 1N33E 2J65A 4DV6I 1NZ0A 3H1CA 1USVA 1WUUA 1BKNA 2GQ0A 5DROA 4X64E 5LMUI 4YY3E 5K36B 4DPUA 2O1VA 4YHHE 2HKJA 4DR4I 2JEAA 4KHPE 3U1KA 2AJ4A 4DV5E 4IS9A 4ZVIA 4WUCA 2C38B 1KVKA 4K0KE 4QNJA 1FJGE 1NHHA 2JEBA 2UUAE 1FJGI 1H72C 3ZKBA 3ZM7A 5BR8I 2UXCE 4BA2A 4LCFA 2HKEA 2IOPA 5DRRA 1U2RA 4BA1A 2R42A 3T1YI 4OX9E 4M1KA 5JEAB 4FW7A 2GO3A 4DV7I 3M85G 2CG9A 4OX9I 1Z5AA 4DXLA 1XMQE
chains in the Genus database with same CATH topology
3PYEA 2A2CA 2VQFE 3GONA 1DARA 1XNRI 4K0KI 1S16A 4LFBE 4DR2I 4USKA 4JI4I 3HJCA 1VISA 2Z5BB 1N34E 3M6AA 2BV3A 4DV2E 2Z5CA 4IZKA 4DPWA 3ZZTA 4JI8I 3J81Q 4KHPI 4P52A 4AQYI 2UXBI 1FKAE 4LF7E 1S4EA 5A2QC 3P06A 1Z0CA 4DR7E 2V8PA 4FN5A 3J80Q 1HNWI 4JI6E 4MYTA 2EFGA 4LFAI 3HULA 1KKHA 2O1WA 1IBME 4JI4E 3T1YE 4KQVA 3B78A 1J5EE 2X36A 4DPXA 4LF4E 4FWDA 4GKKE 4DR6I 1Z0EA 3CWVA 4LF5E 2UXDE 1FNMA 4Z7YA 1PKPA 2HFUA 1HNZE 1MG7A 4DV5I 2UU9E 1HNWE 4DV3I 1RR9A 4LF9I 4LFBI 4DR7I 4JI2E 4JI6I 2Z5BA 4XTJA 3H4LA 3JAMC 1I94I 2UUAI 3JAMQ 1FI4A 4IZKB 4JV5E 2PNLA 1NHIA 5IWAE 2E1RA 4LFCI 4FWGA 2O1UA 3OTOE 4DR6E 4IZJA 4JI8E 2UUBE 3Q6NA 5A2QQ 2O1TA 1FWLA 4X66I 2UUCE 4EMDA 4DV3E 1N36E 1IBKI 2X7IA 2XEXA 1HNZI 1QZRA 3Q1QA 3QT7A 1XNQI 4DU8A 2UXCI 4N3OA 4JYAI 1Z0TA 2J7KA 1J5EI 4LF4I 4GKKI 1MU5A 1Z0GA 3K85A 2R3VA 4JV5I 5FWKA 4X62I 3J81C 2PNMA 1Z59A 4HY1A 1XHKA 4FWHA 2IOQA 1XNRE 2ZITA 4HYMA 3ZZ0A 3ZZUA 1XMOI 4JI0I 2HFSA 1I94E 4JI0E 4HXZA 4DV2I 4DU7A 1B62A 4DV4I 1K47A 3PYGA 4PU9A 1IBLI 2UUBI 4IZJB 4LF6E 2WW4A 1FWKA 1KTVA 3LPSA 1Z5CA 4JG4A 1OJ4A 5FLXQ 1N32I 1HK7A 1XNQE 1N32E 1N36I 2HHHI 3PRYA 1RREA 4LF9E 4DPYA 1USUA 1IBMI 1ZM2A 4DV4E 3WU5A 1HR0E 1N34I 2ZM6I 4DR5I 4LF5I 1Y4SA 3K1JA 4X62E 3K17A 4NXME 2UXDI 4ED4A 3WU6A 2V2VA 1MX0A 4DV0I 4Z7CA 2V2ZA 3PYFA 1XMOE 3WU3A 4DUZE 4JI2I 1ZXNA 2Z5EA 2BM1A 5IWAI 1Z5BA 4DR3E 4P7AA 2ZBKB 3J7AM 3OTOI 2CZ9A 2Z5CB 5L3JA 1D6TA 3PYDA 1IBLE 2VQEI 3D4JA 2UUCI 4NXMI 4LF6I 4MYUA 4WUDA 1B63A 5FLXC 1ZM3A 5LMNI 2V2QA 2UU9I 4X65E 5LL6R 4DUZI 1Z0BA 4NXNI 4B3MI 2BM0A 4PRVA 5BR8E 4DR1I 3T1HE 4B3ME 3B82A 3QT5A 3V5RA 4DR1E 1PIEA 1PVGA 4DV6E 4DR3I 1HR0I 4B3TE 3LNUA 4DV1I 4B3SI 1XMQI 1Y6ZA 2GS8A 1NHJA 4LF8E 2HK3A 5LMNE 4DV0E 2LJPA 4GKJI 5GMEA 4UT4A 4B3RE 2HHHE 4DPTA 1Y4UA 3T1HI 2VF3A 1H7SA 4NXNE 4JYAE 5IT9C 4I3HA 1EI1A 4WUBA 1N0UA 1H7UA 4RPFA 1KIJA 2ZM6E 2NPFA 4DR4E 3LTOA 4DV1E 4B3SE 1EA6A 3WU4A 2VQEE 4DUYE 2CGEA 4R1FA 4PRXA 4HACB 1H74A 3B8HA 4B3RI 3Q6MA 2DEJA 4JI7I 4DR5E 1Z0VA 4UTGA 3F0NA 4URLA 1ZXMA 3QT8A 1Z0WA 4X64I 1ELOA 4USMA 3V2UC 2E5LE 4JI3E 4DUYI 4YHHI 4JI1E 2E5LI 4JI3I 2UXBE 1ZM9A 3J80C 4JI5I 3QT6A 4HACA 2F4VI 4GKJE 1HNXE 1A6FA 1N33I 4JI5E 4DR2E 1UEKA 2OI2A 2HK2A 4IZJD 2F4VE 1N0VC 2A2DA 5GMDA 2V34A 4JI7E 2DEIA 4FW9A 5LMUE 4YY3I 4LFCE 4AQYE 4B3TI 4LF7I 4JI1I 1H73A 4DV7E 4X66E 2VQFI 1IBKE 4X65I 4LF8I 1ZM4A 4LFAE 3J7AG 3ZKDA 2Q2EB 5IT9Q 1HNXI 1N33E 4DV6I 1NZ0A 1USVA 1WUUA 1BKNA 2GQ0A 4X64E 5LMUI 4YY3E 4DPUA 2O1VA 4YHHE 2HKJA 4DR4I 4KHPE 4DV5E 2AJ4A 4ZVIA 4WUCA 1KVKA 4K0KE 1FJGE 1NHHA 2UUAE 1FJGI 1H72C 3ZKBA 3ZM7A 5BR8I 2UXCE 2HKEA 2IOPA 1U2RA 2R42A 3T1YI 4OX9E 4M1KA 4DV7I 2CG9A 4OX9I 1Z5AA 4DXLA 1XMQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B B;  2Z5E A;  2Z5C B; 
#chains in the Genus database with same CATH topology
 1R6L A;  2IER A;  3PYE A;  2A2C A;  4J3D A;  2VQF E;  3GON A;  1DAR A;  1XNR I;  4K0K I;  1S16 A;  4LFB E;  4DR2 I;  2WP8 A;  4USK A;  4AID A;  4JI4 I;  3HJC A;  1VIS A;  1Y5Y A;  2Z5B B;  1N34 E;  3M6A A;  4ISA A;  2C39 A;  2BV3 A;  4DV2 E;  2Z5C A;  4IZK A;  4DPW A;  3ZZT A;  4JI8 I;  3J81 Q;  4KHP I;  4P52 A;  4AQY I;  2UXB I;  1FKA E;  2BA1 D;  4LF7 E;  1S4E A;  4OZE A;  5A2Q C;  4FW6 A;  4FW4 A;  3P06 A;  3UHM A;  1Z0C A;  4OO1 C;  4DR7 E;  3PS2 A;  2V8P A;  5EKW A;  4FN5 A;  3J80 Q;  1HNW I;  4JI6 E;  4MYT A;  2EFG A;  4LFA I;  3HUL A;  1E3H A;  1KKH A;  1OYR A;  2O1W A;  1IBM E;  4JI4 E;  1E3P A;  3T1Y E;  4BA1 B;  1UDN A;  4AM3 A;  4KQV A;  3B78 A;  1J5E E;  2X36 A;  4DPX A;  4LF4 E;  4FWD A;  4OO1 A;  4GKK E;  4DR6 I;  1Z0E A;  3CWV A;  2IES A;  2C37 A;  5C0X A;  4LF5 E;  2JE6 A;  2GO4 A;  3L7Z A;  2PO0 A;  3P3E A;  2PO2 B;  2UXD E;  1FNM A;  4Z7Y A;  1PKP A;  2HFU A;  1HNZ E;  4OO1 F;  1MG7 A;  4DV5 I;  2UU9 E;  1HNW E;  4DV3 I;  1RR9 A;  4LF9 I;  4LFB I;  4DR7 I;  4JI2 E;  4JI6 I;  2Z5B A;  4XTJ A;  2WNR B;  3H4L A;  3JAM C;  3M85 D;  1I94 I;  2UUA I;  4MQY A;  3JAM Q;  1FI4 A;  4IZK B;  4JV5 E;  2PNL A;  1NHI A;  5IWA E;  2E1R A;  4LFC I;  4FWG A;  2O1U A;  3OTO E;  4DR6 E;  2O3Z A;  4IZJ A;  4JI8 E;  2BA0 D;  3Q6N A;  4FW3 A;  5A2Q Q;  2UUB E;  2O1T A;  1FWL A;  2PO2 A;  3GLL A;  1Y60 A;  4X66 I;  2UUC E;  4EMD A;  4DV3 E;  1N36 E;  1IBK I;  3KRN A;  3M7N D;  2X7I A;  2XEX A;  1HNZ I;  1QZR A;  3Q1Q A;  3QT7 A;  1XNQ I;  4DU8 A;  2UXC I;  4N3O A;  4JYA I;  1Z0T A;  2J7K A;  1J5E I;  4LF4 I;  4U3D A;  4GKK I;  1MU5 A;  3GCM A;  1Z0G A;  4OO1 B;  3K85 A;  2R3V A;  5EL9 A;  4JV5 I;  5FWK A;  4X62 I;  3J81 C;  2PNM A;  1Z59 A;  5JEA C;  4HY1 A;  2PO0 B;  1XHK A;  4FWH A;  2PNZ B;  2IOQ A;  1XNR E;  2ZIT A;  4HYM A;  4MU4 A;  3ZZ0 A;  4LCH A;  3ZZU A;  1XMO I;  4JI0 I;  2HFS A;  2WNR A;  1I94 E;  4JI0 E;  4HXZ A;  4DV2 I;  4DU7 A;  4IFD B;  1B62 A;  1P42 A;  4DV4 I;  4OO1 E;  1K47 A;  3P3G A;  3PYG A;  4PU9 A;  1IBL I;  5K36 C;  2UUB I;  4IZJ B;  4LF6 E;  2AE8 A;  2WW4 A;  1FWK A;  4U3B A;  1KTV A;  3P3C A;  3CDJ A;  3LPS A;  1Z5C A;  4JG4 A;  5K36 E;  1OJ4 A;  5FLX Q;  1N32 I;  1HK7 A;  1XNQ E;  1N32 E;  1N36 I;  2HHH I;  2C38 A;  3PRY A;  1RRE A;  4LF9 E;  4DPY A;  1USU A;  1IBM I;  4LCG A;  1ZM2 A;  1VI7 A;  2JEB B;  4DV4 E;  3WU5 A;  5C0X F;  1HR0 E;  1N34 I;  3HKM A;  2ZM6 I;  4DR5 I;  4LF5 I;  1Y4S A;  3K1J A;  2C37 B;  2NN6 C;  3K17 A;  4X62 E;  5DNL A;  4NXM E;  2UXD I;  3L7Z B;  4ED4 A;  3WU6 A;  2V2V A;  1MX0 A;  4DV0 I;  4Z7C A;  2V2Z A;  3PYF A;  5JEA E;  1XMO E;  3WU3 A;  4IFD C;  4MU1 A;  4DUZ E;  4IFD E;  4JI2 I;  1ZXN A;  2Z5E A;  3GME A;  1UDS A;  2BM1 A;  5C0X D;  1YHC A;  5IWA I;  2WP8 B;  1RHY A;  1Z5B A;  4DR3 E;  4LOM A;  4P7A A;  2ZBK B;  3J7A M;  2JT2 A;  3OTO I;  2CZ9 A;  2Z5C B;  5L3J A;  1D6T A;  3PYD A;  4IFD D;  1IBL E;  2VQE I;  3D4J A;  2UUC I;  4NXM I;  4LF6 I;  4LPF A;  4MYU A;  4WUD A;  1B63 A;  3M7N G;  2NN6 D;  3P76 A;  5FLX C;  4OO1 D;  1ZM3 A;  4OKG A;  5LMN I;  2V2Q A;  2UU9 I;  4X65 E;  1XXE A;  5LL6 R;  4DUZ I;  1Z0B A;  4NXN I;  4B3M I;  2BM0 A;  4PRV A;  5BR8 E;  4DR1 I;  4QNK A;  3T1H E;  4B3M E;  3B82 A;  3QT5 A;  2C39 B;  3V5R A;  4DR1 E;  1PIE A;  3B4T A;  1PVG A;  4DV6 E;  4DR3 I;  1HR0 I;  4B3T E;  4IFD F;  3LNU A;  2NN6 B;  4DV1 I;  4B3S I;  1XMQ I;  1Y6Z A;  3DD6 A;  1UDQ A;  2JE6 B;  2NN6 E;  2BA1 G;  2GS8 A;  4MU3 A;  1NHJ A;  2NN6 F;  2JEA B;  4LF8 E;  2HK3 A;  5LMN E;  4DV0 E;  5DRQ A;  2LJP A;  4GKJ I;  5GME A;  2BR2 B;  4UT4 A;  4B3R E;  2HHH E;  4DPT A;  1Y4U A;  3T1H I;  2VF3 A;  1H7S A;  4NXN E;  4IFD A;  4JYA E;  5IT9 C;  4BA2 B;  4I3H A;  1EI1 A;  2PO1 B;  4WUB A;  1N0U A;  1H7U A;  1OYP A;  4RPF A;  1KIJ A;  4NBQ A;  2NPF A;  3U1Y A;  2ZM6 E;  5C0X B;  4DR4 E;  3LTO A;  4DV1 E;  2CVE A;  4B3S E;  1EA6 A;  3WU4 A;  2VQE E;  4DUY E;  2CGE A;  4R1F A;  5K36 F;  4PRX A;  4HAC B;  1H74 A;  3B8H A;  4B3R I;  3Q6M A;  1R6M A;  1UDO A;  2DEJ A;  4JI7 I;  3PS3 A;  4DR5 E;  1Z0V A;  2VES A;  1OYS A;  4AIM A;  3F0N A;  4UTG A;  4URL A;  1ZXM A;  4FW5 A;  2NN6 A;  3QT8 A;  1Z0W A;  4X64 I;  1ELO A;  4USM A;  3V2U C;  5K36 A;  2E5L E;  4JI3 E;  4DUY I;  4YHH I;  5K36 D;  5ELW A;  4JI1 E;  2E5L I;  4JI3 I;  2UXB E;  1ZM9 A;  5JEA F;  3J80 C;  2BR2 A;  2PNZ A;  4JI5 I;  3QT6 A;  4HAC A;  2F4V I;  4GKJ E;  1HNX E;  1A6F A;  1N33 I;  4JI5 E;  4DR2 E;  1UEK A;  5DRP A;  2OI2 A;  2HK2 A;  4IZJ D;  2F4V E;  1N0V C;  2PO1 A;  2A2D A;  5GMD A;  2V34 A;  4JI7 E;  3PS1 A;  5C0X E;  2DEI A;  4FW9 A;  5C0X C;  5LMU E;  4YY3 I;  4LFC E;  4AQY E;  4B3T I;  5DNX A;  2BA0 G;  4GQU A;  5JEA A;  4LF7 I;  4JI1 I;  5JEA D;  1H73 A;  4DV7 E;  4X66 E;  2VQF I;  1IBK E;  4X65 I;  4MDT A;  4LF8 I;  2F1D A;  1ZM4 A;  4LFA E;  3J7A G;  4MU0 A;  3ZKD A;  3CDI A;  2Q2E B;  3NZK A;  1YH8 A;  5IT9 Q;  1HNX I;  1N33 E;  2J65 A;  4DV6 I;  1NZ0 A;  3H1C A;  1USV A;  1WUU A;  1BKN A;  2GQ0 A;  5DRO A;  4X64 E;  5LMU I;  4YY3 E;  5K36 B;  4DPU A;  2O1V A;  4YHH E;  2HKJ A;  4DR4 I;  2JEA A;  4KHP E;  3U1K A;  2AJ4 A;  4DV5 E;  4IS9 A;  4ZVI A;  4WUC A;  2C38 B;  1KVK A;  4K0K E;  4QNJ A;  1FJG E;  1NHH A;  2JEB A;  2UUA E;  1FJG I;  1H72 C;  3ZKB A;  3ZM7 A;  5BR8 I;  2UXC E;  4BA2 A;  4LCF A;  2HKE A;  2IOP A;  5DRR A;  1U2R A;  4BA1 A;  2R42 A;  3T1Y I;  4OX9 E;  4M1K A;  5JEA B;  4FW7 A;  2GO3 A;  4DV7 I;  3M85 G;  2CG9 A;  4OX9 I;  1Z5A A;  4DXL A;  1XMQ E; 
#chains in the Genus database with same CATH homology
 3PYE A;  2A2C A;  2VQF E;  3GON A;  1DAR A;  1XNR I;  4K0K I;  1S16 A;  4LFB E;  4DR2 I;  4USK A;  4JI4 I;  3HJC A;  1VIS A;  2Z5B B;  1N34 E;  3M6A A;  2BV3 A;  4DV2 E;  2Z5C A;  4IZK A;  4DPW A;  3ZZT A;  4JI8 I;  3J81 Q;  4KHP I;  4P52 A;  4AQY I;  2UXB I;  1FKA E;  4LF7 E;  1S4E A;  5A2Q C;  3P06 A;  1Z0C A;  4DR7 E;  2V8P A;  4FN5 A;  3J80 Q;  1HNW I;  4JI6 E;  4MYT A;  2EFG A;  4LFA I;  3HUL A;  1KKH A;  2O1W A;  1IBM E;  4JI4 E;  3T1Y E;  4KQV A;  3B78 A;  1J5E E;  2X36 A;  4DPX A;  4LF4 E;  4FWD A;  4GKK E;  4DR6 I;  1Z0E A;  3CWV A;  4LF5 E;  2UXD E;  1FNM A;  4Z7Y A;  1PKP A;  2HFU A;  1HNZ E;  1MG7 A;  4DV5 I;  2UU9 E;  1HNW E;  4DV3 I;  1RR9 A;  4LF9 I;  4LFB I;  4DR7 I;  4JI2 E;  4JI6 I;  2Z5B A;  4XTJ A;  3H4L A;  3JAM C;  1I94 I;  2UUA I;  3JAM Q;  1FI4 A;  4IZK B;  4JV5 E;  2PNL A;  1NHI A;  5IWA E;  2E1R A;  4LFC I;  4FWG A;  2O1U A;  3OTO E;  4DR6 E;  4IZJ A;  4JI8 E;  2UUB E;  3Q6N A;  5A2Q Q;  2O1T A;  1FWL A;  4X66 I;  2UUC E;  4EMD A;  4DV3 E;  1N36 E;  1IBK I;  2X7I A;  2XEX A;  1HNZ I;  1QZR A;  3Q1Q A;  3QT7 A;  1XNQ I;  4DU8 A;  2UXC I;  4N3O A;  4JYA I;  1Z0T A;  2J7K A;  1J5E I;  4LF4 I;  4GKK I;  1MU5 A;  1Z0G A;  3K85 A;  2R3V A;  4JV5 I;  5FWK A;  4X62 I;  3J81 C;  2PNM A;  1Z59 A;  4HY1 A;  1XHK A;  4FWH A;  2IOQ A;  1XNR E;  2ZIT A;  4HYM A;  3ZZ0 A;  3ZZU A;  1XMO I;  4JI0 I;  2HFS A;  1I94 E;  4JI0 E;  4HXZ A;  4DV2 I;  4DU7 A;  1B62 A;  4DV4 I;  1K47 A;  3PYG A;  4PU9 A;  1IBL I;  2UUB I;  4IZJ B;  4LF6 E;  2WW4 A;  1FWK A;  1KTV A;  3LPS A;  1Z5C A;  4JG4 A;  1OJ4 A;  5FLX Q;  1N32 I;  1HK7 A;  1XNQ E;  1N32 E;  1N36 I;  2HHH I;  3PRY A;  1RRE A;  4LF9 E;  4DPY A;  1USU A;  1IBM I;  1ZM2 A;  4DV4 E;  3WU5 A;  1HR0 E;  1N34 I;  2ZM6 I;  4DR5 I;  4LF5 I;  1Y4S A;  3K1J A;  4X62 E;  3K17 A;  4NXM E;  2UXD I;  4ED4 A;  3WU6 A;  2V2V A;  1MX0 A;  4DV0 I;  4Z7C A;  2V2Z A;  3PYF A;  1XMO E;  3WU3 A;  4DUZ E;  4JI2 I;  1ZXN A;  2Z5E A;  2BM1 A;  5IWA I;  1Z5B A;  4DR3 E;  4P7A A;  2ZBK B;  3J7A M;  3OTO I;  2CZ9 A;  2Z5C B;  5L3J A;  1D6T A;  3PYD A;  1IBL E;  2VQE I;  3D4J A;  2UUC I;  4NXM I;  4LF6 I;  4MYU A;  4WUD A;  1B63 A;  5FLX C;  1ZM3 A;  5LMN I;  2V2Q A;  2UU9 I;  4X65 E;  5LL6 R;  4DUZ I;  1Z0B A;  4NXN I;  4B3M I;  2BM0 A;  4PRV A;  5BR8 E;  4DR1 I;  3T1H E;  4B3M E;  3B82 A;  3QT5 A;  3V5R A;  4DR1 E;  1PIE A;  1PVG A;  4DV6 E;  4DR3 I;  1HR0 I;  4B3T E;  3LNU A;  4DV1 I;  4B3S I;  1XMQ I;  1Y6Z A;  2GS8 A;  1NHJ A;  4LF8 E;  2HK3 A;  5LMN E;  4DV0 E;  2LJP A;  4GKJ I;  5GME A;  4UT4 A;  4B3R E;  2HHH E;  4DPT A;  1Y4U A;  3T1H I;  2VF3 A;  1H7S A;  4NXN E;  4JYA E;  5IT9 C;  4I3H A;  1EI1 A;  4WUB A;  1N0U A;  1H7U A;  4RPF A;  1KIJ A;  2ZM6 E;  2NPF A;  4DR4 E;  3LTO A;  4DV1 E;  4B3S E;  1EA6 A;  3WU4 A;  2VQE E;  4DUY E;  2CGE A;  4R1F A;  4PRX A;  4HAC B;  1H74 A;  3B8H A;  4B3R I;  3Q6M A;  2DEJ A;  4JI7 I;  4DR5 E;  1Z0V A;  4UTG A;  3F0N A;  4URL A;  1ZXM A;  3QT8 A;  1Z0W A;  4X64 I;  1ELO A;  4USM A;  3V2U C;  2E5L E;  4JI3 E;  4DUY I;  4YHH I;  4JI1 E;  2E5L I;  4JI3 I;  2UXB E;  1ZM9 A;  3J80 C;  4JI5 I;  3QT6 A;  4HAC A;  2F4V I;  4GKJ E;  1HNX E;  1A6F A;  1N33 I;  4JI5 E;  4DR2 E;  1UEK A;  2OI2 A;  2HK2 A;  4IZJ D;  2F4V E;  1N0V C;  2A2D A;  5GMD A;  2V34 A;  4JI7 E;  2DEI A;  4FW9 A;  5LMU E;  4YY3 I;  4LFC E;  4AQY E;  4B3T I;  4LF7 I;  4JI1 I;  1H73 A;  4DV7 E;  4X66 E;  2VQF I;  1IBK E;  4X65 I;  4LF8 I;  1ZM4 A;  4LFA E;  3J7A G;  3ZKD A;  2Q2E B;  5IT9 Q;  1HNX I;  1N33 E;  4DV6 I;  1NZ0 A;  1USV A;  1WUU A;  1BKN A;  2GQ0 A;  4X64 E;  5LMU I;  4YY3 E;  4DPU A;  2O1V A;  4YHH E;  2HKJ A;  4DR4 I;  4KHP E;  4DV5 E;  2AJ4 A;  4ZVI A;  4WUC A;  1KVK A;  4K0K E;  1FJG E;  1NHH A;  2UUA E;  1FJG I;  1H72 C;  3ZKB A;  3ZM7 A;  5BR8 I;  2UXC E;  2HKE A;  2IOP A;  1U2R A;  2R42 A;  3T1Y I;  4OX9 E;  4M1K A;  4DV7 I;  2CG9 A;  4OX9 I;  1Z5A A;  4DXL A;  1XMQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...