2Z5BB

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
178
structure length
132
Chain Sequence
MISYEFQTHLPKENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELYRRVILPEQFSLLISMSSKIWSADDNDFGKLVFVLKCIKDMYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 31
structure length 132
sequence length 178
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5bB01
2Z5BB 2Z5EA 2Z5CB
chains in the Genus database with same CATH superfamily
4B3TE 1XNRE 2PO1A 1I94E 5FWKA 1HK7A 4LF9I 3OTOE 4DR4E 4LOMA 1OYRA 4MYTA 2C38A 4FWHA 3M7NG 3J7AG 2NPFA 2F4VE 4FW9A 3B78A 2E5LI 1XMOE 5C0XE 4DR3E 4IZKB 4X62I 4JI1E 1IBKI 1VI7A 1MG7A 2VESA 4DV1E 4LF5I 3J81Q 2JEAB 3QT8A 4JI4I 3H4LA 3P3EA 3LPSA 4DV7E 4JI6I 2BA1D 4GQUA 4DR6E 4IFDF 1NHIA 2UUAE 1Z5AA 2A2DA 2HKEA 2UUBI 2UU9I 1DARA 4ZVIA 1Z5CA 1PIEA 5IWAE 4DV3I 1ZM2A 2LJPA 5LMNI 1HNZE 5FLXC 1Z0TA 4NXME 4DV6I 2IESA 2R3VA 2BM0A 4NBQA 4OO1A 1FJGE 1PKPA 1N36E 3D4JA 4QNJA 4YHHE 3B82A 4IZJB 4U3BA 1K47A 2BM1A 4LCGA 1XXEA 2Z5BB 3Q6MA 4NXNE 1IBLI 3Q1QA 4OO1C 3LNUA 4LCHA 1FWLA 4J3DA 2C39A 4DU8A 2ZBKB 2GS8A 1N32I 4MU0A 4JV5I 5JEAD 4DV0I 4DV2I 1J5EI 2JEBB 4HY1A 3WU5A 1XNRI 5DNLA 3GCMA 2CZ9A 2O3ZA 5JEAA 5C0XC 2HHHE 1UDQA 5DRRA 4YY3I 3CDJA 2V34A 2Z5CA 5A2QQ 2JE6B 4DU7A 4N3OA 4KHPE 4DUYE 4ISAA 2ZITA 1N0UA 2F4VI 2BA1G 3HJCA 4LFBI 2PNMA 2HK3A 1XMOI 1Y5YA 1Z0CA 4DR3I 2GO4A 4JI0E 3Q6NA 2OI2A 4JI8E 3ZZ0A 2V2QA 2V2VA 1Z0GA 4FWGA 3PS2A 3HULA 4JI2E 5EL9A 1H72C 3P06A 5K36D 2CVEA 2HFUA 4DV7I 4LFAI 4OO1B 4UT4A 4MU4A 3V2UC 1RHYA 5K36A 1XMQE 5IT9C 2UXBE 1Y4UA 1Z59A 2GO3A 2J65A 4JI3E 4PU9A 1HNZI 5LMUE 4IFDD 3JAMC 1HNXE 4NXMI 1H7SA 5C0XF 1NHJA 5C0XB 4DPYA 1FJGI 4B3ME 1ZXMA 1MX0A 5K36C 4DPWA 1N36I 3K1JA 4YHHI 4IFDA 4FN5A 5L3JA 2F1DA 1ZXNA 5GMDA 4OO1E 4ED4A 3U1YA 4MQYA 4WUDA 2VQEE 1KVKA 4UTGA 4OZEA 1Z0BA 2PNZB 2O1UA 4LF8E 1XNQE 1N33I 1R6LA 2DEIA 1Z5BA 4LF4E 2GQ0A 3GONA 4PRVA 4LF7I 2EFGA 1UDNA 2HHHI 4DPXA 2IOPA 3L7ZA 4FW7A 1Z0EA 4EMDA 2PO2A 2AJ4A 2AE8A 2NN6D 3PS3A 5JEAE 4USMA 4X64E 4DUYI 2O1WA 1EA6A 1UEKA 3PS1A 1IBME 2NN6A 4WUCA 1HNWE 1N0VC 4GKJI 4AM3A 3PYFA 4JI0I 4JI8I 2R42A 2X36A 4MYUA 4FWDA 1Z0VA 2NN6C 2PO0A 4HACA 4DR5I 2DEJA 1HR0E 4JYAE 4BA2A 4OX9E 3J7AM 1QZRA 4DR2I 1N34I 2PO1B 1E3HA 4RPFA 1Y6ZA 4I3HA 1FWKA 1XMQI 3J80C 2UXBI 2BR2A 3T1YE 1FI4A 3V5RA 4LFCE 5K36E 1HNXI 2J7KA 2HK2A 5BR8E 2C38B 4B3TI 3P76A 4B3MI 2BA0D 1I94I 1KKHA 2UXCE 1ZM4A 3ZKDA 4LF9E 3P3CA 2C37A 1FKAE 1NHHA 3PYEA 3HKMA 5DRQA 2VQEI 4B3RE 4IFDE 3ZZTA 3OTOI 4DR4I 3L7ZB 2XEXA 3GMEA 3P3GA 4LF8I 1XNQI 1E3PA 5JEAC 3QT7A 3M6AA 4R1FA 4BA1A 1EI1A 4JI5E 4AQYE 4X62E 4JI1I 5DNXA 4Z7CA 1FNMA 2PNLA 1NZ0A 4DV1I 3K17A 4X64I 4KQVA 4OO1F 3M7ND 5ELWA 4DR6I 1IBMI 4USKA 4IZKA 2UUAI 2V8PA 1WUUA 4Z7YA 5IWAI 2NN6E 2UUCE 5LMNE 4DR7E 1R6MA 4DPUA 2C39B 4MU3A 3K85A 1HR0I 4JYAI 4OX9I 4PRXA 1VISA 4DV5E 2CGEA 5EKWA 4NXNI 4JI7E 5JEAF 5JEAB 4DR1E 1UDOA 4IZJD 3T1YI 3B8HA 1RREA 2Z5CB 4IFDC 4DPTA 4LCFA 4QNKA 4LFCI 4DUZE 4DV0E 5GMEA 1J5EE 4B3SE 4IZJA 4K0KE 2UXCI 4BA1B 4LPFA 4P52A 2Z5BA 1MU5A 1KIJA 1ELOA 4X66E 5FLXQ 4YY3E 4X65E 4B3RI 4P7AA 4KHPI 2UXDE 1OYPA 3PRYA 4FW3A 2CG9A 2JEBA 3UHMA 3WU3A 1S4EA 1YH8A 4LFBE 2VQFE 4GKKE 4JI5I 4AQYI 3B4TA 2IOQA 1OYSA 4URLA 3J80Q 4DV4E 3ZKBA 4LF6E 4M1KA 2VF3A 4IS9A 5K36F 3QT6A 5K36B 2HKJA 2JE6A 1USUA 5DROA 2Z5EA 4JI2I 2ZM6E 3T1HE 4MDTA 4LFAE 1P42A 1S16A 4IFDB 4DXLA 3LTOA 3PYDA 3M85D 2O1VA 4OO1D 2UUCI 2WP8A 4JI3I 1B63A 5LMUI 4DR7I 3J81C 2A2CA 2E1RA 2V2ZA 2WNRA 4OKGA 4WUBA 5LL6R 3GLLA 4DV5I 1B62A 5C0XD 4JI7I 4DR1I 4AIDA 1ZM9A 2X7IA 2PO2B 3F0NA 3DD6A 5C0XA 1USVA 1N33E 1Y60A 4XTJA 1D6TA 4DUZI 4B3SI 4LF4I 2E5LE 1BKNA 4K0KI 1XHKA 4FW5A 4LF7E 2NN6F 2NN6B 5IT9Q 1IBKE 4X66I 4FW6A 1Y4SA 3JAMQ 2PNZA 1KTVA 4X65I 3NZKA 4LF5E 3WU4A 4JI4E 2Q2EB 2UXDI 2PO0B 4HACB 5DRPA 1YHCA 1H74A 1OJ4A 1ZM3A 4MU1A 4AIMA 4JI6E 4BA2B 1HNWI 3QT5A 2VQFI 2UUBE 4GKKI 2UU9E 2JT2A 4GKJE 3M85G 3ZZUA 1U2RA 3CDIA 3H1CA 4DV4I 4LF6I 1PVGA 4JG4A 4DV3E 3KRNA 4HYMA 3U1KA 3WU6A 2HFSA 2IERA 2JEAA 2BR2B 1Z0WA 2WP8B 4DV6E 4DR5E 5A2QC 2BV3A 4HXZA 2BA0G 3CWVA 2ZM6I 3T1HI 4FW4A 1RR9A 4U3DA 4DR2E 3ZM7A 1N34E 2WW4A 2WNRB 1H7UA 1IBLE 1UDSA 2C37B 2O1TA 1A6FA 1H73A 3PYGA 1N32E 4JV5E 5BR8I 4DV2E
chains in the Genus database with same CATH topology
4B3TE 1XNRE 1I94E 5FWKA 1HK7A 4LF9I 3OTOE 4DR4E 4MYTA 4FWHA 3J7AG 2NPFA 2F4VE 4FW9A 3B78A 2E5LI 1XMOE 4DR3E 4IZKB 4X62I 4JI1E 1IBKI 1MG7A 4DV1E 4LF5I 3J81Q 3QT8A 4JI4I 3H4LA 3LPSA 4DV7E 4JI6I 4DR6E 1NHIA 2UUAE 1Z5AA 2A2DA 2HKEA 2UUBI 2UU9I 1DARA 4ZVIA 1Z5CA 1PIEA 5IWAE 4DV3I 1ZM2A 2LJPA 5LMNI 1HNZE 5FLXC 1Z0TA 4NXME 4DV6I 2R3VA 2BM0A 1FJGE 1PKPA 1N36E 3D4JA 4YHHE 3B82A 4IZJB 1K47A 2BM1A 2Z5BB 3Q6MA 4NXNE 1IBLI 3Q1QA 3LNUA 1FWLA 4DU8A 2ZBKB 2GS8A 1N32I 4JV5I 4DV0I 4DV2I 1J5EI 4HY1A 3WU5A 1XNRI 2CZ9A 2HHHE 4YY3I 2V34A 2Z5CA 5A2QQ 4DU7A 4N3OA 4KHPE 4DUYE 2ZITA 1N0UA 2F4VI 3HJCA 4LFBI 2PNMA 2HK3A 1XMOI 1Z0CA 4DR3I 4JI0E 3Q6NA 3ZZ0A 2OI2A 4JI8E 2V2QA 2V2VA 1Z0GA 4FWGA 3HULA 4JI2E 1H72C 3P06A 2HFUA 4LFAI 4DV7I 4UT4A 3V2UC 1XMQE 5IT9C 2UXBE 1Y4UA 1Z59A 4JI3E 4PU9A 1HNZI 5LMUE 3JAMC 1HNXE 4NXMI 1H7SA 1NHJA 4DPYA 1FJGI 4B3ME 1ZXMA 1MX0A 4DPWA 1N36I 3K1JA 4YHHI 4FN5A 5L3JA 1ZXNA 5GMDA 4ED4A 4WUDA 2VQEE 1KVKA 4UTGA 1Z0BA 2O1UA 4LF8E 1XNQE 1N33I 2DEIA 1Z5BA 4LF4E 2GQ0A 3GONA 4PRVA 4LF7I 2EFGA 2HHHI 4DPXA 2IOPA 1Z0EA 4EMDA 2AJ4A 4USMA 4X64E 4DUYI 2O1WA 1EA6A 1UEKA 1IBME 4WUCA 1HNWE 1N0VC 4GKJI 3PYFA 4JI0I 4JI8I 2R42A 2X36A 4MYUA 4FWDA 1Z0VA 4DR5I 4HACA 2DEJA 1HR0E 4JYAE 4OX9E 3J7AM 1QZRA 4DR2I 1N34I 4RPFA 1Y6ZA 4I3HA 1FWKA 1XMQI 3J80C 2UXBI 3T1YE 1FI4A 3V5RA 4LFCE 1HNXI 5BR8E 2J7KA 2HK2A 4B3TI 4B3MI 1I94I 1KKHA 2UXCE 1ZM4A 3ZKDA 4LF9E 1FKAE 1NHHA 3PYEA 2VQEI 4B3RE 3ZZTA 3OTOI 4DR4I 2XEXA 4LF8I 1XNQI 3QT7A 3M6AA 4R1FA 1EI1A 4JI5E 4AQYE 4X62E 4JI1I 4Z7CA 1FNMA 2PNLA 1NZ0A 4DV1I 3K17A 4X64I 4KQVA 4DR6I 1IBMI 4USKA 4IZKA 2UUAI 2V8PA 1WUUA 4Z7YA 5IWAI 2UUCE 5LMNE 4DR7E 4DPUA 3K85A 1HR0I 4JYAI 4OX9I 4PRXA 1VISA 4DV5E 2CGEA 4NXNI 4JI7E 4DR1E 4IZJD 3T1YI 3B8HA 1RREA 2Z5CB 4DPTA 4LFCI 4DUZE 4DV0E 5GMEA 1J5EE 4B3SE 4IZJA 4K0KE 2UXCI 4P52A 2Z5BA 1MU5A 1KIJA 1ELOA 4X66E 5FLXQ 4YY3E 4X65E 4B3RI 4P7AA 4KHPI 2UXDE 3PRYA 2CG9A 3WU3A 1S4EA 4LFBE 2VQFE 4GKKE 4JI5I 4AQYI 2IOQA 4URLA 3J80Q 4DV4E 3ZKBA 4LF6E 4M1KA 2VF3A 3QT6A 2HKJA 1USUA 2Z5EA 4JI2I 2ZM6E 3T1HE 4LFAE 1S16A 4DXLA 3LTOA 3PYDA 2O1VA 2UUCI 4JI3I 1B63A 5LMUI 4DR7I 3J81C 2A2CA 2E1RA 2V2ZA 4WUBA 5LL6R 4DV5I 1B62A 4JI7I 4DR1I 1ZM9A 2X7IA 3F0NA 1USVA 1N33E 4XTJA 1D6TA 4DUZI 4B3SI 4LF4I 2E5LE 1BKNA 4K0KI 1XHKA 4LF7E 5IT9Q 1IBKE 4X66I 1Y4SA 3JAMQ 4LF5E 1KTVA 4X65I 3WU4A 4JI4E 2Q2EB 2UXDI 4HACB 1H74A 1OJ4A 1ZM3A 4JI6E 1HNWI 3QT5A 2VQFI 2UUBE 4GKKI 2UU9E 4GKJE 3ZZUA 1U2RA 4DV4I 4LF6I 1PVGA 4JG4A 4DV3E 4HYMA 3WU6A 2HFSA 1Z0WA 4DV6E 4DR5E 5A2QC 2BV3A 4HXZA 3CWVA 2ZM6I 3T1HI 1RR9A 4DR2E 3ZM7A 1N34E 2WW4A 1H7UA 1IBLE 2O1TA 1A6FA 1H73A 3PYGA 1N32E 4JV5E 5BR8I 4DV2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B B;  2Z5E A;  2Z5C B; 
#chains in the Genus database with same CATH topology
 4B3T E;  1XNR E;  2PO1 A;  1I94 E;  5FWK A;  1HK7 A;  4LF9 I;  3OTO E;  4DR4 E;  4LOM A;  1OYR A;  4MYT A;  2C38 A;  4FWH A;  3M7N G;  3J7A G;  2NPF A;  2F4V E;  4FW9 A;  3B78 A;  2E5L I;  1XMO E;  5C0X E;  4DR3 E;  4IZK B;  4X62 I;  4JI1 E;  1IBK I;  1VI7 A;  1MG7 A;  2VES A;  4DV1 E;  4LF5 I;  3J81 Q;  2JEA B;  3QT8 A;  4JI4 I;  3H4L A;  3P3E A;  3LPS A;  4DV7 E;  4JI6 I;  2BA1 D;  4GQU A;  4DR6 E;  4IFD F;  1NHI A;  2UUA E;  1Z5A A;  2A2D A;  2HKE A;  2UUB I;  2UU9 I;  1DAR A;  4ZVI A;  1Z5C A;  1PIE A;  5IWA E;  4DV3 I;  1ZM2 A;  2LJP A;  5LMN I;  1HNZ E;  5FLX C;  1Z0T A;  4NXM E;  4DV6 I;  2IES A;  2R3V A;  2BM0 A;  4NBQ A;  4OO1 A;  1FJG E;  1PKP A;  1N36 E;  3D4J A;  4QNJ A;  4YHH E;  3B82 A;  4IZJ B;  4U3B A;  1K47 A;  2BM1 A;  4LCG A;  1XXE A;  2Z5B B;  3Q6M A;  4NXN E;  1IBL I;  3Q1Q A;  4OO1 C;  3LNU A;  4LCH A;  1FWL A;  4J3D A;  2C39 A;  4DU8 A;  2ZBK B;  2GS8 A;  1N32 I;  4MU0 A;  4JV5 I;  5JEA D;  4DV0 I;  4DV2 I;  1J5E I;  2JEB B;  4HY1 A;  3WU5 A;  1XNR I;  5DNL A;  3GCM A;  2CZ9 A;  2O3Z A;  5JEA A;  5C0X C;  2HHH E;  1UDQ A;  5DRR A;  4YY3 I;  3CDJ A;  2V34 A;  2Z5C A;  5A2Q Q;  2JE6 B;  4DU7 A;  4N3O A;  4KHP E;  4DUY E;  4ISA A;  2ZIT A;  1N0U A;  2F4V I;  2BA1 G;  3HJC A;  4LFB I;  2PNM A;  2HK3 A;  1XMO I;  1Y5Y A;  1Z0C A;  4DR3 I;  2GO4 A;  4JI0 E;  3Q6N A;  2OI2 A;  4JI8 E;  3ZZ0 A;  2V2Q A;  2V2V A;  1Z0G A;  4FWG A;  3PS2 A;  3HUL A;  4JI2 E;  5EL9 A;  1H72 C;  3P06 A;  5K36 D;  2CVE A;  2HFU A;  4DV7 I;  4LFA I;  4OO1 B;  4UT4 A;  4MU4 A;  3V2U C;  1RHY A;  5K36 A;  1XMQ E;  5IT9 C;  2UXB E;  1Y4U A;  1Z59 A;  2GO3 A;  2J65 A;  4JI3 E;  4PU9 A;  1HNZ I;  5LMU E;  4IFD D;  3JAM C;  1HNX E;  4NXM I;  1H7S A;  5C0X F;  1NHJ A;  5C0X B;  4DPY A;  1FJG I;  4B3M E;  1ZXM A;  1MX0 A;  5K36 C;  4DPW A;  1N36 I;  3K1J A;  4YHH I;  4IFD A;  4FN5 A;  5L3J A;  2F1D A;  1ZXN A;  5GMD A;  4OO1 E;  4ED4 A;  3U1Y A;  4MQY A;  4WUD A;  2VQE E;  1KVK A;  4UTG A;  4OZE A;  1Z0B A;  2PNZ B;  2O1U A;  4LF8 E;  1XNQ E;  1N33 I;  1R6L A;  2DEI A;  1Z5B A;  4LF4 E;  2GQ0 A;  3GON A;  4PRV A;  4LF7 I;  2EFG A;  1UDN A;  2HHH I;  4DPX A;  2IOP A;  3L7Z A;  4FW7 A;  1Z0E A;  4EMD A;  2PO2 A;  2AJ4 A;  2AE8 A;  2NN6 D;  3PS3 A;  5JEA E;  4USM A;  4X64 E;  4DUY I;  2O1W A;  1EA6 A;  1UEK A;  3PS1 A;  1IBM E;  2NN6 A;  4WUC A;  1HNW E;  1N0V C;  4GKJ I;  4AM3 A;  3PYF A;  4JI0 I;  4JI8 I;  2R42 A;  2X36 A;  4MYU A;  4FWD A;  1Z0V A;  2NN6 C;  2PO0 A;  4HAC A;  4DR5 I;  2DEJ A;  1HR0 E;  4JYA E;  4BA2 A;  4OX9 E;  3J7A M;  1QZR A;  4DR2 I;  1N34 I;  2PO1 B;  1E3H A;  4RPF A;  1Y6Z A;  4I3H A;  1FWK A;  1XMQ I;  3J80 C;  2UXB I;  2BR2 A;  3T1Y E;  1FI4 A;  3V5R A;  4LFC E;  5K36 E;  1HNX I;  2J7K A;  2HK2 A;  5BR8 E;  2C38 B;  4B3T I;  3P76 A;  4B3M I;  2BA0 D;  1I94 I;  1KKH A;  2UXC E;  1ZM4 A;  3ZKD A;  4LF9 E;  3P3C A;  2C37 A;  1FKA E;  1NHH A;  3PYE A;  3HKM A;  5DRQ A;  2VQE I;  4B3R E;  4IFD E;  3ZZT A;  3OTO I;  4DR4 I;  3L7Z B;  2XEX A;  3GME A;  3P3G A;  4LF8 I;  1XNQ I;  1E3P A;  5JEA C;  3QT7 A;  3M6A A;  4R1F A;  4BA1 A;  1EI1 A;  4JI5 E;  4AQY E;  4X62 E;  4JI1 I;  5DNX A;  4Z7C A;  1FNM A;  2PNL A;  1NZ0 A;  4DV1 I;  3K17 A;  4X64 I;  4KQV A;  4OO1 F;  3M7N D;  5ELW A;  4DR6 I;  1IBM I;  4USK A;  4IZK A;  2UUA I;  2V8P A;  1WUU A;  4Z7Y A;  5IWA I;  2NN6 E;  2UUC E;  5LMN E;  4DR7 E;  1R6M A;  4DPU A;  2C39 B;  4MU3 A;  3K85 A;  1HR0 I;  4JYA I;  4OX9 I;  4PRX A;  1VIS A;  4DV5 E;  2CGE A;  5EKW A;  4NXN I;  4JI7 E;  5JEA F;  5JEA B;  4DR1 E;  1UDO A;  4IZJ D;  3T1Y I;  3B8H A;  1RRE A;  2Z5C B;  4IFD C;  4DPT A;  4LCF A;  4QNK A;  4LFC I;  4DUZ E;  4DV0 E;  5GME A;  1J5E E;  4B3S E;  4IZJ A;  4K0K E;  2UXC I;  4BA1 B;  4LPF A;  4P52 A;  2Z5B A;  1MU5 A;  1KIJ A;  1ELO A;  4X66 E;  5FLX Q;  4YY3 E;  4X65 E;  4B3R I;  4P7A A;  4KHP I;  2UXD E;  1OYP A;  3PRY A;  4FW3 A;  2CG9 A;  2JEB A;  3UHM A;  3WU3 A;  1S4E A;  1YH8 A;  4LFB E;  2VQF E;  4GKK E;  4JI5 I;  4AQY I;  3B4T A;  2IOQ A;  1OYS A;  4URL A;  3J80 Q;  4DV4 E;  3ZKB A;  4LF6 E;  4M1K A;  2VF3 A;  4IS9 A;  5K36 F;  3QT6 A;  5K36 B;  2HKJ A;  2JE6 A;  1USU A;  5DRO A;  2Z5E A;  4JI2 I;  2ZM6 E;  3T1H E;  4MDT A;  4LFA E;  1P42 A;  1S16 A;  4IFD B;  4DXL A;  3LTO A;  3PYD A;  3M85 D;  2O1V A;  4OO1 D;  2UUC I;  2WP8 A;  4JI3 I;  1B63 A;  5LMU I;  4DR7 I;  3J81 C;  2A2C A;  2E1R A;  2V2Z A;  2WNR A;  4OKG A;  4WUB A;  5LL6 R;  3GLL A;  4DV5 I;  1B62 A;  5C0X D;  4JI7 I;  4DR1 I;  4AID A;  1ZM9 A;  2X7I A;  2PO2 B;  3F0N A;  3DD6 A;  5C0X A;  1USV A;  1N33 E;  1Y60 A;  4XTJ A;  1D6T A;  4DUZ I;  4B3S I;  4LF4 I;  2E5L E;  1BKN A;  4K0K I;  1XHK A;  4FW5 A;  4LF7 E;  2NN6 F;  2NN6 B;  5IT9 Q;  1IBK E;  4X66 I;  4FW6 A;  1Y4S A;  3JAM Q;  2PNZ A;  1KTV A;  4X65 I;  3NZK A;  4LF5 E;  3WU4 A;  4JI4 E;  2Q2E B;  2UXD I;  2PO0 B;  4HAC B;  5DRP A;  1YHC A;  1H74 A;  1OJ4 A;  1ZM3 A;  4MU1 A;  4AIM A;  4JI6 E;  4BA2 B;  1HNW I;  3QT5 A;  2VQF I;  2UUB E;  4GKK I;  2UU9 E;  2JT2 A;  4GKJ E;  3M85 G;  3ZZU A;  1U2R A;  3CDI A;  3H1C A;  4DV4 I;  4LF6 I;  1PVG A;  4JG4 A;  4DV3 E;  3KRN A;  4HYM A;  3U1K A;  3WU6 A;  2HFS A;  2IER A;  2JEA A;  2BR2 B;  1Z0W A;  2WP8 B;  4DV6 E;  4DR5 E;  5A2Q C;  2BV3 A;  4HXZ A;  2BA0 G;  3CWV A;  2ZM6 I;  3T1H I;  4FW4 A;  1RR9 A;  4U3D A;  4DR2 E;  3ZM7 A;  1N34 E;  2WW4 A;  2WNR B;  1H7U A;  1IBL E;  1UDS A;  2C37 B;  2O1T A;  1A6F A;  1H73 A;  3PYG A;  1N32 E;  4JV5 E;  5BR8 I;  4DV2 E; 
#chains in the Genus database with same CATH homology
 4B3T E;  1XNR E;  1I94 E;  5FWK A;  1HK7 A;  4LF9 I;  3OTO E;  4DR4 E;  4MYT A;  4FWH A;  3J7A G;  2NPF A;  2F4V E;  4FW9 A;  3B78 A;  2E5L I;  1XMO E;  4DR3 E;  4IZK B;  4X62 I;  4JI1 E;  1IBK I;  1MG7 A;  4DV1 E;  4LF5 I;  3J81 Q;  3QT8 A;  4JI4 I;  3H4L A;  3LPS A;  4DV7 E;  4JI6 I;  4DR6 E;  1NHI A;  2UUA E;  1Z5A A;  2A2D A;  2HKE A;  2UUB I;  2UU9 I;  1DAR A;  4ZVI A;  1Z5C A;  1PIE A;  5IWA E;  4DV3 I;  1ZM2 A;  2LJP A;  5LMN I;  1HNZ E;  5FLX C;  1Z0T A;  4NXM E;  4DV6 I;  2R3V A;  2BM0 A;  1FJG E;  1PKP A;  1N36 E;  3D4J A;  4YHH E;  3B82 A;  4IZJ B;  1K47 A;  2BM1 A;  2Z5B B;  3Q6M A;  4NXN E;  1IBL I;  3Q1Q A;  3LNU A;  1FWL A;  4DU8 A;  2ZBK B;  2GS8 A;  1N32 I;  4JV5 I;  4DV0 I;  4DV2 I;  1J5E I;  4HY1 A;  3WU5 A;  1XNR I;  2CZ9 A;  2HHH E;  4YY3 I;  2V34 A;  2Z5C A;  5A2Q Q;  4DU7 A;  4N3O A;  4KHP E;  4DUY E;  2ZIT A;  1N0U A;  2F4V I;  3HJC A;  4LFB I;  2PNM A;  2HK3 A;  1XMO I;  1Z0C A;  4DR3 I;  4JI0 E;  3Q6N A;  3ZZ0 A;  2OI2 A;  4JI8 E;  2V2Q A;  2V2V A;  1Z0G A;  4FWG A;  3HUL A;  4JI2 E;  1H72 C;  3P06 A;  2HFU A;  4LFA I;  4DV7 I;  4UT4 A;  3V2U C;  1XMQ E;  5IT9 C;  2UXB E;  1Y4U A;  1Z59 A;  4JI3 E;  4PU9 A;  1HNZ I;  5LMU E;  3JAM C;  1HNX E;  4NXM I;  1H7S A;  1NHJ A;  4DPY A;  1FJG I;  4B3M E;  1ZXM A;  1MX0 A;  4DPW A;  1N36 I;  3K1J A;  4YHH I;  4FN5 A;  5L3J A;  1ZXN A;  5GMD A;  4ED4 A;  4WUD A;  2VQE E;  1KVK A;  4UTG A;  1Z0B A;  2O1U A;  4LF8 E;  1XNQ E;  1N33 I;  2DEI A;  1Z5B A;  4LF4 E;  2GQ0 A;  3GON A;  4PRV A;  4LF7 I;  2EFG A;  2HHH I;  4DPX A;  2IOP A;  1Z0E A;  4EMD A;  2AJ4 A;  4USM A;  4X64 E;  4DUY I;  2O1W A;  1EA6 A;  1UEK A;  1IBM E;  4WUC A;  1HNW E;  1N0V C;  4GKJ I;  3PYF A;  4JI0 I;  4JI8 I;  2R42 A;  2X36 A;  4MYU A;  4FWD A;  1Z0V A;  4DR5 I;  4HAC A;  2DEJ A;  1HR0 E;  4JYA E;  4OX9 E;  3J7A M;  1QZR A;  4DR2 I;  1N34 I;  4RPF A;  1Y6Z A;  4I3H A;  1FWK A;  1XMQ I;  3J80 C;  2UXB I;  3T1Y E;  1FI4 A;  3V5R A;  4LFC E;  1HNX I;  5BR8 E;  2J7K A;  2HK2 A;  4B3T I;  4B3M I;  1I94 I;  1KKH A;  2UXC E;  1ZM4 A;  3ZKD A;  4LF9 E;  1FKA E;  1NHH A;  3PYE A;  2VQE I;  4B3R E;  3ZZT A;  3OTO I;  4DR4 I;  2XEX A;  4LF8 I;  1XNQ I;  3QT7 A;  3M6A A;  4R1F A;  1EI1 A;  4JI5 E;  4AQY E;  4X62 E;  4JI1 I;  4Z7C A;  1FNM A;  2PNL A;  1NZ0 A;  4DV1 I;  3K17 A;  4X64 I;  4KQV A;  4DR6 I;  1IBM I;  4USK A;  4IZK A;  2UUA I;  2V8P A;  1WUU A;  4Z7Y A;  5IWA I;  2UUC E;  5LMN E;  4DR7 E;  4DPU A;  3K85 A;  1HR0 I;  4JYA I;  4OX9 I;  4PRX A;  1VIS A;  4DV5 E;  2CGE A;  4NXN I;  4JI7 E;  4DR1 E;  4IZJ D;  3T1Y I;  3B8H A;  1RRE A;  2Z5C B;  4DPT A;  4LFC I;  4DUZ E;  4DV0 E;  5GME A;  1J5E E;  4B3S E;  4IZJ A;  4K0K E;  2UXC I;  4P52 A;  2Z5B A;  1MU5 A;  1KIJ A;  1ELO A;  4X66 E;  5FLX Q;  4YY3 E;  4X65 E;  4B3R I;  4P7A A;  4KHP I;  2UXD E;  3PRY A;  2CG9 A;  3WU3 A;  1S4E A;  4LFB E;  2VQF E;  4GKK E;  4JI5 I;  4AQY I;  2IOQ A;  4URL A;  3J80 Q;  4DV4 E;  3ZKB A;  4LF6 E;  4M1K A;  2VF3 A;  3QT6 A;  2HKJ A;  1USU A;  2Z5E A;  4JI2 I;  2ZM6 E;  3T1H E;  4LFA E;  1S16 A;  4DXL A;  3LTO A;  3PYD A;  2O1V A;  2UUC I;  4JI3 I;  1B63 A;  5LMU I;  4DR7 I;  3J81 C;  2A2C A;  2E1R A;  2V2Z A;  4WUB A;  5LL6 R;  4DV5 I;  1B62 A;  4JI7 I;  4DR1 I;  1ZM9 A;  2X7I A;  3F0N A;  1USV A;  1N33 E;  4XTJ A;  1D6T A;  4DUZ I;  4B3S I;  4LF4 I;  2E5L E;  1BKN A;  4K0K I;  1XHK A;  4LF7 E;  5IT9 Q;  1IBK E;  4X66 I;  1Y4S A;  3JAM Q;  4LF5 E;  1KTV A;  4X65 I;  3WU4 A;  4JI4 E;  2Q2E B;  2UXD I;  4HAC B;  1H74 A;  1OJ4 A;  1ZM3 A;  4JI6 E;  1HNW I;  3QT5 A;  2VQF I;  2UUB E;  4GKK I;  2UU9 E;  4GKJ E;  3ZZU A;  1U2R A;  4DV4 I;  4LF6 I;  1PVG A;  4JG4 A;  4DV3 E;  4HYM A;  3WU6 A;  2HFS A;  1Z0W A;  4DV6 E;  4DR5 E;  5A2Q C;  2BV3 A;  4HXZ A;  3CWV A;  2ZM6 I;  3T1H I;  1RR9 A;  4DR2 E;  3ZM7 A;  1N34 E;  2WW4 A;  1H7U A;  1IBL E;  2O1T A;  1A6F A;  1H73 A;  3PYG A;  1N32 E;  4JV5 E;  5BR8 I;  4DV2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...