4LF5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf5E02
2RS6A 2ZM6I 2V2QA 2GS8A 2HFSA 2UUBI 4B3TI 4YY3E 3OTOI 1B63A 2LJPA 3QT7A 1Z5CA 1WUUA 4GKKI 4LF9E 1NHJA 1KTVA 1X49A 4USMA 3ZKDA 1DI2A 2V2VA 1PIEA 2A2CA 2L2NA 3LPSA 3ZM7A 5CFFE 4DR6E 4K0KI 1MX0A 1YZ9A 1Z0VA 4DU7A 1Z0EA 4JI2I 4DV7E 4JI7E 1T4LB 3CWVA 1UEKA 4B3MI 1N33E 1N0UA 4X62I 5GMEA 4X66I 2A2DA 1Z0WA 4JI4I 1QU6A 4RPFA 1NZ0A 2HKJA 1FJGI 1HNWE 4UT4A 2IHR1 3WU5A 4LFCI 5FLXC 5A2QC 2ZITA 2NUGA 1J26A 1S4EA 3D4JA 3T1YE 1B62A 1ZM2A 3WU3A 1ZM9A 2F4VE 3OTOE 4B3SE 1XMQI 4LF6E 2B7VA 2HHHI 1ZBTA 4KHPE 1O0WA 4JI1E 1GQEA 1H7UA 2CZ9A 3VYYA 2CPNA 2UXDE 4FW9A 4MYUA 2N3HA 2LUPB 2E1RA 4DUZE 1KVKA 4HACA 3VYXA 2B7TA 1H74A 3Q1QA 4DV6E 1IBKE 4DR3E 4DR6I 3ZZ0A 2VQFE 4JYAE 2Q2EB 4DPWA 1T4NA 4DV7I 2DB2A 4JI7I 4LF8E 1RC7A 1NHHA 1IBLI 3PYEA 1N33I 2BM1A 1YYKA 1S16A 4Z7YA 4JI5E 2UU9I 1WHQA 2DEIA 2R42A 4WFTA 4NXNE 1HNWI 2V34A 4HACB 3J7AM 3ZZTA 2HHHE 5LMNE 3T1YI 1XHKA 2L2MA 3T1HE 1ZM3A 4LF4E 4ED4A 2F4VI 4B3SI 4LF6I 2HK3A 3HTXA 2V8PA 4KHPI 4JI1I 4PU9A 2NA2A 2UXDI 4DR4E 4NXME 3B82A 1HNXE 3LNUA 2ZBKB 4DPUA 3ZKBA 2HKEA 1XNQE 1YYOA 2EZ6A 1Z5AA 4DUZI 4B3RE 3K1JA 4DV6I 1NHIA 1IBKI 4I3HA 4LF5E 4DV3E 1Z0GA 2X36A 1IBLE 4DR3I 4YHHE 2VQFI 4JYAI 1XNRE 2X7IA 2LTSA 1XMOE 3ADLA 4DPXA 1PKPA 1UHZA 4X65E 2BV3A 2L3CA 4DXLA 4DR7E 4LF8I 1VISA 2VF3A 4DPYA 4JI5I 4M1KA 4DKKA 1WHNA 2E5LE 1Z0TA 4X64E 4OX9E 1RR9A 4NXNI 3J80Q 4USKA 1Z59A 2RSMA 5LMNI 4JI6E 1HR0E 1ZM4A 2JVAA 1FKAE 2L3JA 3T1HI 4P52A 2NUFA 4LF4I 3GONA 1RREA 4DV2E 4AQYE 3QT6A 3V2UC 2UXCE 1T4OA 3LLHA 4Z7CA 3JAMQ 2NUEA 5L3JA 4LFBE 3ADJA 2J7KA 4DV5E 4DR4I 4NXMI 3PYFA 1HNXI 1XNQI 1STUA 1FWLA 4ZVIA 3WU4A 4M30A 4DV0E 4B3RI 3J7AG 4FWHA 2LBSB 2DMYA 5LMUE 4LF5I 1QZRA 4WYQB 4DV3I 4YHHI 1XNRI 1EI1A 4LF7I 1XMOI 2BM0A 4X65I 1PVGA 4HY1A 4DR7I 3V5RA 1J5EE 4KQVA 4DR2E 4DUYE 4JV5E 4HXZA 2JY9A 4EMDA 3J81Q 5IT9Q 1KIJA 5LL6R 3J80C 2LTRA 2MDRA 1Z5BA 2E5LI 4X64I 4DV4E 4OX9I 1FNMA 4PRXA 1FI4A 3PYGA 4MYTA 3ADGA 4DR5I 3QT8A 2LJHA 4JI6I 1HR0I 4GKJE 5BR8E 1N32E 1ELOA 5IWAE 2UXBE 2L33A 4PRVA 2RS7A 4DV2I 1MG7A 4AQYI 1FWKA 1N36E 2VQEE 1EKZA 3HULA 3JAMC 2UXCI 4JI8E 4OOGC 3C4BA 1YYWA 2OI2A 4FN5A 4LFBI 1U2RA 2EFGA 1Z0CA 4XTJA 4DV5I 2B3TB 2LUQA 4DR1E 1BKNA 1RQ0A 1ZXMA 1H7SA 4LF7E 3B78A 4WUDA 4DU8A 2N3GA 4DV0I 1X48A 4DV1E 4JI3I 5LMUI 4M2ZA 3ZZUA 4LFAE 1UILA 1A6FA 1HNZE 3P1XA 3PYDA 4R1FA 1N34E 3H4LA 4JI0I 2UUCI 4WUBA 1I94E 3J81C 1IBME 2XEXA 4DR5E 5IT9C 1J5EI 2DIXA 4DR2I 4DUYI 4JV5I 2NPFA 1H73A 2UU9E 2UUAE 2ZM6E 4FWGA 3C4TA 4DV4I 4P7AA 2UUBE 2HFUA 4B3TE 1H72C 4GKJI 5BR8I 1N32I 3B8HA 5IWAI 2KHXA 4GKKE 2UXBI 3WU6A 4FWDA 4UTGA 1N36I 2VQEI 1MU5A 4JI8I 3ADIA 4YY3I 1EA6A 3M6AA 1K47A 4HYMA 4K0KE 4JI3E 4LF9I 1KKHA 4JI2E 4X8WA 4DR1I 1DARA 2LRSA 4B3ME 3QT5A 2WW4A 4URLA 4X62E 2RTXA 4X66E 4JI0E 2UUCE 4JI4E 2HK2A 4DV1I 4DPTA 1N0VC 4LFAI 1FJGE 1D6TA 1X47A 4JG4A 3K17A 1ZXNA 4LFCE 1HNZI 3F0NA 1Z0BA 1OJ4A 2YT4A 1N34I 5FLXQ 2AJ4A 5A2QQ 1I94I 1IBMI 5GMDA 2R3VA 2DEJA 2L2KB 2V2ZA 3J7Yp 1XMQE 3LTOA 2UUAI 4WUCA
chains in the Genus database with same CATH superfamily
2DMIA 2RS6A 2ZM6I 1USUA 1BBOA 4KWYA 3THOB 5EL9A 1A1KA 2V2QA 2YRHA 5C0XF 1R6MA 2GS8A 2HFSA 2JT2A 4MU3A 4KZSA 2UUBI 2BBGA 3KRNA 4TUIA 1JK2A 4B3TI 2R76A 2DRPA 4YY3E 3OTOI 1B63A 2LJPA 2VE7C 3UHMA 3QT7A 2RQLA 1Z5CA 2EMIA 4BMJA 1Z1BA 1WUUA 4GKKI 2EOHA 2BR2A 4LF9E 1NHJA 4IFDE 3DD6A 1KTVA 3QG5C 2YTPA 2MC5A 1X5WA 4WUBA 1X49A 2MKDA 2EMXA 3ZKDA 4USMA 1DI2A 2V2VA 2EPCA 1PIEA 4L5NC 5A6BA 5C0XC 4TUGA 2EM4A 2L2NA 2WBTA 1PDAA 2A2CA 3LPSA 3ZM7A 5CFFE 5JEAB 2KONA 4DR6E 3P06A 4K0KI 1MX0A 1YZ9A 1Z0VA 1PJTA 4DU7A 2EOSA 3TQMA 1Z0EA 2ADRA 4JI2I 4O43A 4JI7E 4DV7E 1T4LB 1MEYC 3BF2A 2PO0A 3CWVA 4IZJD 4NBQA 5ELWA 3M85D 2EPLX 5C0XA 3ECRA 1UEKA 1EH7A 2EMWA 3EQ1A 4B3MI 1X6FA 1N33E 1N0UA 4X62I 5GMEA 4BHCA 1A1FA 4X66I 2O3ZA 2F8BA 1IQSA 3FIGA 2A2DA 1Z0WA 4JI4I 2BR2B 1QU6A 4RPFA 1NZ0A 4F54A 2V86A 2HKJA 1FJGI 2GQ0A 5AASA 2JOXA 1HNWE 4UT4A 2IHR1 3L7ZA 3WU5A 4LFCI 4IZKA 5FLXC 5A2QC 2ZITA 1JK1A 2N8XA 2NUGA 1J26A 2O1UA 1S4EA 3D4JA 3T1YE 1UDNA 2EPZA 4IS1C 1B62A 1ZM2A 2EM9A 3WU3A 4P78A 5DRRA 1ZM9A 1PJQA 2F4VE 3OTOE 2PO0B 1OYSA 4B3SE 1XMQI 4LF6E 2EJ4A 5C0XB 2B7VA 2DLQA 1YUJA 2GO3A 4Q28A 4MDTA 2HHHI 1ZBTA 4WPYA 2JEBA 2EN8A 2EMKA 4FW3A 2M7QA 4KHPE 2LVHA 1O0WA 4JI1E 3THNA 2PNMA 5JEAE 1TF6A 5K36C 4N4RB 1GQEA 1H7UA 2CZ9A 2ELYA 2ENHA 3VYYA 2CPNA 3JTZA 4BHBA 2UXDE 4FW9A 4MYUA 2IESA 2K4VA 4GQUA 2N3HA 4IZKB 4I8OA 2EN3A 2LUPB 2WCC3 2E1RA 1NCSA 2EL5A 1EH8A 4DMIA 4DUZE 1KVKA 4HACA 3VYXA 2B7TA 2L8TA 1H74A 4DV6E 4QNKA 1IBKE 2C37A 3Q1QA 3K6QA 1SR9A 4BS9A 5A6AA 1Y4UA 4DR3E 4GZNC 2JOBA 3Q6MA 2EOXA 2WZOA 2JR1A 1KJKA 3ZZ0A 4DR6I 2VQFE 2EMLA 5KL3A 1KYQA 2EOZA 5A6BD 4JYAE 4MLQA 2Q2EB 4IS9A 4DPWA 2EOMA 1N3GA 2JEBB 1T4NA 1IMUA 4DV7I 2DB2A 2M9AA 4JI7I 3HQ1A 5KL5A 4LF8E 3VK6A 5AC5A 1RC7A 2ENAA 3MSWA 4R2QA 1Y4SA 2EMCA 2IERA 1NHHA 1IBLI 3PYEA 1N33I 2BM1A 2O1WA 4NZVA 4BA1A 2EM5A 1YYKA 1S16A 4Z7YA 3OMLA 4JI5E 1G2DC 5C0XE 4R2PA 2UU9I 3F6HA 4QNJA 1WHQA 2DEIA 2R42A 1VI7A 4WFTA 4NXNE 2EMAA 3LMLA 1HNWI 3IWCA 3CDJA 2V34A 4HACB 3J7AM 1E3PA 2C37B 3ZZTA 4OZEA 4RHBB 3C6KA 2HHHE 5LMNE 2C38A 2WP8A 3T1YI 1XHKA 5AE3A 2V8QB 3L00A 2L2MA 2LMZA 3U1KA 2EPMX 3T1HE 2LO3A 1ZM3A 3P3GA 3HPSA 1BBGA 4LF4E 4ED4A 2F4VI 1NEIA 2CGEA 4B3SI 4LF6I 2JYAA 2GHFA 2HK3A 2EMFA 3HTXA 2EMZA 2M4IA 5FWKA 2YTIA 3C6MA 4R2EA 2V8PA 1UDOA 4O4KA 4F2JC 4BA1B 4KHPI 2L92A 4OO1C 4N3OA 4JI1I 3BBGA 4PU9A 3GCMA 4O24A 2NA2A 3EPLA 2H36X 2Z5CA 4LOMA 5A69A 2FTXB 3DF6A 5KL6A 5KL7A 5DNLA 4R2DA 2EOQA 2YTGA 2UXDI 4DR4E 4NXME 3B82A 1F2IG 4Q35B 1HNXE 2ZBKB 3LNUA 4DPUA 3ZKBA 2YSPA 2HKEA 1XNQE 1YYOA 2EZ6A 1UDSA 2C38B 2WP8B 1Z5AA 1WXRA 1Y60A 5KL4A 1OYPA 4DUZI 4B3RE 3PS2A 2J7JA 2EE8A 2MDGA 1A1GA 3M7NG 3MHSC 3K1JA 1DQ3A 1NHIA 3ZOQB 2PNLA 4I3HA 1DGCA 1XXEA 4LF5E 4DV6I 1IBKI 3NZKA 4J8ZA 4DV3E 3BGHA 1Z0GA 2X36A 1IBLE 4DR3I 5K36D 1OYRA 4YHHE 4MU0A 2EOOA 2VQFI 4WX9A 4JYAI 1XNRE 2X7IA 2LTSA 2V85A 1WJPA 1XMOE 3ADLA 4DPXA 1PKPA 1UHZA 4X65E 1UN6B 2BV3A 2L3CA 4DXLA 4DR7E 4LF8I 2EOFA 2IOQA 3P76A 2Z5CB 1UDQA 1SFEA 2DSYA 2YRKA 3EPHA 1VISA 2VF3A 4DPYA 2G7HA 4BBYA 1UBDC 4M9VC 5K36F 4LPFA 2KOUA 5DRQA 3AUZA 4AIDA 4M1KA 4JI5I 4DKKA 1WHNA 2EPKX 2E5LE 2VF1A 1YPNA 1Z0TA 4X64E 4R2RA 3KZZA 1AH5A 4OX9E 5IV8B 1RR9A 4NXNI 5IXMB 3U1YA 3J80Q 4USKA 1X6HA 3H09A 1Z59A 1GZ6A 1HK7A 4IFDC 2RSMA 5LMNI 4JI6E 1HR0E 5A6KA 1ZM4A 2JVAA 2EQ0A 1FKAE 3VHTB 2L3JA 2PNZA 2E1MA 3T1HI 4P52A 1A1HA 2NN6D 2NUFA 1WRJA 3K85A 4LF4I 3GONA 2HGHA 2O1TA 1RREA 1X3CA 2GPIA 4ZYGA 4DV2E 4AQYE 2MKNA 3QT6A 3L7ZB 3V2UC 2UXCE 3KWRA 1T4OA 2EL6A 3EPKA 2FV4B 3LLHA 2YTJA 2AE8A 4Z7CA 3JAMQ 1RMDA 2CT1A 2D9HA 1TF3A 1YUIA 2NUEA 4LFBE 5AC4A 3LTOA 3ADJA 4MU4A 5L3JA 5K36A 2NN6F 2EQ1A 2YTQA 1GTKA 2J7KA 2J65A 1PJSA 2EPPA 4DV5E 2BB8A 3MHHC 5T6JA 4DR4I 4ZYDA 4NXMI 3PYFA 2HJJA 4F6NA 1HNXI 4IJDA 2Q8UA 2C39A 3Q6NA 1XNQI 4AM3A 1STUA 1FWLA 5KL2A 4ZVIA 2EN1A 5DRPA 4M30A 1ZR9A 4DV0E 4FW7A 3WU4A 2MC6A 4B3RI 2YU5A 2PNZB 4WXCA 3J7AG 4F9BB 4FWHA 2LBSB 2DMYA 2EOEA 5LMUE 4LF5I 1QZRA 4WYQB 3M7ND 2PO2A 4BA2A 4OO1D 4DV3I 2EOJA 4R03A 2NN6C 2JP9A 2EPOA 3RMPA 4YHHI 2YTEA 3GMEA 2RPCA 1EI1A 1XNRI 4LF7I 2K7IA 1XMOI 2BM0A 2WNRA 1PVGA 4X65I 2HC5A 4HY1A 4HEIA 4DR7I 5K36B 3JU0A 4ZYEA 2JWOA 3DJWA 3V5RA 2Z5EA 3HJCA 4LU9A 4OO1F 2EMHA 1J5EE 2NN6A 1G2FC 4DR2E 4KQVA 4OKGA 4DUYE 2JPAA 1YFHA 4JV5E 4HXZA 5DROA 1QNTA 2JY9A 4EMDA 3J81Q 3M99B 5JEAC 2C39B 3HPZA 5IT9Q 5LL6R 1KIJA 4J3DA 3J80C 2EN7A 3IWDA 2LTRA 2MDRA 1Z5BA 2E5LI 1P42A 4X64I 4DV4E 4OX9I 1FNMA 4PRXA 1FI4A 1MGTA 3PYGA 2NABA 4F9AB 4MYTA 3ADGA 4DR5I 3QT8A 2ENCA 2ELZA 2PO2B 4BA2B 2LJHA 1Y6ZA 4JI6I 1HR0I 2YU8A 5DNYA 4GKJE 5BR8E 1A1IA 2EPRA 1N32E 2ODRD 3P3EA 1ELOA 2LE2A 5IWAE 4R2AA 2UXBE 1Y5YA 2L33A 2WNRB 2RS7A 4PRVA 4DV2I 1MG7A 4AQYI 1FWKA 1N36E 2VQEE 1EKZA 3JAMC 3HULA 2UXCI 4JI8E 2NN6B 1BB8A 2YRMA 4OOGC 1YHCA 4OO1A 2V89A 3C4BA 1YYWA 2OI2A 4BCAA 4FN5A 2I9IA 2DGCA 4IFDD 4LFBI 1U2RA 4FW6A 2EMYA 2EFGA 2JE6A 4MLVA 2PRTA 4L8NA 1Z0CA 2BA1G 2O1VA 1ZBQA 4XTJA 4ISAA 2EWLA 4LCFA 2EPXA 2YZTA 4DV5I 2B3TB 2LUQA 2R1FA 3IWBA 4DR1E 2IOPA 3GLLA 1BKNA 2GO4A 2M1SA 5K36E 1RQ0A 1ZXMA 3H1CA 5F3WA 2PO1A 3B4TA 1H7SA 4LF7E 3B78A 4WUDA 2DLKA 2N3GA 4DU8A 4DV0I 1X48A 1R6LA 1X6EA 2BA0G 4IFDF 5TSEA 2EN6A 1T38A 4DV1E 4JI3I 4X9JA 5LMUI 4M2ZA 3ZZUA 4LFAE 1UILA 2ODRC 1T39A 1A6FA 2LT7A 3EPJA 1HNZE 1ZU1A 3F6GA 2EM7A 2V87A 3P1XA 1LLMC 4ZYHA 3PYDA 4OO1B 4R1FA 1N34E 3H4LA 2EM3A 3PS3A 4U3BA 4JI0I 2UUCI 2LV2A 2EOYA 2JE6B 1I94E 3J81C 3BIDA 2E72A 1IBME 2EP3A 2XEXA 2A25A 4DR5E 5IT9C 1J5EI 2DIXA 4DR2I 5DNXA 4DUYI 4JV5I 2YWQA 2EORA 2NPFA 1H73A 4F6MA 2UU9E 2UUAE 4WXDA 2GLIA 2ZM6E 4FWGA 2PO1B 1TN9A 3C4TA 3UK3C 2CG9A 2NN6E 4DV4I 4FW4A 4R2CA 4MQYA 4U3DA 4LTYA 4P7AA 4F9CB 5ADZA 2UUBE 2HFUA 2YTFA 4IFDA 4B3TE 4WSGA 2EL4A 1H72C 4MU1A 5AE1A 2YTNA 1B69A 5EKWA 2EPNA 4GKJI 5BR8I 1N32I 3B8HA 4R8OA 5IWAI 4LCHA 2KHXA 2VRDA 3KZYA 4GKKE 2F1DA 2UXBI 3WU6A 2EPAA 4HTGA 4P7DA 5JEAD 4GEQB 4FK5C 1USVA 1EH6A 1P47A 4FWDA 3P3CA 1AAYA 4UTGA 2YTDA 2VQEI 2YPNA 1YSAC 1MU5A 3HKMA 1N36I 4JI8I 4R2SA 3ADIA 4YY3I 1EA6A 2VESA 2LJUA 2Z5BA 2V83A 3M6AA 1ZAAC 2EOIA 1K47A 2EM6A 4IZJA 2CTDA 4K0KE 4HYMA 2JEAA 2RSIA 4FW5A 4JI3E 4LF9I 3AV0A 2EN4A 1KKHA 3M85G 5A6JA 1A1JA 4NHRA 2EMGA 5JEAF 4JI2E 2BA1D 4WSPA 2L6MA 4OO1E 4X8WA 4DR1I 2FGGA 2EMBA 4IFDB 1DARA 2LRSA 1A1LA 4O5GA 4B3ME 2EPUA 2EM0A 1L4SA 3QT5A 2V88A 2WW4A 4URLA 4X62E 1IQOA 2RTXA 4X66E 2CSHA 2LCEA 4JI0E 2EM8A 2UUCE 4JI4E 2HK2A 4DV1I 4DPTA 3CDIA 2EN2A 2BA0D 1N0VC 1E3HA 4LFAI 4RH8A 2WBUA 1FJGE 1D6TA 2EM2A 2YTOA 3K17A 4JG4A 4BC9A 1ZXNA 4LFCE 1HNZI 3F0NA 1Z0BA 1OJ4A 2Z5BB 4LCGA 5AE2A 2JXPA 2CVEA 2EQ3A 2YT4A 1YH8A 4IZJB 3PS1A 2AJ4A 5A2QQ 3HXLA 5FLXQ 5C0XD 4AIMA 1N34I 2JEAB 1I94I 2WBSA 1IBMI 5GMDA 2R3VA 3PRYA 2I13A 4M0VA 1RHYA 2DEJA 2L2KB 2V2ZA 2YSOA 3J7Yp 2B9DA 5JEAA 1XMQE 1X47A 2UUAI 4BC7A 5LLQA 4WUCA
chains in the Genus database with same CATH topology
2RS6A 2ZM6I 1USUA 2V2QA 2GS8A 2HFSA 4KZSA 2UUBI 4TUIA 4B3TI 4YY3E 3OTOI 1B63A 2LJPA 2VE7C 3QT7A 1Z5CA 4BMJA 1WUUA 4GKKI 4LF9E 1NHJA 1KTVA 2MC5A 1X49A 4USMA 3ZKDA 1DI2A 2V2VA 1PIEA 4L5NC 4TUGA 2A2CA 2L2NA 3LPSA 3ZM7A 5CFFE 2KONA 4DR6E 3P06A 4K0KI 1MX0A 1YZ9A 1Z0VA 4DU7A 1Z0EA 4JI2I 4DV7E 4JI7E 1T4LB 3CWVA 4IZJD 1UEKA 4B3MI 1N33E 1N0UA 4X62I 5GMEA 4X66I 2F8BA 3FIGA 2A2DA 1Z0WA 4JI4I 1QU6A 4RPFA 1NZ0A 4F54A 2V86A 2HKJA 1FJGI 2GQ0A 5AASA 2JOXA 1HNWE 4UT4A 2IHR1 3WU5A 4LFCI 4IZKA 5FLXC 5A2QC 2ZITA 2NUGA 1J26A 2O1UA 1S4EA 3D4JA 3T1YE 1B62A 1ZM2A 3WU3A 4P78A 1ZM9A 2F4VE 3OTOE 4B3SE 1XMQI 4LF6E 2B7VA 4Q28A 2HHHI 1ZBTA 4WPYA 2M7QA 4KHPE 1O0WA 4JI1E 2PNMA 1GQEA 1H7UA 2CZ9A 3VYYA 2CPNA 3JTZA 2UXDE 4FW9A 4MYUA 2K4VA 2N3HA 4IZKB 4I8OA 2LUPB 2E1RA 4DMIA 4DUZE 1KVKA 4HACA 3VYXA 2B7TA 2L8TA 1H74A 4DV6E 3Q1QA 1IBKE 3K6QA 1SR9A 4BS9A 1Y4UA 4DR3E 2JOBA 3Q6MA 2WZOA 3ZZ0A 2JR1A 4DR6I 2VQFE 4JYAE 2Q2EB 4DPWA 1T4NA 4DV7I 2DB2A 4JI7I 3HQ1A 4LF8E 3VK6A 1RC7A 3MSWA 1Y4SA 1NHHA 1IBLI 3PYEA 1N33I 2BM1A 2O1WA 1YYKA 1S16A 4Z7YA 3OMLA 4JI5E 2UU9I 3F6HA 1WHQA 2DEIA 2R42A 4WFTA 4NXNE 3LMLA 1HNWI 3IWCA 2V34A 4HACB 3J7AM 3ZZTA 2HHHE 5LMNE 3T1YI 1XHKA 5AE3A 2V8QB 2L2MA 2LMZA 3T1HE 1ZM3A 3HPSA 4LF4E 4ED4A 2F4VI 2CGEA 4B3SI 4LF6I 2HK3A 3HTXA 2M4IA 5FWKA 2V8PA 4KHPI 2L92A 4N3OA 4JI1I 4PU9A 2NA2A 2H36X 2Z5CA 2FTXB 3DF6A 2UXDI 4DR4E 4NXME 3B82A 1HNXE 3LNUA 2ZBKB 4DPUA 3ZKBA 2HKEA 1XNQE 1YYOA 2EZ6A 1Z5AA 1WXRA 4DUZI 4B3RE 3K1JA 1DQ3A 1NHIA 3ZOQB 2PNLA 4I3HA 4DV6I 1IBKI 4LF5E 4J8ZA 4DV3E 1Z0GA 2X36A 1IBLE 4DR3I 4YHHE 2VQFI 4JYAI 1XNRE 2X7IA 2LTSA 2V85A 1XMOE 3ADLA 4DPXA 1PKPA 1UHZA 4X65E 2BV3A 2L3CA 4DXLA 4DR7E 4LF8I 2IOQA 2Z5CB 2DSYA 1VISA 2VF3A 4DPYA 2G7HA 4BBYA 2KOUA 3AUZA 4JI5I 4M1KA 4DKKA 1WHNA 2E5LE 2VF1A 1Z0TA 4X64E 4OX9E 1RR9A 4NXNI 3J80Q 4USKA 3H09A 1Z59A 1GZ6A 1HK7A 2RSMA 5LMNI 4JI6E 1HR0E 1ZM4A 2JVAA 1FKAE 2L3JA 2E1MA 3T1HI 4P52A 3K85A 2NUFA 4LF4I 3GONA 2O1TA 1RREA 4DV2E 4AQYE 3QT6A 3V2UC 2UXCE 3KWRA 1T4OA 2FV4B 3LLHA 4Z7CA 3JAMQ 2NUEA 5L3JA 4LFBE 3LTOA 3ADJA 2J7KA 4DV5E 5T6JA 4DR4I 4NXMI 3PYFA 1HNXI 3Q6NA 1XNQI 1STUA 1FWLA 4ZVIA 3WU4A 4M30A 4DV0E 2MC6A 4B3RI 3J7AG 4F9BB 4FWHA 2LBSB 2DMYA 5LMUE 4LF5I 1QZRA 4WYQB 4DV3I 4R03A 3RMPA 4YHHI 1XNRI 1EI1A 4LF7I 1XMOI 2BM0A 4X65I 1PVGA 4HY1A 4DR7I 3JU0A 2JWOA 3DJWA 3V5RA 2Z5EA 3HJCA 4LU9A 1J5EE 4KQVA 4DR2E 4DUYE 4JV5E 4HXZA 2JY9A 4EMDA 3J81Q 3HPZA 5IT9Q 5LL6R 1KIJA 3J80C 3IWDA 2LTRA 2MDRA 1Z5BA 2E5LI 4X64I 4DV4E 4OX9I 1FNMA 4PRXA 1FI4A 3PYGA 4F9AB 4MYTA 3ADGA 4DR5I 3QT8A 2LJHA 1Y6ZA 4JI6I 1HR0I 5DNYA 4GKJE 5BR8E 1N32E 2ODRD 1ELOA 2LE2A 5IWAE 2UXBE 2L33A 4PRVA 2RS7A 4DV2I 1MG7A 4AQYI 1FWKA 1N36E 2VQEE 1EKZA 3JAMC 3HULA 2UXCI 4JI8E 4OOGC 2V89A 3C4BA 1YYWA 2OI2A 4BCAA 4FN5A 4LFBI 1U2RA 2EFGA 2O1VA 4L8NA 1Z0CA 1ZBQA 4XTJA 2EWLA 2YZTA 4DV5I 2B3TB 2LUQA 3IWBA 4DR1E 2IOPA 1BKNA 2M1SA 1RQ0A 1ZXMA 5F3WA 1H7SA 4LF7E 3B78A 4WUDA 4DU8A 2N3GA 4DV0I 1X48A 4DV1E 4JI3I 5LMUI 4M2ZA 3ZZUA 4LFAE 1UILA 2ODRC 1A6FA 1HNZE 3F6GA 2V87A 3P1XA 3PYDA 4R1FA 1N34E 3H4LA 4JI0I 2UUCI 4WUBA 1I94E 3J81C 1IBME 2XEXA 4DR5E 5IT9C 1J5EI 2DIXA 4DR2I 4DUYI 4JV5I 2NPFA 1H73A 2UU9E 2UUAE 2ZM6E 4FWGA 3C4TA 2CG9A 4DV4I 4LTYA 4P7AA 4F9CB 5ADZA 2UUBE 2HFUA 4B3TE 1H72C 5AE1A 4GKJI 5BR8I 1N32I 3B8HA 4R8OA 5IWAI 2KHXA 4GKKE 2UXBI 3WU6A 4P7DA 4GEQB 1USVA 4FWDA 4UTGA 1N36I 2VQEI 1MU5A 4JI8I 3ADIA 4YY3I 1EA6A 2Z5BA 2V83A 3M6AA 1K47A 4IZJA 4HYMA 4K0KE 4JI3E 4LF9I 3AV0A 1KKHA 4JI2E 4WSPA 2L6MA 4X8WA 4DR1I 2FGGA 1DARA 2LRSA 4B3ME 3QT5A 2V88A 2WW4A 4URLA 4X62E 2RTXA 4X66E 4JI0E 2UUCE 4JI4E 2HK2A 4DV1I 4DPTA 1N0VC 4LFAI 1FJGE 1D6TA 3K17A 4JG4A 4BC9A 1ZXNA 4LFCE 1HNZI 3F0NA 1Z0BA 1OJ4A 2Z5BB 5AE2A 2YT4A 4IZJB 1N34I 5FLXQ 2AJ4A 5A2QQ 3HXLA 1I94I 1IBMI 5GMDA 2R3VA 3PRYA 4M0VA 2DEJA 2L2KB 2V2ZA 3J7Yp 2B9DA 1XMQE 1X47A 2UUAI 4BC7A 4WUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS6 A;  2ZM6 I;  2V2Q A;  2GS8 A;  2HFS A;  2UUB I;  4B3T I;  4YY3 E;  3OTO I;  1B63 A;  2LJP A;  3QT7 A;  1Z5C A;  1WUU A;  4GKK I;  4LF9 E;  1NHJ A;  1KTV A;  1X49 A;  4USM A;  3ZKD A;  1DI2 A;  2V2V A;  1PIE A;  2A2C A;  2L2N A;  3LPS A;  3ZM7 A;  5CFF E;  4DR6 E;  4K0K I;  1MX0 A;  1YZ9 A;  1Z0V A;  4DU7 A;  1Z0E A;  4JI2 I;  4DV7 E;  4JI7 E;  1T4L B;  3CWV A;  1UEK A;  4B3M I;  1N33 E;  1N0U A;  4X62 I;  5GME A;  4X66 I;  2A2D A;  1Z0W A;  4JI4 I;  1QU6 A;  4RPF A;  1NZ0 A;  2HKJ A;  1FJG I;  1HNW E;  4UT4 A;  2IHR 1;  3WU5 A;  4LFC I;  5FLX C;  5A2Q C;  2ZIT A;  2NUG A;  1J26 A;  1S4E A;  3D4J A;  3T1Y E;  1B62 A;  1ZM2 A;  3WU3 A;  1ZM9 A;  2F4V E;  3OTO E;  4B3S E;  1XMQ I;  4LF6 E;  2B7V A;  2HHH I;  1ZBT A;  4KHP E;  1O0W A;  4JI1 E;  1GQE A;  1H7U A;  2CZ9 A;  3VYY A;  2CPN A;  2UXD E;  4FW9 A;  4MYU A;  2N3H A;  2LUP B;  2E1R A;  4DUZ E;  1KVK A;  4HAC A;  3VYX A;  2B7T A;  1H74 A;  3Q1Q A;  4DV6 E;  1IBK E;  4DR3 E;  4DR6 I;  3ZZ0 A;  2VQF E;  4JYA E;  2Q2E B;  4DPW A;  1T4N A;  4DV7 I;  2DB2 A;  4JI7 I;  4LF8 E;  1RC7 A;  1NHH A;  1IBL I;  3PYE A;  1N33 I;  2BM1 A;  1YYK A;  1S16 A;  4Z7Y A;  4JI5 E;  2UU9 I;  1WHQ A;  2DEI A;  2R42 A;  4WFT A;  4NXN E;  1HNW I;  2V34 A;  4HAC B;  3J7A M;  3ZZT A;  2HHH E;  5LMN E;  3T1Y I;  1XHK A;  2L2M A;  3T1H E;  1ZM3 A;  4LF4 E;  4ED4 A;  2F4V I;  4B3S I;  4LF6 I;  2HK3 A;  3HTX A;  2V8P A;  4KHP I;  4JI1 I;  4PU9 A;  2NA2 A;  2UXD I;  4DR4 E;  4NXM E;  3B82 A;  1HNX E;  3LNU A;  2ZBK B;  4DPU A;  3ZKB A;  2HKE A;  1XNQ E;  1YYO A;  2EZ6 A;  1Z5A A;  4DUZ I;  4B3R E;  3K1J A;  4DV6 I;  1NHI A;  1IBK I;  4I3H A;  4LF5 E;  4DV3 E;  1Z0G A;  2X36 A;  1IBL E;  4DR3 I;  4YHH E;  2VQF I;  4JYA I;  1XNR E;  2X7I A;  2LTS A;  1XMO E;  3ADL A;  4DPX A;  1PKP A;  1UHZ A;  4X65 E;  2BV3 A;  2L3C A;  4DXL A;  4DR7 E;  4LF8 I;  1VIS A;  2VF3 A;  4DPY A;  4JI5 I;  4M1K A;  4DKK A;  1WHN A;  2E5L E;  1Z0T A;  4X64 E;  4OX9 E;  1RR9 A;  4NXN I;  3J80 Q;  4USK A;  1Z59 A;  2RSM A;  5LMN I;  4JI6 E;  1HR0 E;  1ZM4 A;  2JVA A;  1FKA E;  2L3J A;  3T1H I;  4P52 A;  2NUF A;  4LF4 I;  3GON A;  1RRE A;  4DV2 E;  4AQY E;  3QT6 A;  3V2U C;  2UXC E;  1T4O A;  3LLH A;  4Z7C A;  3JAM Q;  2NUE A;  5L3J A;  4LFB E;  3ADJ A;  2J7K A;  4DV5 E;  4DR4 I;  4NXM I;  3PYF A;  1HNX I;  1XNQ I;  1STU A;  1FWL A;  4ZVI A;  3WU4 A;  4M30 A;  4DV0 E;  4B3R I;  3J7A G;  4FWH A;  2LBS B;  2DMY A;  5LMU E;  4LF5 I;  1QZR A;  4WYQ B;  4DV3 I;  4YHH I;  1XNR I;  1EI1 A;  4LF7 I;  1XMO I;  2BM0 A;  4X65 I;  1PVG A;  4HY1 A;  4DR7 I;  3V5R A;  1J5E E;  4KQV A;  4DR2 E;  4DUY E;  4JV5 E;  4HXZ A;  2JY9 A;  4EMD A;  3J81 Q;  5IT9 Q;  1KIJ A;  5LL6 R;  3J80 C;  2LTR A;  2MDR A;  1Z5B A;  2E5L I;  4X64 I;  4DV4 E;  4OX9 I;  1FNM A;  4PRX A;  1FI4 A;  3PYG A;  4MYT A;  3ADG A;  4DR5 I;  3QT8 A;  2LJH A;  4JI6 I;  1HR0 I;  4GKJ E;  5BR8 E;  1N32 E;  1ELO A;  5IWA E;  2UXB E;  2L33 A;  4PRV A;  2RS7 A;  4DV2 I;  1MG7 A;  4AQY I;  1FWK A;  1N36 E;  2VQE E;  1EKZ A;  3HUL A;  3JAM C;  2UXC I;  4JI8 E;  4OOG C;  3C4B A;  1YYW A;  2OI2 A;  4FN5 A;  4LFB I;  1U2R A;  2EFG A;  1Z0C A;  4XTJ A;  4DV5 I;  2B3T B;  2LUQ A;  4DR1 E;  1BKN A;  1RQ0 A;  1ZXM A;  1H7S A;  4LF7 E;  3B78 A;  4WUD A;  4DU8 A;  2N3G A;  4DV0 I;  1X48 A;  4DV1 E;  4JI3 I;  5LMU I;  4M2Z A;  3ZZU A;  4LFA E;  1UIL A;  1A6F A;  1HNZ E;  3P1X A;  3PYD A;  4R1F A;  1N34 E;  3H4L A;  4JI0 I;  2UUC I;  4WUB A;  1I94 E;  3J81 C;  1IBM E;  2XEX A;  4DR5 E;  5IT9 C;  1J5E I;  2DIX A;  4DR2 I;  4DUY I;  4JV5 I;  2NPF A;  1H73 A;  2UU9 E;  2UUA E;  2ZM6 E;  4FWG A;  3C4T A;  4DV4 I;  4P7A A;  2UUB E;  2HFU A;  4B3T E;  1H72 C;  4GKJ I;  5BR8 I;  1N32 I;  3B8H A;  5IWA I;  2KHX A;  4GKK E;  2UXB I;  3WU6 A;  4FWD A;  4UTG A;  1N36 I;  2VQE I;  1MU5 A;  4JI8 I;  3ADI A;  4YY3 I;  1EA6 A;  3M6A A;  1K47 A;  4HYM A;  4K0K E;  4JI3 E;  4LF9 I;  1KKH A;  4JI2 E;  4X8W A;  4DR1 I;  1DAR A;  2LRS A;  4B3M E;  3QT5 A;  2WW4 A;  4URL A;  4X62 E;  2RTX A;  4X66 E;  4JI0 E;  2UUC E;  4JI4 E;  2HK2 A;  4DV1 I;  4DPT A;  1N0V C;  4LFA I;  1FJG E;  1D6T A;  1X47 A;  4JG4 A;  3K17 A;  1ZXN A;  4LFC E;  1HNZ I;  3F0N A;  1Z0B A;  1OJ4 A;  2YT4 A;  1N34 I;  5FLX Q;  2AJ4 A;  5A2Q Q;  1I94 I;  1IBM I;  5GMD A;  2R3V A;  2DEJ A;  2L2K B;  2V2Z A;  3J7Y p;  1XMQ E;  3LTO A;  2UUA I;  4WUC A; 
#chains in the Genus database with same CATH topology
 2DMI A;  2RS6 A;  2ZM6 I;  1USU A;  1BBO A;  4KWY A;  3THO B;  5EL9 A;  1A1K A;  2V2Q A;  2YRH A;  5C0X F;  1R6M A;  2GS8 A;  2HFS A;  2JT2 A;  4MU3 A;  4KZS A;  2UUB I;  2BBG A;  3KRN A;  4TUI A;  1JK2 A;  4B3T I;  2R76 A;  2DRP A;  4YY3 E;  3OTO I;  1B63 A;  2LJP A;  2VE7 C;  3UHM A;  3QT7 A;  2RQL A;  1Z5C A;  2EMI A;  4BMJ A;  1Z1B A;  1WUU A;  4GKK I;  2EOH A;  2BR2 A;  4LF9 E;  1NHJ A;  4IFD E;  3DD6 A;  1KTV A;  3QG5 C;  2YTP A;  2MC5 A;  1X5W A;  4WUB A;  1X49 A;  2MKD A;  2EMX A;  3ZKD A;  4USM A;  1DI2 A;  2V2V A;  2EPC A;  1PIE A;  4L5N C;  5A6B A;  5C0X C;  4TUG A;  2EM4 A;  2L2N A;  2WBT A;  1PDA A;  2A2C A;  3LPS A;  3ZM7 A;  5CFF E;  5JEA B;  2KON A;  4DR6 E;  3P06 A;  4K0K I;  1MX0 A;  1YZ9 A;  1Z0V A;  1PJT A;  4DU7 A;  2EOS A;  3TQM A;  1Z0E A;  2ADR A;  4JI2 I;  4O43 A;  4JI7 E;  4DV7 E;  1T4L B;  1MEY C;  3BF2 A;  2PO0 A;  3CWV A;  4IZJ D;  4NBQ A;  5ELW A;  3M85 D;  2EPL X;  5C0X A;  3ECR A;  1UEK A;  1EH7 A;  2EMW A;  3EQ1 A;  4B3M I;  1X6F A;  1N33 E;  1N0U A;  4X62 I;  5GME A;  4BHC A;  1A1F A;  4X66 I;  2O3Z A;  2F8B A;  1IQS A;  3FIG A;  2A2D A;  1Z0W A;  4JI4 I;  2BR2 B;  1QU6 A;  4RPF A;  1NZ0 A;  4F54 A;  2V86 A;  2HKJ A;  1FJG I;  2GQ0 A;  5AAS A;  2JOX A;  1HNW E;  4UT4 A;  2IHR 1;  3L7Z A;  3WU5 A;  4LFC I;  4IZK A;  5FLX C;  5A2Q C;  2ZIT A;  1JK1 A;  2N8X A;  2NUG A;  1J26 A;  2O1U A;  1S4E A;  3D4J A;  3T1Y E;  1UDN A;  2EPZ A;  4IS1 C;  1B62 A;  1ZM2 A;  2EM9 A;  3WU3 A;  4P78 A;  5DRR A;  1ZM9 A;  1PJQ A;  2F4V E;  3OTO E;  2PO0 B;  1OYS A;  4B3S E;  1XMQ I;  4LF6 E;  2EJ4 A;  5C0X B;  2B7V A;  2DLQ A;  1YUJ A;  2GO3 A;  4Q28 A;  4MDT A;  2HHH I;  1ZBT A;  4WPY A;  2JEB A;  2EN8 A;  2EMK A;  4FW3 A;  2M7Q A;  4KHP E;  2LVH A;  1O0W A;  4JI1 E;  3THN A;  2PNM A;  5JEA E;  1TF6 A;  5K36 C;  4N4R B;  1GQE A;  1H7U A;  2CZ9 A;  2ELY A;  2ENH A;  3VYY A;  2CPN A;  3JTZ A;  4BHB A;  2UXD E;  4FW9 A;  4MYU A;  2IES A;  2K4V A;  4GQU A;  2N3H A;  4IZK B;  4I8O A;  2EN3 A;  2LUP B;  2WCC 3;  2E1R A;  1NCS A;  2EL5 A;  1EH8 A;  4DMI A;  4DUZ E;  1KVK A;  4HAC A;  3VYX A;  2B7T A;  2L8T A;  1H74 A;  4DV6 E;  4QNK A;  1IBK E;  2C37 A;  3Q1Q A;  3K6Q A;  1SR9 A;  4BS9 A;  5A6A A;  1Y4U A;  4DR3 E;  4GZN C;  2JOB A;  3Q6M A;  2EOX A;  2WZO A;  2JR1 A;  1KJK A;  3ZZ0 A;  4DR6 I;  2VQF E;  2EML A;  5KL3 A;  1KYQ A;  2EOZ A;  5A6B D;  4JYA E;  4MLQ A;  2Q2E B;  4IS9 A;  4DPW A;  2EOM A;  1N3G A;  2JEB B;  1T4N A;  1IMU A;  4DV7 I;  2DB2 A;  2M9A A;  4JI7 I;  3HQ1 A;  5KL5 A;  4LF8 E;  3VK6 A;  5AC5 A;  1RC7 A;  2ENA A;  3MSW A;  4R2Q A;  1Y4S A;  2EMC A;  2IER A;  1NHH A;  1IBL I;  3PYE A;  1N33 I;  2BM1 A;  2O1W A;  4NZV A;  4BA1 A;  2EM5 A;  1YYK A;  1S16 A;  4Z7Y A;  3OML A;  4JI5 E;  1G2D C;  5C0X E;  4R2P A;  2UU9 I;  3F6H A;  4QNJ A;  1WHQ A;  2DEI A;  2R42 A;  1VI7 A;  4WFT A;  4NXN E;  2EMA A;  3LML A;  1HNW I;  3IWC A;  3CDJ A;  2V34 A;  4HAC B;  3J7A M;  1E3P A;  2C37 B;  3ZZT A;  4OZE A;  4RHB B;  3C6K A;  2HHH E;  5LMN E;  2C38 A;  2WP8 A;  3T1Y I;  1XHK A;  5AE3 A;  2V8Q B;  3L00 A;  2L2M A;  2LMZ A;  3U1K A;  2EPM X;  3T1H E;  2LO3 A;  1ZM3 A;  3P3G A;  3HPS A;  1BBG A;  4LF4 E;  4ED4 A;  2F4V I;  1NEI A;  2CGE A;  4B3S I;  4LF6 I;  2JYA A;  2GHF A;  2HK3 A;  2EMF A;  3HTX A;  2EMZ A;  2M4I A;  5FWK A;  2YTI A;  3C6M A;  4R2E A;  2V8P A;  1UDO A;  4O4K A;  4F2J C;  4BA1 B;  4KHP I;  2L92 A;  4OO1 C;  4N3O A;  4JI1 I;  3BBG A;  4PU9 A;  3GCM A;  4O24 A;  2NA2 A;  3EPL A;  2H36 X;  2Z5C A;  4LOM A;  5A69 A;  2FTX B;  3DF6 A;  5KL6 A;  5KL7 A;  5DNL A;  4R2D A;  2EOQ A;  2YTG A;  2UXD I;  4DR4 E;  4NXM E;  3B82 A;  1F2I G;  4Q35 B;  1HNX E;  2ZBK B;  3LNU A;  4DPU A;  3ZKB A;  2YSP A;  2HKE A;  1XNQ E;  1YYO A;  2EZ6 A;  1UDS A;  2C38 B;  2WP8 B;  1Z5A A;  1WXR A;  1Y60 A;  5KL4 A;  1OYP A;  4DUZ I;  4B3R E;  3PS2 A;  2J7J A;  2EE8 A;  2MDG A;  1A1G A;  3M7N G;  3MHS C;  3K1J A;  1DQ3 A;  1NHI A;  3ZOQ B;  2PNL A;  4I3H A;  1DGC A;  1XXE A;  4LF5 E;  4DV6 I;  1IBK I;  3NZK A;  4J8Z A;  4DV3 E;  3BGH A;  1Z0G A;  2X36 A;  1IBL E;  4DR3 I;  5K36 D;  1OYR A;  4YHH E;  4MU0 A;  2EOO A;  2VQF I;  4WX9 A;  4JYA I;  1XNR E;  2X7I A;  2LTS A;  2V85 A;  1WJP A;  1XMO E;  3ADL A;  4DPX A;  1PKP A;  1UHZ A;  4X65 E;  1UN6 B;  2BV3 A;  2L3C A;  4DXL A;  4DR7 E;  4LF8 I;  2EOF A;  2IOQ A;  3P76 A;  2Z5C B;  1UDQ A;  1SFE A;  2DSY A;  2YRK A;  3EPH A;  1VIS A;  2VF3 A;  4DPY A;  2G7H A;  4BBY A;  1UBD C;  4M9V C;  5K36 F;  4LPF A;  2KOU A;  5DRQ A;  3AUZ A;  4AID A;  4M1K A;  4JI5 I;  4DKK A;  1WHN A;  2EPK X;  2E5L E;  2VF1 A;  1YPN A;  1Z0T A;  4X64 E;  4R2R A;  3KZZ A;  1AH5 A;  4OX9 E;  5IV8 B;  1RR9 A;  4NXN I;  5IXM B;  3U1Y A;  3J80 Q;  4USK A;  1X6H A;  3H09 A;  1Z59 A;  1GZ6 A;  1HK7 A;  4IFD C;  2RSM A;  5LMN I;  4JI6 E;  1HR0 E;  5A6K A;  1ZM4 A;  2JVA A;  2EQ0 A;  1FKA E;  3VHT B;  2L3J A;  2PNZ A;  2E1M A;  3T1H I;  4P52 A;  1A1H A;  2NN6 D;  2NUF A;  1WRJ A;  3K85 A;  4LF4 I;  3GON A;  2HGH A;  2O1T A;  1RRE A;  1X3C A;  2GPI A;  4ZYG A;  4DV2 E;  4AQY E;  2MKN A;  3QT6 A;  3L7Z B;  3V2U C;  2UXC E;  3KWR A;  1T4O A;  2EL6 A;  3EPK A;  2FV4 B;  3LLH A;  2YTJ A;  2AE8 A;  4Z7C A;  3JAM Q;  1RMD A;  2CT1 A;  2D9H A;  1TF3 A;  1YUI A;  2NUE A;  4LFB E;  5AC4 A;  3LTO A;  3ADJ A;  4MU4 A;  5L3J A;  5K36 A;  2NN6 F;  2EQ1 A;  2YTQ A;  1GTK A;  2J7K A;  2J65 A;  1PJS A;  2EPP A;  4DV5 E;  2BB8 A;  3MHH C;  5T6J A;  4DR4 I;  4ZYD A;  4NXM I;  3PYF A;  2HJJ A;  4F6N A;  1HNX I;  4IJD A;  2Q8U A;  2C39 A;  3Q6N A;  1XNQ I;  4AM3 A;  1STU A;  1FWL A;  5KL2 A;  4ZVI A;  2EN1 A;  5DRP A;  4M30 A;  1ZR9 A;  4DV0 E;  4FW7 A;  3WU4 A;  2MC6 A;  4B3R I;  2YU5 A;  2PNZ B;  4WXC A;  3J7A G;  4F9B B;  4FWH A;  2LBS B;  2DMY A;  2EOE A;  5LMU E;  4LF5 I;  1QZR A;  4WYQ B;  3M7N D;  2PO2 A;  4BA2 A;  4OO1 D;  4DV3 I;  2EOJ A;  4R03 A;  2NN6 C;  2JP9 A;  2EPO A;  3RMP A;  4YHH I;  2YTE A;  3GME A;  2RPC A;  1EI1 A;  1XNR I;  4LF7 I;  2K7I A;  1XMO I;  2BM0 A;  2WNR A;  1PVG A;  4X65 I;  2HC5 A;  4HY1 A;  4HEI A;  4DR7 I;  5K36 B;  3JU0 A;  4ZYE A;  2JWO A;  3DJW A;  3V5R A;  2Z5E A;  3HJC A;  4LU9 A;  4OO1 F;  2EMH A;  1J5E E;  2NN6 A;  1G2F C;  4DR2 E;  4KQV A;  4OKG A;  4DUY E;  2JPA A;  1YFH A;  4JV5 E;  4HXZ A;  5DRO A;  1QNT A;  2JY9 A;  4EMD A;  3J81 Q;  3M99 B;  5JEA C;  2C39 B;  3HPZ A;  5IT9 Q;  5LL6 R;  1KIJ A;  4J3D A;  3J80 C;  2EN7 A;  3IWD A;  2LTR A;  2MDR A;  1Z5B A;  2E5L I;  1P42 A;  4X64 I;  4DV4 E;  4OX9 I;  1FNM A;  4PRX A;  1FI4 A;  1MGT A;  3PYG A;  2NAB A;  4F9A B;  4MYT A;  3ADG A;  4DR5 I;  3QT8 A;  2ENC A;  2ELZ A;  2PO2 B;  4BA2 B;  2LJH A;  1Y6Z A;  4JI6 I;  1HR0 I;  2YU8 A;  5DNY A;  4GKJ E;  5BR8 E;  1A1I A;  2EPR A;  1N32 E;  2ODR D;  3P3E A;  1ELO A;  2LE2 A;  5IWA E;  4R2A A;  2UXB E;  1Y5Y A;  2L33 A;  2WNR B;  2RS7 A;  4PRV A;  4DV2 I;  1MG7 A;  4AQY I;  1FWK A;  1N36 E;  2VQE E;  1EKZ A;  3JAM C;  3HUL A;  2UXC I;  4JI8 E;  2NN6 B;  1BB8 A;  2YRM A;  4OOG C;  1YHC A;  4OO1 A;  2V89 A;  3C4B A;  1YYW A;  2OI2 A;  4BCA A;  4FN5 A;  2I9I A;  2DGC A;  4IFD D;  4LFB I;  1U2R A;  4FW6 A;  2EMY A;  2EFG A;  2JE6 A;  4MLV A;  2PRT A;  4L8N A;  1Z0C A;  2BA1 G;  2O1V A;  1ZBQ A;  4XTJ A;  4ISA A;  2EWL A;  4LCF A;  2EPX A;  2YZT A;  4DV5 I;  2B3T B;  2LUQ A;  2R1F A;  3IWB A;  4DR1 E;  2IOP A;  3GLL A;  1BKN A;  2GO4 A;  2M1S A;  5K36 E;  1RQ0 A;  1ZXM A;  3H1C A;  5F3W A;  2PO1 A;  3B4T A;  1H7S A;  4LF7 E;  3B78 A;  4WUD A;  2DLK A;  2N3G A;  4DU8 A;  4DV0 I;  1X48 A;  1R6L A;  1X6E A;  2BA0 G;  4IFD F;  5TSE A;  2EN6 A;  1T38 A;  4DV1 E;  4JI3 I;  4X9J A;  5LMU I;  4M2Z A;  3ZZU A;  4LFA E;  1UIL A;  2ODR C;  1T39 A;  1A6F A;  2LT7 A;  3EPJ A;  1HNZ E;  1ZU1 A;  3F6G A;  2EM7 A;  2V87 A;  3P1X A;  1LLM C;  4ZYH A;  3PYD A;  4OO1 B;  4R1F A;  1N34 E;  3H4L A;  2EM3 A;  3PS3 A;  4U3B A;  4JI0 I;  2UUC I;  2LV2 A;  2EOY A;  2JE6 B;  1I94 E;  3J81 C;  3BID A;  2E72 A;  1IBM E;  2EP3 A;  2XEX A;  2A25 A;  4DR5 E;  5IT9 C;  1J5E I;  2DIX A;  4DR2 I;  5DNX A;  4DUY I;  4JV5 I;  2YWQ A;  2EOR A;  2NPF A;  1H73 A;  4F6M A;  2UU9 E;  2UUA E;  4WXD A;  2GLI A;  2ZM6 E;  4FWG A;  2PO1 B;  1TN9 A;  3C4T A;  3UK3 C;  2CG9 A;  2NN6 E;  4DV4 I;  4FW4 A;  4R2C A;  4MQY A;  4U3D A;  4LTY A;  4P7A A;  4F9C B;  5ADZ A;  2UUB E;  2HFU A;  2YTF A;  4IFD A;  4B3T E;  4WSG A;  2EL4 A;  1H72 C;  4MU1 A;  5AE1 A;  2YTN A;  1B69 A;  5EKW A;  2EPN A;  4GKJ I;  5BR8 I;  1N32 I;  3B8H A;  4R8O A;  5IWA I;  4LCH A;  2KHX A;  2VRD A;  3KZY A;  4GKK E;  2F1D A;  2UXB I;  3WU6 A;  2EPA A;  4HTG A;  4P7D A;  5JEA D;  4GEQ B;  4FK5 C;  1USV A;  1EH6 A;  1P47 A;  4FWD A;  3P3C A;  1AAY A;  4UTG A;  2YTD A;  2VQE I;  2YPN A;  1YSA C;  1MU5 A;  3HKM A;  1N36 I;  4JI8 I;  4R2S A;  3ADI A;  4YY3 I;  1EA6 A;  2VES A;  2LJU A;  2Z5B A;  2V83 A;  3M6A A;  1ZAA C;  2EOI A;  1K47 A;  2EM6 A;  4IZJ A;  2CTD A;  4K0K E;  4HYM A;  2JEA A;  2RSI A;  4FW5 A;  4JI3 E;  4LF9 I;  3AV0 A;  2EN4 A;  1KKH A;  3M85 G;  5A6J A;  1A1J A;  4NHR A;  2EMG A;  5JEA F;  4JI2 E;  2BA1 D;  4WSP A;  2L6M A;  4OO1 E;  4X8W A;  4DR1 I;  2FGG A;  2EMB A;  4IFD B;  1DAR A;  2LRS A;  1A1L A;  4O5G A;  4B3M E;  2EPU A;  2EM0 A;  1L4S A;  3QT5 A;  2V88 A;  2WW4 A;  4URL A;  4X62 E;  1IQO A;  2RTX A;  4X66 E;  2CSH A;  2LCE A;  4JI0 E;  2EM8 A;  2UUC E;  4JI4 E;  2HK2 A;  4DV1 I;  4DPT A;  3CDI A;  2EN2 A;  2BA0 D;  1N0V C;  1E3H A;  4LFA I;  4RH8 A;  2WBU A;  1FJG E;  1D6T A;  2EM2 A;  2YTO A;  3K17 A;  4JG4 A;  4BC9 A;  1ZXN A;  4LFC E;  1HNZ I;  3F0N A;  1Z0B A;  1OJ4 A;  2Z5B B;  4LCG A;  5AE2 A;  2JXP A;  2CVE A;  2EQ3 A;  2YT4 A;  1YH8 A;  4IZJ B;  3PS1 A;  2AJ4 A;  5A2Q Q;  3HXL A;  5FLX Q;  5C0X D;  4AIM A;  1N34 I;  2JEA B;  1I94 I;  2WBS A;  1IBM I;  5GMD A;  2R3V A;  3PRY A;  2I13 A;  4M0V A;  1RHY A;  2DEJ A;  2L2K B;  2V2Z A;  2YSO A;  3J7Y p;  2B9D A;  5JEA A;  1XMQ E;  1X47 A;  2UUA I;  4BC7 A;  5LLQ A;  4WUC A; 
#chains in the Genus database with same CATH homology
 2RS6 A;  2ZM6 I;  1USU A;  2V2Q A;  2GS8 A;  2HFS A;  4KZS A;  2UUB I;  4TUI A;  4B3T I;  4YY3 E;  3OTO I;  1B63 A;  2LJP A;  2VE7 C;  3QT7 A;  1Z5C A;  4BMJ A;  1WUU A;  4GKK I;  4LF9 E;  1NHJ A;  1KTV A;  2MC5 A;  1X49 A;  4USM A;  3ZKD A;  1DI2 A;  2V2V A;  1PIE A;  4L5N C;  4TUG A;  2A2C A;  2L2N A;  3LPS A;  3ZM7 A;  5CFF E;  2KON A;  4DR6 E;  3P06 A;  4K0K I;  1MX0 A;  1YZ9 A;  1Z0V A;  4DU7 A;  1Z0E A;  4JI2 I;  4DV7 E;  4JI7 E;  1T4L B;  3CWV A;  4IZJ D;  1UEK A;  4B3M I;  1N33 E;  1N0U A;  4X62 I;  5GME A;  4X66 I;  2F8B A;  3FIG A;  2A2D A;  1Z0W A;  4JI4 I;  1QU6 A;  4RPF A;  1NZ0 A;  4F54 A;  2V86 A;  2HKJ A;  1FJG I;  2GQ0 A;  5AAS A;  2JOX A;  1HNW E;  4UT4 A;  2IHR 1;  3WU5 A;  4LFC I;  4IZK A;  5FLX C;  5A2Q C;  2ZIT A;  2NUG A;  1J26 A;  2O1U A;  1S4E A;  3D4J A;  3T1Y E;  1B62 A;  1ZM2 A;  3WU3 A;  4P78 A;  1ZM9 A;  2F4V E;  3OTO E;  4B3S E;  1XMQ I;  4LF6 E;  2B7V A;  4Q28 A;  2HHH I;  1ZBT A;  4WPY A;  2M7Q A;  4KHP E;  1O0W A;  4JI1 E;  2PNM A;  1GQE A;  1H7U A;  2CZ9 A;  3VYY A;  2CPN A;  3JTZ A;  2UXD E;  4FW9 A;  4MYU A;  2K4V A;  2N3H A;  4IZK B;  4I8O A;  2LUP B;  2E1R A;  4DMI A;  4DUZ E;  1KVK A;  4HAC A;  3VYX A;  2B7T A;  2L8T A;  1H74 A;  4DV6 E;  3Q1Q A;  1IBK E;  3K6Q A;  1SR9 A;  4BS9 A;  1Y4U A;  4DR3 E;  2JOB A;  3Q6M A;  2WZO A;  3ZZ0 A;  2JR1 A;  4DR6 I;  2VQF E;  4JYA E;  2Q2E B;  4DPW A;  1T4N A;  4DV7 I;  2DB2 A;  4JI7 I;  3HQ1 A;  4LF8 E;  3VK6 A;  1RC7 A;  3MSW A;  1Y4S A;  1NHH A;  1IBL I;  3PYE A;  1N33 I;  2BM1 A;  2O1W A;  1YYK A;  1S16 A;  4Z7Y A;  3OML A;  4JI5 E;  2UU9 I;  3F6H A;  1WHQ A;  2DEI A;  2R42 A;  4WFT A;  4NXN E;  3LML A;  1HNW I;  3IWC A;  2V34 A;  4HAC B;  3J7A M;  3ZZT A;  2HHH E;  5LMN E;  3T1Y I;  1XHK A;  5AE3 A;  2V8Q B;  2L2M A;  2LMZ A;  3T1H E;  1ZM3 A;  3HPS A;  4LF4 E;  4ED4 A;  2F4V I;  2CGE A;  4B3S I;  4LF6 I;  2HK3 A;  3HTX A;  2M4I A;  5FWK A;  2V8P A;  4KHP I;  2L92 A;  4N3O A;  4JI1 I;  4PU9 A;  2NA2 A;  2H36 X;  2Z5C A;  2FTX B;  3DF6 A;  2UXD I;  4DR4 E;  4NXM E;  3B82 A;  1HNX E;  3LNU A;  2ZBK B;  4DPU A;  3ZKB A;  2HKE A;  1XNQ E;  1YYO A;  2EZ6 A;  1Z5A A;  1WXR A;  4DUZ I;  4B3R E;  3K1J A;  1DQ3 A;  1NHI A;  3ZOQ B;  2PNL A;  4I3H A;  4DV6 I;  1IBK I;  4LF5 E;  4J8Z A;  4DV3 E;  1Z0G A;  2X36 A;  1IBL E;  4DR3 I;  4YHH E;  2VQF I;  4JYA I;  1XNR E;  2X7I A;  2LTS A;  2V85 A;  1XMO E;  3ADL A;  4DPX A;  1PKP A;  1UHZ A;  4X65 E;  2BV3 A;  2L3C A;  4DXL A;  4DR7 E;  4LF8 I;  2IOQ A;  2Z5C B;  2DSY A;  1VIS A;  2VF3 A;  4DPY A;  2G7H A;  4BBY A;  2KOU A;  3AUZ A;  4JI5 I;  4M1K A;  4DKK A;  1WHN A;  2E5L E;  2VF1 A;  1Z0T A;  4X64 E;  4OX9 E;  1RR9 A;  4NXN I;  3J80 Q;  4USK A;  3H09 A;  1Z59 A;  1GZ6 A;  1HK7 A;  2RSM A;  5LMN I;  4JI6 E;  1HR0 E;  1ZM4 A;  2JVA A;  1FKA E;  2L3J A;  2E1M A;  3T1H I;  4P52 A;  3K85 A;  2NUF A;  4LF4 I;  3GON A;  2O1T A;  1RRE A;  4DV2 E;  4AQY E;  3QT6 A;  3V2U C;  2UXC E;  3KWR A;  1T4O A;  2FV4 B;  3LLH A;  4Z7C A;  3JAM Q;  2NUE A;  5L3J A;  4LFB E;  3LTO A;  3ADJ A;  2J7K A;  4DV5 E;  5T6J A;  4DR4 I;  4NXM I;  3PYF A;  1HNX I;  3Q6N A;  1XNQ I;  1STU A;  1FWL A;  4ZVI A;  3WU4 A;  4M30 A;  4DV0 E;  2MC6 A;  4B3R I;  3J7A G;  4F9B B;  4FWH A;  2LBS B;  2DMY A;  5LMU E;  4LF5 I;  1QZR A;  4WYQ B;  4DV3 I;  4R03 A;  3RMP A;  4YHH I;  1XNR I;  1EI1 A;  4LF7 I;  1XMO I;  2BM0 A;  4X65 I;  1PVG A;  4HY1 A;  4DR7 I;  3JU0 A;  2JWO A;  3DJW A;  3V5R A;  2Z5E A;  3HJC A;  4LU9 A;  1J5E E;  4KQV A;  4DR2 E;  4DUY E;  4JV5 E;  4HXZ A;  2JY9 A;  4EMD A;  3J81 Q;  3HPZ A;  5IT9 Q;  5LL6 R;  1KIJ A;  3J80 C;  3IWD A;  2LTR A;  2MDR A;  1Z5B A;  2E5L I;  4X64 I;  4DV4 E;  4OX9 I;  1FNM A;  4PRX A;  1FI4 A;  3PYG A;  4F9A B;  4MYT A;  3ADG A;  4DR5 I;  3QT8 A;  2LJH A;  1Y6Z A;  4JI6 I;  1HR0 I;  5DNY A;  4GKJ E;  5BR8 E;  1N32 E;  2ODR D;  1ELO A;  2LE2 A;  5IWA E;  2UXB E;  2L33 A;  4PRV A;  2RS7 A;  4DV2 I;  1MG7 A;  4AQY I;  1FWK A;  1N36 E;  2VQE E;  1EKZ A;  3JAM C;  3HUL A;  2UXC I;  4JI8 E;  4OOG C;  2V89 A;  3C4B A;  1YYW A;  2OI2 A;  4BCA A;  4FN5 A;  4LFB I;  1U2R A;  2EFG A;  2O1V A;  4L8N A;  1Z0C A;  1ZBQ A;  4XTJ A;  2EWL A;  2YZT A;  4DV5 I;  2B3T B;  2LUQ A;  3IWB A;  4DR1 E;  2IOP A;  1BKN A;  2M1S A;  1RQ0 A;  1ZXM A;  5F3W A;  1H7S A;  4LF7 E;  3B78 A;  4WUD A;  4DU8 A;  2N3G A;  4DV0 I;  1X48 A;  4DV1 E;  4JI3 I;  5LMU I;  4M2Z A;  3ZZU A;  4LFA E;  1UIL A;  2ODR C;  1A6F A;  1HNZ E;  3F6G A;  2V87 A;  3P1X A;  3PYD A;  4R1F A;  1N34 E;  3H4L A;  4JI0 I;  2UUC I;  4WUB A;  1I94 E;  3J81 C;  1IBM E;  2XEX A;  4DR5 E;  5IT9 C;  1J5E I;  2DIX A;  4DR2 I;  4DUY I;  4JV5 I;  2NPF A;  1H73 A;  2UU9 E;  2UUA E;  2ZM6 E;  4FWG A;  3C4T A;  2CG9 A;  4DV4 I;  4LTY A;  4P7A A;  4F9C B;  5ADZ A;  2UUB E;  2HFU A;  4B3T E;  1H72 C;  5AE1 A;  4GKJ I;  5BR8 I;  1N32 I;  3B8H A;  4R8O A;  5IWA I;  2KHX A;  4GKK E;  2UXB I;  3WU6 A;  4P7D A;  4GEQ B;  1USV A;  4FWD A;  4UTG A;  1N36 I;  2VQE I;  1MU5 A;  4JI8 I;  3ADI A;  4YY3 I;  1EA6 A;  2Z5B A;  2V83 A;  3M6A A;  1K47 A;  4IZJ A;  4HYM A;  4K0K E;  4JI3 E;  4LF9 I;  3AV0 A;  1KKH A;  4JI2 E;  4WSP A;  2L6M A;  4X8W A;  4DR1 I;  2FGG A;  1DAR A;  2LRS A;  4B3M E;  3QT5 A;  2V88 A;  2WW4 A;  4URL A;  4X62 E;  2RTX A;  4X66 E;  4JI0 E;  2UUC E;  4JI4 E;  2HK2 A;  4DV1 I;  4DPT A;  1N0V C;  4LFA I;  1FJG E;  1D6T A;  3K17 A;  4JG4 A;  4BC9 A;  1ZXN A;  4LFC E;  1HNZ I;  3F0N A;  1Z0B A;  1OJ4 A;  2Z5B B;  5AE2 A;  2YT4 A;  4IZJ B;  1N34 I;  5FLX Q;  2AJ4 A;  5A2Q Q;  3HXL A;  1I94 I;  1IBM I;  5GMD A;  2R3V A;  3PRY A;  4M0V A;  2DEJ A;  2L2K B;  2V2Z A;  3J7Y p;  2B9D A;  1XMQ E;  1X47 A;  2UUA I;  4BC7 A;  4WUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...