4LF5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf5E02
4MYTA 2RSMA 5BR8E 2UUAE 4DV3I 1T4LB 1WHNA 1ZXNA 1NZ0A 1HNZE 1XHKA 4WUDA 4JI2I 1N36E 4DV7I 3B78A 1N0UA 4YY3I 4DPUA 2HKEA 4P7AA 2HKJA 4Z7CA 4AQYI 4JI5I 1ZM2A 1N0VC 3QT8A 3QT6A 2E5LE 1S4EA 3ZZ0A 4DUYE 3V2UC 3T1HI 3J80C 2V8PA 4USMA 2B7TA 4DR7I 3T1YE 4LF9I 1XNQI 2UXDE 1Z0EA 1VISA 3ZKBA 1FWKA 4B3SE 4GKKI 2ZM6E 2NA2A 3M6AA 4X64I 2L3JA 5CFFE 4DPXA 2LTSA 1HNXE 4OOGC 2UXBE 1ZM4A 3LNUA 4JI1E 5A2QQ 1EI1A 1Z59A 3PYGA 1KIJA 1H7SA 3OTOE 1IBKE 2LBSB 2LJPA 4HXZA 1DARA 4HY1A 4LFBI 4DV3E 1RC7A 2V2VA 4DR2E 4X65E 1MG7A 1O0WA 4DV7E 1XMOI 2UUBI 4DV2I 2EFGA 5BR8I 4DU7A 1DI2A 2UUAI 4EMDA 3WU4A 4JI5E 3GONA 2EZ6A 1N36I 3WU6A 3J81C 3T1HE 3B8HA 2JY9A 2OI2A 2N3GA 3ADJA 4DR7E 1N34E 2BV3A 1MX0A 2X7IA 1KVKA 2E5LI 2VQFE 3WU3A 4X64E 2HK3A 2N3HA 3C4TA 4DUYI 2DEJA 1H7UA 1Z5BA 3LPSA 3T1YI 5IT9C 4UT4A 2V34A 1I94E 4JI6E 1IBMI 4XTJA 4B3SI 2ZM6I 2DMYA 2UXBI 1YYOA 1EKZA 2HFSA 4LFBE 2HFUA 3J80Q 1K47A 4FWHA 1U2RA 1FJGE 4HYMA 1IBKI 4M2ZA 1XMOE 1XNRE 1XMQI 2ZBKB 3PYEA 2MDRA 3JAMC 4DR2I 4X65I 3LLHA 2F4VE 4I3HA 4NXMI 3D4JA 1X48A 4JG4A 1T4NA 2L33A 1EA6A 3WU5A 2KHXA 2NUFA 5LMNI 4JYAE 3HULA 4URLA 1UHZA 4B3RE 4B3TE 1N34I 3ADIA 1RQ0A 3ADGA 1IBME 4DR3E 4HACB 4FN5A 2VQFI 4KQVA 1Z0BA 1IBLE 2UXCE 2NPFA 2UUCE 3J81Q 2VQEE 4LFAE 1I94I 4X66E 5LL6R 4JI6I 1B63A 1GQEA 2NUEA 4LF6I 2B7VA 1XMQE 3K1JA 3K17A 2L3CA 4DV6I 1FJGI 5IT9Q 1ZBTA 4NXME 1J5EE 1XNRI 4DU8A 4KHPE 2R3VA 1RR9A 5L3JA 4PRVA 2R42A 4HACA 2X36A 4JI0E 4JI3E 4JI7E 1WUUA 2F4VI 1X49A 4DPTA 3F0NA 1HR0I 1D6TA 5LMNE 4JI4I 2BM0A 3H4LA 3VYYA 4DV1I 2BM1A 3B82A 2NUGA 3J7AM 4YHHE 4X8WA 1KTVA 4JI8I 3ADLA 3P1XA 4DUZE 4JV5E 1NHJA 1ZXMA 4R1FA 4JYAI 3VYXA 1FNMA 4LF4E 4B3RI 4B3TI 4MYUA 1ELOA 3Q1QA 4DR3I 4DR1E 2L2NA 5FLXC 4LF6E 2CPNA 2YT4A 1IBLI 5LMUE 1UILA 2DB2A 2UXCI 2UUCI 2VQEI 2CZ9A 4LFAI 4X66I 4DV6E 1ZM9A 1YYKA 2E1RA 3ZKDA 3PYDA 3ZZTA 4DR6E 4DR5I 1NHIA 4K0KI 3LTOA 2A2DA 2UU9E 1HR0E 4DR4I 1J5EI 4JI4E 1BKNA 4KHPI 4DKKA 5GMEA 4DV1E 1OJ4A 4LF5E 1H74A 4JI0I 4JI3I 4JI7I 5IWAE 4JI8E 2LUQA 2LUPB 2IHR1 4M1KA 2HHHE 3QT5A 4RPFA 2DEIA 4DXLA 4LF8E 1FKAE 4YHHI 4X62E 4DV0E 2J7KA 2ZITA 2LTRA 3C4BA 4JV5I 4DUZI 1UEKA 4LF4I 1YYWA 1FI4A 4USKA 2RTXA 4DV4E 3ZM7A 4ZVIA 4DR1I 1H73A 1ZM3A 3V5RA 2WW4A 1Z5AA 5LMUI 1PIEA 1S16A 3QT7A 4GKJI 1N33E 4WFTA 2AJ4A 4DR5E 2VF3A 4K0KE 1HNWI 2V2ZA 4B3MI 1RREA 4OX9E 4LF7I 4LFCI 2A2CA 4DR4E 1FWLA 4DR6I 4DPWA 5FLXQ 4WUCA 2RS6A 4DPYA 4Z7YA 1X47A 4NXNI 2L2KB 2RS7A 4DV5I 2V2QA 1Z5CA 2UU9I 1KKHA 4FW9A 4FWGA 2XEXA 1J26A 1B62A 1WHQA 1YZ9A 4JI2E 1N32I 4LF5I 3J7Yp 4YY3E 2DIXA 2JVAA 5IWAI 3JAMQ 1H72C 4AQYE 2HHHI 1HNZI 1MU5A 4UTGA 5A2QC 2HK2A 4P52A 1PVGA 4LF8I 4X62I 4PU9A 4DV0I 4LF9E 1XNQE 2LRSA 2B3TB 1PKPA 2LJHA 4GKKE 4GKJE 4WYQB 4DV4I 3HTXA 1Z0GA 2GS8A 1Z0TA 1HNWE 4B3ME 1STUA 4LF7E 1NHHA 4LFCE 1Z0WA 3PYFA 4PRXA 2UXDI 1Z0CA 5GMDA 1QU6A 1N33I 4NXNE 4ED4A 2Q2EB 4DV5E 1Z0VA 1HNXI 4OX9I 1A6FA 3CWVA 4JI1I 3J7AG 4FWDA 1T4OA 1QZRA 3OTOI 4WUBA 2L2MA 1N32E 4M30A 2UUBE 4DV2E 3ZZUA
chains in the Genus database with same CATH superfamily
4ZYDA 4MYTA 2RSMA 5BR8E 2UUAE 4DV3I 1T4LB 2DLQA 2JOXA 1WHNA 4LTYA 1ZXNA 1NZ0A 3F6HA 1HNZE 1XHKA 1X6FA 4WUDA 4JI2I 3Q6MA 2EMFA 5LLQA 1N36E 1SR9A 2IOPA 1A1GA 2YRMA 2L6MA 4DV7I 2EOOA 3B78A 1P47A 3KRNA 2YSOA 2PO2B 2EN7A 1N0UA 4YY3I 4DPUA 2HKEA 2ELZA 2HKJA 4P7AA 4LPFA 4Z7CA 1YSAC 4AQYI 2EMIA 4JI5I 2MKDA 1ZM2A 1N0VC 1IQSA 1ZAAC 2YZTA 2GLIA 1S4EA 2E5LE 3QT6A 2BA0G 3QT8A 2LJUA 4U3DA 4O4KA 2WP8B 3ZZ0A 4DUYE 3V2UC 3T1HI 2O3ZA 1ZR9A 3KZZA 3J80C 2PNMA 2V8PA 5C0XF 4USMA 3PS2A 3P06A 2B7TA 4MLVA 4DR7I 3T1YE 4LF9I 2FV4B 1XNQI 2UXDE 1KJKA 5K36E 2LT7A 1Z0EA 2C39A 1VISA 3F6GA 4NHRA 1E3HA 2L8TA 4MQYA 1FWKA 4LCFA 4B3SE 3L7ZA 3ZKBA 4USKA 4GKKI 2ZM6E 2NA2A 2NN6F 3M6AA 2WCC3 4X64I 2L3JA 4FW7A 5CFFE 2O1VA 1BB8A 5KL3A 2BBGA 4DPXA 2NN6E 2LTSA 1HNXE 4OOGC 2UXBE 1ZM4A 3LNUA 3M7NG 4WXCA 4JI1E 5A2QQ 2EPPA 3L00A 5AE2A 1EI1A 1UDOA 5A69A 1Z59A 1KIJA 1GZ6A 3PYGA 1H7SA 2H36X 2V88A 5A6JA 3JU0A 4O24A 2EM6A 3OTOE 1UDSA 1IMUA 3H1CA 4FW3A 1IBKE 2EM8A 2PO2A 2YTOA 2LBSB 3AV0A 2LJPA 4OKGA 2ELYA 2PRTA 4HXZA 2C38B 2M9AA 2JXPA 1DARA 4HY1A 1T38A 4QNKA 2V85A 4LFBI 2JWOA 2EN3A 4DV3E 5DROA 1UBDC 1RC7A 2BA1D 2V2VA 4DR2E 4X65E 1JK2A 1MG7A 3UK3C 2JEAB 1E3PA 5F3WA 2PO0B 1O0WA 2I9IA 4DV7E 1XMOI 2UUBI 4DV2I 1MGTA 2EFGA 3MHSC 4L8NA 4IZKB 5KL7A 5BR8I 4DU7A 3C6KA 1DI2A 2UUAI 2HJJA 4EMDA 3WU4A 2YTJA 2EPKX 2JP9A 4JI5E 2JEBB 2YTDA 2O1TA 3GONA 1F2IG 2EZ6A 5C0XD 2JE6B 5K36D 5C0XB 1N36I 2EWLA 4F54A 1TF6A 5K36B 3WU6A 3J81C 3T1HE 3B8HA 2JY9A 2OI2A 2N3GA 3ADJA 4WSGA 4DR7E 1N34E 2MC5A 2EOHA 5A6AA 2BV3A 2NN6D 1P42A 2O1UA 2YU5A 2DLKA 1MX0A 2NN6B 1KVKA 2X7IA 2YTFA 2E5LI 4P78A 2VQFE 3WU3A 4X64E 2HK3A 2N3HA 3C4TA 3EPKA 2C38A 2HC5A 4DUYI 1PJSA 2DEJA 4KZSA 3BBGA 1H7UA 1YHCA 1Z5BA 4TUIA 4FW4A 4IFDF 3U1KA 2EPXA 3LPSA 4BA1B 3HPSA 2L92A 5IT9C 4UT4A 2V34A 3T1YI 4WSPA 1A1LA 1I94E 4F6NA 2JEAA 4IFDC 2PO0A 4TUGA 4JI6E 1IBMI 4XTJA 4IJDA 4B3SI 2ZM6I 2DMYA 3VK6A 1ZBQA 4IZKA 2DMIA 2UXBI 1YYOA 1EKZA 4M0VA 2LE2A 2GPIA 2PO1B 2HFSA 5JEAE 1AH5A 4LFBE 2HFUA 2JEBA 3J80Q 1K47A 4FWHA 1U2RA 2JE6A 1WJPA 1FJGE 4HYMA 5C0XA 1NEIA 2RPCA 3THNA 2JR1A 4N4RB 2N8XA 5K36A 1IBKI 2RSIA 4ISAA 2EOXA 4M2ZA 1XMOE 1XNRE 1T39A 5TSEA 2ZBKB 1XMQI 3PYEA 4N3OA 2EP3A 2MDRA 2NN6A 1A1IA 4OO1F 4IS1C 3GMEA 2YTGA 3OMLA 4NBQA 1XXEA 3JAMC 2KOUA 2R1FA 1BBGA 2YTNA 4DR2I 2DGCA 2EMAA 2Z5CB 4X65I 3LLHA 3H09A 3GCMA 4BA2B 4OO1C 2F4VE 4O43A 2EOFA 4I3HA 4NXMI 5EKWA 3D4JA 1WXRA 2DSYA 2EMXA 4BA1A 1X48A 1LLMC 1YH8A 1T4NA 4BMJA 1R6LA 4JG4A 1WRJA 2L33A 2BB8A 2VF1A 2GO3A 1EA6A 4R2CA 1G2FC 3IWBA 3WU5A 2KHXA 1A1KA 2NUFA 4MLQA 4F6MA 4U3BA 2VE7C 4BC7A 3M99B 2EPAA 5LMNI 2EN8A 3RMPA 4JYAE 4M9VC 1Y4SA 3HULA 2FGGA 4QNJA 2EN4A 4URLA 1EH8A 1UHZA 1PJQA 4B3TE 2CTDA 4B3RE 3CDIA 4BHCA 5C0XE 1N34I 3ADIA 2JPAA 1GTKA 4P7DA 2GQ0A 5AC5A 5DRRA 1RQ0A 2M4IA 2EOYA 3ADGA 2WZOA 3BIDA 1IBME 2CGEA 5JEAD 4DR3E 2ODRD 4FN5A 4HACB 5JEAB 2VQFI 5DNXA 4KQVA 3EPHA 2F8BA 1Z0BA 2EN6A 3BGHA 1DGCA 1IBLE 4KWYA 2UXCE 2NPFA 3NZKA 4ZYEA 3KZYA 4R2PA 2UUCE 3J81Q 2VQEE 2EMHA 2Z5CA 2M7QA 4LFAE 4BA2A 1I94I 4X66E 5LL6R 2MKNA 4JI6I 2GHFA 1GQEA 4BC9A 1B63A 2F1DA 2NUEA 1AAYA 1Y60A 4LF6I 2Q8UA 4MU3A 5DNLA 2B7VA 1XMQE 3K1JA 1RMDA 2DRPA 5A6BD 2EMWA 4BBYA 2EM9A 2LMZA 2EMZA 3K17A 1PDAA 5AASA 2BA0D 2YTEA 4WPYA 2JYAA 2L3CA 4DV6I 1FJGI 2EMCA 1YFHA 2WP8A 2YSPA 5AC4A 1Y6ZA 5IT9Q 1USUA 1ZBTA 1Z1BA 4NXME 1J5EE 3M85G 1XNRI 2CVEA 4DU8A 4RHBB 4KHPE 2R3VA 2R76A 1RR9A 5L3JA 5FWKA 2LCEA 1YUJA 4PRVA 3B4TA 2R42A 2IESA 4HACA 2EL5A 2X36A 2V8QB 5JEAA 4JI0E 2EM4A 4JI7E 4JI3E 3U1YA 2YWQA 1WUUA 4LOMA 2EQ3A 2F4VI 1X49A 2EPNA 4DPTA 3F0NA 1HR0I 3M7ND 3K85A 5LMNE 1D6TA 2EOSA 4JI4I 2BM0A 1OYSA 1X5WA 4R2SA 1UN6B 2EMYA 2EJ4A 3H4LA 3VYYA 4DV1I 2EM3A 2BM1A 3B82A 4R2RA 2NUGA 3UHMA 3J7AM 4YHHE 2FTXB 5T6JA 2HGHA 3PRYA 4X8WA 4R8OA 1HK7A 1KTVA 2JT2A 4JI8I 3ZOQB 3ADLA 2M1SA 3P1XA 5A6BA 4DUZE 4JV5E 1NHJA 1ZXMA 4R1FA 5EL9A 4JYAI 3VYXA 1FNMA 4LF4E 3K6QA 4B3RI 4B3TI 2WBSA 3GLLA 4MYUA 1N3GA 1ELOA 4IFDE 2WBTA 2YU8A 3MSWA 4BS9A 2WBUA 3Q1QA 4X9JA 2CSHA 2GO4A 1TF3A 3MHHC 2EMLA 1OYRA 4DR3I 4DR1E 4IS9A 2L2NA 5FLXC 3P3EA 4LF6E 2CPNA 2NABA 3DD6A 2YT4A 2EPZA 5LMUE 1IBLI 1UILA 2YTPA 2DB2A 2UXCI 5A6KA 3PS3A 2ADRA 2UUCI 2VQEI 2CZ9A 4WXDA 4LFAI 2EN2A 4X66I 2AE8A 4DV6E 1YPNA 2BR2B 2EE8A 1ZM9A 1YYKA 2E1RA 3HPZA 4F9CB 2IOQA 4ZYHA 1RHYA 3HQ1A 3ZKDA 3PYDA 3HJCA 2EQ1A 2EOZA 2YTQA 1YUIA 3ZZTA 1G2DC 4DR6E 2CG9A 4R2DA 2EMBA 2EL6A 5ADZA 4IZJD 3EPJA 3BF2A 4DR5I 1NHIA 4IZJB 2ENCA 4K0KI 4OO1E 2LV2A 2A2DA 3LTOA 2EPOA 2UU9E 3DJWA 2V83A 1HR0E 4DR4I 1J5EI 4J8ZA 4JI4E 1L4SA 1BKNA 1X6HA 4KHPI 4DKKA 3Q6NA 4BCAA 5GMEA 2ENHA 2EOEA 2LVHA 1USVA 4DV1E 2EPLX 1QNTA 1OJ4A 4LF5E 1H74A 5IV8B 5KL4A 4LCGA 4JI0I 4JI3I 4JI7I 4IFDD 1SFEA 5DRPA 2Z5EA 5IWAE 4IFDB 4JI8E 3EPLA 2CT1A 2LUQA 2YRKA 2LUPB 1TN9A 2IHR1 1PJTA 4M1KA 2PO1A 2HHHE 2YTIA 2B9DA 4GZNC 3QT5A 4RPFA 2K4VA 2DEIA 2ENAA 5KL2A 2BR2A 4DXLA 4LF8E 3VHTB 1FKAE 5IXMB 4YHHI 4X62E 4DV0E 2J7KA 1A1FA 2ZITA 1R6MA 2MC6A 4FW5A 2LTRA 3C4BA 3C6MA 3IWCA 2C37B 4DUZI 4F9AB 4JV5I 2EMGA 4F2JC 4GEQB 1UDNA 4AIDA 1UEKA 2V86A 4IZJA 4LF4I 4R2EA 1YYWA 1FI4A 2K7IA 4ZYGA 2BA1G 3P76A 2EQ0A 4J3DA 4MU4A 2RTXA 4DV4E 2PNZB 2V89A 3QG5C 3CDJA 5DNYA 3ZM7A 4Q28A 1JK1A 4ZVIA 4DR1I 5K36F 2EPRA 1H73A 1ZM3A 3V5RA 4LU9A 4OO1D 2EN1A 2EPCA 2WW4A 5C0XC 4MU0A 4OO1B 3FIGA 2EM2A 1Z5AA 5K36C 5LMUI 1PIEA 3EQ1A 1S16A 1IQOA 3QT7A 4GKJI 1N33E 4WFTA 2AJ4A 4DR5E 2VF3A 4K0KE 1HNWI 2V2ZA 2EORA 1RREA 4B3MI 4IFDA 4OX9E 4LF7I 4R2AA 3ECRA 2NN6C 5ELWA 4LFCI 2A2CA 4DR4E 1FWLA 3DF6A 3HXLA 4I8OA 4DPWA 4DR6I 5FLXQ 5KL6A 2EMKA 2RS6A 4WUCA 4Z7YA 4DPYA 1X47A 5KL5A 4NXNI 2J65A 2L2KB 2RS7A 2VRDA 4DV5I 1Y4UA 3KWRA 2V2QA 1Z5CA 3HKMA 1Y5YA 2UU9I 1KKHA 4FW9A 2C37A 1DQ3A 2EOIA 4FWGA 1MEYC 2XEXA 3LMLA 1J26A 1B62A 2PNZA 2JOBA 3P3GA 1WHQA 2KONA 4GQUA 1YZ9A 4JI2E 4Q35B 1N32I 2PNLA 1VI7A 2J7JA 4O5GA 4DMIA 2MDGA 4MU1A 2EL4A 4LF5I 4AIMA 4RH8A 3J7Yp 2WNRB 4YY3E 2DIXA 1BBOA 3JTZA 1NCSA 2JVAA 4OO1A 5IWAI 3JAMQ 4FK5C 1H72C 4R2QA 4AQYE 2HHHI 3TQMA 1HNZI 1MU5A 3PS1A 5A2QC 2HK2A 4UTGA 4P52A 1PVGA 4LF8I 2LO3A 4HTGA 2EPMX 4LCHA 2Z5BB 4PU9A 4X62I 4DV0I 2VESA 2EM7A 3M85D 4LF9E 2V87A 1XNQE 1KYQA 2I13A 2G7HA 2RQLA 1X3CA 2LRSA 4WX9A 2B3TB 1PKPA 2LJHA 4GKKE 3AUZA 4GKJE 3THOB 4WYQB 1A1JA 4DV4I 3HTXA 3IWDA 1Z0GA 2GS8A 2EOQA 1B69A 1Z0TA 1HNWE 4B3ME 1STUA 4LF7E 4F9BB 1NHHA 4LFCE 2EOJA 2D9HA 1Z0WA 3PYFA 4PRXA 2UXDI 2A25A 1Z0CA 5GMDA 1UDQA 1QU6A 2EM5A 4BHBA 2IERA 2E72A 5DRQA 1N33I 4NXNE 1EH6A 2WNRA 4ED4A 2Q2EB 2EM0A 4DV5E 5JEAF 1Z0VA 1HNXI 1ZU1A 4OX9I 1A6FA 4NZVA 3CWVA 4R03A 2EOMA 3J7AG 4FWDA 4JI1I 1T4OA 4MDTA 1EH7A 2YRHA 1OYPA 2O1WA 5JEAC 1QZRA 2ODRC 4AM3A 5AE3A 2E1MA 3OTOI 2EPUA 4WUBA 2C39B 2L2MA 1A1HA 2Z5BA 1X6EA 1N32E 3L7ZB 4M30A 2YPNA 5AE1A 2UUBE 4DV2E 3P3CA 4OZEA 4L5NC 3ZZUA 4FW6A 4HEIA
chains in the Genus database with same CATH topology
4MYTA 2RSMA 5BR8E 2UUAE 4DV3I 1T4LB 2JOXA 1WHNA 4LTYA 1ZXNA 1NZ0A 3F6HA 1HNZE 1XHKA 4WUDA 4JI2I 3Q6MA 1N36E 1SR9A 2IOPA 4DV7I 2L6MA 3B78A 1N0UA 4YY3I 4DPUA 2HKEA 4P7AA 2HKJA 4Z7CA 4AQYI 4JI5I 1ZM2A 1N0VC 3QT8A 2YZTA 1S4EA 2E5LE 3QT6A 3ZZ0A 4DUYE 3V2UC 3T1HI 3J80C 2PNMA 2V8PA 4USMA 3P06A 2B7TA 4DR7I 3T1YE 4LF9I 2FV4B 1XNQI 2UXDE 1Z0EA 1VISA 3F6GA 3ZKBA 2L8TA 1FWKA 4B3SE 4GKKI 2ZM6E 2NA2A 3M6AA 4X64I 2L3JA 5CFFE 2O1VA 4DPXA 2LTSA 1HNXE 4OOGC 2UXBE 1ZM4A 3LNUA 4JI1E 5A2QQ 5AE2A 1EI1A 1Z59A 3PYGA 1KIJA 1GZ6A 1H7SA 2H36X 2V88A 3JU0A 3OTOE 1IBKE 2LBSB 3AV0A 2LJPA 4HXZA 1DARA 4HY1A 2V85A 4LFBI 2JWOA 4DV3E 1RC7A 2V2VA 4DR2E 4X65E 1MG7A 5F3WA 1O0WA 4DV7E 1XMOI 2UUBI 4DV2I 2EFGA 4L8NA 4IZKB 5BR8I 4DU7A 1DI2A 2UUAI 4EMDA 3WU4A 4JI5E 2O1TA 3GONA 2EZ6A 1N36I 2EWLA 4F54A 3WU6A 3J81C 3T1HE 3B8HA 2JY9A 2OI2A 2N3GA 3ADJA 4DR7E 1N34E 2MC5A 2BV3A 2O1UA 1MX0A 2X7IA 1KVKA 2E5LI 4P78A 2VQFE 3WU3A 4X64E 2HK3A 2N3HA 3C4TA 4DUYI 2DEJA 4KZSA 1H7UA 1Z5BA 4TUIA 3LPSA 3HPSA 2L92A 5IT9C 4UT4A 2V34A 3T1YI 4WSPA 1I94E 4TUGA 4JI6E 1IBMI 4XTJA 4B3SI 2ZM6I 2DMYA 3VK6A 1ZBQA 4IZKA 2UXBI 1YYOA 1EKZA 4M0VA 2LE2A 2HFSA 4LFBE 2HFUA 3J80Q 1K47A 4FWHA 1U2RA 1FJGE 4HYMA 2JR1A 1IBKI 4M2ZA 1XMOE 1XNRE 1XMQI 2ZBKB 3PYEA 4N3OA 2MDRA 3OMLA 3JAMC 2KOUA 4DR2I 2Z5CB 4X65I 3LLHA 3H09A 2F4VE 4I3HA 4NXMI 3D4JA 1WXRA 2DSYA 1X48A 4JG4A 1T4NA 4BMJA 2L33A 2VF1A 1EA6A 3IWBA 3WU5A 2KHXA 2NUFA 2VE7C 4BC7A 5LMNI 3RMPA 4JYAE 1Y4SA 3HULA 2FGGA 4URLA 1UHZA 4B3RE 4B3TE 1N34I 3ADIA 4P7DA 2GQ0A 1RQ0A 2M4IA 3ADGA 1IBME 2WZOA 2CGEA 4DR3E 2ODRD 4FN5A 4HACB 2VQFI 4KQVA 2F8BA 1Z0BA 1IBLE 2UXCE 2NPFA 2UUCE 3J81Q 2VQEE 2Z5CA 2M7QA 4LFAE 1I94I 4X66E 5LL6R 4JI6I 1B63A 1GQEA 4BC9A 2NUEA 4LF6I 2B7VA 1XMQE 3K1JA 4BBYA 2LMZA 3K17A 5AASA 2L3CA 4WPYA 4DV6I 1FJGI 1Y6ZA 5IT9Q 1USUA 1ZBTA 4NXME 1J5EE 1XNRI 4DU8A 4KHPE 2R3VA 1RR9A 5L3JA 5FWKA 4PRVA 2R42A 4HACA 2X36A 2V8QB 4JI0E 4JI3E 4JI7E 1WUUA 2F4VI 1X49A 4DPTA 3F0NA 1HR0I 3K85A 5LMNE 1D6TA 4JI4I 2BM0A 3H4LA 3VYYA 4DV1I 2BM1A 3B82A 2NUGA 3J7AM 4YHHE 2FTXB 5T6JA 3PRYA 4X8WA 4R8OA 1HK7A 1KTVA 4JI8I 3ZOQB 3ADLA 2M1SA 3P1XA 4DUZE 4JV5E 1NHJA 1ZXMA 4R1FA 4JYAI 3VYXA 1FNMA 4LF4E 3K6QA 4B3RI 4B3TI 4MYUA 1ELOA 4BS9A 3MSWA 3Q1QA 4DR3I 4DR1E 2L2NA 5FLXC 4LF6E 2CPNA 2YT4A 1IBLI 5LMUE 1UILA 2DB2A 2UXCI 2UUCI 2VQEI 2CZ9A 4LFAI 4X66I 4DV6E 1ZM9A 1YYKA 2E1RA 3HPZA 4F9CB 2IOQA 3HQ1A 3ZKDA 3PYDA 3HJCA 3ZZTA 4DR6E 2CG9A 5ADZA 4IZJD 4DR5I 1NHIA 4IZJB 4K0KI 3LTOA 2A2DA 2UU9E 3DJWA 2V83A 1HR0E 4DR4I 1J5EI 4J8ZA 4JI4E 1BKNA 4KHPI 4DKKA 3Q6NA 4BCAA 5GMEA 1USVA 4DV1E 1OJ4A 4LF5E 1H74A 4JI0I 4JI3I 4JI7I 2Z5EA 5IWAE 4JI8E 2LUQA 2LUPB 2IHR1 4M1KA 2HHHE 2B9DA 3QT5A 4RPFA 2K4VA 2DEIA 4DXLA 4LF8E 1FKAE 4YHHI 4X62E 4DV0E 2J7KA 2ZITA 2MC6A 2LTRA 3C4BA 3IWCA 4JV5I 4DUZI 4F9AB 4GEQB 1UEKA 2V86A 4IZJA 4LF4I 1YYWA 1FI4A 4USKA 2RTXA 4DV4E 2V89A 3ZM7A 5DNYA 4Q28A 4ZVIA 4DR1I 1H73A 1ZM3A 3V5RA 4LU9A 2WW4A 3FIGA 1Z5AA 5LMUI 1PIEA 1S16A 3QT7A 4GKJI 1N33E 4WFTA 2AJ4A 4DR5E 2VF3A 4K0KE 1HNWI 2V2ZA 4B3MI 1RREA 4OX9E 4LF7I 4LFCI 2A2CA 4DR4E 1FWLA 3DF6A 3HXLA 4I8OA 4DPWA 4DR6I 5FLXQ 4WUCA 2RS6A 4DPYA 4Z7YA 1X47A 4NXNI 2L2KB 2RS7A 4DV5I 1Y4UA 3KWRA 2V2QA 1Z5CA 2UU9I 1KKHA 4FW9A 1DQ3A 4FWGA 2XEXA 3LMLA 1J26A 1B62A 2JOBA 1WHQA 2KONA 1YZ9A 4JI2E 1N32I 2PNLA 4DMIA 4LF5I 3J7Yp 4YY3E 2DIXA 3JTZA 2JVAA 5IWAI 3JAMQ 1H72C 4AQYE 2HHHI 1HNZI 1MU5A 4UTGA 5A2QC 2HK2A 4P52A 1PVGA 4LF8I 4X62I 4PU9A 2Z5BB 4DV0I 4LF9E 2V87A 1XNQE 2G7HA 2LRSA 2B3TB 1PKPA 2LJHA 4GKKE 3AUZA 4GKJE 4WYQB 4DV4I 3HTXA 3IWDA 1Z0GA 2GS8A 1Z0TA 1HNWE 4B3ME 1STUA 4LF7E 4F9BB 1NHHA 4LFCE 1Z0WA 3PYFA 4PRXA 2UXDI 1Z0CA 5GMDA 1QU6A 1N33I 4NXNE 4ED4A 2Q2EB 4DV5E 1Z0VA 1HNXI 4OX9I 1A6FA 3CWVA 4JI1I 4R03A 3J7AG 4FWDA 1T4OA 2O1WA 1QZRA 2ODRC 5AE3A 2E1MA 3OTOI 4WUBA 2L2MA 2Z5BA 1N32E 4M30A 5AE1A 2UUBE 4DV2E 4L5NC 3ZZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MYT A;  2RSM A;  5BR8 E;  2UUA E;  4DV3 I;  1T4L B;  1WHN A;  1ZXN A;  1NZ0 A;  1HNZ E;  1XHK A;  4WUD A;  4JI2 I;  1N36 E;  4DV7 I;  3B78 A;  1N0U A;  4YY3 I;  4DPU A;  2HKE A;  4P7A A;  2HKJ A;  4Z7C A;  4AQY I;  4JI5 I;  1ZM2 A;  1N0V C;  3QT8 A;  3QT6 A;  2E5L E;  1S4E A;  3ZZ0 A;  4DUY E;  3V2U C;  3T1H I;  3J80 C;  2V8P A;  4USM A;  2B7T A;  4DR7 I;  3T1Y E;  4LF9 I;  1XNQ I;  2UXD E;  1Z0E A;  1VIS A;  3ZKB A;  1FWK A;  4B3S E;  4GKK I;  2ZM6 E;  2NA2 A;  3M6A A;  4X64 I;  2L3J A;  5CFF E;  4DPX A;  2LTS A;  1HNX E;  4OOG C;  2UXB E;  1ZM4 A;  3LNU A;  4JI1 E;  5A2Q Q;  1EI1 A;  1Z59 A;  3PYG A;  1KIJ A;  1H7S A;  3OTO E;  1IBK E;  2LBS B;  2LJP A;  4HXZ A;  1DAR A;  4HY1 A;  4LFB I;  4DV3 E;  1RC7 A;  2V2V A;  4DR2 E;  4X65 E;  1MG7 A;  1O0W A;  4DV7 E;  1XMO I;  2UUB I;  4DV2 I;  2EFG A;  5BR8 I;  4DU7 A;  1DI2 A;  2UUA I;  4EMD A;  3WU4 A;  4JI5 E;  3GON A;  2EZ6 A;  1N36 I;  3WU6 A;  3J81 C;  3T1H E;  3B8H A;  2JY9 A;  2OI2 A;  2N3G A;  3ADJ A;  4DR7 E;  1N34 E;  2BV3 A;  1MX0 A;  2X7I A;  1KVK A;  2E5L I;  2VQF E;  3WU3 A;  4X64 E;  2HK3 A;  2N3H A;  3C4T A;  4DUY I;  2DEJ A;  1H7U A;  1Z5B A;  3LPS A;  3T1Y I;  5IT9 C;  4UT4 A;  2V34 A;  1I94 E;  4JI6 E;  1IBM I;  4XTJ A;  4B3S I;  2ZM6 I;  2DMY A;  2UXB I;  1YYO A;  1EKZ A;  2HFS A;  4LFB E;  2HFU A;  3J80 Q;  1K47 A;  4FWH A;  1U2R A;  1FJG E;  4HYM A;  1IBK I;  4M2Z A;  1XMO E;  1XNR E;  1XMQ I;  2ZBK B;  3PYE A;  2MDR A;  3JAM C;  4DR2 I;  4X65 I;  3LLH A;  2F4V E;  4I3H A;  4NXM I;  3D4J A;  1X48 A;  4JG4 A;  1T4N A;  2L33 A;  1EA6 A;  3WU5 A;  2KHX A;  2NUF A;  5LMN I;  4JYA E;  3HUL A;  4URL A;  1UHZ A;  4B3R E;  4B3T E;  1N34 I;  3ADI A;  1RQ0 A;  3ADG A;  1IBM E;  4DR3 E;  4HAC B;  4FN5 A;  2VQF I;  4KQV A;  1Z0B A;  1IBL E;  2UXC E;  2NPF A;  2UUC E;  3J81 Q;  2VQE E;  4LFA E;  1I94 I;  4X66 E;  5LL6 R;  4JI6 I;  1B63 A;  1GQE A;  2NUE A;  4LF6 I;  2B7V A;  1XMQ E;  3K1J A;  3K17 A;  2L3C A;  4DV6 I;  1FJG I;  5IT9 Q;  1ZBT A;  4NXM E;  1J5E E;  1XNR I;  4DU8 A;  4KHP E;  2R3V A;  1RR9 A;  5L3J A;  4PRV A;  2R42 A;  4HAC A;  2X36 A;  4JI0 E;  4JI3 E;  4JI7 E;  1WUU A;  2F4V I;  1X49 A;  4DPT A;  3F0N A;  1HR0 I;  1D6T A;  5LMN E;  4JI4 I;  2BM0 A;  3H4L A;  3VYY A;  4DV1 I;  2BM1 A;  3B82 A;  2NUG A;  3J7A M;  4YHH E;  4X8W A;  1KTV A;  4JI8 I;  3ADL A;  3P1X A;  4DUZ E;  4JV5 E;  1NHJ A;  1ZXM A;  4R1F A;  4JYA I;  3VYX A;  1FNM A;  4LF4 E;  4B3R I;  4B3T I;  4MYU A;  1ELO A;  3Q1Q A;  4DR3 I;  4DR1 E;  2L2N A;  5FLX C;  4LF6 E;  2CPN A;  2YT4 A;  1IBL I;  5LMU E;  1UIL A;  2DB2 A;  2UXC I;  2UUC I;  2VQE I;  2CZ9 A;  4LFA I;  4X66 I;  4DV6 E;  1ZM9 A;  1YYK A;  2E1R A;  3ZKD A;  3PYD A;  3ZZT A;  4DR6 E;  4DR5 I;  1NHI A;  4K0K I;  3LTO A;  2A2D A;  2UU9 E;  1HR0 E;  4DR4 I;  1J5E I;  4JI4 E;  1BKN A;  4KHP I;  4DKK A;  5GME A;  4DV1 E;  1OJ4 A;  4LF5 E;  1H74 A;  4JI0 I;  4JI3 I;  4JI7 I;  5IWA E;  4JI8 E;  2LUQ A;  2LUP B;  2IHR 1;  4M1K A;  2HHH E;  3QT5 A;  4RPF A;  2DEI A;  4DXL A;  4LF8 E;  1FKA E;  4YHH I;  4X62 E;  4DV0 E;  2J7K A;  2ZIT A;  2LTR A;  3C4B A;  4JV5 I;  4DUZ I;  1UEK A;  4LF4 I;  1YYW A;  1FI4 A;  4USK A;  2RTX A;  4DV4 E;  3ZM7 A;  4ZVI A;  4DR1 I;  1H73 A;  1ZM3 A;  3V5R A;  2WW4 A;  1Z5A A;  5LMU I;  1PIE A;  1S16 A;  3QT7 A;  4GKJ I;  1N33 E;  4WFT A;  2AJ4 A;  4DR5 E;  2VF3 A;  4K0K E;  1HNW I;  2V2Z A;  4B3M I;  1RRE A;  4OX9 E;  4LF7 I;  4LFC I;  2A2C A;  4DR4 E;  1FWL A;  4DR6 I;  4DPW A;  5FLX Q;  4WUC A;  2RS6 A;  4DPY A;  4Z7Y A;  1X47 A;  4NXN I;  2L2K B;  2RS7 A;  4DV5 I;  2V2Q A;  1Z5C A;  2UU9 I;  1KKH A;  4FW9 A;  4FWG A;  2XEX A;  1J26 A;  1B62 A;  1WHQ A;  1YZ9 A;  4JI2 E;  1N32 I;  4LF5 I;  3J7Y p;  4YY3 E;  2DIX A;  2JVA A;  5IWA I;  3JAM Q;  1H72 C;  4AQY E;  2HHH I;  1HNZ I;  1MU5 A;  4UTG A;  5A2Q C;  2HK2 A;  4P52 A;  1PVG A;  4LF8 I;  4X62 I;  4PU9 A;  4DV0 I;  4LF9 E;  1XNQ E;  2LRS A;  2B3T B;  1PKP A;  2LJH A;  4GKK E;  4GKJ E;  4WYQ B;  4DV4 I;  3HTX A;  1Z0G A;  2GS8 A;  1Z0T A;  1HNW E;  4B3M E;  1STU A;  4LF7 E;  1NHH A;  4LFC E;  1Z0W A;  3PYF A;  4PRX A;  2UXD I;  1Z0C A;  5GMD A;  1QU6 A;  1N33 I;  4NXN E;  4ED4 A;  2Q2E B;  4DV5 E;  1Z0V A;  1HNX I;  4OX9 I;  1A6F A;  3CWV A;  4JI1 I;  3J7A G;  4FWD A;  1T4O A;  1QZR A;  3OTO I;  4WUB A;  2L2M A;  1N32 E;  4M30 A;  2UUB E;  4DV2 E;  3ZZU A; 
#chains in the Genus database with same CATH topology
 4ZYD A;  4MYT A;  2RSM A;  5BR8 E;  2UUA E;  4DV3 I;  1T4L B;  2DLQ A;  2JOX A;  1WHN A;  4LTY A;  1ZXN A;  1NZ0 A;  3F6H A;  1HNZ E;  1XHK A;  1X6F A;  4WUD A;  4JI2 I;  3Q6M A;  2EMF A;  5LLQ A;  1N36 E;  1SR9 A;  2IOP A;  1A1G A;  2YRM A;  2L6M A;  4DV7 I;  2EOO A;  3B78 A;  1P47 A;  3KRN A;  2YSO A;  2PO2 B;  2EN7 A;  1N0U A;  4YY3 I;  4DPU A;  2HKE A;  2ELZ A;  2HKJ A;  4P7A A;  4LPF A;  4Z7C A;  1YSA C;  4AQY I;  2EMI A;  4JI5 I;  2MKD A;  1ZM2 A;  1N0V C;  1IQS A;  1ZAA C;  2YZT A;  2GLI A;  1S4E A;  2E5L E;  3QT6 A;  2BA0 G;  3QT8 A;  2LJU A;  4U3D A;  4O4K A;  2WP8 B;  3ZZ0 A;  4DUY E;  3V2U C;  3T1H I;  2O3Z A;  1ZR9 A;  3KZZ A;  3J80 C;  2PNM A;  2V8P A;  5C0X F;  4USM A;  3PS2 A;  3P06 A;  2B7T A;  4MLV A;  4DR7 I;  3T1Y E;  4LF9 I;  2FV4 B;  1XNQ I;  2UXD E;  1KJK A;  5K36 E;  2LT7 A;  1Z0E A;  2C39 A;  1VIS A;  3F6G A;  4NHR A;  1E3H A;  2L8T A;  4MQY A;  1FWK A;  4LCF A;  4B3S E;  3L7Z A;  3ZKB A;  4USK A;  4GKK I;  2ZM6 E;  2NA2 A;  2NN6 F;  3M6A A;  2WCC 3;  4X64 I;  2L3J A;  4FW7 A;  5CFF E;  2O1V A;  1BB8 A;  5KL3 A;  2BBG A;  4DPX A;  2NN6 E;  2LTS A;  1HNX E;  4OOG C;  2UXB E;  1ZM4 A;  3LNU A;  3M7N G;  4WXC A;  4JI1 E;  5A2Q Q;  2EPP A;  3L00 A;  5AE2 A;  1EI1 A;  1UDO A;  5A69 A;  1Z59 A;  1KIJ A;  1GZ6 A;  3PYG A;  1H7S A;  2H36 X;  2V88 A;  5A6J A;  3JU0 A;  4O24 A;  2EM6 A;  3OTO E;  1UDS A;  1IMU A;  3H1C A;  4FW3 A;  1IBK E;  2EM8 A;  2PO2 A;  2YTO A;  2LBS B;  3AV0 A;  2LJP A;  4OKG A;  2ELY A;  2PRT A;  4HXZ A;  2C38 B;  2M9A A;  2JXP A;  1DAR A;  4HY1 A;  1T38 A;  4QNK A;  2V85 A;  4LFB I;  2JWO A;  2EN3 A;  4DV3 E;  5DRO A;  1UBD C;  1RC7 A;  2BA1 D;  2V2V A;  4DR2 E;  4X65 E;  1JK2 A;  1MG7 A;  3UK3 C;  2JEA B;  1E3P A;  5F3W A;  2PO0 B;  1O0W A;  2I9I A;  4DV7 E;  1XMO I;  2UUB I;  4DV2 I;  1MGT A;  2EFG A;  3MHS C;  4L8N A;  4IZK B;  5KL7 A;  5BR8 I;  4DU7 A;  3C6K A;  1DI2 A;  2UUA I;  2HJJ A;  4EMD A;  3WU4 A;  2YTJ A;  2EPK X;  2JP9 A;  4JI5 E;  2JEB B;  2YTD A;  2O1T A;  3GON A;  1F2I G;  2EZ6 A;  5C0X D;  2JE6 B;  5K36 D;  5C0X B;  1N36 I;  2EWL A;  4F54 A;  1TF6 A;  5K36 B;  3WU6 A;  3J81 C;  3T1H E;  3B8H A;  2JY9 A;  2OI2 A;  2N3G A;  3ADJ A;  4WSG A;  4DR7 E;  1N34 E;  2MC5 A;  2EOH A;  5A6A A;  2BV3 A;  2NN6 D;  1P42 A;  2O1U A;  2YU5 A;  2DLK A;  1MX0 A;  2NN6 B;  1KVK A;  2X7I A;  2YTF A;  2E5L I;  4P78 A;  2VQF E;  3WU3 A;  4X64 E;  2HK3 A;  2N3H A;  3C4T A;  3EPK A;  2C38 A;  2HC5 A;  4DUY I;  1PJS A;  2DEJ A;  4KZS A;  3BBG A;  1H7U A;  1YHC A;  1Z5B A;  4TUI A;  4FW4 A;  4IFD F;  3U1K A;  2EPX A;  3LPS A;  4BA1 B;  3HPS A;  2L92 A;  5IT9 C;  4UT4 A;  2V34 A;  3T1Y I;  4WSP A;  1A1L A;  1I94 E;  4F6N A;  2JEA A;  4IFD C;  2PO0 A;  4TUG A;  4JI6 E;  1IBM I;  4XTJ A;  4IJD A;  4B3S I;  2ZM6 I;  2DMY A;  3VK6 A;  1ZBQ A;  4IZK A;  2DMI A;  2UXB I;  1YYO A;  1EKZ A;  4M0V A;  2LE2 A;  2GPI A;  2PO1 B;  2HFS A;  5JEA E;  1AH5 A;  4LFB E;  2HFU A;  2JEB A;  3J80 Q;  1K47 A;  4FWH A;  1U2R A;  2JE6 A;  1WJP A;  1FJG E;  4HYM A;  5C0X A;  1NEI A;  2RPC A;  3THN A;  2JR1 A;  4N4R B;  2N8X A;  5K36 A;  1IBK I;  2RSI A;  4ISA A;  2EOX A;  4M2Z A;  1XMO E;  1XNR E;  1T39 A;  5TSE A;  2ZBK B;  1XMQ I;  3PYE A;  4N3O A;  2EP3 A;  2MDR A;  2NN6 A;  1A1I A;  4OO1 F;  4IS1 C;  3GME A;  2YTG A;  3OML A;  4NBQ A;  1XXE A;  3JAM C;  2KOU A;  2R1F A;  1BBG A;  2YTN A;  4DR2 I;  2DGC A;  2EMA A;  2Z5C B;  4X65 I;  3LLH A;  3H09 A;  3GCM A;  4BA2 B;  4OO1 C;  2F4V E;  4O43 A;  2EOF A;  4I3H A;  4NXM I;  5EKW A;  3D4J A;  1WXR A;  2DSY A;  2EMX A;  4BA1 A;  1X48 A;  1LLM C;  1YH8 A;  1T4N A;  4BMJ A;  1R6L A;  4JG4 A;  1WRJ A;  2L33 A;  2BB8 A;  2VF1 A;  2GO3 A;  1EA6 A;  4R2C A;  1G2F C;  3IWB A;  3WU5 A;  2KHX A;  1A1K A;  2NUF A;  4MLQ A;  4F6M A;  4U3B A;  2VE7 C;  4BC7 A;  3M99 B;  2EPA A;  5LMN I;  2EN8 A;  3RMP A;  4JYA E;  4M9V C;  1Y4S A;  3HUL A;  2FGG A;  4QNJ A;  2EN4 A;  4URL A;  1EH8 A;  1UHZ A;  1PJQ A;  4B3T E;  2CTD A;  4B3R E;  3CDI A;  4BHC A;  5C0X E;  1N34 I;  3ADI A;  2JPA A;  1GTK A;  4P7D A;  2GQ0 A;  5AC5 A;  5DRR A;  1RQ0 A;  2M4I A;  2EOY A;  3ADG A;  2WZO A;  3BID A;  1IBM E;  2CGE A;  5JEA D;  4DR3 E;  2ODR D;  4FN5 A;  4HAC B;  5JEA B;  2VQF I;  5DNX A;  4KQV A;  3EPH A;  2F8B A;  1Z0B A;  2EN6 A;  3BGH A;  1DGC A;  1IBL E;  4KWY A;  2UXC E;  2NPF A;  3NZK A;  4ZYE A;  3KZY A;  4R2P A;  2UUC E;  3J81 Q;  2VQE E;  2EMH A;  2Z5C A;  2M7Q A;  4LFA E;  4BA2 A;  1I94 I;  4X66 E;  5LL6 R;  2MKN A;  4JI6 I;  2GHF A;  1GQE A;  4BC9 A;  1B63 A;  2F1D A;  2NUE A;  1AAY A;  1Y60 A;  4LF6 I;  2Q8U A;  4MU3 A;  5DNL A;  2B7V A;  1XMQ E;  3K1J A;  1RMD A;  2DRP A;  5A6B D;  2EMW A;  4BBY A;  2EM9 A;  2LMZ A;  2EMZ A;  3K17 A;  1PDA A;  5AAS A;  2BA0 D;  2YTE A;  4WPY A;  2JYA A;  2L3C A;  4DV6 I;  1FJG I;  2EMC A;  1YFH A;  2WP8 A;  2YSP A;  5AC4 A;  1Y6Z A;  5IT9 Q;  1USU A;  1ZBT A;  1Z1B A;  4NXM E;  1J5E E;  3M85 G;  1XNR I;  2CVE A;  4DU8 A;  4RHB B;  4KHP E;  2R3V A;  2R76 A;  1RR9 A;  5L3J A;  5FWK A;  2LCE A;  1YUJ A;  4PRV A;  3B4T A;  2R42 A;  2IES A;  4HAC A;  2EL5 A;  2X36 A;  2V8Q B;  5JEA A;  4JI0 E;  2EM4 A;  4JI7 E;  4JI3 E;  3U1Y A;  2YWQ A;  1WUU A;  4LOM A;  2EQ3 A;  2F4V I;  1X49 A;  2EPN A;  4DPT A;  3F0N A;  1HR0 I;  3M7N D;  3K85 A;  5LMN E;  1D6T A;  2EOS A;  4JI4 I;  2BM0 A;  1OYS A;  1X5W A;  4R2S A;  1UN6 B;  2EMY A;  2EJ4 A;  3H4L A;  3VYY A;  4DV1 I;  2EM3 A;  2BM1 A;  3B82 A;  4R2R A;  2NUG A;  3UHM A;  3J7A M;  4YHH E;  2FTX B;  5T6J A;  2HGH A;  3PRY A;  4X8W A;  4R8O A;  1HK7 A;  1KTV A;  2JT2 A;  4JI8 I;  3ZOQ B;  3ADL A;  2M1S A;  3P1X A;  5A6B A;  4DUZ E;  4JV5 E;  1NHJ A;  1ZXM A;  4R1F A;  5EL9 A;  4JYA I;  3VYX A;  1FNM A;  4LF4 E;  3K6Q A;  4B3R I;  4B3T I;  2WBS A;  3GLL A;  4MYU A;  1N3G A;  1ELO A;  4IFD E;  2WBT A;  2YU8 A;  3MSW A;  4BS9 A;  2WBU A;  3Q1Q A;  4X9J A;  2CSH A;  2GO4 A;  1TF3 A;  3MHH C;  2EML A;  1OYR A;  4DR3 I;  4DR1 E;  4IS9 A;  2L2N A;  5FLX C;  3P3E A;  4LF6 E;  2CPN A;  2NAB A;  3DD6 A;  2YT4 A;  2EPZ A;  5LMU E;  1IBL I;  1UIL A;  2YTP A;  2DB2 A;  2UXC I;  5A6K A;  3PS3 A;  2ADR A;  2UUC I;  2VQE I;  2CZ9 A;  4WXD A;  4LFA I;  2EN2 A;  4X66 I;  2AE8 A;  4DV6 E;  1YPN A;  2BR2 B;  2EE8 A;  1ZM9 A;  1YYK A;  2E1R A;  3HPZ A;  4F9C B;  2IOQ A;  4ZYH A;  1RHY A;  3HQ1 A;  3ZKD A;  3PYD A;  3HJC A;  2EQ1 A;  2EOZ A;  2YTQ A;  1YUI A;  3ZZT A;  1G2D C;  4DR6 E;  2CG9 A;  4R2D A;  2EMB A;  2EL6 A;  5ADZ A;  4IZJ D;  3EPJ A;  3BF2 A;  4DR5 I;  1NHI A;  4IZJ B;  2ENC A;  4K0K I;  4OO1 E;  2LV2 A;  2A2D A;  3LTO A;  2EPO A;  2UU9 E;  3DJW A;  2V83 A;  1HR0 E;  4DR4 I;  1J5E I;  4J8Z A;  4JI4 E;  1L4S A;  1BKN A;  1X6H A;  4KHP I;  4DKK A;  3Q6N A;  4BCA A;  5GME A;  2ENH A;  2EOE A;  2LVH A;  1USV A;  4DV1 E;  2EPL X;  1QNT A;  1OJ4 A;  4LF5 E;  1H74 A;  5IV8 B;  5KL4 A;  4LCG A;  4JI0 I;  4JI3 I;  4JI7 I;  4IFD D;  1SFE A;  5DRP A;  2Z5E A;  5IWA E;  4IFD B;  4JI8 E;  3EPL A;  2CT1 A;  2LUQ A;  2YRK A;  2LUP B;  1TN9 A;  2IHR 1;  1PJT A;  4M1K A;  2PO1 A;  2HHH E;  2YTI A;  2B9D A;  4GZN C;  3QT5 A;  4RPF A;  2K4V A;  2DEI A;  2ENA A;  5KL2 A;  2BR2 A;  4DXL A;  4LF8 E;  3VHT B;  1FKA E;  5IXM B;  4YHH I;  4X62 E;  4DV0 E;  2J7K A;  1A1F A;  2ZIT A;  1R6M A;  2MC6 A;  4FW5 A;  2LTR A;  3C4B A;  3C6M A;  3IWC A;  2C37 B;  4DUZ I;  4F9A B;  4JV5 I;  2EMG A;  4F2J C;  4GEQ B;  1UDN A;  4AID A;  1UEK A;  2V86 A;  4IZJ A;  4LF4 I;  4R2E A;  1YYW A;  1FI4 A;  2K7I A;  4ZYG A;  2BA1 G;  3P76 A;  2EQ0 A;  4J3D A;  4MU4 A;  2RTX A;  4DV4 E;  2PNZ B;  2V89 A;  3QG5 C;  3CDJ A;  5DNY A;  3ZM7 A;  4Q28 A;  1JK1 A;  4ZVI A;  4DR1 I;  5K36 F;  2EPR A;  1H73 A;  1ZM3 A;  3V5R A;  4LU9 A;  4OO1 D;  2EN1 A;  2EPC A;  2WW4 A;  5C0X C;  4MU0 A;  4OO1 B;  3FIG A;  2EM2 A;  1Z5A A;  5K36 C;  5LMU I;  1PIE A;  3EQ1 A;  1S16 A;  1IQO A;  3QT7 A;  4GKJ I;  1N33 E;  4WFT A;  2AJ4 A;  4DR5 E;  2VF3 A;  4K0K E;  1HNW I;  2V2Z A;  2EOR A;  1RRE A;  4B3M I;  4IFD A;  4OX9 E;  4LF7 I;  4R2A A;  3ECR A;  2NN6 C;  5ELW A;  4LFC I;  2A2C A;  4DR4 E;  1FWL A;  3DF6 A;  3HXL A;  4I8O A;  4DPW A;  4DR6 I;  5FLX Q;  5KL6 A;  2EMK A;  2RS6 A;  4WUC A;  4Z7Y A;  4DPY A;  1X47 A;  5KL5 A;  4NXN I;  2J65 A;  2L2K B;  2RS7 A;  2VRD A;  4DV5 I;  1Y4U A;  3KWR A;  2V2Q A;  1Z5C A;  3HKM A;  1Y5Y A;  2UU9 I;  1KKH A;  4FW9 A;  2C37 A;  1DQ3 A;  2EOI A;  4FWG A;  1MEY C;  2XEX A;  3LML A;  1J26 A;  1B62 A;  2PNZ A;  2JOB A;  3P3G A;  1WHQ A;  2KON A;  4GQU A;  1YZ9 A;  4JI2 E;  4Q35 B;  1N32 I;  2PNL A;  1VI7 A;  2J7J A;  4O5G A;  4DMI A;  2MDG A;  4MU1 A;  2EL4 A;  4LF5 I;  4AIM A;  4RH8 A;  3J7Y p;  2WNR B;  4YY3 E;  2DIX A;  1BBO A;  3JTZ A;  1NCS A;  2JVA A;  4OO1 A;  5IWA I;  3JAM Q;  4FK5 C;  1H72 C;  4R2Q A;  4AQY E;  2HHH I;  3TQM A;  1HNZ I;  1MU5 A;  3PS1 A;  5A2Q C;  2HK2 A;  4UTG A;  4P52 A;  1PVG A;  4LF8 I;  2LO3 A;  4HTG A;  2EPM X;  4LCH A;  2Z5B B;  4PU9 A;  4X62 I;  4DV0 I;  2VES A;  2EM7 A;  3M85 D;  4LF9 E;  2V87 A;  1XNQ E;  1KYQ A;  2I13 A;  2G7H A;  2RQL A;  1X3C A;  2LRS A;  4WX9 A;  2B3T B;  1PKP A;  2LJH A;  4GKK E;  3AUZ A;  4GKJ E;  3THO B;  4WYQ B;  1A1J A;  4DV4 I;  3HTX A;  3IWD A;  1Z0G A;  2GS8 A;  2EOQ A;  1B69 A;  1Z0T A;  1HNW E;  4B3M E;  1STU A;  4LF7 E;  4F9B B;  1NHH A;  4LFC E;  2EOJ A;  2D9H A;  1Z0W A;  3PYF A;  4PRX A;  2UXD I;  2A25 A;  1Z0C A;  5GMD A;  1UDQ A;  1QU6 A;  2EM5 A;  4BHB A;  2IER A;  2E72 A;  5DRQ A;  1N33 I;  4NXN E;  1EH6 A;  2WNR A;  4ED4 A;  2Q2E B;  2EM0 A;  4DV5 E;  5JEA F;  1Z0V A;  1HNX I;  1ZU1 A;  4OX9 I;  1A6F A;  4NZV A;  3CWV A;  4R03 A;  2EOM A;  3J7A G;  4FWD A;  4JI1 I;  1T4O A;  4MDT A;  1EH7 A;  2YRH A;  1OYP A;  2O1W A;  5JEA C;  1QZR A;  2ODR C;  4AM3 A;  5AE3 A;  2E1M A;  3OTO I;  2EPU A;  4WUB A;  2C39 B;  2L2M A;  1A1H A;  2Z5B A;  1X6E A;  1N32 E;  3L7Z B;  4M30 A;  2YPN A;  5AE1 A;  2UUB E;  4DV2 E;  3P3C A;  4OZE A;  4L5N C;  3ZZU A;  4FW6 A;  4HEI A; 
#chains in the Genus database with same CATH homology
 4MYT A;  2RSM A;  5BR8 E;  2UUA E;  4DV3 I;  1T4L B;  2JOX A;  1WHN A;  4LTY A;  1ZXN A;  1NZ0 A;  3F6H A;  1HNZ E;  1XHK A;  4WUD A;  4JI2 I;  3Q6M A;  1N36 E;  1SR9 A;  2IOP A;  4DV7 I;  2L6M A;  3B78 A;  1N0U A;  4YY3 I;  4DPU A;  2HKE A;  4P7A A;  2HKJ A;  4Z7C A;  4AQY I;  4JI5 I;  1ZM2 A;  1N0V C;  3QT8 A;  2YZT A;  1S4E A;  2E5L E;  3QT6 A;  3ZZ0 A;  4DUY E;  3V2U C;  3T1H I;  3J80 C;  2PNM A;  2V8P A;  4USM A;  3P06 A;  2B7T A;  4DR7 I;  3T1Y E;  4LF9 I;  2FV4 B;  1XNQ I;  2UXD E;  1Z0E A;  1VIS A;  3F6G A;  3ZKB A;  2L8T A;  1FWK A;  4B3S E;  4GKK I;  2ZM6 E;  2NA2 A;  3M6A A;  4X64 I;  2L3J A;  5CFF E;  2O1V A;  4DPX A;  2LTS A;  1HNX E;  4OOG C;  2UXB E;  1ZM4 A;  3LNU A;  4JI1 E;  5A2Q Q;  5AE2 A;  1EI1 A;  1Z59 A;  3PYG A;  1KIJ A;  1GZ6 A;  1H7S A;  2H36 X;  2V88 A;  3JU0 A;  3OTO E;  1IBK E;  2LBS B;  3AV0 A;  2LJP A;  4HXZ A;  1DAR A;  4HY1 A;  2V85 A;  4LFB I;  2JWO A;  4DV3 E;  1RC7 A;  2V2V A;  4DR2 E;  4X65 E;  1MG7 A;  5F3W A;  1O0W A;  4DV7 E;  1XMO I;  2UUB I;  4DV2 I;  2EFG A;  4L8N A;  4IZK B;  5BR8 I;  4DU7 A;  1DI2 A;  2UUA I;  4EMD A;  3WU4 A;  4JI5 E;  2O1T A;  3GON A;  2EZ6 A;  1N36 I;  2EWL A;  4F54 A;  3WU6 A;  3J81 C;  3T1H E;  3B8H A;  2JY9 A;  2OI2 A;  2N3G A;  3ADJ A;  4DR7 E;  1N34 E;  2MC5 A;  2BV3 A;  2O1U A;  1MX0 A;  2X7I A;  1KVK A;  2E5L I;  4P78 A;  2VQF E;  3WU3 A;  4X64 E;  2HK3 A;  2N3H A;  3C4T A;  4DUY I;  2DEJ A;  4KZS A;  1H7U A;  1Z5B A;  4TUI A;  3LPS A;  3HPS A;  2L92 A;  5IT9 C;  4UT4 A;  2V34 A;  3T1Y I;  4WSP A;  1I94 E;  4TUG A;  4JI6 E;  1IBM I;  4XTJ A;  4B3S I;  2ZM6 I;  2DMY A;  3VK6 A;  1ZBQ A;  4IZK A;  2UXB I;  1YYO A;  1EKZ A;  4M0V A;  2LE2 A;  2HFS A;  4LFB E;  2HFU A;  3J80 Q;  1K47 A;  4FWH A;  1U2R A;  1FJG E;  4HYM A;  2JR1 A;  1IBK I;  4M2Z A;  1XMO E;  1XNR E;  1XMQ I;  2ZBK B;  3PYE A;  4N3O A;  2MDR A;  3OML A;  3JAM C;  2KOU A;  4DR2 I;  2Z5C B;  4X65 I;  3LLH A;  3H09 A;  2F4V E;  4I3H A;  4NXM I;  3D4J A;  1WXR A;  2DSY A;  1X48 A;  4JG4 A;  1T4N A;  4BMJ A;  2L33 A;  2VF1 A;  1EA6 A;  3IWB A;  3WU5 A;  2KHX A;  2NUF A;  2VE7 C;  4BC7 A;  5LMN I;  3RMP A;  4JYA E;  1Y4S A;  3HUL A;  2FGG A;  4URL A;  1UHZ A;  4B3R E;  4B3T E;  1N34 I;  3ADI A;  4P7D A;  2GQ0 A;  1RQ0 A;  2M4I A;  3ADG A;  1IBM E;  2WZO A;  2CGE A;  4DR3 E;  2ODR D;  4FN5 A;  4HAC B;  2VQF I;  4KQV A;  2F8B A;  1Z0B A;  1IBL E;  2UXC E;  2NPF A;  2UUC E;  3J81 Q;  2VQE E;  2Z5C A;  2M7Q A;  4LFA E;  1I94 I;  4X66 E;  5LL6 R;  4JI6 I;  1B63 A;  1GQE A;  4BC9 A;  2NUE A;  4LF6 I;  2B7V A;  1XMQ E;  3K1J A;  4BBY A;  2LMZ A;  3K17 A;  5AAS A;  2L3C A;  4WPY A;  4DV6 I;  1FJG I;  1Y6Z A;  5IT9 Q;  1USU A;  1ZBT A;  4NXM E;  1J5E E;  1XNR I;  4DU8 A;  4KHP E;  2R3V A;  1RR9 A;  5L3J A;  5FWK A;  4PRV A;  2R42 A;  4HAC A;  2X36 A;  2V8Q B;  4JI0 E;  4JI3 E;  4JI7 E;  1WUU A;  2F4V I;  1X49 A;  4DPT A;  3F0N A;  1HR0 I;  3K85 A;  5LMN E;  1D6T A;  4JI4 I;  2BM0 A;  3H4L A;  3VYY A;  4DV1 I;  2BM1 A;  3B82 A;  2NUG A;  3J7A M;  4YHH E;  2FTX B;  5T6J A;  3PRY A;  4X8W A;  4R8O A;  1HK7 A;  1KTV A;  4JI8 I;  3ZOQ B;  3ADL A;  2M1S A;  3P1X A;  4DUZ E;  4JV5 E;  1NHJ A;  1ZXM A;  4R1F A;  4JYA I;  3VYX A;  1FNM A;  4LF4 E;  3K6Q A;  4B3R I;  4B3T I;  4MYU A;  1ELO A;  4BS9 A;  3MSW A;  3Q1Q A;  4DR3 I;  4DR1 E;  2L2N A;  5FLX C;  4LF6 E;  2CPN A;  2YT4 A;  1IBL I;  5LMU E;  1UIL A;  2DB2 A;  2UXC I;  2UUC I;  2VQE I;  2CZ9 A;  4LFA I;  4X66 I;  4DV6 E;  1ZM9 A;  1YYK A;  2E1R A;  3HPZ A;  4F9C B;  2IOQ A;  3HQ1 A;  3ZKD A;  3PYD A;  3HJC A;  3ZZT A;  4DR6 E;  2CG9 A;  5ADZ A;  4IZJ D;  4DR5 I;  1NHI A;  4IZJ B;  4K0K I;  3LTO A;  2A2D A;  2UU9 E;  3DJW A;  2V83 A;  1HR0 E;  4DR4 I;  1J5E I;  4J8Z A;  4JI4 E;  1BKN A;  4KHP I;  4DKK A;  3Q6N A;  4BCA A;  5GME A;  1USV A;  4DV1 E;  1OJ4 A;  4LF5 E;  1H74 A;  4JI0 I;  4JI3 I;  4JI7 I;  2Z5E A;  5IWA E;  4JI8 E;  2LUQ A;  2LUP B;  2IHR 1;  4M1K A;  2HHH E;  2B9D A;  3QT5 A;  4RPF A;  2K4V A;  2DEI A;  4DXL A;  4LF8 E;  1FKA E;  4YHH I;  4X62 E;  4DV0 E;  2J7K A;  2ZIT A;  2MC6 A;  2LTR A;  3C4B A;  3IWC A;  4JV5 I;  4DUZ I;  4F9A B;  4GEQ B;  1UEK A;  2V86 A;  4IZJ A;  4LF4 I;  1YYW A;  1FI4 A;  4USK A;  2RTX A;  4DV4 E;  2V89 A;  3ZM7 A;  5DNY A;  4Q28 A;  4ZVI A;  4DR1 I;  1H73 A;  1ZM3 A;  3V5R A;  4LU9 A;  2WW4 A;  3FIG A;  1Z5A A;  5LMU I;  1PIE A;  1S16 A;  3QT7 A;  4GKJ I;  1N33 E;  4WFT A;  2AJ4 A;  4DR5 E;  2VF3 A;  4K0K E;  1HNW I;  2V2Z A;  4B3M I;  1RRE A;  4OX9 E;  4LF7 I;  4LFC I;  2A2C A;  4DR4 E;  1FWL A;  3DF6 A;  3HXL A;  4I8O A;  4DPW A;  4DR6 I;  5FLX Q;  4WUC A;  2RS6 A;  4DPY A;  4Z7Y A;  1X47 A;  4NXN I;  2L2K B;  2RS7 A;  4DV5 I;  1Y4U A;  3KWR A;  2V2Q A;  1Z5C A;  2UU9 I;  1KKH A;  4FW9 A;  1DQ3 A;  4FWG A;  2XEX A;  3LML A;  1J26 A;  1B62 A;  2JOB A;  1WHQ A;  2KON A;  1YZ9 A;  4JI2 E;  1N32 I;  2PNL A;  4DMI A;  4LF5 I;  3J7Y p;  4YY3 E;  2DIX A;  3JTZ A;  2JVA A;  5IWA I;  3JAM Q;  1H72 C;  4AQY E;  2HHH I;  1HNZ I;  1MU5 A;  4UTG A;  5A2Q C;  2HK2 A;  4P52 A;  1PVG A;  4LF8 I;  4X62 I;  4PU9 A;  2Z5B B;  4DV0 I;  4LF9 E;  2V87 A;  1XNQ E;  2G7H A;  2LRS A;  2B3T B;  1PKP A;  2LJH A;  4GKK E;  3AUZ A;  4GKJ E;  4WYQ B;  4DV4 I;  3HTX A;  3IWD A;  1Z0G A;  2GS8 A;  1Z0T A;  1HNW E;  4B3M E;  1STU A;  4LF7 E;  4F9B B;  1NHH A;  4LFC E;  1Z0W A;  3PYF A;  4PRX A;  2UXD I;  1Z0C A;  5GMD A;  1QU6 A;  1N33 I;  4NXN E;  4ED4 A;  2Q2E B;  4DV5 E;  1Z0V A;  1HNX I;  4OX9 I;  1A6F A;  3CWV A;  4JI1 I;  4R03 A;  3J7A G;  4FWD A;  1T4O A;  2O1W A;  1QZR A;  2ODR C;  5AE3 A;  2E1M A;  3OTO I;  4WUB A;  2L2M A;  2Z5B A;  1N32 E;  4M30 A;  5AE1 A;  2UUB E;  4DV2 E;  4L5N C;  3ZZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...