4LF5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf5E02
4GKKE 2AJ4A 1Z0TA 5IWAI 4JI6I 1STUA 1VISA 5LMNI 2MDRA 5LMNE 4MYUA 2LTRA 4FN5A 4DUYI 1Z59A 4DU8A 4LFCI 4KQVA 4OX9I 3ADIA 1N0UA 1FJGE 5LMUE 3C4TA 1NHHA 4JI8I 1WUUA 4DR3I 2HK3A 2A2DA 4FWDA 4LF9I 4OX9E 4B3MI 1B63A 1J26A 1H72C 1ZXNA 1N34E 4LF8I 1BKNA 4LF7E 4JI3E 4DKKA 1GQEA 1IBME 2HHHE 4DV4I 2BM0A 2RSMA 4JG4A 4URLA 3ZZUA 4I3HA 4YY3I 3T1HI 2ZM6E 4DV1E 2L33A 3LPSA 1FKAE 2LBSB 1YYWA 1EA6A 4HACA 2NUEA 1HNWE 1N0VC 2UU9E 4JI1E 3PYGA 1KTVA 4LFBI 4LF9E 2ZITA 4LF4I 4KHPE 1N36I 4JI0E 1Z0GA 4Z7CA 2NA2A 2BV3A 4LF7I 4LF6I 4HACB 4DV3I 4JV5I 1O0WA 4LFCE 2B3TB 2DMYA 2RTXA 2RS7A 1N34I 2N3GA 4B3SE 1XNRE 1UILA 2E1RA 4JYAE 2UUCI 3J7AM 4FW9A 2LRSA 3J7Yp 1KKHA 2CPNA 4DR2I 1KIJA 4X66E 2NUGA 4DR4I 1ELOA 4K0KI 3WU4A 4GKKI 4WYQB 1ZXMA 3ZZTA 3K17A 4DV2I 3J7AG 4X62E 1FI4A 2IHR1 4B3RE 1ZM9A 3B78A 1Z0WA 1HNWI 2L2MA 4B3RI 2L3CA 2ZBKB 1Z5CA 4MYTA 4JI0I 2J7KA 3LNUA 1N36E 2R3VA 1J5EE 2UXBE 5A2QQ 4JI5E 1H74A 4UTGA 1NZ0A 2GS8A 2UXCE 3WU6A 1HR0E 4DR6I 1IBMI 5GMDA 1MX0A 3V2UC 4B3ME 5FLXC 4LFAE 3WU5A 4YHHI 1NHIA 5L3JA 4LFAI 3ZKDA 3PYDA 1N33I 1ZBTA 2L3JA 4HXZA 1Z5BA 4X64I 4B3TI 4DV0E 2L2KB 3GONA 2F4VI 4NXNI 1S4EA 2EFGA 4X65E 2V2ZA 3ADJA 3ZZ0A 3OTOI 1QU6A 2UUCE 2L2NA 2F4VE 4DPTA 3CWVA 2HKEA 1HNZI 5GMEA 1DARA 4DR2E 1XHKA 3ADLA 2WW4A 1X49A 1XMQI 4B3SI 4DUYE 2LJPA 1FWKA 4DPXA 2LUPB 4UT4A 3P1XA 1N32E 4DR1E 1MG7A 4Z7YA 2X7IA 2NUFA 4B3TE 4X64E 1XNRI 3H4LA 1YYKA 2CZ9A 1KVKA 3HTXA 1DI2A 4LF6E 2OI2A 5LL6R 4WFTA 1OJ4A 4DPUA 3ZKBA 3V5RA 1Z0EA 4JI1I 3T1HE 4JV5E 4YY3E 2UXCI 4LF5I 4JI2I 3JAMQ 4WUBA 2YT4A 1Z5AA 4DV4E 2DEJA 4YHHE 1H7SA 3ADGA 1N32I 2JVAA 4X8WA 1FJGI 2UXBI 3J80Q 2X36A 1Z0CA 2N3HA 1YZ9A 3QT6A 4DV7E 4R1FA 4DR3E 2ZM6I 1PKPA 4DUZE 1IBKI 4DXLA 4JI4E 1RR9A 5IWAE 4JI6E 3WU3A 4DR5I 2LUQA 5IT9Q 5LMUI 4FWHA 3M6AA 4M2ZA 2DIXA 1FWLA 3LLHA 3T1YI 2RS6A 3J81Q 4X65I 4JI3I 4FWGA 1IBKE 1FNMA 2HFSA 3B82A 4DUZI 1ZM2A 2UUBI 1UEKA 1RREA 5FLXQ 2UXDI 1ZM3A 3JAMC 4DV0I 1PVGA 2BM1A 1XMQE 4JI7E 4DV3E 1RC7A 3VYYA 1K47A 3VYXA 2VQFE 4JI8E 4PU9A 1XMOI 1A6FA 4DV5E 3PYEA 1HR0I 4DR5E 4JI4I 4NXNE 4DR7E 4DPWA 3QT7A 1X47A 1B62A 1J5EI 3J81C 2UUAI 4ZVIA 4JI2E 4LF5E 1HNXE 3D4JA 4DR7I 5IT9C 4DV6E 2HHHI 2VF3A 1XMOE 2JY9A 4PRVA 1H7UA 3Q1QA 4WUCA 4EMDA 4DR6E 4USKA 2VQFI 3J80C 1I94E 4GKJI 4M30A 1YYOA 4DV2E 2B7TA 2Q2EB 2NPFA 2LJHA 1U2RA 5BR8E 2UUAE 4DU7A 4ED4A 1MU5A 1XNQE 4OOGC 2R42A 4DR1I 4USMA 1EI1A 2VQEE 4LF8E 2V2QA 3OTOE 4JYAI 3PYFA 1H73A 1NHJA 3T1YE 2DEIA 4XTJA 4DR4E 2UUBE 1XNQI 1Z0BA 1RQ0A 3QT8A 2HK2A 5BR8I 2EZ6A 4HY1A 1S16A 3ZM7A 1Z0VA 2A2CA 2UXDE 5A2QC 2VQEI 2HKJA 4M1KA 1QZRA 1UHZA 2B7VA 4KHPI 3HULA 1HNXI 2XEXA 4AQYE 1EKZA 4NXME 4JI5I 2V2VA 1IBLE 2E5LI 4DV7I 1T4NA 4LF4E 4LFBE 4P7AA 4WUDA 5CFFE 1T4OA 2KHXA 4GKJE 2V8PA 1I94I 2HFUA 4DV6I 4RPFA 3K1JA 1N33E 4DV5I 2DB2A 1WHQA 4PRXA 4DPYA 2E5LE 3C4BA 4DV1I 3B8HA 1T4LB 1D6TA 4AQYI 4P52A 4HYMA 4X66I 1X48A 2UU9I 1WHNA 4JI7I 4X62I 3F0NA 1PIEA 4K0KE 1HNZE 1ZM4A 1IBLI 2LTSA 4NXMI 3LTOA 3QT5A 2V34A
chains in the Genus database with same CATH superfamily
4O4KA 4MU3A 4GKKE 5C0XC 4O24A 4LU9A 2AJ4A 1Z0TA 3L7ZB 2MKDA 4MLVA 5A6AA 1STUA 1XXEA 5IWAI 4JI6I 5KL7A 1VISA 5LMNI 2PO0A 4OO1E 2MDRA 5LMNE 2C37A 4MYUA 2ODRD 4OKGA 2FV4B 2EQ0A 2LTRA 2ELYA 4FN5A 4IFDF 2E1MA 4DUYI 4FK5C 1Z59A 4DU8A 1YFHA 4LFCI 2YTJA 2EM6A 1G2DC 2YRMA 3EPHA 2JP9A 4KQVA 3ADIA 1N0UA 2YTOA 4WSPA 4OX9I 4BMJA 2LMZA 1FJGE 2WNRB 2EN6A 1PJTA 3CDJA 2EOIA 4X9JA 5LMUE 3HPZA 2NN6A 3C4TA 4ZYDA 1NHHA 4JI8I 1WUUA 1IMUA 2EP3A 3IWBA 3AV0A 4DR3I 2HK3A 1A1GA 3Q6MA 2CTDA 2PRTA 4P7DA 1Y4UA 5DRQA 2EOZA 2A2DA 4FWDA 2EM7A 1QNTA 2GHFA 2AE8A 4LF9I 3KWRA 4OX9E 4B3MI 1B63A 4IFDD 1J26A 2M4IA 1H72C 1ZXNA 1N34E 3EPJA 2YTNA 4LF8I 4R2RA 1BKNA 2L6MA 4LF7E 2BBGA 4WPYA 4JI3E 2JEBA 2JXPA 3UHMA 5AASA 4DKKA 2PNLA 3P3CA 1DGCA 4R2AA 1GQEA 2G7HA 1IBME 2HHHE 4WXDA 1N3GA 4DV4I 1R6LA 1AH5A 2BM0A 3DJWA 2RSMA 4JG4A 5EL9A 2EQ1A 2ELZA 4URLA 3ZZUA 4LCFA 4I3HA 4YY3I 3T1HI 1UN6B 3LMLA 2V86A 2ZM6E 4DV1E 2L33A 3LPSA 1KYQA 5ADZA 1FKAE 2EOSA 5AE1A 1L4SA 4MU4A 3C6MA 2DLQA 2EN2A 4BA2A 2Q8UA 2EM3A 3F6GA 2LBSB 4F9BB 1YYWA 1EA6A 2CGEA 4HACA 2NUEA 4U3BA 2CSHA 1HNWE 2UU9E 1N0VC 4P78A 4JI1E 3PYGA 1KTVA 4LFBI 4LF9E 5C0XF 2ZITA 4LF4I 4KHPE 2WBSA 1N36I 4JI0E 4IS1C 4R2SA 1Z0GA 3M85D 4Z7CA 2JEAB 2EOEA 2PNZA 1BB8A 2NA2A 2BV3A 2NN6C 4LF7I 2EPAA 2EPZA 4F9AB 2ENHA 4LF6I 1A1JA 4HACB 2EOOA 2BR2A 4DV3I 1O0WA 3KZYA 3P76A 4JV5I 1EH6A 4LFCE 5A6BA 3C6KA 2B3TB 2DMYA 5KL4A 5JEAA 4NHRA 2EM5A 3GMEA 2RTXA 2RS7A 3KRNA 1N34I 4ZYEA 2N3GA 1PJQA 4B3SE 4FW7A 2NN6D 2MDGA 3P3EA 1XNRE 1UILA 2HGHA 2E1RA 4WX9A 1WJPA 4BBYA 4OO1F 1YUJA 2JEBB 4JYAE 1VI7A 1YSAC 4J3DA 2YTQA 2UUCI 2DMIA 4BA2B 3THOB 5KL6A 3J7AM 1E3PA 4FW9A 2LRSA 3J7Yp 2WP8A 1KKHA 1IBKI 2R76A 5JEAC 1T38A 2CPNA 2PO2A 1UDNA 4DR2I 1KIJA 3MSWA 5FWKA 2LT7A 1SR9A 2ENAA 4QNKA 1IQSA 4X66E 1B69A 1GZ6A 2NUGA 5ELWA 4DR4I 1ELOA 3B4TA 5C0XA 4K0KI 3HQ1A 3WU4A 2EMCA 4WYQB 4GKKI 2NN6F 3M7NG 4LOMA 2V83A 5A69A 1ZXMA 5IV8B 3ZZTA 3BIDA 3K17A 4DV2I 3J7AG 4X62E 1FI4A 2IHR1 4B3RE 1ZM9A 3B78A 1Z0WA 1HNWI 2L2MA 4B3RI 4IZKA 2L3CA 2ZBKB 2A25A 2L92A 1Z5CA 4MYTA 2EPXA 1X6EA 4JI0I 2J7KA 2EE8A 2WBTA 1N36E 3LNUA 4AIDA 1NEIA 2C39A 1J5EE 2UXBE 2DGCA 2R3VA 2WZOA 5A2QQ 4R2CA 4JI5E 2EMBA 1H74A 4UTGA 1NZ0A 2NN6B 1P42A 1YHCA 2GS8A 3HJCA 2UXCE 3GCMA 3WU6A 1JK2A 1HR0E 3U1KA 2EPLX 1IBMI 4DR6I 5GMDA 1MX0A 3V2UC 4B3ME 5FLXC 4LFAE 2PO1B 3HXLA 4R2DA 1NHIA 2KOUA 3WU5A 5L3JA 4YHHI 2VESA 3ZKDA 4BC7A 3PYDA 4LFAI 1N33I 1ZBTA 2E72A 3EQ1A 2L3JA 2MKNA 5T6JA 2EOXA 2EPKX 2YTGA 1Y5YA 1Z5BA 4HXZA 1OYPA 4N4RB 4IZKB 1JK1A 3M85G 2Z5CB 5K36D 4X64I 3PS1A 4B3TI 4DV0E 2L2KB 1T39A 3GONA 1YPNA 2F4VI 2EMXA 2MC5A 2YWQA 3JTZA 3JU0A 3K6QA 4O5GA 4WSGA 2GLIA 4NXNI 4MLQA 1S4EA 2EFGA 4X65E 4IZJA 4N3OA 2V2ZA 3ADJA 4R2EA 3HKMA 4R8OA 3TQMA 2JR1A 3ZZ0A 4R2QA 2F8BA 2CT1A 3OTOI 1QU6A 1Y6ZA 2YPNA 2UUCE 2L2NA 2LCEA 2LO3A 2LV2A 2F4VE 4HTGA 3F6HA 3M99B 2EORA 2EPRA 2I9IA 3CWVA 4DPTA 3MHHC 2HKEA 1HNZI 5GMEA 1DARA 4J8ZA 4DR2E 1XHKA 4R2PA 4BA1B 3ADLA 2WW4A 1X49A 1XMQI 2PNZB 4B3SI 4DUYE 2LJPA 2NN6E 2ENCA 1MGTA 2MC6A 2V88A 2YSPA 5KL3A 3EPLA 3QG5C 1FWKA 4DPXA 4TUGA 5KL5A 2LUPB 4UT4A 3P1XA 1N32E 4M0VA 2M7QA 4DR1E 1MG7A 1UDOA 4Z7YA 2X7IA 3HPSA 1WRJA 2NUFA 4B3TE 2JOXA 4X64E 4NBQA 2JE6B 4BHCA 4ZYHA 1YYKA 3H4LA 2CZ9A 1KVKA 2O1WA 1XNRI 2O1TA 3HTXA 1DI2A 4LF6E 4MDTA 4RHBB 3PS3A 2OI2A 5DNXA 2JEAA 2NABA 5LL6R 3K85A 2EJ4A 2EPMX 2B9DA 5LLQA 1YUIA 4WFTA 2Z5EA 1PJSA 2O1UA 1OJ4A 1MEYC 4DPUA 3ZKBA 4IS9A 2LE2A 3V5RA 4BHBA 2EN3A 1KJKA 3T1HE 4JV5E 2EL4A 2V89A 4YY3E 5DNYA 1ZAAC 4IZJB 4JI1I 2UXCI 5A6KA 3P3GA 4LF5I 5K36E 4U3DA 4JI2I 3JAMQ 5DNLA 2YTEA 4WUBA 2YT4A 2EOJA 1Z5AA 4DV4E 2DEJA 4YHHE 1H7SA 4GZNC 3ADGA 2RPCA 4KZSA 1YH8A 4MU0A 2EMLA 3NZKA 2EPPA 4LPFA 2IERA 2RSIA 2JVAA 2YRKA 1A1LA 4X8WA 1N32I 2FGGA 1FJGI 2EOYA 1R6MA 2UXBI 3ZOQB 2X36A 2N8XA 1Z0CA 2EMKA 3BBGA 1X3CA 2GQ0A 4FW4A 3J80Q 3PRYA 2D9HA 2N3HA 1YZ9A 3QT6A 3RMPA 4DV7E 4R1FA 4DR3E 2ZM6I 1PKPA 1ZU1A 2JE6A 2JOBA 3AUZA 2DSYA 4O43A 4DUZE 1OYRA 4DXLA 1I94I 2EN4A 4Q35B 4JI4E 1RR9A 5IWAE 4JI6E 3WU3A 5JEAF 2LUQA 4DR5I 5IT9Q 4LCGA 5LMUI 4FWHA 3M6AA 5JEAD 4M2ZA 3THNA 2Z5CA 4F2JC 2DIXA 1BBOA 1FWLA 2C39B 3LLHA 2PO0B 2F1DA 3T1YI 2J7JA 2O1VA 2RS6A 5AE3A 2EN1A 1X6FA 3ECRA 4WXCA 2GO4A 4HEIA 3J81Q 2LJUA 4X65I 4JI3I 2EM4A 4FWGA 2CVEA 1IBKE 1FNMA 2GO3A 2HFSA 3B82A 4DUZI 1ZM2A 2UUBI 1UEKA 4FW6A 4MU1A 1RHYA 1RREA 3DD6A 2JPAA 5FLXQ 2UXDI 1ZM3A 3JAMC 4DV0I 1PVGA 2BM1A 1XMQE 1UDSA 4OO1A 4IZJD 4JI7E 4DV3E 5DROA 1RC7A 2EQ3A 5AC5A 3VYYA 2IESA 1DQ3A 2M1SA 4NZVA 1F2IG 5DRRA 3L00A 5K36B 1K47A 1SFEA 3VYXA 2VQFE 4GQUA 5K36A 4JI8E 1PDAA 2I13A 1USUA 4R03A 5C0XD 4PU9A 1EH8A 2JT2A 5AC4A 1XMOI 1A6FA 2V87A 4IJDA 4DV5E 4L5NC 3PYEA 1HR0I 4DR5E 2LVHA 1BBGA 2EOFA 4JI4I 4NXNE 4DR7E 5AE2A 3M7ND 4M9VC 3UK3C 2EMYA 4DPWA 2EMHA 2PNMA 2EOHA 3QT7A 1X47A 1B62A 1J5EI 1GTKA 3J81C 4BC9A 2WBUA 4BS9A 2EN8A 3EPKA 1Z1BA 4ZVIA 2EPUA 2UUAI 1ZBQA 3P06A 4TUIA 4JI2E 2YRHA 4MQYA 4LF5E 2KONA 1HNXE 3D4JA 4DR7I 5IT9C 4DV6E 1RMDA 2EM9A 2RQLA 2VF3A 2M9AA 2HHHI 5F3WA 2PO2B 1A1HA 4IFDA 2EMFA 2EMAA 2WP8B 4LCHA 1XMOE 2JY9A 4BCAA 4I8OA 4PRVA 2GPIA 1H7UA 3Q1QA 1E3HA 4WUCA 4EMDA 4DR6E 4FW3A 4USKA 2VQFI 2YSOA 4F6NA 3J80C 2IOQA 2CG9A 1I94E 4GKJI 4M30A 1WXRA 1YYOA 4DV2E 2B7TA 2Z5BB 2Q2EB 3CDIA 2NPFA 5A6BD 2EMZA 2LJHA 1U2RA 2BA1D 5BR8E 2UUAE 2VRDA 4DU7A 4ED4A 4OO1C 1LLMC 1MU5A 2K7IA 4OOGC 1XNQE 2H36X 2R42A 4DR1I 4USMA 1EI1A 1UDQA 1A1IA 5C0XB 4AIMA 2VQEE 4LF8E 1TF3A 2L8TA 2EMGA 2HJJA 2YU8A 3OTOE 4DMIA 2V2QA 3H1CA 4AM3A 3PYFA 4JYAI 2ADRA 1H73A 1NHJA 3T1YE 2DEIA 2YU5A 1USVA 1TN9A 3DF6A 4ISAA 1NCSA 2EPCA 4DR4E 2UUBE 4XTJA 3IWCA 2V85A 1XNQI 1IQOA 4L8NA 1Z0BA 2V8QB 3Q6NA 2EM2A 5DRPA 4FW5A 1RQ0A 4IFDC 3QT8A 2VF1A 2HK2A 5BR8I 2YZTA 2EZ6A 4HY1A 2YTPA 1S16A 3ZM7A 1Z0VA 2JWOA 5JEAE 2DRPA 4LTYA 2BB8A 1Z0EA 1ZR9A 5A2QC 2UXDE 2A2CA 1TF6A 2O3ZA 3MHSC 2VQEI 2HKJA 4KWYA 4OZEA 2VE7C 2EMWA 4ZYGA 4M1KA 2K4VA 4OO1D 4QNJA 1QZRA 5JEAB 1UHZA 2B7VA 4KHPI 3FIGA 3HULA 3IWDA 2IOPA 1X6HA 1HNXI 2EM0A 2XEXA 4AQYE 1EKZA 3H09A 3BGHA 4NXME 2EPOA 1IBLE 2BR2B 2V2VA 4JI5I 1OYSA 1EH7A 2EM8A 4F54A 5IXMB 2E5LI 2EL5A 2BA0D 4DV7I 2EPNA 1T4NA 4RH8A 5KL2A 4F6MA 4LF4E 1HK7A 2EL6A 4LFBE 5K36F 4P7AA 4WUDA 5CFFE 1T4OA 2KHXA 5C0XE 2DLKA 3BF2A 4GKJE 2JYAA 2V8PA 2HC5A 5A6JA 1A1FA 2HFUA 4GEQB 1UBDC 2R1FA 2C37B 2WCC3 3K1JA 4RPFA 4IFDE 1N33E 2Z5BA 2EMIA 4DV5I 3OMLA 2YTDA 2DB2A 1WHQA 2YTFA 4BA1A 1X5WA 2EOMA 2BA0G 4PRXA 4DPYA 2E5LE 3C4BA 4DV1I 2EOQA 1AAYA 2EN7A 3B8HA 1T4LB 1G2FC 1D6TA 4AQYI 2FTXB 4HYMA 3GLLA 4P52A 5K36C 4IFDB 4X66I 1X48A 4Q28A 1WHNA 3PS2A 2J65A 1Y4SA 2WNRA 5TSEA 2UU9I 4JI7I 4X62I 2ODRC 2EWLA 1A1KA 2C38B 3F0NA 1PIEA 2YTIA 3VHTB 5EKWA 2PO1A 2C38A 3KZZA 1Y60A 4K0KE 1HNZE 4DV6I 3U1YA 1ZM4A 1IBLI 2LTSA 4NXMI 3LTOA 2BA1G 4OO1B 3L7ZA 3QT5A 1P47A 4F9CB 3VK6A 2V34A
chains in the Genus database with same CATH topology
4GKKE 4LU9A 2AJ4A 1Z0TA 5IWAI 4JI6I 1STUA 1VISA 5LMNI 2MDRA 5LMNE 4MYUA 2ODRD 2FV4B 2LTRA 4FN5A 2E1MA 4DUYI 1Z59A 4DU8A 4LFCI 4KQVA 4OX9I 3ADIA 1N0UA 4WSPA 4BMJA 2LMZA 1FJGE 5LMUE 3HPZA 3C4TA 1NHHA 4JI8I 1WUUA 3IWBA 3AV0A 4DR3I 2HK3A 3Q6MA 4P7DA 1Y4UA 2A2DA 4FWDA 4LF9I 3KWRA 4OX9E 4B3MI 1B63A 1J26A 2M4IA 1H72C 1ZXNA 1N34E 4LF8I 1BKNA 2L6MA 4LF7E 4WPYA 4JI3E 5AASA 4DKKA 2PNLA 1GQEA 2G7HA 1IBME 2HHHE 4DV4I 2BM0A 3DJWA 2RSMA 4JG4A 4URLA 3ZZUA 4I3HA 4YY3I 3T1HI 3LMLA 2V86A 2ZM6E 4DV1E 2L33A 3LPSA 5ADZA 1FKAE 5AE1A 2CGEA 3F6GA 2LBSB 4F9BB 1YYWA 1EA6A 4HACA 2NUEA 1HNWE 1N0VC 2UU9E 4P78A 4JI1E 3PYGA 1KTVA 4LFBI 4LF9E 2ZITA 4LF4I 4KHPE 1N36I 4JI0E 1Z0GA 4Z7CA 2NA2A 2BV3A 4LF7I 4F9AB 4LF6I 4HACB 4DV3I 4JV5I 1O0WA 4LFCE 2B3TB 2DMYA 2RTXA 2RS7A 1N34I 2N3GA 4B3SE 1XNRE 1UILA 2E1RA 4BBYA 4JYAE 2UUCI 3J7AM 4FW9A 2LRSA 3J7Yp 1KKHA 2CPNA 4DR2I 1KIJA 3MSWA 5FWKA 1SR9A 4X66E 1GZ6A 2NUGA 4DR4I 1ELOA 4K0KI 3HQ1A 3WU4A 4GKKI 4WYQB 2V83A 1ZXMA 3ZZTA 3K17A 4DV2I 3J7AG 4X62E 1FI4A 2IHR1 4B3RE 1ZM9A 3B78A 1Z0WA 1HNWI 2L2MA 4B3RI 4IZKA 2L3CA 2ZBKB 2L92A 1Z5CA 4MYTA 4JI0I 2J7KA 3LNUA 1N36E 2R3VA 1J5EE 2UXBE 5A2QQ 2WZOA 4JI5E 1H74A 4UTGA 1NZ0A 2GS8A 3HJCA 2UXCE 3WU6A 1HR0E 4DR6I 1IBMI 5GMDA 1MX0A 3V2UC 4B3ME 5FLXC 4LFAE 3HXLA 3WU5A 1NHIA 2KOUA 4YHHI 5L3JA 4LFAI 3ZKDA 4BC7A 3PYDA 1N33I 1ZBTA 2L3JA 5T6JA 4HXZA 1Z5BA 4IZKB 2Z5CB 4X64I 4B3TI 4DV0E 2L2KB 3GONA 2F4VI 2MC5A 3JTZA 3JU0A 3K6QA 4NXNI 1S4EA 2EFGA 4X65E 4IZJA 4N3OA 2V2ZA 3ADJA 4R8OA 3ZZ0A 2JR1A 2F8BA 3OTOI 1QU6A 1Y6ZA 2UUCE 2L2NA 2F4VE 3F6HA 4DPTA 3CWVA 2HKEA 1HNZI 5GMEA 1DARA 4J8ZA 4DR2E 1XHKA 3ADLA 2WW4A 1X49A 1XMQI 4B3SI 4DUYE 2LJPA 2MC6A 2V88A 1FWKA 4DPXA 4TUGA 2LUPB 4UT4A 3P1XA 1N32E 4M0VA 2M7QA 4DR1E 1MG7A 4Z7YA 2X7IA 3HPSA 2NUFA 4B3TE 2JOXA 4X64E 1XNRI 3H4LA 1YYKA 2CZ9A 1KVKA 2O1WA 2O1TA 3HTXA 1DI2A 4LF6E 2OI2A 3K85A 5LL6R 2B9DA 4WFTA 2Z5EA 2O1UA 1OJ4A 4DPUA 3ZKBA 2LE2A 3V5RA 1Z0EA 4JI1I 3T1HE 4JV5E 2V89A 4YY3E 4IZJB 5DNYA 2UXCI 4LF5I 4JI2I 3JAMQ 4WUBA 2YT4A 1Z5AA 4DV4E 2DEJA 4YHHE 1H7SA 3ADGA 4KZSA 1N32I 2JVAA 4X8WA 2FGGA 1FJGI 2UXBI 3ZOQB 2X36A 3J80Q 1Z0CA 2GQ0A 3PRYA 2N3HA 1YZ9A 3QT6A 3RMPA 4DV7E 4R1FA 4DR3E 2ZM6I 1PKPA 2JOBA 3AUZA 2DSYA 4DUZE 1IBKI 4DXLA 4JI4E 1RR9A 5IWAE 4JI6E 3WU3A 4DR5I 2LUQA 5IT9Q 5LMUI 4FWHA 3M6AA 4M2ZA 2Z5CA 2DIXA 1FWLA 3LLHA 3T1YI 2O1VA 2RS6A 5AE3A 3J81Q 4X65I 4JI3I 4FWGA 1IBKE 1FNMA 2HFSA 3B82A 4DUZI 1ZM2A 2UUBI 1UEKA 1RREA 5FLXQ 2UXDI 1ZM3A 3JAMC 4DV0I 1PVGA 2BM1A 1XMQE 4IZJD 4JI7E 4DV3E 1RC7A 3VYYA 1DQ3A 2M1SA 1K47A 3VYXA 2VQFE 4JI8E 1USUA 4R03A 4PU9A 1XMOI 1A6FA 2V87A 4DV5E 4L5NC 3PYEA 1HR0I 4DR5E 4JI4I 4NXNE 4DR7E 5AE2A 4DPWA 2PNMA 3QT7A 1X47A 1B62A 1J5EI 3J81C 4BC9A 4BS9A 2UUAI 4ZVIA 1ZBQA 3P06A 4TUIA 4JI2E 4LF5E 2KONA 1HNXE 3D4JA 4DR7I 5IT9C 4DV6E 2HHHI 2VF3A 5F3WA 1XMOE 2JY9A 4BCAA 4I8OA 4PRVA 1H7UA 3Q1QA 4WUCA 4EMDA 4DR6E 4USKA 2VQFI 3J80C 2IOQA 2CG9A 1I94E 4GKJI 4M30A 1WXRA 1YYOA 4DV2E 2B7TA 2Z5BB 2Q2EB 2NPFA 2LJHA 1U2RA 5BR8E 2UUAE 4DU7A 4ED4A 1MU5A 1XNQE 4OOGC 2R42A 2H36X 4DR1I 4USMA 1EI1A 2VQEE 4LF8E 2L8TA 2V2QA 3OTOE 4DMIA 4JYAI 3PYFA 1H73A 1NHJA 3T1YE 2DEIA 1USVA 3DF6A 4XTJA 4DR4E 2UUBE 3IWCA 2V85A 1XNQI 1Z0BA 4L8NA 2V8QB 3Q6NA 1RQ0A 3QT8A 2VF1A 2HK2A 5BR8I 2YZTA 2EZ6A 4HY1A 1S16A 3ZM7A 1Z0VA 2JWOA 4LTYA 5A2QC 2UXDE 2A2CA 2VQEI 2HKJA 2VE7C 4M1KA 2K4VA 1QZRA 1UHZA 2B7VA 4KHPI 3FIGA 3HULA 3IWDA 2IOPA 1HNXI 2XEXA 4AQYE 1EKZA 3H09A 4NXME 4JI5I 2V2VA 1IBLE 4F54A 2E5LI 4DV7I 1HK7A 1T4NA 4LF4E 4LFBE 4P7AA 4WUDA 5CFFE 1T4OA 2KHXA 4GKJE 2V8PA 1I94I 2HFUA 4DV6I 4GEQB 4RPFA 3K1JA 1N33E 2Z5BA 4DV5I 3OMLA 2DB2A 1WHQA 4PRXA 4DPYA 2E5LE 3C4BA 4DV1I 3B8HA 1T4LB 1D6TA 4AQYI 2FTXB 4HYMA 4P52A 4X66I 1X48A 4Q28A 1WHNA 2UU9I 1Y4SA 4JI7I 4X62I 2ODRC 2EWLA 3F0NA 1PIEA 4K0KE 1HNZE 1ZM4A 1IBLI 2LTSA 4NXMI 3LTOA 3QT5A 4F9CB 3VK6A 2V34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK E;  2AJ4 A;  1Z0T A;  5IWA I;  4JI6 I;  1STU A;  1VIS A;  5LMN I;  2MDR A;  5LMN E;  4MYU A;  2LTR A;  4FN5 A;  4DUY I;  1Z59 A;  4DU8 A;  4LFC I;  4KQV A;  4OX9 I;  3ADI A;  1N0U A;  1FJG E;  5LMU E;  3C4T A;  1NHH A;  4JI8 I;  1WUU A;  4DR3 I;  2HK3 A;  2A2D A;  4FWD A;  4LF9 I;  4OX9 E;  4B3M I;  1B63 A;  1J26 A;  1H72 C;  1ZXN A;  1N34 E;  4LF8 I;  1BKN A;  4LF7 E;  4JI3 E;  4DKK A;  1GQE A;  1IBM E;  2HHH E;  4DV4 I;  2BM0 A;  2RSM A;  4JG4 A;  4URL A;  3ZZU A;  4I3H A;  4YY3 I;  3T1H I;  2ZM6 E;  4DV1 E;  2L33 A;  3LPS A;  1FKA E;  2LBS B;  1YYW A;  1EA6 A;  4HAC A;  2NUE A;  1HNW E;  1N0V C;  2UU9 E;  4JI1 E;  3PYG A;  1KTV A;  4LFB I;  4LF9 E;  2ZIT A;  4LF4 I;  4KHP E;  1N36 I;  4JI0 E;  1Z0G A;  4Z7C A;  2NA2 A;  2BV3 A;  4LF7 I;  4LF6 I;  4HAC B;  4DV3 I;  4JV5 I;  1O0W A;  4LFC E;  2B3T B;  2DMY A;  2RTX A;  2RS7 A;  1N34 I;  2N3G A;  4B3S E;  1XNR E;  1UIL A;  2E1R A;  4JYA E;  2UUC I;  3J7A M;  4FW9 A;  2LRS A;  3J7Y p;  1KKH A;  2CPN A;  4DR2 I;  1KIJ A;  4X66 E;  2NUG A;  4DR4 I;  1ELO A;  4K0K I;  3WU4 A;  4GKK I;  4WYQ B;  1ZXM A;  3ZZT A;  3K17 A;  4DV2 I;  3J7A G;  4X62 E;  1FI4 A;  2IHR 1;  4B3R E;  1ZM9 A;  3B78 A;  1Z0W A;  1HNW I;  2L2M A;  4B3R I;  2L3C A;  2ZBK B;  1Z5C A;  4MYT A;  4JI0 I;  2J7K A;  3LNU A;  1N36 E;  2R3V A;  1J5E E;  2UXB E;  5A2Q Q;  4JI5 E;  1H74 A;  4UTG A;  1NZ0 A;  2GS8 A;  2UXC E;  3WU6 A;  1HR0 E;  4DR6 I;  1IBM I;  5GMD A;  1MX0 A;  3V2U C;  4B3M E;  5FLX C;  4LFA E;  3WU5 A;  4YHH I;  1NHI A;  5L3J A;  4LFA I;  3ZKD A;  3PYD A;  1N33 I;  1ZBT A;  2L3J A;  4HXZ A;  1Z5B A;  4X64 I;  4B3T I;  4DV0 E;  2L2K B;  3GON A;  2F4V I;  4NXN I;  1S4E A;  2EFG A;  4X65 E;  2V2Z A;  3ADJ A;  3ZZ0 A;  3OTO I;  1QU6 A;  2UUC E;  2L2N A;  2F4V E;  4DPT A;  3CWV A;  2HKE A;  1HNZ I;  5GME A;  1DAR A;  4DR2 E;  1XHK A;  3ADL A;  2WW4 A;  1X49 A;  1XMQ I;  4B3S I;  4DUY E;  2LJP A;  1FWK A;  4DPX A;  2LUP B;  4UT4 A;  3P1X A;  1N32 E;  4DR1 E;  1MG7 A;  4Z7Y A;  2X7I A;  2NUF A;  4B3T E;  4X64 E;  1XNR I;  3H4L A;  1YYK A;  2CZ9 A;  1KVK A;  3HTX A;  1DI2 A;  4LF6 E;  2OI2 A;  5LL6 R;  4WFT A;  1OJ4 A;  4DPU A;  3ZKB A;  3V5R A;  1Z0E A;  4JI1 I;  3T1H E;  4JV5 E;  4YY3 E;  2UXC I;  4LF5 I;  4JI2 I;  3JAM Q;  4WUB A;  2YT4 A;  1Z5A A;  4DV4 E;  2DEJ A;  4YHH E;  1H7S A;  3ADG A;  1N32 I;  2JVA A;  4X8W A;  1FJG I;  2UXB I;  3J80 Q;  2X36 A;  1Z0C A;  2N3H A;  1YZ9 A;  3QT6 A;  4DV7 E;  4R1F A;  4DR3 E;  2ZM6 I;  1PKP A;  4DUZ E;  1IBK I;  4DXL A;  4JI4 E;  1RR9 A;  5IWA E;  4JI6 E;  3WU3 A;  4DR5 I;  2LUQ A;  5IT9 Q;  5LMU I;  4FWH A;  3M6A A;  4M2Z A;  2DIX A;  1FWL A;  3LLH A;  3T1Y I;  2RS6 A;  3J81 Q;  4X65 I;  4JI3 I;  4FWG A;  1IBK E;  1FNM A;  2HFS A;  3B82 A;  4DUZ I;  1ZM2 A;  2UUB I;  1UEK A;  1RRE A;  5FLX Q;  2UXD I;  1ZM3 A;  3JAM C;  4DV0 I;  1PVG A;  2BM1 A;  1XMQ E;  4JI7 E;  4DV3 E;  1RC7 A;  3VYY A;  1K47 A;  3VYX A;  2VQF E;  4JI8 E;  4PU9 A;  1XMO I;  1A6F A;  4DV5 E;  3PYE A;  1HR0 I;  4DR5 E;  4JI4 I;  4NXN E;  4DR7 E;  4DPW A;  3QT7 A;  1X47 A;  1B62 A;  1J5E I;  3J81 C;  2UUA I;  4ZVI A;  4JI2 E;  4LF5 E;  1HNX E;  3D4J A;  4DR7 I;  5IT9 C;  4DV6 E;  2HHH I;  2VF3 A;  1XMO E;  2JY9 A;  4PRV A;  1H7U A;  3Q1Q A;  4WUC A;  4EMD A;  4DR6 E;  4USK A;  2VQF I;  3J80 C;  1I94 E;  4GKJ I;  4M30 A;  1YYO A;  4DV2 E;  2B7T A;  2Q2E B;  2NPF A;  2LJH A;  1U2R A;  5BR8 E;  2UUA E;  4DU7 A;  4ED4 A;  1MU5 A;  1XNQ E;  4OOG C;  2R42 A;  4DR1 I;  4USM A;  1EI1 A;  2VQE E;  4LF8 E;  2V2Q A;  3OTO E;  4JYA I;  3PYF A;  1H73 A;  1NHJ A;  3T1Y E;  2DEI A;  4XTJ A;  4DR4 E;  2UUB E;  1XNQ I;  1Z0B A;  1RQ0 A;  3QT8 A;  2HK2 A;  5BR8 I;  2EZ6 A;  4HY1 A;  1S16 A;  3ZM7 A;  1Z0V A;  2A2C A;  2UXD E;  5A2Q C;  2VQE I;  2HKJ A;  4M1K A;  1QZR A;  1UHZ A;  2B7V A;  4KHP I;  3HUL A;  1HNX I;  2XEX A;  4AQY E;  1EKZ A;  4NXM E;  4JI5 I;  2V2V A;  1IBL E;  2E5L I;  4DV7 I;  1T4N A;  4LF4 E;  4LFB E;  4P7A A;  4WUD A;  5CFF E;  1T4O A;  2KHX A;  4GKJ E;  2V8P A;  1I94 I;  2HFU A;  4DV6 I;  4RPF A;  3K1J A;  1N33 E;  4DV5 I;  2DB2 A;  1WHQ A;  4PRX A;  4DPY A;  2E5L E;  3C4B A;  4DV1 I;  3B8H A;  1T4L B;  1D6T A;  4AQY I;  4P52 A;  4HYM A;  4X66 I;  1X48 A;  2UU9 I;  1WHN A;  4JI7 I;  4X62 I;  3F0N A;  1PIE A;  4K0K E;  1HNZ E;  1ZM4 A;  1IBL I;  2LTS A;  4NXM I;  3LTO A;  3QT5 A;  2V34 A; 
#chains in the Genus database with same CATH topology
 4O4K A;  4MU3 A;  4GKK E;  5C0X C;  4O24 A;  4LU9 A;  2AJ4 A;  1Z0T A;  3L7Z B;  2MKD A;  4MLV A;  5A6A A;  1STU A;  1XXE A;  5IWA I;  4JI6 I;  5KL7 A;  1VIS A;  5LMN I;  2PO0 A;  4OO1 E;  2MDR A;  5LMN E;  2C37 A;  4MYU A;  2ODR D;  4OKG A;  2FV4 B;  2EQ0 A;  2LTR A;  2ELY A;  4FN5 A;  4IFD F;  2E1M A;  4DUY I;  4FK5 C;  1Z59 A;  4DU8 A;  1YFH A;  4LFC I;  2YTJ A;  2EM6 A;  1G2D C;  2YRM A;  3EPH A;  2JP9 A;  4KQV A;  3ADI A;  1N0U A;  2YTO A;  4WSP A;  4OX9 I;  4BMJ A;  2LMZ A;  1FJG E;  2WNR B;  2EN6 A;  1PJT A;  3CDJ A;  2EOI A;  4X9J A;  5LMU E;  3HPZ A;  2NN6 A;  3C4T A;  4ZYD A;  1NHH A;  4JI8 I;  1WUU A;  1IMU A;  2EP3 A;  3IWB A;  3AV0 A;  4DR3 I;  2HK3 A;  1A1G A;  3Q6M A;  2CTD A;  2PRT A;  4P7D A;  1Y4U A;  5DRQ A;  2EOZ A;  2A2D A;  4FWD A;  2EM7 A;  1QNT A;  2GHF A;  2AE8 A;  4LF9 I;  3KWR A;  4OX9 E;  4B3M I;  1B63 A;  4IFD D;  1J26 A;  2M4I A;  1H72 C;  1ZXN A;  1N34 E;  3EPJ A;  2YTN A;  4LF8 I;  4R2R A;  1BKN A;  2L6M A;  4LF7 E;  2BBG A;  4WPY A;  4JI3 E;  2JEB A;  2JXP A;  3UHM A;  5AAS A;  4DKK A;  2PNL A;  3P3C A;  1DGC A;  4R2A A;  1GQE A;  2G7H A;  1IBM E;  2HHH E;  4WXD A;  1N3G A;  4DV4 I;  1R6L A;  1AH5 A;  2BM0 A;  3DJW A;  2RSM A;  4JG4 A;  5EL9 A;  2EQ1 A;  2ELZ A;  4URL A;  3ZZU A;  4LCF A;  4I3H A;  4YY3 I;  3T1H I;  1UN6 B;  3LML A;  2V86 A;  2ZM6 E;  4DV1 E;  2L33 A;  3LPS A;  1KYQ A;  5ADZ A;  1FKA E;  2EOS A;  5AE1 A;  1L4S A;  4MU4 A;  3C6M A;  2DLQ A;  2EN2 A;  4BA2 A;  2Q8U A;  2EM3 A;  3F6G A;  2LBS B;  4F9B B;  1YYW A;  1EA6 A;  2CGE A;  4HAC A;  2NUE A;  4U3B A;  2CSH A;  1HNW E;  2UU9 E;  1N0V C;  4P78 A;  4JI1 E;  3PYG A;  1KTV A;  4LFB I;  4LF9 E;  5C0X F;  2ZIT A;  4LF4 I;  4KHP E;  2WBS A;  1N36 I;  4JI0 E;  4IS1 C;  4R2S A;  1Z0G A;  3M85 D;  4Z7C A;  2JEA B;  2EOE A;  2PNZ A;  1BB8 A;  2NA2 A;  2BV3 A;  2NN6 C;  4LF7 I;  2EPA A;  2EPZ A;  4F9A B;  2ENH A;  4LF6 I;  1A1J A;  4HAC B;  2EOO A;  2BR2 A;  4DV3 I;  1O0W A;  3KZY A;  3P76 A;  4JV5 I;  1EH6 A;  4LFC E;  5A6B A;  3C6K A;  2B3T B;  2DMY A;  5KL4 A;  5JEA A;  4NHR A;  2EM5 A;  3GME A;  2RTX A;  2RS7 A;  3KRN A;  1N34 I;  4ZYE A;  2N3G A;  1PJQ A;  4B3S E;  4FW7 A;  2NN6 D;  2MDG A;  3P3E A;  1XNR E;  1UIL A;  2HGH A;  2E1R A;  4WX9 A;  1WJP A;  4BBY A;  4OO1 F;  1YUJ A;  2JEB B;  4JYA E;  1VI7 A;  1YSA C;  4J3D A;  2YTQ A;  2UUC I;  2DMI A;  4BA2 B;  3THO B;  5KL6 A;  3J7A M;  1E3P A;  4FW9 A;  2LRS A;  3J7Y p;  2WP8 A;  1KKH A;  1IBK I;  2R76 A;  5JEA C;  1T38 A;  2CPN A;  2PO2 A;  1UDN A;  4DR2 I;  1KIJ A;  3MSW A;  5FWK A;  2LT7 A;  1SR9 A;  2ENA A;  4QNK A;  1IQS A;  4X66 E;  1B69 A;  1GZ6 A;  2NUG A;  5ELW A;  4DR4 I;  1ELO A;  3B4T A;  5C0X A;  4K0K I;  3HQ1 A;  3WU4 A;  2EMC A;  4WYQ B;  4GKK I;  2NN6 F;  3M7N G;  4LOM A;  2V83 A;  5A69 A;  1ZXM A;  5IV8 B;  3ZZT A;  3BID A;  3K17 A;  4DV2 I;  3J7A G;  4X62 E;  1FI4 A;  2IHR 1;  4B3R E;  1ZM9 A;  3B78 A;  1Z0W A;  1HNW I;  2L2M A;  4B3R I;  4IZK A;  2L3C A;  2ZBK B;  2A25 A;  2L92 A;  1Z5C A;  4MYT A;  2EPX A;  1X6E A;  4JI0 I;  2J7K A;  2EE8 A;  2WBT A;  1N36 E;  3LNU A;  4AID A;  1NEI A;  2C39 A;  1J5E E;  2UXB E;  2DGC A;  2R3V A;  2WZO A;  5A2Q Q;  4R2C A;  4JI5 E;  2EMB A;  1H74 A;  4UTG A;  1NZ0 A;  2NN6 B;  1P42 A;  1YHC A;  2GS8 A;  3HJC A;  2UXC E;  3GCM A;  3WU6 A;  1JK2 A;  1HR0 E;  3U1K A;  2EPL X;  1IBM I;  4DR6 I;  5GMD A;  1MX0 A;  3V2U C;  4B3M E;  5FLX C;  4LFA E;  2PO1 B;  3HXL A;  4R2D A;  1NHI A;  2KOU A;  3WU5 A;  5L3J A;  4YHH I;  2VES A;  3ZKD A;  4BC7 A;  3PYD A;  4LFA I;  1N33 I;  1ZBT A;  2E72 A;  3EQ1 A;  2L3J A;  2MKN A;  5T6J A;  2EOX A;  2EPK X;  2YTG A;  1Y5Y A;  1Z5B A;  4HXZ A;  1OYP A;  4N4R B;  4IZK B;  1JK1 A;  3M85 G;  2Z5C B;  5K36 D;  4X64 I;  3PS1 A;  4B3T I;  4DV0 E;  2L2K B;  1T39 A;  3GON A;  1YPN A;  2F4V I;  2EMX A;  2MC5 A;  2YWQ A;  3JTZ A;  3JU0 A;  3K6Q A;  4O5G A;  4WSG A;  2GLI A;  4NXN I;  4MLQ A;  1S4E A;  2EFG A;  4X65 E;  4IZJ A;  4N3O A;  2V2Z A;  3ADJ A;  4R2E A;  3HKM A;  4R8O A;  3TQM A;  2JR1 A;  3ZZ0 A;  4R2Q A;  2F8B A;  2CT1 A;  3OTO I;  1QU6 A;  1Y6Z A;  2YPN A;  2UUC E;  2L2N A;  2LCE A;  2LO3 A;  2LV2 A;  2F4V E;  4HTG A;  3F6H A;  3M99 B;  2EOR A;  2EPR A;  2I9I A;  3CWV A;  4DPT A;  3MHH C;  2HKE A;  1HNZ I;  5GME A;  1DAR A;  4J8Z A;  4DR2 E;  1XHK A;  4R2P A;  4BA1 B;  3ADL A;  2WW4 A;  1X49 A;  1XMQ I;  2PNZ B;  4B3S I;  4DUY E;  2LJP A;  2NN6 E;  2ENC A;  1MGT A;  2MC6 A;  2V88 A;  2YSP A;  5KL3 A;  3EPL A;  3QG5 C;  1FWK A;  4DPX A;  4TUG A;  5KL5 A;  2LUP B;  4UT4 A;  3P1X A;  1N32 E;  4M0V A;  2M7Q A;  4DR1 E;  1MG7 A;  1UDO A;  4Z7Y A;  2X7I A;  3HPS A;  1WRJ A;  2NUF A;  4B3T E;  2JOX A;  4X64 E;  4NBQ A;  2JE6 B;  4BHC A;  4ZYH A;  1YYK A;  3H4L A;  2CZ9 A;  1KVK A;  2O1W A;  1XNR I;  2O1T A;  3HTX A;  1DI2 A;  4LF6 E;  4MDT A;  4RHB B;  3PS3 A;  2OI2 A;  5DNX A;  2JEA A;  2NAB A;  5LL6 R;  3K85 A;  2EJ4 A;  2EPM X;  2B9D A;  5LLQ A;  1YUI A;  4WFT A;  2Z5E A;  1PJS A;  2O1U A;  1OJ4 A;  1MEY C;  4DPU A;  3ZKB A;  4IS9 A;  2LE2 A;  3V5R A;  4BHB A;  2EN3 A;  1KJK A;  3T1H E;  4JV5 E;  2EL4 A;  2V89 A;  4YY3 E;  5DNY A;  1ZAA C;  4IZJ B;  4JI1 I;  2UXC I;  5A6K A;  3P3G A;  4LF5 I;  5K36 E;  4U3D A;  4JI2 I;  3JAM Q;  5DNL A;  2YTE A;  4WUB A;  2YT4 A;  2EOJ A;  1Z5A A;  4DV4 E;  2DEJ A;  4YHH E;  1H7S A;  4GZN C;  3ADG A;  2RPC A;  4KZS A;  1YH8 A;  4MU0 A;  2EML A;  3NZK A;  2EPP A;  4LPF A;  2IER A;  2RSI A;  2JVA A;  2YRK A;  1A1L A;  4X8W A;  1N32 I;  2FGG A;  1FJG I;  2EOY A;  1R6M A;  2UXB I;  3ZOQ B;  2X36 A;  2N8X A;  1Z0C A;  2EMK A;  3BBG A;  1X3C A;  2GQ0 A;  4FW4 A;  3J80 Q;  3PRY A;  2D9H A;  2N3H A;  1YZ9 A;  3QT6 A;  3RMP A;  4DV7 E;  4R1F A;  4DR3 E;  2ZM6 I;  1PKP A;  1ZU1 A;  2JE6 A;  2JOB A;  3AUZ A;  2DSY A;  4O43 A;  4DUZ E;  1OYR A;  4DXL A;  1I94 I;  2EN4 A;  4Q35 B;  4JI4 E;  1RR9 A;  5IWA E;  4JI6 E;  3WU3 A;  5JEA F;  2LUQ A;  4DR5 I;  5IT9 Q;  4LCG A;  5LMU I;  4FWH A;  3M6A A;  5JEA D;  4M2Z A;  3THN A;  2Z5C A;  4F2J C;  2DIX A;  1BBO A;  1FWL A;  2C39 B;  3LLH A;  2PO0 B;  2F1D A;  3T1Y I;  2J7J A;  2O1V A;  2RS6 A;  5AE3 A;  2EN1 A;  1X6F A;  3ECR A;  4WXC A;  2GO4 A;  4HEI A;  3J81 Q;  2LJU A;  4X65 I;  4JI3 I;  2EM4 A;  4FWG A;  2CVE A;  1IBK E;  1FNM A;  2GO3 A;  2HFS A;  3B82 A;  4DUZ I;  1ZM2 A;  2UUB I;  1UEK A;  4FW6 A;  4MU1 A;  1RHY A;  1RRE A;  3DD6 A;  2JPA A;  5FLX Q;  2UXD I;  1ZM3 A;  3JAM C;  4DV0 I;  1PVG A;  2BM1 A;  1XMQ E;  1UDS A;  4OO1 A;  4IZJ D;  4JI7 E;  4DV3 E;  5DRO A;  1RC7 A;  2EQ3 A;  5AC5 A;  3VYY A;  2IES A;  1DQ3 A;  2M1S A;  4NZV A;  1F2I G;  5DRR A;  3L00 A;  5K36 B;  1K47 A;  1SFE A;  3VYX A;  2VQF E;  4GQU A;  5K36 A;  4JI8 E;  1PDA A;  2I13 A;  1USU A;  4R03 A;  5C0X D;  4PU9 A;  1EH8 A;  2JT2 A;  5AC4 A;  1XMO I;  1A6F A;  2V87 A;  4IJD A;  4DV5 E;  4L5N C;  3PYE A;  1HR0 I;  4DR5 E;  2LVH A;  1BBG A;  2EOF A;  4JI4 I;  4NXN E;  4DR7 E;  5AE2 A;  3M7N D;  4M9V C;  3UK3 C;  2EMY A;  4DPW A;  2EMH A;  2PNM A;  2EOH A;  3QT7 A;  1X47 A;  1B62 A;  1J5E I;  1GTK A;  3J81 C;  4BC9 A;  2WBU A;  4BS9 A;  2EN8 A;  3EPK A;  1Z1B A;  4ZVI A;  2EPU A;  2UUA I;  1ZBQ A;  3P06 A;  4TUI A;  4JI2 E;  2YRH A;  4MQY A;  4LF5 E;  2KON A;  1HNX E;  3D4J A;  4DR7 I;  5IT9 C;  4DV6 E;  1RMD A;  2EM9 A;  2RQL A;  2VF3 A;  2M9A A;  2HHH I;  5F3W A;  2PO2 B;  1A1H A;  4IFD A;  2EMF A;  2EMA A;  2WP8 B;  4LCH A;  1XMO E;  2JY9 A;  4BCA A;  4I8O A;  4PRV A;  2GPI A;  1H7U A;  3Q1Q A;  1E3H A;  4WUC A;  4EMD A;  4DR6 E;  4FW3 A;  4USK A;  2VQF I;  2YSO A;  4F6N A;  3J80 C;  2IOQ A;  2CG9 A;  1I94 E;  4GKJ I;  4M30 A;  1WXR A;  1YYO A;  4DV2 E;  2B7T A;  2Z5B B;  2Q2E B;  3CDI A;  2NPF A;  5A6B D;  2EMZ A;  2LJH A;  1U2R A;  2BA1 D;  5BR8 E;  2UUA E;  2VRD A;  4DU7 A;  4ED4 A;  4OO1 C;  1LLM C;  1MU5 A;  2K7I A;  4OOG C;  1XNQ E;  2H36 X;  2R42 A;  4DR1 I;  4USM A;  1EI1 A;  1UDQ A;  1A1I A;  5C0X B;  4AIM A;  2VQE E;  4LF8 E;  1TF3 A;  2L8T A;  2EMG A;  2HJJ A;  2YU8 A;  3OTO E;  4DMI A;  2V2Q A;  3H1C A;  4AM3 A;  3PYF A;  4JYA I;  2ADR A;  1H73 A;  1NHJ A;  3T1Y E;  2DEI A;  2YU5 A;  1USV A;  1TN9 A;  3DF6 A;  4ISA A;  1NCS A;  2EPC A;  4DR4 E;  2UUB E;  4XTJ A;  3IWC A;  2V85 A;  1XNQ I;  1IQO A;  4L8N A;  1Z0B A;  2V8Q B;  3Q6N A;  2EM2 A;  5DRP A;  4FW5 A;  1RQ0 A;  4IFD C;  3QT8 A;  2VF1 A;  2HK2 A;  5BR8 I;  2YZT A;  2EZ6 A;  4HY1 A;  2YTP A;  1S16 A;  3ZM7 A;  1Z0V A;  2JWO A;  5JEA E;  2DRP A;  4LTY A;  2BB8 A;  1Z0E A;  1ZR9 A;  5A2Q C;  2UXD E;  2A2C A;  1TF6 A;  2O3Z A;  3MHS C;  2VQE I;  2HKJ A;  4KWY A;  4OZE A;  2VE7 C;  2EMW A;  4ZYG A;  4M1K A;  2K4V A;  4OO1 D;  4QNJ A;  1QZR A;  5JEA B;  1UHZ A;  2B7V A;  4KHP I;  3FIG A;  3HUL A;  3IWD A;  2IOP A;  1X6H A;  1HNX I;  2EM0 A;  2XEX A;  4AQY E;  1EKZ A;  3H09 A;  3BGH A;  4NXM E;  2EPO A;  1IBL E;  2BR2 B;  2V2V A;  4JI5 I;  1OYS A;  1EH7 A;  2EM8 A;  4F54 A;  5IXM B;  2E5L I;  2EL5 A;  2BA0 D;  4DV7 I;  2EPN A;  1T4N A;  4RH8 A;  5KL2 A;  4F6M A;  4LF4 E;  1HK7 A;  2EL6 A;  4LFB E;  5K36 F;  4P7A A;  4WUD A;  5CFF E;  1T4O A;  2KHX A;  5C0X E;  2DLK A;  3BF2 A;  4GKJ E;  2JYA A;  2V8P A;  2HC5 A;  5A6J A;  1A1F A;  2HFU A;  4GEQ B;  1UBD C;  2R1F A;  2C37 B;  2WCC 3;  3K1J A;  4RPF A;  4IFD E;  1N33 E;  2Z5B A;  2EMI A;  4DV5 I;  3OML A;  2YTD A;  2DB2 A;  1WHQ A;  2YTF A;  4BA1 A;  1X5W A;  2EOM A;  2BA0 G;  4PRX A;  4DPY A;  2E5L E;  3C4B A;  4DV1 I;  2EOQ A;  1AAY A;  2EN7 A;  3B8H A;  1T4L B;  1G2F C;  1D6T A;  4AQY I;  2FTX B;  4HYM A;  3GLL A;  4P52 A;  5K36 C;  4IFD B;  4X66 I;  1X48 A;  4Q28 A;  1WHN A;  3PS2 A;  2J65 A;  1Y4S A;  2WNR A;  5TSE A;  2UU9 I;  4JI7 I;  4X62 I;  2ODR C;  2EWL A;  1A1K A;  2C38 B;  3F0N A;  1PIE A;  2YTI A;  3VHT B;  5EKW A;  2PO1 A;  2C38 A;  3KZZ A;  1Y60 A;  4K0K E;  1HNZ E;  4DV6 I;  3U1Y A;  1ZM4 A;  1IBL I;  2LTS A;  4NXM I;  3LTO A;  2BA1 G;  4OO1 B;  3L7Z A;  3QT5 A;  1P47 A;  4F9C B;  3VK6 A;  2V34 A; 
#chains in the Genus database with same CATH homology
 4GKK E;  4LU9 A;  2AJ4 A;  1Z0T A;  5IWA I;  4JI6 I;  1STU A;  1VIS A;  5LMN I;  2MDR A;  5LMN E;  4MYU A;  2ODR D;  2FV4 B;  2LTR A;  4FN5 A;  2E1M A;  4DUY I;  1Z59 A;  4DU8 A;  4LFC I;  4KQV A;  4OX9 I;  3ADI A;  1N0U A;  4WSP A;  4BMJ A;  2LMZ A;  1FJG E;  5LMU E;  3HPZ A;  3C4T A;  1NHH A;  4JI8 I;  1WUU A;  3IWB A;  3AV0 A;  4DR3 I;  2HK3 A;  3Q6M A;  4P7D A;  1Y4U A;  2A2D A;  4FWD A;  4LF9 I;  3KWR A;  4OX9 E;  4B3M I;  1B63 A;  1J26 A;  2M4I A;  1H72 C;  1ZXN A;  1N34 E;  4LF8 I;  1BKN A;  2L6M A;  4LF7 E;  4WPY A;  4JI3 E;  5AAS A;  4DKK A;  2PNL A;  1GQE A;  2G7H A;  1IBM E;  2HHH E;  4DV4 I;  2BM0 A;  3DJW A;  2RSM A;  4JG4 A;  4URL A;  3ZZU A;  4I3H A;  4YY3 I;  3T1H I;  3LML A;  2V86 A;  2ZM6 E;  4DV1 E;  2L33 A;  3LPS A;  5ADZ A;  1FKA E;  5AE1 A;  2CGE A;  3F6G A;  2LBS B;  4F9B B;  1YYW A;  1EA6 A;  4HAC A;  2NUE A;  1HNW E;  1N0V C;  2UU9 E;  4P78 A;  4JI1 E;  3PYG A;  1KTV A;  4LFB I;  4LF9 E;  2ZIT A;  4LF4 I;  4KHP E;  1N36 I;  4JI0 E;  1Z0G A;  4Z7C A;  2NA2 A;  2BV3 A;  4LF7 I;  4F9A B;  4LF6 I;  4HAC B;  4DV3 I;  4JV5 I;  1O0W A;  4LFC E;  2B3T B;  2DMY A;  2RTX A;  2RS7 A;  1N34 I;  2N3G A;  4B3S E;  1XNR E;  1UIL A;  2E1R A;  4BBY A;  4JYA E;  2UUC I;  3J7A M;  4FW9 A;  2LRS A;  3J7Y p;  1KKH A;  2CPN A;  4DR2 I;  1KIJ A;  3MSW A;  5FWK A;  1SR9 A;  4X66 E;  1GZ6 A;  2NUG A;  4DR4 I;  1ELO A;  4K0K I;  3HQ1 A;  3WU4 A;  4GKK I;  4WYQ B;  2V83 A;  1ZXM A;  3ZZT A;  3K17 A;  4DV2 I;  3J7A G;  4X62 E;  1FI4 A;  2IHR 1;  4B3R E;  1ZM9 A;  3B78 A;  1Z0W A;  1HNW I;  2L2M A;  4B3R I;  4IZK A;  2L3C A;  2ZBK B;  2L92 A;  1Z5C A;  4MYT A;  4JI0 I;  2J7K A;  3LNU A;  1N36 E;  2R3V A;  1J5E E;  2UXB E;  5A2Q Q;  2WZO A;  4JI5 E;  1H74 A;  4UTG A;  1NZ0 A;  2GS8 A;  3HJC A;  2UXC E;  3WU6 A;  1HR0 E;  4DR6 I;  1IBM I;  5GMD A;  1MX0 A;  3V2U C;  4B3M E;  5FLX C;  4LFA E;  3HXL A;  3WU5 A;  1NHI A;  2KOU A;  4YHH I;  5L3J A;  4LFA I;  3ZKD A;  4BC7 A;  3PYD A;  1N33 I;  1ZBT A;  2L3J A;  5T6J A;  4HXZ A;  1Z5B A;  4IZK B;  2Z5C B;  4X64 I;  4B3T I;  4DV0 E;  2L2K B;  3GON A;  2F4V I;  2MC5 A;  3JTZ A;  3JU0 A;  3K6Q A;  4NXN I;  1S4E A;  2EFG A;  4X65 E;  4IZJ A;  4N3O A;  2V2Z A;  3ADJ A;  4R8O A;  3ZZ0 A;  2JR1 A;  2F8B A;  3OTO I;  1QU6 A;  1Y6Z A;  2UUC E;  2L2N A;  2F4V E;  3F6H A;  4DPT A;  3CWV A;  2HKE A;  1HNZ I;  5GME A;  1DAR A;  4J8Z A;  4DR2 E;  1XHK A;  3ADL A;  2WW4 A;  1X49 A;  1XMQ I;  4B3S I;  4DUY E;  2LJP A;  2MC6 A;  2V88 A;  1FWK A;  4DPX A;  4TUG A;  2LUP B;  4UT4 A;  3P1X A;  1N32 E;  4M0V A;  2M7Q A;  4DR1 E;  1MG7 A;  4Z7Y A;  2X7I A;  3HPS A;  2NUF A;  4B3T E;  2JOX A;  4X64 E;  1XNR I;  3H4L A;  1YYK A;  2CZ9 A;  1KVK A;  2O1W A;  2O1T A;  3HTX A;  1DI2 A;  4LF6 E;  2OI2 A;  3K85 A;  5LL6 R;  2B9D A;  4WFT A;  2Z5E A;  2O1U A;  1OJ4 A;  4DPU A;  3ZKB A;  2LE2 A;  3V5R A;  1Z0E A;  4JI1 I;  3T1H E;  4JV5 E;  2V89 A;  4YY3 E;  4IZJ B;  5DNY A;  2UXC I;  4LF5 I;  4JI2 I;  3JAM Q;  4WUB A;  2YT4 A;  1Z5A A;  4DV4 E;  2DEJ A;  4YHH E;  1H7S A;  3ADG A;  4KZS A;  1N32 I;  2JVA A;  4X8W A;  2FGG A;  1FJG I;  2UXB I;  3ZOQ B;  2X36 A;  3J80 Q;  1Z0C A;  2GQ0 A;  3PRY A;  2N3H A;  1YZ9 A;  3QT6 A;  3RMP A;  4DV7 E;  4R1F A;  4DR3 E;  2ZM6 I;  1PKP A;  2JOB A;  3AUZ A;  2DSY A;  4DUZ E;  1IBK I;  4DXL A;  4JI4 E;  1RR9 A;  5IWA E;  4JI6 E;  3WU3 A;  4DR5 I;  2LUQ A;  5IT9 Q;  5LMU I;  4FWH A;  3M6A A;  4M2Z A;  2Z5C A;  2DIX A;  1FWL A;  3LLH A;  3T1Y I;  2O1V A;  2RS6 A;  5AE3 A;  3J81 Q;  4X65 I;  4JI3 I;  4FWG A;  1IBK E;  1FNM A;  2HFS A;  3B82 A;  4DUZ I;  1ZM2 A;  2UUB I;  1UEK A;  1RRE A;  5FLX Q;  2UXD I;  1ZM3 A;  3JAM C;  4DV0 I;  1PVG A;  2BM1 A;  1XMQ E;  4IZJ D;  4JI7 E;  4DV3 E;  1RC7 A;  3VYY A;  1DQ3 A;  2M1S A;  1K47 A;  3VYX A;  2VQF E;  4JI8 E;  1USU A;  4R03 A;  4PU9 A;  1XMO I;  1A6F A;  2V87 A;  4DV5 E;  4L5N C;  3PYE A;  1HR0 I;  4DR5 E;  4JI4 I;  4NXN E;  4DR7 E;  5AE2 A;  4DPW A;  2PNM A;  3QT7 A;  1X47 A;  1B62 A;  1J5E I;  3J81 C;  4BC9 A;  4BS9 A;  2UUA I;  4ZVI A;  1ZBQ A;  3P06 A;  4TUI A;  4JI2 E;  4LF5 E;  2KON A;  1HNX E;  3D4J A;  4DR7 I;  5IT9 C;  4DV6 E;  2HHH I;  2VF3 A;  5F3W A;  1XMO E;  2JY9 A;  4BCA A;  4I8O A;  4PRV A;  1H7U A;  3Q1Q A;  4WUC A;  4EMD A;  4DR6 E;  4USK A;  2VQF I;  3J80 C;  2IOQ A;  2CG9 A;  1I94 E;  4GKJ I;  4M30 A;  1WXR A;  1YYO A;  4DV2 E;  2B7T A;  2Z5B B;  2Q2E B;  2NPF A;  2LJH A;  1U2R A;  5BR8 E;  2UUA E;  4DU7 A;  4ED4 A;  1MU5 A;  1XNQ E;  4OOG C;  2R42 A;  2H36 X;  4DR1 I;  4USM A;  1EI1 A;  2VQE E;  4LF8 E;  2L8T A;  2V2Q A;  3OTO E;  4DMI A;  4JYA I;  3PYF A;  1H73 A;  1NHJ A;  3T1Y E;  2DEI A;  1USV A;  3DF6 A;  4XTJ A;  4DR4 E;  2UUB E;  3IWC A;  2V85 A;  1XNQ I;  1Z0B A;  4L8N A;  2V8Q B;  3Q6N A;  1RQ0 A;  3QT8 A;  2VF1 A;  2HK2 A;  5BR8 I;  2YZT A;  2EZ6 A;  4HY1 A;  1S16 A;  3ZM7 A;  1Z0V A;  2JWO A;  4LTY A;  5A2Q C;  2UXD E;  2A2C A;  2VQE I;  2HKJ A;  2VE7 C;  4M1K A;  2K4V A;  1QZR A;  1UHZ A;  2B7V A;  4KHP I;  3FIG A;  3HUL A;  3IWD A;  2IOP A;  1HNX I;  2XEX A;  4AQY E;  1EKZ A;  3H09 A;  4NXM E;  4JI5 I;  2V2V A;  1IBL E;  4F54 A;  2E5L I;  4DV7 I;  1HK7 A;  1T4N A;  4LF4 E;  4LFB E;  4P7A A;  4WUD A;  5CFF E;  1T4O A;  2KHX A;  4GKJ E;  2V8P A;  1I94 I;  2HFU A;  4DV6 I;  4GEQ B;  4RPF A;  3K1J A;  1N33 E;  2Z5B A;  4DV5 I;  3OML A;  2DB2 A;  1WHQ A;  4PRX A;  4DPY A;  2E5L E;  3C4B A;  4DV1 I;  3B8H A;  1T4L B;  1D6T A;  4AQY I;  2FTX B;  4HYM A;  4P52 A;  4X66 I;  1X48 A;  4Q28 A;  1WHN A;  2UU9 I;  1Y4S A;  4JI7 I;  4X62 I;  2ODR C;  2EWL A;  3F0N A;  1PIE A;  4K0K E;  1HNZ E;  1ZM4 A;  1IBL I;  2LTS A;  4NXM I;  3LTO A;  3QT5 A;  4F9C B;  3VK6 A;  2V34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...