4LF5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf5E02
1UILA 1EA6A 4DR3I 4DUYE 2B7VA 3K17A 2RTXA 4DV5I 1KVKA 4FW9A 4DR5E 4R1FA 4DV4I 4DR7I 1UHZA 2UU9E 2VQFE 1H74A 1H7UA 3WU6A 4DR4I 1FWKA 1O0WA 4Z7YA 4NXNE 2X7IA 1MU5A 3QT8A 2E5LE 2DEIA 2R3VA 1ZXMA 4DKKA 2DEJA 2Q2EB 1Z0CA 1ZM3A 2V2VA 2HHHI 3HULA 1RREA 1NHIA 4JI6I 2UXBI 1U2RA 3ZZ0A 2NA2A 1N33E 2DB2A 1EI1A 4DR2E 2ZM6E 1MX0A 4GKJI 1H72C 1Z5BA 4DPTA 4JI4I 3T1YE 1IBLI 3J81C 2LUQA 1A6FA 1FNMA 2R42A 2JVAA 1VISA 3C4TA 4USKA 1H7SA 4LFBI 4B3TE 1Z0TA 2LTRA 2IHR1 1ZM2A 1HNXI 3ZZTA 3P1XA 1YYKA 4MYTA 4B3SI 1YZ9A 4JI8E 2EZ6A 1STUA 1KIJA 2V2QA 2E1RA 4JV5E 2VQEE 3LPSA 4JI5E 5GMDA 4LFAE 1ZXNA 2MDRA 4P7AA 1XNRI 3Q1QA 1HR0I 4X64E 2LJHA 1Z5AA 4AQYI 1HNWI 4B3ME 1FWLA 4HYMA 4DPUA 1KTVA 3VYYA 5IT9Q 4JI1I 1HNZI 1ZM9A 4DV2I 2NUEA 2UUBI 2RS6A 1DI2A 2HFUA 3HTXA 4OX9E 4LF5I 5A2QC 2L33A 3J7AM 3WU5A 1X47A 4YHHE 2LTSA 1YYOA 1N32E 4PRVA 4K0KE 2V2ZA 2F4VE 2GS8A 1ZBTA 5FLXC 1EKZA 3T1HI 1X48A 4DR3E 1N36I 4JI7I 2RSMA 3J7AG 4DV5E 1T4OA 1KKHA 4KQVA 4DV4E 4DR7E 1Z0EA 4DV6I 4I3HA 4DR4E 3C4BA 2NUFA 4LFCI 2L2KB 1ELOA 1NZ0A 2ZITA 2L3CA 5LMUI 3JAMQ 4X66I 4LF9I 2HHHE 1X49A 3J81Q 4LF6I 4DUZI 2UUAI 4YY3I 4JI6E 4B3RI 2UXBE 3B82A 4JI3I 3OTOI 1S4EA 1RQ0A 4DR1I 2VF3A 2XEXA 1Z0WA 2B3TB 4WFTA 4GKJE 3ZKDA 3LLHA 4JI4E 1IBLE 4WYQB 2AJ4A 3ZKBA 4GKKI 3H4LA 1Z0BA 4RPFA 1NHJA 4DXLA 4MYUA 4LFBE 1QU6A 1XMOI 4DR6I 1HNXE 4X62I 3LTOA 4NXMI 4LF4I 4B3SE 2LJPA 4DU7A 1I94I 4DV3I 2UXCI 4FWHA 4KHPI 1FKAE 4X8WA 1IBKI 2BM0A 4WUCA 1WHNA 1XNRE 5BR8I 1HR0E 4FWDA 4JG4A 3J80C 1H73A 4M1KA 2L2MA 4AQYE 1B62A 4M2ZA 1BKNA 5L3JA 4JI1E 1HNZE 2A2DA 4DV2E 4FWGA 1RC7A 2UUBE 5CFFE 4LF7I 2KHXA 5FLXQ 3PYEA 4UTGA 4LF5E 3F0NA 4ED4A 5IWAI 3D4JA 1YYWA 2YT4A 2A2CA 4JI0I 3ZM7A 2DIXA 1FJGI 1WUUA 2UXDI 1XNQI 2JY9A 4JYAI 5LL6R 3QT7A 1IBMI 3PYDA 1XMQI 2HKEA 3ADJA 4DV7I 1J5EI 2EFGA 4DV1I 1DARA 1N36E 4JI7E 2UUCI 2LBSB 4PRXA 1PKPA 1Z0VA 4X65I 4DV6E 3LNUA 3WU3A 2HK2A 4HACB 4LFCE 1XHKA 4Z7CA 5LMUE 4JI2I 2X36A 3CWVA 4X66E 2LRSA 4YHHI 4LF9E 4LF6E 4DUZE 4K0KI 2UUAE 5LMNI 4YY3E 3WU4A 4B3RE 4JI3E 4DPYA 1B63A 3V2UC 4UT4A 1T4NA 4DR1E 1RR9A 2CZ9A 2HKJA 4LF8I 4HY1A 4DV0I 1N34I 4DUYI 2NPFA 4GKKE 3QT5A 2ZBKB 4DR5I 2B7TA 2UU9I 2L2NA 2VQFI 3ADLA 1XMOE 1ZM4A 3PYGA 3J80Q 4DR6E 4DPWA 3V5RA 4NXNI 4X62E 4WUDA 2WW4A 4NXME 4LF4E 2RS7A 2E5LI 1I94E 4DV3E 2UXCE 4KHPE 3PYFA 5GMEA 2L3JA 1IBKE 1WHQA 5BR8E 2BM1A 2N3GA 1N33I 1J26A 3JAMC 1OJ4A 2CPNA 2V8PA 4DR2I 2ZM6I 4ZVIA 4DU8A 1K47A 1HNWE 2NUGA 5A2QQ 3T1YI 1PIEA 4LF7E 3ADIA 4WUBA 2BV3A 4USMA 1N0VC 1QZRA 1NHHA 4FN5A 4B3TI 1GQEA 5IWAE 4XTJA 4JI0E 1FJGE 2UXDE 1XNQE 3QT6A 4JYAE 4JI8I 3ZZUA 1IBME 1XMQE 4JV5I 1N0UA 2LUPB 2VQEI 4JI5I 1Z0GA 4DV7E 4P52A 4LFAI 3VYXA 3GONA 1J5EE 4DV1E 4X64I 2V34A 2OI2A 2UUCE 3K1JA 1MG7A 3T1HE 3J7Yp 4B3MI 4X65E 1UEKA 1FI4A 2HFSA 1S16A 4M30A 1T4LB 3B8HA 4HXZA 2DMYA 2HK3A 4EMDA 4JI2E 2J7KA 4OX9I 3ADGA 3B78A 5LMNE 5IT9C 4URLA 1Z59A 1N32I 1PVGA 2F4VI 4LF8E 4HACA 4PU9A 4DPXA 1D6TA 3OTOE 4DV0E 1Z5CA 1N34E 2N3HA 4OOGC 3M6AA
chains in the Genus database with same CATH superfamily
4AM3A 1UILA 3EPHA 1Y4UA 2WBSA 1EA6A 4DR3I 4DUYE 4LCGA 1SFEA 4J3DA 2B7VA 2YTGA 4I8OA 4DMIA 3IWCA 3K17A 2RTXA 4DV5I 1KVKA 2EPXA 4FW9A 3KRNA 4DR5E 4R1FA 4IJDA 4DV4I 4DR7I 3AUZA 3M85G 1UHZA 2BBGA 2UU9E 3M7NG 2VQFE 4O4KA 1H74A 2O3ZA 2IERA 1H7UA 2O1TA 3WU6A 4F6NA 1AAYA 1FWKA 4DR4I 1X6FA 1USUA 1O0WA 4Z7YA 4NXNE 1QNTA 3P76A 2X7IA 5T6JA 1MU5A 3QT8A 4MU1A 2EMCA 1RMDA 3DF6A 4LPFA 2E5LE 2RQLA 2VF1A 2DEIA 2R3VA 4IFDC 1ZXMA 4ZYGA 4IZKB 4BHBA 4DKKA 4MDTA 1UDNA 4MU4A 1R6MA 2DEJA 1JK2A 2Q2EB 5A6BA 2Z5CB 1Z0CA 2V87A 2F8BA 5EKWA 1ZM3A 2V2VA 1EH8A 2E72A 2Z5EA 2Z5BA 3HULA 3P3GA 2HHHI 1RREA 4OKGA 1JK1A 2YTNA 1NHIA 2EL6A 4JI6I 2UXBI 1UBDC 1U2RA 2Q8UA 3ZZ0A 2NA2A 1N33E 2V83A 5A6AA 2DB2A 2D9HA 5JEAF 1EI1A 4DR2E 3L00A 5AC5A 2ZM6E 5K36D 1MX0A 4OO1E 4GKJI 1H72C 2HC5A 1Z5BA 4IFDE 4DPTA 2CSHA 2WBTA 4JI4I 3T1YE 1IBLI 2ENAA 3J81C 2YSPA 2LUQA 1A6FA 1FNMA 3CDJA 2R42A 4OZEA 2JVAA 1A1GA 1VISA 4FW4A 2YTEA 3C4TA 1R6LA 4USKA 3P06A 5KL2A 3U1YA 1BBGA 1H7SA 4LFBI 4B3TE 2YSOA 4O43A 3RMPA 1Z0TA 2LTRA 2IHR1 1ZM2A 2C39A 2JT2A 1HNXI 2EPKX 2NN6F 3ZZTA 3P1XA 1YYKA 1MEYC 4MYTA 5FWKA 2LV2A 2WP8A 4B3SI 5AC4A 2M4IA 2M7QA 2EM4A 4JI8E 1YZ9A 2EMXA 1STUA 2EZ6A 1KIJA 1Z5CA 3P3EA 2V2QA 2E1RA 2LT7A 4JV5E 3OMLA 2YTPA 5KL6A 2LJUA 2VQEE 3PS1A 3LPSA 4IFDD 4JI5E 2C38B 5GMDA 4LFAE 3EPKA 1ZXNA 2JOBA 4F9BB 2MDRA 4GQUA 1YPNA 4IZJA 4R2DA 4P7AA 1XNRI 3Q1QA 1HR0I 4X64E 4FW6A 2EM7A 1YFHA 1A1KA 2LJHA 1Z1BA 2EMFA 5DRPA 3HKMA 1ZAAC 1Z5AA 4AQYI 1HNWI 4B3ME 2EWLA 1FWLA 4BA2B 1PDAA 4L5NC 4OO1A 2WNRA 4HYMA 4DPUA 1KTVA 3VYYA 5IT9Q 4JI1I 1HNZI 2R76A 3C6KA 1P42A 2O1UA 2NN6A 4N4RB 1ZM9A 4DV2I 1RHYA 2NUEA 4FK5C 2UUBI 2EPRA 2RS6A 1DI2A 2DLQA 2HFUA 2R1FA 2PO2A 3DJWA 3HTXA 1IQSA 2BR2A 3HPSA 4BMJA 4OX9E 2PO1A 5DRRA 4LF5I 2MDGA 2HGHA 1IQOA 5A2QC 1TF3A 1Y5YA 2L33A 2EPZA 2GLIA 3J7AM 4ZYHA 4WXDA 3C6MA 3WU5A 2VRDA 1X47A 5TSEA 3L7ZA 4P7DA 5C0XA 3F6GA 4YHHE 2JEBB 2LTSA 4RH8A 1YYOA 2BA1D 2EMLA 1N32E 4PRVA 4K0KE 3U1KA 2V2ZA 2GO3A 2F4VE 2EOMA 2DMIA 2EN4A 1ZBTA 2EPNA 5FLXC 2GS8A 1EKZA 3T1HI 2JEAB 1X48A 1Y6ZA 1YUJA 4NHRA 4DR3E 1N36I 4JI7I 5IV8B 1A1HA 4N3OA 2EPLX 2RSMA 3J7AG 4DV5E 2GHFA 1T4OA 1KKHA 2JE6A 4KQVA 1T39A 5JEAC 2V88A 4DV4E 2EM8A 1PJQA 2EPOA 4DR7E 1X3CA 1T38A 2V89A 1OYSA 1Z0EA 2CVEA 2YRKA 4I3HA 4DV6I 1KJKA 2LE2A 4MU3A 3ZOQB 3GMEA 4DR4E 3C4BA 3TQMA 2NUFA 5A6BD 4ZYDA 2EOHA 3QG5C 4KWYA 4LFCI 2BA1G 2PO0A 4BC9A 3IWBA 2L2KB 3Q6MA 3H1CA 1ZBQA 3MHSC 3IWDA 1ELOA 1NZ0A 4BC7A 2ZITA 2L3CA 2EQ0A 4M9VC 5LMUI 3THNA 3JAMQ 5EL9A 2DLKA 4OO1C 2JWOA 3BBGA 1KYQA 5AASA 4X66I 4LF9I 2HHHE 1X49A 2L92A 3PRYA 3J81Q 4R03A 4DUZI 4LF6I 1G2DC 2EE8A 3EQ1A 4F2JC 2NN6C 2UUAI 4YY3I 4JI6E 5JEAE 4B3RI 2UXBE 5KL4A 3B82A 2EM0A 3OTOI 1WXRA 1UN6B 4JI3I 2EMZA 1S4EA 1RQ0A 4DR1I 2VF3A 5KL3A 4QNJA 2XEXA 1Z0WA 2B3TB 4WXCA 4WFTA 5F3WA 4FW5A 3EPLA 4GKJE 2KOUA 3ZKDA 2ENCA 2EOEA 3LLHA 4JI4E 1IBLE 4WYQB 2AJ4A 3K85A 5C0XC 3ZKBA 4GKKI 2Z5CA 2IOQA 3H4LA 2DGCA 1Z0BA 1NCSA 2L6MA 2RPCA 1NHJA 1OYPA 2ADRA 4RPFA 2EN8A 4F9AB 4DXLA 2NN6E 4MYUA 5LLQA 4LFBE 2WCC3 3KZYA 5K36F 2EOJA 1QU6A 2YTIA 3KWRA 1YUIA 2CGEA 1XMOI 4DR6I 3UHMA 2RSIA 1HNXE 4ISAA 3MSWA 2YTDA 4X62I 3LTOA 4NXMI 1WRJA 4LF4I 1ZU1A 4IZJD 4B3SE 2LJPA 4DU7A 2EOSA 1I94I 2J7JA 4DV3I 2UXCI 4FWHA 4KHPI 4R2CA 1FKAE 5K36B 4NBQA 2C39B 4X8WA 1IBKI 2BM0A 4WUCA 1WHNA 1XNRE 5BR8I 1HR0E 4FWDA 4AIMA 4JG4A 5DNLA 5JEAA 4OO1D 4HTGA 3J80C 1G2FC 1H73A 1YH8A 2GPIA 1Y4SA 2ELYA 4M1KA 1B69A 2L2MA 2NN6D 2EN7A 4AQYE 1B62A 4M2ZA 4IZJB 1BKNA 5L3JA 4P78A 2MKDA 2EPAA 2JOXA 1HNZE 4JI1E 1IMUA 2A2DA 4DV2E 2EORA 4MU0A 2CTDA 4FWGA 1RC7A 2UUBE 5CFFE 4LF7I 2WBUA 3HXLA 2LVHA 3GCMA 2O1VA 2EMWA 2KHXA 2C38A 5AE2A 5FLXQ 4OO1B 1A1IA 1F2IG 5C0XD 1TN9A 3NZKA 2EOFA 4L8NA 2BA0D 3PYEA 4UTGA 4LF5E 3F0NA 4IFDB 4ED4A 5IWAI 3D4JA 1YYWA 1OYRA 4R8OA 2K7IA 4WSPA 2YT4A 2A2CA 2E1MA 4JI0I 2EMKA 3ZM7A 2DIXA 1NEIA 1FJGI 1WUUA 2UXDI 4BCAA 1E3HA 1XNQI 2JY9A 4JYAI 5LL6R 3QT7A 1IBMI 3PYDA 2EOXA 2F1DA 5DNXA 1XMQI 2EQ3A 4BBYA 4Q35B 4TUGA 2HKEA 2LCEA 1SR9A 2EMHA 2N8XA 2V8QB 4J8ZA 3CDIA 2B9DA 3MHHC 3ADJA 4LCHA 4DV7I 4R2RA 3VK6A 1A1JA 2MKNA 1J5EI 2JPAA 2EFGA 1N3GA 2C37A 2IESA 3L7ZB 4DV1I 1DARA 1N36E 2PNZB 2EN1A 2M1SA 4JI7E 2EP3A 2UUCI 3BF2A 2LBSB 2BA0G 4PRXA 2YPNA 5KL7A 2PNLA 2LO3A 1PKPA 2EOIA 1Z0VA 4DV6E 4X65I 1X5WA 3LNUA 3WU3A 2HK2A 2EMBA 2I13A 2YTJA 1BB8A 4M0VA 2JEBA 4HACB 3JTZA 4LFCE 2EMIA 4BHCA 1XHKA 2ODRC 2JE6B 4R2QA 4AIDA 1UDOA 4RHBB 5A69A 4Z7CA 5LMUE 4JI2I 5A6KA 2X36A 3CWVA 3BIDA 1YHCA 4X66E 2LRSA 1A1LA 4YHHI 2JR1A 4LF9E 4X9JA 4LF6E 4DUZE 4R2SA 2ENHA 4K0KI 2UUAE 2EMYA 3JU0A 5LMNI 4WX9A 4YY3E 3WU4A 4B3RE 4JI3E 4BA1A 1TF6A 4MQYA 4DPYA 1B63A 1E3PA 3V2UC 4UT4A 2EL5A 1T4NA 4DR1E 1RR9A 2CZ9A 2HKJA 2VE7C 2EJ4A 4LF8I 3F6HA 4HY1A 2YU5A 4NZVA 4IS1C 3HPZA 4IS9A 4DV0I 1PJTA 1N34I 2G7HA 5A6JA 4DUYI 5AE3A 1PJSA 1DGCA 4GEQB 4F54A 2AE8A 2NPFA 2Z5BB 4GKKE 5K36E 3QT5A 2PNMA 1HK7A 2YWQA 2ZBKB 4DR5I 3AV0A 2IOPA 4IZKA 3VHTB 2B7TA 2V85A 1VI7A 2UU9I 2EPUA 2L2NA 3EPJA 3UK3C 1XMOE 3ADLA 1ZM4A 3PYGA 3J80Q 2VQFI 2DSYA 4DR6E 1USVA 4DPWA 3PS2A 3V5RA 2CG9A 3KZZA 4X62E 4R2AA 4WUDA 4NXNI 4LCFA 4NXME 2WW4A 3H09A 4LF4E 2RS7A 2M9AA 2J65A 2E5LI 2JYAA 5DNYA 1I94E 2PRTA 5JEAD 4DV3E 2UXCE 4KHPE 3PYFA 2H36X 3P3CA 2ODRD 3ECRA 2FV4B 1GTKA 2L3JA 5GMEA 4O5GA 3PS3A 1IBKE 2L8TA 2YRHA 3DD6A 1GZ6A 1WHQA 5BR8E 1DQ3A 2WZOA 1WJPA 3THOB 1A1FA 1L4SA 2BM1A 2N3GA 1N33I 1J26A 3JAMC 1AH5A 1OJ4A 2WP8B 2BB8A 2CPNA 2EOZA 2FTXB 4LTYA 1YSAC 2GQ0A 2V8PA 4QNKA 2ZM6I 4DR2I 2YRMA 2EMGA 4LU9A 4MLVA 4ZVIA 5JEAB 2EM5A 4DU8A 1K47A 2GO4A 1HNWE 2NUGA 4F6MA 3M99B 4U3DA 5A2QQ 3T1YI 1PIEA 4OO1F 5K36A 2EN6A 4LF7E 4IFDF 4HEIA 3ADIA 1P47A 4WUBA 5ELWA 2BV3A 4USMA 2VESA 2ELZA 1N0VC 3BGHA 1NHHA 1QZRA 4FN5A 4FW3A 4LOMA 2MC6A 4R2PA 4B3TI 1GQEA 5IWAE 4XTJA 2EOOA 1EH7A 3FIGA 2EM2A 4KZSA 4GZNC 2FGGA 4JI0E 3HJCA 2YTFA 2WNRB 3LMLA 1UDSA 4Q28A 2YU8A 1FJGE 5AE1A 2UXDE 1XNQE 3QT6A 4JYAE 2NN6B 4JI8I 3ZZUA 1IBME 3K6QA 3GLLA 2YTOA 1XMQE 1LLMC 1Y60A 4JV5I 1N0UA 2EMAA 2LUPB 5C0XF 2VQEI 4BA2A 4JI5I 1Z0GA 3B4TA 4DV7E 4P52A 2I9IA 4TUIA 2PO2B 3VYXA 1ZR9A 4O24A 1J5EE 3GONA 4LFAI 2BR2B 4DV1E 4X64I 2V34A 2PO1B 2KONA 2NABA 5DROA 2OI2A 2UUCE 3K1JA 2JXPA 4WSGA 4IFDA 1MG7A 3T1HE 3J7Yp 5IXMB 4B3MI 2EPMX 2MC5A 5C0XB 1BBOA 4X65E 5ADZA 2EN3A 1FI4A 2EOQA 1UEKA 2HFSA 2DRPA 2A25A 1S16A 2C37B 4M30A 2EM9A 1X6HA 1T4LB 2K4VA 5DRQA 2CT1A 2EM3A 2EM6A 3HQ1A 4BS9A 3B8HA 4HXZA 2HJJA 4ZYEA 2DMYA 2EQ1A 2HK3A 1MGTA 4BA1B 1X6EA 4EMDA 1EH6A 4JI2E 1XXEA 2EL4A 2J7KA 4OX9I 2PNZA 2EN2A 2YZTA 3M85D 2EPPA 3M7ND 3Q6NA 3ADGA 3B78A 5LMNE 5C0XE 2V86A 2JEAA 4F9CB 5IT9C 2YTQA 4U3BA 1UDQA 2EOYA 2O1WA 5K36C 4URLA 4R2EA 2JP9A 1Z59A 2EPCA 1N32I 2PO0B 2LMZA 1PVGA 2F4VI 4LF8E 4WPYA 4HACA 4PU9A 4DPXA 1D6TA 3OTOE 5KL5A 4DV0E 1N34E 4MLQA 2N3HA 4FW7A 4OOGC 3M6AA
chains in the Genus database with same CATH topology
1UILA 1Y4UA 1EA6A 4DR3I 4DUYE 2B7VA 4I8OA 4DMIA 3IWCA 3K17A 2RTXA 4DV5I 1KVKA 4FW9A 4DR5E 4R1FA 4DV4I 4DR7I 3AUZA 1UHZA 2UU9E 2VQFE 1H74A 1H7UA 2O1TA 3WU6A 4DR4I 1FWKA 1USUA 1O0WA 4Z7YA 4NXNE 2X7IA 5T6JA 1MU5A 3QT8A 3DF6A 2E5LE 2DEIA 2VF1A 2R3VA 1ZXMA 4IZKB 4DKKA 2DEJA 2Q2EB 2Z5CB 1Z0CA 2V87A 2F8BA 1ZM3A 2V2VA 2HHHI 2Z5EA 2Z5BA 3HULA 1RREA 1NHIA 4JI6I 2UXBI 1U2RA 3ZZ0A 2NA2A 1N33E 2V83A 2DB2A 1EI1A 4DR2E 2ZM6E 1MX0A 4GKJI 1H72C 1Z5BA 4DPTA 4JI4I 3T1YE 1IBLI 3J81C 2LUQA 1A6FA 1FNMA 2R42A 2JVAA 1VISA 3C4TA 4USKA 3P06A 1H7SA 4LFBI 4B3TE 3RMPA 1Z0TA 2LTRA 2IHR1 1ZM2A 1HNXI 3ZZTA 3P1XA 1YYKA 4MYTA 5FWKA 4B3SI 1YZ9A 2M4IA 2M7QA 4JI8E 2EZ6A 1STUA 1KIJA 1Z5CA 2V2QA 2E1RA 4JV5E 3OMLA 2VQEE 3LPSA 4JI5E 5GMDA 4LFAE 1ZXNA 4IZJA 2JOBA 4F9BB 2MDRA 4P7AA 1XNRI 3Q1QA 1HR0I 4X64E 2LJHA 1Z5AA 4AQYI 1HNWI 4B3ME 2EWLA 1FWLA 4L5NC 4HYMA 4DPUA 1KTVA 3VYYA 5IT9Q 4JI1I 1HNZI 2O1UA 1ZM9A 4DV2I 2NUEA 2UUBI 2RS6A 1DI2A 2HFUA 3DJWA 3HTXA 4BMJA 3HPSA 4OX9E 4LF5I 5A2QC 2L33A 3J7AM 3WU5A 1X47A 4P7DA 3F6GA 4YHHE 2LTSA 1YYOA 1N32E 4PRVA 4K0KE 2V2ZA 2F4VE 2GS8A 1ZBTA 5FLXC 1EKZA 3T1HI 1X48A 1Y6ZA 4DR3E 1N36I 4JI7I 4N3OA 2RSMA 3J7AG 4DV5E 1T4OA 1KKHA 4KQVA 2V88A 4DV4E 4DR7E 1Z0EA 2V89A 4DV6I 4I3HA 2LE2A 3ZOQB 4DR4E 3C4BA 2NUFA 4LFCI 4BC9A 3IWBA 2L2KB 3Q6MA 1ZBQA 3IWDA 1ELOA 1NZ0A 4BC7A 2ZITA 2L3CA 5LMUI 3JAMQ 2JWOA 4X66I 5AASA 4LF9I 2HHHE 1X49A 2L92A 3PRYA 3J81Q 4R03A 4DUZI 4LF6I 2UUAI 4YY3I 4JI6E 4B3RI 2UXBE 3B82A 4JI3I 3OTOI 1WXRA 1S4EA 1RQ0A 4DR1I 2VF3A 2XEXA 1Z0WA 2B3TB 4WFTA 5F3WA 4GKJE 2KOUA 3ZKDA 3LLHA 4JI4E 1IBLE 4WYQB 2AJ4A 3K85A 3ZKBA 4GKKI 2Z5CA 2IOQA 3H4LA 1Z0BA 4RPFA 2L6MA 1NHJA 4F9AB 4DXLA 4MYUA 4LFBE 1QU6A 3KWRA 2CGEA 1XMOI 4DR6I 1HNXE 3MSWA 4X62I 3LTOA 4NXMI 4LF4I 4IZJD 4B3SE 2LJPA 4DU7A 1I94I 4DV3I 2UXCI 4FWHA 4KHPI 1FKAE 4X8WA 1IBKI 2BM0A 4WUCA 1WHNA 1XNRE 5BR8I 1HR0E 4FWDA 4JG4A 3J80C 1H73A 1Y4SA 4M1KA 2L2MA 4AQYE 1B62A 4M2ZA 4IZJB 1BKNA 5L3JA 4P78A 2JOXA 4JI1E 1HNZE 2A2DA 4DV2E 4FWGA 1RC7A 2UUBE 5CFFE 4LF7I 3HXLA 2O1VA 2KHXA 5AE2A 5FLXQ 4L8NA 3PYEA 4UTGA 4LF5E 3F0NA 4ED4A 5IWAI 3D4JA 1YYWA 4R8OA 4WSPA 2YT4A 2A2CA 2E1MA 4JI0I 3ZM7A 2DIXA 1FJGI 1WUUA 2UXDI 4BCAA 1XNQI 2JY9A 4JYAI 5LL6R 3QT7A 1IBMI 3PYDA 1XMQI 4BBYA 4TUGA 2HKEA 1SR9A 2V8QB 4J8ZA 2B9DA 3ADJA 4DV7I 3VK6A 1J5EI 2EFGA 4DV1I 1DARA 1N36E 4JI7E 2M1SA 2UUCI 2LBSB 4PRXA 2PNLA 1PKPA 1Z0VA 4X65I 4DV6E 3LNUA 3WU3A 2HK2A 4M0VA 4HACB 3JTZA 4LFCE 1XHKA 2ODRC 4Z7CA 5LMUE 4JI2I 2X36A 3CWVA 4X66E 2LRSA 4YHHI 4LF9E 2JR1A 4LF6E 4DUZE 4K0KI 2UUAE 3JU0A 5LMNI 4YY3E 3WU4A 4B3RE 4JI3E 4DPYA 1B63A 3V2UC 4UT4A 1T4NA 4DR1E 1RR9A 2CZ9A 2HKJA 2VE7C 4LF8I 3F6HA 4HY1A 3HPZA 4DV0I 1N34I 2G7HA 4DUYI 5AE3A 4GEQB 4F54A 2NPFA 2Z5BB 4GKKE 3QT5A 2PNMA 1HK7A 2ZBKB 4DR5I 3AV0A 2IOPA 4IZKA 2B7TA 2V85A 2UU9I 2L2NA 2VQFI 3ADLA 1XMOE 1ZM4A 3PYGA 3J80Q 2DSYA 4DR6E 1USVA 4DPWA 3V5RA 2CG9A 4X62E 4NXNI 4WUDA 4NXME 2WW4A 3H09A 4LF4E 2RS7A 2E5LI 5DNYA 1I94E 4DV3E 2UXCE 4KHPE 3PYFA 2H36X 2ODRD 5GMEA 2FV4B 2L3JA 1IBKE 2L8TA 1GZ6A 1WHQA 5BR8E 1DQ3A 2WZOA 2BM1A 2N3GA 1N33I 1J26A 3JAMC 1OJ4A 2CPNA 2FTXB 2GQ0A 4LTYA 2V8PA 2ZM6I 4DR2I 4LU9A 4ZVIA 4DU8A 1K47A 1HNWE 2NUGA 5A2QQ 3T1YI 1PIEA 4LF7E 3ADIA 4WUBA 2BV3A 4USMA 1N0VC 1QZRA 1NHHA 4FN5A 2MC6A 4B3TI 1GQEA 5IWAE 4XTJA 4KZSA 3FIGA 3HJCA 2FGGA 4JI0E 3LMLA 4Q28A 1FJGE 5AE1A 2UXDE 1XNQE 3QT6A 4JYAE 4JI8I 3ZZUA 1IBME 3K6QA 1XMQE 4JV5I 1N0UA 2LUPB 2VQEI 4JI5I 1Z0GA 4DV7E 4P52A 4LFAI 4TUIA 3VYXA 3GONA 1J5EE 4DV1E 4X64I 2V34A 2KONA 2OI2A 2UUCE 3K1JA 1MG7A 3T1HE 3J7Yp 4B3MI 2MC5A 4X65E 5ADZA 1UEKA 1FI4A 2HFSA 1S16A 4M30A 1T4LB 2K4VA 4BS9A 3HQ1A 3B8HA 4HXZA 2DMYA 2HK3A 4EMDA 4JI2E 2J7KA 4OX9I 2YZTA 3Q6NA 3ADGA 3B78A 5LMNE 2V86A 4F9CB 5IT9C 2O1WA 4URLA 1Z59A 1N32I 2LMZA 1PVGA 2F4VI 4LF8E 4WPYA 4HACA 4PU9A 4DPXA 1D6TA 3OTOE 4DV0E 1N34E 2N3HA 4OOGC 3M6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIL A;  1EA6 A;  4DR3 I;  4DUY E;  2B7V A;  3K17 A;  2RTX A;  4DV5 I;  1KVK A;  4FW9 A;  4DR5 E;  4R1F A;  4DV4 I;  4DR7 I;  1UHZ A;  2UU9 E;  2VQF E;  1H74 A;  1H7U A;  3WU6 A;  4DR4 I;  1FWK A;  1O0W A;  4Z7Y A;  4NXN E;  2X7I A;  1MU5 A;  3QT8 A;  2E5L E;  2DEI A;  2R3V A;  1ZXM A;  4DKK A;  2DEJ A;  2Q2E B;  1Z0C A;  1ZM3 A;  2V2V A;  2HHH I;  3HUL A;  1RRE A;  1NHI A;  4JI6 I;  2UXB I;  1U2R A;  3ZZ0 A;  2NA2 A;  1N33 E;  2DB2 A;  1EI1 A;  4DR2 E;  2ZM6 E;  1MX0 A;  4GKJ I;  1H72 C;  1Z5B A;  4DPT A;  4JI4 I;  3T1Y E;  1IBL I;  3J81 C;  2LUQ A;  1A6F A;  1FNM A;  2R42 A;  2JVA A;  1VIS A;  3C4T A;  4USK A;  1H7S A;  4LFB I;  4B3T E;  1Z0T A;  2LTR A;  2IHR 1;  1ZM2 A;  1HNX I;  3ZZT A;  3P1X A;  1YYK A;  4MYT A;  4B3S I;  1YZ9 A;  4JI8 E;  2EZ6 A;  1STU A;  1KIJ A;  2V2Q A;  2E1R A;  4JV5 E;  2VQE E;  3LPS A;  4JI5 E;  5GMD A;  4LFA E;  1ZXN A;  2MDR A;  4P7A A;  1XNR I;  3Q1Q A;  1HR0 I;  4X64 E;  2LJH A;  1Z5A A;  4AQY I;  1HNW I;  4B3M E;  1FWL A;  4HYM A;  4DPU A;  1KTV A;  3VYY A;  5IT9 Q;  4JI1 I;  1HNZ I;  1ZM9 A;  4DV2 I;  2NUE A;  2UUB I;  2RS6 A;  1DI2 A;  2HFU A;  3HTX A;  4OX9 E;  4LF5 I;  5A2Q C;  2L33 A;  3J7A M;  3WU5 A;  1X47 A;  4YHH E;  2LTS A;  1YYO A;  1N32 E;  4PRV A;  4K0K E;  2V2Z A;  2F4V E;  2GS8 A;  1ZBT A;  5FLX C;  1EKZ A;  3T1H I;  1X48 A;  4DR3 E;  1N36 I;  4JI7 I;  2RSM A;  3J7A G;  4DV5 E;  1T4O A;  1KKH A;  4KQV A;  4DV4 E;  4DR7 E;  1Z0E A;  4DV6 I;  4I3H A;  4DR4 E;  3C4B A;  2NUF A;  4LFC I;  2L2K B;  1ELO A;  1NZ0 A;  2ZIT A;  2L3C A;  5LMU I;  3JAM Q;  4X66 I;  4LF9 I;  2HHH E;  1X49 A;  3J81 Q;  4LF6 I;  4DUZ I;  2UUA I;  4YY3 I;  4JI6 E;  4B3R I;  2UXB E;  3B82 A;  4JI3 I;  3OTO I;  1S4E A;  1RQ0 A;  4DR1 I;  2VF3 A;  2XEX A;  1Z0W A;  2B3T B;  4WFT A;  4GKJ E;  3ZKD A;  3LLH A;  4JI4 E;  1IBL E;  4WYQ B;  2AJ4 A;  3ZKB A;  4GKK I;  3H4L A;  1Z0B A;  4RPF A;  1NHJ A;  4DXL A;  4MYU A;  4LFB E;  1QU6 A;  1XMO I;  4DR6 I;  1HNX E;  4X62 I;  3LTO A;  4NXM I;  4LF4 I;  4B3S E;  2LJP A;  4DU7 A;  1I94 I;  4DV3 I;  2UXC I;  4FWH A;  4KHP I;  1FKA E;  4X8W A;  1IBK I;  2BM0 A;  4WUC A;  1WHN A;  1XNR E;  5BR8 I;  1HR0 E;  4FWD A;  4JG4 A;  3J80 C;  1H73 A;  4M1K A;  2L2M A;  4AQY E;  1B62 A;  4M2Z A;  1BKN A;  5L3J A;  4JI1 E;  1HNZ E;  2A2D A;  4DV2 E;  4FWG A;  1RC7 A;  2UUB E;  5CFF E;  4LF7 I;  2KHX A;  5FLX Q;  3PYE A;  4UTG A;  4LF5 E;  3F0N A;  4ED4 A;  5IWA I;  3D4J A;  1YYW A;  2YT4 A;  2A2C A;  4JI0 I;  3ZM7 A;  2DIX A;  1FJG I;  1WUU A;  2UXD I;  1XNQ I;  2JY9 A;  4JYA I;  5LL6 R;  3QT7 A;  1IBM I;  3PYD A;  1XMQ I;  2HKE A;  3ADJ A;  4DV7 I;  1J5E I;  2EFG A;  4DV1 I;  1DAR A;  1N36 E;  4JI7 E;  2UUC I;  2LBS B;  4PRX A;  1PKP A;  1Z0V A;  4X65 I;  4DV6 E;  3LNU A;  3WU3 A;  2HK2 A;  4HAC B;  4LFC E;  1XHK A;  4Z7C A;  5LMU E;  4JI2 I;  2X36 A;  3CWV A;  4X66 E;  2LRS A;  4YHH I;  4LF9 E;  4LF6 E;  4DUZ E;  4K0K I;  2UUA E;  5LMN I;  4YY3 E;  3WU4 A;  4B3R E;  4JI3 E;  4DPY A;  1B63 A;  3V2U C;  4UT4 A;  1T4N A;  4DR1 E;  1RR9 A;  2CZ9 A;  2HKJ A;  4LF8 I;  4HY1 A;  4DV0 I;  1N34 I;  4DUY I;  2NPF A;  4GKK E;  3QT5 A;  2ZBK B;  4DR5 I;  2B7T A;  2UU9 I;  2L2N A;  2VQF I;  3ADL A;  1XMO E;  1ZM4 A;  3PYG A;  3J80 Q;  4DR6 E;  4DPW A;  3V5R A;  4NXN I;  4X62 E;  4WUD A;  2WW4 A;  4NXM E;  4LF4 E;  2RS7 A;  2E5L I;  1I94 E;  4DV3 E;  2UXC E;  4KHP E;  3PYF A;  5GME A;  2L3J A;  1IBK E;  1WHQ A;  5BR8 E;  2BM1 A;  2N3G A;  1N33 I;  1J26 A;  3JAM C;  1OJ4 A;  2CPN A;  2V8P A;  4DR2 I;  2ZM6 I;  4ZVI A;  4DU8 A;  1K47 A;  1HNW E;  2NUG A;  5A2Q Q;  3T1Y I;  1PIE A;  4LF7 E;  3ADI A;  4WUB A;  2BV3 A;  4USM A;  1N0V C;  1QZR A;  1NHH A;  4FN5 A;  4B3T I;  1GQE A;  5IWA E;  4XTJ A;  4JI0 E;  1FJG E;  2UXD E;  1XNQ E;  3QT6 A;  4JYA E;  4JI8 I;  3ZZU A;  1IBM E;  1XMQ E;  4JV5 I;  1N0U A;  2LUP B;  2VQE I;  4JI5 I;  1Z0G A;  4DV7 E;  4P52 A;  4LFA I;  3VYX A;  3GON A;  1J5E E;  4DV1 E;  4X64 I;  2V34 A;  2OI2 A;  2UUC E;  3K1J A;  1MG7 A;  3T1H E;  3J7Y p;  4B3M I;  4X65 E;  1UEK A;  1FI4 A;  2HFS A;  1S16 A;  4M30 A;  1T4L B;  3B8H A;  4HXZ A;  2DMY A;  2HK3 A;  4EMD A;  4JI2 E;  2J7K A;  4OX9 I;  3ADG A;  3B78 A;  5LMN E;  5IT9 C;  4URL A;  1Z59 A;  1N32 I;  1PVG A;  2F4V I;  4LF8 E;  4HAC A;  4PU9 A;  4DPX A;  1D6T A;  3OTO E;  4DV0 E;  1Z5C A;  1N34 E;  2N3H A;  4OOG C;  3M6A A; 
#chains in the Genus database with same CATH topology
 4AM3 A;  1UIL A;  3EPH A;  1Y4U A;  2WBS A;  1EA6 A;  4DR3 I;  4DUY E;  4LCG A;  1SFE A;  4J3D A;  2B7V A;  2YTG A;  4I8O A;  4DMI A;  3IWC A;  3K17 A;  2RTX A;  4DV5 I;  1KVK A;  2EPX A;  4FW9 A;  3KRN A;  4DR5 E;  4R1F A;  4IJD A;  4DV4 I;  4DR7 I;  3AUZ A;  3M85 G;  1UHZ A;  2BBG A;  2UU9 E;  3M7N G;  2VQF E;  4O4K A;  1H74 A;  2O3Z A;  2IER A;  1H7U A;  2O1T A;  3WU6 A;  4F6N A;  1AAY A;  1FWK A;  4DR4 I;  1X6F A;  1USU A;  1O0W A;  4Z7Y A;  4NXN E;  1QNT A;  3P76 A;  2X7I A;  5T6J A;  1MU5 A;  3QT8 A;  4MU1 A;  2EMC A;  1RMD A;  3DF6 A;  4LPF A;  2E5L E;  2RQL A;  2VF1 A;  2DEI A;  2R3V A;  4IFD C;  1ZXM A;  4ZYG A;  4IZK B;  4BHB A;  4DKK A;  4MDT A;  1UDN A;  4MU4 A;  1R6M A;  2DEJ A;  1JK2 A;  2Q2E B;  5A6B A;  2Z5C B;  1Z0C A;  2V87 A;  2F8B A;  5EKW A;  1ZM3 A;  2V2V A;  1EH8 A;  2E72 A;  2Z5E A;  2Z5B A;  3HUL A;  3P3G A;  2HHH I;  1RRE A;  4OKG A;  1JK1 A;  2YTN A;  1NHI A;  2EL6 A;  4JI6 I;  2UXB I;  1UBD C;  1U2R A;  2Q8U A;  3ZZ0 A;  2NA2 A;  1N33 E;  2V83 A;  5A6A A;  2DB2 A;  2D9H A;  5JEA F;  1EI1 A;  4DR2 E;  3L00 A;  5AC5 A;  2ZM6 E;  5K36 D;  1MX0 A;  4OO1 E;  4GKJ I;  1H72 C;  2HC5 A;  1Z5B A;  4IFD E;  4DPT A;  2CSH A;  2WBT A;  4JI4 I;  3T1Y E;  1IBL I;  2ENA A;  3J81 C;  2YSP A;  2LUQ A;  1A6F A;  1FNM A;  3CDJ A;  2R42 A;  4OZE A;  2JVA A;  1A1G A;  1VIS A;  4FW4 A;  2YTE A;  3C4T A;  1R6L A;  4USK A;  3P06 A;  5KL2 A;  3U1Y A;  1BBG A;  1H7S A;  4LFB I;  4B3T E;  2YSO A;  4O43 A;  3RMP A;  1Z0T A;  2LTR A;  2IHR 1;  1ZM2 A;  2C39 A;  2JT2 A;  1HNX I;  2EPK X;  2NN6 F;  3ZZT A;  3P1X A;  1YYK A;  1MEY C;  4MYT A;  5FWK A;  2LV2 A;  2WP8 A;  4B3S I;  5AC4 A;  2M4I A;  2M7Q A;  2EM4 A;  4JI8 E;  1YZ9 A;  2EMX A;  1STU A;  2EZ6 A;  1KIJ A;  1Z5C A;  3P3E A;  2V2Q A;  2E1R A;  2LT7 A;  4JV5 E;  3OML A;  2YTP A;  5KL6 A;  2LJU A;  2VQE E;  3PS1 A;  3LPS A;  4IFD D;  4JI5 E;  2C38 B;  5GMD A;  4LFA E;  3EPK A;  1ZXN A;  2JOB A;  4F9B B;  2MDR A;  4GQU A;  1YPN A;  4IZJ A;  4R2D A;  4P7A A;  1XNR I;  3Q1Q A;  1HR0 I;  4X64 E;  4FW6 A;  2EM7 A;  1YFH A;  1A1K A;  2LJH A;  1Z1B A;  2EMF A;  5DRP A;  3HKM A;  1ZAA C;  1Z5A A;  4AQY I;  1HNW I;  4B3M E;  2EWL A;  1FWL A;  4BA2 B;  1PDA A;  4L5N C;  4OO1 A;  2WNR A;  4HYM A;  4DPU A;  1KTV A;  3VYY A;  5IT9 Q;  4JI1 I;  1HNZ I;  2R76 A;  3C6K A;  1P42 A;  2O1U A;  2NN6 A;  4N4R B;  1ZM9 A;  4DV2 I;  1RHY A;  2NUE A;  4FK5 C;  2UUB I;  2EPR A;  2RS6 A;  1DI2 A;  2DLQ A;  2HFU A;  2R1F A;  2PO2 A;  3DJW A;  3HTX A;  1IQS A;  2BR2 A;  3HPS A;  4BMJ A;  4OX9 E;  2PO1 A;  5DRR A;  4LF5 I;  2MDG A;  2HGH A;  1IQO A;  5A2Q C;  1TF3 A;  1Y5Y A;  2L33 A;  2EPZ A;  2GLI A;  3J7A M;  4ZYH A;  4WXD A;  3C6M A;  3WU5 A;  2VRD A;  1X47 A;  5TSE A;  3L7Z A;  4P7D A;  5C0X A;  3F6G A;  4YHH E;  2JEB B;  2LTS A;  4RH8 A;  1YYO A;  2BA1 D;  2EML A;  1N32 E;  4PRV A;  4K0K E;  3U1K A;  2V2Z A;  2GO3 A;  2F4V E;  2EOM A;  2DMI A;  2EN4 A;  1ZBT A;  2EPN A;  5FLX C;  2GS8 A;  1EKZ A;  3T1H I;  2JEA B;  1X48 A;  1Y6Z A;  1YUJ A;  4NHR A;  4DR3 E;  1N36 I;  4JI7 I;  5IV8 B;  1A1H A;  4N3O A;  2EPL X;  2RSM A;  3J7A G;  4DV5 E;  2GHF A;  1T4O A;  1KKH A;  2JE6 A;  4KQV A;  1T39 A;  5JEA C;  2V88 A;  4DV4 E;  2EM8 A;  1PJQ A;  2EPO A;  4DR7 E;  1X3C A;  1T38 A;  2V89 A;  1OYS A;  1Z0E A;  2CVE A;  2YRK A;  4I3H A;  4DV6 I;  1KJK A;  2LE2 A;  4MU3 A;  3ZOQ B;  3GME A;  4DR4 E;  3C4B A;  3TQM A;  2NUF A;  5A6B D;  4ZYD A;  2EOH A;  3QG5 C;  4KWY A;  4LFC I;  2BA1 G;  2PO0 A;  4BC9 A;  3IWB A;  2L2K B;  3Q6M A;  3H1C A;  1ZBQ A;  3MHS C;  3IWD A;  1ELO A;  1NZ0 A;  4BC7 A;  2ZIT A;  2L3C A;  2EQ0 A;  4M9V C;  5LMU I;  3THN A;  3JAM Q;  5EL9 A;  2DLK A;  4OO1 C;  2JWO A;  3BBG A;  1KYQ A;  5AAS A;  4X66 I;  4LF9 I;  2HHH E;  1X49 A;  2L92 A;  3PRY A;  3J81 Q;  4R03 A;  4DUZ I;  4LF6 I;  1G2D C;  2EE8 A;  3EQ1 A;  4F2J C;  2NN6 C;  2UUA I;  4YY3 I;  4JI6 E;  5JEA E;  4B3R I;  2UXB E;  5KL4 A;  3B82 A;  2EM0 A;  3OTO I;  1WXR A;  1UN6 B;  4JI3 I;  2EMZ A;  1S4E A;  1RQ0 A;  4DR1 I;  2VF3 A;  5KL3 A;  4QNJ A;  2XEX A;  1Z0W A;  2B3T B;  4WXC A;  4WFT A;  5F3W A;  4FW5 A;  3EPL A;  4GKJ E;  2KOU A;  3ZKD A;  2ENC A;  2EOE A;  3LLH A;  4JI4 E;  1IBL E;  4WYQ B;  2AJ4 A;  3K85 A;  5C0X C;  3ZKB A;  4GKK I;  2Z5C A;  2IOQ A;  3H4L A;  2DGC A;  1Z0B A;  1NCS A;  2L6M A;  2RPC A;  1NHJ A;  1OYP A;  2ADR A;  4RPF A;  2EN8 A;  4F9A B;  4DXL A;  2NN6 E;  4MYU A;  5LLQ A;  4LFB E;  2WCC 3;  3KZY A;  5K36 F;  2EOJ A;  1QU6 A;  2YTI A;  3KWR A;  1YUI A;  2CGE A;  1XMO I;  4DR6 I;  3UHM A;  2RSI A;  1HNX E;  4ISA A;  3MSW A;  2YTD A;  4X62 I;  3LTO A;  4NXM I;  1WRJ A;  4LF4 I;  1ZU1 A;  4IZJ D;  4B3S E;  2LJP A;  4DU7 A;  2EOS A;  1I94 I;  2J7J A;  4DV3 I;  2UXC I;  4FWH A;  4KHP I;  4R2C A;  1FKA E;  5K36 B;  4NBQ A;  2C39 B;  4X8W A;  1IBK I;  2BM0 A;  4WUC A;  1WHN A;  1XNR E;  5BR8 I;  1HR0 E;  4FWD A;  4AIM A;  4JG4 A;  5DNL A;  5JEA A;  4OO1 D;  4HTG A;  3J80 C;  1G2F C;  1H73 A;  1YH8 A;  2GPI A;  1Y4S A;  2ELY A;  4M1K A;  1B69 A;  2L2M A;  2NN6 D;  2EN7 A;  4AQY E;  1B62 A;  4M2Z A;  4IZJ B;  1BKN A;  5L3J A;  4P78 A;  2MKD A;  2EPA A;  2JOX A;  1HNZ E;  4JI1 E;  1IMU A;  2A2D A;  4DV2 E;  2EOR A;  4MU0 A;  2CTD A;  4FWG A;  1RC7 A;  2UUB E;  5CFF E;  4LF7 I;  2WBU A;  3HXL A;  2LVH A;  3GCM A;  2O1V A;  2EMW A;  2KHX A;  2C38 A;  5AE2 A;  5FLX Q;  4OO1 B;  1A1I A;  1F2I G;  5C0X D;  1TN9 A;  3NZK A;  2EOF A;  4L8N A;  2BA0 D;  3PYE A;  4UTG A;  4LF5 E;  3F0N A;  4IFD B;  4ED4 A;  5IWA I;  3D4J A;  1YYW A;  1OYR A;  4R8O A;  2K7I A;  4WSP A;  2YT4 A;  2A2C A;  2E1M A;  4JI0 I;  2EMK A;  3ZM7 A;  2DIX A;  1NEI A;  1FJG I;  1WUU A;  2UXD I;  4BCA A;  1E3H A;  1XNQ I;  2JY9 A;  4JYA I;  5LL6 R;  3QT7 A;  1IBM I;  3PYD A;  2EOX A;  2F1D A;  5DNX A;  1XMQ I;  2EQ3 A;  4BBY A;  4Q35 B;  4TUG A;  2HKE A;  2LCE A;  1SR9 A;  2EMH A;  2N8X A;  2V8Q B;  4J8Z A;  3CDI A;  2B9D A;  3MHH C;  3ADJ A;  4LCH A;  4DV7 I;  4R2R A;  3VK6 A;  1A1J A;  2MKN A;  1J5E I;  2JPA A;  2EFG A;  1N3G A;  2C37 A;  2IES A;  3L7Z B;  4DV1 I;  1DAR A;  1N36 E;  2PNZ B;  2EN1 A;  2M1S A;  4JI7 E;  2EP3 A;  2UUC I;  3BF2 A;  2LBS B;  2BA0 G;  4PRX A;  2YPN A;  5KL7 A;  2PNL A;  2LO3 A;  1PKP A;  2EOI A;  1Z0V A;  4DV6 E;  4X65 I;  1X5W A;  3LNU A;  3WU3 A;  2HK2 A;  2EMB A;  2I13 A;  2YTJ A;  1BB8 A;  4M0V A;  2JEB A;  4HAC B;  3JTZ A;  4LFC E;  2EMI A;  4BHC A;  1XHK A;  2ODR C;  2JE6 B;  4R2Q A;  4AID A;  1UDO A;  4RHB B;  5A69 A;  4Z7C A;  5LMU E;  4JI2 I;  5A6K A;  2X36 A;  3CWV A;  3BID A;  1YHC A;  4X66 E;  2LRS A;  1A1L A;  4YHH I;  2JR1 A;  4LF9 E;  4X9J A;  4LF6 E;  4DUZ E;  4R2S A;  2ENH A;  4K0K I;  2UUA E;  2EMY A;  3JU0 A;  5LMN I;  4WX9 A;  4YY3 E;  3WU4 A;  4B3R E;  4JI3 E;  4BA1 A;  1TF6 A;  4MQY A;  4DPY A;  1B63 A;  1E3P A;  3V2U C;  4UT4 A;  2EL5 A;  1T4N A;  4DR1 E;  1RR9 A;  2CZ9 A;  2HKJ A;  2VE7 C;  2EJ4 A;  4LF8 I;  3F6H A;  4HY1 A;  2YU5 A;  4NZV A;  4IS1 C;  3HPZ A;  4IS9 A;  4DV0 I;  1PJT A;  1N34 I;  2G7H A;  5A6J A;  4DUY I;  5AE3 A;  1PJS A;  1DGC A;  4GEQ B;  4F54 A;  2AE8 A;  2NPF A;  2Z5B B;  4GKK E;  5K36 E;  3QT5 A;  2PNM A;  1HK7 A;  2YWQ A;  2ZBK B;  4DR5 I;  3AV0 A;  2IOP A;  4IZK A;  3VHT B;  2B7T A;  2V85 A;  1VI7 A;  2UU9 I;  2EPU A;  2L2N A;  3EPJ A;  3UK3 C;  1XMO E;  3ADL A;  1ZM4 A;  3PYG A;  3J80 Q;  2VQF I;  2DSY A;  4DR6 E;  1USV A;  4DPW A;  3PS2 A;  3V5R A;  2CG9 A;  3KZZ A;  4X62 E;  4R2A A;  4WUD A;  4NXN I;  4LCF A;  4NXM E;  2WW4 A;  3H09 A;  4LF4 E;  2RS7 A;  2M9A A;  2J65 A;  2E5L I;  2JYA A;  5DNY A;  1I94 E;  2PRT A;  5JEA D;  4DV3 E;  2UXC E;  4KHP E;  3PYF A;  2H36 X;  3P3C A;  2ODR D;  3ECR A;  2FV4 B;  1GTK A;  2L3J A;  5GME A;  4O5G A;  3PS3 A;  1IBK E;  2L8T A;  2YRH A;  3DD6 A;  1GZ6 A;  1WHQ A;  5BR8 E;  1DQ3 A;  2WZO A;  1WJP A;  3THO B;  1A1F A;  1L4S A;  2BM1 A;  2N3G A;  1N33 I;  1J26 A;  3JAM C;  1AH5 A;  1OJ4 A;  2WP8 B;  2BB8 A;  2CPN A;  2EOZ A;  2FTX B;  4LTY A;  1YSA C;  2GQ0 A;  2V8P A;  4QNK A;  2ZM6 I;  4DR2 I;  2YRM A;  2EMG A;  4LU9 A;  4MLV A;  4ZVI A;  5JEA B;  2EM5 A;  4DU8 A;  1K47 A;  2GO4 A;  1HNW E;  2NUG A;  4F6M A;  3M99 B;  4U3D A;  5A2Q Q;  3T1Y I;  1PIE A;  4OO1 F;  5K36 A;  2EN6 A;  4LF7 E;  4IFD F;  4HEI A;  3ADI A;  1P47 A;  4WUB A;  5ELW A;  2BV3 A;  4USM A;  2VES A;  2ELZ A;  1N0V C;  3BGH A;  1NHH A;  1QZR A;  4FN5 A;  4FW3 A;  4LOM A;  2MC6 A;  4R2P A;  4B3T I;  1GQE A;  5IWA E;  4XTJ A;  2EOO A;  1EH7 A;  3FIG A;  2EM2 A;  4KZS A;  4GZN C;  2FGG A;  4JI0 E;  3HJC A;  2YTF A;  2WNR B;  3LML A;  1UDS A;  4Q28 A;  2YU8 A;  1FJG E;  5AE1 A;  2UXD E;  1XNQ E;  3QT6 A;  4JYA E;  2NN6 B;  4JI8 I;  3ZZU A;  1IBM E;  3K6Q A;  3GLL A;  2YTO A;  1XMQ E;  1LLM C;  1Y60 A;  4JV5 I;  1N0U A;  2EMA A;  2LUP B;  5C0X F;  2VQE I;  4BA2 A;  4JI5 I;  1Z0G A;  3B4T A;  4DV7 E;  4P52 A;  2I9I A;  4TUI A;  2PO2 B;  3VYX A;  1ZR9 A;  4O24 A;  1J5E E;  3GON A;  4LFA I;  2BR2 B;  4DV1 E;  4X64 I;  2V34 A;  2PO1 B;  2KON A;  2NAB A;  5DRO A;  2OI2 A;  2UUC E;  3K1J A;  2JXP A;  4WSG A;  4IFD A;  1MG7 A;  3T1H E;  3J7Y p;  5IXM B;  4B3M I;  2EPM X;  2MC5 A;  5C0X B;  1BBO A;  4X65 E;  5ADZ A;  2EN3 A;  1FI4 A;  2EOQ A;  1UEK A;  2HFS A;  2DRP A;  2A25 A;  1S16 A;  2C37 B;  4M30 A;  2EM9 A;  1X6H A;  1T4L B;  2K4V A;  5DRQ A;  2CT1 A;  2EM3 A;  2EM6 A;  3HQ1 A;  4BS9 A;  3B8H A;  4HXZ A;  2HJJ A;  4ZYE A;  2DMY A;  2EQ1 A;  2HK3 A;  1MGT A;  4BA1 B;  1X6E A;  4EMD A;  1EH6 A;  4JI2 E;  1XXE A;  2EL4 A;  2J7K A;  4OX9 I;  2PNZ A;  2EN2 A;  2YZT A;  3M85 D;  2EPP A;  3M7N D;  3Q6N A;  3ADG A;  3B78 A;  5LMN E;  5C0X E;  2V86 A;  2JEA A;  4F9C B;  5IT9 C;  2YTQ A;  4U3B A;  1UDQ A;  2EOY A;  2O1W A;  5K36 C;  4URL A;  4R2E A;  2JP9 A;  1Z59 A;  2EPC A;  1N32 I;  2PO0 B;  2LMZ A;  1PVG A;  2F4V I;  4LF8 E;  4WPY A;  4HAC A;  4PU9 A;  4DPX A;  1D6T A;  3OTO E;  5KL5 A;  4DV0 E;  1N34 E;  4MLQ A;  2N3H A;  4FW7 A;  4OOG C;  3M6A A; 
#chains in the Genus database with same CATH homology
 1UIL A;  1Y4U A;  1EA6 A;  4DR3 I;  4DUY E;  2B7V A;  4I8O A;  4DMI A;  3IWC A;  3K17 A;  2RTX A;  4DV5 I;  1KVK A;  4FW9 A;  4DR5 E;  4R1F A;  4DV4 I;  4DR7 I;  3AUZ A;  1UHZ A;  2UU9 E;  2VQF E;  1H74 A;  1H7U A;  2O1T A;  3WU6 A;  4DR4 I;  1FWK A;  1USU A;  1O0W A;  4Z7Y A;  4NXN E;  2X7I A;  5T6J A;  1MU5 A;  3QT8 A;  3DF6 A;  2E5L E;  2DEI A;  2VF1 A;  2R3V A;  1ZXM A;  4IZK B;  4DKK A;  2DEJ A;  2Q2E B;  2Z5C B;  1Z0C A;  2V87 A;  2F8B A;  1ZM3 A;  2V2V A;  2HHH I;  2Z5E A;  2Z5B A;  3HUL A;  1RRE A;  1NHI A;  4JI6 I;  2UXB I;  1U2R A;  3ZZ0 A;  2NA2 A;  1N33 E;  2V83 A;  2DB2 A;  1EI1 A;  4DR2 E;  2ZM6 E;  1MX0 A;  4GKJ I;  1H72 C;  1Z5B A;  4DPT A;  4JI4 I;  3T1Y E;  1IBL I;  3J81 C;  2LUQ A;  1A6F A;  1FNM A;  2R42 A;  2JVA A;  1VIS A;  3C4T A;  4USK A;  3P06 A;  1H7S A;  4LFB I;  4B3T E;  3RMP A;  1Z0T A;  2LTR A;  2IHR 1;  1ZM2 A;  1HNX I;  3ZZT A;  3P1X A;  1YYK A;  4MYT A;  5FWK A;  4B3S I;  1YZ9 A;  2M4I A;  2M7Q A;  4JI8 E;  2EZ6 A;  1STU A;  1KIJ A;  1Z5C A;  2V2Q A;  2E1R A;  4JV5 E;  3OML A;  2VQE E;  3LPS A;  4JI5 E;  5GMD A;  4LFA E;  1ZXN A;  4IZJ A;  2JOB A;  4F9B B;  2MDR A;  4P7A A;  1XNR I;  3Q1Q A;  1HR0 I;  4X64 E;  2LJH A;  1Z5A A;  4AQY I;  1HNW I;  4B3M E;  2EWL A;  1FWL A;  4L5N C;  4HYM A;  4DPU A;  1KTV A;  3VYY A;  5IT9 Q;  4JI1 I;  1HNZ I;  2O1U A;  1ZM9 A;  4DV2 I;  2NUE A;  2UUB I;  2RS6 A;  1DI2 A;  2HFU A;  3DJW A;  3HTX A;  4BMJ A;  3HPS A;  4OX9 E;  4LF5 I;  5A2Q C;  2L33 A;  3J7A M;  3WU5 A;  1X47 A;  4P7D A;  3F6G A;  4YHH E;  2LTS A;  1YYO A;  1N32 E;  4PRV A;  4K0K E;  2V2Z A;  2F4V E;  2GS8 A;  1ZBT A;  5FLX C;  1EKZ A;  3T1H I;  1X48 A;  1Y6Z A;  4DR3 E;  1N36 I;  4JI7 I;  4N3O A;  2RSM A;  3J7A G;  4DV5 E;  1T4O A;  1KKH A;  4KQV A;  2V88 A;  4DV4 E;  4DR7 E;  1Z0E A;  2V89 A;  4DV6 I;  4I3H A;  2LE2 A;  3ZOQ B;  4DR4 E;  3C4B A;  2NUF A;  4LFC I;  4BC9 A;  3IWB A;  2L2K B;  3Q6M A;  1ZBQ A;  3IWD A;  1ELO A;  1NZ0 A;  4BC7 A;  2ZIT A;  2L3C A;  5LMU I;  3JAM Q;  2JWO A;  4X66 I;  5AAS A;  4LF9 I;  2HHH E;  1X49 A;  2L92 A;  3PRY A;  3J81 Q;  4R03 A;  4DUZ I;  4LF6 I;  2UUA I;  4YY3 I;  4JI6 E;  4B3R I;  2UXB E;  3B82 A;  4JI3 I;  3OTO I;  1WXR A;  1S4E A;  1RQ0 A;  4DR1 I;  2VF3 A;  2XEX A;  1Z0W A;  2B3T B;  4WFT A;  5F3W A;  4GKJ E;  2KOU A;  3ZKD A;  3LLH A;  4JI4 E;  1IBL E;  4WYQ B;  2AJ4 A;  3K85 A;  3ZKB A;  4GKK I;  2Z5C A;  2IOQ A;  3H4L A;  1Z0B A;  4RPF A;  2L6M A;  1NHJ A;  4F9A B;  4DXL A;  4MYU A;  4LFB E;  1QU6 A;  3KWR A;  2CGE A;  1XMO I;  4DR6 I;  1HNX E;  3MSW A;  4X62 I;  3LTO A;  4NXM I;  4LF4 I;  4IZJ D;  4B3S E;  2LJP A;  4DU7 A;  1I94 I;  4DV3 I;  2UXC I;  4FWH A;  4KHP I;  1FKA E;  4X8W A;  1IBK I;  2BM0 A;  4WUC A;  1WHN A;  1XNR E;  5BR8 I;  1HR0 E;  4FWD A;  4JG4 A;  3J80 C;  1H73 A;  1Y4S A;  4M1K A;  2L2M A;  4AQY E;  1B62 A;  4M2Z A;  4IZJ B;  1BKN A;  5L3J A;  4P78 A;  2JOX A;  4JI1 E;  1HNZ E;  2A2D A;  4DV2 E;  4FWG A;  1RC7 A;  2UUB E;  5CFF E;  4LF7 I;  3HXL A;  2O1V A;  2KHX A;  5AE2 A;  5FLX Q;  4L8N A;  3PYE A;  4UTG A;  4LF5 E;  3F0N A;  4ED4 A;  5IWA I;  3D4J A;  1YYW A;  4R8O A;  4WSP A;  2YT4 A;  2A2C A;  2E1M A;  4JI0 I;  3ZM7 A;  2DIX A;  1FJG I;  1WUU A;  2UXD I;  4BCA A;  1XNQ I;  2JY9 A;  4JYA I;  5LL6 R;  3QT7 A;  1IBM I;  3PYD A;  1XMQ I;  4BBY A;  4TUG A;  2HKE A;  1SR9 A;  2V8Q B;  4J8Z A;  2B9D A;  3ADJ A;  4DV7 I;  3VK6 A;  1J5E I;  2EFG A;  4DV1 I;  1DAR A;  1N36 E;  4JI7 E;  2M1S A;  2UUC I;  2LBS B;  4PRX A;  2PNL A;  1PKP A;  1Z0V A;  4X65 I;  4DV6 E;  3LNU A;  3WU3 A;  2HK2 A;  4M0V A;  4HAC B;  3JTZ A;  4LFC E;  1XHK A;  2ODR C;  4Z7C A;  5LMU E;  4JI2 I;  2X36 A;  3CWV A;  4X66 E;  2LRS A;  4YHH I;  4LF9 E;  2JR1 A;  4LF6 E;  4DUZ E;  4K0K I;  2UUA E;  3JU0 A;  5LMN I;  4YY3 E;  3WU4 A;  4B3R E;  4JI3 E;  4DPY A;  1B63 A;  3V2U C;  4UT4 A;  1T4N A;  4DR1 E;  1RR9 A;  2CZ9 A;  2HKJ A;  2VE7 C;  4LF8 I;  3F6H A;  4HY1 A;  3HPZ A;  4DV0 I;  1N34 I;  2G7H A;  4DUY I;  5AE3 A;  4GEQ B;  4F54 A;  2NPF A;  2Z5B B;  4GKK E;  3QT5 A;  2PNM A;  1HK7 A;  2ZBK B;  4DR5 I;  3AV0 A;  2IOP A;  4IZK A;  2B7T A;  2V85 A;  2UU9 I;  2L2N A;  2VQF I;  3ADL A;  1XMO E;  1ZM4 A;  3PYG A;  3J80 Q;  2DSY A;  4DR6 E;  1USV A;  4DPW A;  3V5R A;  2CG9 A;  4X62 E;  4NXN I;  4WUD A;  4NXM E;  2WW4 A;  3H09 A;  4LF4 E;  2RS7 A;  2E5L I;  5DNY A;  1I94 E;  4DV3 E;  2UXC E;  4KHP E;  3PYF A;  2H36 X;  2ODR D;  5GME A;  2FV4 B;  2L3J A;  1IBK E;  2L8T A;  1GZ6 A;  1WHQ A;  5BR8 E;  1DQ3 A;  2WZO A;  2BM1 A;  2N3G A;  1N33 I;  1J26 A;  3JAM C;  1OJ4 A;  2CPN A;  2FTX B;  2GQ0 A;  4LTY A;  2V8P A;  2ZM6 I;  4DR2 I;  4LU9 A;  4ZVI A;  4DU8 A;  1K47 A;  1HNW E;  2NUG A;  5A2Q Q;  3T1Y I;  1PIE A;  4LF7 E;  3ADI A;  4WUB A;  2BV3 A;  4USM A;  1N0V C;  1QZR A;  1NHH A;  4FN5 A;  2MC6 A;  4B3T I;  1GQE A;  5IWA E;  4XTJ A;  4KZS A;  3FIG A;  3HJC A;  2FGG A;  4JI0 E;  3LML A;  4Q28 A;  1FJG E;  5AE1 A;  2UXD E;  1XNQ E;  3QT6 A;  4JYA E;  4JI8 I;  3ZZU A;  1IBM E;  3K6Q A;  1XMQ E;  4JV5 I;  1N0U A;  2LUP B;  2VQE I;  4JI5 I;  1Z0G A;  4DV7 E;  4P52 A;  4LFA I;  4TUI A;  3VYX A;  3GON A;  1J5E E;  4DV1 E;  4X64 I;  2V34 A;  2KON A;  2OI2 A;  2UUC E;  3K1J A;  1MG7 A;  3T1H E;  3J7Y p;  4B3M I;  2MC5 A;  4X65 E;  5ADZ A;  1UEK A;  1FI4 A;  2HFS A;  1S16 A;  4M30 A;  1T4L B;  2K4V A;  4BS9 A;  3HQ1 A;  3B8H A;  4HXZ A;  2DMY A;  2HK3 A;  4EMD A;  4JI2 E;  2J7K A;  4OX9 I;  2YZT A;  3Q6N A;  3ADG A;  3B78 A;  5LMN E;  2V86 A;  4F9C B;  5IT9 C;  2O1W A;  4URL A;  1Z59 A;  1N32 I;  2LMZ A;  1PVG A;  2F4V I;  4LF8 E;  4WPY A;  4HAC A;  4PU9 A;  4DPX A;  1D6T A;  3OTO E;  4DV0 E;  1N34 E;  2N3H A;  4OOG C;  3M6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...