5LMNE

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmnE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnE02
4JI2I 2UUBI 4DR1I 2DB2A 1IBKI 3T1HE 4AQYI 1Z0WA 1ZM4A 4MYUA 4JI4E 1Z5BA 4URLA 4LF5I 5A2QC 3JAMC 1IBLE 2DEJA 3Q1QA 3ZKDA 4X65I 4LF7E 2HKEA 4LF4I 1QZRA 3K1JA 4DU8A 1B63A 4XTJA 4DV1E 4B3TE 4X62E 2ZITA 1RQ0A 4JV5I 4JI3E 4JI0I 4FWDA 4GKJI 1T4OA 1VISA 2L33A 1OJ4A 3V2UC 1Z0TA 1XNRE 4DR4E 4EMDA 4WYQB 3B82A 5FLXQ 1HNXE 1WHNA 3ADJA 4DPTA 3T1YE 2HKJA 2XEXA 4JI1I 2X7IA 3ZZUA 3B8HA 2DMYA 4P7AA 2RTXA 4FW9A 2B3TB 1N33E 4FWGA 4DR5E 1HNZI 2B7TA 4DR1E 1KVKA 1HR0I 2Q2EB 1IBKE 2IHR1 2HFUA 4DR6E 4P52A 2L3CA 4USMA 4DR3I 4DV3E 2ZM6I 1KTVA 3GONA 1T4LB 5A2QQ 1RR9A 2J7KA 5IWAI 4OX9E 2L2MA 3LTOA 2HFSA 3ZZTA 1YYWA 4GKJE 5CFFE 4WUCA 4HY1A 3K17A 1MG7A 2N3GA 4B3RE 3CWVA 2NA2A 4X66I 1U2RA 1YYOA 1N34E 2VF3A 1H72C 4X64I 1ZM9A 4OOGC 3ZM7A 1Z0EA 4NXMI 4K0KI 1Z0BA 4NXNI 1X48A 2CPNA 4DPXA 2RS6A 1ZBTA 2UUAI 2UU9I 4DV0I 4DR7E 1ZXMA 2VQFI 3J80Q 2UXDI 5IT9C 4DV7I 1N0VC 4DV4I 3WU4A 4ED4A 3M6AA 2HK2A 4MYTA 4LF9I 1HNZE 4DKKA 2R3VA 1NHIA 2R42A 3PYFA 1RREA 2UUCI 1FNMA 4M2ZA 1GQEA 2HHHE 1N32E 4HYMA 1Z0CA 1N0UA 4JI6E 4DR3E 1MX0A 2AJ4A 2X36A 3HULA 4JI5E 1FWLA 2RS7A 3WU6A 2F4VI 2L2KB 2JY9A 1H7SA 5IWAE 4JI8E 2CZ9A 1H74A 4DV5E 2YT4A 1O0WA 3C4BA 4GKKI 1N36I 1FJGI 4HACB 4WUDA 1Z5CA 5BR8I 2WW4A 4X66E 3VYXA 4LF8I 1HNWE 1MU5A 5LMUE 3J80C 1DI2A 2UXCI 4X64E 2BM0A 4DUYI 2V2QA 4NXME 2L2NA 2UXBE 4LFBI 1ZM2A 2UUAE 3LPSA 1Z0VA 1XMOI 4JYAI 4DV0E 2VQFE 2V2VA 4DUZE 3J7Yp 2UXDE 2VQEE 4DV7E 2V8PA 1PKPA 3B78A 3OTOI 3PYGA 4LF6I 3QT8A 4JI2E 4Z7YA 2UUBE 1PIEA 1J5EI 4UTGA 1ELOA 1XMQI 5IT9Q 4AQYE 1X49A 1H7UA 1NHJA 4JI7I 1XHKA 2E1RA 1PVGA 2V2ZA 4LF5E 1UHZA 4JG4A 4DU7A 1T4NA 4B3SI 1WUUA 4X65E 4LF4E 1D6TA 3VYYA 4PU9A 4B3MI 4JV5E 3ADGA 4FN5A 2LUPB 4JI0E 1N36E 4I3HA 4JI4I 4KHPI 2NUFA 1KKHA 5BR8E 1XNQI 2NUEA 4LF8E 2GS8A 1BKNA 4WFTA 2UXCE 1S4EA 2EZ6A 5L3JA 4DUYE 4DV1I 4B3TI 1EI1A 4X62I 4JI3I 1XMOE 2DEIA 2V34A 4JI1E 3ZZ0A 2LUQA 3J81C 3F0NA 2E5LI 4DPYA 1XNRI 3OTOE 4KQVA 4DR4I 1HNXI 2N3HA 1HR0E 4DV2I 1UEKA 4FWHA 1K47A 2LTSA 3ADIA 4M1KA 2ZM6E 1X47A 4DPUA 4RPFA 1S16A 2LRSA 4DR5I 2LTRA 3ADLA 1IBMI 3LLHA 1A6FA 4WUBA 2RSMA 4DR6I 5LMNI 1H73A 4Z7CA 4KHPE 2NPFA 3WU3A 2KHXA 1NZ0A 1XNQE 4YY3I 3C4TA 4HACA 4ZVIA 4DV3I 4YHHI 2A2CA 4DR2I 2MDRA 4K0KE 1FI4A 4NXNE 4OX9I 2JVAA 2UU9E 4R1FA 3J7AM 4HXZA 4LFAI 1NHHA 1WHQA 2E5LE 4DV4E 4B3RI 3PYEA 1RC7A 2BM1A 4LF9E 1J26A 1ZXNA 1N34I 3WU5A 4DV2E 3QT6A 1I94I 2UUCE 1FKAE 3J81Q 1UILA 4PRVA 2LJPA 1STUA 4DR7I 2LBSB 4LFCI 3HTXA 1ZM3A 4X8WA 2F4VE 4M30A 2B7VA 1IBME 3D4JA 1DARA 4DV6I 5LL6R 1Z59A 1YYKA 3T1HI 4GKKE 2HHHI 5LMNE 1EA6A 1N32I 1FJGE 1QU6A 1Z0GA 4JI6I 4DPWA 1IBLI 2EFGA 4YY3E 4PRXA 5GMDA 4USKA 2NUGA 4LF7I 4YHHE 1Z5AA 5GMEA 4DR2E 3ZKBA 3P1XA 4JI5I 4DXLA 2BV3A 2LJHA 3JAMQ 4LFBE 4JI8I 2OI2A 3H4LA 4DV5I 4JYAE 4UT4A 4LFAE 5FLXC 2L3JA 3V5RA 1YZ9A 1HNWI 4LF6E 5LMUI 2DIXA 2A2DA 1J5EE 1I94E 2UXBI 1XMQE 2HK3A 3T1YI 4JI7E 1EKZA 3J7AG 3PYDA 4DUZI 3LNUA 1FWKA 1B62A 2VQEI 4B3SE 4LFCE 3QT5A 2ZBKB 1N33I 3QT7A 1KIJA 4B3ME 4DV6E
chains in the Genus database with same CATH superfamily
4JI2I 3KWRA 4F2JC 2UUBI 1SFEA 4DR1I 5JEAF 4BA2A 2DB2A 1IBKI 3T1HE 4AQYI 1Z0WA 1ZM4A 1XXEA 1LLMC 4MYUA 4JI4E 1Z5BA 4URLA 4LF5I 2BR2B 3GCMA 1DQ3A 5A2QC 3P3EA 3JAMC 1UDOA 4IFDD 2EPRA 1IBLE 2J7JA 2F8BA 2DEJA 3Q1QA 3ZKDA 4X65I 4LF7E 4OO1E 2HKEA 4LF4I 4HEIA 4R8OA 4N3OA 4FW7A 1QZRA 3K1JA 2YU5A 4DU8A 1B63A 4XTJA 2PO1A 4MU4A 3DJWA 4DV1E 4B3TE 4LPFA 4X62E 1PJSA 2ZITA 3CDIA 1X6EA 1RQ0A 4JV5I 4JI3E 1A1IA 1X3CA 3UK3C 2YSOA 4JI0I 2ELZA 4R2SA 4FWDA 2EM2A 3ZOQB 4GKJI 2EE8A 1T4OA 1VISA 2EOZA 2WP8A 2L33A 1OJ4A 4OKGA 2C39B 4L8NA 4WSGA 3V2UC 2EPLX 2YTJA 4M9VC 5EKWA 1Z0TA 1YH8A 2O1VA 1XNRE 2NN6C 4DR4E 2I9IA 4EMDA 2Z5EA 4O5GA 4WYQB 2EN6A 5KL5A 4ZYGA 3B82A 5FLXQ 1HNXE 1WHNA 2H36X 1IQSA 2EQ3A 3ADJA 2DLKA 4BA1A 4LOMA 3QG5C 4DPTA 2VF1A 4LU9A 4NBQA 3T1YE 2EL4A 2BA0G 2DSYA 1JK1A 3MHHC 2HKJA 2XEXA 4JI1I 2X7IA 2JE6B 3ZZUA 4F54A 1ZAAC 3B8HA 2DMYA 4P7AA 2YSPA 2E72A 2EM9A 2RTXA 3H1CA 2EP3A 2EMZA 2MDGA 2B3TB 4FW9A 2VE7C 1N33E 2EM5A 3TQMA 4FWGA 4DR5E 3Q6MA 4MDTA 1HNZI 2YPNA 2LMZA 1YUJA 4J3DA 4U3DA 2LCEA 4FW3A 2B7TA 4N4RB 4DR1E 2V89A 2PNZA 1KVKA 4GZNC 1HR0I 2EMFA 1P47A 1IBKE 2Q2EB 2EPUA 4BMJA 2IHR1 2HFUA 4DR6E 4IZJB 5K36C 5C0XF 4P52A 2EMBA 5KL7A 2L3CA 2EOOA 1G2FC 1G2DC 1B69A 4F9AB 1KJKA 2EN1A 3HPSA 2CG9A 4USMA 4DR3I 4DV3E 5JEAC 2ZM6I 1KTVA 4X9JA 3GONA 1TF6A 2CVEA 1R6LA 4RH8A 1T4LB 2EM0A 2EN7A 3PS2A 2JEAB 4KZSA 2WZOA 2MKNA 2MKDA 2AE8A 3Q6NA 2YTGA 5A2QQ 5AASA 2D9HA 4TUIA 1RR9A 4OX9E 1MEYC 1UBDC 2J7KA 2L2MA 5IWAI 4AM3A 2C37B 2EWLA 3LTOA 4F6MA 2ENAA 3IWCA 2CGEA 2EMHA 3M99B 2WBTA 4RHBB 2HFSA 3VHTB 3ZZTA 1YYWA 1F2IG 5CFFE 4GKJE 4WUCA 2DRPA 1DGCA 4HY1A 2K7IA 1EH8A 2C38B 3K17A 1MG7A 2N3GA 4QNKA 4B3RE 3CWVA 5ELWA 2PO0B 2NA2A 5DRQA 4X66I 2NN6D 3F6HA 1U2RA 2EPZA 5F3WA 2BA1D 5AE3A 2EQ1A 3DF6A 1YYOA 1N34E 3ECRA 2JOBA 1H72C 2VF3A 4X64I 1ZM9A 2EPCA 1X6FA 4OOGC 4R2QA 1Y6ZA 3ZM7A 4OO1B 1Z0EA 4NXMI 4R2DA 4K0KI 1Z0BA 4NXNI 1PDAA 1X48A 3THNA 2CPNA 4DPXA 1WJPA 3BIDA 2RS6A 1ZBTA 2UUAI 1YHCA 2Z5CB 5A6JA 2FV4B 2UU9I 3VK6A 2YTPA 2CTDA 2GHFA 2ENHA 1UDSA 4DR7E 1ZXMA 2VQFI 1A1HA 4DV0I 3J80Q 2L92A 5T6JA 4OO1F 2UXDI 4GEQB 5IT9C 1T38A 1A1KA 4DV7I 1ZU1A 1N0VC 4DV4I 2ODRC 3WU4A 4ED4A 3M6AA 2HK2A 2RPCA 4MYTA 4LF9I 2JEBA 1HNZE 4LCGA 4DKKA 2R3VA 5JEAA 4MLVA 1NHIA 5KL6A 2R42A 4DMIA 3PYFA 3F6GA 3L7ZB 1X6HA 1AAYA 3HKMA 1RREA 2UUCI 2EOQA 1FNMA 3M7ND 2HGHA 4M2ZA 1GQEA 5K36D 2HHHE 2EPKX 1N32E 4HYMA 5DRRA 1Z0CA 3U1YA 1UDNA 2I13A 2O3ZA 1N0UA 4TUGA 4JI6E 4BBYA 2JWOA 4IFDB 2IESA 2GPIA 4DR3E 3BBGA 1MX0A 5JEAD 2AJ4A 2X36A 3HULA 4JI5E 2EORA 1YSAC 1FWLA 2RS7A 3WU6A 2F4VI 4BA2B 5C0XC 2L2KB 2JY9A 1H7SA 2FGGA 2WNRA 5IWAE 1OYPA 4JI8E 2CZ9A 1H74A 1P42A 2JYAA 4DV5E 2M7QA 2YT4A 1O0WA 3C4BA 4MU0A 4GKKI 1N36I 1FJGI 2CSHA 3P3CA 4HACB 3M85G 1R6MA 4WUDA 2V86A 1Z5CA 4U3BA 5BR8I 1Y5YA 4QNJA 2WW4A 2YTEA 1A1FA 4X66E 2PO1B 3VYXA 5IV8B 4NHRA 2EPXA 4LF8I 1HNWE 1MU5A 5LMUE 2EN2A 4IZKA 2C39A 2EOJA 3J80C 1Y60A 1DI2A 2UXCI 4X64E 2BM0A 1Y4UA 2EMLA 4DUYI 2YTOA 4NXME 2L2NA 2V2QA 2UXBE 4LFBI 2YRKA 4IFDE 2M4IA 1ZM2A 2UUAE 3LPSA 1IQOA 1Z0VA 2EM6A 1E3HA 1XMOI 2EPMX 3PS1A 4DV0E 4JYAI 2VQFE 4BC9A 4O43A 4DUZE 1HK7A 2V2VA 1EH6A 3J7Yp 2UXDE 4FW5A 2VQEE 4BHBA 4DV7E 2ODRD 2PRTA 3LMLA 2V8PA 5DROA 2JE6A 5ADZA 1PKPA 5EL9A 3B78A 2O1TA 3OTOI 3PYGA 4LF6I 2PO2A 2EM3A 4OZEA 3QT8A 4AIDA 2VESA 4BA1B 2ENCA 4JI2E 4Z7YA 2EQ0A 2UUBE 2LVHA 1PIEA 1J5EI 2EL5A 4OO1C 2EPNA 4UTGA 2M9AA 4WX9A 1ELOA 1XMQI 5KL4A 2EOXA 5C0XA 5IT9Q 2MC5A 4AQYE 3KZYA 1X49A 5A69A 1H7UA 2BB8A 1NHJA 1XHKA 2E1RA 2PNLA 4JI7I 4LF5E 1PVGA 2V2ZA 5DNXA 2EMCA 3EPHA 3DD6A 1ZBQA 2JOXA 1UHZA 2JPAA 4IZJA 4JG4A 4DU7A 2N8XA 1T4NA 4B3SI 1WUUA 4X65E 3HJCA 2EMXA 3P3GA 4LF4E 4R2RA 1D6TA 2KONA 5C0XD 3VYYA 4PU9A 4B3MI 1USUA 4LCFA 2HC5A 1OYRA 1YPNA 1OYSA 4JV5E 3ADGA 4FN5A 4BS9A 4IZJD 2LUPB 4MU3A 4JI0E 2F1DA 1N36E 4I3HA 4JI4I 3K85A 4KHPI 2C37A 2YTQA 3JU0A 3C6KA 4L5NC 3KZZA 1A1JA 2NUFA 1KKHA 4MLQA 5BR8E 1TF3A 3NZKA 2BA0D 2EOMA 2YWQA 1RMDA 3AV0A 1Z1BA 1XNQI 2NUEA 4O4KA 4LF8E 2GS8A 1BKNA 3H09A 2NN6B 5FWKA 2V85A 2PO0A 4WFTA 2UXCE 4F9CB 2LT7A 1S4EA 5K36A 2EPOA 2EZ6A 3P06A 3EPLA 5L3JA 4DUYE 4DV1I 4B3TI 1EI1A 2EM4A 4X62I 4P78A 1EH7A 2EM8A 5DRPA 2EPAA 2FTXB 4JI3I 2EMGA 2V83A 4WSPA 1N3GA 1XMOE 2DEIA 4OO1A 2V34A 4FW6A 2EM7A 4BC7A 4JI1E 3ZZ0A 2LE2A 2CT1A 3BF2A 2LUQA 4R03A 3J81C 3F0NA 2E5LI 4DPYA 4R2AA 2Z5BB 1XNRI 3OTOE 4KQVA 3RMPA 4KWYA 5TSEA 4DR4I 3EQ1A 4AIMA 4BCAA 2YTDA 2DMIA 4OO1D 1HNXI 2N3HA 1HR0E 4DV2I 1WXRA 2WCC3 4FK5C 2K4VA 1MGTA 2EL6A 1UEKA 3L7ZA 4FWHA 1K47A 2NN6E 3KRNA 2WBUA 4LCHA 2EOSA 2LTSA 2JP9A 4F6NA 3ADIA 4I8OA 2JEBB 5IXMB 4M1KA 1TN9A 2ZM6E 5JEAB 1X47A 4DPUA 2BR2A 1RHYA 2R76A 4RPFA 2EMKA 2EOYA 2GLIA 3PRYA 4IFDA 3MHSC 1S16A 2LRSA 4DR5I 2LTRA 3ADLA 1IBMI 2IERA 4IFDF 4ZYHA 3LLHA 2V88A 1GTKA 5DNYA 2RSIA 1A6FA 4WUBA 2RSMA 4O24A 5LLQA 2O1UA 3EPKA 1KYQA 4DR6I 2YTNA 5LMNI 1H73A 4Z7CA 4KHPE 2NPFA 2L8TA 2B9DA 3WU3A 2VRDA 5A6BA 2KHXA 1NZ0A 1XNQE 1L4SA 4YY3I 3C4TA 1A1LA 4HACA 4ZVIA 4DV3I 2YRMA 4BHCA 2A2CA 2WNRB 2LO3A 4YHHI 4DR2I 1JK2A 1PJTA 2V87A 4R2CA 2YU8A 5K36E 3GLLA 3UHMA 2R1FA 2EMWA 3THOB 2MDRA 2E1MA 1USVA 2BBGA 4K0KE 4J8ZA 1FI4A 4NXNE 4R2EA 3AUZA 4OX9I 2J65A 5A6BD 2WP8B 2JVAA 5JEAE 2UU9E 4R1FA 3J7AM 4FW4A 1AH5A 4HXZA 4LFAI 1ZR9A 1NHHA 1WHQA 2E5LE 4IZKB 5AE2A 4DV4E 4B3RI 3PYEA 1YFHA 3OMLA 1RC7A 2BM1A 1NCSA 4LF9E 1J26A 2YRHA 3IWBA 1ZXNA 2Q8UA 3HPZA 4M0VA 2ADRA 2YZTA 1N34I 2RQLA 3WU5A 3JTZA 4DV2E 3QT6A 1I94I 3C6MA 3BGHA 3MSWA 4WXDA 3IWDA 1FKAE 5KL2A 2UUCE 3J81Q 1IMUA 1UILA 4PRVA 1BB8A 2LJPA 1STUA 1WRJA 4DR7I 3P76A 2LBSB 2BA1G 5AC5A 1A1GA 2IOQA 2PO2B 2EMYA 4LFCI 2GQ0A 4MQYA 4R2PA 3PS3A 1GZ6A 3M85D 3HTXA 1ZM3A 4Q35B 4X8WA 1UDQA 3CDJA 2PNZB 4MU1A 4ISAA 2F4VE 4M30A 1YUIA 2B7VA 2EN4A 1IBME 5C0XB 3D4JA 2M1SA 1DARA 4DV6I 5A6AA 5LL6R 2G7HA 1Z59A 2JEAA 2PNMA 1YYKA 2LV2A 2EOFA 3GMEA 2IOPA 3T1HI 4GKKE 2HHHI 5LMNE 2EN8A 1EA6A 1N32I 4HTGA 1FJGE 3L00A 1BBGA 1QU6A 1Z0GA 4JI6I 1PJQA 4DPWA 4IFDC 2JT2A 3B4TA 2EJ4A 4P7DA 1NEIA 4YY3E 2EFGA 4PRXA 4USKA 5GMDA 1IBLI 2NUGA 4LF7I 2LJUA 4YHHE 1Z5AA 5GMEA 4DR2E 4WPYA 2C38A 3ZKBA 3P1XA 2GO3A 4JI5I 2YTIA 3M7NG 4DXLA 2BV3A 2NN6A 2LJHA 1X5WA 3JAMQ 4LFBE 4JI8I 5DNLA 2EOIA 4IS9A 2OI2A 3H4LA 2NN6F 4DV5I 5KL3A 1Y4SA 5A6KA 2DLQA 4JYAE 2JR1A 3EPJA 2EN3A 4UT4A 1QNTA 2O1WA 5FLXC 4LFAE 2HJJA 2L3JA 1UN6B 3U1KA 3K6QA 2DGCA 2Z5CA 2A25A 5C0XE 3HXLA 4ZYEA 3FIGA 3V5RA 2EMAA 1YZ9A 4ZYDA 4IS1C 1BBOA 1HNWI 4LF6E 5LMUI 2DIXA 4NZVA 1E3PA 2KOUA 5AC4A 2Z5BA 2A2DA 2YTFA 1J5EE 5AE1A 2EPPA 1I94E 2EOEA 2UXBI 1XMQE 2NABA 2WBSA 2HK3A 2JXPA 2L6MA 2MC6A 4GQUA 3T1YI 4IJDA 4JI7E 1EKZA 1VI7A 5K36B 3J7AG 3PYDA 4WXCA 4DUZI 1SR9A 2ELYA 2GO4A 1FWKA 3LNUA 2EMIA 1B62A 2VQEI 4B3SE 4Q28A 4LFCE 4LTYA 1T39A 4F9BB 2ZBKB 2EOHA 3QT5A 5K36F 1N33I 2V8QB 3QT7A 1KIJA 4B3ME 4DV6E 3HQ1A
chains in the Genus database with same CATH topology
4JI2I 3KWRA 2UUBI 4DR1I 2DB2A 1IBKI 3T1HE 4AQYI 1Z0WA 1ZM4A 4MYUA 4JI4E 1Z5BA 4URLA 4LF5I 1DQ3A 5A2QC 3JAMC 1IBLE 2F8BA 2DEJA 3Q1QA 3ZKDA 4X65I 4LF7E 2HKEA 4LF4I 4R8OA 4N3OA 1QZRA 3K1JA 4DU8A 1B63A 4XTJA 3DJWA 4DV1E 4B3TE 4X62E 2ZITA 1RQ0A 4JV5I 4JI3E 4JI0I 4FWDA 3ZOQB 4GKJI 1T4OA 1VISA 2L33A 1OJ4A 4L8NA 3V2UC 1Z0TA 2O1VA 1XNRE 4DR4E 4EMDA 2Z5EA 4WYQB 3B82A 5FLXQ 1HNXE 1WHNA 2H36X 3ADJA 4DPTA 2VF1A 4LU9A 3T1YE 2DSYA 2HKJA 2XEXA 4JI1I 2X7IA 3ZZUA 4F54A 3B8HA 2DMYA 4P7AA 2RTXA 4FW9A 2B3TB 2VE7C 1N33E 4FWGA 4DR5E 3Q6MA 1HNZI 2LMZA 2B7TA 4DR1E 2V89A 1KVKA 1HR0I 2Q2EB 1IBKE 4BMJA 2IHR1 2HFUA 4DR6E 4IZJB 4P52A 2L3CA 4F9AB 3HPSA 2CG9A 4USMA 4DR3I 4DV3E 2ZM6I 1KTVA 3GONA 1T4LB 4KZSA 2WZOA 3Q6NA 5A2QQ 5AASA 1RR9A 4TUIA 2J7KA 4OX9E 5IWAI 2L2MA 2EWLA 3LTOA 3IWCA 2CGEA 2HFSA 3ZZTA 1YYWA 4GKJE 5CFFE 4WUCA 4HY1A 3K17A 1MG7A 2N3GA 4B3RE 3CWVA 2NA2A 4X66I 3F6HA 1U2RA 5F3WA 5AE3A 3DF6A 1YYOA 1N34E 2VF3A 2JOBA 1H72C 4X64I 1ZM9A 4OOGC 1Y6ZA 3ZM7A 1Z0EA 4NXMI 4K0KI 1Z0BA 4NXNI 1X48A 2CPNA 4DPXA 2RS6A 1ZBTA 2UUAI 2Z5CB 2FV4B 2UU9I 3VK6A 4DV0I 4DR7E 1ZXMA 2VQFI 3J80Q 2L92A 5T6JA 2UXDI 4GEQB 5IT9C 4DV7I 1N0VC 4DV4I 2ODRC 3WU4A 4ED4A 3M6AA 2HK2A 4MYTA 4LF9I 1HNZE 4DKKA 2R3VA 1NHIA 2R42A 4DMIA 3PYFA 3F6GA 1RREA 2UUCI 1FNMA 4M2ZA 1GQEA 2HHHE 1N32E 4HYMA 1Z0CA 1N0UA 4TUGA 4JI6E 4BBYA 2JWOA 4DR3E 1MX0A 2AJ4A 2X36A 3HULA 4JI5E 1FWLA 2RS7A 3WU6A 2F4VI 2L2KB 2JY9A 1H7SA 2FGGA 5IWAE 4JI8E 2CZ9A 1H74A 4DV5E 2M7QA 2YT4A 1O0WA 3C4BA 4GKKI 1N36I 1FJGI 4HACB 4WUDA 2V86A 1Z5CA 5BR8I 2WW4A 4X66E 3VYXA 4LF8I 1HNWE 1MU5A 5LMUE 4IZKA 3J80C 1DI2A 2UXCI 4X64E 2BM0A 1Y4UA 4DUYI 2V2QA 4NXME 2L2NA 2UXBE 4LFBI 2M4IA 1ZM2A 2UUAE 3LPSA 1Z0VA 1XMOI 4JYAI 4DV0E 2VQFE 4BC9A 4DUZE 1HK7A 2V2VA 3J7Yp 2UXDE 2VQEE 4DV7E 2ODRD 3LMLA 2V8PA 5ADZA 1PKPA 3B78A 2O1TA 3OTOI 3PYGA 4LF6I 3QT8A 4JI2E 4Z7YA 2UUBE 1PIEA 1J5EI 4UTGA 1ELOA 1XMQI 5IT9Q 2MC5A 4AQYE 1X49A 1H7UA 1NHJA 4JI7I 1XHKA 2E1RA 2PNLA 4LF5E 1PVGA 2V2ZA 1ZBQA 2JOXA 1UHZA 4IZJA 4JG4A 4DU7A 1T4NA 4B3SI 1WUUA 4X65E 3HJCA 4LF4E 1D6TA 2KONA 3VYYA 4PU9A 4B3MI 1USUA 4JV5E 3ADGA 4FN5A 4BS9A 4IZJD 2LUPB 4JI0E 1N36E 4I3HA 4JI4I 3K85A 4KHPI 3JU0A 4L5NC 2NUFA 1KKHA 5BR8E 3AV0A 1XNQI 2NUEA 4LF8E 2GS8A 1BKNA 3H09A 5FWKA 2V85A 4WFTA 2UXCE 4F9CB 1S4EA 2EZ6A 3P06A 5L3JA 4DUYE 4DV1I 4B3TI 1EI1A 4X62I 4P78A 2FTXB 4JI3I 2V83A 4WSPA 1XMOE 2DEIA 2V34A 4BC7A 4JI1E 3ZZ0A 2LE2A 2LUQA 4R03A 3J81C 3F0NA 2E5LI 4DPYA 2Z5BB 1XNRI 3OTOE 4KQVA 3RMPA 4DR4I 4BCAA 1HNXI 2N3HA 1HR0E 4DV2I 1WXRA 2K4VA 1UEKA 4FWHA 1K47A 2LTSA 3ADIA 4I8OA 4M1KA 2ZM6E 1X47A 4DPUA 4RPFA 3PRYA 1S16A 2LRSA 4DR5I 2LTRA 3ADLA 1IBMI 3LLHA 2V88A 5DNYA 1A6FA 4WUBA 2RSMA 2O1UA 4DR6I 5LMNI 1H73A 4Z7CA 4KHPE 2NPFA 2L8TA 2B9DA 3WU3A 2KHXA 1NZ0A 1XNQE 4YY3I 3C4TA 4HACA 4ZVIA 4DV3I 4YHHI 2A2CA 4DR2I 2V87A 2MDRA 2E1MA 1USVA 4K0KE 4J8ZA 1FI4A 4NXNE 3AUZA 4OX9I 2JVAA 2UU9E 4R1FA 3J7AM 4HXZA 4LFAI 1NHHA 1WHQA 2E5LE 4IZKB 5AE2A 4DV4E 4B3RI 3PYEA 3OMLA 1RC7A 2BM1A 4LF9E 1J26A 3IWBA 1ZXNA 3HPZA 4M0VA 2YZTA 1N34I 3WU5A 3JTZA 4DV2E 3QT6A 1I94I 3MSWA 2UUCE 3IWDA 1FKAE 3J81Q 1UILA 4PRVA 2LJPA 1STUA 4DR7I 2LBSB 2IOQA 4LFCI 2GQ0A 1GZ6A 3HTXA 1ZM3A 4X8WA 2F4VE 4M30A 2B7VA 1IBME 3D4JA 2M1SA 1DARA 4DV6I 5LL6R 2G7HA 1Z59A 2PNMA 1YYKA 3T1HI 2IOPA 4GKKE 2HHHI 5LMNE 1EA6A 1N32I 1FJGE 1QU6A 1Z0GA 4JI6I 4DPWA 1IBLI 4P7DA 4YY3E 2EFGA 4PRXA 4USKA 5GMDA 2NUGA 4LF7I 4YHHE 1Z5AA 5GMEA 4DR2E 4WPYA 3ZKBA 3P1XA 4JI5I 4DXLA 2BV3A 2LJHA 3JAMQ 4LFBE 4JI8I 2OI2A 3H4LA 4DV5I 1Y4SA 4JYAE 2JR1A 4UT4A 2O1WA 5FLXC 4LFAE 2L3JA 3K6QA 2Z5CA 3HXLA 3FIGA 3V5RA 1YZ9A 1HNWI 4LF6E 5LMUI 2DIXA 2KOUA 2Z5BA 2A2DA 1J5EE 5AE1A 1I94E 2UXBI 1XMQE 2HK3A 2L6MA 2MC6A 3T1YI 4JI7E 1EKZA 3J7AG 3PYDA 4DUZI 1SR9A 3LNUA 1FWKA 1B62A 2VQEI 4B3SE 4Q28A 4LFCE 4LTYA 3QT5A 4F9BB 2ZBKB 1N33I 2V8QB 3QT7A 1KIJA 4B3ME 4DV6E 3HQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 I;  2UUB I;  4DR1 I;  2DB2 A;  1IBK I;  3T1H E;  4AQY I;  1Z0W A;  1ZM4 A;  4MYU A;  4JI4 E;  1Z5B A;  4URL A;  4LF5 I;  5A2Q C;  3JAM C;  1IBL E;  2DEJ A;  3Q1Q A;  3ZKD A;  4X65 I;  4LF7 E;  2HKE A;  4LF4 I;  1QZR A;  3K1J A;  4DU8 A;  1B63 A;  4XTJ A;  4DV1 E;  4B3T E;  4X62 E;  2ZIT A;  1RQ0 A;  4JV5 I;  4JI3 E;  4JI0 I;  4FWD A;  4GKJ I;  1T4O A;  1VIS A;  2L33 A;  1OJ4 A;  3V2U C;  1Z0T A;  1XNR E;  4DR4 E;  4EMD A;  4WYQ B;  3B82 A;  5FLX Q;  1HNX E;  1WHN A;  3ADJ A;  4DPT A;  3T1Y E;  2HKJ A;  2XEX A;  4JI1 I;  2X7I A;  3ZZU A;  3B8H A;  2DMY A;  4P7A A;  2RTX A;  4FW9 A;  2B3T B;  1N33 E;  4FWG A;  4DR5 E;  1HNZ I;  2B7T A;  4DR1 E;  1KVK A;  1HR0 I;  2Q2E B;  1IBK E;  2IHR 1;  2HFU A;  4DR6 E;  4P52 A;  2L3C A;  4USM A;  4DR3 I;  4DV3 E;  2ZM6 I;  1KTV A;  3GON A;  1T4L B;  5A2Q Q;  1RR9 A;  2J7K A;  5IWA I;  4OX9 E;  2L2M A;  3LTO A;  2HFS A;  3ZZT A;  1YYW A;  4GKJ E;  5CFF E;  4WUC A;  4HY1 A;  3K17 A;  1MG7 A;  2N3G A;  4B3R E;  3CWV A;  2NA2 A;  4X66 I;  1U2R A;  1YYO A;  1N34 E;  2VF3 A;  1H72 C;  4X64 I;  1ZM9 A;  4OOG C;  3ZM7 A;  1Z0E A;  4NXM I;  4K0K I;  1Z0B A;  4NXN I;  1X48 A;  2CPN A;  4DPX A;  2RS6 A;  1ZBT A;  2UUA I;  2UU9 I;  4DV0 I;  4DR7 E;  1ZXM A;  2VQF I;  3J80 Q;  2UXD I;  5IT9 C;  4DV7 I;  1N0V C;  4DV4 I;  3WU4 A;  4ED4 A;  3M6A A;  2HK2 A;  4MYT A;  4LF9 I;  1HNZ E;  4DKK A;  2R3V A;  1NHI A;  2R42 A;  3PYF A;  1RRE A;  2UUC I;  1FNM A;  4M2Z A;  1GQE A;  2HHH E;  1N32 E;  4HYM A;  1Z0C A;  1N0U A;  4JI6 E;  4DR3 E;  1MX0 A;  2AJ4 A;  2X36 A;  3HUL A;  4JI5 E;  1FWL A;  2RS7 A;  3WU6 A;  2F4V I;  2L2K B;  2JY9 A;  1H7S A;  5IWA E;  4JI8 E;  2CZ9 A;  1H74 A;  4DV5 E;  2YT4 A;  1O0W A;  3C4B A;  4GKK I;  1N36 I;  1FJG I;  4HAC B;  4WUD A;  1Z5C A;  5BR8 I;  2WW4 A;  4X66 E;  3VYX A;  4LF8 I;  1HNW E;  1MU5 A;  5LMU E;  3J80 C;  1DI2 A;  2UXC I;  4X64 E;  2BM0 A;  4DUY I;  2V2Q A;  4NXM E;  2L2N A;  2UXB E;  4LFB I;  1ZM2 A;  2UUA E;  3LPS A;  1Z0V A;  1XMO I;  4JYA I;  4DV0 E;  2VQF E;  2V2V A;  4DUZ E;  3J7Y p;  2UXD E;  2VQE E;  4DV7 E;  2V8P A;  1PKP A;  3B78 A;  3OTO I;  3PYG A;  4LF6 I;  3QT8 A;  4JI2 E;  4Z7Y A;  2UUB E;  1PIE A;  1J5E I;  4UTG A;  1ELO A;  1XMQ I;  5IT9 Q;  4AQY E;  1X49 A;  1H7U A;  1NHJ A;  4JI7 I;  1XHK A;  2E1R A;  1PVG A;  2V2Z A;  4LF5 E;  1UHZ A;  4JG4 A;  4DU7 A;  1T4N A;  4B3S I;  1WUU A;  4X65 E;  4LF4 E;  1D6T A;  3VYY A;  4PU9 A;  4B3M I;  4JV5 E;  3ADG A;  4FN5 A;  2LUP B;  4JI0 E;  1N36 E;  4I3H A;  4JI4 I;  4KHP I;  2NUF A;  1KKH A;  5BR8 E;  1XNQ I;  2NUE A;  4LF8 E;  2GS8 A;  1BKN A;  4WFT A;  2UXC E;  1S4E A;  2EZ6 A;  5L3J A;  4DUY E;  4DV1 I;  4B3T I;  1EI1 A;  4X62 I;  4JI3 I;  1XMO E;  2DEI A;  2V34 A;  4JI1 E;  3ZZ0 A;  2LUQ A;  3J81 C;  3F0N A;  2E5L I;  4DPY A;  1XNR I;  3OTO E;  4KQV A;  4DR4 I;  1HNX I;  2N3H A;  1HR0 E;  4DV2 I;  1UEK A;  4FWH A;  1K47 A;  2LTS A;  3ADI A;  4M1K A;  2ZM6 E;  1X47 A;  4DPU A;  4RPF A;  1S16 A;  2LRS A;  4DR5 I;  2LTR A;  3ADL A;  1IBM I;  3LLH A;  1A6F A;  4WUB A;  2RSM A;  4DR6 I;  5LMN I;  1H73 A;  4Z7C A;  4KHP E;  2NPF A;  3WU3 A;  2KHX A;  1NZ0 A;  1XNQ E;  4YY3 I;  3C4T A;  4HAC A;  4ZVI A;  4DV3 I;  4YHH I;  2A2C A;  4DR2 I;  2MDR A;  4K0K E;  1FI4 A;  4NXN E;  4OX9 I;  2JVA A;  2UU9 E;  4R1F A;  3J7A M;  4HXZ A;  4LFA I;  1NHH A;  1WHQ A;  2E5L E;  4DV4 E;  4B3R I;  3PYE A;  1RC7 A;  2BM1 A;  4LF9 E;  1J26 A;  1ZXN A;  1N34 I;  3WU5 A;  4DV2 E;  3QT6 A;  1I94 I;  2UUC E;  1FKA E;  3J81 Q;  1UIL A;  4PRV A;  2LJP A;  1STU A;  4DR7 I;  2LBS B;  4LFC I;  3HTX A;  1ZM3 A;  4X8W A;  2F4V E;  4M30 A;  2B7V A;  1IBM E;  3D4J A;  1DAR A;  4DV6 I;  5LL6 R;  1Z59 A;  1YYK A;  3T1H I;  4GKK E;  2HHH I;  5LMN E;  1EA6 A;  1N32 I;  1FJG E;  1QU6 A;  1Z0G A;  4JI6 I;  4DPW A;  1IBL I;  2EFG A;  4YY3 E;  4PRX A;  5GMD A;  4USK A;  2NUG A;  4LF7 I;  4YHH E;  1Z5A A;  5GME A;  4DR2 E;  3ZKB A;  3P1X A;  4JI5 I;  4DXL A;  2BV3 A;  2LJH A;  3JAM Q;  4LFB E;  4JI8 I;  2OI2 A;  3H4L A;  4DV5 I;  4JYA E;  4UT4 A;  4LFA E;  5FLX C;  2L3J A;  3V5R A;  1YZ9 A;  1HNW I;  4LF6 E;  5LMU I;  2DIX A;  2A2D A;  1J5E E;  1I94 E;  2UXB I;  1XMQ E;  2HK3 A;  3T1Y I;  4JI7 E;  1EKZ A;  3J7A G;  3PYD A;  4DUZ I;  3LNU A;  1FWK A;  1B62 A;  2VQE I;  4B3S E;  4LFC E;  3QT5 A;  2ZBK B;  1N33 I;  3QT7 A;  1KIJ A;  4B3M E;  4DV6 E; 
#chains in the Genus database with same CATH topology
 4JI2 I;  3KWR A;  4F2J C;  2UUB I;  1SFE A;  4DR1 I;  5JEA F;  4BA2 A;  2DB2 A;  1IBK I;  3T1H E;  4AQY I;  1Z0W A;  1ZM4 A;  1XXE A;  1LLM C;  4MYU A;  4JI4 E;  1Z5B A;  4URL A;  4LF5 I;  2BR2 B;  3GCM A;  1DQ3 A;  5A2Q C;  3P3E A;  3JAM C;  1UDO A;  4IFD D;  2EPR A;  1IBL E;  2J7J A;  2F8B A;  2DEJ A;  3Q1Q A;  3ZKD A;  4X65 I;  4LF7 E;  4OO1 E;  2HKE A;  4LF4 I;  4HEI A;  4R8O A;  4N3O A;  4FW7 A;  1QZR A;  3K1J A;  2YU5 A;  4DU8 A;  1B63 A;  4XTJ A;  2PO1 A;  4MU4 A;  3DJW A;  4DV1 E;  4B3T E;  4LPF A;  4X62 E;  1PJS A;  2ZIT A;  3CDI A;  1X6E A;  1RQ0 A;  4JV5 I;  4JI3 E;  1A1I A;  1X3C A;  3UK3 C;  2YSO A;  4JI0 I;  2ELZ A;  4R2S A;  4FWD A;  2EM2 A;  3ZOQ B;  4GKJ I;  2EE8 A;  1T4O A;  1VIS A;  2EOZ A;  2WP8 A;  2L33 A;  1OJ4 A;  4OKG A;  2C39 B;  4L8N A;  4WSG A;  3V2U C;  2EPL X;  2YTJ A;  4M9V C;  5EKW A;  1Z0T A;  1YH8 A;  2O1V A;  1XNR E;  2NN6 C;  4DR4 E;  2I9I A;  4EMD A;  2Z5E A;  4O5G A;  4WYQ B;  2EN6 A;  5KL5 A;  4ZYG A;  3B82 A;  5FLX Q;  1HNX E;  1WHN A;  2H36 X;  1IQS A;  2EQ3 A;  3ADJ A;  2DLK A;  4BA1 A;  4LOM A;  3QG5 C;  4DPT A;  2VF1 A;  4LU9 A;  4NBQ A;  3T1Y E;  2EL4 A;  2BA0 G;  2DSY A;  1JK1 A;  3MHH C;  2HKJ A;  2XEX A;  4JI1 I;  2X7I A;  2JE6 B;  3ZZU A;  4F54 A;  1ZAA C;  3B8H A;  2DMY A;  4P7A A;  2YSP A;  2E72 A;  2EM9 A;  2RTX A;  3H1C A;  2EP3 A;  2EMZ A;  2MDG A;  2B3T B;  4FW9 A;  2VE7 C;  1N33 E;  2EM5 A;  3TQM A;  4FWG A;  4DR5 E;  3Q6M A;  4MDT A;  1HNZ I;  2YPN A;  2LMZ A;  1YUJ A;  4J3D A;  4U3D A;  2LCE A;  4FW3 A;  2B7T A;  4N4R B;  4DR1 E;  2V89 A;  2PNZ A;  1KVK A;  4GZN C;  1HR0 I;  2EMF A;  1P47 A;  1IBK E;  2Q2E B;  2EPU A;  4BMJ A;  2IHR 1;  2HFU A;  4DR6 E;  4IZJ B;  5K36 C;  5C0X F;  4P52 A;  2EMB A;  5KL7 A;  2L3C A;  2EOO A;  1G2F C;  1G2D C;  1B69 A;  4F9A B;  1KJK A;  2EN1 A;  3HPS A;  2CG9 A;  4USM A;  4DR3 I;  4DV3 E;  5JEA C;  2ZM6 I;  1KTV A;  4X9J A;  3GON A;  1TF6 A;  2CVE A;  1R6L A;  4RH8 A;  1T4L B;  2EM0 A;  2EN7 A;  3PS2 A;  2JEA B;  4KZS A;  2WZO A;  2MKN A;  2MKD A;  2AE8 A;  3Q6N A;  2YTG A;  5A2Q Q;  5AAS A;  2D9H A;  4TUI A;  1RR9 A;  4OX9 E;  1MEY C;  1UBD C;  2J7K A;  2L2M A;  5IWA I;  4AM3 A;  2C37 B;  2EWL A;  3LTO A;  4F6M A;  2ENA A;  3IWC A;  2CGE A;  2EMH A;  3M99 B;  2WBT A;  4RHB B;  2HFS A;  3VHT B;  3ZZT A;  1YYW A;  1F2I G;  5CFF E;  4GKJ E;  4WUC A;  2DRP A;  1DGC A;  4HY1 A;  2K7I A;  1EH8 A;  2C38 B;  3K17 A;  1MG7 A;  2N3G A;  4QNK A;  4B3R E;  3CWV A;  5ELW A;  2PO0 B;  2NA2 A;  5DRQ A;  4X66 I;  2NN6 D;  3F6H A;  1U2R A;  2EPZ A;  5F3W A;  2BA1 D;  5AE3 A;  2EQ1 A;  3DF6 A;  1YYO A;  1N34 E;  3ECR A;  2JOB A;  1H72 C;  2VF3 A;  4X64 I;  1ZM9 A;  2EPC A;  1X6F A;  4OOG C;  4R2Q A;  1Y6Z A;  3ZM7 A;  4OO1 B;  1Z0E A;  4NXM I;  4R2D A;  4K0K I;  1Z0B A;  4NXN I;  1PDA A;  1X48 A;  3THN A;  2CPN A;  4DPX A;  1WJP A;  3BID A;  2RS6 A;  1ZBT A;  2UUA I;  1YHC A;  2Z5C B;  5A6J A;  2FV4 B;  2UU9 I;  3VK6 A;  2YTP A;  2CTD A;  2GHF A;  2ENH A;  1UDS A;  4DR7 E;  1ZXM A;  2VQF I;  1A1H A;  4DV0 I;  3J80 Q;  2L92 A;  5T6J A;  4OO1 F;  2UXD I;  4GEQ B;  5IT9 C;  1T38 A;  1A1K A;  4DV7 I;  1ZU1 A;  1N0V C;  4DV4 I;  2ODR C;  3WU4 A;  4ED4 A;  3M6A A;  2HK2 A;  2RPC A;  4MYT A;  4LF9 I;  2JEB A;  1HNZ E;  4LCG A;  4DKK A;  2R3V A;  5JEA A;  4MLV A;  1NHI A;  5KL6 A;  2R42 A;  4DMI A;  3PYF A;  3F6G A;  3L7Z B;  1X6H A;  1AAY A;  3HKM A;  1RRE A;  2UUC I;  2EOQ A;  1FNM A;  3M7N D;  2HGH A;  4M2Z A;  1GQE A;  5K36 D;  2HHH E;  2EPK X;  1N32 E;  4HYM A;  5DRR A;  1Z0C A;  3U1Y A;  1UDN A;  2I13 A;  2O3Z A;  1N0U A;  4TUG A;  4JI6 E;  4BBY A;  2JWO A;  4IFD B;  2IES A;  2GPI A;  4DR3 E;  3BBG A;  1MX0 A;  5JEA D;  2AJ4 A;  2X36 A;  3HUL A;  4JI5 E;  2EOR A;  1YSA C;  1FWL A;  2RS7 A;  3WU6 A;  2F4V I;  4BA2 B;  5C0X C;  2L2K B;  2JY9 A;  1H7S A;  2FGG A;  2WNR A;  5IWA E;  1OYP A;  4JI8 E;  2CZ9 A;  1H74 A;  1P42 A;  2JYA A;  4DV5 E;  2M7Q A;  2YT4 A;  1O0W A;  3C4B A;  4MU0 A;  4GKK I;  1N36 I;  1FJG I;  2CSH A;  3P3C A;  4HAC B;  3M85 G;  1R6M A;  4WUD A;  2V86 A;  1Z5C A;  4U3B A;  5BR8 I;  1Y5Y A;  4QNJ A;  2WW4 A;  2YTE A;  1A1F A;  4X66 E;  2PO1 B;  3VYX A;  5IV8 B;  4NHR A;  2EPX A;  4LF8 I;  1HNW E;  1MU5 A;  5LMU E;  2EN2 A;  4IZK A;  2C39 A;  2EOJ A;  3J80 C;  1Y60 A;  1DI2 A;  2UXC I;  4X64 E;  2BM0 A;  1Y4U A;  2EML A;  4DUY I;  2YTO A;  4NXM E;  2L2N A;  2V2Q A;  2UXB E;  4LFB I;  2YRK A;  4IFD E;  2M4I A;  1ZM2 A;  2UUA E;  3LPS A;  1IQO A;  1Z0V A;  2EM6 A;  1E3H A;  1XMO I;  2EPM X;  3PS1 A;  4DV0 E;  4JYA I;  2VQF E;  4BC9 A;  4O43 A;  4DUZ E;  1HK7 A;  2V2V A;  1EH6 A;  3J7Y p;  2UXD E;  4FW5 A;  2VQE E;  4BHB A;  4DV7 E;  2ODR D;  2PRT A;  3LML A;  2V8P A;  5DRO A;  2JE6 A;  5ADZ A;  1PKP A;  5EL9 A;  3B78 A;  2O1T A;  3OTO I;  3PYG A;  4LF6 I;  2PO2 A;  2EM3 A;  4OZE A;  3QT8 A;  4AID A;  2VES A;  4BA1 B;  2ENC A;  4JI2 E;  4Z7Y A;  2EQ0 A;  2UUB E;  2LVH A;  1PIE A;  1J5E I;  2EL5 A;  4OO1 C;  2EPN A;  4UTG A;  2M9A A;  4WX9 A;  1ELO A;  1XMQ I;  5KL4 A;  2EOX A;  5C0X A;  5IT9 Q;  2MC5 A;  4AQY E;  3KZY A;  1X49 A;  5A69 A;  1H7U A;  2BB8 A;  1NHJ A;  1XHK A;  2E1R A;  2PNL A;  4JI7 I;  4LF5 E;  1PVG A;  2V2Z A;  5DNX A;  2EMC A;  3EPH A;  3DD6 A;  1ZBQ A;  2JOX A;  1UHZ A;  2JPA A;  4IZJ A;  4JG4 A;  4DU7 A;  2N8X A;  1T4N A;  4B3S I;  1WUU A;  4X65 E;  3HJC A;  2EMX A;  3P3G A;  4LF4 E;  4R2R A;  1D6T A;  2KON A;  5C0X D;  3VYY A;  4PU9 A;  4B3M I;  1USU A;  4LCF A;  2HC5 A;  1OYR A;  1YPN A;  1OYS A;  4JV5 E;  3ADG A;  4FN5 A;  4BS9 A;  4IZJ D;  2LUP B;  4MU3 A;  4JI0 E;  2F1D A;  1N36 E;  4I3H A;  4JI4 I;  3K85 A;  4KHP I;  2C37 A;  2YTQ A;  3JU0 A;  3C6K A;  4L5N C;  3KZZ A;  1A1J A;  2NUF A;  1KKH A;  4MLQ A;  5BR8 E;  1TF3 A;  3NZK A;  2BA0 D;  2EOM A;  2YWQ A;  1RMD A;  3AV0 A;  1Z1B A;  1XNQ I;  2NUE A;  4O4K A;  4LF8 E;  2GS8 A;  1BKN A;  3H09 A;  2NN6 B;  5FWK A;  2V85 A;  2PO0 A;  4WFT A;  2UXC E;  4F9C B;  2LT7 A;  1S4E A;  5K36 A;  2EPO A;  2EZ6 A;  3P06 A;  3EPL A;  5L3J A;  4DUY E;  4DV1 I;  4B3T I;  1EI1 A;  2EM4 A;  4X62 I;  4P78 A;  1EH7 A;  2EM8 A;  5DRP A;  2EPA A;  2FTX B;  4JI3 I;  2EMG A;  2V83 A;  4WSP A;  1N3G A;  1XMO E;  2DEI A;  4OO1 A;  2V34 A;  4FW6 A;  2EM7 A;  4BC7 A;  4JI1 E;  3ZZ0 A;  2LE2 A;  2CT1 A;  3BF2 A;  2LUQ A;  4R03 A;  3J81 C;  3F0N A;  2E5L I;  4DPY A;  4R2A A;  2Z5B B;  1XNR I;  3OTO E;  4KQV A;  3RMP A;  4KWY A;  5TSE A;  4DR4 I;  3EQ1 A;  4AIM A;  4BCA A;  2YTD A;  2DMI A;  4OO1 D;  1HNX I;  2N3H A;  1HR0 E;  4DV2 I;  1WXR A;  2WCC 3;  4FK5 C;  2K4V A;  1MGT A;  2EL6 A;  1UEK A;  3L7Z A;  4FWH A;  1K47 A;  2NN6 E;  3KRN A;  2WBU A;  4LCH A;  2EOS A;  2LTS A;  2JP9 A;  4F6N A;  3ADI A;  4I8O A;  2JEB B;  5IXM B;  4M1K A;  1TN9 A;  2ZM6 E;  5JEA B;  1X47 A;  4DPU A;  2BR2 A;  1RHY A;  2R76 A;  4RPF A;  2EMK A;  2EOY A;  2GLI A;  3PRY A;  4IFD A;  3MHS C;  1S16 A;  2LRS A;  4DR5 I;  2LTR A;  3ADL A;  1IBM I;  2IER A;  4IFD F;  4ZYH A;  3LLH A;  2V88 A;  1GTK A;  5DNY A;  2RSI A;  1A6F A;  4WUB A;  2RSM A;  4O24 A;  5LLQ A;  2O1U A;  3EPK A;  1KYQ A;  4DR6 I;  2YTN A;  5LMN I;  1H73 A;  4Z7C A;  4KHP E;  2NPF A;  2L8T A;  2B9D A;  3WU3 A;  2VRD A;  5A6B A;  2KHX A;  1NZ0 A;  1XNQ E;  1L4S A;  4YY3 I;  3C4T A;  1A1L A;  4HAC A;  4ZVI A;  4DV3 I;  2YRM A;  4BHC A;  2A2C A;  2WNR B;  2LO3 A;  4YHH I;  4DR2 I;  1JK2 A;  1PJT A;  2V87 A;  4R2C A;  2YU8 A;  5K36 E;  3GLL A;  3UHM A;  2R1F A;  2EMW A;  3THO B;  2MDR A;  2E1M A;  1USV A;  2BBG A;  4K0K E;  4J8Z A;  1FI4 A;  4NXN E;  4R2E A;  3AUZ A;  4OX9 I;  2J65 A;  5A6B D;  2WP8 B;  2JVA A;  5JEA E;  2UU9 E;  4R1F A;  3J7A M;  4FW4 A;  1AH5 A;  4HXZ A;  4LFA I;  1ZR9 A;  1NHH A;  1WHQ A;  2E5L E;  4IZK B;  5AE2 A;  4DV4 E;  4B3R I;  3PYE A;  1YFH A;  3OML A;  1RC7 A;  2BM1 A;  1NCS A;  4LF9 E;  1J26 A;  2YRH A;  3IWB A;  1ZXN A;  2Q8U A;  3HPZ A;  4M0V A;  2ADR A;  2YZT A;  1N34 I;  2RQL A;  3WU5 A;  3JTZ A;  4DV2 E;  3QT6 A;  1I94 I;  3C6M A;  3BGH A;  3MSW A;  4WXD A;  3IWD A;  1FKA E;  5KL2 A;  2UUC E;  3J81 Q;  1IMU A;  1UIL A;  4PRV A;  1BB8 A;  2LJP A;  1STU A;  1WRJ A;  4DR7 I;  3P76 A;  2LBS B;  2BA1 G;  5AC5 A;  1A1G A;  2IOQ A;  2PO2 B;  2EMY A;  4LFC I;  2GQ0 A;  4MQY A;  4R2P A;  3PS3 A;  1GZ6 A;  3M85 D;  3HTX A;  1ZM3 A;  4Q35 B;  4X8W A;  1UDQ A;  3CDJ A;  2PNZ B;  4MU1 A;  4ISA A;  2F4V E;  4M30 A;  1YUI A;  2B7V A;  2EN4 A;  1IBM E;  5C0X B;  3D4J A;  2M1S A;  1DAR A;  4DV6 I;  5A6A A;  5LL6 R;  2G7H A;  1Z59 A;  2JEA A;  2PNM A;  1YYK A;  2LV2 A;  2EOF A;  3GME A;  2IOP A;  3T1H I;  4GKK E;  2HHH I;  5LMN E;  2EN8 A;  1EA6 A;  1N32 I;  4HTG A;  1FJG E;  3L00 A;  1BBG A;  1QU6 A;  1Z0G A;  4JI6 I;  1PJQ A;  4DPW A;  4IFD C;  2JT2 A;  3B4T A;  2EJ4 A;  4P7D A;  1NEI A;  4YY3 E;  2EFG A;  4PRX A;  4USK A;  5GMD A;  1IBL I;  2NUG A;  4LF7 I;  2LJU A;  4YHH E;  1Z5A A;  5GME A;  4DR2 E;  4WPY A;  2C38 A;  3ZKB A;  3P1X A;  2GO3 A;  4JI5 I;  2YTI A;  3M7N G;  4DXL A;  2BV3 A;  2NN6 A;  2LJH A;  1X5W A;  3JAM Q;  4LFB E;  4JI8 I;  5DNL A;  2EOI A;  4IS9 A;  2OI2 A;  3H4L A;  2NN6 F;  4DV5 I;  5KL3 A;  1Y4S A;  5A6K A;  2DLQ A;  4JYA E;  2JR1 A;  3EPJ A;  2EN3 A;  4UT4 A;  1QNT A;  2O1W A;  5FLX C;  4LFA E;  2HJJ A;  2L3J A;  1UN6 B;  3U1K A;  3K6Q A;  2DGC A;  2Z5C A;  2A25 A;  5C0X E;  3HXL A;  4ZYE A;  3FIG A;  3V5R A;  2EMA A;  1YZ9 A;  4ZYD A;  4IS1 C;  1BBO A;  1HNW I;  4LF6 E;  5LMU I;  2DIX A;  4NZV A;  1E3P A;  2KOU A;  5AC4 A;  2Z5B A;  2A2D A;  2YTF A;  1J5E E;  5AE1 A;  2EPP A;  1I94 E;  2EOE A;  2UXB I;  1XMQ E;  2NAB A;  2WBS A;  2HK3 A;  2JXP A;  2L6M A;  2MC6 A;  4GQU A;  3T1Y I;  4IJD A;  4JI7 E;  1EKZ A;  1VI7 A;  5K36 B;  3J7A G;  3PYD A;  4WXC A;  4DUZ I;  1SR9 A;  2ELY A;  2GO4 A;  1FWK A;  3LNU A;  2EMI A;  1B62 A;  2VQE I;  4B3S E;  4Q28 A;  4LFC E;  4LTY A;  1T39 A;  4F9B B;  2ZBK B;  2EOH A;  3QT5 A;  5K36 F;  1N33 I;  2V8Q B;  3QT7 A;  1KIJ A;  4B3M E;  4DV6 E;  3HQ1 A; 
#chains in the Genus database with same CATH homology
 4JI2 I;  3KWR A;  2UUB I;  4DR1 I;  2DB2 A;  1IBK I;  3T1H E;  4AQY I;  1Z0W A;  1ZM4 A;  4MYU A;  4JI4 E;  1Z5B A;  4URL A;  4LF5 I;  1DQ3 A;  5A2Q C;  3JAM C;  1IBL E;  2F8B A;  2DEJ A;  3Q1Q A;  3ZKD A;  4X65 I;  4LF7 E;  2HKE A;  4LF4 I;  4R8O A;  4N3O A;  1QZR A;  3K1J A;  4DU8 A;  1B63 A;  4XTJ A;  3DJW A;  4DV1 E;  4B3T E;  4X62 E;  2ZIT A;  1RQ0 A;  4JV5 I;  4JI3 E;  4JI0 I;  4FWD A;  3ZOQ B;  4GKJ I;  1T4O A;  1VIS A;  2L33 A;  1OJ4 A;  4L8N A;  3V2U C;  1Z0T A;  2O1V A;  1XNR E;  4DR4 E;  4EMD A;  2Z5E A;  4WYQ B;  3B82 A;  5FLX Q;  1HNX E;  1WHN A;  2H36 X;  3ADJ A;  4DPT A;  2VF1 A;  4LU9 A;  3T1Y E;  2DSY A;  2HKJ A;  2XEX A;  4JI1 I;  2X7I A;  3ZZU A;  4F54 A;  3B8H A;  2DMY A;  4P7A A;  2RTX A;  4FW9 A;  2B3T B;  2VE7 C;  1N33 E;  4FWG A;  4DR5 E;  3Q6M A;  1HNZ I;  2LMZ A;  2B7T A;  4DR1 E;  2V89 A;  1KVK A;  1HR0 I;  2Q2E B;  1IBK E;  4BMJ A;  2IHR 1;  2HFU A;  4DR6 E;  4IZJ B;  4P52 A;  2L3C A;  4F9A B;  3HPS A;  2CG9 A;  4USM A;  4DR3 I;  4DV3 E;  2ZM6 I;  1KTV A;  3GON A;  1T4L B;  4KZS A;  2WZO A;  3Q6N A;  5A2Q Q;  5AAS A;  1RR9 A;  4TUI A;  2J7K A;  4OX9 E;  5IWA I;  2L2M A;  2EWL A;  3LTO A;  3IWC A;  2CGE A;  2HFS A;  3ZZT A;  1YYW A;  4GKJ E;  5CFF E;  4WUC A;  4HY1 A;  3K17 A;  1MG7 A;  2N3G A;  4B3R E;  3CWV A;  2NA2 A;  4X66 I;  3F6H A;  1U2R A;  5F3W A;  5AE3 A;  3DF6 A;  1YYO A;  1N34 E;  2VF3 A;  2JOB A;  1H72 C;  4X64 I;  1ZM9 A;  4OOG C;  1Y6Z A;  3ZM7 A;  1Z0E A;  4NXM I;  4K0K I;  1Z0B A;  4NXN I;  1X48 A;  2CPN A;  4DPX A;  2RS6 A;  1ZBT A;  2UUA I;  2Z5C B;  2FV4 B;  2UU9 I;  3VK6 A;  4DV0 I;  4DR7 E;  1ZXM A;  2VQF I;  3J80 Q;  2L92 A;  5T6J A;  2UXD I;  4GEQ B;  5IT9 C;  4DV7 I;  1N0V C;  4DV4 I;  2ODR C;  3WU4 A;  4ED4 A;  3M6A A;  2HK2 A;  4MYT A;  4LF9 I;  1HNZ E;  4DKK A;  2R3V A;  1NHI A;  2R42 A;  4DMI A;  3PYF A;  3F6G A;  1RRE A;  2UUC I;  1FNM A;  4M2Z A;  1GQE A;  2HHH E;  1N32 E;  4HYM A;  1Z0C A;  1N0U A;  4TUG A;  4JI6 E;  4BBY A;  2JWO A;  4DR3 E;  1MX0 A;  2AJ4 A;  2X36 A;  3HUL A;  4JI5 E;  1FWL A;  2RS7 A;  3WU6 A;  2F4V I;  2L2K B;  2JY9 A;  1H7S A;  2FGG A;  5IWA E;  4JI8 E;  2CZ9 A;  1H74 A;  4DV5 E;  2M7Q A;  2YT4 A;  1O0W A;  3C4B A;  4GKK I;  1N36 I;  1FJG I;  4HAC B;  4WUD A;  2V86 A;  1Z5C A;  5BR8 I;  2WW4 A;  4X66 E;  3VYX A;  4LF8 I;  1HNW E;  1MU5 A;  5LMU E;  4IZK A;  3J80 C;  1DI2 A;  2UXC I;  4X64 E;  2BM0 A;  1Y4U A;  4DUY I;  2V2Q A;  4NXM E;  2L2N A;  2UXB E;  4LFB I;  2M4I A;  1ZM2 A;  2UUA E;  3LPS A;  1Z0V A;  1XMO I;  4JYA I;  4DV0 E;  2VQF E;  4BC9 A;  4DUZ E;  1HK7 A;  2V2V A;  3J7Y p;  2UXD E;  2VQE E;  4DV7 E;  2ODR D;  3LML A;  2V8P A;  5ADZ A;  1PKP A;  3B78 A;  2O1T A;  3OTO I;  3PYG A;  4LF6 I;  3QT8 A;  4JI2 E;  4Z7Y A;  2UUB E;  1PIE A;  1J5E I;  4UTG A;  1ELO A;  1XMQ I;  5IT9 Q;  2MC5 A;  4AQY E;  1X49 A;  1H7U A;  1NHJ A;  4JI7 I;  1XHK A;  2E1R A;  2PNL A;  4LF5 E;  1PVG A;  2V2Z A;  1ZBQ A;  2JOX A;  1UHZ A;  4IZJ A;  4JG4 A;  4DU7 A;  1T4N A;  4B3S I;  1WUU A;  4X65 E;  3HJC A;  4LF4 E;  1D6T A;  2KON A;  3VYY A;  4PU9 A;  4B3M I;  1USU A;  4JV5 E;  3ADG A;  4FN5 A;  4BS9 A;  4IZJ D;  2LUP B;  4JI0 E;  1N36 E;  4I3H A;  4JI4 I;  3K85 A;  4KHP I;  3JU0 A;  4L5N C;  2NUF A;  1KKH A;  5BR8 E;  3AV0 A;  1XNQ I;  2NUE A;  4LF8 E;  2GS8 A;  1BKN A;  3H09 A;  5FWK A;  2V85 A;  4WFT A;  2UXC E;  4F9C B;  1S4E A;  2EZ6 A;  3P06 A;  5L3J A;  4DUY E;  4DV1 I;  4B3T I;  1EI1 A;  4X62 I;  4P78 A;  2FTX B;  4JI3 I;  2V83 A;  4WSP A;  1XMO E;  2DEI A;  2V34 A;  4BC7 A;  4JI1 E;  3ZZ0 A;  2LE2 A;  2LUQ A;  4R03 A;  3J81 C;  3F0N A;  2E5L I;  4DPY A;  2Z5B B;  1XNR I;  3OTO E;  4KQV A;  3RMP A;  4DR4 I;  4BCA A;  1HNX I;  2N3H A;  1HR0 E;  4DV2 I;  1WXR A;  2K4V A;  1UEK A;  4FWH A;  1K47 A;  2LTS A;  3ADI A;  4I8O A;  4M1K A;  2ZM6 E;  1X47 A;  4DPU A;  4RPF A;  3PRY A;  1S16 A;  2LRS A;  4DR5 I;  2LTR A;  3ADL A;  1IBM I;  3LLH A;  2V88 A;  5DNY A;  1A6F A;  4WUB A;  2RSM A;  2O1U A;  4DR6 I;  5LMN I;  1H73 A;  4Z7C A;  4KHP E;  2NPF A;  2L8T A;  2B9D A;  3WU3 A;  2KHX A;  1NZ0 A;  1XNQ E;  4YY3 I;  3C4T A;  4HAC A;  4ZVI A;  4DV3 I;  4YHH I;  2A2C A;  4DR2 I;  2V87 A;  2MDR A;  2E1M A;  1USV A;  4K0K E;  4J8Z A;  1FI4 A;  4NXN E;  3AUZ A;  4OX9 I;  2JVA A;  2UU9 E;  4R1F A;  3J7A M;  4HXZ A;  4LFA I;  1NHH A;  1WHQ A;  2E5L E;  4IZK B;  5AE2 A;  4DV4 E;  4B3R I;  3PYE A;  3OML A;  1RC7 A;  2BM1 A;  4LF9 E;  1J26 A;  3IWB A;  1ZXN A;  3HPZ A;  4M0V A;  2YZT A;  1N34 I;  3WU5 A;  3JTZ A;  4DV2 E;  3QT6 A;  1I94 I;  3MSW A;  2UUC E;  3IWD A;  1FKA E;  3J81 Q;  1UIL A;  4PRV A;  2LJP A;  1STU A;  4DR7 I;  2LBS B;  2IOQ A;  4LFC I;  2GQ0 A;  1GZ6 A;  3HTX A;  1ZM3 A;  4X8W A;  2F4V E;  4M30 A;  2B7V A;  1IBM E;  3D4J A;  2M1S A;  1DAR A;  4DV6 I;  5LL6 R;  2G7H A;  1Z59 A;  2PNM A;  1YYK A;  3T1H I;  2IOP A;  4GKK E;  2HHH I;  5LMN E;  1EA6 A;  1N32 I;  1FJG E;  1QU6 A;  1Z0G A;  4JI6 I;  4DPW A;  1IBL I;  4P7D A;  4YY3 E;  2EFG A;  4PRX A;  4USK A;  5GMD A;  2NUG A;  4LF7 I;  4YHH E;  1Z5A A;  5GME A;  4DR2 E;  4WPY A;  3ZKB A;  3P1X A;  4JI5 I;  4DXL A;  2BV3 A;  2LJH A;  3JAM Q;  4LFB E;  4JI8 I;  2OI2 A;  3H4L A;  4DV5 I;  1Y4S A;  4JYA E;  2JR1 A;  4UT4 A;  2O1W A;  5FLX C;  4LFA E;  2L3J A;  3K6Q A;  2Z5C A;  3HXL A;  3FIG A;  3V5R A;  1YZ9 A;  1HNW I;  4LF6 E;  5LMU I;  2DIX A;  2KOU A;  2Z5B A;  2A2D A;  1J5E E;  5AE1 A;  1I94 E;  2UXB I;  1XMQ E;  2HK3 A;  2L6M A;  2MC6 A;  3T1Y I;  4JI7 E;  1EKZ A;  3J7A G;  3PYD A;  4DUZ I;  1SR9 A;  3LNU A;  1FWK A;  1B62 A;  2VQE I;  4B3S E;  4Q28 A;  4LFC E;  4LTY A;  3QT5 A;  4F9B B;  2ZBK B;  1N33 I;  2V8Q B;  3QT7 A;  1KIJ A;  4B3M E;  4DV6 E;  3HQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...