5LMNE

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmnE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnE02
4K0KI 1OJ4A 2DEJA 3LPSA 4MYUA 4PRXA 1FWLA 2V2VA 2JY9A 1YYWA 1U2RA 1NHJA 2NUEA 4JI6I 4LF5I 1T4NA 4X65I 4LF9I 3PYGA 1RREA 4URLA 4B3MI 1ZM3A 1Z5CA 4LF5E 2UXBI 1NZ0A 2N3GA 3QT8A 4X65E 4LF9E 4HY1A 4B3ME 1FJGI 3T1YI 3PYFA 4M30A 2UXBE 4HXZA 2VQEI 3QT7A 1EI1A 4LFCI 1RQ0A 2KHXA 1FJGE 3T1YE 1XMQI 2NUGA 3C4BA 2VQEE 4X8WA 1GQEA 4DKKA 5LL6R 4LFCE 3QT5A 4WUBA 1EKZA 2RS6A 1ZM4A 1XMQE 2NUFA 4DR5I 1PKPA 1WHQA 1HNXI 4JG4A 2RTXA 4AQYE 4DR5E 2E5LI 4DV4I 1N32I 1HNXE 4DPUA 1MX0A 1S4EA 1YYOA 1Z5BA 4P7AA 4DPTA 2B7VA 4DPXA 1EA6A 2E5LE 4DV4E 2F4VI 4JYAI 4KHPI 1N32E 1WHNA 3ADIA 5CFFE 1XHKA 3LNUA 2F4VE 4JYAE 3ZKBA 4KHPE 1PVGA 2JVAA 4JI7I 5L3JA 1FI4A 4DR2I 5A2QC 2HHHI 4X64I 3D4JA 3PYEA 2IHR1 4JI1I 1H73A 4DU8A 2B3TB 4JI7E 4HACB 4DR2E 2LTSA 2HHHE 3VYXA 4X64E 3V5RA 5A2QQ 4JI1E 3JAMQ 1ZM2A 4LF4I 4I3HA 2LRSA 4GKJI 1KIJA 4JI5I 1XNRI 1J26A 2Q2EB 4WFTA 3V2UC 2ZBKB 3F0NA 3K1JA 2UXCI 4ED4A 4LF4E 4M2ZA 4DV7I 4GKJE 3H4LA 4DV6I 4JI5E 1XNRE 3J7Yp 2UXCE 1PIEA 1UHZA 4DV7E 2DEIA 4DR7I 4DV6E 1N34I 1FWKA 1HNWI 4DV3I 2NPFA 1X49A 4DR7E 4KQVA 3J81C 4WYQB 2L3CA 1N34E 1O0WA 1T4LB 1HNWE 4DV3E 1ZXMA 1NHIA 2HK2A 2HFUA 4USKA 4OX9I 4DV2I 2ZM6I 4WUDA 1Z0EA 1Z0TA 1BKNA 2LUQA 1FKAE 1IBKI 2BV3A 1T4OA 2LBSB 2GS8A 4OX9E 4DV2E 2ZM6E 4DR1I 4DUYI 4AQYI 1WUUA 2UUAI 4PU9A 4NXMI 3WU6A 4GKKI 1IBKE 3ZZUA 3K17A 5FLXC 4DR1E 4DUYE 2MDRA 2UUAE 4NXME 3GONA 5GMDA 3VYYA 5IT9C 2CZ9A 4GKKE 1J5EI 1H72C 4M1KA 2L2MA 2X7IA 2B7TA 2CPNA 4DPYA 1B63A 3OTOI 1VISA 1J5EE 2LJPA 1RC7A 2BM1A 1N33I 1KKHA 3ADJA 3P1XA 3OTOE 2AJ4A 2R3VA 3Q1QA 2V8PA 2LJHA 2A2DA 2BM0A 4JI0I 1N33E 1KTVA 1N0UA 2UUBI 4B3TI 2UU9I 4Z7CA 3J80C 4JI0E 4X66I 2L3JA 1MG7A 1MU5A 1Z0GA 1XMOI 4LFBI 1FNMA 2ZITA 2UUBE 4B3TE 2UU9E 4JI3I 2YT4A 4DXLA 4DR6I 4X66E 1XMOE 1NHHA 4LFBE 3J80Q 3ZKDA 4JI3E 2EFGA 1K47A 2HKJA 3T1HI 4DR6E 2J7KA 1IBLI 4PRVA 5BR8I 4FW9A 3T1HE 2L33A 1ZM9A 4UT4A 1YYKA 1IBLE 4FWGA 4X62I 4B3SI 5BR8E 2V34A 2HK3A 2DIXA 4JI8I 4JI4I 1I94I 1HNZI 1H74A 3ZZTA 2L2KB 4X62E 3WU3A 4B3SE 4DUZI 4DV0I 1X47A 2DB2A 1XNQI 4JI8E 4JI4E 4JV5I 1I94E 1HNZE 3CWVA 3M6AA 1Z5AA 2HKEA 4K0KE 4USMA 5GMEA 1IBMI 1UILA 4DUZE 3B82A 4DV0E 2L2NA 1XNQE 4JV5E 3ZZ0A 4DR3I 4ZVIA 2DMYA 2R42A 4LF7I 4JI6E 4FWDA 1IBME 3J81Q 2OI2A 1A6FA 5LMUI 1X48A 4DR3E 2V2ZA 4LF7E 3WU4A 1D6TA 3ADLA 3J7AG 5LMUE 1N36I 2UUCI 1RR9A 2VQFI 5LMNI 4Z7YA 1Z59A 4JI2I 1UEKA 1Z0VA 4EMDA 1DARA 2N3HA 1N36E 2UUCE 5LMNE 2VQFE 2WW4A 4P52A 4JI2E 1YZ9A 4R1FA 5FLXQ 3LTOA 2HFSA 3ADGA 3ZM7A 5IT9Q 1Z0CA 2A2CA 3J7AM 4DV5I 4XTJA 4FN5A 3C4TA 1DI2A 3HULA 3HTXA 4MYTA 1QU6A 3PYDA 2VF3A 1N0VC 4NXNI 4DV5E 1ZBTA 4LF6I 1ZXNA 4RPFA 4DU7A 4YY3I 1S16A 2V2QA 4NXNE 2X36A 2E1RA 4LF6E 1H7UA 4LF8I 2RS7A 4YY3E 4YHHI 4B3RI 4LFAI 4DPWA 4OOGC 4UTGA 5IWAI 1STUA 2UXDI 4LF8E 4DV1I 4YHHE 3B8HA 1QZRA 4B3RE 3B78A 4FWHA 2RSMA 4LFAE 1Z0WA 3JAMC 1KVKA 5IWAE 2XEXA 4DR4I 2EZ6A 3WU5A 2UXDE 4DV1E 1ELOA 3QT6A 2LTRA 4HACA 1HR0I 1Z0BA 3LLHA 1H7SA 4HYMA 4DR4E 4WUCA 1B62A 2NA2A 2LUPB 1HR0E
chains in the Genus database with same CATH superfamily
2Q8UA 4K0KI 2EM0A 1KYQA 5AASA 3K6QA 2EOSA 4P7DA 2CT1A 3ZOQB 5A69A 1OJ4A 1VI7A 2DEJA 3LPSA 2EL6A 4MYUA 4PRXA 1A1JA 2EN6A 1FWLA 3H09A 2V2VA 2JY9A 1YYWA 1BBOA 1U2RA 5IXMB 1NHJA 1PDAA 1Y5YA 2EMXA 2BA0D 2EMWA 2NUEA 2LO3A 4JI6I 4GZNC 4LF5I 1T4NA 2F1DA 4BMJA 4X65I 2B9DA 4LF9I 2EN1A 3PYGA 2PO2B 1RREA 2CTDA 4URLA 2R1FA 4B3MI 1ZM3A 5DNYA 1Z5CA 3ECRA 4LF5E 2UXBI 1NZ0A 2EMKA 2N3GA 3QT8A 2RQLA 4X65E 4LF9E 2YRKA 2MKNA 4HY1A 4IS1C 4L8NA 1YFHA 1EH6A 4B3ME 1FJGI 5ELWA 3T1YI 1USUA 1OYPA 3PYFA 4M30A 2UXBE 3GCMA 4ZYHA 1WRJA 2ELZA 4HXZA 2VQEI 1WJPA 4ISAA 1X6FA 3QT7A 2JEAB 2YSOA 1EI1A 4LFCI 1RQ0A 2EPUA 2KHXA 1P47A 4WSGA 5FWKA 1PJSA 1FJGE 3T1YE 2E72A 4R8OA 2V8QB 1XMQI 2NUGA 2YTIA 3MHHC 3C4BA 2VQEE 1QNTA 4X8WA 4WXCA 1GQEA 4DKKA 2J65A 2EM7A 5LL6R 4LFCE 3QT5A 4WUBA 3BGHA 2YTDA 1EKZA 4IFDF 1KJKA 3PS3A 2EMHA 4U3BA 1G2FC 2RS6A 1ZM4A 5DRPA 1XMQE 2NUFA 2C38B 2NN6D 4DR5I 1PKPA 1WHQA 1UDNA 2JYAA 2ELYA 5TSEA 1UDOA 4QNKA 4AIDA 1F2IG 4RHBB 1HNXI 5KL2A 2O1UA 2G7HA 4OZEA 3M7ND 2PO1B 4IZJB 4JG4A 2DMIA 2RTXA 4AQYE 4FW7A 4BS9A 2EN3A 2VESA 2HGHA 5AE3A 4DR5E 2E5LI 1UDSA 3HJCA 1A1KA 2EPMX 2JP9A 4DV4I 5K36A 1N32I 2YTQA 1HNXE 4IZKA 1MX0A 4DPUA 2EMFA 2RPCA 1S4EA 1YYOA 5K36C 4RH8A 1Z5BA 4P7AA 2IOQA 4DPTA 2GO4A 2I9IA 2B7VA 2N8XA 4ZYDA 1YH8A 5A6BD 1EA6A 4DPXA 4BHBA 2E5LE 4DV4E 2WNRB 3F6HA 2F4VI 4JYAI 4KHPI 1N32E 2YZTA 1WHNA 2BR2B 3ADIA 2V83A 5CFFE 3B4TA 1DGCA 3DD6A 1XHKA 2MDGA 5JEAA 4F9BB 3LNUA 2F4VE 2VRDA 1NCSA 3EPHA 4JYAE 5JEAC 3ZKBA 4KHPE 2Z5BB 3KRNA 2J7JA 2V89A 2PNZA 1T39A 1YUIA 1PVGA 2JVAA 4F6NA 2CGEA 5KL4A 5DROA 1E3PA 5K36D 4U3DA 2EN7A 4F2JC 4JI7I 5L3JA 1Z1BA 3AV0A 3Q6NA 1FI4A 2BBGA 4DR2I 4WPYA 2YTGA 2WP8B 4N3OA 5A2QC 3CDJA 2HHHI 3BF2A 2EN4A 4X64I 4AIMA 3D4JA 3PYEA 2IHR1 4BA2A 2MC5A 1A1FA 4MLQA 3M99B 4JI1I 1H73A 4DU8A 2B3TB 4JI7E 4OO1A 5K36E 2WCC3 4O43A 4R2DA 1YUJA 4HACB 4DR2E 2EOFA 4OO1C 2ENCA 2LTSA 3C6MA 5KL6A 2HHHE 2EOOA 3VYXA 1A1HA 4X64E 1YSAC 3P3GA 3PS1A 3V5RA 4M9VC 5A2QQ 4JI1E 2Z5CB 3JAMQ 2O1TA 2K7IA 2LMZA 1R6MA 4FW4A 1ZM2A 2EM3A 4LF4I 4I3HA 2LRSA 4GKJI 1KIJA 1EH7A 4BA1A 4JI5I 2YTJA 2FV4B 1XNRI 1J26A 2KONA 2Q2EB 5JEAE 4WFTA 3VK6A 3V2UC 4KZSA 2EMCA 2ZBKB 3F0NA 3K1JA 2UXCI 2EMYA 4LF4E 4BBYA 4ED4A 3AUZA 2CSHA 4M2ZA 2PO0A 4DV7I 2EMZA 4GKJE 2DSYA 3H4LA 4DV6I 2E1MA 4JI5E 2GO3A 4IFDD 2M7QA 1XNRE 2JE6A 3J7Yp 2YU5A 2UXCE 4OO1D 1PIEA 1UHZA 4DV7E 2I13A 2LV2A 2DEIA 4DR7I 3MHSC 2VF1A 3JTZA 4DV6E 2LE2A 1N34I 1RMDA 5A6JA 2EOIA 2NN6A 1FWKA 1HNWI 4DV3I 3DJWA 2NN6C 4BHCA 2NPFA 1IQOA 3KZZA 1ZR9A 4LCHA 1X49A 5DNXA 4DR7E 4OO1E 4KQVA 2EPOA 3J81C 4WYQB 2L3CA 1N34E 1G2DC 1O0WA 3GLLA 1T4LB 2DGCA 1HNWE 4DV3E 1ZXMA 1PJTA 2EPCA 3C6KA 2EPZA 1NHIA 1A1IA 2JEBA 2HK2A 2PNMA 5C0XA 2CG9A 2WBSA 2HFUA 4USKA 5C0XC 2EOJA 4OX9I 4DV2I 2YU8A 4M0VA 1Y4UA 2BA1G 2EPRA 4WUDA 1IQSA 2ZM6I 1Z0EA 5A6BA 1Z0TA 3H1CA 4IJDA 1X6HA 1BKNA 2LUQA 3JU0A 2EOXA 4BC7A 1FKAE 1IBKI 2ODRC 2BV3A 1WXRA 3P76A 1T4OA 2LBSB 4Q35B 4KWYA 1TF6A 2GS8A 4OX9E 4DV2E 4MU3A 4OKGA 4LTYA 4WSPA 2ZM6E 1MGTA 2LVHA 5A6KA 2HC5A 4DUYI 1WUUA 4DR1I 4AQYI 2IESA 4PU9A 2UUAI 1EH8A 4NXMI 3WU6A 4GKKI 1IBKE 3ZZUA 4L5NC 3K17A 5FLXC 3TQMA 3L7ZA 2YSPA 4R2EA 4DUYE 4DR1E 2MDRA 2UUAE 2LCEA 2YRMA 4NXME 3GONA 3VYYA 5GMDA 5A6AA 4LPFA 5K36B 5IT9C 1R6LA 2CZ9A 4GKKE 2NN6E 4Q28A 4HEIA 4IZKB 5C0XD 2FGGA 1H72C 3M85D 1J5EI 4M1KA 3THNA 2L2MA 4ZYGA 2X7IA 1NEIA 2D9HA 2B7TA 4X9JA 4BC9A 3KZYA 2O3ZA 2ODRD 2EOHA 2CPNA 4QNJA 1B63A 2C39A 4DPYA 2EPAA 3OTOI 3HXLA 1VISA 1AH5A 2H36X 1J5EE 2R76A 4R2CA 2EMAA 2JOXA 3EPJA 2LJPA 5C0XE 1RC7A 3L00A 2ENAA 2A25A 2YRHA 4WXDA 2BM1A 2EM4A 4TUIA 1KKHA 3GMEA 5JEAB 1RHYA 3ADJA 2DRPA 1ZAAC 1XXEA 1N33I 3P1XA 4TUGA 1X3CA 2DLKA 3OTOE 2AJ4A 2JPAA 2GLIA 2R3VA 3Q1QA 2V8PA 5EKWA 2ENHA 2LJHA 2A2DA 2BM0A 2PNZB 1TF3A 4JI0I 4MU0A 1N33E 1KTVA 1N0UA 2UUBI 4B3TI 2UU9I 4Z7CA 3J80C 4JI0E 4X66I 2L3JA 1MG7A 1MU5A 1Z0GA 2EPKX 2YTOA 3KWRA 5AC4A 4IFDA 1XMOI 4BA2B 1DQ3A 1FNMA 2ZITA 4LFBI 2UUBE 3F6GA 2UU9E 4B3TE 5T6JA 3PS2A 2LT7A 4JI3I 4IFDC 4OO1B 4NHRA 2YT4A 1OYRA 3P3CA 2EMGA 4DXLA 4DR6I 4X66E 1YPNA 4IS9A 4MDTA 4LU9A 2EL4A 4IZJD 5EL9A 1PJQA 1XMOE 1NHHA 4LFBE 3J80Q 3ZKDA 2WZOA 2PNLA 3LMLA 2GHFA 2EM8A 4JI3E 3EPKA 2EFGA 4N4RB 2EM9A 1K47A 2HKJA 3T1HI 1YHCA 4DR6E 4WX9A 2J7KA 4BA1B 1IBLI 2WBUA 4PRVA 2KOUA 5AE2A 4AM3A 2NABA 4O4KA 2PRTA 4LCFA 3IWBA 5BR8I 4FW9A 5AC5A 2V85A 3T1HE 2L33A 1E3HA 2C37A 2PO0B 2AE8A 2EQ1A 1ZM9A 4UT4A 1YYKA 3IWDA 1IBLE 2EPLX 3IWCA 4FWGA 2EM6A 4HTGA 2JE6B 4X62I 3HPSA 2EORA 3EPLA 2BA1D 4B3SI 5BR8E 3CDIA 2V34A 2HK3A 2DIXA 2M4IA 4JI8I 4JI4I 1MEYC 1I94I 1HNZI 2JT2A 1ZU1A 2EPXA 3QG5C 4I8OA 4MLVA 1H74A 3ZZTA 2L2KB 2NN6B 5KL7A 4X62E 4FW6A 3WU3A 4IFDE 4B3SE 1SR9A 4DUZI 1SFEA 4DV0I 1X47A 3MSWA 2DB2A 4R03A 2V88A 1IMUA 2EPPA 1GZ6A 4JI8E 4JI4E 1I94E 4LCGA 1XNQI 1HNZE 4JV5I 2L92A 3BIDA 5DNLA 3UHMA 2O1VA 3HPZA 3CWVA 3M6AA 2WBTA 3HQ1A 1Z5AA 2EMBA 2EM2A 4K0KE 2HKEA 4MQYA 5GMEA 4USMA 1IBMI 1UILA 4DUZE 2JEBB 4DV0E 3B82A 2L2NA 4F6MA 5C0XB 1XNQE 4JV5E 3ZZ0A 2EOYA 4DR3I 2EOZA 4ZVIA 2DMYA 2R42A 2EOMA 3FIGA 4LF7I 2PO2A 1Y60A 4JI6E 1X6EA 2EOQA 2K4VA 1IBME 4FWDA 1B69A 3J81Q 2OI2A 2EWLA 3BBGA 1A6FA 5LMUI 1X48A 3U1YA 4DR3E 2EL5A 2YWQA 2V2ZA 1L4SA 4LF7E 3NZKA 2EPNA 5JEAF 2EN8A 3WU4A 1AAYA 5AE1A 4O5GA 1D6TA 2VE7C 1USVA 2EQ3A 3ADLA 3J7AG 2EE8A 2GPIA 2M9AA 5LMUE 1N36I 2UUCI 4J3DA 2JEAA 1RR9A 2BA0G 3L7ZB 5IV8B 1UBDC 4Z7YA 2VQFI 1Z59A 5LMNI 1Y6ZA 1X5WA 2JOBA 4JI2I 2CVEA 2EQ0A 3RMPA 1UEKA 5KL3A 3EQ1A 2HJJA 5ADZA 1DARA 1Z0VA 4EMDA 2N3HA 1HK7A 2YTFA 2FTXB 2JR1A 1N36E 3PRYA 2EOEA 2BB8A 2UUCE 4P78A 4FW5A 2JXPA 5LMNE 2VQFE 2EMLA 4NBQA 2V86A 2ADRA 5LLQA 2WW4A 2YPNA 4JI2E 1YZ9A 4P52A 4R1FA 5FLXQ 2C39B 2C38A 3LTOA 3K85A 4OO1F 4F54A 2HFSA 2M1SA 3ADGA 4NZVA 3ZM7A 5IT9Q 2GQ0A 1A1LA 1Z0CA 2A2CA 2PO1A 3Q6MA 4IZJA 2IOPA 4F9AB 3J7AM 4DV5I 4J8ZA 3UK3C 4XTJA 4FK5C 4FN5A 3C4TA 1DI2A 1P42A 3P06A 4R2QA 3HULA 3HTXA 1JK1A 4MYTA 1QU6A 3PYDA 3HKMA 1N3GA 1A1GA 1N0VC 2VF3A 1OYSA 4NXNI 4R2PA 3VHTB 2EM5A 4DV5E 4R2SA 1ZBTA 4LF6I 1ZXNA 2WNRA 4RPFA 4DU7A 4YY3I 3THOB 1UN6B 1S16A 1LLMC 2BR2A 4R2AA 4IFDB 2V2QA 4NXNE 2X36A 4F9CB 2RSIA 2YTNA 2E1RA 1T38A 4LF6E 3M7NG 1H7UA 5DRRA 2O1WA 4LF8I 2RS7A 2Z5BA 4MU1A 4YY3E 1GTKA 4YHHI 1BBGA 4B3RI 1ZBQA 2L6MA 2IERA 2NN6F 4R2RA 4LFAI 4DPWA 2MC6A 4OOGC 5F3WA 4O24A 4UTGA 2DLQA 3OMLA 3M85G 5IWAI 1STUA 2UXDI 3P3EA 3U1KA 4LF8E 4DV1I 3DF6A 4LOMA 4YHHE 3B8HA 2YTEA 1JK2A 1QZRA 4B3RE 3B78A 2EJ4A 2RSMA 4LFAE 1Z0WA 3JAMC 1TN9A 2WP8A 4FWHA 1KVKA 4GQUA 4MU4A 1Y4SA 2LJUA 5C0XF 5IWAE 2XEXA 4DR4I 2YTPA 4BCAA 2EZ6A 2UXDE 2C37B 3WU5A 4DV1E 2JWOA 2MKDA 1ELOA 3QT6A 4GEQB 2LTRA 5KL5A 2Z5EA 4HACA 1BB8A 1Z0BA 1UDQA 1HR0I 3LLHA 1H7SA 2EMIA 2F8BA 4HYMA 5JEAD 4DMIA 4DR4E 4WUCA 1B62A 2Z5CA 2NA2A 4FW3A 5DRQA 2EP3A 2L8TA 2LUPB 2V87A 4ZYEA 1HR0E 5K36F 2EN2A
chains in the Genus database with same CATH topology
4K0KI 5AASA 3K6QA 4P7DA 3ZOQB 1OJ4A 2DEJA 3LPSA 4MYUA 4PRXA 1FWLA 3H09A 2V2VA 2JY9A 1YYWA 1U2RA 1NHJA 2NUEA 4JI6I 4LF5I 1T4NA 4BMJA 4X65I 2B9DA 4LF9I 3PYGA 1RREA 4URLA 4B3MI 1ZM3A 5DNYA 1Z5CA 4LF5E 2UXBI 1NZ0A 2N3GA 3QT8A 4X65E 4LF9E 4HY1A 4L8NA 4B3ME 1FJGI 3T1YI 1USUA 3PYFA 4M30A 2UXBE 4HXZA 2VQEI 3QT7A 1EI1A 4LFCI 1RQ0A 5FWKA 2KHXA 1FJGE 3T1YE 4R8OA 2V8QB 1XMQI 2NUGA 3C4BA 2VQEE 4X8WA 1GQEA 4DKKA 5LL6R 4LFCE 3QT5A 4WUBA 1EKZA 2RS6A 1ZM4A 1XMQE 2NUFA 4DR5I 1PKPA 1WHQA 1HNXI 2O1UA 2G7HA 4IZJB 4JG4A 2RTXA 4AQYE 4BS9A 5AE3A 4DR5E 2E5LI 3HJCA 4DV4I 1N32I 1HNXE 4DPUA 4IZKA 1MX0A 1S4EA 1YYOA 1Z5BA 4P7AA 4DPTA 2IOQA 2B7VA 4DPXA 1EA6A 2E5LE 4DV4E 2F4VI 3F6HA 4JYAI 4KHPI 1N32E 2YZTA 1WHNA 3ADIA 2V83A 5CFFE 1XHKA 4F9BB 3LNUA 2F4VE 4JYAE 3ZKBA 4KHPE 2Z5BB 2V89A 1PVGA 2JVAA 2CGEA 4JI7I 5L3JA 3AV0A 3Q6NA 1FI4A 4DR2I 4WPYA 4N3OA 5A2QC 2HHHI 4X64I 3D4JA 3PYEA 2IHR1 2MC5A 4JI1I 1H73A 4DU8A 2B3TB 4JI7E 4HACB 4DR2E 2LTSA 2HHHE 3VYXA 4X64E 3V5RA 5A2QQ 4JI1E 2Z5CB 3JAMQ 2O1TA 2LMZA 1ZM2A 4LF4I 4I3HA 2LRSA 4GKJI 1KIJA 4JI5I 2FV4B 1XNRI 1J26A 2KONA 2Q2EB 4WFTA 3VK6A 3V2UC 4KZSA 2ZBKB 3F0NA 3K1JA 2UXCI 4ED4A 4LF4E 4BBYA 3AUZA 4M2ZA 4DV7I 4GKJE 2DSYA 3H4LA 4DV6I 2E1MA 4JI5E 2M7QA 1XNRE 3J7Yp 2UXCE 1PIEA 1UHZA 4DV7E 2DEIA 4DR7I 2VF1A 3JTZA 4DV6E 2LE2A 1N34I 1FWKA 1HNWI 4DV3I 3DJWA 2NPFA 1X49A 4DR7E 4KQVA 3J81C 4WYQB 2L3CA 1N34E 1O0WA 1T4LB 1HNWE 4DV3E 1ZXMA 1NHIA 2PNMA 2HK2A 2CG9A 2HFUA 4USKA 4OX9I 4DV2I 4M0VA 1Y4UA 2ZM6I 4WUDA 1Z0EA 1Z0TA 1BKNA 2LUQA 3JU0A 4BC7A 1FKAE 1IBKI 2ODRC 2BV3A 1WXRA 1T4OA 2LBSB 2GS8A 4OX9E 4DV2E 4LTYA 4WSPA 2ZM6E 4DR1I 4DUYI 4AQYI 1WUUA 2UUAI 4PU9A 4NXMI 3WU6A 4GKKI 1IBKE 3ZZUA 4L5NC 3K17A 5FLXC 4DR1E 4DUYE 2MDRA 2UUAE 4NXME 3GONA 5GMDA 3VYYA 5IT9C 2CZ9A 4GKKE 4Q28A 4IZKB 1J5EI 2FGGA 1H72C 4M1KA 2L2MA 2X7IA 2B7TA 4BC9A 2ODRD 2CPNA 4DPYA 1B63A 3OTOI 3HXLA 1VISA 2H36X 1J5EE 2JOXA 2LJPA 1RC7A 2BM1A 4TUIA 1N33I 1KKHA 3ADJA 3P1XA 4TUGA 3OTOE 2AJ4A 2R3VA 3Q1QA 2V8PA 2LJHA 2A2DA 2BM0A 4JI0I 1N33E 1KTVA 1N0UA 2UUBI 4B3TI 2UU9I 4Z7CA 3J80C 4JI0E 4X66I 2L3JA 1MG7A 1MU5A 1Z0GA 3KWRA 1XMOI 4LFBI 1DQ3A 1FNMA 2ZITA 2UUBE 3F6GA 2UU9E 4B3TE 5T6JA 4JI3I 2YT4A 4DXLA 4DR6I 4X66E 4LU9A 4IZJD 1XMOE 1NHHA 4LFBE 3J80Q 3ZKDA 2WZOA 2PNLA 3LMLA 4JI3E 2EFGA 1K47A 2HKJA 3T1HI 4DR6E 2J7KA 1IBLI 4PRVA 2KOUA 5AE2A 5BR8I 3IWBA 4FW9A 2V85A 3T1HE 2L33A 1ZM9A 4UT4A 1YYKA 3IWDA 1IBLE 3IWCA 4FWGA 4X62I 3HPSA 4B3SI 5BR8E 2V34A 2HK3A 2DIXA 2M4IA 4JI8I 4JI4I 1I94I 1HNZI 4I8OA 1H74A 3ZZTA 2L2KB 4X62E 3WU3A 4B3SE 1SR9A 4DUZI 4DV0I 1X47A 2DB2A 3MSWA 4R03A 2V88A 1XNQI 4JI8E 1GZ6A 4JI4E 4JV5I 1I94E 1HNZE 2L92A 2O1VA 3HPZA 3CWVA 3M6AA 3HQ1A 1Z5AA 2HKEA 4K0KE 4USMA 5GMEA 1IBMI 1UILA 4DUZE 3B82A 4DV0E 2L2NA 1XNQE 4JV5E 3ZZ0A 4DR3I 4ZVIA 2DMYA 2R42A 3FIGA 4LF7I 4JI6E 2K4VA 1IBME 4FWDA 3J81Q 2OI2A 2EWLA 1A6FA 5LMUI 1X48A 4DR3E 2V2ZA 4LF7E 3WU4A 5AE1A 1D6TA 2VE7C 1USVA 3ADLA 3J7AG 5LMUE 1N36I 2UUCI 1RR9A 2VQFI 5LMNI 4Z7YA 1Z59A 1Y6ZA 2JOBA 4JI2I 3RMPA 1UEKA 1Z0VA 4EMDA 5ADZA 1DARA 2N3HA 1HK7A 2FTXB 2JR1A 1N36E 3PRYA 2UUCE 4P78A 5LMNE 2VQFE 2V86A 2WW4A 4P52A 4JI2E 1YZ9A 4R1FA 5FLXQ 3LTOA 3K85A 4F54A 2HFSA 2M1SA 3ADGA 3ZM7A 5IT9Q 2GQ0A 1Z0CA 2A2CA 3Q6MA 4IZJA 2IOPA 4F9AB 3J7AM 4DV5I 4J8ZA 4XTJA 4FN5A 3C4TA 1DI2A 3P06A 3HULA 3HTXA 4MYTA 1QU6A 3PYDA 2VF3A 1N0VC 4NXNI 4DV5E 1ZBTA 4LF6I 1ZXNA 4RPFA 4DU7A 4YY3I 1S16A 2V2QA 4NXNE 2X36A 4F9CB 2E1RA 4LF6E 1H7UA 2O1WA 4LF8I 2RS7A 2Z5BA 4YY3E 4YHHI 4B3RI 1ZBQA 2L6MA 4LFAI 4DPWA 2MC6A 4OOGC 5F3WA 4UTGA 3OMLA 5IWAI 1STUA 2UXDI 4LF8E 4DV1I 3DF6A 4YHHE 3B8HA 1QZRA 4B3RE 3B78A 2RSMA 4FWHA 4LFAE 1Z0WA 3JAMC 1KVKA 1Y4SA 5IWAE 2XEXA 4DR4I 4BCAA 2EZ6A 3WU5A 2UXDE 4DV1E 2JWOA 1ELOA 3QT6A 4GEQB 2LTRA 4HACA 2Z5EA 1HR0I 1Z0BA 3LLHA 1H7SA 2F8BA 4HYMA 4DMIA 4DR4E 4WUCA 1B62A 2Z5CA 2NA2A 2L8TA 2LUPB 2V87A 1HR0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K I;  1OJ4 A;  2DEJ A;  3LPS A;  4MYU A;  4PRX A;  1FWL A;  2V2V A;  2JY9 A;  1YYW A;  1U2R A;  1NHJ A;  2NUE A;  4JI6 I;  4LF5 I;  1T4N A;  4X65 I;  4LF9 I;  3PYG A;  1RRE A;  4URL A;  4B3M I;  1ZM3 A;  1Z5C A;  4LF5 E;  2UXB I;  1NZ0 A;  2N3G A;  3QT8 A;  4X65 E;  4LF9 E;  4HY1 A;  4B3M E;  1FJG I;  3T1Y I;  3PYF A;  4M30 A;  2UXB E;  4HXZ A;  2VQE I;  3QT7 A;  1EI1 A;  4LFC I;  1RQ0 A;  2KHX A;  1FJG E;  3T1Y E;  1XMQ I;  2NUG A;  3C4B A;  2VQE E;  4X8W A;  1GQE A;  4DKK A;  5LL6 R;  4LFC E;  3QT5 A;  4WUB A;  1EKZ A;  2RS6 A;  1ZM4 A;  1XMQ E;  2NUF A;  4DR5 I;  1PKP A;  1WHQ A;  1HNX I;  4JG4 A;  2RTX A;  4AQY E;  4DR5 E;  2E5L I;  4DV4 I;  1N32 I;  1HNX E;  4DPU A;  1MX0 A;  1S4E A;  1YYO A;  1Z5B A;  4P7A A;  4DPT A;  2B7V A;  4DPX A;  1EA6 A;  2E5L E;  4DV4 E;  2F4V I;  4JYA I;  4KHP I;  1N32 E;  1WHN A;  3ADI A;  5CFF E;  1XHK A;  3LNU A;  2F4V E;  4JYA E;  3ZKB A;  4KHP E;  1PVG A;  2JVA A;  4JI7 I;  5L3J A;  1FI4 A;  4DR2 I;  5A2Q C;  2HHH I;  4X64 I;  3D4J A;  3PYE A;  2IHR 1;  4JI1 I;  1H73 A;  4DU8 A;  2B3T B;  4JI7 E;  4HAC B;  4DR2 E;  2LTS A;  2HHH E;  3VYX A;  4X64 E;  3V5R A;  5A2Q Q;  4JI1 E;  3JAM Q;  1ZM2 A;  4LF4 I;  4I3H A;  2LRS A;  4GKJ I;  1KIJ A;  4JI5 I;  1XNR I;  1J26 A;  2Q2E B;  4WFT A;  3V2U C;  2ZBK B;  3F0N A;  3K1J A;  2UXC I;  4ED4 A;  4LF4 E;  4M2Z A;  4DV7 I;  4GKJ E;  3H4L A;  4DV6 I;  4JI5 E;  1XNR E;  3J7Y p;  2UXC E;  1PIE A;  1UHZ A;  4DV7 E;  2DEI A;  4DR7 I;  4DV6 E;  1N34 I;  1FWK A;  1HNW I;  4DV3 I;  2NPF A;  1X49 A;  4DR7 E;  4KQV A;  3J81 C;  4WYQ B;  2L3C A;  1N34 E;  1O0W A;  1T4L B;  1HNW E;  4DV3 E;  1ZXM A;  1NHI A;  2HK2 A;  2HFU A;  4USK A;  4OX9 I;  4DV2 I;  2ZM6 I;  4WUD A;  1Z0E A;  1Z0T A;  1BKN A;  2LUQ A;  1FKA E;  1IBK I;  2BV3 A;  1T4O A;  2LBS B;  2GS8 A;  4OX9 E;  4DV2 E;  2ZM6 E;  4DR1 I;  4DUY I;  4AQY I;  1WUU A;  2UUA I;  4PU9 A;  4NXM I;  3WU6 A;  4GKK I;  1IBK E;  3ZZU A;  3K17 A;  5FLX C;  4DR1 E;  4DUY E;  2MDR A;  2UUA E;  4NXM E;  3GON A;  5GMD A;  3VYY A;  5IT9 C;  2CZ9 A;  4GKK E;  1J5E I;  1H72 C;  4M1K A;  2L2M A;  2X7I A;  2B7T A;  2CPN A;  4DPY A;  1B63 A;  3OTO I;  1VIS A;  1J5E E;  2LJP A;  1RC7 A;  2BM1 A;  1N33 I;  1KKH A;  3ADJ A;  3P1X A;  3OTO E;  2AJ4 A;  2R3V A;  3Q1Q A;  2V8P A;  2LJH A;  2A2D A;  2BM0 A;  4JI0 I;  1N33 E;  1KTV A;  1N0U A;  2UUB I;  4B3T I;  2UU9 I;  4Z7C A;  3J80 C;  4JI0 E;  4X66 I;  2L3J A;  1MG7 A;  1MU5 A;  1Z0G A;  1XMO I;  4LFB I;  1FNM A;  2ZIT A;  2UUB E;  4B3T E;  2UU9 E;  4JI3 I;  2YT4 A;  4DXL A;  4DR6 I;  4X66 E;  1XMO E;  1NHH A;  4LFB E;  3J80 Q;  3ZKD A;  4JI3 E;  2EFG A;  1K47 A;  2HKJ A;  3T1H I;  4DR6 E;  2J7K A;  1IBL I;  4PRV A;  5BR8 I;  4FW9 A;  3T1H E;  2L33 A;  1ZM9 A;  4UT4 A;  1YYK A;  1IBL E;  4FWG A;  4X62 I;  4B3S I;  5BR8 E;  2V34 A;  2HK3 A;  2DIX A;  4JI8 I;  4JI4 I;  1I94 I;  1HNZ I;  1H74 A;  3ZZT A;  2L2K B;  4X62 E;  3WU3 A;  4B3S E;  4DUZ I;  4DV0 I;  1X47 A;  2DB2 A;  1XNQ I;  4JI8 E;  4JI4 E;  4JV5 I;  1I94 E;  1HNZ E;  3CWV A;  3M6A A;  1Z5A A;  2HKE A;  4K0K E;  4USM A;  5GME A;  1IBM I;  1UIL A;  4DUZ E;  3B82 A;  4DV0 E;  2L2N A;  1XNQ E;  4JV5 E;  3ZZ0 A;  4DR3 I;  4ZVI A;  2DMY A;  2R42 A;  4LF7 I;  4JI6 E;  4FWD A;  1IBM E;  3J81 Q;  2OI2 A;  1A6F A;  5LMU I;  1X48 A;  4DR3 E;  2V2Z A;  4LF7 E;  3WU4 A;  1D6T A;  3ADL A;  3J7A G;  5LMU E;  1N36 I;  2UUC I;  1RR9 A;  2VQF I;  5LMN I;  4Z7Y A;  1Z59 A;  4JI2 I;  1UEK A;  1Z0V A;  4EMD A;  1DAR A;  2N3H A;  1N36 E;  2UUC E;  5LMN E;  2VQF E;  2WW4 A;  4P52 A;  4JI2 E;  1YZ9 A;  4R1F A;  5FLX Q;  3LTO A;  2HFS A;  3ADG A;  3ZM7 A;  5IT9 Q;  1Z0C A;  2A2C A;  3J7A M;  4DV5 I;  4XTJ A;  4FN5 A;  3C4T A;  1DI2 A;  3HUL A;  3HTX A;  4MYT A;  1QU6 A;  3PYD A;  2VF3 A;  1N0V C;  4NXN I;  4DV5 E;  1ZBT A;  4LF6 I;  1ZXN A;  4RPF A;  4DU7 A;  4YY3 I;  1S16 A;  2V2Q A;  4NXN E;  2X36 A;  2E1R A;  4LF6 E;  1H7U A;  4LF8 I;  2RS7 A;  4YY3 E;  4YHH I;  4B3R I;  4LFA I;  4DPW A;  4OOG C;  4UTG A;  5IWA I;  1STU A;  2UXD I;  4LF8 E;  4DV1 I;  4YHH E;  3B8H A;  1QZR A;  4B3R E;  3B78 A;  4FWH A;  2RSM A;  4LFA E;  1Z0W A;  3JAM C;  1KVK A;  5IWA E;  2XEX A;  4DR4 I;  2EZ6 A;  3WU5 A;  2UXD E;  4DV1 E;  1ELO A;  3QT6 A;  2LTR A;  4HAC A;  1HR0 I;  1Z0B A;  3LLH A;  1H7S A;  4HYM A;  4DR4 E;  4WUC A;  1B62 A;  2NA2 A;  2LUP B;  1HR0 E; 
#chains in the Genus database with same CATH topology
 2Q8U A;  4K0K I;  2EM0 A;  1KYQ A;  5AAS A;  3K6Q A;  2EOS A;  4P7D A;  2CT1 A;  3ZOQ B;  5A69 A;  1OJ4 A;  1VI7 A;  2DEJ A;  3LPS A;  2EL6 A;  4MYU A;  4PRX A;  1A1J A;  2EN6 A;  1FWL A;  3H09 A;  2V2V A;  2JY9 A;  1YYW A;  1BBO A;  1U2R A;  5IXM B;  1NHJ A;  1PDA A;  1Y5Y A;  2EMX A;  2BA0 D;  2EMW A;  2NUE A;  2LO3 A;  4JI6 I;  4GZN C;  4LF5 I;  1T4N A;  2F1D A;  4BMJ A;  4X65 I;  2B9D A;  4LF9 I;  2EN1 A;  3PYG A;  2PO2 B;  1RRE A;  2CTD A;  4URL A;  2R1F A;  4B3M I;  1ZM3 A;  5DNY A;  1Z5C A;  3ECR A;  4LF5 E;  2UXB I;  1NZ0 A;  2EMK A;  2N3G A;  3QT8 A;  2RQL A;  4X65 E;  4LF9 E;  2YRK A;  2MKN A;  4HY1 A;  4IS1 C;  4L8N A;  1YFH A;  1EH6 A;  4B3M E;  1FJG I;  5ELW A;  3T1Y I;  1USU A;  1OYP A;  3PYF A;  4M30 A;  2UXB E;  3GCM A;  4ZYH A;  1WRJ A;  2ELZ A;  4HXZ A;  2VQE I;  1WJP A;  4ISA A;  1X6F A;  3QT7 A;  2JEA B;  2YSO A;  1EI1 A;  4LFC I;  1RQ0 A;  2EPU A;  2KHX A;  1P47 A;  4WSG A;  5FWK A;  1PJS A;  1FJG E;  3T1Y E;  2E72 A;  4R8O A;  2V8Q B;  1XMQ I;  2NUG A;  2YTI A;  3MHH C;  3C4B A;  2VQE E;  1QNT A;  4X8W A;  4WXC A;  1GQE A;  4DKK A;  2J65 A;  2EM7 A;  5LL6 R;  4LFC E;  3QT5 A;  4WUB A;  3BGH A;  2YTD A;  1EKZ A;  4IFD F;  1KJK A;  3PS3 A;  2EMH A;  4U3B A;  1G2F C;  2RS6 A;  1ZM4 A;  5DRP A;  1XMQ E;  2NUF A;  2C38 B;  2NN6 D;  4DR5 I;  1PKP A;  1WHQ A;  1UDN A;  2JYA A;  2ELY A;  5TSE A;  1UDO A;  4QNK A;  4AID A;  1F2I G;  4RHB B;  1HNX I;  5KL2 A;  2O1U A;  2G7H A;  4OZE A;  3M7N D;  2PO1 B;  4IZJ B;  4JG4 A;  2DMI A;  2RTX A;  4AQY E;  4FW7 A;  4BS9 A;  2EN3 A;  2VES A;  2HGH A;  5AE3 A;  4DR5 E;  2E5L I;  1UDS A;  3HJC A;  1A1K A;  2EPM X;  2JP9 A;  4DV4 I;  5K36 A;  1N32 I;  2YTQ A;  1HNX E;  4IZK A;  1MX0 A;  4DPU A;  2EMF A;  2RPC A;  1S4E A;  1YYO A;  5K36 C;  4RH8 A;  1Z5B A;  4P7A A;  2IOQ A;  4DPT A;  2GO4 A;  2I9I A;  2B7V A;  2N8X A;  4ZYD A;  1YH8 A;  5A6B D;  1EA6 A;  4DPX A;  4BHB A;  2E5L E;  4DV4 E;  2WNR B;  3F6H A;  2F4V I;  4JYA I;  4KHP I;  1N32 E;  2YZT A;  1WHN A;  2BR2 B;  3ADI A;  2V83 A;  5CFF E;  3B4T A;  1DGC A;  3DD6 A;  1XHK A;  2MDG A;  5JEA A;  4F9B B;  3LNU A;  2F4V E;  2VRD A;  1NCS A;  3EPH A;  4JYA E;  5JEA C;  3ZKB A;  4KHP E;  2Z5B B;  3KRN A;  2J7J A;  2V89 A;  2PNZ A;  1T39 A;  1YUI A;  1PVG A;  2JVA A;  4F6N A;  2CGE A;  5KL4 A;  5DRO A;  1E3P A;  5K36 D;  4U3D A;  2EN7 A;  4F2J C;  4JI7 I;  5L3J A;  1Z1B A;  3AV0 A;  3Q6N A;  1FI4 A;  2BBG A;  4DR2 I;  4WPY A;  2YTG A;  2WP8 B;  4N3O A;  5A2Q C;  3CDJ A;  2HHH I;  3BF2 A;  2EN4 A;  4X64 I;  4AIM A;  3D4J A;  3PYE A;  2IHR 1;  4BA2 A;  2MC5 A;  1A1F A;  4MLQ A;  3M99 B;  4JI1 I;  1H73 A;  4DU8 A;  2B3T B;  4JI7 E;  4OO1 A;  5K36 E;  2WCC 3;  4O43 A;  4R2D A;  1YUJ A;  4HAC B;  4DR2 E;  2EOF A;  4OO1 C;  2ENC A;  2LTS A;  3C6M A;  5KL6 A;  2HHH E;  2EOO A;  3VYX A;  1A1H A;  4X64 E;  1YSA C;  3P3G A;  3PS1 A;  3V5R A;  4M9V C;  5A2Q Q;  4JI1 E;  2Z5C B;  3JAM Q;  2O1T A;  2K7I A;  2LMZ A;  1R6M A;  4FW4 A;  1ZM2 A;  2EM3 A;  4LF4 I;  4I3H A;  2LRS A;  4GKJ I;  1KIJ A;  1EH7 A;  4BA1 A;  4JI5 I;  2YTJ A;  2FV4 B;  1XNR I;  1J26 A;  2KON A;  2Q2E B;  5JEA E;  4WFT A;  3VK6 A;  3V2U C;  4KZS A;  2EMC A;  2ZBK B;  3F0N A;  3K1J A;  2UXC I;  2EMY A;  4LF4 E;  4BBY A;  4ED4 A;  3AUZ A;  2CSH A;  4M2Z A;  2PO0 A;  4DV7 I;  2EMZ A;  4GKJ E;  2DSY A;  3H4L A;  4DV6 I;  2E1M A;  4JI5 E;  2GO3 A;  4IFD D;  2M7Q A;  1XNR E;  2JE6 A;  3J7Y p;  2YU5 A;  2UXC E;  4OO1 D;  1PIE A;  1UHZ A;  4DV7 E;  2I13 A;  2LV2 A;  2DEI A;  4DR7 I;  3MHS C;  2VF1 A;  3JTZ A;  4DV6 E;  2LE2 A;  1N34 I;  1RMD A;  5A6J A;  2EOI A;  2NN6 A;  1FWK A;  1HNW I;  4DV3 I;  3DJW A;  2NN6 C;  4BHC A;  2NPF A;  1IQO A;  3KZZ A;  1ZR9 A;  4LCH A;  1X49 A;  5DNX A;  4DR7 E;  4OO1 E;  4KQV A;  2EPO A;  3J81 C;  4WYQ B;  2L3C A;  1N34 E;  1G2D C;  1O0W A;  3GLL A;  1T4L B;  2DGC A;  1HNW E;  4DV3 E;  1ZXM A;  1PJT A;  2EPC A;  3C6K A;  2EPZ A;  1NHI A;  1A1I A;  2JEB A;  2HK2 A;  2PNM A;  5C0X A;  2CG9 A;  2WBS A;  2HFU A;  4USK A;  5C0X C;  2EOJ A;  4OX9 I;  4DV2 I;  2YU8 A;  4M0V A;  1Y4U A;  2BA1 G;  2EPR A;  4WUD A;  1IQS A;  2ZM6 I;  1Z0E A;  5A6B A;  1Z0T A;  3H1C A;  4IJD A;  1X6H A;  1BKN A;  2LUQ A;  3JU0 A;  2EOX A;  4BC7 A;  1FKA E;  1IBK I;  2ODR C;  2BV3 A;  1WXR A;  3P76 A;  1T4O A;  2LBS B;  4Q35 B;  4KWY A;  1TF6 A;  2GS8 A;  4OX9 E;  4DV2 E;  4MU3 A;  4OKG A;  4LTY A;  4WSP A;  2ZM6 E;  1MGT A;  2LVH A;  5A6K A;  2HC5 A;  4DUY I;  1WUU A;  4DR1 I;  4AQY I;  2IES A;  4PU9 A;  2UUA I;  1EH8 A;  4NXM I;  3WU6 A;  4GKK I;  1IBK E;  3ZZU A;  4L5N C;  3K17 A;  5FLX C;  3TQM A;  3L7Z A;  2YSP A;  4R2E A;  4DUY E;  4DR1 E;  2MDR A;  2UUA E;  2LCE A;  2YRM A;  4NXM E;  3GON A;  3VYY A;  5GMD A;  5A6A A;  4LPF A;  5K36 B;  5IT9 C;  1R6L A;  2CZ9 A;  4GKK E;  2NN6 E;  4Q28 A;  4HEI A;  4IZK B;  5C0X D;  2FGG A;  1H72 C;  3M85 D;  1J5E I;  4M1K A;  3THN A;  2L2M A;  4ZYG A;  2X7I A;  1NEI A;  2D9H A;  2B7T A;  4X9J A;  4BC9 A;  3KZY A;  2O3Z A;  2ODR D;  2EOH A;  2CPN A;  4QNJ A;  1B63 A;  2C39 A;  4DPY A;  2EPA A;  3OTO I;  3HXL A;  1VIS A;  1AH5 A;  2H36 X;  1J5E E;  2R76 A;  4R2C A;  2EMA A;  2JOX A;  3EPJ A;  2LJP A;  5C0X E;  1RC7 A;  3L00 A;  2ENA A;  2A25 A;  2YRH A;  4WXD A;  2BM1 A;  2EM4 A;  4TUI A;  1KKH A;  3GME A;  5JEA B;  1RHY A;  3ADJ A;  2DRP A;  1ZAA C;  1XXE A;  1N33 I;  3P1X A;  4TUG A;  1X3C A;  2DLK A;  3OTO E;  2AJ4 A;  2JPA A;  2GLI A;  2R3V A;  3Q1Q A;  2V8P A;  5EKW A;  2ENH A;  2LJH A;  2A2D A;  2BM0 A;  2PNZ B;  1TF3 A;  4JI0 I;  4MU0 A;  1N33 E;  1KTV A;  1N0U A;  2UUB I;  4B3T I;  2UU9 I;  4Z7C A;  3J80 C;  4JI0 E;  4X66 I;  2L3J A;  1MG7 A;  1MU5 A;  1Z0G A;  2EPK X;  2YTO A;  3KWR A;  5AC4 A;  4IFD A;  1XMO I;  4BA2 B;  1DQ3 A;  1FNM A;  2ZIT A;  4LFB I;  2UUB E;  3F6G A;  2UU9 E;  4B3T E;  5T6J A;  3PS2 A;  2LT7 A;  4JI3 I;  4IFD C;  4OO1 B;  4NHR A;  2YT4 A;  1OYR A;  3P3C A;  2EMG A;  4DXL A;  4DR6 I;  4X66 E;  1YPN A;  4IS9 A;  4MDT A;  4LU9 A;  2EL4 A;  4IZJ D;  5EL9 A;  1PJQ A;  1XMO E;  1NHH A;  4LFB E;  3J80 Q;  3ZKD A;  2WZO A;  2PNL A;  3LML A;  2GHF A;  2EM8 A;  4JI3 E;  3EPK A;  2EFG A;  4N4R B;  2EM9 A;  1K47 A;  2HKJ A;  3T1H I;  1YHC A;  4DR6 E;  4WX9 A;  2J7K A;  4BA1 B;  1IBL I;  2WBU A;  4PRV A;  2KOU A;  5AE2 A;  4AM3 A;  2NAB A;  4O4K A;  2PRT A;  4LCF A;  3IWB A;  5BR8 I;  4FW9 A;  5AC5 A;  2V85 A;  3T1H E;  2L33 A;  1E3H A;  2C37 A;  2PO0 B;  2AE8 A;  2EQ1 A;  1ZM9 A;  4UT4 A;  1YYK A;  3IWD A;  1IBL E;  2EPL X;  3IWC A;  4FWG A;  2EM6 A;  4HTG A;  2JE6 B;  4X62 I;  3HPS A;  2EOR A;  3EPL A;  2BA1 D;  4B3S I;  5BR8 E;  3CDI A;  2V34 A;  2HK3 A;  2DIX A;  2M4I A;  4JI8 I;  4JI4 I;  1MEY C;  1I94 I;  1HNZ I;  2JT2 A;  1ZU1 A;  2EPX A;  3QG5 C;  4I8O A;  4MLV A;  1H74 A;  3ZZT A;  2L2K B;  2NN6 B;  5KL7 A;  4X62 E;  4FW6 A;  3WU3 A;  4IFD E;  4B3S E;  1SR9 A;  4DUZ I;  1SFE A;  4DV0 I;  1X47 A;  3MSW A;  2DB2 A;  4R03 A;  2V88 A;  1IMU A;  2EPP A;  1GZ6 A;  4JI8 E;  4JI4 E;  1I94 E;  4LCG A;  1XNQ I;  1HNZ E;  4JV5 I;  2L92 A;  3BID A;  5DNL A;  3UHM A;  2O1V A;  3HPZ A;  3CWV A;  3M6A A;  2WBT A;  3HQ1 A;  1Z5A A;  2EMB A;  2EM2 A;  4K0K E;  2HKE A;  4MQY A;  5GME A;  4USM A;  1IBM I;  1UIL A;  4DUZ E;  2JEB B;  4DV0 E;  3B82 A;  2L2N A;  4F6M A;  5C0X B;  1XNQ E;  4JV5 E;  3ZZ0 A;  2EOY A;  4DR3 I;  2EOZ A;  4ZVI A;  2DMY A;  2R42 A;  2EOM A;  3FIG A;  4LF7 I;  2PO2 A;  1Y60 A;  4JI6 E;  1X6E A;  2EOQ A;  2K4V A;  1IBM E;  4FWD A;  1B69 A;  3J81 Q;  2OI2 A;  2EWL A;  3BBG A;  1A6F A;  5LMU I;  1X48 A;  3U1Y A;  4DR3 E;  2EL5 A;  2YWQ A;  2V2Z A;  1L4S A;  4LF7 E;  3NZK A;  2EPN A;  5JEA F;  2EN8 A;  3WU4 A;  1AAY A;  5AE1 A;  4O5G A;  1D6T A;  2VE7 C;  1USV A;  2EQ3 A;  3ADL A;  3J7A G;  2EE8 A;  2GPI A;  2M9A A;  5LMU E;  1N36 I;  2UUC I;  4J3D A;  2JEA A;  1RR9 A;  2BA0 G;  3L7Z B;  5IV8 B;  1UBD C;  4Z7Y A;  2VQF I;  1Z59 A;  5LMN I;  1Y6Z A;  1X5W A;  2JOB A;  4JI2 I;  2CVE A;  2EQ0 A;  3RMP A;  1UEK A;  5KL3 A;  3EQ1 A;  2HJJ A;  5ADZ A;  1DAR A;  1Z0V A;  4EMD A;  2N3H A;  1HK7 A;  2YTF A;  2FTX B;  2JR1 A;  1N36 E;  3PRY A;  2EOE A;  2BB8 A;  2UUC E;  4P78 A;  4FW5 A;  2JXP A;  5LMN E;  2VQF E;  2EML A;  4NBQ A;  2V86 A;  2ADR A;  5LLQ A;  2WW4 A;  2YPN A;  4JI2 E;  1YZ9 A;  4P52 A;  4R1F A;  5FLX Q;  2C39 B;  2C38 A;  3LTO A;  3K85 A;  4OO1 F;  4F54 A;  2HFS A;  2M1S A;  3ADG A;  4NZV A;  3ZM7 A;  5IT9 Q;  2GQ0 A;  1A1L A;  1Z0C A;  2A2C A;  2PO1 A;  3Q6M A;  4IZJ A;  2IOP A;  4F9A B;  3J7A M;  4DV5 I;  4J8Z A;  3UK3 C;  4XTJ A;  4FK5 C;  4FN5 A;  3C4T A;  1DI2 A;  1P42 A;  3P06 A;  4R2Q A;  3HUL A;  3HTX A;  1JK1 A;  4MYT A;  1QU6 A;  3PYD A;  3HKM A;  1N3G A;  1A1G A;  1N0V C;  2VF3 A;  1OYS A;  4NXN I;  4R2P A;  3VHT B;  2EM5 A;  4DV5 E;  4R2S A;  1ZBT A;  4LF6 I;  1ZXN A;  2WNR A;  4RPF A;  4DU7 A;  4YY3 I;  3THO B;  1UN6 B;  1S16 A;  1LLM C;  2BR2 A;  4R2A A;  4IFD B;  2V2Q A;  4NXN E;  2X36 A;  4F9C B;  2RSI A;  2YTN A;  2E1R A;  1T38 A;  4LF6 E;  3M7N G;  1H7U A;  5DRR A;  2O1W A;  4LF8 I;  2RS7 A;  2Z5B A;  4MU1 A;  4YY3 E;  1GTK A;  4YHH I;  1BBG A;  4B3R I;  1ZBQ A;  2L6M A;  2IER A;  2NN6 F;  4R2R A;  4LFA I;  4DPW A;  2MC6 A;  4OOG C;  5F3W A;  4O24 A;  4UTG A;  2DLQ A;  3OML A;  3M85 G;  5IWA I;  1STU A;  2UXD I;  3P3E A;  3U1K A;  4LF8 E;  4DV1 I;  3DF6 A;  4LOM A;  4YHH E;  3B8H A;  2YTE A;  1JK2 A;  1QZR A;  4B3R E;  3B78 A;  2EJ4 A;  2RSM A;  4LFA E;  1Z0W A;  3JAM C;  1TN9 A;  2WP8 A;  4FWH A;  1KVK A;  4GQU A;  4MU4 A;  1Y4S A;  2LJU A;  5C0X F;  5IWA E;  2XEX A;  4DR4 I;  2YTP A;  4BCA A;  2EZ6 A;  2UXD E;  2C37 B;  3WU5 A;  4DV1 E;  2JWO A;  2MKD A;  1ELO A;  3QT6 A;  4GEQ B;  2LTR A;  5KL5 A;  2Z5E A;  4HAC A;  1BB8 A;  1Z0B A;  1UDQ A;  1HR0 I;  3LLH A;  1H7S A;  2EMI A;  2F8B A;  4HYM A;  5JEA D;  4DMI A;  4DR4 E;  4WUC A;  1B62 A;  2Z5C A;  2NA2 A;  4FW3 A;  5DRQ A;  2EP3 A;  2L8T A;  2LUP B;  2V87 A;  4ZYE A;  1HR0 E;  5K36 F;  2EN2 A; 
#chains in the Genus database with same CATH homology
 4K0K I;  5AAS A;  3K6Q A;  4P7D A;  3ZOQ B;  1OJ4 A;  2DEJ A;  3LPS A;  4MYU A;  4PRX A;  1FWL A;  3H09 A;  2V2V A;  2JY9 A;  1YYW A;  1U2R A;  1NHJ A;  2NUE A;  4JI6 I;  4LF5 I;  1T4N A;  4BMJ A;  4X65 I;  2B9D A;  4LF9 I;  3PYG A;  1RRE A;  4URL A;  4B3M I;  1ZM3 A;  5DNY A;  1Z5C A;  4LF5 E;  2UXB I;  1NZ0 A;  2N3G A;  3QT8 A;  4X65 E;  4LF9 E;  4HY1 A;  4L8N A;  4B3M E;  1FJG I;  3T1Y I;  1USU A;  3PYF A;  4M30 A;  2UXB E;  4HXZ A;  2VQE I;  3QT7 A;  1EI1 A;  4LFC I;  1RQ0 A;  5FWK A;  2KHX A;  1FJG E;  3T1Y E;  4R8O A;  2V8Q B;  1XMQ I;  2NUG A;  3C4B A;  2VQE E;  4X8W A;  1GQE A;  4DKK A;  5LL6 R;  4LFC E;  3QT5 A;  4WUB A;  1EKZ A;  2RS6 A;  1ZM4 A;  1XMQ E;  2NUF A;  4DR5 I;  1PKP A;  1WHQ A;  1HNX I;  2O1U A;  2G7H A;  4IZJ B;  4JG4 A;  2RTX A;  4AQY E;  4BS9 A;  5AE3 A;  4DR5 E;  2E5L I;  3HJC A;  4DV4 I;  1N32 I;  1HNX E;  4DPU A;  4IZK A;  1MX0 A;  1S4E A;  1YYO A;  1Z5B A;  4P7A A;  4DPT A;  2IOQ A;  2B7V A;  4DPX A;  1EA6 A;  2E5L E;  4DV4 E;  2F4V I;  3F6H A;  4JYA I;  4KHP I;  1N32 E;  2YZT A;  1WHN A;  3ADI A;  2V83 A;  5CFF E;  1XHK A;  4F9B B;  3LNU A;  2F4V E;  4JYA E;  3ZKB A;  4KHP E;  2Z5B B;  2V89 A;  1PVG A;  2JVA A;  2CGE A;  4JI7 I;  5L3J A;  3AV0 A;  3Q6N A;  1FI4 A;  4DR2 I;  4WPY A;  4N3O A;  5A2Q C;  2HHH I;  4X64 I;  3D4J A;  3PYE A;  2IHR 1;  2MC5 A;  4JI1 I;  1H73 A;  4DU8 A;  2B3T B;  4JI7 E;  4HAC B;  4DR2 E;  2LTS A;  2HHH E;  3VYX A;  4X64 E;  3V5R A;  5A2Q Q;  4JI1 E;  2Z5C B;  3JAM Q;  2O1T A;  2LMZ A;  1ZM2 A;  4LF4 I;  4I3H A;  2LRS A;  4GKJ I;  1KIJ A;  4JI5 I;  2FV4 B;  1XNR I;  1J26 A;  2KON A;  2Q2E B;  4WFT A;  3VK6 A;  3V2U C;  4KZS A;  2ZBK B;  3F0N A;  3K1J A;  2UXC I;  4ED4 A;  4LF4 E;  4BBY A;  3AUZ A;  4M2Z A;  4DV7 I;  4GKJ E;  2DSY A;  3H4L A;  4DV6 I;  2E1M A;  4JI5 E;  2M7Q A;  1XNR E;  3J7Y p;  2UXC E;  1PIE A;  1UHZ A;  4DV7 E;  2DEI A;  4DR7 I;  2VF1 A;  3JTZ A;  4DV6 E;  2LE2 A;  1N34 I;  1FWK A;  1HNW I;  4DV3 I;  3DJW A;  2NPF A;  1X49 A;  4DR7 E;  4KQV A;  3J81 C;  4WYQ B;  2L3C A;  1N34 E;  1O0W A;  1T4L B;  1HNW E;  4DV3 E;  1ZXM A;  1NHI A;  2PNM A;  2HK2 A;  2CG9 A;  2HFU A;  4USK A;  4OX9 I;  4DV2 I;  4M0V A;  1Y4U A;  2ZM6 I;  4WUD A;  1Z0E A;  1Z0T A;  1BKN A;  2LUQ A;  3JU0 A;  4BC7 A;  1FKA E;  1IBK I;  2ODR C;  2BV3 A;  1WXR A;  1T4O A;  2LBS B;  2GS8 A;  4OX9 E;  4DV2 E;  4LTY A;  4WSP A;  2ZM6 E;  4DR1 I;  4DUY I;  4AQY I;  1WUU A;  2UUA I;  4PU9 A;  4NXM I;  3WU6 A;  4GKK I;  1IBK E;  3ZZU A;  4L5N C;  3K17 A;  5FLX C;  4DR1 E;  4DUY E;  2MDR A;  2UUA E;  4NXM E;  3GON A;  5GMD A;  3VYY A;  5IT9 C;  2CZ9 A;  4GKK E;  4Q28 A;  4IZK B;  1J5E I;  2FGG A;  1H72 C;  4M1K A;  2L2M A;  2X7I A;  2B7T A;  4BC9 A;  2ODR D;  2CPN A;  4DPY A;  1B63 A;  3OTO I;  3HXL A;  1VIS A;  2H36 X;  1J5E E;  2JOX A;  2LJP A;  1RC7 A;  2BM1 A;  4TUI A;  1N33 I;  1KKH A;  3ADJ A;  3P1X A;  4TUG A;  3OTO E;  2AJ4 A;  2R3V A;  3Q1Q A;  2V8P A;  2LJH A;  2A2D A;  2BM0 A;  4JI0 I;  1N33 E;  1KTV A;  1N0U A;  2UUB I;  4B3T I;  2UU9 I;  4Z7C A;  3J80 C;  4JI0 E;  4X66 I;  2L3J A;  1MG7 A;  1MU5 A;  1Z0G A;  3KWR A;  1XMO I;  4LFB I;  1DQ3 A;  1FNM A;  2ZIT A;  2UUB E;  3F6G A;  2UU9 E;  4B3T E;  5T6J A;  4JI3 I;  2YT4 A;  4DXL A;  4DR6 I;  4X66 E;  4LU9 A;  4IZJ D;  1XMO E;  1NHH A;  4LFB E;  3J80 Q;  3ZKD A;  2WZO A;  2PNL A;  3LML A;  4JI3 E;  2EFG A;  1K47 A;  2HKJ A;  3T1H I;  4DR6 E;  2J7K A;  1IBL I;  4PRV A;  2KOU A;  5AE2 A;  5BR8 I;  3IWB A;  4FW9 A;  2V85 A;  3T1H E;  2L33 A;  1ZM9 A;  4UT4 A;  1YYK A;  3IWD A;  1IBL E;  3IWC A;  4FWG A;  4X62 I;  3HPS A;  4B3S I;  5BR8 E;  2V34 A;  2HK3 A;  2DIX A;  2M4I A;  4JI8 I;  4JI4 I;  1I94 I;  1HNZ I;  4I8O A;  1H74 A;  3ZZT A;  2L2K B;  4X62 E;  3WU3 A;  4B3S E;  1SR9 A;  4DUZ I;  4DV0 I;  1X47 A;  2DB2 A;  3MSW A;  4R03 A;  2V88 A;  1XNQ I;  4JI8 E;  1GZ6 A;  4JI4 E;  4JV5 I;  1I94 E;  1HNZ E;  2L92 A;  2O1V A;  3HPZ A;  3CWV A;  3M6A A;  3HQ1 A;  1Z5A A;  2HKE A;  4K0K E;  4USM A;  5GME A;  1IBM I;  1UIL A;  4DUZ E;  3B82 A;  4DV0 E;  2L2N A;  1XNQ E;  4JV5 E;  3ZZ0 A;  4DR3 I;  4ZVI A;  2DMY A;  2R42 A;  3FIG A;  4LF7 I;  4JI6 E;  2K4V A;  1IBM E;  4FWD A;  3J81 Q;  2OI2 A;  2EWL A;  1A6F A;  5LMU I;  1X48 A;  4DR3 E;  2V2Z A;  4LF7 E;  3WU4 A;  5AE1 A;  1D6T A;  2VE7 C;  1USV A;  3ADL A;  3J7A G;  5LMU E;  1N36 I;  2UUC I;  1RR9 A;  2VQF I;  5LMN I;  4Z7Y A;  1Z59 A;  1Y6Z A;  2JOB A;  4JI2 I;  3RMP A;  1UEK A;  1Z0V A;  4EMD A;  5ADZ A;  1DAR A;  2N3H A;  1HK7 A;  2FTX B;  2JR1 A;  1N36 E;  3PRY A;  2UUC E;  4P78 A;  5LMN E;  2VQF E;  2V86 A;  2WW4 A;  4P52 A;  4JI2 E;  1YZ9 A;  4R1F A;  5FLX Q;  3LTO A;  3K85 A;  4F54 A;  2HFS A;  2M1S A;  3ADG A;  3ZM7 A;  5IT9 Q;  2GQ0 A;  1Z0C A;  2A2C A;  3Q6M A;  4IZJ A;  2IOP A;  4F9A B;  3J7A M;  4DV5 I;  4J8Z A;  4XTJ A;  4FN5 A;  3C4T A;  1DI2 A;  3P06 A;  3HUL A;  3HTX A;  4MYT A;  1QU6 A;  3PYD A;  2VF3 A;  1N0V C;  4NXN I;  4DV5 E;  1ZBT A;  4LF6 I;  1ZXN A;  4RPF A;  4DU7 A;  4YY3 I;  1S16 A;  2V2Q A;  4NXN E;  2X36 A;  4F9C B;  2E1R A;  4LF6 E;  1H7U A;  2O1W A;  4LF8 I;  2RS7 A;  2Z5B A;  4YY3 E;  4YHH I;  4B3R I;  1ZBQ A;  2L6M A;  4LFA I;  4DPW A;  2MC6 A;  4OOG C;  5F3W A;  4UTG A;  3OML A;  5IWA I;  1STU A;  2UXD I;  4LF8 E;  4DV1 I;  3DF6 A;  4YHH E;  3B8H A;  1QZR A;  4B3R E;  3B78 A;  2RSM A;  4FWH A;  4LFA E;  1Z0W A;  3JAM C;  1KVK A;  1Y4S A;  5IWA E;  2XEX A;  4DR4 I;  4BCA A;  2EZ6 A;  3WU5 A;  2UXD E;  4DV1 E;  2JWO A;  1ELO A;  3QT6 A;  4GEQ B;  2LTR A;  4HAC A;  2Z5E A;  1HR0 I;  1Z0B A;  3LLH A;  1H7S A;  2F8B A;  4HYM A;  4DMI A;  4DR4 E;  4WUC A;  1B62 A;  2Z5C A;  2NA2 A;  2L8T A;  2LUP B;  2V87 A;  1HR0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...