5LMNE

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmnE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnE02
4AQYI 3LTOA 4DV3E 4X64I 1Z5AA 4KHPE 2HHHI 2LTRA 2A2CA 4JI5I 4DR1I 1T4LB 2V8PA 4DR4E 3K1JA 4M2ZA 1FNMA 3T1YI 1ZM9A 3HTXA 5IT9C 1Z0GA 5BR8I 4WUBA 1ZM3A 3M6AA 4LF8E 4LFBE 4M30A 1WHQA 2HKEA 1PKPA 1KVKA 2ZM6E 4DR5I 3J7AG 1FJGI 2WW4A 2UXDE 5L3JA 4JI8I 1XNQE 3PYEA 2BM1A 1RR9A 4JI4I 1UEKA 4FW9A 3WU3A 2IHR1 1N32E 4YHHI 3B78A 1N34E 4X65E 1VISA 4P52A 1ELOA 4R1FA 4DV5E 2UU9E 1FI4A 1XMOI 3LLHA 1H7SA 4OX9I 4DUYE 4DV7I 4B3TI 3PYGA 3B82A 1HNZE 3J80C 3T1HI 1J5EI 2X36A 2VQFI 2E5LE 2RSMA 4YY3I 4JYAE 1D6TA 2R42A 4JI7I 1OJ4A 4DPYA 2VQEI 4DR6I 1I94I 1FKAE 4X66E 2CPNA 4JI0I 2RS6A 3J81C 5FLXC 4DXLA 4FWDA 4NXME 2HFUA 3J7AM 3V5RA 2V2VA 1S4EA 4GKJI 1A6FA 4DR3I 1N36E 2DEJA 2E1RA 4WUDA 2LBSB 4B3SI 1Z0CA 1ZM2A 4NXMI 1KIJA 1NHIA 1XMQE 4DV2E 3QT6A 2B7TA 1YYKA 1N0UA 2Q2EB 2ZBKB 1N33E 4WUCA 1XHKA 4JI6I 2UXCE 3ADJA 4MYUA 1B63A 3JAMC 1N0VC 1YZ9A 4WFTA 2UUAI 2DMYA 4DV6E 1EI1A 5LMNE 2HKJA 3F0NA 4LF4E 5IWAI 4B3MI 2L2NA 4LF7E 2J7KA 2EFGA 4JI2E 1HNWI 1WHNA 3LPSA 4FN5A 4DV0I 1Z59A 1H73A 4OOGC 3VYYA 3Q1QA 4B3RE 4HYMA 2NUEA 4DV3I 2RTXA 1EKZA 4HXZA 2VF3A 4KHPI 4HACB 1Z0EA 4NXNE 3PYFA 4DR4I 1EA6A 3VYXA 2ZITA 1FWLA 2NA2A 4LF8I 4LFBI 2XEXA 3WU5A 1Z5CA 4LF6E 2R3VA 2ZM6I 4XTJA 5GMEA 1QU6A 3ZKDA 4USKA 3ZM7A 2L3JA 2UUBE 1KTVA 3HULA 4X62E 2UXDI 2B7VA 2L2MA 1XNQI 4HACA 2BV3A 4UTGA 1WUUA 3J80Q 1N32I 2V2QA 1H7UA 4DPXA 3C4TA 1N34I 4X65I 2HK3A 1DI2A 1XNRE 2DB2A 4DV5I 4JV5E 3QT7A 2UU9I 2LRSA 4LFAE 1MU5A 4DUYI 4DU8A 2LUQA 1HNZI 4LF5E 1HNXE 2B3TB 3ADIA 2HFSA 2E5LI 1UILA 4JYAI 5LMUE 4EMDA 4FWHA 4LF9E 1J26A 4GKKE 2LJPA 1UHZA 3ZZUA 1STUA 1Z0TA 4MYTA 2LJHA 3ZZTA 4X66I 5LMUI 2V2ZA 3PYDA 4WYQB 2MDRA 4DR7E 4USMA 3ADGA 1IBKE 1PIEA 3H4LA 4PRXA 1N36I 4JG4A 2N3GA 4X8WA 2KHXA 4DR2E 2HK2A 1K47A 3ZZ0A 1RQ0A 4K0KE 2N3HA 3ADLA 1XMQI 4DV2I 2UXBE 5A2QQ 4JI1E 1IBLE 4DPTA 4DV4E 2A2DA 4M1KA 4DPUA 1N33I 2F4VE 1QZRA 4JI3E 3WU4A 1YYOA 1IBME 2UXCI 1Z5BA 5LL6R 2UUCE 4DV1E 4DU7A 4DPWA 1HR0E 4KQVA 3OTOE 5IT9Q 4AQYE 2AJ4A 4DV6I 5LMNI 4X64E 4LF4I 2HHHE 4PU9A 4JI5E 1YYWA 4LF7I 4DR1E 2YT4A 4JI2I 3T1YE 5BR8E 3C4BA 1H72C 4B3RI 4ED4A 2OI2A 4DR5E 4FWGA 1FJGE 4NXNI 2LUPB 4JI8E 4DKKA 2V34A 2NUGA 1KKHA 3QT5A 4JI4E 1NHHA 2L2KB 2RS7A 1RC7A 5GMDA 4YHHE 4RPFA 2GS8A 4LF6I 5CFFE 1ZM4A 2DIXA 2UUBI 3WU6A 2L33A 4X62I 2X7IA 3GONA 2LTSA 1Z0VA 1T4OA 4Z7YA 1XMOE 4URLA 4OX9E 4DV7E 4B3TE 3CWVA 3P1XA 3ZKBA 3T1HE 1J5EE 4I3HA 2VQFE 3QT8A 3J81Q 4ZVIA 5FLXQ 4YY3E 1XNRI 1S16A 4HY1A 4JV5I 4JI7E 4LFAI 4DUZE 1DARA 2NPFA 1X48A 1FWKA 2VQEE 4DR6E 1I94E 2L3CA 4LF5I 1GQEA 3D4JA 1HNXI 4JI0E 1ZXMA 4DUZI 4PRVA 4GKJE 3B8HA 2BM0A 4LF9I 4DR3E 4GKKI 1ZBTA 3K17A 4B3SE 1NZ0A 1MG7A 4P7AA 1X49A 3JAMQ 4DR7I 1IBKI 1NHJA 2DEIA 4DR2I 4JI6E 2JVAA 1ZXNA 4K0KI 3J7Yp 1Z0BA 3V2UC 1B62A 2UXBI 4LFCE 2CZ9A 1X47A 1U2RA 4JI1I 2JY9A 1T4NA 1IBLI 3LNUA 2UUAE 1Z0WA 4DV4I 2F4VI 2NUFA 1O0WA 4Z7CA 4JI3I 1PVGA 1IBMI 5IWAE 4B3ME 1BKNA 2UUCI 1MX0A 1HNWE 4LFCI 4UT4A 4DV1I 1HR0I 3OTOI 5A2QC 1H74A 4DV0E 2EZ6A 1RREA
chains in the Genus database with same CATH superfamily
3EPKA 4AQYI 5A6BD 2C39B 2EPKX 2ENCA 3LTOA 2DLKA 4DV3E 2EOHA 4X64I 1Z5AA 5A6AA 4KHPE 2EOQA 4MQYA 2YRKA 1F2IG 2HHHI 2LTRA 4AIDA 2A2CA 4JI5I 2EQ0A 4DR1I 1T4LB 3VHTB 2V8PA 4DR4E 3K1JA 4OO1B 4M2ZA 1FNMA 3T1YI 2YTIA 2PO2B 1ZM9A 3B4TA 1TF3A 3HTXA 2YRMA 5IT9C 1Z0GA 4U3BA 2BA1G 4BA2B 5BR8I 4WUBA 2JEAA 1ZM3A 3M6AA 2EMYA 4LF8E 2EM4A 4LFBE 4R8OA 4M30A 1GTKA 1WHQA 1UN6B 2HKEA 1PKPA 1KVKA 2ZM6E 2C39A 4IZKB 2EE8A 1X5WA 2WZOA 2EPPA 3J7AG 4DR5I 1HNWI 4LU9A 1FJGI 4GZNC 1HK7A 2WW4A 2UXDE 5L3JA 2EPMX 2BA0D 2G7HA 2DSYA 2EPAA 3PS3A 4JI8I 2EM6A 1XNQE 1IQOA 4J8ZA 3PYEA 2EMKA 2EMFA 2BM1A 2PNZB 3EQ1A 4OO1A 2YTQA 1RR9A 4JI4I 1UEKA 2EL5A 4FW9A 2BB8A 4DMIA 4R2PA 1E3PA 2PO2A 4MU0A 3WU3A 1PDAA 3DD6A 2CT1A 2IHR1 1N32E 1X6HA 4MU4A 3B78A 4YHHI 3QG5C 2MC5A 4BA2A 2YTPA 5DNYA 5F3WA 1ZBQA 5DRQA 1N34E 3M99B 2O3ZA 4X65E 1VISA 4M0VA 2WBSA 4P52A 1SFEA 4BA1B 2IESA 1ELOA 1Y60A 4R1FA 2EOOA 2O1WA 4DV5E 3TQMA 2E1MA 2UU9E 1FI4A 4F9BB 1XMOI 3LLHA 1H7SA 4OX9I 4DUYE 4DV7I 4B3TI 2E72A 3PRYA 3CDIA 4WXDA 1R6LA 2JT2A 3PYGA 2PNZA 2MC6A 3B82A 1HNZE 2MKDA 2NN6B 3J80C 4LCGA 3T1HI 1J5EI 2X36A 3IWBA 3K85A 2E5LE 3P3EA 2VQFI 2RSMA 1G2FC 4YY3I 4JYAE 2EM5A 1D6TA 2R42A 4JI7I 3PS1A 1ZU1A 4M9VC 1A1FA 2O1VA 3Q6NA 4BA1A 4GEQB 3M7NG 3UHMA 2NN6C 1YUIA 1OJ4A 4DPYA 1Z1BA 2EMGA 2VQEI 4DR6I 1I94I 5C0XE 2BR2B 2LCEA 4IS1C 2DGCA 1FKAE 4X66E 2YU8A 4NHRA 2CPNA 2GHFA 4JI0I 2RS6A 3J81C 2EPOA 5FLXC 1BBGA 4Q35B 3BGHA 2NN6A 4DXLA 1R6MA 4FWDA 4NXME 2HFUA 2EMLA 2R1FA 3J7AM 4R2QA 2YTOA 4RHBB 1S4EA 2V2VA 3V5RA 4GKJI 1A6FA 4DR3I 1N36E 2DEJA 2E1RA 5AE2A 5AASA 2F1DA 5K36F 4F54A 4WUDA 1YH8A 5A6BA 3BF2A 2LBSB 2Z5CB 4B3SI 5IV8B 2BA1D 1Z0CA 3RMPA 1ZM2A 4MU1A 4LPFA 4NXMI 2LJUA 1KIJA 2GO3A 2BR2A 3MHHC 1NHIA 1XMQE 5JEAF 4DV2E 2EPUA 3QT6A 4WX9A 2WCC3 2YRHA 2RSIA 2B7TA 4FW4A 1YYKA 4IJDA 4ZYGA 1N0UA 2Q2EB 2WP8B 1N33E 2ZBKB 2JR1A 3PS2A 2O1UA 4WUCA 1XHKA 2A25A 4JI6I 2BBGA 3HPSA 2UXCE 4ZYDA 1YHCA 1Y6ZA 3VK6A 1UDQA 1X3CA 4F9AB 3ADJA 2JYAA 4F9CB 2L92A 3F6HA 1AH5A 2EOIA 4BMJA 1BBOA 4P7DA 4MYUA 4RH8A 2Z5CA 1B63A 3MHSC 5IXMB 3JAMC 1N0VC 1YZ9A 1YUJA 4O43A 4WFTA 2UUAI 4HTGA 2DMYA 2V89A 5KL7A 4NZVA 4DV6E 4WSGA 5KL3A 5LMNE 4BC7A 2EMWA 1EI1A 2I9IA 2D9HA 2HKJA 2EQ1A 2ELZA 4Q28A 3C6MA 4LF4E 3F0NA 4J3DA 5IWAI 4B3MI 2L2NA 3CDJA 2WP8A 4ZYEA 3EPLA 3UK3C 1X6FA 4LF7E 4JI2E 2EP3A 1WHNA 2V83A 2EFGA 2J7KA 4MU3A 2PO1B 1N3GA 3L7ZB 3LPSA 2J65A 4FN5A 4DV0I 3HKMA 1Z59A 2RQLA 5DRRA 2JWOA 4IFDF 4O5GA 1H73A 5TSEA 4OOGC 3VYYA 3Q1QA 1A1JA 4B3RE 4HYMA 2NUEA 4DV3I 1NEIA 2RTXA 1EKZA 3GCMA 4HXZA 4R2CA 1NCSA 2VF3A 5K36E 1A1LA 4KHPI 5KL4A 4HACB 2R76A 2LO3A 1UDNA 1Z0EA 4NXNE 3PYFA 2DRPA 4DR4I 4AM3A 2JOBA 1EA6A 3M7ND 4BS9A 3BIDA 3VYXA 2ZITA 1QNTA 2CTDA 4FW3A 2PO1A 2JE6B 5JEAE 4N4RB 3L7ZA 4LCFA 1FWLA 2EPXA 2LMZA 2NA2A 1SR9A 5DNLA 4LF8I 4LFBI 2XEXA 2GO4A 1Z5CA 3WU5A 4O4KA 5ADZA 4LF6E 1IMUA 2R3VA 2ZM6I 4XTJA 5GMEA 1QU6A 2JEBB 3ZKDA 4USKA 3ZM7A 2EMCA 5AC4A 2L3JA 2UUBE 1KTVA 3HULA 4X62E 2UXDI 2EM3A 2B7VA 2L2MA 2MDGA 1ZAAC 1XNQI 2YSOA 4HACA 2BV3A 4GQUA 2EOMA 1T38A 2KONA 2L8TA 2V86A 4UTGA 1WXRA 3L00A 4BHCA 5A69A 1WUUA 2JE6A 2JXPA 2YTFA 3J80Q 2CVEA 2V2QA 2GLIA 1H7UA 1N32I 2EN1A 2L6MA 4DPXA 4FW7A 2YTDA 3C4TA 1TN9A 1YSAC 2CG9A 2DLQA 3EPJA 2IERA 1N34I 4F2JC 4X65I 2HK3A 2EPRA 1DI2A 1XNRE 1ZR9A 2JEBA 2DB2A 4DV5I 1KYQA 3H09A 2LVHA 4WSPA 5KL2A 4JV5E 2ODRC 3QT7A 5A6JA 2UU9I 2LRSA 2EPZA 3BBGA 2J7JA 4LFAE 1MU5A 4R03A 3P3GA 5LLQA 2PO0B 5C0XB 5DNXA 4DUYI 4DU8A 2EOEA 5K36D 2EN8A 5AC5A 1A1IA 4IFDE 4O24A 2LUQA 4LTYA 1HNZI 2EMIA 2EMXA 1Y4UA 4LF5E 3THOB 1USUA 2EOJA 1HNXE 2B3TB 3ADIA 2ENHA 1P47A 2HFSA 2E5LI 3C6KA 5AE1A 4R2RA 5JEAD 2K7IA 2WBUA 1UILA 5C0XC 4JYAI 5LMUE 4EMDA 4OZEA 2VESA 4FWHA 1XXEA 3IWDA 3K6QA 4LF9E 2V87A 2PRTA 2C37B 4TUGA 4FK5C 4ISAA 1J26A 2IOQA 1DQ3A 3IWCA 4IZJD 1Y5YA 4GKKE 5A6KA 4R2EA 2EOSA 2LJPA 1UHZA 2PO0A 3ZZUA 5C0XA 2EMZA 2K4VA 1STUA 1Z0TA 4MYTA 2LJHA 3ZZTA 4X66I 5LMUI 2H36X 2V2ZA 3PYDA 4WYQB 1PJTA 2MDRA 2EL6A 4F6MA 4DR7E 1Y4SA 3P76A 4USMA 3ADGA 3KWRA 1EH6A 1GZ6A 2EQ3A 1IBKE 1YPNA 1PIEA 2I13A 3H4LA 4PRXA 1N36I 4WXCA 3P3CA 4JG4A 2N3GA 4X8WA 2KHXA 2IOPA 4TUIA 2EM2A 4DR2E 3MSWA 2HK2A 4I8OA 1OYPA 1K47A 2C37A 3ZZ0A 1JK1A 1RQ0A 2EN2A 4K0KE 2N3HA 5DROA 4BC9A 4N3OA 3ADLA 2EM0A 1XMQI 4DV2I 2UXBE 4OO1F 2V85A 1EH8A 5A2QQ 2N8XA 4JI1E 2EN6A 2EPCA 2FTXB 1A1HA 4IFDD 1IBLE 4DPTA 4DV4E 2A2DA 4M1KA 4DPUA 1N33I 2F4VE 5ELWA 1QZRA 4JI3E 5EKWA 3WU4A 3U1KA 1YYOA 2EWLA 1IBME 1KJKA 1TF6A 2UXCI 5LL6R 1Z5BA 2UUCE 4U3DA 4DV1E 2Z5BB 4DU7A 3LMLA 5KL5A 4P78A 4DPWA 1HR0E 2JPAA 1X6EA 4KQVA 2HC5A 3OTOE 4X9JA 5IT9Q 2M7QA 2GQ0A 2LE2A 5AE3A 5K36B 4AQYE 3AV0A 4ZYHA 3ZOQB 1UDOA 2AJ4A 5LMNI 4DV6I 4X64E 3AUZA 3HPZA 4LF4I 2EN3A 1E3HA 4QNKA 1P42A 1G2DC 2HHHE 4PU9A 2YTJA 4JI5E 2EN7A 1AAYA 2YTEA 1YYWA 4LF7I 4DR1E 2ENAA 2YT4A 5JEAB 4JI2I 3T1YE 2WNRB 5K36C 4L5NC 4BHBA 2YPNA 2JOXA 1USVA 5T6JA 2Z5BA 4LOMA 5BR8E 3HJCA 4BBYA 3C4BA 2DMIA 4IZJB 1H72C 4B3RI 4ED4A 3GMEA 4FW6A 2OI2A 2EOFA 4QNJA 5K36A 5JEAC 2B9DA 4DR5E 2YTGA 4FWGA 1FJGE 2NN6F 4NXNI 2LUPB 1L4SA 4MLQA 2YTNA 4JI8E 4DKKA 1BB8A 4KWYA 5C0XF 2V34A 5JEAA 2NUGA 2YZTA 1YFHA 1KKHA 3QT5A 4OO1E 3ECRA 4JI4E 3NZKA 2WNRA 1LLMC 4R2DA 4BCAA 1NHHA 5DRPA 2L2KB 2RS7A 1RC7A 5GMDA 4YHHE 4RPFA 2YSPA 2GS8A 4LF6I 5CFFE 4IZJA 1ZM4A 5KL6A 2DIXA 1WJPA 2EMBA 2UUBI 3WU6A 2L33A 4X62I 1A1GA 2MKNA 3M85G 2EPNA 2KOUA 3EPHA 2X7IA 3GONA 2LTSA 1Z0VA 1T4OA 2O1TA 2YU5A 1EH7A 2M1SA 1OYRA 4IFDB 1VI7A 2PNLA 1PJSA 1XMOE 4Z7YA 4URLA 4OX9E 3KRNA 4DV7E 4B3TE 3P06A 3CWVA 3P1XA 2EM8A 3ZKBA 2EMHA 1T39A 2EM7A 1OYSA 4IZKA 3T1HE 2EORA 1J5EE 4I3HA 2VQFE 4IFDC 3QT8A 4IS9A 3J81Q 2EOXA 2GPIA 4R2AA 2EOYA 3GLLA 4ZVIA 5FLXQ 4YY3E 4MLVA 1XNRI 4KZSA 1UBDC 1S16A 2CSHA 2EN4A 4HY1A 4JV5I 4JI7E 4LFAI 4DUZE 1DARA 2ELYA 2NPFA 2EOZA 1RMDA 1X48A 4FW5A 4IFDA 1FWKA 2Z5EA 2LV2A 2VQEE 1JK2A 4R2SA 1I94E 2L3CA 4DR6E 1MEYC 4LF5I 1GQEA 3D4JA 3THNA 1HNXI 4OKGA 2F8BA 3JTZA 3OMLA 4HEIA 4JI0E 1ZXMA 2M4IA 2V88A 2VRDA 3KZZA 2NABA 2NN6E 4DUZI 1MGTA 4OO1D 2VE7C 4OO1C 2RPCA 2CGEA 4PRVA 4GKJE 3B8HA 2EL4A 2BM0A 4LF9I 4DR3E 4F6NA 2WBTA 2BA0G 2HGHA 4GKKI 1ZBTA 2ADRA 1PJQA 3K17A 4B3SE 2C38B 5EL9A 1NZ0A 3F6GA 2FV4B 1MG7A 3KZYA 4P7AA 5FWKA 4AIMA 1A1KA 1X49A 4WPYA 2VF1A 3JAMQ 4DR7I 1B69A 4NBQA 1IBKI 2YWQA 3HQ1A 1NHJA 3U1YA 3HXLA 2Q8UA 1IQSA 2EM9A 2DEIA 4DR2I 4JI6E 2JVAA 2M9AA 2AE8A 1ZXNA 2LT7A 4K0KI 3H1CA 4L8NA 3J7Yp 1Z0BA 3V2UC 1B62A 2UXBI 1UDSA 2EJ4A 2C38A 4LFCE 1DGCA 2CZ9A 3FIGA 1X47A 2EMAA 2EPLX 1U2RA 2JY9A 1T4NA 4JI1I 3Q6MA 2V8QB 2ODRD 1IBLI 3LNUA 2UUAE 1Z0WA 4DV4I 3JU0A 1RHYA 3M85D 2F4VI 2NUFA 1O0WA 2FGGA 4Z7CA 4JI3I 1PVGA 3DF6A 4MDTA 1IBMI 3DJWA 5IWAE 2JP9A 4B3ME 1BKNA 2UUCI 2NN6D 4LCHA 1MX0A 1HNWE 4LFCI 4UT4A 4DV1I 2JEAB 1HR0I 1WRJA 5A2QC 3OTOI 2HJJA 1H74A 5C0XD 4DV0E 2EZ6A 2PNMA 1RREA
chains in the Genus database with same CATH topology
4AQYI 3LTOA 4DV3E 4X64I 1Z5AA 4KHPE 2HHHI 2LTRA 2A2CA 4JI5I 4DR1I 1T4LB 2V8PA 4DR4E 3K1JA 4M2ZA 1FNMA 3T1YI 1ZM9A 3HTXA 5IT9C 1Z0GA 5BR8I 4WUBA 1ZM3A 3M6AA 4LF8E 4LFBE 4R8OA 4M30A 1WHQA 4IZKB 2HKEA 1PKPA 1KVKA 2ZM6E 4DR5I 3J7AG 2WZOA 4LU9A 1FJGI 1HK7A 2WW4A 2UXDE 5L3JA 2G7HA 2DSYA 4JI8I 1XNQE 4J8ZA 3PYEA 2BM1A 1RR9A 4JI4I 1UEKA 4FW9A 4DMIA 3WU3A 2IHR1 1N32E 4YHHI 3B78A 2MC5A 5DNYA 5F3WA 1ZBQA 1N34E 4X65E 1VISA 4M0VA 4P52A 1ELOA 4R1FA 2O1WA 4DV5E 2E1MA 2UU9E 1FI4A 4F9BB 1XMOI 3LLHA 1H7SA 4OX9I 4DUYE 4DV7I 4B3TI 3PRYA 3PYGA 2MC6A 3B82A 1HNZE 3J80C 3T1HI 1J5EI 2X36A 3IWBA 3K85A 2E5LE 2VQFI 2RSMA 4YY3I 4JYAE 1D6TA 2R42A 4JI7I 2O1VA 3Q6NA 4GEQB 1OJ4A 4DPYA 2VQEI 4DR6I 1I94I 1FKAE 4X66E 2CPNA 4JI0I 2RS6A 3J81C 5FLXC 4DXLA 4FWDA 4NXME 2HFUA 3J7AM 3V5RA 2V2VA 1S4EA 4GKJI 1A6FA 4DR3I 1N36E 2DEJA 2E1RA 5AE2A 5AASA 4F54A 4WUDA 2LBSB 2Z5CB 4B3SI 1Z0CA 3RMPA 1ZM2A 4NXMI 1KIJA 1NHIA 1XMQE 4DV2E 3QT6A 2B7TA 1YYKA 1N0UA 2Q2EB 2ZBKB 1N33E 2JR1A 2O1UA 4WUCA 1XHKA 4JI6I 3HPSA 2UXCE 1Y6ZA 3VK6A 4F9AB 3ADJA 4F9CB 2L92A 3F6HA 4BMJA 4MYUA 4P7DA 2Z5CA 1B63A 3JAMC 1N0VC 1YZ9A 4WFTA 2UUAI 2DMYA 2V89A 4DV6E 1EI1A 5LMNE 4BC7A 2HKJA 3F0NA 4LF4E 4Q28A 5IWAI 4B3MI 2L2NA 4LF7E 2J7KA 2EFGA 4JI2E 1HNWI 1WHNA 2V83A 3LPSA 4FN5A 4DV0I 1Z59A 2JWOA 1H73A 4OOGC 3VYYA 3Q1QA 4B3RE 4HYMA 2NUEA 4DV3I 2RTXA 1EKZA 4HXZA 2VF3A 4KHPI 4HACB 1Z0EA 4NXNE 3PYFA 4DR4I 2JOBA 1EA6A 4BS9A 3VYXA 2ZITA 1FWLA 2LMZA 2NA2A 1SR9A 4LF8I 4LFBI 2XEXA 3WU5A 1Z5CA 5ADZA 4LF6E 2R3VA 2ZM6I 4XTJA 5GMEA 1QU6A 3ZKDA 4USKA 3ZM7A 2L3JA 2UUBE 1KTVA 3HULA 4X62E 2UXDI 2B7VA 2L2MA 1XNQI 4HACA 2BV3A 2KONA 2V86A 2L8TA 4UTGA 1WXRA 1WUUA 3J80Q 1N32I 2V2QA 1H7UA 2L6MA 4DPXA 3C4TA 2CG9A 1N34I 4X65I 2HK3A 1DI2A 1XNRE 2DB2A 4DV5I 3H09A 4WSPA 4JV5E 3QT7A 2ODRC 2UU9I 2LRSA 4LFAE 1MU5A 4R03A 4DUYI 4DU8A 2LUQA 4LTYA 1HNZI 1Y4UA 4LF5E 1USUA 1HNXE 2B3TB 3ADIA 2HFSA 2E5LI 5AE1A 1UILA 4JYAI 5LMUE 4EMDA 4FWHA 3IWDA 3K6QA 4LF9E 2V87A 4TUGA 1J26A 2IOQA 1DQ3A 3IWCA 4IZJD 4GKKE 2LJPA 1UHZA 3ZZUA 2K4VA 1STUA 1Z0TA 4MYTA 2LJHA 3ZZTA 4X66I 5LMUI 2H36X 2V2ZA 3PYDA 4WYQB 2MDRA 4DR7E 4USMA 1Y4SA 3ADGA 3KWRA 1GZ6A 1IBKE 1PIEA 3H4LA 4PRXA 1N36I 4JG4A 2N3GA 4X8WA 2KHXA 2IOPA 4TUIA 4DR2E 2HK2A 3MSWA 4I8OA 1K47A 3ZZ0A 1RQ0A 4K0KE 2N3HA 4BC9A 4N3OA 3ADLA 1XMQI 4DV2I 2UXBE 2V85A 5A2QQ 4JI1E 2FTXB 1IBLE 4DPTA 4DV4E 2A2DA 4M1KA 4DPUA 1N33I 2F4VE 1QZRA 4JI3E 3WU4A 1YYOA 2EWLA 1IBME 2UXCI 5LL6R 1Z5BA 2UUCE 4DV1E 2Z5BB 4DU7A 3LMLA 4P78A 4DPWA 1HR0E 4KQVA 3OTOE 5IT9Q 2M7QA 2GQ0A 2LE2A 5AE3A 4AQYE 3AV0A 3ZOQB 2AJ4A 4DV6I 5LMNI 4X64E 3AUZA 3HPZA 4LF4I 2HHHE 4PU9A 4JI5E 1YYWA 4LF7I 4DR1E 2YT4A 4JI2I 3T1YE 4L5NC 2JOXA 1USVA 5T6JA 2Z5BA 5BR8E 3HJCA 4BBYA 3C4BA 4IZJB 1H72C 4B3RI 4ED4A 2OI2A 2B9DA 4DR5E 4FWGA 1FJGE 4NXNI 2LUPB 4JI8E 4DKKA 2V34A 2NUGA 2YZTA 1KKHA 3QT5A 4JI4E 4BCAA 1NHHA 2L2KB 2RS7A 1RC7A 5GMDA 4YHHE 4RPFA 2GS8A 4LF6I 5CFFE 4IZJA 1ZM4A 2DIXA 2UUBI 3WU6A 2L33A 4X62I 2KOUA 2X7IA 3GONA 2LTSA 1Z0VA 1T4OA 2O1TA 2M1SA 2PNLA 4Z7YA 1XMOE 4URLA 4OX9E 4B3TE 4DV7E 3P06A 3CWVA 3P1XA 3ZKBA 4IZKA 3T1HE 1J5EE 4I3HA 2VQFE 3QT8A 3J81Q 4ZVIA 5FLXQ 4YY3E 1XNRI 4KZSA 1S16A 4HY1A 4JV5I 4JI7E 4LFAI 4DUZE 1DARA 2NPFA 1X48A 1FWKA 2Z5EA 2VQEE 4DR6E 1I94E 2L3CA 4LF5I 1GQEA 3D4JA 1HNXI 2F8BA 3JTZA 3OMLA 4JI0E 1ZXMA 2M4IA 2V88A 4DUZI 2VE7C 2CGEA 4PRVA 4GKJE 3B8HA 2BM0A 4LF9I 4DR3E 4GKKI 1ZBTA 3K17A 4B3SE 1NZ0A 3F6GA 2FV4B 1MG7A 4P7AA 5FWKA 1X49A 4WPYA 2VF1A 3JAMQ 4DR7I 1IBKI 3HQ1A 1NHJA 3HXLA 2DEIA 4DR2I 4JI6E 2JVAA 1ZXNA 4K0KI 4L8NA 3J7Yp 1Z0BA 3V2UC 1B62A 2UXBI 4LFCE 2CZ9A 1X47A 3FIGA 1U2RA 4JI1I 2JY9A 1T4NA 3Q6MA 2V8QB 2ODRD 1IBLI 3LNUA 2UUAE 1Z0WA 4DV4I 3JU0A 2F4VI 2NUFA 1O0WA 2FGGA 4Z7CA 4JI3I 1PVGA 3DF6A 1IBMI 3DJWA 5IWAE 4B3ME 1BKNA 2UUCI 1MX0A 1HNWE 4LFCI 4UT4A 4DV1I 1HR0I 3OTOI 5A2QC 1H74A 4DV0E 2EZ6A 2PNMA 1RREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY I;  3LTO A;  4DV3 E;  4X64 I;  1Z5A A;  4KHP E;  2HHH I;  2LTR A;  2A2C A;  4JI5 I;  4DR1 I;  1T4L B;  2V8P A;  4DR4 E;  3K1J A;  4M2Z A;  1FNM A;  3T1Y I;  1ZM9 A;  3HTX A;  5IT9 C;  1Z0G A;  5BR8 I;  4WUB A;  1ZM3 A;  3M6A A;  4LF8 E;  4LFB E;  4M30 A;  1WHQ A;  2HKE A;  1PKP A;  1KVK A;  2ZM6 E;  4DR5 I;  3J7A G;  1FJG I;  2WW4 A;  2UXD E;  5L3J A;  4JI8 I;  1XNQ E;  3PYE A;  2BM1 A;  1RR9 A;  4JI4 I;  1UEK A;  4FW9 A;  3WU3 A;  2IHR 1;  1N32 E;  4YHH I;  3B78 A;  1N34 E;  4X65 E;  1VIS A;  4P52 A;  1ELO A;  4R1F A;  4DV5 E;  2UU9 E;  1FI4 A;  1XMO I;  3LLH A;  1H7S A;  4OX9 I;  4DUY E;  4DV7 I;  4B3T I;  3PYG A;  3B82 A;  1HNZ E;  3J80 C;  3T1H I;  1J5E I;  2X36 A;  2VQF I;  2E5L E;  2RSM A;  4YY3 I;  4JYA E;  1D6T A;  2R42 A;  4JI7 I;  1OJ4 A;  4DPY A;  2VQE I;  4DR6 I;  1I94 I;  1FKA E;  4X66 E;  2CPN A;  4JI0 I;  2RS6 A;  3J81 C;  5FLX C;  4DXL A;  4FWD A;  4NXM E;  2HFU A;  3J7A M;  3V5R A;  2V2V A;  1S4E A;  4GKJ I;  1A6F A;  4DR3 I;  1N36 E;  2DEJ A;  2E1R A;  4WUD A;  2LBS B;  4B3S I;  1Z0C A;  1ZM2 A;  4NXM I;  1KIJ A;  1NHI A;  1XMQ E;  4DV2 E;  3QT6 A;  2B7T A;  1YYK A;  1N0U A;  2Q2E B;  2ZBK B;  1N33 E;  4WUC A;  1XHK A;  4JI6 I;  2UXC E;  3ADJ A;  4MYU A;  1B63 A;  3JAM C;  1N0V C;  1YZ9 A;  4WFT A;  2UUA I;  2DMY A;  4DV6 E;  1EI1 A;  5LMN E;  2HKJ A;  3F0N A;  4LF4 E;  5IWA I;  4B3M I;  2L2N A;  4LF7 E;  2J7K A;  2EFG A;  4JI2 E;  1HNW I;  1WHN A;  3LPS A;  4FN5 A;  4DV0 I;  1Z59 A;  1H73 A;  4OOG C;  3VYY A;  3Q1Q A;  4B3R E;  4HYM A;  2NUE A;  4DV3 I;  2RTX A;  1EKZ A;  4HXZ A;  2VF3 A;  4KHP I;  4HAC B;  1Z0E A;  4NXN E;  3PYF A;  4DR4 I;  1EA6 A;  3VYX A;  2ZIT A;  1FWL A;  2NA2 A;  4LF8 I;  4LFB I;  2XEX A;  3WU5 A;  1Z5C A;  4LF6 E;  2R3V A;  2ZM6 I;  4XTJ A;  5GME A;  1QU6 A;  3ZKD A;  4USK A;  3ZM7 A;  2L3J A;  2UUB E;  1KTV A;  3HUL A;  4X62 E;  2UXD I;  2B7V A;  2L2M A;  1XNQ I;  4HAC A;  2BV3 A;  4UTG A;  1WUU A;  3J80 Q;  1N32 I;  2V2Q A;  1H7U A;  4DPX A;  3C4T A;  1N34 I;  4X65 I;  2HK3 A;  1DI2 A;  1XNR E;  2DB2 A;  4DV5 I;  4JV5 E;  3QT7 A;  2UU9 I;  2LRS A;  4LFA E;  1MU5 A;  4DUY I;  4DU8 A;  2LUQ A;  1HNZ I;  4LF5 E;  1HNX E;  2B3T B;  3ADI A;  2HFS A;  2E5L I;  1UIL A;  4JYA I;  5LMU E;  4EMD A;  4FWH A;  4LF9 E;  1J26 A;  4GKK E;  2LJP A;  1UHZ A;  3ZZU A;  1STU A;  1Z0T A;  4MYT A;  2LJH A;  3ZZT A;  4X66 I;  5LMU I;  2V2Z A;  3PYD A;  4WYQ B;  2MDR A;  4DR7 E;  4USM A;  3ADG A;  1IBK E;  1PIE A;  3H4L A;  4PRX A;  1N36 I;  4JG4 A;  2N3G A;  4X8W A;  2KHX A;  4DR2 E;  2HK2 A;  1K47 A;  3ZZ0 A;  1RQ0 A;  4K0K E;  2N3H A;  3ADL A;  1XMQ I;  4DV2 I;  2UXB E;  5A2Q Q;  4JI1 E;  1IBL E;  4DPT A;  4DV4 E;  2A2D A;  4M1K A;  4DPU A;  1N33 I;  2F4V E;  1QZR A;  4JI3 E;  3WU4 A;  1YYO A;  1IBM E;  2UXC I;  1Z5B A;  5LL6 R;  2UUC E;  4DV1 E;  4DU7 A;  4DPW A;  1HR0 E;  4KQV A;  3OTO E;  5IT9 Q;  4AQY E;  2AJ4 A;  4DV6 I;  5LMN I;  4X64 E;  4LF4 I;  2HHH E;  4PU9 A;  4JI5 E;  1YYW A;  4LF7 I;  4DR1 E;  2YT4 A;  4JI2 I;  3T1Y E;  5BR8 E;  3C4B A;  1H72 C;  4B3R I;  4ED4 A;  2OI2 A;  4DR5 E;  4FWG A;  1FJG E;  4NXN I;  2LUP B;  4JI8 E;  4DKK A;  2V34 A;  2NUG A;  1KKH A;  3QT5 A;  4JI4 E;  1NHH A;  2L2K B;  2RS7 A;  1RC7 A;  5GMD A;  4YHH E;  4RPF A;  2GS8 A;  4LF6 I;  5CFF E;  1ZM4 A;  2DIX A;  2UUB I;  3WU6 A;  2L33 A;  4X62 I;  2X7I A;  3GON A;  2LTS A;  1Z0V A;  1T4O A;  4Z7Y A;  1XMO E;  4URL A;  4OX9 E;  4DV7 E;  4B3T E;  3CWV A;  3P1X A;  3ZKB A;  3T1H E;  1J5E E;  4I3H A;  2VQF E;  3QT8 A;  3J81 Q;  4ZVI A;  5FLX Q;  4YY3 E;  1XNR I;  1S16 A;  4HY1 A;  4JV5 I;  4JI7 E;  4LFA I;  4DUZ E;  1DAR A;  2NPF A;  1X48 A;  1FWK A;  2VQE E;  4DR6 E;  1I94 E;  2L3C A;  4LF5 I;  1GQE A;  3D4J A;  1HNX I;  4JI0 E;  1ZXM A;  4DUZ I;  4PRV A;  4GKJ E;  3B8H A;  2BM0 A;  4LF9 I;  4DR3 E;  4GKK I;  1ZBT A;  3K17 A;  4B3S E;  1NZ0 A;  1MG7 A;  4P7A A;  1X49 A;  3JAM Q;  4DR7 I;  1IBK I;  1NHJ A;  2DEI A;  4DR2 I;  4JI6 E;  2JVA A;  1ZXN A;  4K0K I;  3J7Y p;  1Z0B A;  3V2U C;  1B62 A;  2UXB I;  4LFC E;  2CZ9 A;  1X47 A;  1U2R A;  4JI1 I;  2JY9 A;  1T4N A;  1IBL I;  3LNU A;  2UUA E;  1Z0W A;  4DV4 I;  2F4V I;  2NUF A;  1O0W A;  4Z7C A;  4JI3 I;  1PVG A;  1IBM I;  5IWA E;  4B3M E;  1BKN A;  2UUC I;  1MX0 A;  1HNW E;  4LFC I;  4UT4 A;  4DV1 I;  1HR0 I;  3OTO I;  5A2Q C;  1H74 A;  4DV0 E;  2EZ6 A;  1RRE A; 
#chains in the Genus database with same CATH topology
 3EPK A;  4AQY I;  5A6B D;  2C39 B;  2EPK X;  2ENC A;  3LTO A;  2DLK A;  4DV3 E;  2EOH A;  4X64 I;  1Z5A A;  5A6A A;  4KHP E;  2EOQ A;  4MQY A;  2YRK A;  1F2I G;  2HHH I;  2LTR A;  4AID A;  2A2C A;  4JI5 I;  2EQ0 A;  4DR1 I;  1T4L B;  3VHT B;  2V8P A;  4DR4 E;  3K1J A;  4OO1 B;  4M2Z A;  1FNM A;  3T1Y I;  2YTI A;  2PO2 B;  1ZM9 A;  3B4T A;  1TF3 A;  3HTX A;  2YRM A;  5IT9 C;  1Z0G A;  4U3B A;  2BA1 G;  4BA2 B;  5BR8 I;  4WUB A;  2JEA A;  1ZM3 A;  3M6A A;  2EMY A;  4LF8 E;  2EM4 A;  4LFB E;  4R8O A;  4M30 A;  1GTK A;  1WHQ A;  1UN6 B;  2HKE A;  1PKP A;  1KVK A;  2ZM6 E;  2C39 A;  4IZK B;  2EE8 A;  1X5W A;  2WZO A;  2EPP A;  3J7A G;  4DR5 I;  1HNW I;  4LU9 A;  1FJG I;  4GZN C;  1HK7 A;  2WW4 A;  2UXD E;  5L3J A;  2EPM X;  2BA0 D;  2G7H A;  2DSY A;  2EPA A;  3PS3 A;  4JI8 I;  2EM6 A;  1XNQ E;  1IQO A;  4J8Z A;  3PYE A;  2EMK A;  2EMF A;  2BM1 A;  2PNZ B;  3EQ1 A;  4OO1 A;  2YTQ A;  1RR9 A;  4JI4 I;  1UEK A;  2EL5 A;  4FW9 A;  2BB8 A;  4DMI A;  4R2P A;  1E3P A;  2PO2 A;  4MU0 A;  3WU3 A;  1PDA A;  3DD6 A;  2CT1 A;  2IHR 1;  1N32 E;  1X6H A;  4MU4 A;  3B78 A;  4YHH I;  3QG5 C;  2MC5 A;  4BA2 A;  2YTP A;  5DNY A;  5F3W A;  1ZBQ A;  5DRQ A;  1N34 E;  3M99 B;  2O3Z A;  4X65 E;  1VIS A;  4M0V A;  2WBS A;  4P52 A;  1SFE A;  4BA1 B;  2IES A;  1ELO A;  1Y60 A;  4R1F A;  2EOO A;  2O1W A;  4DV5 E;  3TQM A;  2E1M A;  2UU9 E;  1FI4 A;  4F9B B;  1XMO I;  3LLH A;  1H7S A;  4OX9 I;  4DUY E;  4DV7 I;  4B3T I;  2E72 A;  3PRY A;  3CDI A;  4WXD A;  1R6L A;  2JT2 A;  3PYG A;  2PNZ A;  2MC6 A;  3B82 A;  1HNZ E;  2MKD A;  2NN6 B;  3J80 C;  4LCG A;  3T1H I;  1J5E I;  2X36 A;  3IWB A;  3K85 A;  2E5L E;  3P3E A;  2VQF I;  2RSM A;  1G2F C;  4YY3 I;  4JYA E;  2EM5 A;  1D6T A;  2R42 A;  4JI7 I;  3PS1 A;  1ZU1 A;  4M9V C;  1A1F A;  2O1V A;  3Q6N A;  4BA1 A;  4GEQ B;  3M7N G;  3UHM A;  2NN6 C;  1YUI A;  1OJ4 A;  4DPY A;  1Z1B A;  2EMG A;  2VQE I;  4DR6 I;  1I94 I;  5C0X E;  2BR2 B;  2LCE A;  4IS1 C;  2DGC A;  1FKA E;  4X66 E;  2YU8 A;  4NHR A;  2CPN A;  2GHF A;  4JI0 I;  2RS6 A;  3J81 C;  2EPO A;  5FLX C;  1BBG A;  4Q35 B;  3BGH A;  2NN6 A;  4DXL A;  1R6M A;  4FWD A;  4NXM E;  2HFU A;  2EML A;  2R1F A;  3J7A M;  4R2Q A;  2YTO A;  4RHB B;  1S4E A;  2V2V A;  3V5R A;  4GKJ I;  1A6F A;  4DR3 I;  1N36 E;  2DEJ A;  2E1R A;  5AE2 A;  5AAS A;  2F1D A;  5K36 F;  4F54 A;  4WUD A;  1YH8 A;  5A6B A;  3BF2 A;  2LBS B;  2Z5C B;  4B3S I;  5IV8 B;  2BA1 D;  1Z0C A;  3RMP A;  1ZM2 A;  4MU1 A;  4LPF A;  4NXM I;  2LJU A;  1KIJ A;  2GO3 A;  2BR2 A;  3MHH C;  1NHI A;  1XMQ E;  5JEA F;  4DV2 E;  2EPU A;  3QT6 A;  4WX9 A;  2WCC 3;  2YRH A;  2RSI A;  2B7T A;  4FW4 A;  1YYK A;  4IJD A;  4ZYG A;  1N0U A;  2Q2E B;  2WP8 B;  1N33 E;  2ZBK B;  2JR1 A;  3PS2 A;  2O1U A;  4WUC A;  1XHK A;  2A25 A;  4JI6 I;  2BBG A;  3HPS A;  2UXC E;  4ZYD A;  1YHC A;  1Y6Z A;  3VK6 A;  1UDQ A;  1X3C A;  4F9A B;  3ADJ A;  2JYA A;  4F9C B;  2L92 A;  3F6H A;  1AH5 A;  2EOI A;  4BMJ A;  1BBO A;  4P7D A;  4MYU A;  4RH8 A;  2Z5C A;  1B63 A;  3MHS C;  5IXM B;  3JAM C;  1N0V C;  1YZ9 A;  1YUJ A;  4O43 A;  4WFT A;  2UUA I;  4HTG A;  2DMY A;  2V89 A;  5KL7 A;  4NZV A;  4DV6 E;  4WSG A;  5KL3 A;  5LMN E;  4BC7 A;  2EMW A;  1EI1 A;  2I9I A;  2D9H A;  2HKJ A;  2EQ1 A;  2ELZ A;  4Q28 A;  3C6M A;  4LF4 E;  3F0N A;  4J3D A;  5IWA I;  4B3M I;  2L2N A;  3CDJ A;  2WP8 A;  4ZYE A;  3EPL A;  3UK3 C;  1X6F A;  4LF7 E;  4JI2 E;  2EP3 A;  1WHN A;  2V83 A;  2EFG A;  2J7K A;  4MU3 A;  2PO1 B;  1N3G A;  3L7Z B;  3LPS A;  2J65 A;  4FN5 A;  4DV0 I;  3HKM A;  1Z59 A;  2RQL A;  5DRR A;  2JWO A;  4IFD F;  4O5G A;  1H73 A;  5TSE A;  4OOG C;  3VYY A;  3Q1Q A;  1A1J A;  4B3R E;  4HYM A;  2NUE A;  4DV3 I;  1NEI A;  2RTX A;  1EKZ A;  3GCM A;  4HXZ A;  4R2C A;  1NCS A;  2VF3 A;  5K36 E;  1A1L A;  4KHP I;  5KL4 A;  4HAC B;  2R76 A;  2LO3 A;  1UDN A;  1Z0E A;  4NXN E;  3PYF A;  2DRP A;  4DR4 I;  4AM3 A;  2JOB A;  1EA6 A;  3M7N D;  4BS9 A;  3BID A;  3VYX A;  2ZIT A;  1QNT A;  2CTD A;  4FW3 A;  2PO1 A;  2JE6 B;  5JEA E;  4N4R B;  3L7Z A;  4LCF A;  1FWL A;  2EPX A;  2LMZ A;  2NA2 A;  1SR9 A;  5DNL A;  4LF8 I;  4LFB I;  2XEX A;  2GO4 A;  1Z5C A;  3WU5 A;  4O4K A;  5ADZ A;  4LF6 E;  1IMU A;  2R3V A;  2ZM6 I;  4XTJ A;  5GME A;  1QU6 A;  2JEB B;  3ZKD A;  4USK A;  3ZM7 A;  2EMC A;  5AC4 A;  2L3J A;  2UUB E;  1KTV A;  3HUL A;  4X62 E;  2UXD I;  2EM3 A;  2B7V A;  2L2M A;  2MDG A;  1ZAA C;  1XNQ I;  2YSO A;  4HAC A;  2BV3 A;  4GQU A;  2EOM A;  1T38 A;  2KON A;  2L8T A;  2V86 A;  4UTG A;  1WXR A;  3L00 A;  4BHC A;  5A69 A;  1WUU A;  2JE6 A;  2JXP A;  2YTF A;  3J80 Q;  2CVE A;  2V2Q A;  2GLI A;  1H7U A;  1N32 I;  2EN1 A;  2L6M A;  4DPX A;  4FW7 A;  2YTD A;  3C4T A;  1TN9 A;  1YSA C;  2CG9 A;  2DLQ A;  3EPJ A;  2IER A;  1N34 I;  4F2J C;  4X65 I;  2HK3 A;  2EPR A;  1DI2 A;  1XNR E;  1ZR9 A;  2JEB A;  2DB2 A;  4DV5 I;  1KYQ A;  3H09 A;  2LVH A;  4WSP A;  5KL2 A;  4JV5 E;  2ODR C;  3QT7 A;  5A6J A;  2UU9 I;  2LRS A;  2EPZ A;  3BBG A;  2J7J A;  4LFA E;  1MU5 A;  4R03 A;  3P3G A;  5LLQ A;  2PO0 B;  5C0X B;  5DNX A;  4DUY I;  4DU8 A;  2EOE A;  5K36 D;  2EN8 A;  5AC5 A;  1A1I A;  4IFD E;  4O24 A;  2LUQ A;  4LTY A;  1HNZ I;  2EMI A;  2EMX A;  1Y4U A;  4LF5 E;  3THO B;  1USU A;  2EOJ A;  1HNX E;  2B3T B;  3ADI A;  2ENH A;  1P47 A;  2HFS A;  2E5L I;  3C6K A;  5AE1 A;  4R2R A;  5JEA D;  2K7I A;  2WBU A;  1UIL A;  5C0X C;  4JYA I;  5LMU E;  4EMD A;  4OZE A;  2VES A;  4FWH A;  1XXE A;  3IWD A;  3K6Q A;  4LF9 E;  2V87 A;  2PRT A;  2C37 B;  4TUG A;  4FK5 C;  4ISA A;  1J26 A;  2IOQ A;  1DQ3 A;  3IWC A;  4IZJ D;  1Y5Y A;  4GKK E;  5A6K A;  4R2E A;  2EOS A;  2LJP A;  1UHZ A;  2PO0 A;  3ZZU A;  5C0X A;  2EMZ A;  2K4V A;  1STU A;  1Z0T A;  4MYT A;  2LJH A;  3ZZT A;  4X66 I;  5LMU I;  2H36 X;  2V2Z A;  3PYD A;  4WYQ B;  1PJT A;  2MDR A;  2EL6 A;  4F6M A;  4DR7 E;  1Y4S A;  3P76 A;  4USM A;  3ADG A;  3KWR A;  1EH6 A;  1GZ6 A;  2EQ3 A;  1IBK E;  1YPN A;  1PIE A;  2I13 A;  3H4L A;  4PRX A;  1N36 I;  4WXC A;  3P3C A;  4JG4 A;  2N3G A;  4X8W A;  2KHX A;  2IOP A;  4TUI A;  2EM2 A;  4DR2 E;  3MSW A;  2HK2 A;  4I8O A;  1OYP A;  1K47 A;  2C37 A;  3ZZ0 A;  1JK1 A;  1RQ0 A;  2EN2 A;  4K0K E;  2N3H A;  5DRO A;  4BC9 A;  4N3O A;  3ADL A;  2EM0 A;  1XMQ I;  4DV2 I;  2UXB E;  4OO1 F;  2V85 A;  1EH8 A;  5A2Q Q;  2N8X A;  4JI1 E;  2EN6 A;  2EPC A;  2FTX B;  1A1H A;  4IFD D;  1IBL E;  4DPT A;  4DV4 E;  2A2D A;  4M1K A;  4DPU A;  1N33 I;  2F4V E;  5ELW A;  1QZR A;  4JI3 E;  5EKW A;  3WU4 A;  3U1K A;  1YYO A;  2EWL A;  1IBM E;  1KJK A;  1TF6 A;  2UXC I;  5LL6 R;  1Z5B A;  2UUC E;  4U3D A;  4DV1 E;  2Z5B B;  4DU7 A;  3LML A;  5KL5 A;  4P78 A;  4DPW A;  1HR0 E;  2JPA A;  1X6E A;  4KQV A;  2HC5 A;  3OTO E;  4X9J A;  5IT9 Q;  2M7Q A;  2GQ0 A;  2LE2 A;  5AE3 A;  5K36 B;  4AQY E;  3AV0 A;  4ZYH A;  3ZOQ B;  1UDO A;  2AJ4 A;  5LMN I;  4DV6 I;  4X64 E;  3AUZ A;  3HPZ A;  4LF4 I;  2EN3 A;  1E3H A;  4QNK A;  1P42 A;  1G2D C;  2HHH E;  4PU9 A;  2YTJ A;  4JI5 E;  2EN7 A;  1AAY A;  2YTE A;  1YYW A;  4LF7 I;  4DR1 E;  2ENA A;  2YT4 A;  5JEA B;  4JI2 I;  3T1Y E;  2WNR B;  5K36 C;  4L5N C;  4BHB A;  2YPN A;  2JOX A;  1USV A;  5T6J A;  2Z5B A;  4LOM A;  5BR8 E;  3HJC A;  4BBY A;  3C4B A;  2DMI A;  4IZJ B;  1H72 C;  4B3R I;  4ED4 A;  3GME A;  4FW6 A;  2OI2 A;  2EOF A;  4QNJ A;  5K36 A;  5JEA C;  2B9D A;  4DR5 E;  2YTG A;  4FWG A;  1FJG E;  2NN6 F;  4NXN I;  2LUP B;  1L4S A;  4MLQ A;  2YTN A;  4JI8 E;  4DKK A;  1BB8 A;  4KWY A;  5C0X F;  2V34 A;  5JEA A;  2NUG A;  2YZT A;  1YFH A;  1KKH A;  3QT5 A;  4OO1 E;  3ECR A;  4JI4 E;  3NZK A;  2WNR A;  1LLM C;  4R2D A;  4BCA A;  1NHH A;  5DRP A;  2L2K B;  2RS7 A;  1RC7 A;  5GMD A;  4YHH E;  4RPF A;  2YSP A;  2GS8 A;  4LF6 I;  5CFF E;  4IZJ A;  1ZM4 A;  5KL6 A;  2DIX A;  1WJP A;  2EMB A;  2UUB I;  3WU6 A;  2L33 A;  4X62 I;  1A1G A;  2MKN A;  3M85 G;  2EPN A;  2KOU A;  3EPH A;  2X7I A;  3GON A;  2LTS A;  1Z0V A;  1T4O A;  2O1T A;  2YU5 A;  1EH7 A;  2M1S A;  1OYR A;  4IFD B;  1VI7 A;  2PNL A;  1PJS A;  1XMO E;  4Z7Y A;  4URL A;  4OX9 E;  3KRN A;  4DV7 E;  4B3T E;  3P06 A;  3CWV A;  3P1X A;  2EM8 A;  3ZKB A;  2EMH A;  1T39 A;  2EM7 A;  1OYS A;  4IZK A;  3T1H E;  2EOR A;  1J5E E;  4I3H A;  2VQF E;  4IFD C;  3QT8 A;  4IS9 A;  3J81 Q;  2EOX A;  2GPI A;  4R2A A;  2EOY A;  3GLL A;  4ZVI A;  5FLX Q;  4YY3 E;  4MLV A;  1XNR I;  4KZS A;  1UBD C;  1S16 A;  2CSH A;  2EN4 A;  4HY1 A;  4JV5 I;  4JI7 E;  4LFA I;  4DUZ E;  1DAR A;  2ELY A;  2NPF A;  2EOZ A;  1RMD A;  1X48 A;  4FW5 A;  4IFD A;  1FWK A;  2Z5E A;  2LV2 A;  2VQE E;  1JK2 A;  4R2S A;  1I94 E;  2L3C A;  4DR6 E;  1MEY C;  4LF5 I;  1GQE A;  3D4J A;  3THN A;  1HNX I;  4OKG A;  2F8B A;  3JTZ A;  3OML A;  4HEI A;  4JI0 E;  1ZXM A;  2M4I A;  2V88 A;  2VRD A;  3KZZ A;  2NAB A;  2NN6 E;  4DUZ I;  1MGT A;  4OO1 D;  2VE7 C;  4OO1 C;  2RPC A;  2CGE A;  4PRV A;  4GKJ E;  3B8H A;  2EL4 A;  2BM0 A;  4LF9 I;  4DR3 E;  4F6N A;  2WBT A;  2BA0 G;  2HGH A;  4GKK I;  1ZBT A;  2ADR A;  1PJQ A;  3K17 A;  4B3S E;  2C38 B;  5EL9 A;  1NZ0 A;  3F6G A;  2FV4 B;  1MG7 A;  3KZY A;  4P7A A;  5FWK A;  4AIM A;  1A1K A;  1X49 A;  4WPY A;  2VF1 A;  3JAM Q;  4DR7 I;  1B69 A;  4NBQ A;  1IBK I;  2YWQ A;  3HQ1 A;  1NHJ A;  3U1Y A;  3HXL A;  2Q8U A;  1IQS A;  2EM9 A;  2DEI A;  4DR2 I;  4JI6 E;  2JVA A;  2M9A A;  2AE8 A;  1ZXN A;  2LT7 A;  4K0K I;  3H1C A;  4L8N A;  3J7Y p;  1Z0B A;  3V2U C;  1B62 A;  2UXB I;  1UDS A;  2EJ4 A;  2C38 A;  4LFC E;  1DGC A;  2CZ9 A;  3FIG A;  1X47 A;  2EMA A;  2EPL X;  1U2R A;  2JY9 A;  1T4N A;  4JI1 I;  3Q6M A;  2V8Q B;  2ODR D;  1IBL I;  3LNU A;  2UUA E;  1Z0W A;  4DV4 I;  3JU0 A;  1RHY A;  3M85 D;  2F4V I;  2NUF A;  1O0W A;  2FGG A;  4Z7C A;  4JI3 I;  1PVG A;  3DF6 A;  4MDT A;  1IBM I;  3DJW A;  5IWA E;  2JP9 A;  4B3M E;  1BKN A;  2UUC I;  2NN6 D;  4LCH A;  1MX0 A;  1HNW E;  4LFC I;  4UT4 A;  4DV1 I;  2JEA B;  1HR0 I;  1WRJ A;  5A2Q C;  3OTO I;  2HJJ A;  1H74 A;  5C0X D;  4DV0 E;  2EZ6 A;  2PNM A;  1RRE A; 
#chains in the Genus database with same CATH homology
 4AQY I;  3LTO A;  4DV3 E;  4X64 I;  1Z5A A;  4KHP E;  2HHH I;  2LTR A;  2A2C A;  4JI5 I;  4DR1 I;  1T4L B;  2V8P A;  4DR4 E;  3K1J A;  4M2Z A;  1FNM A;  3T1Y I;  1ZM9 A;  3HTX A;  5IT9 C;  1Z0G A;  5BR8 I;  4WUB A;  1ZM3 A;  3M6A A;  4LF8 E;  4LFB E;  4R8O A;  4M30 A;  1WHQ A;  4IZK B;  2HKE A;  1PKP A;  1KVK A;  2ZM6 E;  4DR5 I;  3J7A G;  2WZO A;  4LU9 A;  1FJG I;  1HK7 A;  2WW4 A;  2UXD E;  5L3J A;  2G7H A;  2DSY A;  4JI8 I;  1XNQ E;  4J8Z A;  3PYE A;  2BM1 A;  1RR9 A;  4JI4 I;  1UEK A;  4FW9 A;  4DMI A;  3WU3 A;  2IHR 1;  1N32 E;  4YHH I;  3B78 A;  2MC5 A;  5DNY A;  5F3W A;  1ZBQ A;  1N34 E;  4X65 E;  1VIS A;  4M0V A;  4P52 A;  1ELO A;  4R1F A;  2O1W A;  4DV5 E;  2E1M A;  2UU9 E;  1FI4 A;  4F9B B;  1XMO I;  3LLH A;  1H7S A;  4OX9 I;  4DUY E;  4DV7 I;  4B3T I;  3PRY A;  3PYG A;  2MC6 A;  3B82 A;  1HNZ E;  3J80 C;  3T1H I;  1J5E I;  2X36 A;  3IWB A;  3K85 A;  2E5L E;  2VQF I;  2RSM A;  4YY3 I;  4JYA E;  1D6T A;  2R42 A;  4JI7 I;  2O1V A;  3Q6N A;  4GEQ B;  1OJ4 A;  4DPY A;  2VQE I;  4DR6 I;  1I94 I;  1FKA E;  4X66 E;  2CPN A;  4JI0 I;  2RS6 A;  3J81 C;  5FLX C;  4DXL A;  4FWD A;  4NXM E;  2HFU A;  3J7A M;  3V5R A;  2V2V A;  1S4E A;  4GKJ I;  1A6F A;  4DR3 I;  1N36 E;  2DEJ A;  2E1R A;  5AE2 A;  5AAS A;  4F54 A;  4WUD A;  2LBS B;  2Z5C B;  4B3S I;  1Z0C A;  3RMP A;  1ZM2 A;  4NXM I;  1KIJ A;  1NHI A;  1XMQ E;  4DV2 E;  3QT6 A;  2B7T A;  1YYK A;  1N0U A;  2Q2E B;  2ZBK B;  1N33 E;  2JR1 A;  2O1U A;  4WUC A;  1XHK A;  4JI6 I;  3HPS A;  2UXC E;  1Y6Z A;  3VK6 A;  4F9A B;  3ADJ A;  4F9C B;  2L92 A;  3F6H A;  4BMJ A;  4MYU A;  4P7D A;  2Z5C A;  1B63 A;  3JAM C;  1N0V C;  1YZ9 A;  4WFT A;  2UUA I;  2DMY A;  2V89 A;  4DV6 E;  1EI1 A;  5LMN E;  4BC7 A;  2HKJ A;  3F0N A;  4LF4 E;  4Q28 A;  5IWA I;  4B3M I;  2L2N A;  4LF7 E;  2J7K A;  2EFG A;  4JI2 E;  1HNW I;  1WHN A;  2V83 A;  3LPS A;  4FN5 A;  4DV0 I;  1Z59 A;  2JWO A;  1H73 A;  4OOG C;  3VYY A;  3Q1Q A;  4B3R E;  4HYM A;  2NUE A;  4DV3 I;  2RTX A;  1EKZ A;  4HXZ A;  2VF3 A;  4KHP I;  4HAC B;  1Z0E A;  4NXN E;  3PYF A;  4DR4 I;  2JOB A;  1EA6 A;  4BS9 A;  3VYX A;  2ZIT A;  1FWL A;  2LMZ A;  2NA2 A;  1SR9 A;  4LF8 I;  4LFB I;  2XEX A;  3WU5 A;  1Z5C A;  5ADZ A;  4LF6 E;  2R3V A;  2ZM6 I;  4XTJ A;  5GME A;  1QU6 A;  3ZKD A;  4USK A;  3ZM7 A;  2L3J A;  2UUB E;  1KTV A;  3HUL A;  4X62 E;  2UXD I;  2B7V A;  2L2M A;  1XNQ I;  4HAC A;  2BV3 A;  2KON A;  2V86 A;  2L8T A;  4UTG A;  1WXR A;  1WUU A;  3J80 Q;  1N32 I;  2V2Q A;  1H7U A;  2L6M A;  4DPX A;  3C4T A;  2CG9 A;  1N34 I;  4X65 I;  2HK3 A;  1DI2 A;  1XNR E;  2DB2 A;  4DV5 I;  3H09 A;  4WSP A;  4JV5 E;  3QT7 A;  2ODR C;  2UU9 I;  2LRS A;  4LFA E;  1MU5 A;  4R03 A;  4DUY I;  4DU8 A;  2LUQ A;  4LTY A;  1HNZ I;  1Y4U A;  4LF5 E;  1USU A;  1HNX E;  2B3T B;  3ADI A;  2HFS A;  2E5L I;  5AE1 A;  1UIL A;  4JYA I;  5LMU E;  4EMD A;  4FWH A;  3IWD A;  3K6Q A;  4LF9 E;  2V87 A;  4TUG A;  1J26 A;  2IOQ A;  1DQ3 A;  3IWC A;  4IZJ D;  4GKK E;  2LJP A;  1UHZ A;  3ZZU A;  2K4V A;  1STU A;  1Z0T A;  4MYT A;  2LJH A;  3ZZT A;  4X66 I;  5LMU I;  2H36 X;  2V2Z A;  3PYD A;  4WYQ B;  2MDR A;  4DR7 E;  4USM A;  1Y4S A;  3ADG A;  3KWR A;  1GZ6 A;  1IBK E;  1PIE A;  3H4L A;  4PRX A;  1N36 I;  4JG4 A;  2N3G A;  4X8W A;  2KHX A;  2IOP A;  4TUI A;  4DR2 E;  2HK2 A;  3MSW A;  4I8O A;  1K47 A;  3ZZ0 A;  1RQ0 A;  4K0K E;  2N3H A;  4BC9 A;  4N3O A;  3ADL A;  1XMQ I;  4DV2 I;  2UXB E;  2V85 A;  5A2Q Q;  4JI1 E;  2FTX B;  1IBL E;  4DPT A;  4DV4 E;  2A2D A;  4M1K A;  4DPU A;  1N33 I;  2F4V E;  1QZR A;  4JI3 E;  3WU4 A;  1YYO A;  2EWL A;  1IBM E;  2UXC I;  5LL6 R;  1Z5B A;  2UUC E;  4DV1 E;  2Z5B B;  4DU7 A;  3LML A;  4P78 A;  4DPW A;  1HR0 E;  4KQV A;  3OTO E;  5IT9 Q;  2M7Q A;  2GQ0 A;  2LE2 A;  5AE3 A;  4AQY E;  3AV0 A;  3ZOQ B;  2AJ4 A;  4DV6 I;  5LMN I;  4X64 E;  3AUZ A;  3HPZ A;  4LF4 I;  2HHH E;  4PU9 A;  4JI5 E;  1YYW A;  4LF7 I;  4DR1 E;  2YT4 A;  4JI2 I;  3T1Y E;  4L5N C;  2JOX A;  1USV A;  5T6J A;  2Z5B A;  5BR8 E;  3HJC A;  4BBY A;  3C4B A;  4IZJ B;  1H72 C;  4B3R I;  4ED4 A;  2OI2 A;  2B9D A;  4DR5 E;  4FWG A;  1FJG E;  4NXN I;  2LUP B;  4JI8 E;  4DKK A;  2V34 A;  2NUG A;  2YZT A;  1KKH A;  3QT5 A;  4JI4 E;  4BCA A;  1NHH A;  2L2K B;  2RS7 A;  1RC7 A;  5GMD A;  4YHH E;  4RPF A;  2GS8 A;  4LF6 I;  5CFF E;  4IZJ A;  1ZM4 A;  2DIX A;  2UUB I;  3WU6 A;  2L33 A;  4X62 I;  2KOU A;  2X7I A;  3GON A;  2LTS A;  1Z0V A;  1T4O A;  2O1T A;  2M1S A;  2PNL A;  4Z7Y A;  1XMO E;  4URL A;  4OX9 E;  4B3T E;  4DV7 E;  3P06 A;  3CWV A;  3P1X A;  3ZKB A;  4IZK A;  3T1H E;  1J5E E;  4I3H A;  2VQF E;  3QT8 A;  3J81 Q;  4ZVI A;  5FLX Q;  4YY3 E;  1XNR I;  4KZS A;  1S16 A;  4HY1 A;  4JV5 I;  4JI7 E;  4LFA I;  4DUZ E;  1DAR A;  2NPF A;  1X48 A;  1FWK A;  2Z5E A;  2VQE E;  4DR6 E;  1I94 E;  2L3C A;  4LF5 I;  1GQE A;  3D4J A;  1HNX I;  2F8B A;  3JTZ A;  3OML A;  4JI0 E;  1ZXM A;  2M4I A;  2V88 A;  4DUZ I;  2VE7 C;  2CGE A;  4PRV A;  4GKJ E;  3B8H A;  2BM0 A;  4LF9 I;  4DR3 E;  4GKK I;  1ZBT A;  3K17 A;  4B3S E;  1NZ0 A;  3F6G A;  2FV4 B;  1MG7 A;  4P7A A;  5FWK A;  1X49 A;  4WPY A;  2VF1 A;  3JAM Q;  4DR7 I;  1IBK I;  3HQ1 A;  1NHJ A;  3HXL A;  2DEI A;  4DR2 I;  4JI6 E;  2JVA A;  1ZXN A;  4K0K I;  4L8N A;  3J7Y p;  1Z0B A;  3V2U C;  1B62 A;  2UXB I;  4LFC E;  2CZ9 A;  1X47 A;  3FIG A;  1U2R A;  4JI1 I;  2JY9 A;  1T4N A;  3Q6M A;  2V8Q B;  2ODR D;  1IBL I;  3LNU A;  2UUA E;  1Z0W A;  4DV4 I;  3JU0 A;  2F4V I;  2NUF A;  1O0W A;  2FGG A;  4Z7C A;  4JI3 I;  1PVG A;  3DF6 A;  1IBM I;  3DJW A;  5IWA E;  4B3M E;  1BKN A;  2UUC I;  1MX0 A;  1HNW E;  4LFC I;  4UT4 A;  4DV1 I;  1HR0 I;  3OTO I;  5A2Q C;  1H74 A;  4DV0 E;  2EZ6 A;  2PNM A;  1RRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...