5LMNE

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmnE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnE02
2XEXA 4DXLA 1N0VC 4DV4E 1UILA 2UU9I 2L2KB 1Z0TA 4YHHE 1Z0BA 1RQ0A 4UTGA 4JI6E 1N34E 2E1RA 2LTSA 2NPFA 1HNZE 4YY3E 1B63A 2HFSA 2VQEE 2NUFA 1BKNA 4DV0E 4DPUA 4B3SE 2UXBE 4JI6I 1N34I 4GKKI 4X65E 3D4JA 2DMYA 1HNZI 3LPSA 4RPFA 4URLA 4YY3I 2VQEI 3J81Q 3WU5A 3Q1QA 1D6TA 5IWAI 4DV2E 4B3SI 1YZ9A 4JI3E 3VYXA 2UXBI 2OI2A 4X65I 4JI5I 1T4OA 5GMDA 1QZRA 4MYTA 3ZZ0A 2JY9A 1YYKA 3QT8A 2R42A 4DR3E 1H74A 1XHKA 2UXDI 2WW4A 4NXNI 1H7SA 4JI3I 2RSMA 3J80C 3GONA 1N36I 3VYYA 3ZKBA 4OX9E 4JI8E 2V2QA 4HY1A 2AJ4A 2E5LI 2JVAA 2UUBE 2DB2A 4OOGC 4DKKA 2CZ9A 4B3ME 2CPNA 4DUYE 1N33E 4OX9I 4B3RE 1Z0GA 2MDRA 2V2VA 4X64I 4JI8I 2EFGA 2HK3A 4FN5A 2HFUA 2UXCE 2UUBI 1J5EI 2DEJA 4DUZE 2L33A 4B3TI 2N3GA 2X36A 1HR0E 4JI1I 3T1YE 4B3MI 4DUYI 4JI7E 1ZM9A 3ZKDA 4NXMI 1HNWE 1WUUA 4M30A 2UXCI 3T1HE 2X7IA 1ZXNA 1DARA 4LF4I 5GMEA 1ZBTA 4WUCA 1K47A 3M6AA 4LF5E 5LL6R 1EI1A 1FNMA 4DR7E 2NA2A 4AQYE 3B8HA 4DV6E 3T1HI 2RTXA 3OTOE 1H7UA 5A2QQ 5CFFE 4UT4A 4DV5I 1X47A 1S4EA 2ZM6E 4X62E 2GS8A 4MYUA 4LF5I 1H73A 4P52A 4DR5I 4DR7I 4AQYI 3PYEA 1XMQI 4LF7E 4FWGA 4LF9I 1PKPA 3OTOI 3ADGA 1NHIA 3CWVA 4WYQB 1PIEA 1MG7A 4DV4I 3J81C 4X62I 1Z0VA 1EA6A 1FJGE 3H4LA 4YHHI 4LF7I 3WU3A 4DR4E 1HNXE 1NHHA 3C4BA 2YT4A 1XNQE 4PRVA 1FI4A 4DPTA 1Z5AA 1KTVA 2A2DA 1FWKA 2NUEA 4DV0I 2VQFE 4USKA 4EMDA 4DR1E 1HNXI 4USMA 1Z5BA 1UHZA 1GQEA 5BR8E 2L2NA 3ZZTA 4JI4E 4DV2I 4LFBE 4ED4A 2V2ZA 1X49A 4DR1I 2F4VE 2DEIA 3HULA 4KQVA 1VISA 3F0NA 4DR3I 3PYFA 5BR8I 1ZM3A 4JG4A 1PVGA 4JI4I 4X8WA 4LFBI 4GKJE 4M2ZA 2F4VI 2V34A 1KKHA 2L3CA 4LF6E 3V2UC 3JAMC 4HYMA 5IT9C 1I94E 1N0UA 1X48A 4WUDA 3V5RA 2ZBKB 1FKAE 1OJ4A 1A6FA 4LF6I 1RC7A 5L3JA 3QT7A 2IHR1 4K0KE 1N33I 4B3RI 3LLHA 1Z0WA 3J80Q 3B78A 1DI2A 3ADJA 4LFAE 1WHQA 1S16A 4FWHA 4DUZI 1IBME 1Z59A 1HR0I 3T1YI 1N32E 4K0KI 1XMOE 4JI7I 2LJHA 4Z7YA 1HNWI 1Z0CA 5LMUE 4LFAI 1RR9A 4FWDA 1T4NA 1ZM2A 3QT6A 1N32I 1ELOA 2VF3A 4DV3E 2V8PA 4HACB 5LMUI 4JYAE 4DV6I 4DPWA 2BM1A 2B7TA 4WFTA 1XNRE 1J26A 2ZM6I 1H72C 4DV3I 5FLXQ 1O0WA 2LTRA 2RS7A 4JYAI 3WU4A 2KHXA 2UUAE 4X66E 1XNRI 2LRSA 1U2RA 1MU5A 4GKKE 2HKJA 3ADLA 1FJGI 2RS6A 3K1JA 1KVKA 2UUAI 2LUQA 4DR4I 5IWAE 2A2CA 2B3TB 4X66I 4I3HA 1MX0A 1YYOA 2LJPA 1XNQI 1Z0EA 1IBKE 4JI5E 4Z7CA 4FW9A 2HHHE 2VQFI 1QU6A 1YYWA 1IBLE 4DPYA 2UXDE 2LBSB 3J7AG 2J7KA 3HTXA 4NXNE 1NHJA 4JI2E 4DR2E 2L2MA 2L3JA 1IBKI 4WUBA 4PRXA 4DV7E 4HACA 1N36E 1B62A 1UEKA 2HHHI 1IBLI 4JV5E 3ADIA 1RREA 2ZITA 2E5LE 4DR2I 4JI2I 3PYDA 5LMNE 4DR6E 4DPXA 4DV7I 2Q2EB 2HKEA 4GKJI 1ZM4A 4JV5I 4X64E 2LUPB 3QT5A 4LFCE 3LNUA 2B7VA 3PYGA 4PU9A 2DIXA 1J5EE 5LMNI 1I94I 3P1XA 4DR6I 4B3TE 4JI1E 2BV3A 2R3VA 3ZZUA 3C4TA 5A2QC 4NXME 4LFCI 1NZ0A 4DV1E 4R1FA 3J7AM 1FWLA 1ZXMA 2BM0A 2EZ6A 2N3HA 2UUCE 4LF4E 1STUA 3JAMQ 5IT9Q 4ZVIA 4JI0E 4KHPE 4DV1I 1EKZA 1IBMI 4XTJA 3ZM7A 3B82A 4DU7A 3WU6A 4LF8E 2NUGA 1XMOI 5FLXC 3K17A 4DV5E 4DU8A 2HK2A 4P7AA 2UUCI 1Z5CA 1KIJA 2UU9E 4JI0I 4KHPI 1WHNA 4HXZA 1T4LB 4DR5E 1XMQE 3LTOA 4LF9E 4LF8I 3J7Yp 4M1KA
chains in the Genus database with same CATH superfamily
1PDAA 4OO1B 2EN2A 2XEXA 4DXLA 2DSYA 2LVHA 2RPCA 2H36X 1N0VC 4DV4E 1F2IG 1UILA 2UU9I 4IZJD 3GLLA 2ENCA 2L2KB 3IWCA 1Z0TA 2CVEA 1X5WA 3JTZA 1Z1BA 4YHHE 4IFDB 1Z0BA 2YRHA 2EWLA 1ZU1A 1RQ0A 4R2SA 4UTGA 3TQMA 1WJPA 3UHMA 4JI6E 3VHTB 2FGGA 2PRTA 1N34E 2E1RA 2LTSA 2YRKA 3HXLA 4LOMA 2NPFA 3F6GA 2MKNA 4Q35B 1SR9A 1HNZE 4YY3E 1B63A 1A1LA 2HFSA 2VQEE 4F9BB 5JEAA 2NUFA 4WXDA 4O43A 5K36F 2YSPA 1BKNA 4DV0E 5C0XF 4FW6A 4B3SE 4DPUA 2NN6A 2EMZA 2DGCA 2EPCA 1Y4UA 3AUZA 4J3DA 2UXBE 1X6HA 1N34I 4JI6I 4GKKI 4X65E 3D4JA 4JV5I 1A1JA 2YWQA 2C39B 2DMYA 4KWYA 4U3BA 3LPSA 4RPFA 4URLA 4YY3I 2YZTA 1HNZI 5DNLA 2VQEI 3J81Q 2O1VA 3WU5A 2EPAA 3Q1QA 1D6TA 1GZ6A 2EOOA 2O1WA 5IWAI 5AE2A 4DV2E 3U1KA 1YSAC 2EOEA 4B3SI 1X6FA 1YZ9A 2EMCA 4JI3E 3VYXA 2UXBI 1RMDA 2OI2A 4X65I 2JP9A 1T4OA 5GMDA 3PS1A 1QZRA 4MU3A 1DGCA 4JI5I 2EPPA 4MYTA 3ZZ0A 2JY9A 1YYKA 3QT8A 3KRNA 4P78A 3DD6A 3OMLA 4NZVA 2NN6F 2R42A 4DR3E 1H74A 2YTGA 1XHKA 2UXDI 2WW4A 1JK1A 4NHRA 1PJTA 4NXNI 4LCHA 1H7SA 2EN8A 2J7JA 2I13A 2C38A 4JI3I 5K36C 2RSMA 1EH6A 2EQ3A 3C6KA 5JEAD 3J80C 2EPNA 3GONA 5FWKA 1N36I 3VYYA 1DQ3A 3ZKBA 2DLQA 4OX9E 2IOPA 4BS9A 1YUIA 1USUA 4QNKA 4JI8E 3GCMA 2V2QA 3M85G 4HY1A 2M7QA 4MU0A 3KZYA 2MDGA 2EQ1A 5DNXA 2AJ4A 2E5LI 2JVAA 2UUBE 3IWDA 5AC4A 1UN6B 2FTXB 5KL6A 2DB2A 2YTEA 2EMXA 4OOGC 2PO0B 2ADRA 3THOB 4IS1C 4DKKA 2CZ9A 4KZSA 4B3ME 2CPNA 4DUYE 1N33E 2D9HA 5JEAC 4OX9I 4B3RE 1E3HA 1Z0GA 2MDRA 2V2VA 4X64I 4OO1F 4JI8I 2EFGA 2HK3A 4FN5A 2EN4A 5ELWA 2NN6C 2EOJA 2HFUA 2UXCE 2LT7A 2UUBI 5KL2A 2EPKX 5DRPA 4LF9I 1J5EI 3M85D 2DEJA 4DUZE 2L33A 4B3TI 2EMYA 2N3GA 2V89A 1HR0E 2X36A 2C39A 4JI1I 3T1YE 4B3MI 2YU8A 4IFDF 2EOYA 4DUYI 1YPNA 3PS3A 3U1YA 4JI7E 1IQSA 1QNTA 1ZM9A 3HPSA 4LCFA 3ZKDA 1SFEA 4NXMI 2K4VA 2ENAA 4LTYA 1HNWE 1WUUA 4M30A 2UXCI 3T1HE 3CDIA 2X7IA 4FW7A 2YTQA 4DMIA 5TSEA 4RHBB 2R76A 2EOIA 5LLQA 1P47A 4LU9A 1ZXNA 3HKMA 3P06A 2Q8UA 4R2RA 2EPUA 1DARA 2B9DA 4LF4I 2EMWA 5GMEA 2PNLA 2EOSA 2GLIA 1ZBTA 4OKGA 4WUCA 1K47A 1YUJA 3M6AA 4LF5E 5LL6R 1R6MA 1EI1A 1FNMA 4RH8A 4FW3A 2IESA 4DR7E 2NA2A 4AQYE 3B8HA 4DV6E 3T1HI 2EPLX 3MHSC 2RTXA 3OTOE 4F54A 2C38B 2YTNA 1H7UA 4OO1C 3DF6A 5A2QQ 2YTJA 2ELYA 5CFFE 4UT4A 4DV5I 5A69A 1X47A 2EPZA 4I8OA 1S4EA 4AIMA 2ZM6E 3MSWA 4X62E 2IERA 2KOUA 4BC7A 2GS8A 4LCGA 4MYUA 4WXCA 4LF5I 1H73A 3EPHA 4ISAA 2DMIA 4P52A 4IFDC 4DR5I 4DR7I 4BA2B 4AQYI 3PYEA 2JE6B 1XMQI 4LF7E 4FWGA 2EOQA 2CTDA 1PKPA 1Y60A 2Z5CA 3OTOI 4N3OA 2EJ4A 2EPXA 3ADGA 3THNA 3BF2A 1NHIA 2PO0A 3BIDA 4WYQB 3CWVA 3FIGA 2Z5BA 2EOMA 1MG7A 1PIEA 4AIDA 4DV4I 2F1DA 3J81C 1T39A 4X62I 1Z0VA 2NABA 2O3ZA 4BHCA 1EA6A 5KL3A 2GHFA 2JEAA 1FJGE 1EH7A 3H4LA 4AM3A 4YHHI 1G2FC 4IJDA 1EH8A 4LF7I 3WU3A 4DR4E 3P76A 1LLMC 1ZBQA 4F2JC 4R2AA 1HNXE 2C37B 1NHHA 3C4BA 2CSHA 2YT4A 1B69A 1XNQE 2EMKA 4LPFA 4PRVA 1VI7A 3BGHA 1FI4A 2V85A 4BHBA 4DPTA 1Z5AA 2EPMX 3EPKA 1KTVA 2A2DA 1FWKA 4HTGA 4O24A 2NUEA 4DV0I 4ZYHA 2VQFE 1ZR9A 4BBYA 4MLQA 4USKA 4EMDA 5IXMB 3ZOQB 4DR1E 5JEAF 2LCEA 1HNXI 4USMA 1NEIA 1Z5BA 1UHZA 3MHHC 3ECRA 1A1GA 1GQEA 5BR8E 2LV2A 2L2NA 4BC9A 3ZZTA 2EN3A 4JI4E 4DV2I 2ENHA 4LFBE 4ED4A 2V2ZA 4MDTA 1X49A 3IWBA 4F6NA 4DR1I 2F4VE 2DEIA 1A1HA 4R2QA 3M99B 5EL9A 5C0XE 3HULA 4KQVA 1VISA 3L00A 3RMPA 3F0NA 4DR3I 3PYFA 2YU5A 5BR8I 1ZM3A 4JG4A 2FV4B 2EM9A 4R2DA 1PVGA 4JI4I 4BA2A 4X8WA 2JE6A 2O1TA 4GKJE 5IV8B 4GQUA 4LFBI 2EPRA 2LO3A 1OYSA 2ODRD 2Z5CB 4M2ZA 2F4VI 2V34A 1TF6A 2EOXA 1KKHA 2L6MA 2Z5EA 2L3CA 4LF6E 2WP8B 1YH8A 1UDOA 2PNZB 2Z5BB 3JAMC 4HYMA 5IT9C 3V2UC 4MU1A 1I94E 2V87A 1N0UA 1X48A 1X6EA 4WUDA 2HGHA 2VESA 3V5RA 5C0XB 2JEAB 2ZBKB 1FKAE 2BR2B 4NBQA 1A1IA 1OJ4A 2EM2A 2JXPA 2JR1A 3Q6MA 4F9AB 3EQ1A 2EN7A 4L5NC 4F9CB 1IQOA 1L4SA 1A6FA 2HJJA 2C37A 3M7NG 4LF6I 1RC7A 5L3JA 2ODRC 3QT7A 2LJUA 2EMAA 2IHR1 2GO4A 1Y5YA 4K0KE 4HEIA 2MC5A 1N33I 2M1SA 2VF1A 4B3RI 3AV0A 4X9JA 2EE8A 4WX9A 3LLHA 2E1MA 1Z0WA 3J80Q 5ADZA 1IMUA 1P42A 2LE2A 2CG9A 2JYAA 1DI2A 3B78A 4ZYEA 3ADJA 4LFAE 1WHQA 5EKWA 1S16A 3GMEA 3C6MA 4FWHA 2EM3A 4DUZI 2JWOA 1IBME 1Z59A 1HR0I 3JU0A 2PNMA 4FK5C 3T1YI 2YTPA 1N32E 4K0KI 2LMZA 2V88A 1XMOE 3M7ND 4R2EA 1NCSA 1KYQA 4JI7I 1YFHA 3B4TA 2L92A 2EPOA 2LJHA 4BMJA 1A1FA 4Z7YA 1HNWI 1Z0CA 4IZKB 5LMUE 4LFAI 1WXRA 1RR9A 4FWDA 1T4NA 1RHYA 4R2CA 2YSOA 1ZM2A 3BBGA 1JK2A 3QT6A 1UBDC 1N32I 2M9AA 4QNJA 2A25A 3VK6A 1ELOA 1BB8A 2VF3A 1OYRA 3EPJA 4DV3E 3P3GA 2V8PA 5AE3A 4HACB 2I9IA 3HPZA 5LMUI 4JYAE 4DV6I 1USVA 4DPWA 2BM1A 4Q28A 2B7TA 2YTOA 4WFTA 3DJWA 4M1KA 2K7IA 1PJQA 2WP8A 3L7ZB 2PNZA 1XNRE 1J26A 2PO2A 2ZM6I 3K6QA 4MU4A 3LMLA 1H72C 4FW4A 5K36A 4DV3I 5FLXQ 1R6LA 5C0XA 1MEYC 1O0WA 2LTRA 2JEBB 2RS7A 2BR2A 2WZOA 4TUIA 2L8TA 4JYAI 5A6BA 2YPNA 5KL4A 2GQ0A 3WU4A 2KHXA 2EM4A 2UUAE 3EPLA 4GEQB 3KWRA 5AE1A 2YTFA 4X66E 1UDQA 2WBSA 5DRRA 1XNRI 2LRSA 2VRDA 1U2RA 1MU5A 1BBGA 4GKKE 2EMHA 2HKJA 4P7DA 2GPIA 2BB8A 3ADLA 4WPYA 1FJGI 2J65A 2RS6A 3K1JA 4BCAA 3K85A 1KVKA 2UUAI 2LUQA 4DR4I 1OYPA 5IWAE 2IOQA 2A2CA 1E3PA 2B3TB 4X66I 2WBUA 4I3HA 2EP3A 1MX0A 4L8NA 1YYOA 2LJPA 4IZJB 1XNQI 2EL4A 2EL6A 1Z0EA 5KL5A 5A6AA 1IBKE 4JI5E 4Z7CA 3NZKA 2EN6A 2MC6A 2V8QB 2EN1A 3P3CA 4WSGA 2R1FA 4IZKA 4M0VA 4FW9A 2HHHE 3F6HA 2VQFI 1KJKA 1XXEA 1QU6A 1YYWA 2EM6A 3P3EA 1AH5A 1IBLE 2WNRB 3PRYA 4DPYA 2G7HA 5K36D 2UXDE 2LBSB 3J7AG 2J7KA 4BA1B 5C0XD 3HTXA 4NXNE 1NHJA 5K36E 3Q6NA 4JI2E 4DR2E 2JT2A 2L2MA 2CT1A 2L3JA 1IBKI 4WUBA 5A6BD 2ELZA 2EMGA 4DV7E 3CDJA 1TF3A 4HACA 4PRXA 1N36E 1B62A 1UEKA 2HHHI 1A1KA 5KL7A 2PO1A 1GTKA 2WBTA 4R8OA 4F6MA 4M9VC 4R2PA 2JPAA 5DROA 1IBLI 4JV5E 3ADIA 4FW5A 1UDNA 4WSPA 3L7ZA 1RREA 2RSIA 1UDSA 2ZITA 2E5LE 4DR2I 4JI2I 4O5GA 3PS2A 3PYDA 2BA1G 2EMBA 5LMNE 2PO2B 5A6KA 4OO1A 5K36B 5C0XC 2EORA 4DR6E 2EOFA 4DPXA 4DV7I 2M4IA 2JOXA 1YHCA 2EM0A 2JEBA 5JEAE 2Q2EB 4ZYGA 2EL5A 2HKEA 4GKJI 2NN6D 4N4RB 3HQ1A 5DRQA 1ZM4A 3H1CA 2EOHA 5AASA 2BA0G 2NN6E 3HJCA 4X64E 2LUPB 4O4KA 3QT5A 4LFCE 3LNUA 4OZEA 4IFDA 1BBOA 1HK7A 3UK3C 2B7VA 2JOBA 1MGTA 3PYGA 4MQYA 4PU9A 2DIXA 4ZYDA 5F3WA 1J5EE 2BBGA 5LMNI 1I94I 2DLKA 2MKDA 3P1XA 4TUGA 1T38A 4DR6I 4B3TE 4JI1E 2BA1D 2BV3A 2F8BA 2AE8A 2R3VA 3ZZUA 3C4TA 1G2DC 5JEAB 2VE7C 5A2QC 5T6JA 5A6JA 4NXME 4LFCI 1NZ0A 4DV1E 4R1FA 2V86A 4IZJA 2YTIA 2BA0D 2NN6B 1FWLA 3J7AM 1TN9A 1ZXMA 2KONA 2BM0A 2EZ6A 5AC5A 1AAYA 2N3HA 2UUCE 4LF4E 1STUA 2EM5A 3JAMQ 5IT9Q 2YRMA 2E72A 4ZVIA 4JI0E 4KHPE 2WNRA 4MLVA 4U3DA 4OO1D 4BA1A 4DV1I 1EKZA 4R03A 2GO3A 2V83A 4XTJA 3ZM7A 2EQ0A 3B82A 4DU7A 1PJSA 2RQLA 4GZNC 1IBMI 1Y4SA 4OO1E 2EOZA 4LF8E 5DNYA 3WU6A 3H09A 2NUGA 1XMOI 2EMLA 1WRJA 2CGEA 5FLXC 3K17A 4DV5E 4DU8A 2HK2A 4P7AA 2UUCI 2HC5A 3KZZA 1Z5CA 2YTDA 1ZAAC 4IFDD 2O1UA 1KIJA 2N8XA 2UU9E 4JI0I 2PO1B 1WHNA 4IFDE 4KHPI 2DRPA 1X3CA 1T4LB 2EMFA 2WCC3 4HXZA 4DR5E 4IS9A 1XMQE 4J8ZA 4LF9E 3LTOA 2EM7A 4LF8I 3J7Yp 2EM8A 3QG5C 1Y6ZA 1N3GA 2EMIA
chains in the Genus database with same CATH topology
2XEXA 4DXLA 2DSYA 2H36X 1N0VC 4DV4E 1UILA 2UU9I 4IZJD 2L2KB 3IWCA 1Z0TA 3JTZA 4YHHE 1Z0BA 2EWLA 1RQ0A 4UTGA 4JI6E 1N34E 2FGGA 2E1RA 2LTSA 2NPFA 3HXLA 3F6GA 1HNZE 1SR9A 4YY3E 1B63A 2HFSA 2VQEE 4F9BB 2NUFA 1BKNA 4DV0E 4DPUA 4B3SE 1Y4UA 3AUZA 2UXBE 4JI6I 1N34I 4GKKI 4X65E 3D4JA 2DMYA 1HNZI 3LPSA 4RPFA 4URLA 4YY3I 2YZTA 2VQEI 3J81Q 2O1VA 3WU5A 3Q1QA 1D6TA 1GZ6A 2O1WA 5IWAI 5AE2A 4DV2E 4B3SI 1YZ9A 4JI3E 3VYXA 2UXBI 2OI2A 4X65I 4JI5I 1T4OA 5GMDA 1QZRA 4MYTA 3ZZ0A 2JY9A 1YYKA 3QT8A 4P78A 3OMLA 2R42A 4DR3E 1H74A 1XHKA 2UXDI 2WW4A 4NXNI 1H7SA 4JI3I 2RSMA 3J80C 3GONA 5FWKA 1N36I 3VYYA 1DQ3A 3ZKBA 4OX9E 2IOPA 4BS9A 1USUA 4JI8E 2V2QA 4HY1A 2M7QA 2AJ4A 2E5LI 2JVAA 2UUBE 3IWDA 2FTXB 2DB2A 4OOGC 4DKKA 2CZ9A 4KZSA 4B3ME 2CPNA 4DUYE 1N33E 4OX9I 4B3RE 1Z0GA 2MDRA 2V2VA 4X64I 4JI8I 2EFGA 2HK3A 4FN5A 2HFUA 2UXCE 2UUBI 1J5EI 2DEJA 4DUZE 2L33A 4B3TI 2N3GA 2V89A 1HR0E 2X36A 4JI1I 3T1YE 4B3MI 4DUYI 4JI7E 1ZM9A 3HPSA 3ZKDA 4NXMI 2K4VA 4LTYA 1HNWE 1WUUA 4M30A 2UXCI 3T1HE 2X7IA 4DMIA 4LU9A 1ZXNA 3P06A 1DARA 2B9DA 4LF4I 5GMEA 2PNLA 1ZBTA 4WUCA 1K47A 3M6AA 4LF5E 5LL6R 1EI1A 1FNMA 4DR7E 2NA2A 4AQYE 3B8HA 4DV6E 3T1HI 2RTXA 3OTOE 4F54A 1H7UA 3DF6A 5A2QQ 5CFFE 4UT4A 4DV5I 1X47A 4I8OA 1S4EA 2ZM6E 3MSWA 4X62E 2KOUA 4BC7A 2GS8A 4MYUA 4LF5I 1H73A 4P52A 4DR5I 4DR7I 4AQYI 3PYEA 1XMQI 4LF7E 4FWGA 4LF9I 1PKPA 2Z5CA 3OTOI 4N3OA 3ADGA 1NHIA 3CWVA 4WYQB 3FIGA 2Z5BA 1PIEA 1MG7A 4DV4I 3J81C 4X62I 1Z0VA 1EA6A 1FJGE 3H4LA 4YHHI 4LF7I 3WU3A 4DR4E 1ZBQA 1HNXE 1NHHA 3C4BA 2YT4A 1XNQE 4PRVA 1FI4A 2V85A 4DPTA 1Z5AA 1KTVA 2A2DA 1FWKA 2NUEA 4DV0I 2VQFE 4BBYA 4USKA 4EMDA 4DR1E 3ZOQB 1HNXI 4USMA 1Z5BA 1UHZA 1GQEA 5BR8E 2L2NA 4BC9A 3ZZTA 4JI4E 4DV2I 4LFBE 4ED4A 2V2ZA 1X49A 3IWBA 4DR1I 2F4VE 2DEIA 3HULA 4KQVA 1VISA 3RMPA 3F0NA 4DR3I 3PYFA 5BR8I 1ZM3A 4JG4A 2FV4B 1PVGA 4JI4I 4X8WA 4LFBI 2O1TA 4GKJE 2ODRD 2Z5CB 4M2ZA 2F4VI 2V34A 1KKHA 2L6MA 2Z5EA 2L3CA 4LF6E 2Z5BB 3JAMC 4HYMA 5IT9C 3V2UC 1I94E 2V87A 1N0UA 1X48A 4WUDA 3V5RA 2ZBKB 1FKAE 1OJ4A 3Q6MA 2JR1A 4F9AB 1A6FA 4L5NC 4F9CB 4LF6I 1RC7A 5L3JA 2ODRC 3QT7A 2IHR1 4K0KE 2MC5A 1N33I 2M1SA 2VF1A 4B3RI 3AV0A 3LLHA 2E1MA 1Z0WA 3J80Q 5ADZA 3B78A 2LE2A 2CG9A 1DI2A 3ADJA 4LFAE 1WHQA 1S16A 4FWHA 4DUZI 2JWOA 1IBME 1Z59A 1HR0I 3JU0A 2PNMA 3T1YI 1N32E 4K0KI 2LMZA 2V88A 1XMOE 4JI7I 2L92A 2LJHA 4BMJA 4Z7YA 1HNWI 1Z0CA 4IZKB 5LMUE 4LFAI 1WXRA 1RR9A 4FWDA 1T4NA 1ZM2A 3QT6A 1N32I 3VK6A 1ELOA 2VF3A 4DV3E 2V8PA 5AE3A 4HACB 3HPZA 5LMUI 4JYAE 4DV6I 1USVA 4DPWA 2BM1A 4Q28A 2B7TA 4WFTA 3DJWA 4M1KA 1XNRE 1J26A 2ZM6I 3K6QA 3LMLA 1H72C 4DV3I 5FLXQ 1O0WA 2LTRA 2RS7A 2WZOA 4TUIA 2L8TA 4JYAI 2GQ0A 3WU4A 2KHXA 2UUAE 4GEQB 3KWRA 5AE1A 4X66E 1XNRI 2LRSA 1U2RA 1MU5A 4GKKE 2HKJA 4P7DA 3ADLA 4WPYA 1FJGI 2RS6A 3K1JA 4BCAA 3K85A 1KVKA 2UUAI 2LUQA 4DR4I 5IWAE 2A2CA 2B3TB 4X66I 4I3HA 1MX0A 4L8NA 1YYOA 2LJPA 4IZJB 1XNQI 1Z0EA 1IBKE 4JI5E 4Z7CA 2MC6A 2V8QB 4IZKA 4M0VA 4FW9A 2HHHE 3F6HA 2VQFI 1QU6A 1YYWA 1IBLE 3PRYA 4DPYA 2G7HA 2UXDE 2LBSB 3J7AG 2J7KA 3HTXA 4NXNE 1NHJA 3Q6NA 4JI2E 4DR2E 2L2MA 2L3JA 1IBKI 4WUBA 4PRXA 4DV7E 4HACA 1N36E 1B62A 1UEKA 2HHHI 4R8OA 1IBLI 4JV5E 3ADIA 4WSPA 1RREA 2ZITA 2E5LE 4DR2I 4JI2I 3PYDA 5LMNE 4DR6E 4DPXA 4DV7I 2M4IA 2JOXA 2Q2EB 2HKEA 4GKJI 3HQ1A 1ZM4A 5AASA 3HJCA 4JV5I 4X64E 2LUPB 3QT5A 4LFCE 3LNUA 1HK7A 2B7VA 2JOBA 3PYGA 4PU9A 2DIXA 5F3WA 1J5EE 5LMNI 1I94I 3P1XA 4TUGA 4DR6I 4B3TE 4JI1E 2BV3A 2F8BA 2R3VA 3ZZUA 3C4TA 2VE7C 5A2QC 5T6JA 4NXME 4LFCI 1NZ0A 4DV1E 4R1FA 2V86A 4IZJA 3J7AM 1FWLA 1ZXMA 2KONA 2BM0A 2EZ6A 2N3HA 2UUCE 4LF4E 1STUA 3JAMQ 5IT9Q 4ZVIA 4JI0E 4KHPE 4DV1I 1EKZA 4R03A 2V83A 4XTJA 3ZM7A 3B82A 4DU7A 1IBMI 1Y4SA 3WU6A 4LF8E 5DNYA 3H09A 2NUGA 1XMOI 2CGEA 5FLXC 3K17A 4DV5E 4DU8A 2HK2A 4P7AA 2UUCI 1Z5CA 2O1UA 1KIJA 2UU9E 4JI0I 4KHPI 1WHNA 4HXZA 1T4LB 4DR5E 1XMQE 4J8ZA 4LF9E 3LTOA 4LF8I 3J7Yp 1Y6ZA 2IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEX A;  4DXL A;  1N0V C;  4DV4 E;  1UIL A;  2UU9 I;  2L2K B;  1Z0T A;  4YHH E;  1Z0B A;  1RQ0 A;  4UTG A;  4JI6 E;  1N34 E;  2E1R A;  2LTS A;  2NPF A;  1HNZ E;  4YY3 E;  1B63 A;  2HFS A;  2VQE E;  2NUF A;  1BKN A;  4DV0 E;  4DPU A;  4B3S E;  2UXB E;  4JI6 I;  1N34 I;  4GKK I;  4X65 E;  3D4J A;  2DMY A;  1HNZ I;  3LPS A;  4RPF A;  4URL A;  4YY3 I;  2VQE I;  3J81 Q;  3WU5 A;  3Q1Q A;  1D6T A;  5IWA I;  4DV2 E;  4B3S I;  1YZ9 A;  4JI3 E;  3VYX A;  2UXB I;  2OI2 A;  4X65 I;  4JI5 I;  1T4O A;  5GMD A;  1QZR A;  4MYT A;  3ZZ0 A;  2JY9 A;  1YYK A;  3QT8 A;  2R42 A;  4DR3 E;  1H74 A;  1XHK A;  2UXD I;  2WW4 A;  4NXN I;  1H7S A;  4JI3 I;  2RSM A;  3J80 C;  3GON A;  1N36 I;  3VYY A;  3ZKB A;  4OX9 E;  4JI8 E;  2V2Q A;  4HY1 A;  2AJ4 A;  2E5L I;  2JVA A;  2UUB E;  2DB2 A;  4OOG C;  4DKK A;  2CZ9 A;  4B3M E;  2CPN A;  4DUY E;  1N33 E;  4OX9 I;  4B3R E;  1Z0G A;  2MDR A;  2V2V A;  4X64 I;  4JI8 I;  2EFG A;  2HK3 A;  4FN5 A;  2HFU A;  2UXC E;  2UUB I;  1J5E I;  2DEJ A;  4DUZ E;  2L33 A;  4B3T I;  2N3G A;  2X36 A;  1HR0 E;  4JI1 I;  3T1Y E;  4B3M I;  4DUY I;  4JI7 E;  1ZM9 A;  3ZKD A;  4NXM I;  1HNW E;  1WUU A;  4M30 A;  2UXC I;  3T1H E;  2X7I A;  1ZXN A;  1DAR A;  4LF4 I;  5GME A;  1ZBT A;  4WUC A;  1K47 A;  3M6A A;  4LF5 E;  5LL6 R;  1EI1 A;  1FNM A;  4DR7 E;  2NA2 A;  4AQY E;  3B8H A;  4DV6 E;  3T1H I;  2RTX A;  3OTO E;  1H7U A;  5A2Q Q;  5CFF E;  4UT4 A;  4DV5 I;  1X47 A;  1S4E A;  2ZM6 E;  4X62 E;  2GS8 A;  4MYU A;  4LF5 I;  1H73 A;  4P52 A;  4DR5 I;  4DR7 I;  4AQY I;  3PYE A;  1XMQ I;  4LF7 E;  4FWG A;  4LF9 I;  1PKP A;  3OTO I;  3ADG A;  1NHI A;  3CWV A;  4WYQ B;  1PIE A;  1MG7 A;  4DV4 I;  3J81 C;  4X62 I;  1Z0V A;  1EA6 A;  1FJG E;  3H4L A;  4YHH I;  4LF7 I;  3WU3 A;  4DR4 E;  1HNX E;  1NHH A;  3C4B A;  2YT4 A;  1XNQ E;  4PRV A;  1FI4 A;  4DPT A;  1Z5A A;  1KTV A;  2A2D A;  1FWK A;  2NUE A;  4DV0 I;  2VQF E;  4USK A;  4EMD A;  4DR1 E;  1HNX I;  4USM A;  1Z5B A;  1UHZ A;  1GQE A;  5BR8 E;  2L2N A;  3ZZT A;  4JI4 E;  4DV2 I;  4LFB E;  4ED4 A;  2V2Z A;  1X49 A;  4DR1 I;  2F4V E;  2DEI A;  3HUL A;  4KQV A;  1VIS A;  3F0N A;  4DR3 I;  3PYF A;  5BR8 I;  1ZM3 A;  4JG4 A;  1PVG A;  4JI4 I;  4X8W A;  4LFB I;  4GKJ E;  4M2Z A;  2F4V I;  2V34 A;  1KKH A;  2L3C A;  4LF6 E;  3V2U C;  3JAM C;  4HYM A;  5IT9 C;  1I94 E;  1N0U A;  1X48 A;  4WUD A;  3V5R A;  2ZBK B;  1FKA E;  1OJ4 A;  1A6F A;  4LF6 I;  1RC7 A;  5L3J A;  3QT7 A;  2IHR 1;  4K0K E;  1N33 I;  4B3R I;  3LLH A;  1Z0W A;  3J80 Q;  3B78 A;  1DI2 A;  3ADJ A;  4LFA E;  1WHQ A;  1S16 A;  4FWH A;  4DUZ I;  1IBM E;  1Z59 A;  1HR0 I;  3T1Y I;  1N32 E;  4K0K I;  1XMO E;  4JI7 I;  2LJH A;  4Z7Y A;  1HNW I;  1Z0C A;  5LMU E;  4LFA I;  1RR9 A;  4FWD A;  1T4N A;  1ZM2 A;  3QT6 A;  1N32 I;  1ELO A;  2VF3 A;  4DV3 E;  2V8P A;  4HAC B;  5LMU I;  4JYA E;  4DV6 I;  4DPW A;  2BM1 A;  2B7T A;  4WFT A;  1XNR E;  1J26 A;  2ZM6 I;  1H72 C;  4DV3 I;  5FLX Q;  1O0W A;  2LTR A;  2RS7 A;  4JYA I;  3WU4 A;  2KHX A;  2UUA E;  4X66 E;  1XNR I;  2LRS A;  1U2R A;  1MU5 A;  4GKK E;  2HKJ A;  3ADL A;  1FJG I;  2RS6 A;  3K1J A;  1KVK A;  2UUA I;  2LUQ A;  4DR4 I;  5IWA E;  2A2C A;  2B3T B;  4X66 I;  4I3H A;  1MX0 A;  1YYO A;  2LJP A;  1XNQ I;  1Z0E A;  1IBK E;  4JI5 E;  4Z7C A;  4FW9 A;  2HHH E;  2VQF I;  1QU6 A;  1YYW A;  1IBL E;  4DPY A;  2UXD E;  2LBS B;  3J7A G;  2J7K A;  3HTX A;  4NXN E;  1NHJ A;  4JI2 E;  4DR2 E;  2L2M A;  2L3J A;  1IBK I;  4WUB A;  4PRX A;  4DV7 E;  4HAC A;  1N36 E;  1B62 A;  1UEK A;  2HHH I;  1IBL I;  4JV5 E;  3ADI A;  1RRE A;  2ZIT A;  2E5L E;  4DR2 I;  4JI2 I;  3PYD A;  5LMN E;  4DR6 E;  4DPX A;  4DV7 I;  2Q2E B;  2HKE A;  4GKJ I;  1ZM4 A;  4JV5 I;  4X64 E;  2LUP B;  3QT5 A;  4LFC E;  3LNU A;  2B7V A;  3PYG A;  4PU9 A;  2DIX A;  1J5E E;  5LMN I;  1I94 I;  3P1X A;  4DR6 I;  4B3T E;  4JI1 E;  2BV3 A;  2R3V A;  3ZZU A;  3C4T A;  5A2Q C;  4NXM E;  4LFC I;  1NZ0 A;  4DV1 E;  4R1F A;  3J7A M;  1FWL A;  1ZXM A;  2BM0 A;  2EZ6 A;  2N3H A;  2UUC E;  4LF4 E;  1STU A;  3JAM Q;  5IT9 Q;  4ZVI A;  4JI0 E;  4KHP E;  4DV1 I;  1EKZ A;  1IBM I;  4XTJ A;  3ZM7 A;  3B82 A;  4DU7 A;  3WU6 A;  4LF8 E;  2NUG A;  1XMO I;  5FLX C;  3K17 A;  4DV5 E;  4DU8 A;  2HK2 A;  4P7A A;  2UUC I;  1Z5C A;  1KIJ A;  2UU9 E;  4JI0 I;  4KHP I;  1WHN A;  4HXZ A;  1T4L B;  4DR5 E;  1XMQ E;  3LTO A;  4LF9 E;  4LF8 I;  3J7Y p;  4M1K A; 
#chains in the Genus database with same CATH topology
 1PDA A;  4OO1 B;  2EN2 A;  2XEX A;  4DXL A;  2DSY A;  2LVH A;  2RPC A;  2H36 X;  1N0V C;  4DV4 E;  1F2I G;  1UIL A;  2UU9 I;  4IZJ D;  3GLL A;  2ENC A;  2L2K B;  3IWC A;  1Z0T A;  2CVE A;  1X5W A;  3JTZ A;  1Z1B A;  4YHH E;  4IFD B;  1Z0B A;  2YRH A;  2EWL A;  1ZU1 A;  1RQ0 A;  4R2S A;  4UTG A;  3TQM A;  1WJP A;  3UHM A;  4JI6 E;  3VHT B;  2FGG A;  2PRT A;  1N34 E;  2E1R A;  2LTS A;  2YRK A;  3HXL A;  4LOM A;  2NPF A;  3F6G A;  2MKN A;  4Q35 B;  1SR9 A;  1HNZ E;  4YY3 E;  1B63 A;  1A1L A;  2HFS A;  2VQE E;  4F9B B;  5JEA A;  2NUF A;  4WXD A;  4O43 A;  5K36 F;  2YSP A;  1BKN A;  4DV0 E;  5C0X F;  4FW6 A;  4B3S E;  4DPU A;  2NN6 A;  2EMZ A;  2DGC A;  2EPC A;  1Y4U A;  3AUZ A;  4J3D A;  2UXB E;  1X6H A;  1N34 I;  4JI6 I;  4GKK I;  4X65 E;  3D4J A;  4JV5 I;  1A1J A;  2YWQ A;  2C39 B;  2DMY A;  4KWY A;  4U3B A;  3LPS A;  4RPF A;  4URL A;  4YY3 I;  2YZT A;  1HNZ I;  5DNL A;  2VQE I;  3J81 Q;  2O1V A;  3WU5 A;  2EPA A;  3Q1Q A;  1D6T A;  1GZ6 A;  2EOO A;  2O1W A;  5IWA I;  5AE2 A;  4DV2 E;  3U1K A;  1YSA C;  2EOE A;  4B3S I;  1X6F A;  1YZ9 A;  2EMC A;  4JI3 E;  3VYX A;  2UXB I;  1RMD A;  2OI2 A;  4X65 I;  2JP9 A;  1T4O A;  5GMD A;  3PS1 A;  1QZR A;  4MU3 A;  1DGC A;  4JI5 I;  2EPP A;  4MYT A;  3ZZ0 A;  2JY9 A;  1YYK A;  3QT8 A;  3KRN A;  4P78 A;  3DD6 A;  3OML A;  4NZV A;  2NN6 F;  2R42 A;  4DR3 E;  1H74 A;  2YTG A;  1XHK A;  2UXD I;  2WW4 A;  1JK1 A;  4NHR A;  1PJT A;  4NXN I;  4LCH A;  1H7S A;  2EN8 A;  2J7J A;  2I13 A;  2C38 A;  4JI3 I;  5K36 C;  2RSM A;  1EH6 A;  2EQ3 A;  3C6K A;  5JEA D;  3J80 C;  2EPN A;  3GON A;  5FWK A;  1N36 I;  3VYY A;  1DQ3 A;  3ZKB A;  2DLQ A;  4OX9 E;  2IOP A;  4BS9 A;  1YUI A;  1USU A;  4QNK A;  4JI8 E;  3GCM A;  2V2Q A;  3M85 G;  4HY1 A;  2M7Q A;  4MU0 A;  3KZY A;  2MDG A;  2EQ1 A;  5DNX A;  2AJ4 A;  2E5L I;  2JVA A;  2UUB E;  3IWD A;  5AC4 A;  1UN6 B;  2FTX B;  5KL6 A;  2DB2 A;  2YTE A;  2EMX A;  4OOG C;  2PO0 B;  2ADR A;  3THO B;  4IS1 C;  4DKK A;  2CZ9 A;  4KZS A;  4B3M E;  2CPN A;  4DUY E;  1N33 E;  2D9H A;  5JEA C;  4OX9 I;  4B3R E;  1E3H A;  1Z0G A;  2MDR A;  2V2V A;  4X64 I;  4OO1 F;  4JI8 I;  2EFG A;  2HK3 A;  4FN5 A;  2EN4 A;  5ELW A;  2NN6 C;  2EOJ A;  2HFU A;  2UXC E;  2LT7 A;  2UUB I;  5KL2 A;  2EPK X;  5DRP A;  4LF9 I;  1J5E I;  3M85 D;  2DEJ A;  4DUZ E;  2L33 A;  4B3T I;  2EMY A;  2N3G A;  2V89 A;  1HR0 E;  2X36 A;  2C39 A;  4JI1 I;  3T1Y E;  4B3M I;  2YU8 A;  4IFD F;  2EOY A;  4DUY I;  1YPN A;  3PS3 A;  3U1Y A;  4JI7 E;  1IQS A;  1QNT A;  1ZM9 A;  3HPS A;  4LCF A;  3ZKD A;  1SFE A;  4NXM I;  2K4V A;  2ENA A;  4LTY A;  1HNW E;  1WUU A;  4M30 A;  2UXC I;  3T1H E;  3CDI A;  2X7I A;  4FW7 A;  2YTQ A;  4DMI A;  5TSE A;  4RHB B;  2R76 A;  2EOI A;  5LLQ A;  1P47 A;  4LU9 A;  1ZXN A;  3HKM A;  3P06 A;  2Q8U A;  4R2R A;  2EPU A;  1DAR A;  2B9D A;  4LF4 I;  2EMW A;  5GME A;  2PNL A;  2EOS A;  2GLI A;  1ZBT A;  4OKG A;  4WUC A;  1K47 A;  1YUJ A;  3M6A A;  4LF5 E;  5LL6 R;  1R6M A;  1EI1 A;  1FNM A;  4RH8 A;  4FW3 A;  2IES A;  4DR7 E;  2NA2 A;  4AQY E;  3B8H A;  4DV6 E;  3T1H I;  2EPL X;  3MHS C;  2RTX A;  3OTO E;  4F54 A;  2C38 B;  2YTN A;  1H7U A;  4OO1 C;  3DF6 A;  5A2Q Q;  2YTJ A;  2ELY A;  5CFF E;  4UT4 A;  4DV5 I;  5A69 A;  1X47 A;  2EPZ A;  4I8O A;  1S4E A;  4AIM A;  2ZM6 E;  3MSW A;  4X62 E;  2IER A;  2KOU A;  4BC7 A;  2GS8 A;  4LCG A;  4MYU A;  4WXC A;  4LF5 I;  1H73 A;  3EPH A;  4ISA A;  2DMI A;  4P52 A;  4IFD C;  4DR5 I;  4DR7 I;  4BA2 B;  4AQY I;  3PYE A;  2JE6 B;  1XMQ I;  4LF7 E;  4FWG A;  2EOQ A;  2CTD A;  1PKP A;  1Y60 A;  2Z5C A;  3OTO I;  4N3O A;  2EJ4 A;  2EPX A;  3ADG A;  3THN A;  3BF2 A;  1NHI A;  2PO0 A;  3BID A;  4WYQ B;  3CWV A;  3FIG A;  2Z5B A;  2EOM A;  1MG7 A;  1PIE A;  4AID A;  4DV4 I;  2F1D A;  3J81 C;  1T39 A;  4X62 I;  1Z0V A;  2NAB A;  2O3Z A;  4BHC A;  1EA6 A;  5KL3 A;  2GHF A;  2JEA A;  1FJG E;  1EH7 A;  3H4L A;  4AM3 A;  4YHH I;  1G2F C;  4IJD A;  1EH8 A;  4LF7 I;  3WU3 A;  4DR4 E;  3P76 A;  1LLM C;  1ZBQ A;  4F2J C;  4R2A A;  1HNX E;  2C37 B;  1NHH A;  3C4B A;  2CSH A;  2YT4 A;  1B69 A;  1XNQ E;  2EMK A;  4LPF A;  4PRV A;  1VI7 A;  3BGH A;  1FI4 A;  2V85 A;  4BHB A;  4DPT A;  1Z5A A;  2EPM X;  3EPK A;  1KTV A;  2A2D A;  1FWK A;  4HTG A;  4O24 A;  2NUE A;  4DV0 I;  4ZYH A;  2VQF E;  1ZR9 A;  4BBY A;  4MLQ A;  4USK A;  4EMD A;  5IXM B;  3ZOQ B;  4DR1 E;  5JEA F;  2LCE A;  1HNX I;  4USM A;  1NEI A;  1Z5B A;  1UHZ A;  3MHH C;  3ECR A;  1A1G A;  1GQE A;  5BR8 E;  2LV2 A;  2L2N A;  4BC9 A;  3ZZT A;  2EN3 A;  4JI4 E;  4DV2 I;  2ENH A;  4LFB E;  4ED4 A;  2V2Z A;  4MDT A;  1X49 A;  3IWB A;  4F6N A;  4DR1 I;  2F4V E;  2DEI A;  1A1H A;  4R2Q A;  3M99 B;  5EL9 A;  5C0X E;  3HUL A;  4KQV A;  1VIS A;  3L00 A;  3RMP A;  3F0N A;  4DR3 I;  3PYF A;  2YU5 A;  5BR8 I;  1ZM3 A;  4JG4 A;  2FV4 B;  2EM9 A;  4R2D A;  1PVG A;  4JI4 I;  4BA2 A;  4X8W A;  2JE6 A;  2O1T A;  4GKJ E;  5IV8 B;  4GQU A;  4LFB I;  2EPR A;  2LO3 A;  1OYS A;  2ODR D;  2Z5C B;  4M2Z A;  2F4V I;  2V34 A;  1TF6 A;  2EOX A;  1KKH A;  2L6M A;  2Z5E A;  2L3C A;  4LF6 E;  2WP8 B;  1YH8 A;  1UDO A;  2PNZ B;  2Z5B B;  3JAM C;  4HYM A;  5IT9 C;  3V2U C;  4MU1 A;  1I94 E;  2V87 A;  1N0U A;  1X48 A;  1X6E A;  4WUD A;  2HGH A;  2VES A;  3V5R A;  5C0X B;  2JEA B;  2ZBK B;  1FKA E;  2BR2 B;  4NBQ A;  1A1I A;  1OJ4 A;  2EM2 A;  2JXP A;  2JR1 A;  3Q6M A;  4F9A B;  3EQ1 A;  2EN7 A;  4L5N C;  4F9C B;  1IQO A;  1L4S A;  1A6F A;  2HJJ A;  2C37 A;  3M7N G;  4LF6 I;  1RC7 A;  5L3J A;  2ODR C;  3QT7 A;  2LJU A;  2EMA A;  2IHR 1;  2GO4 A;  1Y5Y A;  4K0K E;  4HEI A;  2MC5 A;  1N33 I;  2M1S A;  2VF1 A;  4B3R I;  3AV0 A;  4X9J A;  2EE8 A;  4WX9 A;  3LLH A;  2E1M A;  1Z0W A;  3J80 Q;  5ADZ A;  1IMU A;  1P42 A;  2LE2 A;  2CG9 A;  2JYA A;  1DI2 A;  3B78 A;  4ZYE A;  3ADJ A;  4LFA E;  1WHQ A;  5EKW A;  1S16 A;  3GME A;  3C6M A;  4FWH A;  2EM3 A;  4DUZ I;  2JWO A;  1IBM E;  1Z59 A;  1HR0 I;  3JU0 A;  2PNM A;  4FK5 C;  3T1Y I;  2YTP A;  1N32 E;  4K0K I;  2LMZ A;  2V88 A;  1XMO E;  3M7N D;  4R2E A;  1NCS A;  1KYQ A;  4JI7 I;  1YFH A;  3B4T A;  2L92 A;  2EPO A;  2LJH A;  4BMJ A;  1A1F A;  4Z7Y A;  1HNW I;  1Z0C A;  4IZK B;  5LMU E;  4LFA I;  1WXR A;  1RR9 A;  4FWD A;  1T4N A;  1RHY A;  4R2C A;  2YSO A;  1ZM2 A;  3BBG A;  1JK2 A;  3QT6 A;  1UBD C;  1N32 I;  2M9A A;  4QNJ A;  2A25 A;  3VK6 A;  1ELO A;  1BB8 A;  2VF3 A;  1OYR A;  3EPJ A;  4DV3 E;  3P3G A;  2V8P A;  5AE3 A;  4HAC B;  2I9I A;  3HPZ A;  5LMU I;  4JYA E;  4DV6 I;  1USV A;  4DPW A;  2BM1 A;  4Q28 A;  2B7T A;  2YTO A;  4WFT A;  3DJW A;  4M1K A;  2K7I A;  1PJQ A;  2WP8 A;  3L7Z B;  2PNZ A;  1XNR E;  1J26 A;  2PO2 A;  2ZM6 I;  3K6Q A;  4MU4 A;  3LML A;  1H72 C;  4FW4 A;  5K36 A;  4DV3 I;  5FLX Q;  1R6L A;  5C0X A;  1MEY C;  1O0W A;  2LTR A;  2JEB B;  2RS7 A;  2BR2 A;  2WZO A;  4TUI A;  2L8T A;  4JYA I;  5A6B A;  2YPN A;  5KL4 A;  2GQ0 A;  3WU4 A;  2KHX A;  2EM4 A;  2UUA E;  3EPL A;  4GEQ B;  3KWR A;  5AE1 A;  2YTF A;  4X66 E;  1UDQ A;  2WBS A;  5DRR A;  1XNR I;  2LRS A;  2VRD A;  1U2R A;  1MU5 A;  1BBG A;  4GKK E;  2EMH A;  2HKJ A;  4P7D A;  2GPI A;  2BB8 A;  3ADL A;  4WPY A;  1FJG I;  2J65 A;  2RS6 A;  3K1J A;  4BCA A;  3K85 A;  1KVK A;  2UUA I;  2LUQ A;  4DR4 I;  1OYP A;  5IWA E;  2IOQ A;  2A2C A;  1E3P A;  2B3T B;  4X66 I;  2WBU A;  4I3H A;  2EP3 A;  1MX0 A;  4L8N A;  1YYO A;  2LJP A;  4IZJ B;  1XNQ I;  2EL4 A;  2EL6 A;  1Z0E A;  5KL5 A;  5A6A A;  1IBK E;  4JI5 E;  4Z7C A;  3NZK A;  2EN6 A;  2MC6 A;  2V8Q B;  2EN1 A;  3P3C A;  4WSG A;  2R1F A;  4IZK A;  4M0V A;  4FW9 A;  2HHH E;  3F6H A;  2VQF I;  1KJK A;  1XXE A;  1QU6 A;  1YYW A;  2EM6 A;  3P3E A;  1AH5 A;  1IBL E;  2WNR B;  3PRY A;  4DPY A;  2G7H A;  5K36 D;  2UXD E;  2LBS B;  3J7A G;  2J7K A;  4BA1 B;  5C0X D;  3HTX A;  4NXN E;  1NHJ A;  5K36 E;  3Q6N A;  4JI2 E;  4DR2 E;  2JT2 A;  2L2M A;  2CT1 A;  2L3J A;  1IBK I;  4WUB A;  5A6B D;  2ELZ A;  2EMG A;  4DV7 E;  3CDJ A;  1TF3 A;  4HAC A;  4PRX A;  1N36 E;  1B62 A;  1UEK A;  2HHH I;  1A1K A;  5KL7 A;  2PO1 A;  1GTK A;  2WBT A;  4R8O A;  4F6M A;  4M9V C;  4R2P A;  2JPA A;  5DRO A;  1IBL I;  4JV5 E;  3ADI A;  4FW5 A;  1UDN A;  4WSP A;  3L7Z A;  1RRE A;  2RSI A;  1UDS A;  2ZIT A;  2E5L E;  4DR2 I;  4JI2 I;  4O5G A;  3PS2 A;  3PYD A;  2BA1 G;  2EMB A;  5LMN E;  2PO2 B;  5A6K A;  4OO1 A;  5K36 B;  5C0X C;  2EOR A;  4DR6 E;  2EOF A;  4DPX A;  4DV7 I;  2M4I A;  2JOX A;  1YHC A;  2EM0 A;  2JEB A;  5JEA E;  2Q2E B;  4ZYG A;  2EL5 A;  2HKE A;  4GKJ I;  2NN6 D;  4N4R B;  3HQ1 A;  5DRQ A;  1ZM4 A;  3H1C A;  2EOH A;  5AAS A;  2BA0 G;  2NN6 E;  3HJC A;  4X64 E;  2LUP B;  4O4K A;  3QT5 A;  4LFC E;  3LNU A;  4OZE A;  4IFD A;  1BBO A;  1HK7 A;  3UK3 C;  2B7V A;  2JOB A;  1MGT A;  3PYG A;  4MQY A;  4PU9 A;  2DIX A;  4ZYD A;  5F3W A;  1J5E E;  2BBG A;  5LMN I;  1I94 I;  2DLK A;  2MKD A;  3P1X A;  4TUG A;  1T38 A;  4DR6 I;  4B3T E;  4JI1 E;  2BA1 D;  2BV3 A;  2F8B A;  2AE8 A;  2R3V A;  3ZZU A;  3C4T A;  1G2D C;  5JEA B;  2VE7 C;  5A2Q C;  5T6J A;  5A6J A;  4NXM E;  4LFC I;  1NZ0 A;  4DV1 E;  4R1F A;  2V86 A;  4IZJ A;  2YTI A;  2BA0 D;  2NN6 B;  1FWL A;  3J7A M;  1TN9 A;  1ZXM A;  2KON A;  2BM0 A;  2EZ6 A;  5AC5 A;  1AAY A;  2N3H A;  2UUC E;  4LF4 E;  1STU A;  2EM5 A;  3JAM Q;  5IT9 Q;  2YRM A;  2E72 A;  4ZVI A;  4JI0 E;  4KHP E;  2WNR A;  4MLV A;  4U3D A;  4OO1 D;  4BA1 A;  4DV1 I;  1EKZ A;  4R03 A;  2GO3 A;  2V83 A;  4XTJ A;  3ZM7 A;  2EQ0 A;  3B82 A;  4DU7 A;  1PJS A;  2RQL A;  4GZN C;  1IBM I;  1Y4S A;  4OO1 E;  2EOZ A;  4LF8 E;  5DNY A;  3WU6 A;  3H09 A;  2NUG A;  1XMO I;  2EML A;  1WRJ A;  2CGE A;  5FLX C;  3K17 A;  4DV5 E;  4DU8 A;  2HK2 A;  4P7A A;  2UUC I;  2HC5 A;  3KZZ A;  1Z5C A;  2YTD A;  1ZAA C;  4IFD D;  2O1U A;  1KIJ A;  2N8X A;  2UU9 E;  4JI0 I;  2PO1 B;  1WHN A;  4IFD E;  4KHP I;  2DRP A;  1X3C A;  1T4L B;  2EMF A;  2WCC 3;  4HXZ A;  4DR5 E;  4IS9 A;  1XMQ E;  4J8Z A;  4LF9 E;  3LTO A;  2EM7 A;  4LF8 I;  3J7Y p;  2EM8 A;  3QG5 C;  1Y6Z A;  1N3G A;  2EMI A; 
#chains in the Genus database with same CATH homology
 2XEX A;  4DXL A;  2DSY A;  2H36 X;  1N0V C;  4DV4 E;  1UIL A;  2UU9 I;  4IZJ D;  2L2K B;  3IWC A;  1Z0T A;  3JTZ A;  4YHH E;  1Z0B A;  2EWL A;  1RQ0 A;  4UTG A;  4JI6 E;  1N34 E;  2FGG A;  2E1R A;  2LTS A;  2NPF A;  3HXL A;  3F6G A;  1HNZ E;  1SR9 A;  4YY3 E;  1B63 A;  2HFS A;  2VQE E;  4F9B B;  2NUF A;  1BKN A;  4DV0 E;  4DPU A;  4B3S E;  1Y4U A;  3AUZ A;  2UXB E;  4JI6 I;  1N34 I;  4GKK I;  4X65 E;  3D4J A;  2DMY A;  1HNZ I;  3LPS A;  4RPF A;  4URL A;  4YY3 I;  2YZT A;  2VQE I;  3J81 Q;  2O1V A;  3WU5 A;  3Q1Q A;  1D6T A;  1GZ6 A;  2O1W A;  5IWA I;  5AE2 A;  4DV2 E;  4B3S I;  1YZ9 A;  4JI3 E;  3VYX A;  2UXB I;  2OI2 A;  4X65 I;  4JI5 I;  1T4O A;  5GMD A;  1QZR A;  4MYT A;  3ZZ0 A;  2JY9 A;  1YYK A;  3QT8 A;  4P78 A;  3OML A;  2R42 A;  4DR3 E;  1H74 A;  1XHK A;  2UXD I;  2WW4 A;  4NXN I;  1H7S A;  4JI3 I;  2RSM A;  3J80 C;  3GON A;  5FWK A;  1N36 I;  3VYY A;  1DQ3 A;  3ZKB A;  4OX9 E;  2IOP A;  4BS9 A;  1USU A;  4JI8 E;  2V2Q A;  4HY1 A;  2M7Q A;  2AJ4 A;  2E5L I;  2JVA A;  2UUB E;  3IWD A;  2FTX B;  2DB2 A;  4OOG C;  4DKK A;  2CZ9 A;  4KZS A;  4B3M E;  2CPN A;  4DUY E;  1N33 E;  4OX9 I;  4B3R E;  1Z0G A;  2MDR A;  2V2V A;  4X64 I;  4JI8 I;  2EFG A;  2HK3 A;  4FN5 A;  2HFU A;  2UXC E;  2UUB I;  1J5E I;  2DEJ A;  4DUZ E;  2L33 A;  4B3T I;  2N3G A;  2V89 A;  1HR0 E;  2X36 A;  4JI1 I;  3T1Y E;  4B3M I;  4DUY I;  4JI7 E;  1ZM9 A;  3HPS A;  3ZKD A;  4NXM I;  2K4V A;  4LTY A;  1HNW E;  1WUU A;  4M30 A;  2UXC I;  3T1H E;  2X7I A;  4DMI A;  4LU9 A;  1ZXN A;  3P06 A;  1DAR A;  2B9D A;  4LF4 I;  5GME A;  2PNL A;  1ZBT A;  4WUC A;  1K47 A;  3M6A A;  4LF5 E;  5LL6 R;  1EI1 A;  1FNM A;  4DR7 E;  2NA2 A;  4AQY E;  3B8H A;  4DV6 E;  3T1H I;  2RTX A;  3OTO E;  4F54 A;  1H7U A;  3DF6 A;  5A2Q Q;  5CFF E;  4UT4 A;  4DV5 I;  1X47 A;  4I8O A;  1S4E A;  2ZM6 E;  3MSW A;  4X62 E;  2KOU A;  4BC7 A;  2GS8 A;  4MYU A;  4LF5 I;  1H73 A;  4P52 A;  4DR5 I;  4DR7 I;  4AQY I;  3PYE A;  1XMQ I;  4LF7 E;  4FWG A;  4LF9 I;  1PKP A;  2Z5C A;  3OTO I;  4N3O A;  3ADG A;  1NHI A;  3CWV A;  4WYQ B;  3FIG A;  2Z5B A;  1PIE A;  1MG7 A;  4DV4 I;  3J81 C;  4X62 I;  1Z0V A;  1EA6 A;  1FJG E;  3H4L A;  4YHH I;  4LF7 I;  3WU3 A;  4DR4 E;  1ZBQ A;  1HNX E;  1NHH A;  3C4B A;  2YT4 A;  1XNQ E;  4PRV A;  1FI4 A;  2V85 A;  4DPT A;  1Z5A A;  1KTV A;  2A2D A;  1FWK A;  2NUE A;  4DV0 I;  2VQF E;  4BBY A;  4USK A;  4EMD A;  4DR1 E;  3ZOQ B;  1HNX I;  4USM A;  1Z5B A;  1UHZ A;  1GQE A;  5BR8 E;  2L2N A;  4BC9 A;  3ZZT A;  4JI4 E;  4DV2 I;  4LFB E;  4ED4 A;  2V2Z A;  1X49 A;  3IWB A;  4DR1 I;  2F4V E;  2DEI A;  3HUL A;  4KQV A;  1VIS A;  3RMP A;  3F0N A;  4DR3 I;  3PYF A;  5BR8 I;  1ZM3 A;  4JG4 A;  2FV4 B;  1PVG A;  4JI4 I;  4X8W A;  4LFB I;  2O1T A;  4GKJ E;  2ODR D;  2Z5C B;  4M2Z A;  2F4V I;  2V34 A;  1KKH A;  2L6M A;  2Z5E A;  2L3C A;  4LF6 E;  2Z5B B;  3JAM C;  4HYM A;  5IT9 C;  3V2U C;  1I94 E;  2V87 A;  1N0U A;  1X48 A;  4WUD A;  3V5R A;  2ZBK B;  1FKA E;  1OJ4 A;  3Q6M A;  2JR1 A;  4F9A B;  1A6F A;  4L5N C;  4F9C B;  4LF6 I;  1RC7 A;  5L3J A;  2ODR C;  3QT7 A;  2IHR 1;  4K0K E;  2MC5 A;  1N33 I;  2M1S A;  2VF1 A;  4B3R I;  3AV0 A;  3LLH A;  2E1M A;  1Z0W A;  3J80 Q;  5ADZ A;  3B78 A;  2LE2 A;  2CG9 A;  1DI2 A;  3ADJ A;  4LFA E;  1WHQ A;  1S16 A;  4FWH A;  4DUZ I;  2JWO A;  1IBM E;  1Z59 A;  1HR0 I;  3JU0 A;  2PNM A;  3T1Y I;  1N32 E;  4K0K I;  2LMZ A;  2V88 A;  1XMO E;  4JI7 I;  2L92 A;  2LJH A;  4BMJ A;  4Z7Y A;  1HNW I;  1Z0C A;  4IZK B;  5LMU E;  4LFA I;  1WXR A;  1RR9 A;  4FWD A;  1T4N A;  1ZM2 A;  3QT6 A;  1N32 I;  3VK6 A;  1ELO A;  2VF3 A;  4DV3 E;  2V8P A;  5AE3 A;  4HAC B;  3HPZ A;  5LMU I;  4JYA E;  4DV6 I;  1USV A;  4DPW A;  2BM1 A;  4Q28 A;  2B7T A;  4WFT A;  3DJW A;  4M1K A;  1XNR E;  1J26 A;  2ZM6 I;  3K6Q A;  3LML A;  1H72 C;  4DV3 I;  5FLX Q;  1O0W A;  2LTR A;  2RS7 A;  2WZO A;  4TUI A;  2L8T A;  4JYA I;  2GQ0 A;  3WU4 A;  2KHX A;  2UUA E;  4GEQ B;  3KWR A;  5AE1 A;  4X66 E;  1XNR I;  2LRS A;  1U2R A;  1MU5 A;  4GKK E;  2HKJ A;  4P7D A;  3ADL A;  4WPY A;  1FJG I;  2RS6 A;  3K1J A;  4BCA A;  3K85 A;  1KVK A;  2UUA I;  2LUQ A;  4DR4 I;  5IWA E;  2A2C A;  2B3T B;  4X66 I;  4I3H A;  1MX0 A;  4L8N A;  1YYO A;  2LJP A;  4IZJ B;  1XNQ I;  1Z0E A;  1IBK E;  4JI5 E;  4Z7C A;  2MC6 A;  2V8Q B;  4IZK A;  4M0V A;  4FW9 A;  2HHH E;  3F6H A;  2VQF I;  1QU6 A;  1YYW A;  1IBL E;  3PRY A;  4DPY A;  2G7H A;  2UXD E;  2LBS B;  3J7A G;  2J7K A;  3HTX A;  4NXN E;  1NHJ A;  3Q6N A;  4JI2 E;  4DR2 E;  2L2M A;  2L3J A;  1IBK I;  4WUB A;  4PRX A;  4DV7 E;  4HAC A;  1N36 E;  1B62 A;  1UEK A;  2HHH I;  4R8O A;  1IBL I;  4JV5 E;  3ADI A;  4WSP A;  1RRE A;  2ZIT A;  2E5L E;  4DR2 I;  4JI2 I;  3PYD A;  5LMN E;  4DR6 E;  4DPX A;  4DV7 I;  2M4I A;  2JOX A;  2Q2E B;  2HKE A;  4GKJ I;  3HQ1 A;  1ZM4 A;  5AAS A;  3HJC A;  4JV5 I;  4X64 E;  2LUP B;  3QT5 A;  4LFC E;  3LNU A;  1HK7 A;  2B7V A;  2JOB A;  3PYG A;  4PU9 A;  2DIX A;  5F3W A;  1J5E E;  5LMN I;  1I94 I;  3P1X A;  4TUG A;  4DR6 I;  4B3T E;  4JI1 E;  2BV3 A;  2F8B A;  2R3V A;  3ZZU A;  3C4T A;  2VE7 C;  5A2Q C;  5T6J A;  4NXM E;  4LFC I;  1NZ0 A;  4DV1 E;  4R1F A;  2V86 A;  4IZJ A;  3J7A M;  1FWL A;  1ZXM A;  2KON A;  2BM0 A;  2EZ6 A;  2N3H A;  2UUC E;  4LF4 E;  1STU A;  3JAM Q;  5IT9 Q;  4ZVI A;  4JI0 E;  4KHP E;  4DV1 I;  1EKZ A;  4R03 A;  2V83 A;  4XTJ A;  3ZM7 A;  3B82 A;  4DU7 A;  1IBM I;  1Y4S A;  3WU6 A;  4LF8 E;  5DNY A;  3H09 A;  2NUG A;  1XMO I;  2CGE A;  5FLX C;  3K17 A;  4DV5 E;  4DU8 A;  2HK2 A;  4P7A A;  2UUC I;  1Z5C A;  2O1U A;  1KIJ A;  2UU9 E;  4JI0 I;  4KHP I;  1WHN A;  4HXZ A;  1T4L B;  4DR5 E;  1XMQ E;  4J8Z A;  4LF9 E;  3LTO A;  4LF8 I;  3J7Y p;  1Y6Z A;  2IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...