2NN6B

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
235
Chain Sequence
LSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVREASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transferase
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 235
sequence length 235
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01138 RNase_PH 3' exoribonuclease family, domain 1
B PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2nn6B01
4IFDE 5C0XB 2NN6A 2C38B 3GLLA 4OO1F 4IFDF 2BA1D 2BR2B 3B4TA 1UDOA 2PO0A 1R6MA 2NN6D 2PNZA 3CDJA 4AIDA 2C39A 3L7ZB 2JEAA 4IFDC 2WP8A 5JEAC 2BA0D 5C0XC 4IFDB 5JEAA 1R6LA 1UDSA 3M7ND 4BA2B 4OO1E 2WNRA 5JEAB 5C0XA 5K36C 2PO2B 2C38A 2WNRB 5K36A 3HKMA 3KRNA 5K36B 2BR2A 5JEAD 5C0XD 2JEBB 2JE6A 5K36D 3L7ZA 2JE6B 1OYRA 1E3HA 4OO1C 3H1CA 4IFDA 4BA2A 4OO1B 2PO2A 4NBQA 3M85G 1OYSA 1UDQA 4OO1D 2NN6E 4IFDD 4AM3A 2JEBA 3GMEA 1OYPA 3DD6A 2NN6F 3U1KA 2C37A 3CDIA 2BA1G 4OO1A 2C37B 4BA1B 2NN6C 5JEAE 1UDNA 5C0XE 2NN6B 4AIMA 5K36E 3GCMA 2BA0G 5JEAF 5C0XF 2PO1A 2PO0B 3M7NG 1E3PA 3M85D 2PNZB 2PO1B 5K36F 2C39B 2JEAB 2WP8B 4BA1A
chains in the Genus database with same CATH superfamily
3P3EA 2BV3A 2Z5CB 2O1TA 4Z7YA 1HNWI 2AE8A 4B3RE 1DARA 2NN6A 4LF8I 1ZXMA 1RR9A 1YHCA 1I94I 1XMOI 1NHJA 3JAMQ 2LJPA 2UUAE 1FWKA 4MYTA 1UDOA 2PNZA 4GKJE 4JI2I 2UXCI 2VQFI 5LMUI 3CDJA 4AQYE 1EI1A 4DV3E 4IZJB 4B3SE 4IFDC 1XMQI 4URLA 4Z7CA 4YY3E 1HNZI 2CG9A 5DRQA 1MG7A 2BA0D 1XNQE 4QNKA 2UXBI 2Z5CA 3ZKDA 5DNLA 1KIJA 2DEJA 1R6LA 3M7ND 4ED4A 4B3ME 2PO2B 2A2CA 1U2RA 4N3OA 5K36B 5JEAD 4DUYI 1VISA 3J81C 5C0XD 4MU1A 2JEBB 4OKGA 3M6AA 4X64I 4IZJA 1Z0CA 2JE6B 1E3HA 5DRRA 4JI8I 1ZM9A 4X66I 4LF4I 4ISAA 2IERA 4DR6I 4KHPE 1BKNA 4JV5I 5IT9Q 3B8HA 4U3BA 3OTOI 2PNLA 3H4LA 1XXEA 2VQEE 2PO2A 4USMA 1HNXI 3M85G 1HR0E 4LF6I 1Z59A 1S4EA 3QT7A 4XTJA 4OO1D 4IFDD 2JEBA 4FWDA 2GO4A 1XNRE 4JI0I 1IBLI 4JI5E 4NXME 4LF9I 2BA1G 2UUBE 1J5EI 2CGEA 3T1YI 4LFBE 5JEAE 3CWVA 2UUCE 5C0XE 4PU9A 4FW6A 1IBKI 1RREA 4DV1E 5JEAF 1IBME 1KVKA 5C0XF 2J7KA 2PO0B 4GKKE 3M85D 3WU6A 2PO1B 2ZBKB 4J3DA 2C39B 2CZ9A 1H74A 2HK2A 4M1KA 2WP8B 1FJGI 2E5LE 2IOQA 1OJ4A 4IFDE 1H7UA 3Q6NA 3T1HI 1Z0WA 4X65E 2UU9I 5C0XB 2AJ4A 2C38B 3WU5A 4OO1F 4IFDF 3UHMA 4RPFA 5LMNI 1N34I 2BA1D 2Z5EA 3B78A 4LCGA 3LTOA 2PO0A 4DUZE 4DV2E 1FWLA 4OX9E 3PYGA 1N36E 4LF7E 4LFAI 1Z0EA 2C39A 1Z5AA 4DR5I 2WP8A 3PYDA 4UTGA 1N33E 5JEAC 5DNXA 5DRPA 1FKAE 5C0XC 4B3RI 4IFDB 5JEAA 1UDSA 4FW3A 4DR1E 2WNRA 5C0XA 2X7IA 2C38A 4HXZA 2UUAI 2HK3A 3HKMA 2ZM6E 4JI1E 2HKJA 4DV0E 4GKJI 2CVEA 4AQYI 4X62E 4DV3I 4B3SI 4IZKB 4JI3E 4YY3I 1USUA 1S16A 4OO1C 1XNQI 4LOMA 1Z5CA 1ZXNA 2HKEA 4MQYA 4IFDA 4JYAE 5EKWA 4DPYA 4MYUA 4B3MI 4MU0A 1NHHA 3J80Q 4FWHA 2HHHE 1B62A 2HFUA 1OYSA 1B63A 4PRXA 3D4JA 1XMOE 3PRYA 3GMEA 1FI4A 2V2VA 4DR3E 2J65A 2PNMA 3NZKA 4IZKA 3DD6A 5FLXQ 4FWGA 2UXCE 5EL9A 5IWAE 4KHPI 5FWKA 4DV5E 5DROA 2C37A 3CDIA 2VQEI 2VF3A 3JAMC 4GQUA 1HR0I 2GQ0A 4FW4A 3K1JA 2R3VA 1UDNA 2BM1A 1D6TA 4PRVA 2UXDE 4P52A 4JI7E 1MU5A 4LFCI 4I3HA 3HJCA 2GO3A 1EA6A 1QZRA 2ZITA 4LCFA 1XNRI 1N0UA 4DR7E 1N32E 4MU3A 3P76A 3J80C 4DV6E 1Y5YA 4JI5I 4NXMI 4DPWA 2JEAB 4JI8E 4FN5A 4MU4A 4WUBA 4UT4A 2UUBI 4LF4E 2O1WA 4USKA 4JV5E 1A6FA 1Z0GA 5GMEA 2UUCI 4JI6E 2IOPA 3PYEA 2DEIA 1HK7A 4DV1I 3GLLA 2XEXA 1Y4SA 3QT8A 1NZ0A 2BM0A 4FW9A 2F4VE 1IBMI 2HFSA 2BR2B 4GKKI 5IT9C 1NHIA 4EMDA 4DV4E 2JEAA 3PYFA 2E5LI 2Z5BB 5BR8E 4IZJD 4ZVIA 4LF9E 4X65I 4OO1E 5JEAB 4HACA 1Z0VA 2WNRB 4DV7I 1H72C 1WUUA 3ZKBA 3KRNA 4JI4E 2BR2A 4K0KE 2A2DA 4DUZI 2JT2A 4FW7A 1N36I 4LF7I 3K17A 5K36D 5LL6R 1OYRA 1H73A 1ZM4A 3Q1QA 3K85A 2Z5BA 3QT6A 4DR1I 1KKHA 3WU4A 4OO1B 4DR4E 4NBQA 3LNUA 2ZM6I 4IS9A 2Q2EB 4LCHA 4JI1I 4DR2E 4DU7A 2O3ZA 4DV0I 5A2QQ 1YH8A 2E1RA 4X62I 4YHHE 3GONA 4KQVA 3V5RA 4JI3I 3B82A 1FNMA 5ELWA 3U1KA 4NXNE 4JYAI 3J81Q 4B3TE 4MDTA 2VESA 4LF5E 4BA1B 2WW4A 2C37B 4OO1A 1PIEA 2NN6C 2HHHI 1ZM3A 1RHYA 3QT5A 4HY1A 1HNWE 2X36A 4U3DA 4LF8E 5K36E 4DR3I 4DPXA 1I94E 3GCMA 3P3GA 5L3JA 3Q6MA 4DXLA 5IWAI 2F1DA 1E3PA 4DV5I 5K36F 3P06A 3ZM7A 4JI2E 2VQFE 5LMUE 4BA1A 2OI2A 1PVGA 1XMQE 5A2QC 4WUCA 1HNZE 2NPFA 2UXBE 2UXDI 4DPTA 2GS8A 1UEKA 4JI7I 1VI7A 2V34A 4DR7I 1N32I 4DUYE 3B4TA 1R6MA 2NN6D 4DV6I 1Y4UA 3WU3A 4AIDA 3HULA 3PS1A 3L7ZB 1Z0BA 4X64E 1N0VC 1Y6ZA 1P42A 4JG4A 1USVA 1ZM2A 4X66E 4DR6E 4JI6I 4LFBI 4BA2B 3OTOE 3J7AM 5K36C 2F4VI 3ZZTA 5FLXC 5K36A 4HACB 2V8PA 4R1FA 1HNXE 4LF6E 4LPFA 1ELOA 1Z0TA 2R42A 2V2QA 4LFCE 4DPUA 1XHKA 1Z5BA 2JE6A 4DV4I 4FW5A 3L7ZA 5BR8I 3LPSA 3H1CA 4JI0E 1IBLE 4BA2A 3P3CA 1J5EE 3T1YE 3ZZUA 1PKPA 4JI4I 1UDQA 4K0KI 2NN6E 3F0NA 1IBKE 4AM3A 3J7AG 4HYMA 4DV2I 4OX9I 1OYPA 2NN6F 2O1VA 1MX0A 1K47A 1N33I 2V2ZA 4DR4I 1FJGE 4QNJA 2O1UA 4DR2I 3PS2A 3T1HE 2NN6B 2UU9E 4DV7E 4YHHI 1KTVA 4AIMA 3PS3A 4DU8A 1Y60A 2EFGA 3ZZ0A 2BA0G 1H7SA 5LMNE 1N34E 4WUDA 2PO1A 3M7NG 4NXNI 2PNZB 4OZEA 3V2UC 4B3TI 3U1YA 2IESA 4LF5I 4P7AA 4LFAE 5GMDA 4DR5E
chains in the Genus database with same CATH topology
4IFDE 5C0XB 2NN6A 2C38B 3GLLA 4OO1F 4IFDF 2BA1D 2BR2B 3B4TA 1UDOA 2PO0A 1R6MA 2NN6D 2PNZA 3CDJA 4AIDA 2C39A 3L7ZB 2JEAA 4IFDC 2WP8A 5JEAC 2BA0D 5C0XC 4IFDB 5JEAA 1R6LA 1UDSA 3M7ND 4BA2B 4OO1E 2WNRA 5JEAB 5C0XA 5K36C 2PO2B 2C38A 2WNRB 5K36A 3HKMA 3KRNA 5K36B 2BR2A 5JEAD 5C0XD 2JEBB 2JE6A 5K36D 3L7ZA 2JE6B 1OYRA 1E3HA 4OO1C 3H1CA 4IFDA 4BA2A 4OO1B 2PO2A 4NBQA 3M85G 1OYSA 1UDQA 4OO1D 2NN6E 4IFDD 4AM3A 2JEBA 3GMEA 1OYPA 3DD6A 2NN6F 3U1KA 2C37A 3CDIA 2BA1G 4OO1A 2C37B 4BA1B 2NN6C 5JEAE 1UDNA 5C0XE 2NN6B 4AIMA 5K36E 3GCMA 2BA0G 5JEAF 5C0XF 2PO1A 2PO0B 3M7NG 1E3PA 3M85D 2PNZB 2PO1B 5K36F 2C39B 2JEAB 2WP8B 4BA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD E;  5C0X B;  2NN6 A;  2C38 B;  3GLL A;  4OO1 F;  4IFD F;  2BA1 D;  2BR2 B;  3B4T A;  1UDO A;  2PO0 A;  1R6M A;  2NN6 D;  2PNZ A;  3CDJ A;  4AID A;  2C39 A;  3L7Z B;  2JEA A;  4IFD C;  2WP8 A;  5JEA C;  2BA0 D;  5C0X C;  4IFD B;  5JEA A;  1R6L A;  1UDS A;  3M7N D;  4BA2 B;  4OO1 E;  2WNR A;  5JEA B;  5C0X A;  5K36 C;  2PO2 B;  2C38 A;  2WNR B;  5K36 A;  3HKM A;  3KRN A;  5K36 B;  2BR2 A;  5JEA D;  5C0X D;  2JEB B;  2JE6 A;  5K36 D;  3L7Z A;  2JE6 B;  1OYR A;  1E3H A;  4OO1 C;  3H1C A;  4IFD A;  4BA2 A;  4OO1 B;  2PO2 A;  4NBQ A;  3M85 G;  1OYS A;  1UDQ A;  4OO1 D;  2NN6 E;  4IFD D;  4AM3 A;  2JEB A;  3GME A;  1OYP A;  3DD6 A;  2NN6 F;  3U1K A;  2C37 A;  3CDI A;  2BA1 G;  4OO1 A;  2C37 B;  4BA1 B;  2NN6 C;  5JEA E;  1UDN A;  5C0X E;  2NN6 B;  4AIM A;  5K36 E;  3GCM A;  2BA0 G;  5JEA F;  5C0X F;  2PO1 A;  2PO0 B;  3M7N G;  1E3P A;  3M85 D;  2PNZ B;  2PO1 B;  5K36 F;  2C39 B;  2JEA B;  2WP8 B;  4BA1 A; 
#chains in the Genus database with same CATH topology
 3P3E A;  2BV3 A;  2Z5C B;  2O1T A;  4Z7Y A;  1HNW I;  2AE8 A;  4B3R E;  1DAR A;  2NN6 A;  4LF8 I;  1ZXM A;  1RR9 A;  1YHC A;  1I94 I;  1XMO I;  1NHJ A;  3JAM Q;  2LJP A;  2UUA E;  1FWK A;  4MYT A;  1UDO A;  2PNZ A;  4GKJ E;  4JI2 I;  2UXC I;  2VQF I;  5LMU I;  3CDJ A;  4AQY E;  1EI1 A;  4DV3 E;  4IZJ B;  4B3S E;  4IFD C;  1XMQ I;  4URL A;  4Z7C A;  4YY3 E;  1HNZ I;  2CG9 A;  5DRQ A;  1MG7 A;  2BA0 D;  1XNQ E;  4QNK A;  2UXB I;  2Z5C A;  3ZKD A;  5DNL A;  1KIJ A;  2DEJ A;  1R6L A;  3M7N D;  4ED4 A;  4B3M E;  2PO2 B;  2A2C A;  1U2R A;  4N3O A;  5K36 B;  5JEA D;  4DUY I;  1VIS A;  3J81 C;  5C0X D;  4MU1 A;  2JEB B;  4OKG A;  3M6A A;  4X64 I;  4IZJ A;  1Z0C A;  2JE6 B;  1E3H A;  5DRR A;  4JI8 I;  1ZM9 A;  4X66 I;  4LF4 I;  4ISA A;  2IER A;  4DR6 I;  4KHP E;  1BKN A;  4JV5 I;  5IT9 Q;  3B8H A;  4U3B A;  3OTO I;  2PNL A;  3H4L A;  1XXE A;  2VQE E;  2PO2 A;  4USM A;  1HNX I;  3M85 G;  1HR0 E;  4LF6 I;  1Z59 A;  1S4E A;  3QT7 A;  4XTJ A;  4OO1 D;  4IFD D;  2JEB A;  4FWD A;  2GO4 A;  1XNR E;  4JI0 I;  1IBL I;  4JI5 E;  4NXM E;  4LF9 I;  2BA1 G;  2UUB E;  1J5E I;  2CGE A;  3T1Y I;  4LFB E;  5JEA E;  3CWV A;  2UUC E;  5C0X E;  4PU9 A;  4FW6 A;  1IBK I;  1RRE A;  4DV1 E;  5JEA F;  1IBM E;  1KVK A;  5C0X F;  2J7K A;  2PO0 B;  4GKK E;  3M85 D;  3WU6 A;  2PO1 B;  2ZBK B;  4J3D A;  2C39 B;  2CZ9 A;  1H74 A;  2HK2 A;  4M1K A;  2WP8 B;  1FJG I;  2E5L E;  2IOQ A;  1OJ4 A;  4IFD E;  1H7U A;  3Q6N A;  3T1H I;  1Z0W A;  4X65 E;  2UU9 I;  5C0X B;  2AJ4 A;  2C38 B;  3WU5 A;  4OO1 F;  4IFD F;  3UHM A;  4RPF A;  5LMN I;  1N34 I;  2BA1 D;  2Z5E A;  3B78 A;  4LCG A;  3LTO A;  2PO0 A;  4DUZ E;  4DV2 E;  1FWL A;  4OX9 E;  3PYG A;  1N36 E;  4LF7 E;  4LFA I;  1Z0E A;  2C39 A;  1Z5A A;  4DR5 I;  2WP8 A;  3PYD A;  4UTG A;  1N33 E;  5JEA C;  5DNX A;  5DRP A;  1FKA E;  5C0X C;  4B3R I;  4IFD B;  5JEA A;  1UDS A;  4FW3 A;  4DR1 E;  2WNR A;  5C0X A;  2X7I A;  2C38 A;  4HXZ A;  2UUA I;  2HK3 A;  3HKM A;  2ZM6 E;  4JI1 E;  2HKJ A;  4DV0 E;  4GKJ I;  2CVE A;  4AQY I;  4X62 E;  4DV3 I;  4B3S I;  4IZK B;  4JI3 E;  4YY3 I;  1USU A;  1S16 A;  4OO1 C;  1XNQ I;  4LOM A;  1Z5C A;  1ZXN A;  2HKE A;  4MQY A;  4IFD A;  4JYA E;  5EKW A;  4DPY A;  4MYU A;  4B3M I;  4MU0 A;  1NHH A;  3J80 Q;  4FWH A;  2HHH E;  1B62 A;  2HFU A;  1OYS A;  1B63 A;  4PRX A;  3D4J A;  1XMO E;  3PRY A;  3GME A;  1FI4 A;  2V2V A;  4DR3 E;  2J65 A;  2PNM A;  3NZK A;  4IZK A;  3DD6 A;  5FLX Q;  4FWG A;  2UXC E;  5EL9 A;  5IWA E;  4KHP I;  5FWK A;  4DV5 E;  5DRO A;  2C37 A;  3CDI A;  2VQE I;  2VF3 A;  3JAM C;  4GQU A;  1HR0 I;  2GQ0 A;  4FW4 A;  3K1J A;  2R3V A;  1UDN A;  2BM1 A;  1D6T A;  4PRV A;  2UXD E;  4P52 A;  4JI7 E;  1MU5 A;  4LFC I;  4I3H A;  3HJC A;  2GO3 A;  1EA6 A;  1QZR A;  2ZIT A;  4LCF A;  1XNR I;  1N0U A;  4DR7 E;  1N32 E;  4MU3 A;  3P76 A;  3J80 C;  4DV6 E;  1Y5Y A;  4JI5 I;  4NXM I;  4DPW A;  2JEA B;  4JI8 E;  4FN5 A;  4MU4 A;  4WUB A;  4UT4 A;  2UUB I;  4LF4 E;  2O1W A;  4USK A;  4JV5 E;  1A6F A;  1Z0G A;  5GME A;  2UUC I;  4JI6 E;  2IOP A;  3PYE A;  2DEI A;  1HK7 A;  4DV1 I;  3GLL A;  2XEX A;  1Y4S A;  3QT8 A;  1NZ0 A;  2BM0 A;  4FW9 A;  2F4V E;  1IBM I;  2HFS A;  2BR2 B;  4GKK I;  5IT9 C;  1NHI A;  4EMD A;  4DV4 E;  2JEA A;  3PYF A;  2E5L I;  2Z5B B;  5BR8 E;  4IZJ D;  4ZVI A;  4LF9 E;  4X65 I;  4OO1 E;  5JEA B;  4HAC A;  1Z0V A;  2WNR B;  4DV7 I;  1H72 C;  1WUU A;  3ZKB A;  3KRN A;  4JI4 E;  2BR2 A;  4K0K E;  2A2D A;  4DUZ I;  2JT2 A;  4FW7 A;  1N36 I;  4LF7 I;  3K17 A;  5K36 D;  5LL6 R;  1OYR A;  1H73 A;  1ZM4 A;  3Q1Q A;  3K85 A;  2Z5B A;  3QT6 A;  4DR1 I;  1KKH A;  3WU4 A;  4OO1 B;  4DR4 E;  4NBQ A;  3LNU A;  2ZM6 I;  4IS9 A;  2Q2E B;  4LCH A;  4JI1 I;  4DR2 E;  4DU7 A;  2O3Z A;  4DV0 I;  5A2Q Q;  1YH8 A;  2E1R A;  4X62 I;  4YHH E;  3GON A;  4KQV A;  3V5R A;  4JI3 I;  3B82 A;  1FNM A;  5ELW A;  3U1K A;  4NXN E;  4JYA I;  3J81 Q;  4B3T E;  4MDT A;  2VES A;  4LF5 E;  4BA1 B;  2WW4 A;  2C37 B;  4OO1 A;  1PIE A;  2NN6 C;  2HHH I;  1ZM3 A;  1RHY A;  3QT5 A;  4HY1 A;  1HNW E;  2X36 A;  4U3D A;  4LF8 E;  5K36 E;  4DR3 I;  4DPX A;  1I94 E;  3GCM A;  3P3G A;  5L3J A;  3Q6M A;  4DXL A;  5IWA I;  2F1D A;  1E3P A;  4DV5 I;  5K36 F;  3P06 A;  3ZM7 A;  4JI2 E;  2VQF E;  5LMU E;  4BA1 A;  2OI2 A;  1PVG A;  1XMQ E;  5A2Q C;  4WUC A;  1HNZ E;  2NPF A;  2UXB E;  2UXD I;  4DPT A;  2GS8 A;  1UEK A;  4JI7 I;  1VI7 A;  2V34 A;  4DR7 I;  1N32 I;  4DUY E;  3B4T A;  1R6M A;  2NN6 D;  4DV6 I;  1Y4U A;  3WU3 A;  4AID A;  3HUL A;  3PS1 A;  3L7Z B;  1Z0B A;  4X64 E;  1N0V C;  1Y6Z A;  1P42 A;  4JG4 A;  1USV A;  1ZM2 A;  4X66 E;  4DR6 E;  4JI6 I;  4LFB I;  4BA2 B;  3OTO E;  3J7A M;  5K36 C;  2F4V I;  3ZZT A;  5FLX C;  5K36 A;  4HAC B;  2V8P A;  4R1F A;  1HNX E;  4LF6 E;  4LPF A;  1ELO A;  1Z0T A;  2R42 A;  2V2Q A;  4LFC E;  4DPU A;  1XHK A;  1Z5B A;  2JE6 A;  4DV4 I;  4FW5 A;  3L7Z A;  5BR8 I;  3LPS A;  3H1C A;  4JI0 E;  1IBL E;  4BA2 A;  3P3C A;  1J5E E;  3T1Y E;  3ZZU A;  1PKP A;  4JI4 I;  1UDQ A;  4K0K I;  2NN6 E;  3F0N A;  1IBK E;  4AM3 A;  3J7A G;  4HYM A;  4DV2 I;  4OX9 I;  1OYP A;  2NN6 F;  2O1V A;  1MX0 A;  1K47 A;  1N33 I;  2V2Z A;  4DR4 I;  1FJG E;  4QNJ A;  2O1U A;  4DR2 I;  3PS2 A;  3T1H E;  2NN6 B;  2UU9 E;  4DV7 E;  4YHH I;  1KTV A;  4AIM A;  3PS3 A;  4DU8 A;  1Y60 A;  2EFG A;  3ZZ0 A;  2BA0 G;  1H7S A;  5LMN E;  1N34 E;  4WUD A;  2PO1 A;  3M7N G;  4NXN I;  2PNZ B;  4OZE A;  3V2U C;  4B3T I;  3U1Y A;  2IES A;  4LF5 I;  4P7A A;  4LFA E;  5GMD A;  4DR5 E; 
#chains in the Genus database with same CATH homology
 4IFD E;  5C0X B;  2NN6 A;  2C38 B;  3GLL A;  4OO1 F;  4IFD F;  2BA1 D;  2BR2 B;  3B4T A;  1UDO A;  2PO0 A;  1R6M A;  2NN6 D;  2PNZ A;  3CDJ A;  4AID A;  2C39 A;  3L7Z B;  2JEA A;  4IFD C;  2WP8 A;  5JEA C;  2BA0 D;  5C0X C;  4IFD B;  5JEA A;  1R6L A;  1UDS A;  3M7N D;  4BA2 B;  4OO1 E;  2WNR A;  5JEA B;  5C0X A;  5K36 C;  2PO2 B;  2C38 A;  2WNR B;  5K36 A;  3HKM A;  3KRN A;  5K36 B;  2BR2 A;  5JEA D;  5C0X D;  2JEB B;  2JE6 A;  5K36 D;  3L7Z A;  2JE6 B;  1OYR A;  1E3H A;  4OO1 C;  3H1C A;  4IFD A;  4BA2 A;  4OO1 B;  2PO2 A;  4NBQ A;  3M85 G;  1OYS A;  1UDQ A;  4OO1 D;  2NN6 E;  4IFD D;  4AM3 A;  2JEB A;  3GME A;  1OYP A;  3DD6 A;  2NN6 F;  3U1K A;  2C37 A;  3CDI A;  2BA1 G;  4OO1 A;  2C37 B;  4BA1 B;  2NN6 C;  5JEA E;  1UDN A;  5C0X E;  2NN6 B;  4AIM A;  5K36 E;  3GCM A;  2BA0 G;  5JEA F;  5C0X F;  2PO1 A;  2PO0 B;  3M7N G;  1E3P A;  3M85 D;  2PNZ B;  2PO1 B;  5K36 F;  2C39 B;  2JEA B;  2WP8 B;  4BA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...