2NN6B

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
235
Chain Sequence
b'LSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVREASI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
molecule tags Hydrolase/transferase
source organism Homo sapiens
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
total genus 56
structure length 235
sequence length 235
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01138 RNase_PH 3' exoribonuclease family, domain 1
B PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2nn6B01
2NN6D 5K36E 3B4TA 4OO1B 2WP8B 2BA1D 5JEAE 3GMEA 4BA2A 2C38A 3HKMA 4NBQA 5C0XB 3M85G 2PO0B 2BA0D 2JE6A 2NN6C 3CDIA 3L7ZB 3GCMA 2C39B 2NN6A 4IFDF 2BA1G 4OO1A 3CDJA 2PNZB 4AM3A 4IFDA 4BA1B 2PO2B 1OYSA 5JEAC 5C0XE 5K36C 2JEAA 4AIMA 2C38B 2C37A 3L7ZA 4OO1C 4IFDD 1UDSA 5C0XF 1R6MA 3M85D 4IFDB 2BA0G 2JEBB 4AIDA 2BR2B 5C0XC 2PO1A 4IFDE 3M7ND 1UDNA 2PO0A 4OO1D 2C39A 3KRNA 5C0XD 3GLLA 2JEBA 1E3PA 5JEAF 1UDQA 4BA1A 1R6LA 2PO1B 5JEAA 2WNRA 1E3HA 2JE6B 3DD6A 1OYPA 5K36A 5K36F 2C37B 4OO1F 3M7NG 2NN6B 2NN6F 2PNZA 4IFDC 1OYRA 2WP8A 2PO2A 3H1CA 5JEAD 2JEAB 1UDOA 2WNRB 5JEAB 2BR2A 5K36B 4BA2B 5C0XA 2NN6E 5K36D 3U1KA 4OO1E
chains in the Genus database with same CATH superfamily
4DR7E 3LPSA 1HR0E 4IZJA 5IWAE 3J7AG 2NN6D 1IBKI 1K47A 4HACA 5LL6R 2ZBKB 2HFUA 4M1KA 1IBLE 2DEIA 1N32E 2IOPA 1KVKA 3B78A 1ZM2A 4LCGA 1IBKE 1HR0I 4J3DA 5C0XB 2PO0B 2BA0D 2GO3A 1N32I 4ZVIA 2DEJA 4B3MI 3PYGA 2V2ZA 4MU1A 4IFDF 2BA1G 3OTOE 4LPFA 1U2RA 3F0NA 1D6TA 4BA1B 5DNXA 1OYSA 4DR4E 4B3TI 2A2CA 1XNQI 4IZKB 5BR8I 2C37A 1ZM3A 2HKJA 3LTOA 3HULA 1HNXE 4PRVA 1RHYA 4DV1I 4MQYA 2UUAI 2BV3A 5DRRA 4IFDD 1Z0EA 2CZ9A 1DARA 1Y4SA 4R1FA 3M85D 3K17A 2VESA 4X64I 4OZEA 3ZM7A 2UUCI 1XMOI 4KHPE 4QNKA 1Y6ZA 3WU4A 4JI5E 1UDNA 2Z5CB 2ZM6E 4JYAE 4DV6I 4OO1D 4GKJE 1EA6A 4JI5I 4DR3I 4JV5I 1H73A 2HK3A 1H7UA 1UEKA 4FWHA 4X65I 3QT6A 4NXNE 3WU3A 4P7AA 3PS2A 4DV5I 1R6LA 3D4JA 4MU4A 5DROA 2PO1B 2VQEE 4DV1E 2V8PA 1IBME 1Z0CA 5K36A 1Z59A 4DUYE 1Z0VA 4JG4A 3J80Q 4OO1F 5BR8E 3M7NG 4DXLA 2O1TA 5GMEA 2PNZA 5FLXQ 1XNQE 2AJ4A 2JT2A 2WP8A 1N36E 3B8HA 3Q1QA 4DPWA 4HXZA 3OTOI 3ZZ0A 3U1YA 4B3ME 1FWLA 4FW4A 4AIMA 4X65E 1N34I 3K1JA 4LF6E 5IT9Q 3B4TA 3M6AA 2HFSA 4OO1B 2Z5EA 2WP8B 2BA1D 1N34E 4FWDA 4JYAI 3T1YE 1Z0BA 4JI0E 3J80C 1N0VC 4LF8E 3PYEA 2R42A 4DPYA 4JV5E 1XMOE 2C38A 1H74A 3M85G 4DV0E 2F4VE 4DR2E 4DR7I 2NN6C 3P76A 3WU6A 2A2DA 3L7ZB 4GKKE 2C39B 4KHPI 5LMUI 4FW5A 4OO1A 4LFCI 3ZKBA 4JI7I 4OX9I 4YY3E 2PNZB 1XHKA 2CGEA 2PO2B 5JEAC 3GONA 5K36C 2JEAA 1HNXI 5IT9C 3NZKA 2IOQA 4LFCE 1N33E 4ED4A 4MU0A 4HY1A 4DV6E 2V2VA 4DR2I 1FNMA 4GQUA 4RPFA 1FJGE 2BR2B 2IERA 4N3OA 4LOMA 4LF4E 2UUBE 4IFDE 3WU5A 1ZXNA 4DPTA 4FN5A 2UXDI 1H72C 2PNLA 3ZZTA 4LF5I 2Z5BA 2GO4A 2HKEA 2ZITA 4LFAI 4DPXA 1Z0TA 5GMDA 4X62I 2CG9A 2XEXA 1I94I 1HNWI 1B63A 4FW7A 2JEBA 4B3SE 5A2QC 4BA1A 1N0UA 1IBLI 3ZZUA 5JEAA 4YHHI 1Y4UA 4DUZE 1ZXMA 4I3HA 1OJ4A 3HJCA 3JAMQ 3PYDA 4DR6E 3K85A 1MG7A 2HK2A 2E5LE 2BM1A 2F1DA 5LMNI 4JI2E 2R3VA 4IFDC 1OYRA 4JI3E 3PS3A 3LNUA 1I94E 1XXEA 2V2QA 5FLXC 2O3ZA 4P52A 4NXNI 2UXBE 2NN6E 2VF3A 1ZM4A 3U1KA 4OO1E 2UXCE 1S4EA 2O1UA 4LF9I 4JI6E 4K0KE 5IWAI 4PRXA 5L3JA 2GQ0A 1Z5BA 2ZM6I 1NHHA 4USKA 5JEAE 4B3RI 4DR1I 1NHIA 1YH8A 4PU9A 1HNZE 1ZM9A 4LF9E 5DRQA 4NBQA 4DR5I 3QT5A 4X64E 2EFGA 3CDIA 1ELOA 4MYUA 4LCFA 2NN6A 4X66E 3CWVA 3CDJA 4JI4I 4AM3A 4IFDA 4LFBI 2UXBI 4QNJA 2J65A 5C0XE 1HK7A 3J81C 4UTGA 4JI3I 4DV2I 4DR6I 1RREA 4DR5E 2UU9E 1MU5A 2V34A 2HHHE 1P42A 3P3CA 4OO1C 2OI2A 1UDSA 4EMDA 1R6MA 4IFDB 1KTVA 2BM0A 2BA0G 2JEBB 4MDTA 2LJPA 1BKNA 1FWKA 4AIDA 3PRYA 1VISA 1XNRI 4MYTA 5DRPA 2PO1A 2O1VA 3Q6NA 2PO0A 2GS8A 4WUCA 4LF4I 4IS9A 2IESA 3KRNA 3QT8A 1J5EE 2CVEA 1E3PA 4DU7A 2UUBI 3J7AM 4JI6I 2WNRA 1FI4A 1H7SA 2JE6B 4NXMI 4DV4E 3QT7A 4JI4E 5A2QQ 2C37B 1IBMI 4AQYI 1KKHA 1NHJA 4DUZI 4JI8E 4WUDA 4Z7YA 4AQYE 3P3GA 1NZ0A 4FW6A 4JI1I 2PO2A 1EI1A 4DV4I 2PNMA 1UDOA 4JI7E 4OX9E 5LMNE 4JI2I 4IZKA 2WNRB 5DNLA 2BR2A 5LMUE 4X66I 4JI8I 4DR3E 4U3DA 4BA2B 4MU3A 4GKKI 1PKPA 3T1HI 5K36D 1J5EI 4DU8A 5K36E 4USMA 3T1YI 1HNZI 4JI0I 4LF8I 3J81Q 1QZRA 2Q2EB 3T1HE 4FW3A 1S16A 4DV0I 2J7KA 4X62E 4K0KI 4URLA 3GMEA 2UUCE 4BA2A 3HKMA 4LF6I 4LFAE 1VI7A 2Z5BB 4LCHA 2JE6A 4LF7E 3H4LA 3UHMA 3GCMA 3JAMC 4FWGA 4OKGA 1XNRE 4B3TE 1Y60A 4DV3E 4HYMA 2X7IA 4U3BA 3V5RA 1WUUA 4NXME 4XTJA 4IZJD 2UU9I 2C38B 3ZKDA 4B3SI 4LFBE 3Q6MA 4DV3I 3L7ZA 3V2UC 1Z5AA 1Z0WA 4DV5E 4YHHE 4HACB 1YHCA 5FWKA 4LF7I 5C0XF 4LF5E 1Z0GA 1PVGA 2E1RA 2VQFE 4DUYI 1HNWE 1USUA 1PIEA 3B82A 5C0XC 4Z7CA 2O1WA 1FJGI 2NPFA 1KIJA 3PS1A 4IZJB 3P3EA 2UXDE 2HHHI 1USVA 5ELWA 2C39A 4DV2E 4GKJI 5C0XD 3GLLA 1N36I 5JEAF 3P06A 1RR9A 1UDQA 2WW4A 4DPUA 1FKAE 2UUAE 3PYFA 1E3HA 4KQVA 1N33I 2UXCI 3DD6A 1OYPA 4DV7I 2Z5CA 4WUBA 1XMQI 4JI1E 5K36F 1MX0A 2VQFI 4UT4A 1Y5YA 2NN6B 2NN6F 2VQEI 4DR4I 4FW9A 1A6FA 4DV7E 1XMQE 4YY3I 2AE8A 2X36A 3H1CA 5EL9A 5JEAD 2JEAB 1Z5CA 4ISAA 5JEAB 1B62A 5EKWA 2E5LI 4DR1E 5K36B 5C0XA 4B3RE 3M7ND 2F4VI
chains in the Genus database with same CATH topology
2NN6D 5K36E 3B4TA 4OO1B 2WP8B 2BA1D 5JEAE 3GMEA 4BA2A 2C38A 3HKMA 4NBQA 5C0XB 3M85G 2PO0B 2BA0D 2JE6A 2NN6C 3CDIA 3L7ZB 3GCMA 2C39B 2NN6A 4IFDF 2BA1G 4OO1A 3CDJA 2PNZB 4AM3A 4IFDA 4BA1B 2PO2B 1OYSA 5JEAC 5C0XE 5K36C 2JEAA 4AIMA 2C38B 2C37A 3L7ZA 4OO1C 4IFDD 1UDSA 5C0XF 1R6MA 3M85D 4IFDB 2BA0G 2JEBB 4AIDA 2BR2B 5C0XC 2PO1A 4IFDE 3M7ND 1UDNA 2PO0A 4OO1D 2C39A 3KRNA 5C0XD 3GLLA 2JEBA 1E3PA 5JEAF 1UDQA 4BA1A 1R6LA 2PO1B 5JEAA 2WNRA 1E3HA 2JE6B 3DD6A 1OYPA 5K36A 5K36F 2C37B 4OO1F 3M7NG 2NN6B 2NN6F 2PNZA 4IFDC 1OYRA 2WP8A 2PO2A 3H1CA 5JEAD 2JEAB 1UDOA 2WNRB 5JEAB 2BR2A 5K36B 4BA2B 5C0XA 2NN6E 5K36D 3U1KA 4OO1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 D;  5K36 E;  3B4T A;  4OO1 B;  2WP8 B;  2BA1 D;  5JEA E;  3GME A;  4BA2 A;  2C38 A;  3HKM A;  4NBQ A;  5C0X B;  3M85 G;  2PO0 B;  2BA0 D;  2JE6 A;  2NN6 C;  3CDI A;  3L7Z B;  3GCM A;  2C39 B;  2NN6 A;  4IFD F;  2BA1 G;  4OO1 A;  3CDJ A;  2PNZ B;  4AM3 A;  4IFD A;  4BA1 B;  2PO2 B;  1OYS A;  5JEA C;  5C0X E;  5K36 C;  2JEA A;  4AIM A;  2C38 B;  2C37 A;  3L7Z A;  4OO1 C;  4IFD D;  1UDS A;  5C0X F;  1R6M A;  3M85 D;  4IFD B;  2BA0 G;  2JEB B;  4AID A;  2BR2 B;  5C0X C;  2PO1 A;  4IFD E;  3M7N D;  1UDN A;  2PO0 A;  4OO1 D;  2C39 A;  3KRN A;  5C0X D;  3GLL A;  2JEB A;  1E3P A;  5JEA F;  1UDQ A;  4BA1 A;  1R6L A;  2PO1 B;  5JEA A;  2WNR A;  1E3H A;  2JE6 B;  3DD6 A;  1OYP A;  5K36 A;  5K36 F;  2C37 B;  4OO1 F;  3M7N G;  2NN6 B;  2NN6 F;  2PNZ A;  4IFD C;  1OYR A;  2WP8 A;  2PO2 A;  3H1C A;  5JEA D;  2JEA B;  1UDO A;  2WNR B;  5JEA B;  2BR2 A;  5K36 B;  4BA2 B;  5C0X A;  2NN6 E;  5K36 D;  3U1K A;  4OO1 E; 
#chains in the Genus database with same CATH topology
 4DR7 E;  3LPS A;  1HR0 E;  4IZJ A;  5IWA E;  3J7A G;  2NN6 D;  1IBK I;  1K47 A;  4HAC A;  5LL6 R;  2ZBK B;  2HFU A;  4M1K A;  1IBL E;  2DEI A;  1N32 E;  2IOP A;  1KVK A;  3B78 A;  1ZM2 A;  4LCG A;  1IBK E;  1HR0 I;  4J3D A;  5C0X B;  2PO0 B;  2BA0 D;  2GO3 A;  1N32 I;  4ZVI A;  2DEJ A;  4B3M I;  3PYG A;  2V2Z A;  4MU1 A;  4IFD F;  2BA1 G;  3OTO E;  4LPF A;  1U2R A;  3F0N A;  1D6T A;  4BA1 B;  5DNX A;  1OYS A;  4DR4 E;  4B3T I;  2A2C A;  1XNQ I;  4IZK B;  5BR8 I;  2C37 A;  1ZM3 A;  2HKJ A;  3LTO A;  3HUL A;  1HNX E;  4PRV A;  1RHY A;  4DV1 I;  4MQY A;  2UUA I;  2BV3 A;  5DRR A;  4IFD D;  1Z0E A;  2CZ9 A;  1DAR A;  1Y4S A;  4R1F A;  3M85 D;  3K17 A;  2VES A;  4X64 I;  4OZE A;  3ZM7 A;  2UUC I;  1XMO I;  4KHP E;  4QNK A;  1Y6Z A;  3WU4 A;  4JI5 E;  1UDN A;  2Z5C B;  2ZM6 E;  4JYA E;  4DV6 I;  4OO1 D;  4GKJ E;  1EA6 A;  4JI5 I;  4DR3 I;  4JV5 I;  1H73 A;  2HK3 A;  1H7U A;  1UEK A;  4FWH A;  4X65 I;  3QT6 A;  4NXN E;  3WU3 A;  4P7A A;  3PS2 A;  4DV5 I;  1R6L A;  3D4J A;  4MU4 A;  5DRO A;  2PO1 B;  2VQE E;  4DV1 E;  2V8P A;  1IBM E;  1Z0C A;  5K36 A;  1Z59 A;  4DUY E;  1Z0V A;  4JG4 A;  3J80 Q;  4OO1 F;  5BR8 E;  3M7N G;  4DXL A;  2O1T A;  5GME A;  2PNZ A;  5FLX Q;  1XNQ E;  2AJ4 A;  2JT2 A;  2WP8 A;  1N36 E;  3B8H A;  3Q1Q A;  4DPW A;  4HXZ A;  3OTO I;  3ZZ0 A;  3U1Y A;  4B3M E;  1FWL A;  4FW4 A;  4AIM A;  4X65 E;  1N34 I;  3K1J A;  4LF6 E;  5IT9 Q;  3B4T A;  3M6A A;  2HFS A;  4OO1 B;  2Z5E A;  2WP8 B;  2BA1 D;  1N34 E;  4FWD A;  4JYA I;  3T1Y E;  1Z0B A;  4JI0 E;  3J80 C;  1N0V C;  4LF8 E;  3PYE A;  2R42 A;  4DPY A;  4JV5 E;  1XMO E;  2C38 A;  1H74 A;  3M85 G;  4DV0 E;  2F4V E;  4DR2 E;  4DR7 I;  2NN6 C;  3P76 A;  3WU6 A;  2A2D A;  3L7Z B;  4GKK E;  2C39 B;  4KHP I;  5LMU I;  4FW5 A;  4OO1 A;  4LFC I;  3ZKB A;  4JI7 I;  4OX9 I;  4YY3 E;  2PNZ B;  1XHK A;  2CGE A;  2PO2 B;  5JEA C;  3GON A;  5K36 C;  2JEA A;  1HNX I;  5IT9 C;  3NZK A;  2IOQ A;  4LFC E;  1N33 E;  4ED4 A;  4MU0 A;  4HY1 A;  4DV6 E;  2V2V A;  4DR2 I;  1FNM A;  4GQU A;  4RPF A;  1FJG E;  2BR2 B;  2IER A;  4N3O A;  4LOM A;  4LF4 E;  2UUB E;  4IFD E;  3WU5 A;  1ZXN A;  4DPT A;  4FN5 A;  2UXD I;  1H72 C;  2PNL A;  3ZZT A;  4LF5 I;  2Z5B A;  2GO4 A;  2HKE A;  2ZIT A;  4LFA I;  4DPX A;  1Z0T A;  5GMD A;  4X62 I;  2CG9 A;  2XEX A;  1I94 I;  1HNW I;  1B63 A;  4FW7 A;  2JEB A;  4B3S E;  5A2Q C;  4BA1 A;  1N0U A;  1IBL I;  3ZZU A;  5JEA A;  4YHH I;  1Y4U A;  4DUZ E;  1ZXM A;  4I3H A;  1OJ4 A;  3HJC A;  3JAM Q;  3PYD A;  4DR6 E;  3K85 A;  1MG7 A;  2HK2 A;  2E5L E;  2BM1 A;  2F1D A;  5LMN I;  4JI2 E;  2R3V A;  4IFD C;  1OYR A;  4JI3 E;  3PS3 A;  3LNU A;  1I94 E;  1XXE A;  2V2Q A;  5FLX C;  2O3Z A;  4P52 A;  4NXN I;  2UXB E;  2NN6 E;  2VF3 A;  1ZM4 A;  3U1K A;  4OO1 E;  2UXC E;  1S4E A;  2O1U A;  4LF9 I;  4JI6 E;  4K0K E;  5IWA I;  4PRX A;  5L3J A;  2GQ0 A;  1Z5B A;  2ZM6 I;  1NHH A;  4USK A;  5JEA E;  4B3R I;  4DR1 I;  1NHI A;  1YH8 A;  4PU9 A;  1HNZ E;  1ZM9 A;  4LF9 E;  5DRQ A;  4NBQ A;  4DR5 I;  3QT5 A;  4X64 E;  2EFG A;  3CDI A;  1ELO A;  4MYU A;  4LCF A;  2NN6 A;  4X66 E;  3CWV A;  3CDJ A;  4JI4 I;  4AM3 A;  4IFD A;  4LFB I;  2UXB I;  4QNJ A;  2J65 A;  5C0X E;  1HK7 A;  3J81 C;  4UTG A;  4JI3 I;  4DV2 I;  4DR6 I;  1RRE A;  4DR5 E;  2UU9 E;  1MU5 A;  2V34 A;  2HHH E;  1P42 A;  3P3C A;  4OO1 C;  2OI2 A;  1UDS A;  4EMD A;  1R6M A;  4IFD B;  1KTV A;  2BM0 A;  2BA0 G;  2JEB B;  4MDT A;  2LJP A;  1BKN A;  1FWK A;  4AID A;  3PRY A;  1VIS A;  1XNR I;  4MYT A;  5DRP A;  2PO1 A;  2O1V A;  3Q6N A;  2PO0 A;  2GS8 A;  4WUC A;  4LF4 I;  4IS9 A;  2IES A;  3KRN A;  3QT8 A;  1J5E E;  2CVE A;  1E3P A;  4DU7 A;  2UUB I;  3J7A M;  4JI6 I;  2WNR A;  1FI4 A;  1H7S A;  2JE6 B;  4NXM I;  4DV4 E;  3QT7 A;  4JI4 E;  5A2Q Q;  2C37 B;  1IBM I;  4AQY I;  1KKH A;  1NHJ A;  4DUZ I;  4JI8 E;  4WUD A;  4Z7Y A;  4AQY E;  3P3G A;  1NZ0 A;  4FW6 A;  4JI1 I;  2PO2 A;  1EI1 A;  4DV4 I;  2PNM A;  1UDO A;  4JI7 E;  4OX9 E;  5LMN E;  4JI2 I;  4IZK A;  2WNR B;  5DNL A;  2BR2 A;  5LMU E;  4X66 I;  4JI8 I;  4DR3 E;  4U3D A;  4BA2 B;  4MU3 A;  4GKK I;  1PKP A;  3T1H I;  5K36 D;  1J5E I;  4DU8 A;  5K36 E;  4USM A;  3T1Y I;  1HNZ I;  4JI0 I;  4LF8 I;  3J81 Q;  1QZR A;  2Q2E B;  3T1H E;  4FW3 A;  1S16 A;  4DV0 I;  2J7K A;  4X62 E;  4K0K I;  4URL A;  3GME A;  2UUC E;  4BA2 A;  3HKM A;  4LF6 I;  4LFA E;  1VI7 A;  2Z5B B;  4LCH A;  2JE6 A;  4LF7 E;  3H4L A;  3UHM A;  3GCM A;  3JAM C;  4FWG A;  4OKG A;  1XNR E;  4B3T E;  1Y60 A;  4DV3 E;  4HYM A;  2X7I A;  4U3B A;  3V5R A;  1WUU A;  4NXM E;  4XTJ A;  4IZJ D;  2UU9 I;  2C38 B;  3ZKD A;  4B3S I;  4LFB E;  3Q6M A;  4DV3 I;  3L7Z A;  3V2U C;  1Z5A A;  1Z0W A;  4DV5 E;  4YHH E;  4HAC B;  1YHC A;  5FWK A;  4LF7 I;  5C0X F;  4LF5 E;  1Z0G A;  1PVG A;  2E1R A;  2VQF E;  4DUY I;  1HNW E;  1USU A;  1PIE A;  3B82 A;  5C0X C;  4Z7C A;  2O1W A;  1FJG I;  2NPF A;  1KIJ A;  3PS1 A;  4IZJ B;  3P3E A;  2UXD E;  2HHH I;  1USV A;  5ELW A;  2C39 A;  4DV2 E;  4GKJ I;  5C0X D;  3GLL A;  1N36 I;  5JEA F;  3P06 A;  1RR9 A;  1UDQ A;  2WW4 A;  4DPU A;  1FKA E;  2UUA E;  3PYF A;  1E3H A;  4KQV A;  1N33 I;  2UXC I;  3DD6 A;  1OYP A;  4DV7 I;  2Z5C A;  4WUB A;  1XMQ I;  4JI1 E;  5K36 F;  1MX0 A;  2VQF I;  4UT4 A;  1Y5Y A;  2NN6 B;  2NN6 F;  2VQE I;  4DR4 I;  4FW9 A;  1A6F A;  4DV7 E;  1XMQ E;  4YY3 I;  2AE8 A;  2X36 A;  3H1C A;  5EL9 A;  5JEA D;  2JEA B;  1Z5C A;  4ISA A;  5JEA B;  1B62 A;  5EKW A;  2E5L I;  4DR1 E;  5K36 B;  5C0X A;  4B3R E;  3M7N D;  2F4V I; 
#chains in the Genus database with same CATH homology
 2NN6 D;  5K36 E;  3B4T A;  4OO1 B;  2WP8 B;  2BA1 D;  5JEA E;  3GME A;  4BA2 A;  2C38 A;  3HKM A;  4NBQ A;  5C0X B;  3M85 G;  2PO0 B;  2BA0 D;  2JE6 A;  2NN6 C;  3CDI A;  3L7Z B;  3GCM A;  2C39 B;  2NN6 A;  4IFD F;  2BA1 G;  4OO1 A;  3CDJ A;  2PNZ B;  4AM3 A;  4IFD A;  4BA1 B;  2PO2 B;  1OYS A;  5JEA C;  5C0X E;  5K36 C;  2JEA A;  4AIM A;  2C38 B;  2C37 A;  3L7Z A;  4OO1 C;  4IFD D;  1UDS A;  5C0X F;  1R6M A;  3M85 D;  4IFD B;  2BA0 G;  2JEB B;  4AID A;  2BR2 B;  5C0X C;  2PO1 A;  4IFD E;  3M7N D;  1UDN A;  2PO0 A;  4OO1 D;  2C39 A;  3KRN A;  5C0X D;  3GLL A;  2JEB A;  1E3P A;  5JEA F;  1UDQ A;  4BA1 A;  1R6L A;  2PO1 B;  5JEA A;  2WNR A;  1E3H A;  2JE6 B;  3DD6 A;  1OYP A;  5K36 A;  5K36 F;  2C37 B;  4OO1 F;  3M7N G;  2NN6 B;  2NN6 F;  2PNZ A;  4IFD C;  1OYR A;  2WP8 A;  2PO2 A;  3H1C A;  5JEA D;  2JEA B;  1UDO A;  2WNR B;  5JEA B;  2BR2 A;  5K36 B;  4BA2 B;  5C0X A;  2NN6 E;  5K36 D;  3U1K A;  4OO1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...