2NN6B

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
235
Chain Sequence
LSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVREASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 56
structure length 235
sequence length 235
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01138 RNase_PH 3' exoribonuclease family, domain 1
B PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2nn6B01
3B4TA 4AM3A 4BA2A 2NN6B 4OO1B 2NN6F 2NN6A 4OO1F 4OO1A 1UDSA 2JEBB 4NBQA 2PO2B 5K36B 2NN6D 4OO1D 5K36A 5K36D 3M85G 2BR2B 5C0XB 5JEAC 5C0XF 5C0XA 5JEAF 5C0XD 2JEAA 3M7ND 2WNRA 5JEAE 2BA0G 2PO1B 1OYPA 2BA1G 1R6MA 1UDNA 2NN6C 4OO1C 2PO0B 1UDOA 4IFDB 5K36C 2PNZB 2C37B 2PO0A 4IFDA 4IFDF 2PNZA 2JEBA 2C37A 2NN6E 2PO2A 3U1KA 4IFDD 4OO1E 5K36F 5C0XC 2BR2A 1OYSA 5C0XE 3CDJA 3M7NG 4BA1B 2PO1A 3L7ZB 2WP8B 3L7ZA 2WP8A 1E3PA 4IFDC 3HKMA 4IFDE 5K36E 2C39B 4AIDA 2C39A 3DD6A 3GLLA 3H1CA 4AIMA 2C38B 2C38A 3CDIA 2BA1D 3GCMA 4BA2B 1R6LA 4BA1A 3GMEA 3M85D 2JE6B 2JE6A 1UDQA 3KRNA 5JEAB 2JEAB 5JEAA 2WNRB 2BA0D 5JEAD 1OYRA 1E3HA
chains in the Genus database with same CATH superfamily
2VQFE 2UUAI 2E1RA 3J81Q 4JI5I 1HR0E 2HK2A 2NN6A 4OO1A 1IBKE 4P7AA 4DR2I 4DR6I 5K36A 4LF6E 4LCGA 4HACA 3PYEA 2HHHI 4FW5A 4WUCA 4USKA 4DR4I 1S16A 5JEAC 1KVKA 1FI4A 4DR5E 3U1YA 5C0XD 2DEJA 4MYTA 5BR8I 3J7AM 5LMUI 3M7ND 1N33E 4DV6I 2PO1B 4X64E 1VISA 1HNZI 2UXDI 3PYFA 5L3JA 2O1TA 2PNZB 4DV4I 2C37B 4IFDF 5K36F 4X62E 2UXBI 1ZM4A 4X65E 4AQYI 2HKEA 3LTOA 4DV7I 3P76A 4FW6A 5C0XC 1I94I 4GKJI 1S4EA 3OTOI 4DUYI 1XNRI 1H74A 2AE8A 3PS1A 4LF5I 1KIJA 2V8PA 3M7NG 4Z7YA 4HYMA 4DU8A 4LF8I 2PO1A 1USVA 2IESA 2ZITA 1H72C 3V2UC 4LFBI 4MDTA 1Y6ZA 3GONA 5EL9A 2WP8A 1E3PA 1U2RA 4JI2E 2V34A 2UXCI 4IZJD 4JI4I 4FW3A 4IZKA 1XMQI 4DV0I 4IFDE 5DROA 4FW4A 5K36E 2C39B 5DNXA 3T1HE 4OZEA 4GKKI 2HFSA 2C38B 4DV1I 1XNQI 4KHPI 4NXNE 4DPUA 3ZKBA 4FWHA 1Z0EA 2BV3A 1ZM9A 2Z5EA 2HHHE 3HULA 3PYGA 4DR4E 2JE6A 1Z0BA 1MG7A 5BR8E 4MU1A 2JEAB 5LMUE 4LF7I 2Q2EB 4DV6E 2V2QA 1Y4SA 4OKGA 4FN5A 1H7SA 1MU5A 1HNZE 3B4TA 4NXMI 2UXDE 4QNKA 4DV5E 4B3MI 1EI1A 5DRQA 1Y5YA 4DV4E 1H7UA 2NN6B 3WU6A 4OO1B 2UXBE 2JEBB 4NBQA 5K36B 4AQYE 3WU5A 1Z5BA 2UU9E 4GKJE 3OTOE 4DUYE 1XNRE 1PIEA 5C0XF 4LF5E 1A6FA 4PRXA 2JEAA 5JEAE 1NHHA 1PVGA 3PRYA 2IOPA 4LFBE 4JV5I 2Z5BB 1ZXNA 5DNLA 2CVEA 3K17A 2UXCE 1HNWI 4JI7I 1XMQE 2PO0A 4DV0E 4IFDA 2JEBA 3U1KA 4GKKE 4YHHI 4DV1E 1XNQE 4JI6E 2CZ9A 3P06A 1KTVA 1N34I 4U3DA 4FWDA 5C0XE 3CDJA 4BA1B 5IWAI 3PS3A 4LF9I 3B82A 3K1JA 2WP8B 2Z5BA 3L7ZA 5ELWA 4JI0I 3ZZ0A 5A2QC 2XEXA 3HKMA 1Y60A 4IZKB 1PKPA 3QT8A 3T1YI 2F4VI 4LF7E 4GQUA 2GS8A 3H1CA 3QT5A 4B3SI 4I3HA 1N32I 2ZM6I 1IBLI 4NXME 2BA1D 3K85A 4B3ME 1FWKA 2O1UA 5DRPA 4JYAI 2UUBI 1B63A 4HY1A 4BA1A 1Z0TA 2O1VA 2GO3A 2X36A 2JE6B 4DPTA 1J5EI 1FKAE 2HK3A 5FLXC 1Z0VA 1WUUA 4DPWA 5JEAA 2BA0D 4LF4I 4JV5E 1OYRA 2UUAE 1E3HA 1ZXMA 4JI5E 4B3RI 2X7IA 2GQ0A 4DR7I 1OJ4A 1HNWE 4B3TI 1P42A 4DR2E 4DR6E 1ZM2A 4K0KI 2VESA 2PO2B 1N36I 2NN6D 4YHHE 4DXLA 4OO1D 1IBKI 5K36D 3ZZTA 4LFCI 4LF6I 1BKNA 4OX9I 2DEIA 5C0XA 5JEAF 3JAMC 3PS2A 1IBMI 5IWAE 4DV2I 2BA0G 3WU3A 3P3CA 1HNXI 4LF9E 1N33I 2CGEA 3F0NA 5IT9C 1NHJA 4URLA 4X64I 4JI0E 1UDNA 2NN6C 4MU3A 4OO1C 1USUA 3T1YE 2PO0B 1UDOA 1Z5CA 4IFDB 5K36C 2F4VE 2GO4A 2J65A 2PO2A 4JG4A 2VQEI 4DV7E 1N0VC 2V2ZA 1KKHA 4X62I 2ZM6E 1I94E 1IBLE 5A2QQ 4FW9A 4DR3I 2PNMA 1OYSA 2BM1A 3Q6NA 4JYAE 4LF8E 1B62A 5LL6R 1XXEA 2UUCI 4JI8I 1EA6A 2O3ZA 4X66I 4LFAI 3L7ZB 2E5LI 4JI4E 4IZJA 4DPXA 4JI1I 3B8HA 2F1DA 1FJGI 3P3GA 4KQVA 1DARA 4LF4E 4AIMA 1VI7A 3DD6A 4KHPE 3T1HI 4P52A 3CDIA 5FLXQ 4B3RE 4NXNI 4DR7E 1N0UA 4B3TE 3V5RA 4BA2B 1R6LA 1MX0A 4K0KE 1N36E 5EKWA 1FNMA 3H4LA 3M6AA 4RPFA 4LCHA 1XMOI 3D4JA 3GMEA 3NZKA 3LPSA 4LCFA 4LFCE 3M85D 4EMDA 4U3BA 2R42A 5GMDA 3ZKDA 4ISAA 4OX9E 3J80C 1NZ0A 1RHYA 2A2CA 2A2DA 1UDQA 3KRNA 2CG9A 3UHMA 1IBME 5JEAB 4MU0A 2WW4A 4DV2E 2WNRB 1Z0WA 4LPFA 4UT4A 3ZZUA 1HNXE 4YY3I 4DU7A 1Z0GA 4DV3I 2PNLA 4AM3A 3JAMQ 2J7KA 4DV5I 4BA2A 4J3DA 4MQYA 4DR1I 2NN6F 3WU4A 4OO1F 4FW7A 1UDSA 1YH8A 3QT7A 4WUDA 2VQEE 5IT9Q 5DRRA 4HXZA 3M85G 3LNUA 2EFGA 4DR3E 2BR2B 4R1FA 2UU9I 5C0XB 3ZM7A 1NHIA 2JT2A 4DUZI 3J81C 2WNRA 3Q6MA 2V2VA 4WUBA 2IOQA 4ZVIA 4JI8E 2UUCE 4JI3I 1Z0CA 1OYPA 4X66E 1XHKA 4LFAE 2BA1G 2Z5CB 5LMNI 2E5LE 1R6MA 4MYUA 4JI7E 2VQFI 4JI1E 4LOMA 3P3EA 2O1WA 1FJGE 1RREA 3HJCA 1HR0I 3B78A 2PNZA 2C37A 2NN6E 4IFDD 4OO1E 3PYDA 4IS9A 2AJ4A 2BM0A 1N34E 4XTJA 1RR9A 3Q1QA 4JI6I 2BR2A 4FWGA 4DR5I 3QT6A 3CWVA 2R3VA 4DPYA 1XMOE 2NPFA 4ED4A 2Z5CA 1ZM3A 4IZJB 4N3OA 4IFDC 4PRVA 1UEKA 1HK7A 4B3SE 1N32E 1QZRA 1FWLA 4AIDA 2C39A 4QNJA 3GLLA 4YY3E 1Z59A 4X65I 1D6TA 1ELOA 2C38A 5FWKA 2LJPA 2HKJA 1Y4UA 4DV3E 1H73A 3J80Q 3GCMA 1YHCA 2UUBE 2HFUA 4PU9A 2OI2A 4DR1E 4M1KA 2ZBKB 4Z7CA 4USMA 1Z5AA 3J7AG 4HACB 4MU4A 1J5EE 4JI2I 4DUZE 2VF3A 5GMEA 4UTGA 4JI3E 5JEAD 2IERA 1K47A 5LMNE
chains in the Genus database with same CATH topology
3B4TA 4AM3A 4BA2A 2NN6B 4OO1B 2NN6F 2NN6A 4OO1F 4OO1A 1UDSA 2JEBB 4NBQA 2PO2B 5K36B 2NN6D 4OO1D 5K36A 5K36D 3M85G 2BR2B 5C0XB 5JEAC 5C0XF 5C0XA 5JEAF 5C0XD 2JEAA 3M7ND 2WNRA 5JEAE 2BA0G 2PO1B 1OYPA 2BA1G 1R6MA 1UDNA 2NN6C 4OO1C 2PO0B 1UDOA 4IFDB 5K36C 2PNZB 2C37B 2PO0A 4IFDA 4IFDF 2PNZA 2JEBA 2C37A 2NN6E 2PO2A 3U1KA 4IFDD 4OO1E 5K36F 5C0XC 2BR2A 1OYSA 5C0XE 3CDJA 3M7NG 4BA1B 2PO1A 3L7ZB 2WP8B 3L7ZA 2WP8A 1E3PA 4IFDC 3HKMA 4IFDE 5K36E 2C39B 4AIDA 2C39A 3DD6A 3GLLA 3H1CA 4AIMA 2C38B 2C38A 3CDIA 2BA1D 3GCMA 4BA2B 1R6LA 4BA1A 3GMEA 3M85D 2JE6B 2JE6A 1UDQA 3KRNA 5JEAB 2JEAB 5JEAA 2WNRB 2BA0D 5JEAD 1OYRA 1E3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4T A;  4AM3 A;  4BA2 A;  2NN6 B;  4OO1 B;  2NN6 F;  2NN6 A;  4OO1 F;  4OO1 A;  1UDS A;  2JEB B;  4NBQ A;  2PO2 B;  5K36 B;  2NN6 D;  4OO1 D;  5K36 A;  5K36 D;  3M85 G;  2BR2 B;  5C0X B;  5JEA C;  5C0X F;  5C0X A;  5JEA F;  5C0X D;  2JEA A;  3M7N D;  2WNR A;  5JEA E;  2BA0 G;  2PO1 B;  1OYP A;  2BA1 G;  1R6M A;  1UDN A;  2NN6 C;  4OO1 C;  2PO0 B;  1UDO A;  4IFD B;  5K36 C;  2PNZ B;  2C37 B;  2PO0 A;  4IFD A;  4IFD F;  2PNZ A;  2JEB A;  2C37 A;  2NN6 E;  2PO2 A;  3U1K A;  4IFD D;  4OO1 E;  5K36 F;  5C0X C;  2BR2 A;  1OYS A;  5C0X E;  3CDJ A;  3M7N G;  4BA1 B;  2PO1 A;  3L7Z B;  2WP8 B;  3L7Z A;  2WP8 A;  1E3P A;  4IFD C;  3HKM A;  4IFD E;  5K36 E;  2C39 B;  4AID A;  2C39 A;  3DD6 A;  3GLL A;  3H1C A;  4AIM A;  2C38 B;  2C38 A;  3CDI A;  2BA1 D;  3GCM A;  4BA2 B;  1R6L A;  4BA1 A;  3GME A;  3M85 D;  2JE6 B;  2JE6 A;  1UDQ A;  3KRN A;  5JEA B;  2JEA B;  5JEA A;  2WNR B;  2BA0 D;  5JEA D;  1OYR A;  1E3H A; 
#chains in the Genus database with same CATH topology
 2VQF E;  2UUA I;  2E1R A;  3J81 Q;  4JI5 I;  1HR0 E;  2HK2 A;  2NN6 A;  4OO1 A;  1IBK E;  4P7A A;  4DR2 I;  4DR6 I;  5K36 A;  4LF6 E;  4LCG A;  4HAC A;  3PYE A;  2HHH I;  4FW5 A;  4WUC A;  4USK A;  4DR4 I;  1S16 A;  5JEA C;  1KVK A;  1FI4 A;  4DR5 E;  3U1Y A;  5C0X D;  2DEJ A;  4MYT A;  5BR8 I;  3J7A M;  5LMU I;  3M7N D;  1N33 E;  4DV6 I;  2PO1 B;  4X64 E;  1VIS A;  1HNZ I;  2UXD I;  3PYF A;  5L3J A;  2O1T A;  2PNZ B;  4DV4 I;  2C37 B;  4IFD F;  5K36 F;  4X62 E;  2UXB I;  1ZM4 A;  4X65 E;  4AQY I;  2HKE A;  3LTO A;  4DV7 I;  3P76 A;  4FW6 A;  5C0X C;  1I94 I;  4GKJ I;  1S4E A;  3OTO I;  4DUY I;  1XNR I;  1H74 A;  2AE8 A;  3PS1 A;  4LF5 I;  1KIJ A;  2V8P A;  3M7N G;  4Z7Y A;  4HYM A;  4DU8 A;  4LF8 I;  2PO1 A;  1USV A;  2IES A;  2ZIT A;  1H72 C;  3V2U C;  4LFB I;  4MDT A;  1Y6Z A;  3GON A;  5EL9 A;  2WP8 A;  1E3P A;  1U2R A;  4JI2 E;  2V34 A;  2UXC I;  4IZJ D;  4JI4 I;  4FW3 A;  4IZK A;  1XMQ I;  4DV0 I;  4IFD E;  5DRO A;  4FW4 A;  5K36 E;  2C39 B;  5DNX A;  3T1H E;  4OZE A;  4GKK I;  2HFS A;  2C38 B;  4DV1 I;  1XNQ I;  4KHP I;  4NXN E;  4DPU A;  3ZKB A;  4FWH A;  1Z0E A;  2BV3 A;  1ZM9 A;  2Z5E A;  2HHH E;  3HUL A;  3PYG A;  4DR4 E;  2JE6 A;  1Z0B A;  1MG7 A;  5BR8 E;  4MU1 A;  2JEA B;  5LMU E;  4LF7 I;  2Q2E B;  4DV6 E;  2V2Q A;  1Y4S A;  4OKG A;  4FN5 A;  1H7S A;  1MU5 A;  1HNZ E;  3B4T A;  4NXM I;  2UXD E;  4QNK A;  4DV5 E;  4B3M I;  1EI1 A;  5DRQ A;  1Y5Y A;  4DV4 E;  1H7U A;  2NN6 B;  3WU6 A;  4OO1 B;  2UXB E;  2JEB B;  4NBQ A;  5K36 B;  4AQY E;  3WU5 A;  1Z5B A;  2UU9 E;  4GKJ E;  3OTO E;  4DUY E;  1XNR E;  1PIE A;  5C0X F;  4LF5 E;  1A6F A;  4PRX A;  2JEA A;  5JEA E;  1NHH A;  1PVG A;  3PRY A;  2IOP A;  4LFB E;  4JV5 I;  2Z5B B;  1ZXN A;  5DNL A;  2CVE A;  3K17 A;  2UXC E;  1HNW I;  4JI7 I;  1XMQ E;  2PO0 A;  4DV0 E;  4IFD A;  2JEB A;  3U1K A;  4GKK E;  4YHH I;  4DV1 E;  1XNQ E;  4JI6 E;  2CZ9 A;  3P06 A;  1KTV A;  1N34 I;  4U3D A;  4FWD A;  5C0X E;  3CDJ A;  4BA1 B;  5IWA I;  3PS3 A;  4LF9 I;  3B82 A;  3K1J A;  2WP8 B;  2Z5B A;  3L7Z A;  5ELW A;  4JI0 I;  3ZZ0 A;  5A2Q C;  2XEX A;  3HKM A;  1Y60 A;  4IZK B;  1PKP A;  3QT8 A;  3T1Y I;  2F4V I;  4LF7 E;  4GQU A;  2GS8 A;  3H1C A;  3QT5 A;  4B3S I;  4I3H A;  1N32 I;  2ZM6 I;  1IBL I;  4NXM E;  2BA1 D;  3K85 A;  4B3M E;  1FWK A;  2O1U A;  5DRP A;  4JYA I;  2UUB I;  1B63 A;  4HY1 A;  4BA1 A;  1Z0T A;  2O1V A;  2GO3 A;  2X36 A;  2JE6 B;  4DPT A;  1J5E I;  1FKA E;  2HK3 A;  5FLX C;  1Z0V A;  1WUU A;  4DPW A;  5JEA A;  2BA0 D;  4LF4 I;  4JV5 E;  1OYR A;  2UUA E;  1E3H A;  1ZXM A;  4JI5 E;  4B3R I;  2X7I A;  2GQ0 A;  4DR7 I;  1OJ4 A;  1HNW E;  4B3T I;  1P42 A;  4DR2 E;  4DR6 E;  1ZM2 A;  4K0K I;  2VES A;  2PO2 B;  1N36 I;  2NN6 D;  4YHH E;  4DXL A;  4OO1 D;  1IBK I;  5K36 D;  3ZZT A;  4LFC I;  4LF6 I;  1BKN A;  4OX9 I;  2DEI A;  5C0X A;  5JEA F;  3JAM C;  3PS2 A;  1IBM I;  5IWA E;  4DV2 I;  2BA0 G;  3WU3 A;  3P3C A;  1HNX I;  4LF9 E;  1N33 I;  2CGE A;  3F0N A;  5IT9 C;  1NHJ A;  4URL A;  4X64 I;  4JI0 E;  1UDN A;  2NN6 C;  4MU3 A;  4OO1 C;  1USU A;  3T1Y E;  2PO0 B;  1UDO A;  1Z5C A;  4IFD B;  5K36 C;  2F4V E;  2GO4 A;  2J65 A;  2PO2 A;  4JG4 A;  2VQE I;  4DV7 E;  1N0V C;  2V2Z A;  1KKH A;  4X62 I;  2ZM6 E;  1I94 E;  1IBL E;  5A2Q Q;  4FW9 A;  4DR3 I;  2PNM A;  1OYS A;  2BM1 A;  3Q6N A;  4JYA E;  4LF8 E;  1B62 A;  5LL6 R;  1XXE A;  2UUC I;  4JI8 I;  1EA6 A;  2O3Z A;  4X66 I;  4LFA I;  3L7Z B;  2E5L I;  4JI4 E;  4IZJ A;  4DPX A;  4JI1 I;  3B8H A;  2F1D A;  1FJG I;  3P3G A;  4KQV A;  1DAR A;  4LF4 E;  4AIM A;  1VI7 A;  3DD6 A;  4KHP E;  3T1H I;  4P52 A;  3CDI A;  5FLX Q;  4B3R E;  4NXN I;  4DR7 E;  1N0U A;  4B3T E;  3V5R A;  4BA2 B;  1R6L A;  1MX0 A;  4K0K E;  1N36 E;  5EKW A;  1FNM A;  3H4L A;  3M6A A;  4RPF A;  4LCH A;  1XMO I;  3D4J A;  3GME A;  3NZK A;  3LPS A;  4LCF A;  4LFC E;  3M85 D;  4EMD A;  4U3B A;  2R42 A;  5GMD A;  3ZKD A;  4ISA A;  4OX9 E;  3J80 C;  1NZ0 A;  1RHY A;  2A2C A;  2A2D A;  1UDQ A;  3KRN A;  2CG9 A;  3UHM A;  1IBM E;  5JEA B;  4MU0 A;  2WW4 A;  4DV2 E;  2WNR B;  1Z0W A;  4LPF A;  4UT4 A;  3ZZU A;  1HNX E;  4YY3 I;  4DU7 A;  1Z0G A;  4DV3 I;  2PNL A;  4AM3 A;  3JAM Q;  2J7K A;  4DV5 I;  4BA2 A;  4J3D A;  4MQY A;  4DR1 I;  2NN6 F;  3WU4 A;  4OO1 F;  4FW7 A;  1UDS A;  1YH8 A;  3QT7 A;  4WUD A;  2VQE E;  5IT9 Q;  5DRR A;  4HXZ A;  3M85 G;  3LNU A;  2EFG A;  4DR3 E;  2BR2 B;  4R1F A;  2UU9 I;  5C0X B;  3ZM7 A;  1NHI A;  2JT2 A;  4DUZ I;  3J81 C;  2WNR A;  3Q6M A;  2V2V A;  4WUB A;  2IOQ A;  4ZVI A;  4JI8 E;  2UUC E;  4JI3 I;  1Z0C A;  1OYP A;  4X66 E;  1XHK A;  4LFA E;  2BA1 G;  2Z5C B;  5LMN I;  2E5L E;  1R6M A;  4MYU A;  4JI7 E;  2VQF I;  4JI1 E;  4LOM A;  3P3E A;  2O1W A;  1FJG E;  1RRE A;  3HJC A;  1HR0 I;  3B78 A;  2PNZ A;  2C37 A;  2NN6 E;  4IFD D;  4OO1 E;  3PYD A;  4IS9 A;  2AJ4 A;  2BM0 A;  1N34 E;  4XTJ A;  1RR9 A;  3Q1Q A;  4JI6 I;  2BR2 A;  4FWG A;  4DR5 I;  3QT6 A;  3CWV A;  2R3V A;  4DPY A;  1XMO E;  2NPF A;  4ED4 A;  2Z5C A;  1ZM3 A;  4IZJ B;  4N3O A;  4IFD C;  4PRV A;  1UEK A;  1HK7 A;  4B3S E;  1N32 E;  1QZR A;  1FWL A;  4AID A;  2C39 A;  4QNJ A;  3GLL A;  4YY3 E;  1Z59 A;  4X65 I;  1D6T A;  1ELO A;  2C38 A;  5FWK A;  2LJP A;  2HKJ A;  1Y4U A;  4DV3 E;  1H73 A;  3J80 Q;  3GCM A;  1YHC A;  2UUB E;  2HFU A;  4PU9 A;  2OI2 A;  4DR1 E;  4M1K A;  2ZBK B;  4Z7C A;  4USM A;  1Z5A A;  3J7A G;  4HAC B;  4MU4 A;  1J5E E;  4JI2 I;  4DUZ E;  2VF3 A;  5GME A;  4UTG A;  4JI3 E;  5JEA D;  2IER A;  1K47 A;  5LMN E; 
#chains in the Genus database with same CATH homology
 3B4T A;  4AM3 A;  4BA2 A;  2NN6 B;  4OO1 B;  2NN6 F;  2NN6 A;  4OO1 F;  4OO1 A;  1UDS A;  2JEB B;  4NBQ A;  2PO2 B;  5K36 B;  2NN6 D;  4OO1 D;  5K36 A;  5K36 D;  3M85 G;  2BR2 B;  5C0X B;  5JEA C;  5C0X F;  5C0X A;  5JEA F;  5C0X D;  2JEA A;  3M7N D;  2WNR A;  5JEA E;  2BA0 G;  2PO1 B;  1OYP A;  2BA1 G;  1R6M A;  1UDN A;  2NN6 C;  4OO1 C;  2PO0 B;  1UDO A;  4IFD B;  5K36 C;  2PNZ B;  2C37 B;  2PO0 A;  4IFD A;  4IFD F;  2PNZ A;  2JEB A;  2C37 A;  2NN6 E;  2PO2 A;  3U1K A;  4IFD D;  4OO1 E;  5K36 F;  5C0X C;  2BR2 A;  1OYS A;  5C0X E;  3CDJ A;  3M7N G;  4BA1 B;  2PO1 A;  3L7Z B;  2WP8 B;  3L7Z A;  2WP8 A;  1E3P A;  4IFD C;  3HKM A;  4IFD E;  5K36 E;  2C39 B;  4AID A;  2C39 A;  3DD6 A;  3GLL A;  3H1C A;  4AIM A;  2C38 B;  2C38 A;  3CDI A;  2BA1 D;  3GCM A;  4BA2 B;  1R6L A;  4BA1 A;  3GME A;  3M85 D;  2JE6 B;  2JE6 A;  1UDQ A;  3KRN A;  5JEA B;  2JEA B;  5JEA A;  2WNR B;  2BA0 D;  5JEA D;  1OYR A;  1E3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...