4OO1D

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1D00
2WP8B 5C0XA 5K36F 3L7ZA 2C38B 2C38A 5K36D 2PO2A 5C0XF 2PO2B 3M85D 3B4TA 4OO1B 1R6LA 5JEAD 2BA1G 4OO1D 2BR2A 1UDQA 2WNRA 1E3PA 2NN6F 4BA1A 5C0XD 5C0XC 2JEAB 2PO0A 3M85G 4OO1E 2JEBB 2C37A 2PNZB 2JE6A 3M7ND 1UDOA 5K36C 1R6MA 2BA0G 2NN6D 5C0XE 5JEAC 4BA2A 5C0XB 2NN6E 2PO1B 2PO0B 2PO1A 4IFDB 4IFDA 3H1CA 5K36A 3KRNA 2C37B 1OYSA 4NBQA 1OYPA 2BR2B 2C39B 2C39A 4IFDE 3GMEA 2NN6C 3U1KA 1UDSA 2WP8A 5JEAA 4AIMA 2PNZA 3M7NG 1OYRA 3L7ZB 4OO1C 1UDNA 4IFDC 4AM3A 4IFDD 5K36B 1E3HA 5JEAE 2WNRB 4BA1B 5K36E 4IFDF 3GCMA 2JEAA 3CDIA 2BA1D 4AIDA 2NN6B 2NN6A 2JEBA 5JEAB 3CDJA 3DD6A 2JE6B 4OO1A 3GLLA 4BA2B 4OO1F 5JEAF 2BA0D 3HKMA
chains in the Genus database with same CATH superfamily
4DR4E 1Z0GA 3L7ZA 4DU8A 2CZ9A 2UXCI 4MU0A 4LF5E 4HXZA 4ISAA 4DV1I 4DV4E 2V2VA 5JEAD 4B3RI 2BA1G 5A2QC 2OI2A 4DUZE 2UUCI 3ZM7A 5A2QQ 4OX9I 5IWAE 4IZJD 5IWAI 4LPFA 3T1YI 1EI1A 2JEBB 4MYTA 1XXEA 3V2UC 4MDTA 4DV3I 4JV5I 1BKNA 4LF9E 2CG9A 5IT9Q 4X62E 3J7AG 5K36C 1VISA 3J80C 4NXMI 2F1DA 2NN6D 2DEJA 4FWHA 1I94I 4FW9A 4LOMA 3WU5A 4GKKI 4JI5I 4HY1A 4AQYE 4ZVIA 1VI7A 1FI4A 4DV6E 2NN6E 4UT4A 4DV6I 2PO1B 2JT2A 4DV5E 4PRVA 1N32E 2UUBE 4LF5I 4DV1E 4DV7I 4KQVA 1HNZI 4DV7E 1EA6A 5DRPA 3PYFA 1J5EI 4WUBA 3WU3A 4DPWA 2VQFE 1NZ0A 2VQEE 1YH8A 4AIMA 1Z0CA 1N33E 2AE8A 2UU9I 2VF3A 4JG4A 2V2ZA 2X36A 2VESA 4OO1C 2GQ0A 1H7SA 1UDNA 1H7UA 4DR2E 4IFDC 4IFDD 5K36B 4JYAI 4B3RE 1ZM3A 1N0VC 4MU1A 1IBLE 4URLA 4GKKE 1H73A 4DV2E 1RR9A 1ZXMA 4FWGA 4X65E 4IFDF 1USVA 4KHPI 4JI8I 3T1HI 1XNQE 4DR1E 4LFCI 2E1RA 4DV5I 5JEAB 2UUBI 3M6AA 1Z5CA 4DXLA 4X64I 4JI6E 4DPTA 4DU7A 4WUCA 3Q6MA 5IT9C 1ZXNA 1XMOI 1FKAE 2CVEA 4LF4I 4Z7CA 4USMA 5DNXA 4LF8E 1QZRA 2C38A 4B3TE 3T1YE 2BM1A 4ED4A 2V8PA 2UUAI 3Q6NA 2PO2A 4DR2I 2EFGA 1IBMI 3B4TA 4DR3E 4OO1B 4LF7E 4QNJA 4OO1D 2HK3A 2UUCE 5FWKA 1H72C 4M1KA 1E3PA 1J5EE 2JEAB 3GONA 2PO0A 4JI4I 4LFCE 1Z5AA 1B63A 2UU9E 2JE6A 3Q1QA 5EKWA 4X62I 2ZM6E 3PS1A 1Z0BA 2E5LE 4DV4I 4JYAE 4X66I 4N3OA 2V34A 4X66E 4JI5E 5JEAC 4I3HA 3V5RA 1XHKA 4NXNI 4B3SI 4K0KI 3CWVA 3ZZUA 1Z0VA 4JI3E 2Z5BA 1XNQI 4Z7YA 1NHIA 4JI3I 2Z5CA 2X7IA 4YHHE 4LF6E 4IFDB 5K36A 2C37B 1OJ4A 5LMUE 1N36I 4GKJE 1ELOA 4JI6I 1MG7A 2BR2B 2LJPA 5BR8I 1RREA 4XTJA 4U3BA 4LFBI 2VQFI 2F4VI 1ZM9A 2F4VE 3F0NA 3WU6A 4JI4E 2IOQA 1Z59A 1UDSA 2WP8A 5GMDA 4DR7I 4FW7A 2O1WA 4DR6I 4DR6E 4JI1E 1XNRI 2ZM6I 4AM3A 2BV3A 4DR3I 1HNZE 3B8HA 4UTGA 4LCHA 5JEAE 4EMDA 1XMQE 2V2QA 4X65I 1HK7A 4YY3I 5FLXQ 4BA1B 3GCMA 4OZEA 4LF4E 2BA1D 2HKJA 2GO3A 2JEBA 2HKEA 4JI0I 4JI0E 4OO1A 1D6TA 4HACB 4DPYA 1IBME 1KKHA 2HFSA 1MU5A 4BA2B 1PVGA 1WUUA 3HKMA 1FWLA 4LF8I 3B78A 2WP8B 3T1HE 5C0XA 1DARA 5K36F 2HK2A 1PKPA 1HNXE 3UHMA 2O3ZA 1PIEA 3ZKDA 2UXBE 4DUYI 5ELWA 1IBKE 1NHJA 3K85A 2PO2B 1Z5BA 3HJCA 5DRQA 1R6LA 1H74A 1Y5YA 2AJ4A 2O1TA 2NN6F 4YY3E 1XMOE 3J7AM 4MYUA 1KIJA 4LF9I 4DR5I 4B3SE 4K0KE 1S16A 4OO1E 4PRXA 4B3TI 2C37A 2PNZB 4RPFA 2UXCE 1YHCA 4HACA 4DPUA 2IESA 1UDOA 1Z0WA 5DRRA 4LF7I 5C0XE 4OX9E 2UXDE 1U2RA 1ZM4A 1FNMA 5C0XB 2VQEI 4DV3E 4OKGA 4IZJA 4JV5E 4LCGA 2PO1A 2WW4A 1ZM2A 4DUYE 2GO4A 3PS3A 3H1CA 2ZBKB 5FLXC 3KRNA 3OTOI 4IZKA 3K1JA 4NBQA 1OYPA 1Z0EA 2C39B 3HULA 4IFDE 3WU4A 1Y6ZA 3QT5A 5LL6R 2Q2EB 3U1KA 5JEAA 4JI2E 3ZZ0A 4JI8E 1HNXI 3M7NG 1OYRA 3L7ZB 4DR1I 4DV0E 1USUA 1FWKA 1N36E 4LCFA 2J65A 1E3HA 1RHYA 1N34E 2WNRB 3J81Q 5K36E 3PYGA 1N33I 4DR5E 2CGEA 4DR4I 2DEIA 2PNMA 2NN6B 4P7AA 1Y4SA 4FW6A 2UUAE 3DD6A 1Y60A 1XNRE 3PS2A 3QT8A 1UEKA 3LTOA 3P3EA 1XMQI 3LNUA 4FW3A 1Z0TA 2BA0D 1K47A 2O1UA 3PYDA 2C38B 1B62A 2IERA 2NPFA 4X64E 1IBKI 5K36D 3D4JA 5C0XF 2PNLA 3M85D 4NXME 2O1VA 1P42A 2BR2A 3U1YA 1I94E 5DROA 1UDQA 2WNRA 4BA1A 4NXNE 5C0XD 2A2DA 5C0XC 2Z5CB 2A2CA 3M85G 1KTVA 3PRYA 4YHHI 4R1FA 4B3MI 3M7ND 4WUDA 4J3DA 1NHHA 4B3ME 5BR8E 1R6MA 2BA0G 1HR0E 1HR0I 4FW4A 4FWDA 4BA2A 3H4LA 4PU9A 2HFUA 2Z5BB 5DNLA 4FW5A 2PO0B 2HHHE 4JI7I 4JI2I 3OTOE 2ZITA 5GMEA 4JI1I 4IFDA 2E5LI 2Z5EA 1OYSA 1FJGI 2C39A 1FJGE 2J7KA 4DPXA 2IOPA 3GMEA 2NN6C 2UXDI 3ZKBA 3LPSA 3NZKA 1N34I 1KVKA 4KHPE 3QT6A 3PYEA 1N32I 2PNZA 3QT7A 3B82A 3ZZTA 5LMUI 2R42A 4MU3A 4LF6I 4MQYA 4GKJI 4MU4A 3K17A 5LMNI 2GS8A 2XEXA 3J80Q 5LMNE 4DUZI 4LFBE 4FN5A 1HNWE 4AQYI 3P76A 4P52A 4DV2I 3J81C 2JEAA 4GQUA 4DR7E 1HNWI 3CDIA 4IZJB 4AIDA 2HHHI 2UXBI 4JI7E 4HYMA 2NN6A 2BM0A 3CDJA 4DV0I 2JE6B 4LFAI 3GLLA 3JAMC 4IZKB 3P3GA 4LFAE 1MX0A 3JAMQ 5L3JA 1Y4UA 1IBLI 1S4EA 2R3VA 4IS9A 4USKA 5EL9A 3P3CA 1N0UA 4QNKA 4OO1F 3P06A 5JEAF 1A6FA 4U3DA
chains in the Genus database with same CATH topology
2WP8B 5C0XA 5K36F 3L7ZA 2C38B 2C38A 5K36D 2PO2A 5C0XF 2PO2B 3M85D 3B4TA 4OO1B 1R6LA 5JEAD 2BA1G 4OO1D 2BR2A 1UDQA 2WNRA 1E3PA 2NN6F 4BA1A 5C0XD 5C0XC 2JEAB 2PO0A 3M85G 4OO1E 2JEBB 2C37A 2PNZB 2JE6A 3M7ND 1UDOA 5K36C 1R6MA 2BA0G 2NN6D 5C0XE 5JEAC 4BA2A 5C0XB 2NN6E 2PO1B 2PO0B 2PO1A 4IFDB 4IFDA 3H1CA 5K36A 3KRNA 2C37B 1OYSA 4NBQA 1OYPA 2BR2B 2C39B 2C39A 4IFDE 3GMEA 2NN6C 3U1KA 1UDSA 2WP8A 5JEAA 4AIMA 2PNZA 3M7NG 1OYRA 3L7ZB 4OO1C 1UDNA 4IFDC 4AM3A 4IFDD 5K36B 1E3HA 5JEAE 2WNRB 4BA1B 5K36E 4IFDF 3GCMA 2JEAA 3CDIA 2BA1D 4AIDA 2NN6B 2NN6A 2JEBA 5JEAB 3CDJA 3DD6A 2JE6B 4OO1A 3GLLA 4BA2B 4OO1F 5JEAF 2BA0D 3HKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP8 B;  5C0X A;  5K36 F;  3L7Z A;  2C38 B;  2C38 A;  5K36 D;  2PO2 A;  5C0X F;  2PO2 B;  3M85 D;  3B4T A;  4OO1 B;  1R6L A;  5JEA D;  2BA1 G;  4OO1 D;  2BR2 A;  1UDQ A;  2WNR A;  1E3P A;  2NN6 F;  4BA1 A;  5C0X D;  5C0X C;  2JEA B;  2PO0 A;  3M85 G;  4OO1 E;  2JEB B;  2C37 A;  2PNZ B;  2JE6 A;  3M7N D;  1UDO A;  5K36 C;  1R6M A;  2BA0 G;  2NN6 D;  5C0X E;  5JEA C;  4BA2 A;  5C0X B;  2NN6 E;  2PO1 B;  2PO0 B;  2PO1 A;  4IFD B;  4IFD A;  3H1C A;  5K36 A;  3KRN A;  2C37 B;  1OYS A;  4NBQ A;  1OYP A;  2BR2 B;  2C39 B;  2C39 A;  4IFD E;  3GME A;  2NN6 C;  3U1K A;  1UDS A;  2WP8 A;  5JEA A;  4AIM A;  2PNZ A;  3M7N G;  1OYR A;  3L7Z B;  4OO1 C;  1UDN A;  4IFD C;  4AM3 A;  4IFD D;  5K36 B;  1E3H A;  5JEA E;  2WNR B;  4BA1 B;  5K36 E;  4IFD F;  3GCM A;  2JEA A;  3CDI A;  2BA1 D;  4AID A;  2NN6 B;  2NN6 A;  2JEB A;  5JEA B;  3CDJ A;  3DD6 A;  2JE6 B;  4OO1 A;  3GLL A;  4BA2 B;  4OO1 F;  5JEA F;  2BA0 D;  3HKM A; 
#chains in the Genus database with same CATH topology
 4DR4 E;  1Z0G A;  3L7Z A;  4DU8 A;  2CZ9 A;  2UXC I;  4MU0 A;  4LF5 E;  4HXZ A;  4ISA A;  4DV1 I;  4DV4 E;  2V2V A;  5JEA D;  4B3R I;  2BA1 G;  5A2Q C;  2OI2 A;  4DUZ E;  2UUC I;  3ZM7 A;  5A2Q Q;  4OX9 I;  5IWA E;  4IZJ D;  5IWA I;  4LPF A;  3T1Y I;  1EI1 A;  2JEB B;  4MYT A;  1XXE A;  3V2U C;  4MDT A;  4DV3 I;  4JV5 I;  1BKN A;  4LF9 E;  2CG9 A;  5IT9 Q;  4X62 E;  3J7A G;  5K36 C;  1VIS A;  3J80 C;  4NXM I;  2F1D A;  2NN6 D;  2DEJ A;  4FWH A;  1I94 I;  4FW9 A;  4LOM A;  3WU5 A;  4GKK I;  4JI5 I;  4HY1 A;  4AQY E;  4ZVI A;  1VI7 A;  1FI4 A;  4DV6 E;  2NN6 E;  4UT4 A;  4DV6 I;  2PO1 B;  2JT2 A;  4DV5 E;  4PRV A;  1N32 E;  2UUB E;  4LF5 I;  4DV1 E;  4DV7 I;  4KQV A;  1HNZ I;  4DV7 E;  1EA6 A;  5DRP A;  3PYF A;  1J5E I;  4WUB A;  3WU3 A;  4DPW A;  2VQF E;  1NZ0 A;  2VQE E;  1YH8 A;  4AIM A;  1Z0C A;  1N33 E;  2AE8 A;  2UU9 I;  2VF3 A;  4JG4 A;  2V2Z A;  2X36 A;  2VES A;  4OO1 C;  2GQ0 A;  1H7S A;  1UDN A;  1H7U A;  4DR2 E;  4IFD C;  4IFD D;  5K36 B;  4JYA I;  4B3R E;  1ZM3 A;  1N0V C;  4MU1 A;  1IBL E;  4URL A;  4GKK E;  1H73 A;  4DV2 E;  1RR9 A;  1ZXM A;  4FWG A;  4X65 E;  4IFD F;  1USV A;  4KHP I;  4JI8 I;  3T1H I;  1XNQ E;  4DR1 E;  4LFC I;  2E1R A;  4DV5 I;  5JEA B;  2UUB I;  3M6A A;  1Z5C A;  4DXL A;  4X64 I;  4JI6 E;  4DPT A;  4DU7 A;  4WUC A;  3Q6M A;  5IT9 C;  1ZXN A;  1XMO I;  1FKA E;  2CVE A;  4LF4 I;  4Z7C A;  4USM A;  5DNX A;  4LF8 E;  1QZR A;  2C38 A;  4B3T E;  3T1Y E;  2BM1 A;  4ED4 A;  2V8P A;  2UUA I;  3Q6N A;  2PO2 A;  4DR2 I;  2EFG A;  1IBM I;  3B4T A;  4DR3 E;  4OO1 B;  4LF7 E;  4QNJ A;  4OO1 D;  2HK3 A;  2UUC E;  5FWK A;  1H72 C;  4M1K A;  1E3P A;  1J5E E;  2JEA B;  3GON A;  2PO0 A;  4JI4 I;  4LFC E;  1Z5A A;  1B63 A;  2UU9 E;  2JE6 A;  3Q1Q A;  5EKW A;  4X62 I;  2ZM6 E;  3PS1 A;  1Z0B A;  2E5L E;  4DV4 I;  4JYA E;  4X66 I;  4N3O A;  2V34 A;  4X66 E;  4JI5 E;  5JEA C;  4I3H A;  3V5R A;  1XHK A;  4NXN I;  4B3S I;  4K0K I;  3CWV A;  3ZZU A;  1Z0V A;  4JI3 E;  2Z5B A;  1XNQ I;  4Z7Y A;  1NHI A;  4JI3 I;  2Z5C A;  2X7I A;  4YHH E;  4LF6 E;  4IFD B;  5K36 A;  2C37 B;  1OJ4 A;  5LMU E;  1N36 I;  4GKJ E;  1ELO A;  4JI6 I;  1MG7 A;  2BR2 B;  2LJP A;  5BR8 I;  1RRE A;  4XTJ A;  4U3B A;  4LFB I;  2VQF I;  2F4V I;  1ZM9 A;  2F4V E;  3F0N A;  3WU6 A;  4JI4 E;  2IOQ A;  1Z59 A;  1UDS A;  2WP8 A;  5GMD A;  4DR7 I;  4FW7 A;  2O1W A;  4DR6 I;  4DR6 E;  4JI1 E;  1XNR I;  2ZM6 I;  4AM3 A;  2BV3 A;  4DR3 I;  1HNZ E;  3B8H A;  4UTG A;  4LCH A;  5JEA E;  4EMD A;  1XMQ E;  2V2Q A;  4X65 I;  1HK7 A;  4YY3 I;  5FLX Q;  4BA1 B;  3GCM A;  4OZE A;  4LF4 E;  2BA1 D;  2HKJ A;  2GO3 A;  2JEB A;  2HKE A;  4JI0 I;  4JI0 E;  4OO1 A;  1D6T A;  4HAC B;  4DPY A;  1IBM E;  1KKH A;  2HFS A;  1MU5 A;  4BA2 B;  1PVG A;  1WUU A;  3HKM A;  1FWL A;  4LF8 I;  3B78 A;  2WP8 B;  3T1H E;  5C0X A;  1DAR A;  5K36 F;  2HK2 A;  1PKP A;  1HNX E;  3UHM A;  2O3Z A;  1PIE A;  3ZKD A;  2UXB E;  4DUY I;  5ELW A;  1IBK E;  1NHJ A;  3K85 A;  2PO2 B;  1Z5B A;  3HJC A;  5DRQ A;  1R6L A;  1H74 A;  1Y5Y A;  2AJ4 A;  2O1T A;  2NN6 F;  4YY3 E;  1XMO E;  3J7A M;  4MYU A;  1KIJ A;  4LF9 I;  4DR5 I;  4B3S E;  4K0K E;  1S16 A;  4OO1 E;  4PRX A;  4B3T I;  2C37 A;  2PNZ B;  4RPF A;  2UXC E;  1YHC A;  4HAC A;  4DPU A;  2IES A;  1UDO A;  1Z0W A;  5DRR A;  4LF7 I;  5C0X E;  4OX9 E;  2UXD E;  1U2R A;  1ZM4 A;  1FNM A;  5C0X B;  2VQE I;  4DV3 E;  4OKG A;  4IZJ A;  4JV5 E;  4LCG A;  2PO1 A;  2WW4 A;  1ZM2 A;  4DUY E;  2GO4 A;  3PS3 A;  3H1C A;  2ZBK B;  5FLX C;  3KRN A;  3OTO I;  4IZK A;  3K1J A;  4NBQ A;  1OYP A;  1Z0E A;  2C39 B;  3HUL A;  4IFD E;  3WU4 A;  1Y6Z A;  3QT5 A;  5LL6 R;  2Q2E B;  3U1K A;  5JEA A;  4JI2 E;  3ZZ0 A;  4JI8 E;  1HNX I;  3M7N G;  1OYR A;  3L7Z B;  4DR1 I;  4DV0 E;  1USU A;  1FWK A;  1N36 E;  4LCF A;  2J65 A;  1E3H A;  1RHY A;  1N34 E;  2WNR B;  3J81 Q;  5K36 E;  3PYG A;  1N33 I;  4DR5 E;  2CGE A;  4DR4 I;  2DEI A;  2PNM A;  2NN6 B;  4P7A A;  1Y4S A;  4FW6 A;  2UUA E;  3DD6 A;  1Y60 A;  1XNR E;  3PS2 A;  3QT8 A;  1UEK A;  3LTO A;  3P3E A;  1XMQ I;  3LNU A;  4FW3 A;  1Z0T A;  2BA0 D;  1K47 A;  2O1U A;  3PYD A;  2C38 B;  1B62 A;  2IER A;  2NPF A;  4X64 E;  1IBK I;  5K36 D;  3D4J A;  5C0X F;  2PNL A;  3M85 D;  4NXM E;  2O1V A;  1P42 A;  2BR2 A;  3U1Y A;  1I94 E;  5DRO A;  1UDQ A;  2WNR A;  4BA1 A;  4NXN E;  5C0X D;  2A2D A;  5C0X C;  2Z5C B;  2A2C A;  3M85 G;  1KTV A;  3PRY A;  4YHH I;  4R1F A;  4B3M I;  3M7N D;  4WUD A;  4J3D A;  1NHH A;  4B3M E;  5BR8 E;  1R6M A;  2BA0 G;  1HR0 E;  1HR0 I;  4FW4 A;  4FWD A;  4BA2 A;  3H4L A;  4PU9 A;  2HFU A;  2Z5B B;  5DNL A;  4FW5 A;  2PO0 B;  2HHH E;  4JI7 I;  4JI2 I;  3OTO E;  2ZIT A;  5GME A;  4JI1 I;  4IFD A;  2E5L I;  2Z5E A;  1OYS A;  1FJG I;  2C39 A;  1FJG E;  2J7K A;  4DPX A;  2IOP A;  3GME A;  2NN6 C;  2UXD I;  3ZKB A;  3LPS A;  3NZK A;  1N34 I;  1KVK A;  4KHP E;  3QT6 A;  3PYE A;  1N32 I;  2PNZ A;  3QT7 A;  3B82 A;  3ZZT A;  5LMU I;  2R42 A;  4MU3 A;  4LF6 I;  4MQY A;  4GKJ I;  4MU4 A;  3K17 A;  5LMN I;  2GS8 A;  2XEX A;  3J80 Q;  5LMN E;  4DUZ I;  4LFB E;  4FN5 A;  1HNW E;  4AQY I;  3P76 A;  4P52 A;  4DV2 I;  3J81 C;  2JEA A;  4GQU A;  4DR7 E;  1HNW I;  3CDI A;  4IZJ B;  4AID A;  2HHH I;  2UXB I;  4JI7 E;  4HYM A;  2NN6 A;  2BM0 A;  3CDJ A;  4DV0 I;  2JE6 B;  4LFA I;  3GLL A;  3JAM C;  4IZK B;  3P3G A;  4LFA E;  1MX0 A;  3JAM Q;  5L3J A;  1Y4U A;  1IBL I;  1S4E A;  2R3V A;  4IS9 A;  4USK A;  5EL9 A;  3P3C A;  1N0U A;  4QNK A;  4OO1 F;  3P06 A;  5JEA F;  1A6F A;  4U3D A; 
#chains in the Genus database with same CATH homology
 2WP8 B;  5C0X A;  5K36 F;  3L7Z A;  2C38 B;  2C38 A;  5K36 D;  2PO2 A;  5C0X F;  2PO2 B;  3M85 D;  3B4T A;  4OO1 B;  1R6L A;  5JEA D;  2BA1 G;  4OO1 D;  2BR2 A;  1UDQ A;  2WNR A;  1E3P A;  2NN6 F;  4BA1 A;  5C0X D;  5C0X C;  2JEA B;  2PO0 A;  3M85 G;  4OO1 E;  2JEB B;  2C37 A;  2PNZ B;  2JE6 A;  3M7N D;  1UDO A;  5K36 C;  1R6M A;  2BA0 G;  2NN6 D;  5C0X E;  5JEA C;  4BA2 A;  5C0X B;  2NN6 E;  2PO1 B;  2PO0 B;  2PO1 A;  4IFD B;  4IFD A;  3H1C A;  5K36 A;  3KRN A;  2C37 B;  1OYS A;  4NBQ A;  1OYP A;  2BR2 B;  2C39 B;  2C39 A;  4IFD E;  3GME A;  2NN6 C;  3U1K A;  1UDS A;  2WP8 A;  5JEA A;  4AIM A;  2PNZ A;  3M7N G;  1OYR A;  3L7Z B;  4OO1 C;  1UDN A;  4IFD C;  4AM3 A;  4IFD D;  5K36 B;  1E3H A;  5JEA E;  2WNR B;  4BA1 B;  5K36 E;  4IFD F;  3GCM A;  2JEA A;  3CDI A;  2BA1 D;  4AID A;  2NN6 B;  2NN6 A;  2JEB A;  5JEA B;  3CDJ A;  3DD6 A;  2JE6 B;  4OO1 A;  3GLL A;  4BA2 B;  4OO1 F;  5JEA F;  2BA0 D;  3HKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...