4OO1D

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1D00
5K36A 4OO1A 2PO1B 1UDSA 4BA2B 3M7NG 2JEBA 1R6LA 5JEAA 1UDNA 2BA1D 1E3HA 4IFDE 2NN6A 1OYRA 3CDJA 2C37A 2JE6A 4IFDB 4NBQA 2JEAA 1R6MA 4BA1B 5C0XD 2PO2A 2WP8A 4IFDC 5K36B 4OO1B 5C0XA 2BR2A 1E3PA 2BA1G 4IFDF 4AIDA 1UDOA 3HKMA 2NN6B 3L7ZB 5K36F 2C37B 4OO1F 3H1CA 2C39A 5K36E 4OO1E 3U1KA 3GCMA 2C38B 4BA2A 2PO2B 5JEAE 2NN6F 2PO0A 2PNZA 2WNRA 2BR2B 2NN6E 2JEBB 3M85D 5JEAB 4IFDD 4AIMA 5K36C 2BA0D 4OO1C 3GLLA 5JEAC 4AM3A 5K36D 4BA1A 4OO1D 2JE6B 1UDQA 2JEAB 3GMEA 1OYPA 1OYSA 2NN6C 5C0XE 3CDIA 5JEAD 5JEAF 2PO1A 2WP8B 2NN6D 2PO0B 3M7ND 3M85G 5C0XB 2PNZB 2WNRB 3B4TA 3DD6A 2BA0G 3KRNA 5C0XC 3L7ZA 4IFDA 5C0XF 2C38A 2C39B
chains in the Genus database with same CATH superfamily
2V2ZA 4MU3A 4DV0I 4LFBE 2F4VI 4OO1A 1XNRI 4JI2E 4U3DA 4JI3I 5IT9Q 4DR1E 1R6LA 5JEAA 1VISA 1XHKA 2O3ZA 1RHYA 2BA1D 1XNQE 3U1YA 1I94I 4IFDE 1Y4UA 2V2VA 3PYGA 3LNUA 3ZZUA 4DV7I 4FW5A 2JEAA 4HXZA 2WW4A 4X65I 3JAMC 4YHHE 4DPUA 2XEXA 1ZM3A 3F0NA 2GO4A 4B3SI 1XMOE 1Z0BA 3P76A 1N34I 1S4EA 3J7AM 2ZM6E 2X7IA 4DUZI 4LF9E 4JI0E 1KVKA 2CVEA 1HNZE 1HNWE 1B63A 1ELOA 3HULA 4USMA 3WU5A 4X62E 4DR4I 5K36F 2C37B 3H1CA 4DR7E 2HK2A 4B3ME 1Z0CA 2Z5CA 4DR6I 2IOQA 3GCMA 4OX9I 4WUBA 4DV6I 1IBME 2LJPA 4DV2I 2NN6F 4LCHA 4Z7YA 5A2QQ 4LF6I 2PNZA 2BR2B 4J3DA 3M85D 4LOMA 1MX0A 4LF4I 5K36C 5BR8I 1P42A 1N33E 4JI6I 1UDQA 2O1UA 3GMEA 4JI5I 1N32E 2NN6C 1Z5CA 5C0XE 5JEAF 3WU3A 1ZM9A 2HHHE 2GO3A 2UXCE 4HYMA 4FW9A 3ZKBA 3B4TA 4GKKE 4JI7E 4YY3I 4LF5I 3KRNA 1FKAE 3P06A 2V2QA 2CG9A 4USKA 1EI1A 4FWGA 4FN5A 3T1HE 1NHJA 2UUBI 4K0KI 4JV5E 4DUYE 5K36A 2AE8A 2PO1B 4BA2B 5IWAI 4JI1E 4DR3E 1IBKI 2O1WA 2UUCI 2VQEE 1Z5BA 5EL9A 2HK3A 2UUAE 2NN6A 4DU7A 4KHPI 4JI4E 1B62A 1RR9A 4DR2E 4IFDB 4HACB 4X66I 4BA1B 2F4VE 4NXNE 4B3RI 3WU6A 4LFCI 2O1VA 1U2RA 4DV3I 2PO2A 3J80C 4IFDC 2O1TA 1K47A 1A6FA 4AQYI 2UU9E 2BA1G 4GQUA 5A2QC 1MU5A 3ZM7A 5LMUE 3PYFA 4NXMI 3PS1A 1H7SA 2V8PA 1S16A 4IS9A 3HKMA 3ZZTA 5GMEA 1KIJA 2R42A 1NHIA 4IZKB 1NHHA 3L7ZB 4JI8I 4DV4I 1HR0E 1FNMA 2VQFI 4OZEA 4PRVA 4LF7I 3U1KA 1Y60A 2C38B 4BA2A 3QT8A 4DUZE 4LFBI 2PO0A 1ZM2A 1H72C 3B78A 4JI2I 4IFDD 2BA0D 1ZXNA 1ZXMA 1XNQI 2Z5BA 5EKWA 2BV3A 3GONA 5FLXQ 2E5LI 4HACA 3Q1QA 2UXDE 4BA1A 2GS8A 4ED4A 3J80Q 5DNXA 1FWLA 4YHHI 4MU0A 2CGEA 4KQVA 4B3TI 4QNJA 3M7ND 3M85G 2PNMA 5C0XB 2WNRB 2ZM6I 4JI0I 4X64I 1J5EI 4MU4A 5C0XC 4IZKA 3L7ZA 3J7AG 1FJGE 1HNWI 1EA6A 2DEJA 4JI5E 4LF8I 4DPWA 4X62I 2UXBE 3PS3A 3UHMA 1N36E 2C38A 2C39B 4DR7I 4LFAE 4B3MI 1NZ0A 2Z5EA 4DR5E 4LCGA 4UT4A 1IBLE 1QZRA 1UDSA 4FW7A 1IBMI 4MU1A 3D4JA 2X36A 3K85A 3B8HA 4LCFA 4M1KA 1XMQE 1E3HA 3WU4A 4U3BA 3ZKDA 3LPSA 4FWDA 1OYRA 2ZITA 2C37A 3K1JA 4NBQA 1N33I 1R6MA 3P3EA 2F1DA 5C0XD 5GMDA 1D6TA 5FWKA 3OTOE 1N32I 2DEIA 4OO1B 5C0XA 2HHHI 4WUCA 5LMNE 2BR2A 2J65A 1E3PA 4DV1E 4IFDF 4DV5E 1Y4SA 3B82A 4AIDA 4GKJE 3QT7A 4GKKI 4FWHA 1HNXI 1H74A 4URLA 2CZ9A 3ZZ0A 4LFCE 4IZJD 2C39A 4DV3E 5FLXC 4OO1E 4DPTA 4DV0E 2OI2A 1XNRE 3T1HI 5JEAE 4JI3E 3QT5A 2NPFA 4I3HA 1USUA 4NXME 4JI1I 4DR3I 1I94E 2JEBB 3T1YI 4AIMA 1Z0EA 2VF3A 4DV4E 3GLLA 2E1RA 4DV7E 4JYAI 1Z0TA 4X65E 4AM3A 1N0VC 4OO1D 2JE6B 2R3VA 4B3SE 4DR2I 1OYPA 3P3GA 2Z5CB 3HJCA 5ELWA 5JEAD 4NXNI 1N34E 2PO1A 1HK7A 4N3OA 2HFSA 2WP8B 1UEKA 1BKNA 1Y6ZA 5DROA 1Z5AA 1DARA 2PNZB 2IOPA 4MDTA 2AJ4A 2BA0G 4DR1I 2UU9I 5LMUI 1FWKA 1KTVA 4MYTA 2E5LE 4DR4E 5DRQA 3J81C 4IFDA 2IERA 2HFUA 2HKJA 1PVGA 4EMDA 4OX9E 4DR6E 5C0XF 4DV6E 1HR0I 4B3TE 3CWVA 1OJ4A 4UTGA 4DV2E 4LF6E 2HKEA 1RREA 2BM1A 3M7NG 1XMOI 2JEBA 3Q6MA 4X64E 1UDNA 4QNKA 1J5EE 4LF4E 2A2DA 4LF9I 5L3JA 5BR8E 4LF8E 1HNZI 4XTJA 3CDJA 4FW6A 4DU8A 4JI6E 1H73A 2JE6A 4PRXA 2UXDI 2PNLA 3LTOA 3P3CA 1YHCA 3V5RA 2VESA 4Z7CA 2WP8A 3H4LA 1PIEA 5K36B 4PU9A 4LPFA 4IZJB 3PYDA 4YY3E 4LF5E 1Z0VA 4P7AA 4RPFA 3NZKA 3PS2A 4ZVIA 1Z59A 2EFGA 5DRPA 5LL6R 1ZM4A 2IESA 1UDOA 3J81Q 2NN6B 1USVA 3M6AA 3PYEA 3JAMQ 4OO1F 1FJGI 4FW3A 2UUBE 4K0KE 5K36E 4JG4A 2UXBI 2ZBKB 1N36I 5IWAE 2PO2B 2A2CA 1IBKE 4LFAI 4MQYA 1Y5YA 4DR5I 2UUCE 1IBLI 2WNRA 1Z0GA 5IT9C 2NN6E 1PKPA 2UXCI 4ISAA 5JEAB 1HNXE 1KKHA 4KHPE 4DPYA 4JI7I 1XMQI 4OO1C 4MYUA 2J7KA 5JEAC 1WUUA 5K36D 4X66E 4B3RE 1VI7A 4OKGA 2Q2EB 4HY1A 2JEAB 1OYSA 1MG7A 1FI4A 3CDIA 4DXLA 1YH8A 4IZJA 3OTOI 4AQYE 4JV5I 4DUYI 3T1YE 2NN6D 2PO0B 1XXEA 1Z0WA 5LMNI 3V2UC 3DD6A 4R1FA 4JYAE 1H7UA 4DV1I 4DV5I 4GKJI 4JI8E 2VQEI 4FW4A 2Z5BB 2JT2A 5DNLA 3PRYA 4WUDA 2VQFE 2UUAI 2GQ0A 4P52A 4LF7E 3K17A 2V34A 2BM0A 4JI4I 3Q6NA 5DRRA 4DPXA 1N0UA 3QT6A
chains in the Genus database with same CATH topology
5K36A 4OO1A 2PO1B 1UDSA 4BA2B 3M7NG 2JEBA 1R6LA 5JEAA 1UDNA 2BA1D 1E3HA 4IFDE 2NN6A 1OYRA 3CDJA 2C37A 2JE6A 4IFDB 4NBQA 2JEAA 1R6MA 4BA1B 5C0XD 2PO2A 2WP8A 4IFDC 5K36B 4OO1B 5C0XA 2BR2A 1E3PA 2BA1G 4IFDF 4AIDA 1UDOA 3HKMA 2NN6B 3L7ZB 5K36F 2C37B 4OO1F 3H1CA 2C39A 5K36E 4OO1E 3U1KA 3GCMA 2C38B 4BA2A 2PO2B 5JEAE 2NN6F 2PO0A 2PNZA 2WNRA 2BR2B 2NN6E 2JEBB 3M85D 5JEAB 4IFDD 4AIMA 5K36C 2BA0D 4OO1C 3GLLA 5JEAC 4AM3A 5K36D 4BA1A 4OO1D 2JE6B 1UDQA 2JEAB 3GMEA 1OYPA 1OYSA 2NN6C 5C0XE 3CDIA 5JEAD 5JEAF 2PO1A 2WP8B 2NN6D 2PO0B 3M7ND 3M85G 5C0XB 2PNZB 2WNRB 3B4TA 3DD6A 2BA0G 3KRNA 5C0XC 3L7ZA 4IFDA 5C0XF 2C38A 2C39B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 A;  4OO1 A;  2PO1 B;  1UDS A;  4BA2 B;  3M7N G;  2JEB A;  1R6L A;  5JEA A;  1UDN A;  2BA1 D;  1E3H A;  4IFD E;  2NN6 A;  1OYR A;  3CDJ A;  2C37 A;  2JE6 A;  4IFD B;  4NBQ A;  2JEA A;  1R6M A;  4BA1 B;  5C0X D;  2PO2 A;  2WP8 A;  4IFD C;  5K36 B;  4OO1 B;  5C0X A;  2BR2 A;  1E3P A;  2BA1 G;  4IFD F;  4AID A;  1UDO A;  3HKM A;  2NN6 B;  3L7Z B;  5K36 F;  2C37 B;  4OO1 F;  3H1C A;  2C39 A;  5K36 E;  4OO1 E;  3U1K A;  3GCM A;  2C38 B;  4BA2 A;  2PO2 B;  5JEA E;  2NN6 F;  2PO0 A;  2PNZ A;  2WNR A;  2BR2 B;  2NN6 E;  2JEB B;  3M85 D;  5JEA B;  4IFD D;  4AIM A;  5K36 C;  2BA0 D;  4OO1 C;  3GLL A;  5JEA C;  4AM3 A;  5K36 D;  4BA1 A;  4OO1 D;  2JE6 B;  1UDQ A;  2JEA B;  3GME A;  1OYP A;  1OYS A;  2NN6 C;  5C0X E;  3CDI A;  5JEA D;  5JEA F;  2PO1 A;  2WP8 B;  2NN6 D;  2PO0 B;  3M7N D;  3M85 G;  5C0X B;  2PNZ B;  2WNR B;  3B4T A;  3DD6 A;  2BA0 G;  3KRN A;  5C0X C;  3L7Z A;  4IFD A;  5C0X F;  2C38 A;  2C39 B; 
#chains in the Genus database with same CATH topology
 2V2Z A;  4MU3 A;  4DV0 I;  4LFB E;  2F4V I;  4OO1 A;  1XNR I;  4JI2 E;  4U3D A;  4JI3 I;  5IT9 Q;  4DR1 E;  1R6L A;  5JEA A;  1VIS A;  1XHK A;  2O3Z A;  1RHY A;  2BA1 D;  1XNQ E;  3U1Y A;  1I94 I;  4IFD E;  1Y4U A;  2V2V A;  3PYG A;  3LNU A;  3ZZU A;  4DV7 I;  4FW5 A;  2JEA A;  4HXZ A;  2WW4 A;  4X65 I;  3JAM C;  4YHH E;  4DPU A;  2XEX A;  1ZM3 A;  3F0N A;  2GO4 A;  4B3S I;  1XMO E;  1Z0B A;  3P76 A;  1N34 I;  1S4E A;  3J7A M;  2ZM6 E;  2X7I A;  4DUZ I;  4LF9 E;  4JI0 E;  1KVK A;  2CVE A;  1HNZ E;  1HNW E;  1B63 A;  1ELO A;  3HUL A;  4USM A;  3WU5 A;  4X62 E;  4DR4 I;  5K36 F;  2C37 B;  3H1C A;  4DR7 E;  2HK2 A;  4B3M E;  1Z0C A;  2Z5C A;  4DR6 I;  2IOQ A;  3GCM A;  4OX9 I;  4WUB A;  4DV6 I;  1IBM E;  2LJP A;  4DV2 I;  2NN6 F;  4LCH A;  4Z7Y A;  5A2Q Q;  4LF6 I;  2PNZ A;  2BR2 B;  4J3D A;  3M85 D;  4LOM A;  1MX0 A;  4LF4 I;  5K36 C;  5BR8 I;  1P42 A;  1N33 E;  4JI6 I;  1UDQ A;  2O1U A;  3GME A;  4JI5 I;  1N32 E;  2NN6 C;  1Z5C A;  5C0X E;  5JEA F;  3WU3 A;  1ZM9 A;  2HHH E;  2GO3 A;  2UXC E;  4HYM A;  4FW9 A;  3ZKB A;  3B4T A;  4GKK E;  4JI7 E;  4YY3 I;  4LF5 I;  3KRN A;  1FKA E;  3P06 A;  2V2Q A;  2CG9 A;  4USK A;  1EI1 A;  4FWG A;  4FN5 A;  3T1H E;  1NHJ A;  2UUB I;  4K0K I;  4JV5 E;  4DUY E;  5K36 A;  2AE8 A;  2PO1 B;  4BA2 B;  5IWA I;  4JI1 E;  4DR3 E;  1IBK I;  2O1W A;  2UUC I;  2VQE E;  1Z5B A;  5EL9 A;  2HK3 A;  2UUA E;  2NN6 A;  4DU7 A;  4KHP I;  4JI4 E;  1B62 A;  1RR9 A;  4DR2 E;  4IFD B;  4HAC B;  4X66 I;  4BA1 B;  2F4V E;  4NXN E;  4B3R I;  3WU6 A;  4LFC I;  2O1V A;  1U2R A;  4DV3 I;  2PO2 A;  3J80 C;  4IFD C;  2O1T A;  1K47 A;  1A6F A;  4AQY I;  2UU9 E;  2BA1 G;  4GQU A;  5A2Q C;  1MU5 A;  3ZM7 A;  5LMU E;  3PYF A;  4NXM I;  3PS1 A;  1H7S A;  2V8P A;  1S16 A;  4IS9 A;  3HKM A;  3ZZT A;  5GME A;  1KIJ A;  2R42 A;  1NHI A;  4IZK B;  1NHH A;  3L7Z B;  4JI8 I;  4DV4 I;  1HR0 E;  1FNM A;  2VQF I;  4OZE A;  4PRV A;  4LF7 I;  3U1K A;  1Y60 A;  2C38 B;  4BA2 A;  3QT8 A;  4DUZ E;  4LFB I;  2PO0 A;  1ZM2 A;  1H72 C;  3B78 A;  4JI2 I;  4IFD D;  2BA0 D;  1ZXN A;  1ZXM A;  1XNQ I;  2Z5B A;  5EKW A;  2BV3 A;  3GON A;  5FLX Q;  2E5L I;  4HAC A;  3Q1Q A;  2UXD E;  4BA1 A;  2GS8 A;  4ED4 A;  3J80 Q;  5DNX A;  1FWL A;  4YHH I;  4MU0 A;  2CGE A;  4KQV A;  4B3T I;  4QNJ A;  3M7N D;  3M85 G;  2PNM A;  5C0X B;  2WNR B;  2ZM6 I;  4JI0 I;  4X64 I;  1J5E I;  4MU4 A;  5C0X C;  4IZK A;  3L7Z A;  3J7A G;  1FJG E;  1HNW I;  1EA6 A;  2DEJ A;  4JI5 E;  4LF8 I;  4DPW A;  4X62 I;  2UXB E;  3PS3 A;  3UHM A;  1N36 E;  2C38 A;  2C39 B;  4DR7 I;  4LFA E;  4B3M I;  1NZ0 A;  2Z5E A;  4DR5 E;  4LCG A;  4UT4 A;  1IBL E;  1QZR A;  1UDS A;  4FW7 A;  1IBM I;  4MU1 A;  3D4J A;  2X36 A;  3K85 A;  3B8H A;  4LCF A;  4M1K A;  1XMQ E;  1E3H A;  3WU4 A;  4U3B A;  3ZKD A;  3LPS A;  4FWD A;  1OYR A;  2ZIT A;  2C37 A;  3K1J A;  4NBQ A;  1N33 I;  1R6M A;  3P3E A;  2F1D A;  5C0X D;  5GMD A;  1D6T A;  5FWK A;  3OTO E;  1N32 I;  2DEI A;  4OO1 B;  5C0X A;  2HHH I;  4WUC A;  5LMN E;  2BR2 A;  2J65 A;  1E3P A;  4DV1 E;  4IFD F;  4DV5 E;  1Y4S A;  3B82 A;  4AID A;  4GKJ E;  3QT7 A;  4GKK I;  4FWH A;  1HNX I;  1H74 A;  4URL A;  2CZ9 A;  3ZZ0 A;  4LFC E;  4IZJ D;  2C39 A;  4DV3 E;  5FLX C;  4OO1 E;  4DPT A;  4DV0 E;  2OI2 A;  1XNR E;  3T1H I;  5JEA E;  4JI3 E;  3QT5 A;  2NPF A;  4I3H A;  1USU A;  4NXM E;  4JI1 I;  4DR3 I;  1I94 E;  2JEB B;  3T1Y I;  4AIM A;  1Z0E A;  2VF3 A;  4DV4 E;  3GLL A;  2E1R A;  4DV7 E;  4JYA I;  1Z0T A;  4X65 E;  4AM3 A;  1N0V C;  4OO1 D;  2JE6 B;  2R3V A;  4B3S E;  4DR2 I;  1OYP A;  3P3G A;  2Z5C B;  3HJC A;  5ELW A;  5JEA D;  4NXN I;  1N34 E;  2PO1 A;  1HK7 A;  4N3O A;  2HFS A;  2WP8 B;  1UEK A;  1BKN A;  1Y6Z A;  5DRO A;  1Z5A A;  1DAR A;  2PNZ B;  2IOP A;  4MDT A;  2AJ4 A;  2BA0 G;  4DR1 I;  2UU9 I;  5LMU I;  1FWK A;  1KTV A;  4MYT A;  2E5L E;  4DR4 E;  5DRQ A;  3J81 C;  4IFD A;  2IER A;  2HFU A;  2HKJ A;  1PVG A;  4EMD A;  4OX9 E;  4DR6 E;  5C0X F;  4DV6 E;  1HR0 I;  4B3T E;  3CWV A;  1OJ4 A;  4UTG A;  4DV2 E;  4LF6 E;  2HKE A;  1RRE A;  2BM1 A;  3M7N G;  1XMO I;  2JEB A;  3Q6M A;  4X64 E;  1UDN A;  4QNK A;  1J5E E;  4LF4 E;  2A2D A;  4LF9 I;  5L3J A;  5BR8 E;  4LF8 E;  1HNZ I;  4XTJ A;  3CDJ A;  4FW6 A;  4DU8 A;  4JI6 E;  1H73 A;  2JE6 A;  4PRX A;  2UXD I;  2PNL A;  3LTO A;  3P3C A;  1YHC A;  3V5R A;  2VES A;  4Z7C A;  2WP8 A;  3H4L A;  1PIE A;  5K36 B;  4PU9 A;  4LPF A;  4IZJ B;  3PYD A;  4YY3 E;  4LF5 E;  1Z0V A;  4P7A A;  4RPF A;  3NZK A;  3PS2 A;  4ZVI A;  1Z59 A;  2EFG A;  5DRP A;  5LL6 R;  1ZM4 A;  2IES A;  1UDO A;  3J81 Q;  2NN6 B;  1USV A;  3M6A A;  3PYE A;  3JAM Q;  4OO1 F;  1FJG I;  4FW3 A;  2UUB E;  4K0K E;  5K36 E;  4JG4 A;  2UXB I;  2ZBK B;  1N36 I;  5IWA E;  2PO2 B;  2A2C A;  1IBK E;  4LFA I;  4MQY A;  1Y5Y A;  4DR5 I;  2UUC E;  1IBL I;  2WNR A;  1Z0G A;  5IT9 C;  2NN6 E;  1PKP A;  2UXC I;  4ISA A;  5JEA B;  1HNX E;  1KKH A;  4KHP E;  4DPY A;  4JI7 I;  1XMQ I;  4OO1 C;  4MYU A;  2J7K A;  5JEA C;  1WUU A;  5K36 D;  4X66 E;  4B3R E;  1VI7 A;  4OKG A;  2Q2E B;  4HY1 A;  2JEA B;  1OYS A;  1MG7 A;  1FI4 A;  3CDI A;  4DXL A;  1YH8 A;  4IZJ A;  3OTO I;  4AQY E;  4JV5 I;  4DUY I;  3T1Y E;  2NN6 D;  2PO0 B;  1XXE A;  1Z0W A;  5LMN I;  3V2U C;  3DD6 A;  4R1F A;  4JYA E;  1H7U A;  4DV1 I;  4DV5 I;  4GKJ I;  4JI8 E;  2VQE I;  4FW4 A;  2Z5B B;  2JT2 A;  5DNL A;  3PRY A;  4WUD A;  2VQF E;  2UUA I;  2GQ0 A;  4P52 A;  4LF7 E;  3K17 A;  2V34 A;  2BM0 A;  4JI4 I;  3Q6N A;  5DRR A;  4DPX A;  1N0U A;  3QT6 A; 
#chains in the Genus database with same CATH homology
 5K36 A;  4OO1 A;  2PO1 B;  1UDS A;  4BA2 B;  3M7N G;  2JEB A;  1R6L A;  5JEA A;  1UDN A;  2BA1 D;  1E3H A;  4IFD E;  2NN6 A;  1OYR A;  3CDJ A;  2C37 A;  2JE6 A;  4IFD B;  4NBQ A;  2JEA A;  1R6M A;  4BA1 B;  5C0X D;  2PO2 A;  2WP8 A;  4IFD C;  5K36 B;  4OO1 B;  5C0X A;  2BR2 A;  1E3P A;  2BA1 G;  4IFD F;  4AID A;  1UDO A;  3HKM A;  2NN6 B;  3L7Z B;  5K36 F;  2C37 B;  4OO1 F;  3H1C A;  2C39 A;  5K36 E;  4OO1 E;  3U1K A;  3GCM A;  2C38 B;  4BA2 A;  2PO2 B;  5JEA E;  2NN6 F;  2PO0 A;  2PNZ A;  2WNR A;  2BR2 B;  2NN6 E;  2JEB B;  3M85 D;  5JEA B;  4IFD D;  4AIM A;  5K36 C;  2BA0 D;  4OO1 C;  3GLL A;  5JEA C;  4AM3 A;  5K36 D;  4BA1 A;  4OO1 D;  2JE6 B;  1UDQ A;  2JEA B;  3GME A;  1OYP A;  1OYS A;  2NN6 C;  5C0X E;  3CDI A;  5JEA D;  5JEA F;  2PO1 A;  2WP8 B;  2NN6 D;  2PO0 B;  3M7N D;  3M85 G;  5C0X B;  2PNZ B;  2WNR B;  3B4T A;  3DD6 A;  2BA0 G;  3KRN A;  5C0X C;  3L7Z A;  4IFD A;  5C0X F;  2C38 A;  2C39 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...