4OO1D

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1D00
4IFDD 2JEBB 3CDJA 4OO1B 1UDOA 2JEBA 5K36F 5C0XC 1UDQA 2NN6F 3GMEA 2WNRB 5JEAF 2C38B 1UDNA 3B4TA 4AIDA 5K36E 4OO1A 2NN6E 3M85G 5JEAE 1OYSA 2WNRA 2C38A 5C0XA 1OYRA 5K36D 5JEAD 2JEAB 4OO1F 3KRNA 3GLLA 2JEAA 4OO1E 3GCMA 2BA1D 3DD6A 1R6MA 5C0XB 4OO1D 4BA1B 4IFDC 2BA0D 4AM3A 4BA1A 4BA2A 3U1KA 2C37B 3HKMA 2PO0B 2PO1B 5C0XF 2PO2A 2BA0G 5C0XE 1UDSA 2C37A 2C39B 2PO0A 2PO1A 5K36C 2NN6C 2BR2B 5JEAC 3M7ND 2WP8A 3L7ZB 1R6LA 4IFDB 2PNZB 2C39A 5C0XD 3M85D 2BR2A 2NN6A 4BA2B 5JEAA 3L7ZA 4IFDA 2PNZA 2BA1G 2PO2B 4OO1C 2JE6B 3M7NG 3H1CA 2WP8B 2JE6A 4IFDF 1E3PA 4IFDE 5K36B 2NN6B 5JEAB 4NBQA 1E3HA 3CDIA 4AIMA 2NN6D 5K36A 1OYPA
chains in the Genus database with same CATH superfamily
4IFDD 4K0KI 4AQYI 4Z7YA 4OZEA 1IBLE 1UEKA 4DV0E 2V34A 4YHHI 4DR5E 2WNRB 2HHHE 1UDNA 5JEAE 4JI5I 1FJGI 4JI3I 3K17A 5C0XA 1XMOI 4DR2I 4DUYI 3J80Q 2JEAB 4X64I 5IT9Q 5BR8E 4DV2E 4DUZE 1KIJA 3PYEA 3T1YI 5LMUI 5GMEA 2DEIA 1H7SA 3GCMA 2BA1D 4LF6E 4OKGA 1XNQI 4N3OA 2F4VI 4X62I 4R1FA 1BKNA 2OI2A 5C0XB 3K85A 1Y60A 4LFBE 1S16A 1VI7A 1FWKA 4DV4E 4AM3A 4IZKA 4DV6E 4DXLA 4JI4I 1PKPA 1HNXI 3PYGA 3J7AM 1USVA 3B78A 3U1KA 1ELOA 1Z5AA 4X66E 1HR0E 4DV3E 4K0KE 5DRQA 4AQYE 1ZM4A 4DV5I 2UXDI 2PO1A 4DPUA 5K36C 5IWAI 4IZKB 1N34I 4FW7A 4GQUA 4WUDA 2BM0A 4PU9A 5FLXC 4QNJA 4YHHE 2CVEA 2Z5EA 1EA6A 2C39A 4IZJA 2ZITA 5JEAA 2UUCI 4JI5E 4DV0I 2J7KA 1Y4UA 1FJGE 4JI3E 2BA1G 1XMOE 4DR2E 4DUYE 2E5LE 4OO1C 2PNLA 4Z7CA 4X64E 4NXMI 5LMNI 4DPWA 4LF4I 1E3PA 4U3DA 5LMUE 3T1YE 1DARA 1Z0WA 3K1JA 3U1YA 3OTOI 5JEAB 1XNQE 4NBQA 2F4VE 4X62E 4ISAA 2HFSA 4IZJD 4DUZI 4DV1I 2LJPA 4ED4A 2O3ZA 2AJ4A 1OYPA 1HK7A 4MYUA 2JEBB 2GS8A 4FW3A 1IBKI 4B3MI 4JI4E 1HNXE 4DPYA 3CDJA 1UDOA 2Q2EB 5EKWA 2NN6F 3GMEA 2C38B 3B4TA 3Q6NA 3P76A 1NHJA 4I3HA 5K36E 2EFGA 2UXBI 1U2RA 2WNRA 5L3JA 1Z5CA 4FWGA 4DV5E 2UXDE 4KHPI 2V2ZA 4FWHA 4XTJA 2UUBI 4FW4A 4PRVA 4DPTA 5IWAE 1N34E 3PYFA 5EL9A 4LPFA 1YH8A 4P52A 4DV3I 2IERA 4JI2I 1N0VC 3GLLA 1P42A 1Z0CA 2JEAA 4OO1E 1QZRA 2UUCE 1RREA 4UTGA 2A2CA 1H74A 3QT7A 2GQ0A 1H72C 4GKKI 1MX0A 3ZZ0A 4BA1B 4IFDC 2V2QA 4NXME 5LMNE 4LFAI 2Z5BA 4LF4E 5FLXQ 4DR4I 1N33I 4LCFA 2E5LI 4FN5A 4ZVIA 4OX9I 3PS2A 3OTOE 4BA2A 2IOPA 4DU7A 5A2QQ 3B82A 4B3SI 1Z0VA 1RHYA 2V8PA 4DV1E 4DV7I 2PO0B 5C0XF 4LFCI 4DR3I 5GMDA 2BA0G 1UDSA 1IBKE 4B3ME 4LF5I 2Z5BB 2BR2B 1Z0GA 4MDTA 4JI0I 5C0XD 3PS1A 1FI4A 4BA2B 4X65E 1HNWI 2XEXA 3NZKA 2UXBE 4DR1I 4USKA 4LF7I 1N32I 4KHPE 3P3GA 2UUBE 3M6AA 3H1CA 3P3CA 4JI6I 4JI2E 1KTVA 2AE8A 2JT2A 2X36A 4MQYA 3PRYA 3ZKDA 1USUA 1S4EA 4HYMA 1I94I 4IFDE 5K36B 3CDIA 1EI1A 2ZBKB 1PIEA 4AIMA 4USMA 1XMQI 1FKAE 4GKKE 1B62A 5A2QC 4IS9A 2CG9A 4LFAE 4WUCA 4MU3A 4DR4E 1N33E 1NHIA 3QT5A 4OX9E 4OO1B 2JEBA 1Y4SA 4LOMA 1XNRI 1UDQA 5JEAF 4B3SE 5FWKA 4DV7E 1RR9A 4LCHA 3HJCA 4LFCE 4DR3E 1OYSA 2C38A 2CGEA 3GONA 4YY3I 2IOQA 4LF5E 1OYRA 5JEAD 4B3TI 4JI0E 4HXZA 4M1KA 4PRXA 3KRNA 1HNWE 2R3VA 5LL6R 4UT4A 3ZKBA 4FW5A 4DU8A 1Z0EA 1ZM3A 3B8HA 5DNLA 4DR1E 4LF7E 1R6MA 1N32E 3J81C 3WU3A 2O1VA 4X65I 2R42A 4FWDA 2BA0D 4JV5E 4JI6E 1H73A 3ZZTA 4WUBA 1FWLA 2IESA 2O1WA 4BA1A 2V2VA 3T1HI 1I94E 1NHHA 4LF9I 1XMQE 1Y6ZA 2VF3A 2C37B 5DNXA 4JI1I 3HKMA 2UUAI 2Z5CA 2DEJA 5DRPA 4JYAI 2BM1A 2CZ9A 4MU1A 4NXNI 3V2UC 3LPSA 4MU4A 4J3DA 1ZM2A 2VESA 3WU5A 2PO0A 1NZ0A 1ZM9A 2NN6C 3HULA 4GKJI 2GO3A 3L7ZB 4LCGA 1XNRE 3V5RA 1R6LA 4IFDB 2PNZB 1Z0TA 3M85D 2BR2A 4B3RE 2Z5CB 4YY3E 4DPXA 2JE6B 4P7AA 3M7NG 1KKHA 2X7IA 1HNZI 4B3TE 1H7UA 2E1RA 1Z5BA 4URLA 1E3HA 2WW4A 1PVGA 4EMDA 2ZM6I 1YHCA 5K36A 1IBMI 4U3BA 2HKJA 2GO4A 4RPFA 3T1HE 3LTOA 3ZZUA 1N36I 2HK2A 4LF9E 5K36F 5C0XC 4JV5I 4FW9A 2UXCI 2PNMA 4AIDA 2HFUA 2O1TA 2NN6E 2O1UA 3QT6A 4OO1A 3J81Q 3M85G 2UUAE 4JI1E 4JYAE 3D4JA 4FW6A 2VQFI 4NXNE 4JI7I 3JAMC 4GKJE 5K36D 4DR6I 3QT8A 5ELWA 4OO1F 1J5EI 3WU4A 1OJ4A 4MU0A 2F1DA 2VQEI 4LF8I 3P3EA 2HK3A 4JI8I 3DD6A 3Q1QA 4DR7I 3P06A 1MG7A 2UU9I 3PYDA 2A2DA 4OO1D 3J7AG 4HACA 2NPFA 1HNZE 3J80C 4B3RI 1D6TA 3Q6MA 4JG4A 5IT9C 1IBLI 1MU5A 3H4LA 1Y5YA 4DR5I 2HHHI 1XHKA 4HY1A 2ZM6E 1IBME 2PO1B 2PO2A 3PS3A 4KQVA 1A6FA 1Z59A 4HACB 5C0XE 2C37A 1KVKA 2HKEA 3UHMA 3F0NA 2C39B 4IZJB 1ZXNA 5JEAC 3M7ND 1K47A 1N36E 5BR8I 2WP8A 1XXEA 4DV2I 2J65A 2UXCE 2NN6A 1VISA 3L7ZA 4LF6I 4IFDA 2PNZA 2VQFE 1ZXMA 2PO2B 4JI7E 1B63A 4DR6E 1N0UA 4LFBI 1Z0BA 5DROA 4QNKA 4DV4I 1J5EE 1WUUA 4DV6I 2WP8B 2JE6A 4IFDF 3WU6A 2VQEE 5DRRA 1FNMA 4LF8E 2BV3A 2NN6B 4JI8E 3LNUA 4DR7E 3ZM7A 2UU9E 4MYTA 2NN6D 4X66I 1HR0I 3JAMQ 3CWVA
chains in the Genus database with same CATH topology
4IFDD 2JEBB 3CDJA 4OO1B 1UDOA 2JEBA 5K36F 5C0XC 1UDQA 2NN6F 3GMEA 2WNRB 5JEAF 2C38B 1UDNA 3B4TA 4AIDA 5K36E 4OO1A 2NN6E 3M85G 5JEAE 1OYSA 2WNRA 2C38A 5C0XA 1OYRA 5K36D 5JEAD 2JEAB 4OO1F 3KRNA 3GLLA 2JEAA 4OO1E 3GCMA 2BA1D 3DD6A 1R6MA 5C0XB 4OO1D 4BA1B 4IFDC 2BA0D 4AM3A 4BA1A 4BA2A 3U1KA 2C37B 3HKMA 2PO0B 2PO1B 5C0XF 2PO2A 2BA0G 5C0XE 1UDSA 2C37A 2C39B 2PO0A 2PO1A 5K36C 2NN6C 2BR2B 5JEAC 3M7ND 2WP8A 3L7ZB 1R6LA 4IFDB 2PNZB 2C39A 5C0XD 3M85D 2BR2A 2NN6A 4BA2B 5JEAA 3L7ZA 4IFDA 2PNZA 2BA1G 2PO2B 4OO1C 2JE6B 3M7NG 3H1CA 2WP8B 2JE6A 4IFDF 1E3PA 4IFDE 5K36B 2NN6B 5JEAB 4NBQA 1E3HA 3CDIA 4AIMA 2NN6D 5K36A 1OYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD D;  2JEB B;  3CDJ A;  4OO1 B;  1UDO A;  2JEB A;  5K36 F;  5C0X C;  1UDQ A;  2NN6 F;  3GME A;  2WNR B;  5JEA F;  2C38 B;  1UDN A;  3B4T A;  4AID A;  5K36 E;  4OO1 A;  2NN6 E;  3M85 G;  5JEA E;  1OYS A;  2WNR A;  2C38 A;  5C0X A;  1OYR A;  5K36 D;  5JEA D;  2JEA B;  4OO1 F;  3KRN A;  3GLL A;  2JEA A;  4OO1 E;  3GCM A;  2BA1 D;  3DD6 A;  1R6M A;  5C0X B;  4OO1 D;  4BA1 B;  4IFD C;  2BA0 D;  4AM3 A;  4BA1 A;  4BA2 A;  3U1K A;  2C37 B;  3HKM A;  2PO0 B;  2PO1 B;  5C0X F;  2PO2 A;  2BA0 G;  5C0X E;  1UDS A;  2C37 A;  2C39 B;  2PO0 A;  2PO1 A;  5K36 C;  2NN6 C;  2BR2 B;  5JEA C;  3M7N D;  2WP8 A;  3L7Z B;  1R6L A;  4IFD B;  2PNZ B;  2C39 A;  5C0X D;  3M85 D;  2BR2 A;  2NN6 A;  4BA2 B;  5JEA A;  3L7Z A;  4IFD A;  2PNZ A;  2BA1 G;  2PO2 B;  4OO1 C;  2JE6 B;  3M7N G;  3H1C A;  2WP8 B;  2JE6 A;  4IFD F;  1E3P A;  4IFD E;  5K36 B;  2NN6 B;  5JEA B;  4NBQ A;  1E3H A;  3CDI A;  4AIM A;  2NN6 D;  5K36 A;  1OYP A; 
#chains in the Genus database with same CATH topology
 4IFD D;  4K0K I;  4AQY I;  4Z7Y A;  4OZE A;  1IBL E;  1UEK A;  4DV0 E;  2V34 A;  4YHH I;  4DR5 E;  2WNR B;  2HHH E;  1UDN A;  5JEA E;  4JI5 I;  1FJG I;  4JI3 I;  3K17 A;  5C0X A;  1XMO I;  4DR2 I;  4DUY I;  3J80 Q;  2JEA B;  4X64 I;  5IT9 Q;  5BR8 E;  4DV2 E;  4DUZ E;  1KIJ A;  3PYE A;  3T1Y I;  5LMU I;  5GME A;  2DEI A;  1H7S A;  3GCM A;  2BA1 D;  4LF6 E;  4OKG A;  1XNQ I;  4N3O A;  2F4V I;  4X62 I;  4R1F A;  1BKN A;  2OI2 A;  5C0X B;  3K85 A;  1Y60 A;  4LFB E;  1S16 A;  1VI7 A;  1FWK A;  4DV4 E;  4AM3 A;  4IZK A;  4DV6 E;  4DXL A;  4JI4 I;  1PKP A;  1HNX I;  3PYG A;  3J7A M;  1USV A;  3B78 A;  3U1K A;  1ELO A;  1Z5A A;  4X66 E;  1HR0 E;  4DV3 E;  4K0K E;  5DRQ A;  4AQY E;  1ZM4 A;  4DV5 I;  2UXD I;  2PO1 A;  4DPU A;  5K36 C;  5IWA I;  4IZK B;  1N34 I;  4FW7 A;  4GQU A;  4WUD A;  2BM0 A;  4PU9 A;  5FLX C;  4QNJ A;  4YHH E;  2CVE A;  2Z5E A;  1EA6 A;  2C39 A;  4IZJ A;  2ZIT A;  5JEA A;  2UUC I;  4JI5 E;  4DV0 I;  2J7K A;  1Y4U A;  1FJG E;  4JI3 E;  2BA1 G;  1XMO E;  4DR2 E;  4DUY E;  2E5L E;  4OO1 C;  2PNL A;  4Z7C A;  4X64 E;  4NXM I;  5LMN I;  4DPW A;  4LF4 I;  1E3P A;  4U3D A;  5LMU E;  3T1Y E;  1DAR A;  1Z0W A;  3K1J A;  3U1Y A;  3OTO I;  5JEA B;  1XNQ E;  4NBQ A;  2F4V E;  4X62 E;  4ISA A;  2HFS A;  4IZJ D;  4DUZ I;  4DV1 I;  2LJP A;  4ED4 A;  2O3Z A;  2AJ4 A;  1OYP A;  1HK7 A;  4MYU A;  2JEB B;  2GS8 A;  4FW3 A;  1IBK I;  4B3M I;  4JI4 E;  1HNX E;  4DPY A;  3CDJ A;  1UDO A;  2Q2E B;  5EKW A;  2NN6 F;  3GME A;  2C38 B;  3B4T A;  3Q6N A;  3P76 A;  1NHJ A;  4I3H A;  5K36 E;  2EFG A;  2UXB I;  1U2R A;  2WNR A;  5L3J A;  1Z5C A;  4FWG A;  4DV5 E;  2UXD E;  4KHP I;  2V2Z A;  4FWH A;  4XTJ A;  2UUB I;  4FW4 A;  4PRV A;  4DPT A;  5IWA E;  1N34 E;  3PYF A;  5EL9 A;  4LPF A;  1YH8 A;  4P52 A;  4DV3 I;  2IER A;  4JI2 I;  1N0V C;  3GLL A;  1P42 A;  1Z0C A;  2JEA A;  4OO1 E;  1QZR A;  2UUC E;  1RRE A;  4UTG A;  2A2C A;  1H74 A;  3QT7 A;  2GQ0 A;  1H72 C;  4GKK I;  1MX0 A;  3ZZ0 A;  4BA1 B;  4IFD C;  2V2Q A;  4NXM E;  5LMN E;  4LFA I;  2Z5B A;  4LF4 E;  5FLX Q;  4DR4 I;  1N33 I;  4LCF A;  2E5L I;  4FN5 A;  4ZVI A;  4OX9 I;  3PS2 A;  3OTO E;  4BA2 A;  2IOP A;  4DU7 A;  5A2Q Q;  3B82 A;  4B3S I;  1Z0V A;  1RHY A;  2V8P A;  4DV1 E;  4DV7 I;  2PO0 B;  5C0X F;  4LFC I;  4DR3 I;  5GMD A;  2BA0 G;  1UDS A;  1IBK E;  4B3M E;  4LF5 I;  2Z5B B;  2BR2 B;  1Z0G A;  4MDT A;  4JI0 I;  5C0X D;  3PS1 A;  1FI4 A;  4BA2 B;  4X65 E;  1HNW I;  2XEX A;  3NZK A;  2UXB E;  4DR1 I;  4USK A;  4LF7 I;  1N32 I;  4KHP E;  3P3G A;  2UUB E;  3M6A A;  3H1C A;  3P3C A;  4JI6 I;  4JI2 E;  1KTV A;  2AE8 A;  2JT2 A;  2X36 A;  4MQY A;  3PRY A;  3ZKD A;  1USU A;  1S4E A;  4HYM A;  1I94 I;  4IFD E;  5K36 B;  3CDI A;  1EI1 A;  2ZBK B;  1PIE A;  4AIM A;  4USM A;  1XMQ I;  1FKA E;  4GKK E;  1B62 A;  5A2Q C;  4IS9 A;  2CG9 A;  4LFA E;  4WUC A;  4MU3 A;  4DR4 E;  1N33 E;  1NHI A;  3QT5 A;  4OX9 E;  4OO1 B;  2JEB A;  1Y4S A;  4LOM A;  1XNR I;  1UDQ A;  5JEA F;  4B3S E;  5FWK A;  4DV7 E;  1RR9 A;  4LCH A;  3HJC A;  4LFC E;  4DR3 E;  1OYS A;  2C38 A;  2CGE A;  3GON A;  4YY3 I;  2IOQ A;  4LF5 E;  1OYR A;  5JEA D;  4B3T I;  4JI0 E;  4HXZ A;  4M1K A;  4PRX A;  3KRN A;  1HNW E;  2R3V A;  5LL6 R;  4UT4 A;  3ZKB A;  4FW5 A;  4DU8 A;  1Z0E A;  1ZM3 A;  3B8H A;  5DNL A;  4DR1 E;  4LF7 E;  1R6M A;  1N32 E;  3J81 C;  3WU3 A;  2O1V A;  4X65 I;  2R42 A;  4FWD A;  2BA0 D;  4JV5 E;  4JI6 E;  1H73 A;  3ZZT A;  4WUB A;  1FWL A;  2IES A;  2O1W A;  4BA1 A;  2V2V A;  3T1H I;  1I94 E;  1NHH A;  4LF9 I;  1XMQ E;  1Y6Z A;  2VF3 A;  2C37 B;  5DNX A;  4JI1 I;  3HKM A;  2UUA I;  2Z5C A;  2DEJ A;  5DRP A;  4JYA I;  2BM1 A;  2CZ9 A;  4MU1 A;  4NXN I;  3V2U C;  3LPS A;  4MU4 A;  4J3D A;  1ZM2 A;  2VES A;  3WU5 A;  2PO0 A;  1NZ0 A;  1ZM9 A;  2NN6 C;  3HUL A;  4GKJ I;  2GO3 A;  3L7Z B;  4LCG A;  1XNR E;  3V5R A;  1R6L A;  4IFD B;  2PNZ B;  1Z0T A;  3M85 D;  2BR2 A;  4B3R E;  2Z5C B;  4YY3 E;  4DPX A;  2JE6 B;  4P7A A;  3M7N G;  1KKH A;  2X7I A;  1HNZ I;  4B3T E;  1H7U A;  2E1R A;  1Z5B A;  4URL A;  1E3H A;  2WW4 A;  1PVG A;  4EMD A;  2ZM6 I;  1YHC A;  5K36 A;  1IBM I;  4U3B A;  2HKJ A;  2GO4 A;  4RPF A;  3T1H E;  3LTO A;  3ZZU A;  1N36 I;  2HK2 A;  4LF9 E;  5K36 F;  5C0X C;  4JV5 I;  4FW9 A;  2UXC I;  2PNM A;  4AID A;  2HFU A;  2O1T A;  2NN6 E;  2O1U A;  3QT6 A;  4OO1 A;  3J81 Q;  3M85 G;  2UUA E;  4JI1 E;  4JYA E;  3D4J A;  4FW6 A;  2VQF I;  4NXN E;  4JI7 I;  3JAM C;  4GKJ E;  5K36 D;  4DR6 I;  3QT8 A;  5ELW A;  4OO1 F;  1J5E I;  3WU4 A;  1OJ4 A;  4MU0 A;  2F1D A;  2VQE I;  4LF8 I;  3P3E A;  2HK3 A;  4JI8 I;  3DD6 A;  3Q1Q A;  4DR7 I;  3P06 A;  1MG7 A;  2UU9 I;  3PYD A;  2A2D A;  4OO1 D;  3J7A G;  4HAC A;  2NPF A;  1HNZ E;  3J80 C;  4B3R I;  1D6T A;  3Q6M A;  4JG4 A;  5IT9 C;  1IBL I;  1MU5 A;  3H4L A;  1Y5Y A;  4DR5 I;  2HHH I;  1XHK A;  4HY1 A;  2ZM6 E;  1IBM E;  2PO1 B;  2PO2 A;  3PS3 A;  4KQV A;  1A6F A;  1Z59 A;  4HAC B;  5C0X E;  2C37 A;  1KVK A;  2HKE A;  3UHM A;  3F0N A;  2C39 B;  4IZJ B;  1ZXN A;  5JEA C;  3M7N D;  1K47 A;  1N36 E;  5BR8 I;  2WP8 A;  1XXE A;  4DV2 I;  2J65 A;  2UXC E;  2NN6 A;  1VIS A;  3L7Z A;  4LF6 I;  4IFD A;  2PNZ A;  2VQF E;  1ZXM A;  2PO2 B;  4JI7 E;  1B63 A;  4DR6 E;  1N0U A;  4LFB I;  1Z0B A;  5DRO A;  4QNK A;  4DV4 I;  1J5E E;  1WUU A;  4DV6 I;  2WP8 B;  2JE6 A;  4IFD F;  3WU6 A;  2VQE E;  5DRR A;  1FNM A;  4LF8 E;  2BV3 A;  2NN6 B;  4JI8 E;  3LNU A;  4DR7 E;  3ZM7 A;  2UU9 E;  4MYT A;  2NN6 D;  4X66 I;  1HR0 I;  3JAM Q;  3CWV A; 
#chains in the Genus database with same CATH homology
 4IFD D;  2JEB B;  3CDJ A;  4OO1 B;  1UDO A;  2JEB A;  5K36 F;  5C0X C;  1UDQ A;  2NN6 F;  3GME A;  2WNR B;  5JEA F;  2C38 B;  1UDN A;  3B4T A;  4AID A;  5K36 E;  4OO1 A;  2NN6 E;  3M85 G;  5JEA E;  1OYS A;  2WNR A;  2C38 A;  5C0X A;  1OYR A;  5K36 D;  5JEA D;  2JEA B;  4OO1 F;  3KRN A;  3GLL A;  2JEA A;  4OO1 E;  3GCM A;  2BA1 D;  3DD6 A;  1R6M A;  5C0X B;  4OO1 D;  4BA1 B;  4IFD C;  2BA0 D;  4AM3 A;  4BA1 A;  4BA2 A;  3U1K A;  2C37 B;  3HKM A;  2PO0 B;  2PO1 B;  5C0X F;  2PO2 A;  2BA0 G;  5C0X E;  1UDS A;  2C37 A;  2C39 B;  2PO0 A;  2PO1 A;  5K36 C;  2NN6 C;  2BR2 B;  5JEA C;  3M7N D;  2WP8 A;  3L7Z B;  1R6L A;  4IFD B;  2PNZ B;  2C39 A;  5C0X D;  3M85 D;  2BR2 A;  2NN6 A;  4BA2 B;  5JEA A;  3L7Z A;  4IFD A;  2PNZ A;  2BA1 G;  2PO2 B;  4OO1 C;  2JE6 B;  3M7N G;  3H1C A;  2WP8 B;  2JE6 A;  4IFD F;  1E3P A;  4IFD E;  5K36 B;  2NN6 B;  5JEA B;  4NBQ A;  1E3H A;  3CDI A;  4AIM A;  2NN6 D;  5K36 A;  1OYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...