4OO1D

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1D00
2WP8B 3GLLA 2WNRB 2BA0G 2PNZA 1UDSA 4OO1D 3L7ZB 5K36E 4IFDE 1OYPA 3M85D 1E3PA 3GMEA 4OO1F 2NN6E 2C37B 5JEAB 2JEAB 5K36D 4IFDD 3B4TA 2NN6B 4NBQA 4AIDA 2PO2B 2NN6D 5K36F 5C0XF 2C38A 1E3HA 5C0XC 2PNZB 4AIMA 5JEAE 1R6MA 4BA1A 4BA1B 3M7ND 2PO1A 4OO1C 5JEAD 3U1KA 3CDIA 4OO1A 5JEAF 2BA1D 2JEBA 4BA2A 4IFDF 2C38B 1UDNA 5K36C 3HKMA 2C39A 2NN6F 2JE6A 3KRNA 3M85G 4IFDC 2BR2A 5K36A 5C0XA 2NN6C 5C0XB 3H1CA 2PO1B 3GCMA 1UDQA 4AM3A 2WP8A 2BA1G 2WNRA 3DD6A 1OYRA 4OO1B 3L7ZA 2JEBB 4BA2B 1R6LA 5C0XE 2BA0D 3CDJA 2C39B 5JEAC 1OYSA 2JE6B 2C37A 2BR2B 3M7NG 1UDOA 5K36B 5JEAA 2JEAA 4IFDA 4IFDB 5C0XD 2PO0A 2PO0B 2NN6A 4OO1E 2PO2A
chains in the Genus database with same CATH superfamily
2Z5CB 2VF3A 2PNZA 4HXZA 4GKKE 4DUYI 4OO1D 5IWAE 1S16A 4KHPE 1FKAE 2UUCE 4JI8E 2C37B 5IT9Q 1FI4A 5DNXA 4LFCE 2UUAI 4LF5E 4YY3E 4DR3I 2CZ9A 3ZZUA 3B4TA 3K17A 2NN6B 4LF4E 2HKEA 2PO2B 1USVA 4DR7E 4FW6A 2V2VA 3PRYA 1WUUA 1E3HA 5C0XC 4FWDA 4AIMA 4MU1A 2UXDI 1RR9A 4UT4A 3WU5A 1IBKE 1N36E 4LCHA 5LMNI 2A2DA 4JYAE 2HKJA 4M1KA 4BA1A 4FWHA 3M7ND 1N0VC 1XMOE 4R1FA 2E5LE 5JEAD 2UU9I 1N0UA 3HJCA 4IZKB 2O1WA 5L3JA 4LF7E 1Y4SA 3LNUA 4K0KI 4DXLA 4HY1A 1N34I 2JEBA 4IFDF 2VQEI 1Z0VA 4DV3E 1VISA 4DUYE 5K36C 4LFAI 4B3SE 1NHIA 4DUZI 5K36A 2NN6C 2EFGA 4ZVIA 4DR4I 2UUAE 4DPTA 4DR3E 2V34A 1EI1A 1DARA 1PKPA 4DV7E 4MDTA 2WNRA 2ZITA 4EMDA 4YHHI 4KQVA 4DV1E 3L7ZA 1R6LA 2BM1A 3F0NA 2JT2A 3P3EA 1Z0WA 2UXDE 2BA0D 2C39B 1OYSA 2JE6B 4U3BA 1H73A 1ZM3A 2IOPA 3PYFA 2V2QA 2F1DA 2R3VA 4MU3A 5C0XD 2PO0B 4B3ME 2UU9E 4DV6I 4OO1E 3PYEA 4DV4I 5EL9A 4JI0I 1K47A 1N34E 1H7UA 2UXBI 2VQEE 2PNLA 1UDSA 4FW7A 1XNQI 1NZ0A 4X65E 4WUDA 4LFAE 2O3ZA 3QT5A 1OYPA 1E3PA 4OO1F 1FJGI 1RHYA 4FWGA 4DR5E 4ED4A 5K36D 4X64I 4JI2I 4B3TE 4PRVA 4AIDA 2NN6D 1EA6A 4YHHE 5DRQA 5FWKA 4LF9I 2HHHI 4LFBI 4JI3E 1HR0I 4DPYA 2PNMA 4URLA 5JEAE 4JI7E 2HFUA 2ZM6I 1ELOA 4AQYI 1FWKA 1QZRA 3M6AA 1Z0BA 4MYTA 5LMUI 3T1HE 4DU7A 4BA1B 5GMDA 2Z5BA 2IERA 4DV6E 3ZKDA 2GO4A 2GS8A 4DV4E 3CDIA 1IBMI 3T1YE 4MYUA 3B78A 4XTJA 5JEAF 3QT8A 4J3DA 4DV5I 1Z59A 2F4VE 3P76A 5FLXC 2C38B 1UDNA 4FW4A 1FWLA 3KRNA 3M85G 4IFDC 3GONA 4P7AA 2V2ZA 5C0XA 4I3HA 2A2CA 1I94I 4DR6E 4DV2E 4IS9A 4X64E 3B8HA 5DROA 2PO1B 4JI2E 4JV5E 4DPXA 1XNRI 4DR1I 3ZKBA 2XEXA 4JI5I 2IOQA 2Z5CA 4IZJD 2J65A 1OYRA 4P52A 3J7AG 4OO1B 5A2QC 4LF9E 4LFBE 1XMQI 1MX0A 4NXMI 1HR0E 3P3GA 5C0XE 4BA2B 4RPFA 2NPFA 2ZM6E 4AQYE 2C37A 2BR2B 4UTGA 2GO3A 5GMEA 4OX9I 5LMUE 4JG4A 1Y6ZA 4HACB 3V2UC 2NN6A 2Z5EA 4Z7CA 2PO2A 2O1UA 2HK3A 1NHHA 2WP8B 1H74A 4JI1I 1IBME 4JI4I 2BA0G 4MU0A 1Z5AA 4DV5E 1MG7A 5FLXQ 2J7KA 5K36E 3ZZTA 3WU3A 1FNMA 1HNZI 3QT7A 4OZEA 3J7AM 3GMEA 5LMNE 2NN6E 1ZM2A 3LPSA 1I94E 5JEAB 2JEAB 1KVKA 3OTOI 2CG9A 1YHCA 1Z5BA 4IFDD 4IZKA 1XNRE 1B63A 4NBQA 4DR1E 4LPFA 5K36F 4FN5A 1IBLI 2AJ4A 4LCGA 4K0KE 4GKKI 1ZXNA 5A2QQ 1XXEA 1XMQE 2PNZB 3PS3A 2UUBI 3H4LA 4WUBA 3ZM7A 3JAMC 4ISAA 4DUZE 5DRPA 4WUCA 4DR4E 2HFSA 2E1RA 4LF8I 4NXNI 1Y4UA 4LF4I 3U1KA 3NZKA 4IZJA 4LF6I 3J81C 4JI1E 4JI4E 3QT6A 1H7SA 2HK2A 1U2RA 2BA1D 2DEJA 2DEIA 1KIJA 2C39A 2JE6A 4X62I 1IBKI 4MQYA 2UXCI 1Y5YA 1HNZE 1HNWI 4JI6I 2O1VA 4LOMA 3WU4A 2VESA 3P3CA 5C0XB 3K85A 1D6TA 3H1CA 1XMOI 1NHJA 3K1JA 5LL6R 4DPUA 3OTOE 4USKA 2X7IA 4N3OA 4B3RI 3WU6A 4QNKA 1BKNA 4JI0E 1IBLE 1A6FA 4DV3I 1S4EA 2UXBE 2JEBB 4B3SI 4Z7YA 4MU4A 1XNQE 1B62A 1KTVA 3CDJA 2UUBE 2Q2EB 1MU5A 2X36A 4PU9A 3M7NG 3JAMQ 1UDOA 5K36B 1USUA 1H72C 1FJGE 4IFDA 2OI2A 4FW5A 3UHMA 5BR8I 3B82A 3Q1QA 1HNXI 4DV7I 4LF8E 3D4JA 4NXNE 2AE8A 4LF6E 1XHKA 3J81Q 3GLLA 2WNRB 2IESA 4DV1I 2ZBKB 4FW9A 1N33I 3V5RA 4QNJA 2HHHE 3L7ZB 4FW3A 4DR2I 4X62E 2UXCE 4IFDE 3PYGA 1HNWE 3M85D 4JI6E 1Y60A 2V8PA 4LCFA 3J80C 4DPWA 4B3MI 2R42A 1RREA 3HULA 1N32I 2GQ0A 4B3RE 2LJPA 2VQFI 5DRRA 1ZXMA 5EKWA 5C0XF 1ZM4A 2WW4A 4X66I 1Z0TA 2C38A 3PS2A 4X65I 4USMA 1ZM9A 1R6MA 4DR5I 2BV3A 1J5EI 4DV0I 3PS1A 3P06A 4GKJI 2PO1A 3CWVA 5BR8E 1P42A 1HNXE 4OO1C 4B3TI 5DNLA 2O1TA 1VI7A 4IZJB 4OKGA 1PIEA 4OO1A 4JI5E 1Z0CA 4JI3I 4BA2A 1N33E 3HKMA 3LTOA 4NXME 2CGEA 2NN6F 5IWAI 4JI7I 4HYMA 4DR2E 1Z0EA 3Q6MA 2BR2A 4GQUA 4DU8A 3U1YA 4KHPI 2UUCI 3T1HI 4JI8I 5IT9C 4OX9E 3J80Q 4HACA 4LFCI 5ELWA 4LF5I 4YY3I 2CVEA 1Z0GA 3GCMA 1N32E 1UDQA 2Z5BB 4AM3A 2VQFE 2WP8A 2BA1G 3T1YI 3PYDA 4DR7I 3DD6A 3ZZ0A 1PVGA 2F4VI 2BM0A 4X66E 4PRXA 5JEAC 3Q6NA 1YH8A 1N36I 4DR6I 4JYAI 5JEAA 4DV2I 2JEAA 1J5EE 1UEKA 4DV0E 1Z5CA 4IFDB 2PO0A 4GKJE 4JV5I 2E5LI 1HK7A 1KKHA 1OJ4A 4U3DA 4LF7I
chains in the Genus database with same CATH topology
2WP8B 3GLLA 2WNRB 2BA0G 2PNZA 1UDSA 4OO1D 3L7ZB 5K36E 4IFDE 1OYPA 3M85D 1E3PA 3GMEA 4OO1F 2NN6E 2C37B 5JEAB 2JEAB 5K36D 4IFDD 3B4TA 2NN6B 4NBQA 4AIDA 2PO2B 2NN6D 5K36F 5C0XF 2C38A 1E3HA 5C0XC 2PNZB 4AIMA 5JEAE 1R6MA 4BA1A 4BA1B 3M7ND 2PO1A 4OO1C 5JEAD 3U1KA 3CDIA 4OO1A 5JEAF 2BA1D 2JEBA 4BA2A 4IFDF 2C38B 1UDNA 5K36C 3HKMA 2C39A 2NN6F 2JE6A 3KRNA 3M85G 4IFDC 2BR2A 5K36A 5C0XA 2NN6C 5C0XB 3H1CA 2PO1B 3GCMA 1UDQA 4AM3A 2WP8A 2BA1G 2WNRA 3DD6A 1OYRA 4OO1B 3L7ZA 2JEBB 4BA2B 1R6LA 5C0XE 2BA0D 3CDJA 2C39B 5JEAC 1OYSA 2JE6B 2C37A 2BR2B 3M7NG 1UDOA 5K36B 5JEAA 2JEAA 4IFDA 4IFDB 5C0XD 2PO0A 2PO0B 2NN6A 4OO1E 2PO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP8 B;  3GLL A;  2WNR B;  2BA0 G;  2PNZ A;  1UDS A;  4OO1 D;  3L7Z B;  5K36 E;  4IFD E;  1OYP A;  3M85 D;  1E3P A;  3GME A;  4OO1 F;  2NN6 E;  2C37 B;  5JEA B;  2JEA B;  5K36 D;  4IFD D;  3B4T A;  2NN6 B;  4NBQ A;  4AID A;  2PO2 B;  2NN6 D;  5K36 F;  5C0X F;  2C38 A;  1E3H A;  5C0X C;  2PNZ B;  4AIM A;  5JEA E;  1R6M A;  4BA1 A;  4BA1 B;  3M7N D;  2PO1 A;  4OO1 C;  5JEA D;  3U1K A;  3CDI A;  4OO1 A;  5JEA F;  2BA1 D;  2JEB A;  4BA2 A;  4IFD F;  2C38 B;  1UDN A;  5K36 C;  3HKM A;  2C39 A;  2NN6 F;  2JE6 A;  3KRN A;  3M85 G;  4IFD C;  2BR2 A;  5K36 A;  5C0X A;  2NN6 C;  5C0X B;  3H1C A;  2PO1 B;  3GCM A;  1UDQ A;  4AM3 A;  2WP8 A;  2BA1 G;  2WNR A;  3DD6 A;  1OYR A;  4OO1 B;  3L7Z A;  2JEB B;  4BA2 B;  1R6L A;  5C0X E;  2BA0 D;  3CDJ A;  2C39 B;  5JEA C;  1OYS A;  2JE6 B;  2C37 A;  2BR2 B;  3M7N G;  1UDO A;  5K36 B;  5JEA A;  2JEA A;  4IFD A;  4IFD B;  5C0X D;  2PO0 A;  2PO0 B;  2NN6 A;  4OO1 E;  2PO2 A; 
#chains in the Genus database with same CATH topology
 2Z5C B;  2VF3 A;  2PNZ A;  4HXZ A;  4GKK E;  4DUY I;  4OO1 D;  5IWA E;  1S16 A;  4KHP E;  1FKA E;  2UUC E;  4JI8 E;  2C37 B;  5IT9 Q;  1FI4 A;  5DNX A;  4LFC E;  2UUA I;  4LF5 E;  4YY3 E;  4DR3 I;  2CZ9 A;  3ZZU A;  3B4T A;  3K17 A;  2NN6 B;  4LF4 E;  2HKE A;  2PO2 B;  1USV A;  4DR7 E;  4FW6 A;  2V2V A;  3PRY A;  1WUU A;  1E3H A;  5C0X C;  4FWD A;  4AIM A;  4MU1 A;  2UXD I;  1RR9 A;  4UT4 A;  3WU5 A;  1IBK E;  1N36 E;  4LCH A;  5LMN I;  2A2D A;  4JYA E;  2HKJ A;  4M1K A;  4BA1 A;  4FWH A;  3M7N D;  1N0V C;  1XMO E;  4R1F A;  2E5L E;  5JEA D;  2UU9 I;  1N0U A;  3HJC A;  4IZK B;  2O1W A;  5L3J A;  4LF7 E;  1Y4S A;  3LNU A;  4K0K I;  4DXL A;  4HY1 A;  1N34 I;  2JEB A;  4IFD F;  2VQE I;  1Z0V A;  4DV3 E;  1VIS A;  4DUY E;  5K36 C;  4LFA I;  4B3S E;  1NHI A;  4DUZ I;  5K36 A;  2NN6 C;  2EFG A;  4ZVI A;  4DR4 I;  2UUA E;  4DPT A;  4DR3 E;  2V34 A;  1EI1 A;  1DAR A;  1PKP A;  4DV7 E;  4MDT A;  2WNR A;  2ZIT A;  4EMD A;  4YHH I;  4KQV A;  4DV1 E;  3L7Z A;  1R6L A;  2BM1 A;  3F0N A;  2JT2 A;  3P3E A;  1Z0W A;  2UXD E;  2BA0 D;  2C39 B;  1OYS A;  2JE6 B;  4U3B A;  1H73 A;  1ZM3 A;  2IOP A;  3PYF A;  2V2Q A;  2F1D A;  2R3V A;  4MU3 A;  5C0X D;  2PO0 B;  4B3M E;  2UU9 E;  4DV6 I;  4OO1 E;  3PYE A;  4DV4 I;  5EL9 A;  4JI0 I;  1K47 A;  1N34 E;  1H7U A;  2UXB I;  2VQE E;  2PNL A;  1UDS A;  4FW7 A;  1XNQ I;  1NZ0 A;  4X65 E;  4WUD A;  4LFA E;  2O3Z A;  3QT5 A;  1OYP A;  1E3P A;  4OO1 F;  1FJG I;  1RHY A;  4FWG A;  4DR5 E;  4ED4 A;  5K36 D;  4X64 I;  4JI2 I;  4B3T E;  4PRV A;  4AID A;  2NN6 D;  1EA6 A;  4YHH E;  5DRQ A;  5FWK A;  4LF9 I;  2HHH I;  4LFB I;  4JI3 E;  1HR0 I;  4DPY A;  2PNM A;  4URL A;  5JEA E;  4JI7 E;  2HFU A;  2ZM6 I;  1ELO A;  4AQY I;  1FWK A;  1QZR A;  3M6A A;  1Z0B A;  4MYT A;  5LMU I;  3T1H E;  4DU7 A;  4BA1 B;  5GMD A;  2Z5B A;  2IER A;  4DV6 E;  3ZKD A;  2GO4 A;  2GS8 A;  4DV4 E;  3CDI A;  1IBM I;  3T1Y E;  4MYU A;  3B78 A;  4XTJ A;  5JEA F;  3QT8 A;  4J3D A;  4DV5 I;  1Z59 A;  2F4V E;  3P76 A;  5FLX C;  2C38 B;  1UDN A;  4FW4 A;  1FWL A;  3KRN A;  3M85 G;  4IFD C;  3GON A;  4P7A A;  2V2Z A;  5C0X A;  4I3H A;  2A2C A;  1I94 I;  4DR6 E;  4DV2 E;  4IS9 A;  4X64 E;  3B8H A;  5DRO A;  2PO1 B;  4JI2 E;  4JV5 E;  4DPX A;  1XNR I;  4DR1 I;  3ZKB A;  2XEX A;  4JI5 I;  2IOQ A;  2Z5C A;  4IZJ D;  2J65 A;  1OYR A;  4P52 A;  3J7A G;  4OO1 B;  5A2Q C;  4LF9 E;  4LFB E;  1XMQ I;  1MX0 A;  4NXM I;  1HR0 E;  3P3G A;  5C0X E;  4BA2 B;  4RPF A;  2NPF A;  2ZM6 E;  4AQY E;  2C37 A;  2BR2 B;  4UTG A;  2GO3 A;  5GME A;  4OX9 I;  5LMU E;  4JG4 A;  1Y6Z A;  4HAC B;  3V2U C;  2NN6 A;  2Z5E A;  4Z7C A;  2PO2 A;  2O1U A;  2HK3 A;  1NHH A;  2WP8 B;  1H74 A;  4JI1 I;  1IBM E;  4JI4 I;  2BA0 G;  4MU0 A;  1Z5A A;  4DV5 E;  1MG7 A;  5FLX Q;  2J7K A;  5K36 E;  3ZZT A;  3WU3 A;  1FNM A;  1HNZ I;  3QT7 A;  4OZE A;  3J7A M;  3GME A;  5LMN E;  2NN6 E;  1ZM2 A;  3LPS A;  1I94 E;  5JEA B;  2JEA B;  1KVK A;  3OTO I;  2CG9 A;  1YHC A;  1Z5B A;  4IFD D;  4IZK A;  1XNR E;  1B63 A;  4NBQ A;  4DR1 E;  4LPF A;  5K36 F;  4FN5 A;  1IBL I;  2AJ4 A;  4LCG A;  4K0K E;  4GKK I;  1ZXN A;  5A2Q Q;  1XXE A;  1XMQ E;  2PNZ B;  3PS3 A;  2UUB I;  3H4L A;  4WUB A;  3ZM7 A;  3JAM C;  4ISA A;  4DUZ E;  5DRP A;  4WUC A;  4DR4 E;  2HFS A;  2E1R A;  4LF8 I;  4NXN I;  1Y4U A;  4LF4 I;  3U1K A;  3NZK A;  4IZJ A;  4LF6 I;  3J81 C;  4JI1 E;  4JI4 E;  3QT6 A;  1H7S A;  2HK2 A;  1U2R A;  2BA1 D;  2DEJ A;  2DEI A;  1KIJ A;  2C39 A;  2JE6 A;  4X62 I;  1IBK I;  4MQY A;  2UXC I;  1Y5Y A;  1HNZ E;  1HNW I;  4JI6 I;  2O1V A;  4LOM A;  3WU4 A;  2VES A;  3P3C A;  5C0X B;  3K85 A;  1D6T A;  3H1C A;  1XMO I;  1NHJ A;  3K1J A;  5LL6 R;  4DPU A;  3OTO E;  4USK A;  2X7I A;  4N3O A;  4B3R I;  3WU6 A;  4QNK A;  1BKN A;  4JI0 E;  1IBL E;  1A6F A;  4DV3 I;  1S4E A;  2UXB E;  2JEB B;  4B3S I;  4Z7Y A;  4MU4 A;  1XNQ E;  1B62 A;  1KTV A;  3CDJ A;  2UUB E;  2Q2E B;  1MU5 A;  2X36 A;  4PU9 A;  3M7N G;  3JAM Q;  1UDO A;  5K36 B;  1USU A;  1H72 C;  1FJG E;  4IFD A;  2OI2 A;  4FW5 A;  3UHM A;  5BR8 I;  3B82 A;  3Q1Q A;  1HNX I;  4DV7 I;  4LF8 E;  3D4J A;  4NXN E;  2AE8 A;  4LF6 E;  1XHK A;  3J81 Q;  3GLL A;  2WNR B;  2IES A;  4DV1 I;  2ZBK B;  4FW9 A;  1N33 I;  3V5R A;  4QNJ A;  2HHH E;  3L7Z B;  4FW3 A;  4DR2 I;  4X62 E;  2UXC E;  4IFD E;  3PYG A;  1HNW E;  3M85 D;  4JI6 E;  1Y60 A;  2V8P A;  4LCF A;  3J80 C;  4DPW A;  4B3M I;  2R42 A;  1RRE A;  3HUL A;  1N32 I;  2GQ0 A;  4B3R E;  2LJP A;  2VQF I;  5DRR A;  1ZXM A;  5EKW A;  5C0X F;  1ZM4 A;  2WW4 A;  4X66 I;  1Z0T A;  2C38 A;  3PS2 A;  4X65 I;  4USM A;  1ZM9 A;  1R6M A;  4DR5 I;  2BV3 A;  1J5E I;  4DV0 I;  3PS1 A;  3P06 A;  4GKJ I;  2PO1 A;  3CWV A;  5BR8 E;  1P42 A;  1HNX E;  4OO1 C;  4B3T I;  5DNL A;  2O1T A;  1VI7 A;  4IZJ B;  4OKG A;  1PIE A;  4OO1 A;  4JI5 E;  1Z0C A;  4JI3 I;  4BA2 A;  1N33 E;  3HKM A;  3LTO A;  4NXM E;  2CGE A;  2NN6 F;  5IWA I;  4JI7 I;  4HYM A;  4DR2 E;  1Z0E A;  3Q6M A;  2BR2 A;  4GQU A;  4DU8 A;  3U1Y A;  4KHP I;  2UUC I;  3T1H I;  4JI8 I;  5IT9 C;  4OX9 E;  3J80 Q;  4HAC A;  4LFC I;  5ELW A;  4LF5 I;  4YY3 I;  2CVE A;  1Z0G A;  3GCM A;  1N32 E;  1UDQ A;  2Z5B B;  4AM3 A;  2VQF E;  2WP8 A;  2BA1 G;  3T1Y I;  3PYD A;  4DR7 I;  3DD6 A;  3ZZ0 A;  1PVG A;  2F4V I;  2BM0 A;  4X66 E;  4PRX A;  5JEA C;  3Q6N A;  1YH8 A;  1N36 I;  4DR6 I;  4JYA I;  5JEA A;  4DV2 I;  2JEA A;  1J5E E;  1UEK A;  4DV0 E;  1Z5C A;  4IFD B;  2PO0 A;  4GKJ E;  4JV5 I;  2E5L I;  1HK7 A;  1KKH A;  1OJ4 A;  4U3D A;  4LF7 I; 
#chains in the Genus database with same CATH homology
 2WP8 B;  3GLL A;  2WNR B;  2BA0 G;  2PNZ A;  1UDS A;  4OO1 D;  3L7Z B;  5K36 E;  4IFD E;  1OYP A;  3M85 D;  1E3P A;  3GME A;  4OO1 F;  2NN6 E;  2C37 B;  5JEA B;  2JEA B;  5K36 D;  4IFD D;  3B4T A;  2NN6 B;  4NBQ A;  4AID A;  2PO2 B;  2NN6 D;  5K36 F;  5C0X F;  2C38 A;  1E3H A;  5C0X C;  2PNZ B;  4AIM A;  5JEA E;  1R6M A;  4BA1 A;  4BA1 B;  3M7N D;  2PO1 A;  4OO1 C;  5JEA D;  3U1K A;  3CDI A;  4OO1 A;  5JEA F;  2BA1 D;  2JEB A;  4BA2 A;  4IFD F;  2C38 B;  1UDN A;  5K36 C;  3HKM A;  2C39 A;  2NN6 F;  2JE6 A;  3KRN A;  3M85 G;  4IFD C;  2BR2 A;  5K36 A;  5C0X A;  2NN6 C;  5C0X B;  3H1C A;  2PO1 B;  3GCM A;  1UDQ A;  4AM3 A;  2WP8 A;  2BA1 G;  2WNR A;  3DD6 A;  1OYR A;  4OO1 B;  3L7Z A;  2JEB B;  4BA2 B;  1R6L A;  5C0X E;  2BA0 D;  3CDJ A;  2C39 B;  5JEA C;  1OYS A;  2JE6 B;  2C37 A;  2BR2 B;  3M7N G;  1UDO A;  5K36 B;  5JEA A;  2JEA A;  4IFD A;  4IFD B;  5C0X D;  2PO0 A;  2PO0 B;  2NN6 A;  4OO1 E;  2PO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...