4OO1D

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
221
structure length
221
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 55
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1D00
2NN6D 2PO0A 2JEBA 3B4TA 2PO1B 2PO2A 2WNRA 4BA1A 5JEAD 1OYPA 4BA1B 4AIDA 2NN6F 2WP8B 2NN6E 2JEBB 2C38A 2NN6A 3M85G 3GMEA 2WNRB 2PO2B 5C0XC 5K36B 2BA1D 5K36D 2BA0G 1UDQA 2JE6B 1E3PA 3GCMA 3L7ZA 4OO1C 3GLLA 4IFDD 5K36F 5C0XE 5C0XF 5JEAA 3L7ZB 1OYSA 4BA2B 1OYRA 4OO1B 4OO1D 3DD6A 1UDSA 5JEAC 5JEAE 3HKMA 2C38B 4AIMA 5C0XB 5K36C 4OO1F 1R6MA 5K36E 4IFDB 2JEAA 5K36A 2JEAB 2PO0B 1UDOA 2C39B 2PNZA 2WP8A 3H1CA 4IFDA 2BR2B 1R6LA 2BA1G 2C37A 3M7NG 4IFDF 5JEAF 5C0XA 3M85D 2PO1A 4OO1E 3KRNA 4OO1A 3CDJA 4AM3A 5JEAB 1UDNA 1E3HA 4BA2A 3CDIA 3U1KA 4NBQA 2NN6C 5C0XD 4IFDE 4IFDC 2C37B 2BA0D 2BR2A 3M7ND 2JE6A 2PNZB 2NN6B 2C39A
chains in the Genus database with same CATH superfamily
2PO0A 2IOPA 3B4TA 4IZKB 3JAMQ 3T1YI 2PO1B 2PO2A 3V5RA 2WNRA 4IZJB 1ZXMA 2UUBE 3GONA 1OYPA 1N33I 5GMDA 3LNUA 4X66E 2VESA 4DV1I 4AIDA 2BM0A 1H7UA 2WP8B 4HY1A 4LFCE 3M85G 4ISAA 4YHHI 1J5EI 2WNRB 2UU9E 2PO2B 2X7IA 5K36B 4K0KI 4GQUA 3OTOE 2BA0G 1K47A 3GCMA 2CG9A 5FLXQ 5LMUI 3H4LA 1BKNA 4JI0I 4Z7YA 3NZKA 1PVGA 1Y6ZA 4X64E 1D6TA 4MYUA 1Y4UA 2V2VA 2VF3A 5C0XF 2IOQA 4KQVA 4LF5I 2HHHI 4BA2B 1OYRA 1HNWE 2X36A 1HNXE 1UEKA 4OO1D 2PNLA 4DV7E 4DR4I 3V2UC 4DR6E 4N3OA 3DD6A 1UDSA 4MYTA 3HKMA 3ZZTA 4AIMA 1VISA 4DUYI 1FNMA 1FJGI 2UXDI 4USKA 1RHYA 1I94I 2VQEI 1N32E 1MU5A 4ED4A 1Z5AA 5LMNE 4MDTA 4IFDB 1ZM3A 4DR3I 4IZJD 4DPYA 2PNZA 1IBKE 1KIJA 2BR2B 1HK7A 2CVEA 3M6AA 3M7NG 2V34A 3U1YA 4QNKA 4DR7E 3PRYA 2BV3A 4OZEA 4UTGA 1KKHA 2E5LE 4OO1E 5BR8E 4RPFA 1IBME 3Q6NA 2CZ9A 2F4VE 1XXEA 4P7AA 1HR0E 3CDIA 3U1KA 2ZM6I 4JI5E 4NBQA 3WU6A 2NN6C 4MU3A 4JI0E 1QZRA 4X62E 5A2QQ 4LF9I 4JG4A 4FWGA 4B3ME 4X64I 4DPTA 3M7ND 3K85A 3P3EA 4JI7E 2EFGA 2JE6A 1USUA 1N36I 3QT5A 4IS9A 4EMDA 2UUCI 1HNXI 1N34E 4DV7I 4LCHA 3QT6A 4DR4E 2O1VA 4DPWA 1S16A 1FWLA 2CGEA 5DNXA 4DV2I 3P3GA 4DV4E 4IZKA 2NN6A 1RR9A 4DU8A 4JI6I 4XTJA 1NHIA 5GMEA 1E3PA 2UXCE 2R3VA 4HXZA 4JI2E 4GKKE 3L7ZA 2Z5CB 2AJ4A 3WU3A 1FKAE 1ELOA 3ZKDA 2GO3A 5FWKA 3J7AM 1H7SA 4NXMI 5K36F 4LCFA 3T1HE 1Z0CA 5JEAA 4LFBI 2JT2A 1NHHA 4WUCA 2F1DA 4DUZI 1XMQE 3Q1QA 4OO1B 1H74A 4HACB 2V2ZA 1Z59A 2GS8A 1ZM2A 4QNJA 4JYAE 2UUAE 1H73A 4LF4E 4FW5A 1IBMI 4KHPE 4LF8E 5JEAC 3PS3A 2C38B 5C0XB 5DRQA 4JI1I 2J65A 4LF6E 2O1UA 5A2QC 4MU0A 2IESA 4DV6I 4LF7E 1R6MA 5DRRA 2Q2EB 5K36A 1KTVA 4DR5I 4DXLA 4DR2I 1UDOA 2UUBI 3B8HA 4JI7I 1N33E 2WP8A 3PYDA 3J80Q 4FW4A 3HULA 1Z0BA 2C37A 1N34I 4LCGA 3M85D 3LTOA 5IWAI 1HNZI 2PO1A 4X65E 1RREA 4FW9A 1A6FA 5IT9Q 4FN5A 2NPFA 1U2RA 4JI6E 4LOMA 1Z5BA 3J7AG 2O1TA 1B62A 5C0XD 2HHHE 2AE8A 4MU4A 4IFDE 1DARA 4FW6A 2C37B 2BA0D 4PRVA 1XNRE 4JV5I 4B3RI 2BM1A 1YH8A 4LFBE 1ZXNA 4DV5E 4AQYE 2UUAI 4BA1A 5JEAD 4JI8I 4FW7A 4LF8I 2UXBE 2NN6F 4DV0I 2NN6E 1KVKA 2JEBB 4DU7A 4B3SI 1MX0A 2C38A 1IBLI 3GMEA 4DR1E 4OX9E 4DV6E 4FWDA 2O3ZA 4PRXA 1IBKI 5C0XC 2V2QA 5K36D 4YY3E 4HACA 5ELWA 4J3DA 4DR5E 4DR2E 1FWKA 1Z0EA 4OO1C 3F0NA 4ZVIA 2E5LI 1Z0GA 5EKWA 5C0XE 3PYFA 3L7ZB 3QT8A 5IWAE 2A2CA 4OKGA 1HNZE 4X65I 4LF7I 2F4VI 3B82A 1HR0I 2E1RA 4DPXA 1S4EA 2VQFI 3T1YE 4LF9E 4B3MI 4LFAE 2HFUA 3ZZUA 3K1JA 5K36E 2JEAA 4JI4I 2JEAB 1XNRI 4B3RE 4JV5E 4YHHE 3H1CA 4K0KE 1R6LA 3P06A 5FLXC 4DV2E 4DV4I 4DV5I 1Y5YA 4AQYI 4IFDF 5JEAF 1EI1A 4DPUA 2V8PA 2UXBI 2Z5BA 3P76A 2OI2A 3KRNA 1Z0TA 1N0UA 3CDJA 4AM3A 1PKPA 2UXCI 4JI2I 1ZM4A 4LF5E 4DR1I 2A2DA 4OX9I 1HNWI 1E3HA 3Q6MA 3JAMC 1XMOE 3PS1A 4NXME 4I3HA 3T1HI 4GKJI 5DNLA 2HKEA 4DUZE 1XMQI 2BR2A 2ZITA 4DUYE 5DRPA 2PNZB 2NN6D 4FWHA 2JEBA 4PU9A 4DR3E 2LJPA 2Z5BB 1XNQI 4FW3A 1WUUA 4JI1E 3J81C 3PYEA 4LF6I 3PYGA 1EA6A 4BA1B 1NZ0A 2PNMA 3ZZ0A 2VQFE 4LPFA 1Y4SA 4UT4A 2GQ0A 4DR7I 4JI3I 4LFAI 1P42A 3ZM7A 3WU4A 1XHKA 2BA1D 1VI7A 4NXNI 4MU1A 3J80C 1OJ4A 4JI4E 1UDQA 2JE6B 5BR8I 2Z5EA 3B78A 1H72C 4USMA 4B3TE 3GLLA 4U3BA 4IFDD 2GO4A 3P3CA 4R1FA 2ZM6E 4DV3E 1ZM9A 4JI5I 2IERA 1OYSA 3K17A 3LPSA 4X62I 2XEXA 1USVA 4WUBA 4U3DA 1N36E 5JEAE 3CWVA 4X66I 2UUCE 5K36C 4DV1E 1XMOI 1YHCA 3PS2A 1Y60A 4LFCI 4OO1F 2J7KA 1J5EE 3D4JA 2UU9I 2HKJA 4GKJE 2HFSA 3UHMA 4IZJA 2O1WA 3ZKBA 3OTOI 2PO0B 2C39B 5LMUE 1MG7A 4JI8E 3J81Q 2R42A 4IFDA 1PIEA 2BA1G 1XNQE 4DV0E 5C0XA 4GKKI 4B3SE 1IBLE 1Z0VA 1Z5CA 4Z7CA 4HYMA 1NHJA 2WW4A 3WU5A 1B63A 4YY3I 4OO1A 4DR6I 1FI4A 4JI3E 4P52A 4M1KA 5JEAB 1UDNA 4WUDA 4NXNE 4BA2A 2DEJA 1Z0WA 4JYAI 2HK3A 4URLA 4LF4I 1FJGE 2Z5CA 3HJCA 1I94E 4KHPI 2UXDE 2VQEE 2ZBKB 1N32I 5DROA 5LMNI 4B3TI 4IFDC 5LL6R 2DEIA 4DV3I 5L3JA 5IT9C 1N0VC 2HK2A 4MQYA 5EL9A 3QT7A 2NN6B 2C39A
chains in the Genus database with same CATH topology
2NN6D 2PO0A 2JEBA 3B4TA 2PO1B 2PO2A 2WNRA 4BA1A 5JEAD 1OYPA 4BA1B 4AIDA 2NN6F 2WP8B 2NN6E 2JEBB 2C38A 2NN6A 3M85G 3GMEA 2WNRB 2PO2B 5C0XC 5K36B 2BA1D 5K36D 2BA0G 1UDQA 2JE6B 1E3PA 3GCMA 3L7ZA 4OO1C 3GLLA 4IFDD 5K36F 5C0XE 5C0XF 5JEAA 3L7ZB 1OYSA 4BA2B 1OYRA 4OO1B 4OO1D 3DD6A 1UDSA 5JEAC 5JEAE 3HKMA 2C38B 4AIMA 5C0XB 5K36C 4OO1F 1R6MA 5K36E 4IFDB 2JEAA 5K36A 2JEAB 2PO0B 1UDOA 2C39B 2PNZA 2WP8A 3H1CA 4IFDA 2BR2B 1R6LA 2BA1G 2C37A 3M7NG 4IFDF 5JEAF 5C0XA 3M85D 2PO1A 4OO1E 3KRNA 4OO1A 3CDJA 4AM3A 5JEAB 1UDNA 1E3HA 4BA2A 3CDIA 3U1KA 4NBQA 2NN6C 5C0XD 4IFDE 4IFDC 2C37B 2BA0D 2BR2A 3M7ND 2JE6A 2PNZB 2NN6B 2C39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 D;  2PO0 A;  2JEB A;  3B4T A;  2PO1 B;  2PO2 A;  2WNR A;  4BA1 A;  5JEA D;  1OYP A;  4BA1 B;  4AID A;  2NN6 F;  2WP8 B;  2NN6 E;  2JEB B;  2C38 A;  2NN6 A;  3M85 G;  3GME A;  2WNR B;  2PO2 B;  5C0X C;  5K36 B;  2BA1 D;  5K36 D;  2BA0 G;  1UDQ A;  2JE6 B;  1E3P A;  3GCM A;  3L7Z A;  4OO1 C;  3GLL A;  4IFD D;  5K36 F;  5C0X E;  5C0X F;  5JEA A;  3L7Z B;  1OYS A;  4BA2 B;  1OYR A;  4OO1 B;  4OO1 D;  3DD6 A;  1UDS A;  5JEA C;  5JEA E;  3HKM A;  2C38 B;  4AIM A;  5C0X B;  5K36 C;  4OO1 F;  1R6M A;  5K36 E;  4IFD B;  2JEA A;  5K36 A;  2JEA B;  2PO0 B;  1UDO A;  2C39 B;  2PNZ A;  2WP8 A;  3H1C A;  4IFD A;  2BR2 B;  1R6L A;  2BA1 G;  2C37 A;  3M7N G;  4IFD F;  5JEA F;  5C0X A;  3M85 D;  2PO1 A;  4OO1 E;  3KRN A;  4OO1 A;  3CDJ A;  4AM3 A;  5JEA B;  1UDN A;  1E3H A;  4BA2 A;  3CDI A;  3U1K A;  4NBQ A;  2NN6 C;  5C0X D;  4IFD E;  4IFD C;  2C37 B;  2BA0 D;  2BR2 A;  3M7N D;  2JE6 A;  2PNZ B;  2NN6 B;  2C39 A; 
#chains in the Genus database with same CATH topology
 2PO0 A;  2IOP A;  3B4T A;  4IZK B;  3JAM Q;  3T1Y I;  2PO1 B;  2PO2 A;  3V5R A;  2WNR A;  4IZJ B;  1ZXM A;  2UUB E;  3GON A;  1OYP A;  1N33 I;  5GMD A;  3LNU A;  4X66 E;  2VES A;  4DV1 I;  4AID A;  2BM0 A;  1H7U A;  2WP8 B;  4HY1 A;  4LFC E;  3M85 G;  4ISA A;  4YHH I;  1J5E I;  2WNR B;  2UU9 E;  2PO2 B;  2X7I A;  5K36 B;  4K0K I;  4GQU A;  3OTO E;  2BA0 G;  1K47 A;  3GCM A;  2CG9 A;  5FLX Q;  5LMU I;  3H4L A;  1BKN A;  4JI0 I;  4Z7Y A;  3NZK A;  1PVG A;  1Y6Z A;  4X64 E;  1D6T A;  4MYU A;  1Y4U A;  2V2V A;  2VF3 A;  5C0X F;  2IOQ A;  4KQV A;  4LF5 I;  2HHH I;  4BA2 B;  1OYR A;  1HNW E;  2X36 A;  1HNX E;  1UEK A;  4OO1 D;  2PNL A;  4DV7 E;  4DR4 I;  3V2U C;  4DR6 E;  4N3O A;  3DD6 A;  1UDS A;  4MYT A;  3HKM A;  3ZZT A;  4AIM A;  1VIS A;  4DUY I;  1FNM A;  1FJG I;  2UXD I;  4USK A;  1RHY A;  1I94 I;  2VQE I;  1N32 E;  1MU5 A;  4ED4 A;  1Z5A A;  5LMN E;  4MDT A;  4IFD B;  1ZM3 A;  4DR3 I;  4IZJ D;  4DPY A;  2PNZ A;  1IBK E;  1KIJ A;  2BR2 B;  1HK7 A;  2CVE A;  3M6A A;  3M7N G;  2V34 A;  3U1Y A;  4QNK A;  4DR7 E;  3PRY A;  2BV3 A;  4OZE A;  4UTG A;  1KKH A;  2E5L E;  4OO1 E;  5BR8 E;  4RPF A;  1IBM E;  3Q6N A;  2CZ9 A;  2F4V E;  1XXE A;  4P7A A;  1HR0 E;  3CDI A;  3U1K A;  2ZM6 I;  4JI5 E;  4NBQ A;  3WU6 A;  2NN6 C;  4MU3 A;  4JI0 E;  1QZR A;  4X62 E;  5A2Q Q;  4LF9 I;  4JG4 A;  4FWG A;  4B3M E;  4X64 I;  4DPT A;  3M7N D;  3K85 A;  3P3E A;  4JI7 E;  2EFG A;  2JE6 A;  1USU A;  1N36 I;  3QT5 A;  4IS9 A;  4EMD A;  2UUC I;  1HNX I;  1N34 E;  4DV7 I;  4LCH A;  3QT6 A;  4DR4 E;  2O1V A;  4DPW A;  1S16 A;  1FWL A;  2CGE A;  5DNX A;  4DV2 I;  3P3G A;  4DV4 E;  4IZK A;  2NN6 A;  1RR9 A;  4DU8 A;  4JI6 I;  4XTJ A;  1NHI A;  5GME A;  1E3P A;  2UXC E;  2R3V A;  4HXZ A;  4JI2 E;  4GKK E;  3L7Z A;  2Z5C B;  2AJ4 A;  3WU3 A;  1FKA E;  1ELO A;  3ZKD A;  2GO3 A;  5FWK A;  3J7A M;  1H7S A;  4NXM I;  5K36 F;  4LCF A;  3T1H E;  1Z0C A;  5JEA A;  4LFB I;  2JT2 A;  1NHH A;  4WUC A;  2F1D A;  4DUZ I;  1XMQ E;  3Q1Q A;  4OO1 B;  1H74 A;  4HAC B;  2V2Z A;  1Z59 A;  2GS8 A;  1ZM2 A;  4QNJ A;  4JYA E;  2UUA E;  1H73 A;  4LF4 E;  4FW5 A;  1IBM I;  4KHP E;  4LF8 E;  5JEA C;  3PS3 A;  2C38 B;  5C0X B;  5DRQ A;  4JI1 I;  2J65 A;  4LF6 E;  2O1U A;  5A2Q C;  4MU0 A;  2IES A;  4DV6 I;  4LF7 E;  1R6M A;  5DRR A;  2Q2E B;  5K36 A;  1KTV A;  4DR5 I;  4DXL A;  4DR2 I;  1UDO A;  2UUB I;  3B8H A;  4JI7 I;  1N33 E;  2WP8 A;  3PYD A;  3J80 Q;  4FW4 A;  3HUL A;  1Z0B A;  2C37 A;  1N34 I;  4LCG A;  3M85 D;  3LTO A;  5IWA I;  1HNZ I;  2PO1 A;  4X65 E;  1RRE A;  4FW9 A;  1A6F A;  5IT9 Q;  4FN5 A;  2NPF A;  1U2R A;  4JI6 E;  4LOM A;  1Z5B A;  3J7A G;  2O1T A;  1B62 A;  5C0X D;  2HHH E;  2AE8 A;  4MU4 A;  4IFD E;  1DAR A;  4FW6 A;  2C37 B;  2BA0 D;  4PRV A;  1XNR E;  4JV5 I;  4B3R I;  2BM1 A;  1YH8 A;  4LFB E;  1ZXN A;  4DV5 E;  4AQY E;  2UUA I;  4BA1 A;  5JEA D;  4JI8 I;  4FW7 A;  4LF8 I;  2UXB E;  2NN6 F;  4DV0 I;  2NN6 E;  1KVK A;  2JEB B;  4DU7 A;  4B3S I;  1MX0 A;  2C38 A;  1IBL I;  3GME A;  4DR1 E;  4OX9 E;  4DV6 E;  4FWD A;  2O3Z A;  4PRX A;  1IBK I;  5C0X C;  2V2Q A;  5K36 D;  4YY3 E;  4HAC A;  5ELW A;  4J3D A;  4DR5 E;  4DR2 E;  1FWK A;  1Z0E A;  4OO1 C;  3F0N A;  4ZVI A;  2E5L I;  1Z0G A;  5EKW A;  5C0X E;  3PYF A;  3L7Z B;  3QT8 A;  5IWA E;  2A2C A;  4OKG A;  1HNZ E;  4X65 I;  4LF7 I;  2F4V I;  3B82 A;  1HR0 I;  2E1R A;  4DPX A;  1S4E A;  2VQF I;  3T1Y E;  4LF9 E;  4B3M I;  4LFA E;  2HFU A;  3ZZU A;  3K1J A;  5K36 E;  2JEA A;  4JI4 I;  2JEA B;  1XNR I;  4B3R E;  4JV5 E;  4YHH E;  3H1C A;  4K0K E;  1R6L A;  3P06 A;  5FLX C;  4DV2 E;  4DV4 I;  4DV5 I;  1Y5Y A;  4AQY I;  4IFD F;  5JEA F;  1EI1 A;  4DPU A;  2V8P A;  2UXB I;  2Z5B A;  3P76 A;  2OI2 A;  3KRN A;  1Z0T A;  1N0U A;  3CDJ A;  4AM3 A;  1PKP A;  2UXC I;  4JI2 I;  1ZM4 A;  4LF5 E;  4DR1 I;  2A2D A;  4OX9 I;  1HNW I;  1E3H A;  3Q6M A;  3JAM C;  1XMO E;  3PS1 A;  4NXM E;  4I3H A;  3T1H I;  4GKJ I;  5DNL A;  2HKE A;  4DUZ E;  1XMQ I;  2BR2 A;  2ZIT A;  4DUY E;  5DRP A;  2PNZ B;  2NN6 D;  4FWH A;  2JEB A;  4PU9 A;  4DR3 E;  2LJP A;  2Z5B B;  1XNQ I;  4FW3 A;  1WUU A;  4JI1 E;  3J81 C;  3PYE A;  4LF6 I;  3PYG A;  1EA6 A;  4BA1 B;  1NZ0 A;  2PNM A;  3ZZ0 A;  2VQF E;  4LPF A;  1Y4S A;  4UT4 A;  2GQ0 A;  4DR7 I;  4JI3 I;  4LFA I;  1P42 A;  3ZM7 A;  3WU4 A;  1XHK A;  2BA1 D;  1VI7 A;  4NXN I;  4MU1 A;  3J80 C;  1OJ4 A;  4JI4 E;  1UDQ A;  2JE6 B;  5BR8 I;  2Z5E A;  3B78 A;  1H72 C;  4USM A;  4B3T E;  3GLL A;  4U3B A;  4IFD D;  2GO4 A;  3P3C A;  4R1F A;  2ZM6 E;  4DV3 E;  1ZM9 A;  4JI5 I;  2IER A;  1OYS A;  3K17 A;  3LPS A;  4X62 I;  2XEX A;  1USV A;  4WUB A;  4U3D A;  1N36 E;  5JEA E;  3CWV A;  4X66 I;  2UUC E;  5K36 C;  4DV1 E;  1XMO I;  1YHC A;  3PS2 A;  1Y60 A;  4LFC I;  4OO1 F;  2J7K A;  1J5E E;  3D4J A;  2UU9 I;  2HKJ A;  4GKJ E;  2HFS A;  3UHM A;  4IZJ A;  2O1W A;  3ZKB A;  3OTO I;  2PO0 B;  2C39 B;  5LMU E;  1MG7 A;  4JI8 E;  3J81 Q;  2R42 A;  4IFD A;  1PIE A;  2BA1 G;  1XNQ E;  4DV0 E;  5C0X A;  4GKK I;  4B3S E;  1IBL E;  1Z0V A;  1Z5C A;  4Z7C A;  4HYM A;  1NHJ A;  2WW4 A;  3WU5 A;  1B63 A;  4YY3 I;  4OO1 A;  4DR6 I;  1FI4 A;  4JI3 E;  4P52 A;  4M1K A;  5JEA B;  1UDN A;  4WUD A;  4NXN E;  4BA2 A;  2DEJ A;  1Z0W A;  4JYA I;  2HK3 A;  4URL A;  4LF4 I;  1FJG E;  2Z5C A;  3HJC A;  1I94 E;  4KHP I;  2UXD E;  2VQE E;  2ZBK B;  1N32 I;  5DRO A;  5LMN I;  4B3T I;  4IFD C;  5LL6 R;  2DEI A;  4DV3 I;  5L3J A;  5IT9 C;  1N0V C;  2HK2 A;  4MQY A;  5EL9 A;  3QT7 A;  2NN6 B;  2C39 A; 
#chains in the Genus database with same CATH homology
 2NN6 D;  2PO0 A;  2JEB A;  3B4T A;  2PO1 B;  2PO2 A;  2WNR A;  4BA1 A;  5JEA D;  1OYP A;  4BA1 B;  4AID A;  2NN6 F;  2WP8 B;  2NN6 E;  2JEB B;  2C38 A;  2NN6 A;  3M85 G;  3GME A;  2WNR B;  2PO2 B;  5C0X C;  5K36 B;  2BA1 D;  5K36 D;  2BA0 G;  1UDQ A;  2JE6 B;  1E3P A;  3GCM A;  3L7Z A;  4OO1 C;  3GLL A;  4IFD D;  5K36 F;  5C0X E;  5C0X F;  5JEA A;  3L7Z B;  1OYS A;  4BA2 B;  1OYR A;  4OO1 B;  4OO1 D;  3DD6 A;  1UDS A;  5JEA C;  5JEA E;  3HKM A;  2C38 B;  4AIM A;  5C0X B;  5K36 C;  4OO1 F;  1R6M A;  5K36 E;  4IFD B;  2JEA A;  5K36 A;  2JEA B;  2PO0 B;  1UDO A;  2C39 B;  2PNZ A;  2WP8 A;  3H1C A;  4IFD A;  2BR2 B;  1R6L A;  2BA1 G;  2C37 A;  3M7N G;  4IFD F;  5JEA F;  5C0X A;  3M85 D;  2PO1 A;  4OO1 E;  3KRN A;  4OO1 A;  3CDJ A;  4AM3 A;  5JEA B;  1UDN A;  1E3H A;  4BA2 A;  3CDI A;  3U1K A;  4NBQ A;  2NN6 C;  5C0X D;  4IFD E;  4IFD C;  2C37 B;  2BA0 D;  2BR2 A;  3M7N D;  2JE6 A;  2PNZ B;  2NN6 B;  2C39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...