4LF4I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf4I00
2A2DA 3ZZUA 4DR2I 4KHPE 4DR1E 1Z0BA 1PKPA 5GMDA 4X64E 4NXNI 4DR7I 4GKKI 4JYAE 3V2UC 4Z7YA 1ZM9A 4DUZI 1IBME 4DPUA 4PRVA 2NPFA 1KIJA 4JV5I 4DU7A 1N34E 3OTOI 2UUAI 3J80Q 2X36A 2VQFE 3QT5A 1XMOE 1Z5CA 1MG7A 3T1HE 1HNZE 1NHIA 1WUUA 4RPFA 4DPXA 1HNXE 2R3VA 2X7IA 3WU5A 1XNRI 4B3RI 1RREA 4YY3I 2UUCI 2ZBKB 4LF7E 5LMUI 1EI1A 3LTOA 4JI4I 1ZM2A 4DV0E 1NZ0A 3K17A 4DUYI 4DV2E 4HY1A 1Z0TA 3PYDA 4JI7E 2ZM6E 1S16A 4JI3I 1HNWI 1N32I 4GKJE 1K47A 4JI1E 4KHPI 4MYUA 3Q1QA 2VQEI 4NXME 4DR7E 4DR5E 4HACA 4K0KI 4GKKE 1IBKI 2UUBI 2DEIA 1EA6A 4URLA 4ED4A 1Z0CA 1N34I 2E5LE 4LFAI 2VQFI 2V8PA 1I94I 1XMOI 1FWKA 3PYFA 1HNZI 1B62A 5A2QQ 2HKJA 2R42A 1D6TA 1HNXI 3J7AM 3F0NA 2HKEA 4HACB 2Q2EB 4MYTA 4LF7I 5LMUE 2V2VA 3JAMQ 4DV0I 4JI4E 4DV2I 4HXZA 2UXDE 3B8HA 1ELOA 1MU5A 5LL6R 1HR0E 4I3HA 3CWVA 2UXBE 2ZM6I 3V5RA 4B3TI 1N33I 4JI3E 4LFBI 1HNWE 4JI1I 2BV3A 5LMNE 2UXCE 2XEXA 3ZM7A 2VQEE 4NXMI 5IT9Q 4DR5I 2V2ZA 4WUBA 4K0KE 1IBKE 2UUBE 2HFSA 4DU8A 4FWHA 4JI0I 2ZITA 2E5LI 4DPTA 4LFAE 4UT4A 4X62E 4DV4E 2BM0A 3J80C 1I94E 1Z0GA 1ZXNA 4FWDA 3WU4A 4HYMA 3PYGA 1BKNA 4LF4E 3LNUA 4WUCA 1XHKA 4DXLA 2E1RA 5IWAE 1XNQI 4EMDA 1H7SA 1B63A 1A6FA 2UXDI 1HR0I 2VF3A 4JI8E 4X65I 1OJ4A 3ZKBA 4B3SI 2J7KA 4FW9A 4DV6E 3WU3A 4GKJI 4P7AA 2UXBI 3J7AG 4DV5E 1Z0EA 4LF8I 4DV7I 3QT6A 2HK3A 4B3TE 1N33E 4LFBE 5LMNI 2V2QA 2UXCI 1N36I 1VISA 4FN5A 4DR4E 4OX9I 1S4EA 2GS8A 4UTGA 4JI0E 1FJGI 3QT7A 1RR9A 4AQYI 4X62I 4DV4I 1FNMA 2HHHI 4R1FA 1NHJA 2HFUA 4B3ME 4P52A 1H74A 5A2QC 4DR6I 4DPYA 4DV1I 1ZM4A 1H73A 2HK2A 3B78A 4DV3I 3ZZTA 4LF4I 4KQVA 4USKA 5IWAI 1XNQE 3B82A 1NHHA 2DEJA 5BR8I 2LJPA 4DR3I 3JAMC 1KVKA 1QZRA 4JI8I 2F4VE 1MX0A 4X65E 4YHHI 4DV6I 4B3SE 4WUDA 4X66I 3H4LA 5L3JA 4DV5I 4LF8E 4DV7E 3K1JA 1N36E 1Z5AA 4JI5E 4DR4I 3LPSA 4OX9E 1J5EI 2BM1A 2UU9E 3ZZ0A 5IT9C 1FJGE 4AQYE 4LF9I 2HHHE 1KTVA 4B3MI 1U2RA 3HULA 2V34A 2WW4A 3QT8A 4DR6E 1N0VC 4JI6I 4DV1E 4PU9A 4DV3E 2EFGA 5BR8E 4DR3E 5FLXQ 4LF6I 4JG4A 1UEKA 3J81Q 2F4VI 3WU6A 2AJ4A 5FLXC 4YHHE 4X66E 3J81C 3M6AA 1KKHA 1XMQI 4LFCE 3GONA 4JI5I 1J5EE 3T1YI 2UU9I 4LF5E 1H7UA 4JI2E 4FWGA 1ZXMA 1Z59A 1IBLE 2CZ9A 4DR2E 4LF9E 4DR1I 4X64I 1ZM3A 4NXNE 1H72C 4JYAI 1PVGA 4ZVIA 1IBMI 4DUZE 4JI6E 4JV5E 2OI2A 3OTOE 2UUAE 1Z0WA 3T1HI 1Z5BA 4USMA 3PYEA 4PRXA 4LF6E 1FI4A 4XTJA 1DARA 1XNRE 4B3RE 1XMQE 4YY3E 4LFCI 2UUCE 1Z0VA 4DUYE 3T1YE 5GMEA 1PIEA 4LF5I 4M1KA 3D4JA 1N0UA 1FWLA 2A2CA 3ZKDA 4JI2I 4JI7I 4DPWA 1FKAE 1IBLI 4Z7CA 1N32E
chains in the Genus database with same CATH superfamily
2A2DA 3ZZUA 4DR2I 5JEAA 4KHPE 4DR1E 1Z0BA 1PKPA 5GMDA 4X64E 2NN6D 4NXNI 2Z5EA 4DR7I 2NN6E 2WNRB 3Q6NA 4GKKI 3V2UC 4JYAE 4Z7YA 1ZM9A 4DUZI 1IBME 4DPUA 3GMEA 4PRVA 2NPFA 1KIJA 4AIMA 4JV5I 1YH8A 4DU7A 2O3ZA 1N34E 3OTOI 2UUAI 2BA0G 3J80Q 2X36A 2F1DA 2VQFE 3QT5A 1XMOE 3P3EA 1Z5CA 1MG7A 3T1HE 3NZKA 1HNZE 1NHIA 5K36A 3CDIA 1WUUA 1P42A 4RPFA 4DPXA 1HNXE 2R3VA 2X7IA 3WU5A 1XNRI 4B3RI 1RREA 2PO0A 5DROA 2BA1D 3U1KA 4YY3I 5C0XA 2ZBKB 2UUCI 5LMUI 1EI1A 3LTOA 4LF7E 5K36F 4JI4I 1ZM2A 3K17A 1NZ0A 4DUYI 4DV0E 4DV2E 4HY1A 1Y4UA 1Z0TA 3PYDA 1HK7A 4JI7E 5C0XF 5K36B 2ZM6E 1S16A 4JI3I 1HNWI 1N32I 4GKJE 1K47A 4JI1E 1Y4SA 4KHPI 4MYUA 4OO1A 3Q1QA 5EKWA 1R6MA 2VQEI 4BA1B 3H1CA 4NXME 4DR7E 4DR5E 4HACA 4K0KI 4GKKE 1IBKI 2UUBI 1EA6A 2DEIA 4URLA 5C0XB 4ED4A 1Z0CA 1N34I 1Y60A 2NN6A 2E5LE 4GQUA 4LFAI 5K36E 2VQFI 1E3PA 5DRRA 2V8PA 1I94I 1XMOI 1FWKA 1VI7A 3PYFA 1HNZI 1B62A 2Z5CA 5A2QQ 2HKJA 4IFDF 3PS2A 2R42A 3HKMA 1D6TA 1HNXI 3J7AM 3F0NA 4OO1B 5C0XE 2PO2A 2J65A 2HKEA 4HACB 2Q2EB 4MYTA 4LF7I 5LMUE 4IFDB 2V2VA 3M85D 3JAMQ 4DV0I 4JI4E 4DV2I 4HXZA 2JT2A 4MU4A 2UXDE 3B8HA 1Y6ZA 1ELOA 1MU5A 5DRQA 5LL6R 1HR0E 4I3HA 5DNXA 4OO1E 2JEBB 2Z5CB 3CWVA 2ZM6I 2UXBE 3V5RA 4B3TI 4QNKA 1N33I 4JI3E 4LFBI 1HNWE 4JI1I 2BV3A 5LMNE 2UXCE 2XEXA 4IFDD 1UDNA 2PO2B 4IFDE 3UHMA 1UDQA 3ZM7A 2VQEE 4NXMI 5IT9Q 4QNJA 4DR5I 2V2ZA 4WUBA 4K0KE 4FW3A 2GQ0A 2O1WA 1IBKE 2UUBE 2HFSA 4DU8A 3GLLA 4FWHA 4JI0I 2ZITA 4IZJD 2BA1G 2E5LI 4DPTA 4LFAE 4IZKB 4UT4A 4X62E 2BM0A 3P3CA 4DV4E 1E3HA 2O1VA 3J80C 1I94E 1Z0GA 1ZXNA 2PNMA 2WP8A 4FWDA 4NBQA 3WU4A 4HYMA 1R6LA 3PYGA 4BA1A 1BKNA 3PS3A 4FW4A 3DD6A 4LF4E 3LNUA 4WUCA 1XHKA 4DXLA 4BA2A 2E1RA 3P06A 4LCHA 5IWAE 2CVEA 1XNQI 4AM3A 4EMDA 2PNLA 1H7SA 1B63A 1A6FA 2UXDI 1XXEA 1HR0I 3B4TA 2VF3A 4JI8E 4X65I 1OJ4A 3ZKBA 4B3SI 2J7KA 4FW9A 4DV6E 3WU3A 4GKJI 4P7AA 2UXBI 3J7AG 2PNZB 4DV5E 1Z0EA 1YHCA 3CDJA 3QT6A 2HK3A 4DV7I 4LF8I 4B3TE 1N33E 2BA0D 4LFBE 2WP8B 4FW5A 5LMNI 2V2QA 2UXCI 1N36I 1VISA 4FN5A 4DR4E 4OX9I 1S4EA 4ISAA 2GS8A 4UTGA 4BA2B 4IFDA 2BR2A 4JI0E 1FJGI 3QT7A 1RR9A 4AQYI 4X62I 4DV4I 1FNMA 3M85G 2HHHI 4R1FA 1NHJA 4IZJA 4OKGA 2JEBA 1USVA 2HFUA 2PO1A 4B3ME 4P52A 5ELWA 1H74A 3PS1A 5A2QC 4DR6I 4DPYA 4DV1I 1ZM4A 1H73A 2HK2A 4OZEA 3B78A 4LOMA 1OYRA 4FW6A 4DV3I 3ZZTA 4LF4I 4KQVA 4USKA 2IESA 2BR2B 2Z5BA 5IWAI 1XNQE 3B82A 1NHHA 2DEJA 5BR8I 2LJPA 4IZKA 4DR3I 3JAMC 1KVKA 1QZRA 2IOPA 3HJCA 4JI8I 2F4VE 1MX0A 4MU1A 4X65E 4YHHI 4IZJB 4DV6I 4B3SE 4WUDA 4X66I 3H4LA 5L3JA 2GO4A 4DV5I 2PO1B 4LF8E 4DV7E 2C37B 3PRYA 1RHYA 2AE8A 2O1UA 3K1JA 1N36E 5EL9A 1Z5AA 4JI5E 4FW7A 4DR4I 2JEAB 3LPSA 4IS9A 4OX9E 1J5EI 2BM1A 2UU9E 4MDTA 3ZZ0A 5IT9C 2C39A 2GO3A 2Z5BB 1FJGE 5JEAC 4AQYE 4LF9I 4LCGA 2HHHE 3M7ND 1KTVA 3K85A 2PNZA 4B3MI 1U2RA 3HULA 2V34A 2WW4A 3L7ZA 3QT8A 4DR6E 1N0VC 4JI6I 4DV1E 4U3BA 5JEAF 3Q6MA 4PU9A 4DV3E 5K36C 2C39B 2O1TA 2EFGA 3KRNA 2IERA 5DNLA 5DRPA 5BR8E 4DR3E 5FLXQ 4LF6I 4JG4A 1UEKA 3J81Q 5JEAB 3WU6A 2AJ4A 2F4VI 2C38A 5FLXC 4YHHE 4LCFA 4X66E 5C0XC 3J81C 3M6AA 1KKHA 1XMQI 4LFCE 3GONA 1OYPA 3L7ZB 4JI5I 5FWKA 1UDSA 1J5EE 3T1YI 2UU9I 4LF5E 5JEAD 1H7UA 5JEAE 4MU3A 4JI2E 4FWGA 1ZXMA 2CGEA 2IOQA 4OO1C 2CG9A 1Z59A 1IBLE 1USUA 2CZ9A 3GCMA 4DR2E 4LF9E 4MQYA 4DR1I 2C38B 4AIDA 4X64I 1ZM3A 4NXNE 2PO0B 1H72C 4IFDC 4JYAI 2C37A 1PVGA 4ZVIA 4U3DA 1IBMI 4DUZE 2NN6C 4JI6E 4JV5E 2JE6A 2OI2A 5K36D 1Y5YA 3OTOE 2JEAA 2UUAE 4OO1F 1UDOA 3P3GA 1Z0WA 3T1HI 1Z5BA 4USMA 3PYEA 4PRXA 4LF6E 5C0XD 2NN6F 1FI4A 4XTJA 4MU0A 1DARA 1XNRE 4B3RE 2WNRA 1XMQE 3P76A 4YY3E 3M7NG 4LFCI 2UUCE 4LPFA 4N3OA 1OYSA 2JE6B 1Z0VA 4DUYE 2NN6B 3T1YE 5GMEA 1PIEA 4LF5I 2VESA 4M1KA 4OO1D 3D4JA 1N0UA 1FWLA 2A2CA 3ZKDA 4JI2I 4JI7I 4DPWA 1FKAE 3U1YA 4J3DA 1IBLI 4Z7CA 1N32E
chains in the Genus database with same CATH topology
2A2DA 3ZZUA 4DR2I 4KHPE 4DR1E 1Z0BA 1PKPA 5GMDA 4X64E 4NXNI 2Z5EA 4DR7I 3Q6NA 4GKKI 4JYAE 3V2UC 4Z7YA 1ZM9A 4DUZI 1IBME 4DPUA 4PRVA 2NPFA 1KIJA 4JV5I 4DU7A 1N34E 3OTOI 2UUAI 3J80Q 2X36A 2VQFE 3QT5A 1XMOE 1Z5CA 1MG7A 3T1HE 1HNZE 1NHIA 1WUUA 4RPFA 4DPXA 1HNXE 2R3VA 2X7IA 3WU5A 1XNRI 4B3RI 1RREA 4YY3I 2UUCI 2ZBKB 4LF7E 5LMUI 1EI1A 3LTOA 4JI4I 1ZM2A 4DV0E 1NZ0A 3K17A 4DUYI 4DV2E 4HY1A 1Y4UA 1Z0TA 3PYDA 1HK7A 4JI7E 2ZM6E 1S16A 4JI3I 1HNWI 1N32I 4GKJE 1K47A 4JI1E 1Y4SA 4KHPI 4MYUA 3Q1QA 2VQEI 4NXME 4DR7E 4DR5E 4HACA 4K0KI 4GKKE 1IBKI 2UUBI 1EA6A 2DEIA 4URLA 4ED4A 1Z0CA 1N34I 2E5LE 4LFAI 2VQFI 2V8PA 1I94I 1XMOI 1FWKA 3PYFA 1HNZI 1B62A 2Z5CA 5A2QQ 2HKJA 2R42A 1D6TA 1HNXI 3J7AM 3F0NA 2HKEA 4HACB 2Q2EB 4MYTA 4LF7I 5LMUE 2V2VA 3JAMQ 4DV0I 4JI4E 4DV2I 4HXZA 2UXDE 3B8HA 1Y6ZA 1ELOA 1MU5A 5LL6R 1HR0E 4I3HA 2Z5CB 3CWVA 2ZM6I 2UXBE 3V5RA 4B3TI 1N33I 4JI3E 4LFBI 1HNWE 4JI1I 2BV3A 5LMNE 2UXCE 2XEXA 3ZM7A 2VQEE 4NXMI 5IT9Q 4DR5I 2V2ZA 4WUBA 4K0KE 2GQ0A 2O1WA 1IBKE 2UUBE 2HFSA 4DU8A 4FWHA 4JI0I 2ZITA 4IZJD 2E5LI 4DPTA 4LFAE 4IZKB 4UT4A 4X62E 4DV4E 2BM0A 2O1VA 3J80C 1I94E 1Z0GA 1ZXNA 2PNMA 4FWDA 3WU4A 4HYMA 3PYGA 1BKNA 4LF4E 3LNUA 4WUCA 1XHKA 4DXLA 2E1RA 3P06A 5IWAE 1XNQI 4EMDA 2PNLA 1H7SA 1B63A 1A6FA 2UXDI 1HR0I 2VF3A 4JI8E 4X65I 1OJ4A 3ZKBA 4B3SI 2J7KA 4FW9A 4DV6E 3WU3A 4GKJI 4P7AA 2UXBI 3J7AG 4DV5E 1Z0EA 4LF8I 4DV7I 3QT6A 2HK3A 4B3TE 1N33E 4LFBE 5LMNI 2V2QA 2UXCI 1N36I 1VISA 4FN5A 4DR4E 4OX9I 1S4EA 2GS8A 4UTGA 4JI0E 1FJGI 3QT7A 1RR9A 4AQYI 4X62I 4DV4I 1FNMA 2HHHI 4R1FA 1NHJA 4IZJA 1USVA 2HFUA 4B3ME 4P52A 1H74A 5A2QC 4DR6I 4DPYA 4DV1I 1ZM4A 1H73A 2HK2A 3B78A 4DV3I 3ZZTA 4LF4I 4KQVA 4USKA 2Z5BA 5IWAI 1XNQE 3B82A 1NHHA 5BR8I 2DEJA 4DR3I 2LJPA 4IZKA 3JAMC 1KVKA 1QZRA 2IOPA 3HJCA 4JI8I 2F4VE 1MX0A 4X65E 4YHHI 4IZJB 4DV6I 4B3SE 4WUDA 4X66I 3H4LA 5L3JA 4DV5I 4LF8E 4DV7E 3PRYA 2O1UA 3K1JA 1N36E 1Z5AA 4JI5E 4DR4I 3LPSA 4OX9E 1J5EI 2BM1A 2UU9E 3ZZ0A 5IT9C 2Z5BB 1FJGE 4AQYE 4LF9I 2HHHE 1KTVA 3K85A 4B3MI 1U2RA 3HULA 2V34A 2WW4A 3QT8A 4DR6E 1N0VC 4JI6I 4DV1E 3Q6MA 4PU9A 4DV3E 2O1TA 2EFGA 5BR8E 4DR3E 5FLXQ 4LF6I 4JG4A 1UEKA 3J81Q 2F4VI 3WU6A 2AJ4A 5FLXC 4YHHE 4X66E 3J81C 3M6AA 1KKHA 1XMQI 4LFCE 3GONA 4JI5I 5FWKA 1J5EE 3T1YI 2UU9I 4LF5E 1H7UA 4JI2E 4FWGA 1ZXMA 2CGEA 2IOQA 2CG9A 1Z59A 1IBLE 1USUA 2CZ9A 4DR2E 4LF9E 4DR1I 4X64I 1ZM3A 4NXNE 1H72C 4JYAI 1PVGA 4ZVIA 1IBMI 4DUZE 4JI6E 4JV5E 2OI2A 3OTOE 2UUAE 1Z0WA 3T1HI 1Z5BA 4USMA 3PYEA 4PRXA 4LF6E 1FI4A 4XTJA 1DARA 1XNRE 4B3RE 1XMQE 4YY3E 4LFCI 2UUCE 4N3OA 1Z0VA 4DUYE 3T1YE 5GMEA 1PIEA 4LF5I 4M1KA 3D4JA 1N0UA 1FWLA 2A2CA 3ZKDA 4JI2I 4JI7I 4DPWA 1FKAE 1IBLI 4Z7CA 1N32E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2D A;  3ZZU A;  4DR2 I;  4KHP E;  4DR1 E;  1Z0B A;  1PKP A;  5GMD A;  4X64 E;  4NXN I;  4DR7 I;  4GKK I;  4JYA E;  3V2U C;  4Z7Y A;  1ZM9 A;  4DUZ I;  1IBM E;  4DPU A;  4PRV A;  2NPF A;  1KIJ A;  4JV5 I;  4DU7 A;  1N34 E;  3OTO I;  2UUA I;  3J80 Q;  2X36 A;  2VQF E;  3QT5 A;  1XMO E;  1Z5C A;  1MG7 A;  3T1H E;  1HNZ E;  1NHI A;  1WUU A;  4RPF A;  4DPX A;  1HNX E;  2R3V A;  2X7I A;  3WU5 A;  1XNR I;  4B3R I;  1RRE A;  4YY3 I;  2UUC I;  2ZBK B;  4LF7 E;  5LMU I;  1EI1 A;  3LTO A;  4JI4 I;  1ZM2 A;  4DV0 E;  1NZ0 A;  3K17 A;  4DUY I;  4DV2 E;  4HY1 A;  1Z0T A;  3PYD A;  4JI7 E;  2ZM6 E;  1S16 A;  4JI3 I;  1HNW I;  1N32 I;  4GKJ E;  1K47 A;  4JI1 E;  4KHP I;  4MYU A;  3Q1Q A;  2VQE I;  4NXM E;  4DR7 E;  4DR5 E;  4HAC A;  4K0K I;  4GKK E;  1IBK I;  2UUB I;  2DEI A;  1EA6 A;  4URL A;  4ED4 A;  1Z0C A;  1N34 I;  2E5L E;  4LFA I;  2VQF I;  2V8P A;  1I94 I;  1XMO I;  1FWK A;  3PYF A;  1HNZ I;  1B62 A;  5A2Q Q;  2HKJ A;  2R42 A;  1D6T A;  1HNX I;  3J7A M;  3F0N A;  2HKE A;  4HAC B;  2Q2E B;  4MYT A;  4LF7 I;  5LMU E;  2V2V A;  3JAM Q;  4DV0 I;  4JI4 E;  4DV2 I;  4HXZ A;  2UXD E;  3B8H A;  1ELO A;  1MU5 A;  5LL6 R;  1HR0 E;  4I3H A;  3CWV A;  2UXB E;  2ZM6 I;  3V5R A;  4B3T I;  1N33 I;  4JI3 E;  4LFB I;  1HNW E;  4JI1 I;  2BV3 A;  5LMN E;  2UXC E;  2XEX A;  3ZM7 A;  2VQE E;  4NXM I;  5IT9 Q;  4DR5 I;  2V2Z A;  4WUB A;  4K0K E;  1IBK E;  2UUB E;  2HFS A;  4DU8 A;  4FWH A;  4JI0 I;  2ZIT A;  2E5L I;  4DPT A;  4LFA E;  4UT4 A;  4X62 E;  4DV4 E;  2BM0 A;  3J80 C;  1I94 E;  1Z0G A;  1ZXN A;  4FWD A;  3WU4 A;  4HYM A;  3PYG A;  1BKN A;  4LF4 E;  3LNU A;  4WUC A;  1XHK A;  4DXL A;  2E1R A;  5IWA E;  1XNQ I;  4EMD A;  1H7S A;  1B63 A;  1A6F A;  2UXD I;  1HR0 I;  2VF3 A;  4JI8 E;  4X65 I;  1OJ4 A;  3ZKB A;  4B3S I;  2J7K A;  4FW9 A;  4DV6 E;  3WU3 A;  4GKJ I;  4P7A A;  2UXB I;  3J7A G;  4DV5 E;  1Z0E A;  4LF8 I;  4DV7 I;  3QT6 A;  2HK3 A;  4B3T E;  1N33 E;  4LFB E;  5LMN I;  2V2Q A;  2UXC I;  1N36 I;  1VIS A;  4FN5 A;  4DR4 E;  4OX9 I;  1S4E A;  2GS8 A;  4UTG A;  4JI0 E;  1FJG I;  3QT7 A;  1RR9 A;  4AQY I;  4X62 I;  4DV4 I;  1FNM A;  2HHH I;  4R1F A;  1NHJ A;  2HFU A;  4B3M E;  4P52 A;  1H74 A;  5A2Q C;  4DR6 I;  4DPY A;  4DV1 I;  1ZM4 A;  1H73 A;  2HK2 A;  3B78 A;  4DV3 I;  3ZZT A;  4LF4 I;  4KQV A;  4USK A;  5IWA I;  1XNQ E;  3B82 A;  1NHH A;  2DEJ A;  5BR8 I;  2LJP A;  4DR3 I;  3JAM C;  1KVK A;  1QZR A;  4JI8 I;  2F4V E;  1MX0 A;  4X65 E;  4YHH I;  4DV6 I;  4B3S E;  4WUD A;  4X66 I;  3H4L A;  5L3J A;  4DV5 I;  4LF8 E;  4DV7 E;  3K1J A;  1N36 E;  1Z5A A;  4JI5 E;  4DR4 I;  3LPS A;  4OX9 E;  1J5E I;  2BM1 A;  2UU9 E;  3ZZ0 A;  5IT9 C;  1FJG E;  4AQY E;  4LF9 I;  2HHH E;  1KTV A;  4B3M I;  1U2R A;  3HUL A;  2V34 A;  2WW4 A;  3QT8 A;  4DR6 E;  1N0V C;  4JI6 I;  4DV1 E;  4PU9 A;  4DV3 E;  2EFG A;  5BR8 E;  4DR3 E;  5FLX Q;  4LF6 I;  4JG4 A;  1UEK A;  3J81 Q;  2F4V I;  3WU6 A;  2AJ4 A;  5FLX C;  4YHH E;  4X66 E;  3J81 C;  3M6A A;  1KKH A;  1XMQ I;  4LFC E;  3GON A;  4JI5 I;  1J5E E;  3T1Y I;  2UU9 I;  4LF5 E;  1H7U A;  4JI2 E;  4FWG A;  1ZXM A;  1Z59 A;  1IBL E;  2CZ9 A;  4DR2 E;  4LF9 E;  4DR1 I;  4X64 I;  1ZM3 A;  4NXN E;  1H72 C;  4JYA I;  1PVG A;  4ZVI A;  1IBM I;  4DUZ E;  4JI6 E;  4JV5 E;  2OI2 A;  3OTO E;  2UUA E;  1Z0W A;  3T1H I;  1Z5B A;  4USM A;  3PYE A;  4PRX A;  4LF6 E;  1FI4 A;  4XTJ A;  1DAR A;  1XNR E;  4B3R E;  1XMQ E;  4YY3 E;  4LFC I;  2UUC E;  1Z0V A;  4DUY E;  3T1Y E;  5GME A;  1PIE A;  4LF5 I;  4M1K A;  3D4J A;  1N0U A;  1FWL A;  2A2C A;  3ZKD A;  4JI2 I;  4JI7 I;  4DPW A;  1FKA E;  1IBL I;  4Z7C A;  1N32 E; 
#chains in the Genus database with same CATH topology
 2A2D A;  3ZZU A;  4DR2 I;  5JEA A;  4KHP E;  4DR1 E;  1Z0B A;  1PKP A;  5GMD A;  4X64 E;  2NN6 D;  4NXN I;  2Z5E A;  4DR7 I;  2NN6 E;  2WNR B;  3Q6N A;  4GKK I;  3V2U C;  4JYA E;  4Z7Y A;  1ZM9 A;  4DUZ I;  1IBM E;  4DPU A;  3GME A;  4PRV A;  2NPF A;  1KIJ A;  4AIM A;  4JV5 I;  1YH8 A;  4DU7 A;  2O3Z A;  1N34 E;  3OTO I;  2UUA I;  2BA0 G;  3J80 Q;  2X36 A;  2F1D A;  2VQF E;  3QT5 A;  1XMO E;  3P3E A;  1Z5C A;  1MG7 A;  3T1H E;  3NZK A;  1HNZ E;  1NHI A;  5K36 A;  3CDI A;  1WUU A;  1P42 A;  4RPF A;  4DPX A;  1HNX E;  2R3V A;  2X7I A;  3WU5 A;  1XNR I;  4B3R I;  1RRE A;  2PO0 A;  5DRO A;  2BA1 D;  3U1K A;  4YY3 I;  5C0X A;  2ZBK B;  2UUC I;  5LMU I;  1EI1 A;  3LTO A;  4LF7 E;  5K36 F;  4JI4 I;  1ZM2 A;  3K17 A;  1NZ0 A;  4DUY I;  4DV0 E;  4DV2 E;  4HY1 A;  1Y4U A;  1Z0T A;  3PYD A;  1HK7 A;  4JI7 E;  5C0X F;  5K36 B;  2ZM6 E;  1S16 A;  4JI3 I;  1HNW I;  1N32 I;  4GKJ E;  1K47 A;  4JI1 E;  1Y4S A;  4KHP I;  4MYU A;  4OO1 A;  3Q1Q A;  5EKW A;  1R6M A;  2VQE I;  4BA1 B;  3H1C A;  4NXM E;  4DR7 E;  4DR5 E;  4HAC A;  4K0K I;  4GKK E;  1IBK I;  2UUB I;  1EA6 A;  2DEI A;  4URL A;  5C0X B;  4ED4 A;  1Z0C A;  1N34 I;  1Y60 A;  2NN6 A;  2E5L E;  4GQU A;  4LFA I;  5K36 E;  2VQF I;  1E3P A;  5DRR A;  2V8P A;  1I94 I;  1XMO I;  1FWK A;  1VI7 A;  3PYF A;  1HNZ I;  1B62 A;  2Z5C A;  5A2Q Q;  2HKJ A;  4IFD F;  3PS2 A;  2R42 A;  3HKM A;  1D6T A;  1HNX I;  3J7A M;  3F0N A;  4OO1 B;  5C0X E;  2PO2 A;  2J65 A;  2HKE A;  4HAC B;  2Q2E B;  4MYT A;  4LF7 I;  5LMU E;  4IFD B;  2V2V A;  3M85 D;  3JAM Q;  4DV0 I;  4JI4 E;  4DV2 I;  4HXZ A;  2JT2 A;  4MU4 A;  2UXD E;  3B8H A;  1Y6Z A;  1ELO A;  1MU5 A;  5DRQ A;  5LL6 R;  1HR0 E;  4I3H A;  5DNX A;  4OO1 E;  2JEB B;  2Z5C B;  3CWV A;  2ZM6 I;  2UXB E;  3V5R A;  4B3T I;  4QNK A;  1N33 I;  4JI3 E;  4LFB I;  1HNW E;  4JI1 I;  2BV3 A;  5LMN E;  2UXC E;  2XEX A;  4IFD D;  1UDN A;  2PO2 B;  4IFD E;  3UHM A;  1UDQ A;  3ZM7 A;  2VQE E;  4NXM I;  5IT9 Q;  4QNJ A;  4DR5 I;  2V2Z A;  4WUB A;  4K0K E;  4FW3 A;  2GQ0 A;  2O1W A;  1IBK E;  2UUB E;  2HFS A;  4DU8 A;  3GLL A;  4FWH A;  4JI0 I;  2ZIT A;  4IZJ D;  2BA1 G;  2E5L I;  4DPT A;  4LFA E;  4IZK B;  4UT4 A;  4X62 E;  2BM0 A;  3P3C A;  4DV4 E;  1E3H A;  2O1V A;  3J80 C;  1I94 E;  1Z0G A;  1ZXN A;  2PNM A;  2WP8 A;  4FWD A;  4NBQ A;  3WU4 A;  4HYM A;  1R6L A;  3PYG A;  4BA1 A;  1BKN A;  3PS3 A;  4FW4 A;  3DD6 A;  4LF4 E;  3LNU A;  4WUC A;  1XHK A;  4DXL A;  4BA2 A;  2E1R A;  3P06 A;  4LCH A;  5IWA E;  2CVE A;  1XNQ I;  4AM3 A;  4EMD A;  2PNL A;  1H7S A;  1B63 A;  1A6F A;  2UXD I;  1XXE A;  1HR0 I;  3B4T A;  2VF3 A;  4JI8 E;  4X65 I;  1OJ4 A;  3ZKB A;  4B3S I;  2J7K A;  4FW9 A;  4DV6 E;  3WU3 A;  4GKJ I;  4P7A A;  2UXB I;  3J7A G;  2PNZ B;  4DV5 E;  1Z0E A;  1YHC A;  3CDJ A;  3QT6 A;  2HK3 A;  4DV7 I;  4LF8 I;  4B3T E;  1N33 E;  2BA0 D;  4LFB E;  2WP8 B;  4FW5 A;  5LMN I;  2V2Q A;  2UXC I;  1N36 I;  1VIS A;  4FN5 A;  4DR4 E;  4OX9 I;  1S4E A;  4ISA A;  2GS8 A;  4UTG A;  4BA2 B;  4IFD A;  2BR2 A;  4JI0 E;  1FJG I;  3QT7 A;  1RR9 A;  4AQY I;  4X62 I;  4DV4 I;  1FNM A;  3M85 G;  2HHH I;  4R1F A;  1NHJ A;  4IZJ A;  4OKG A;  2JEB A;  1USV A;  2HFU A;  2PO1 A;  4B3M E;  4P52 A;  5ELW A;  1H74 A;  3PS1 A;  5A2Q C;  4DR6 I;  4DPY A;  4DV1 I;  1ZM4 A;  1H73 A;  2HK2 A;  4OZE A;  3B78 A;  4LOM A;  1OYR A;  4FW6 A;  4DV3 I;  3ZZT A;  4LF4 I;  4KQV A;  4USK A;  2IES A;  2BR2 B;  2Z5B A;  5IWA I;  1XNQ E;  3B82 A;  1NHH A;  2DEJ A;  5BR8 I;  2LJP A;  4IZK A;  4DR3 I;  3JAM C;  1KVK A;  1QZR A;  2IOP A;  3HJC A;  4JI8 I;  2F4V E;  1MX0 A;  4MU1 A;  4X65 E;  4YHH I;  4IZJ B;  4DV6 I;  4B3S E;  4WUD A;  4X66 I;  3H4L A;  5L3J A;  2GO4 A;  4DV5 I;  2PO1 B;  4LF8 E;  4DV7 E;  2C37 B;  3PRY A;  1RHY A;  2AE8 A;  2O1U A;  3K1J A;  1N36 E;  5EL9 A;  1Z5A A;  4JI5 E;  4FW7 A;  4DR4 I;  2JEA B;  3LPS A;  4IS9 A;  4OX9 E;  1J5E I;  2BM1 A;  2UU9 E;  4MDT A;  3ZZ0 A;  5IT9 C;  2C39 A;  2GO3 A;  2Z5B B;  1FJG E;  5JEA C;  4AQY E;  4LF9 I;  4LCG A;  2HHH E;  3M7N D;  1KTV A;  3K85 A;  2PNZ A;  4B3M I;  1U2R A;  3HUL A;  2V34 A;  2WW4 A;  3L7Z A;  3QT8 A;  4DR6 E;  1N0V C;  4JI6 I;  4DV1 E;  4U3B A;  5JEA F;  3Q6M A;  4PU9 A;  4DV3 E;  5K36 C;  2C39 B;  2O1T A;  2EFG A;  3KRN A;  2IER A;  5DNL A;  5DRP A;  5BR8 E;  4DR3 E;  5FLX Q;  4LF6 I;  4JG4 A;  1UEK A;  3J81 Q;  5JEA B;  3WU6 A;  2AJ4 A;  2F4V I;  2C38 A;  5FLX C;  4YHH E;  4LCF A;  4X66 E;  5C0X C;  3J81 C;  3M6A A;  1KKH A;  1XMQ I;  4LFC E;  3GON A;  1OYP A;  3L7Z B;  4JI5 I;  5FWK A;  1UDS A;  1J5E E;  3T1Y I;  2UU9 I;  4LF5 E;  5JEA D;  1H7U A;  5JEA E;  4MU3 A;  4JI2 E;  4FWG A;  1ZXM A;  2CGE A;  2IOQ A;  4OO1 C;  2CG9 A;  1Z59 A;  1IBL E;  1USU A;  2CZ9 A;  3GCM A;  4DR2 E;  4LF9 E;  4MQY A;  4DR1 I;  2C38 B;  4AID A;  4X64 I;  1ZM3 A;  4NXN E;  2PO0 B;  1H72 C;  4IFD C;  4JYA I;  2C37 A;  1PVG A;  4ZVI A;  4U3D A;  1IBM I;  4DUZ E;  2NN6 C;  4JI6 E;  4JV5 E;  2JE6 A;  2OI2 A;  5K36 D;  1Y5Y A;  3OTO E;  2JEA A;  2UUA E;  4OO1 F;  1UDO A;  3P3G A;  1Z0W A;  3T1H I;  1Z5B A;  4USM A;  3PYE A;  4PRX A;  4LF6 E;  5C0X D;  2NN6 F;  1FI4 A;  4XTJ A;  4MU0 A;  1DAR A;  1XNR E;  4B3R E;  2WNR A;  1XMQ E;  3P76 A;  4YY3 E;  3M7N G;  4LFC I;  2UUC E;  4LPF A;  4N3O A;  1OYS A;  2JE6 B;  1Z0V A;  4DUY E;  2NN6 B;  3T1Y E;  5GME A;  1PIE A;  4LF5 I;  2VES A;  4M1K A;  4OO1 D;  3D4J A;  1N0U A;  1FWL A;  2A2C A;  3ZKD A;  4JI2 I;  4JI7 I;  4DPW A;  1FKA E;  3U1Y A;  4J3D A;  1IBL I;  4Z7C A;  1N32 E; 
#chains in the Genus database with same CATH homology
 2A2D A;  3ZZU A;  4DR2 I;  4KHP E;  4DR1 E;  1Z0B A;  1PKP A;  5GMD A;  4X64 E;  4NXN I;  2Z5E A;  4DR7 I;  3Q6N A;  4GKK I;  4JYA E;  3V2U C;  4Z7Y A;  1ZM9 A;  4DUZ I;  1IBM E;  4DPU A;  4PRV A;  2NPF A;  1KIJ A;  4JV5 I;  4DU7 A;  1N34 E;  3OTO I;  2UUA I;  3J80 Q;  2X36 A;  2VQF E;  3QT5 A;  1XMO E;  1Z5C A;  1MG7 A;  3T1H E;  1HNZ E;  1NHI A;  1WUU A;  4RPF A;  4DPX A;  1HNX E;  2R3V A;  2X7I A;  3WU5 A;  1XNR I;  4B3R I;  1RRE A;  4YY3 I;  2UUC I;  2ZBK B;  4LF7 E;  5LMU I;  1EI1 A;  3LTO A;  4JI4 I;  1ZM2 A;  4DV0 E;  1NZ0 A;  3K17 A;  4DUY I;  4DV2 E;  4HY1 A;  1Y4U A;  1Z0T A;  3PYD A;  1HK7 A;  4JI7 E;  2ZM6 E;  1S16 A;  4JI3 I;  1HNW I;  1N32 I;  4GKJ E;  1K47 A;  4JI1 E;  1Y4S A;  4KHP I;  4MYU A;  3Q1Q A;  2VQE I;  4NXM E;  4DR7 E;  4DR5 E;  4HAC A;  4K0K I;  4GKK E;  1IBK I;  2UUB I;  1EA6 A;  2DEI A;  4URL A;  4ED4 A;  1Z0C A;  1N34 I;  2E5L E;  4LFA I;  2VQF I;  2V8P A;  1I94 I;  1XMO I;  1FWK A;  3PYF A;  1HNZ I;  1B62 A;  2Z5C A;  5A2Q Q;  2HKJ A;  2R42 A;  1D6T A;  1HNX I;  3J7A M;  3F0N A;  2HKE A;  4HAC B;  2Q2E B;  4MYT A;  4LF7 I;  5LMU E;  2V2V A;  3JAM Q;  4DV0 I;  4JI4 E;  4DV2 I;  4HXZ A;  2UXD E;  3B8H A;  1Y6Z A;  1ELO A;  1MU5 A;  5LL6 R;  1HR0 E;  4I3H A;  2Z5C B;  3CWV A;  2ZM6 I;  2UXB E;  3V5R A;  4B3T I;  1N33 I;  4JI3 E;  4LFB I;  1HNW E;  4JI1 I;  2BV3 A;  5LMN E;  2UXC E;  2XEX A;  3ZM7 A;  2VQE E;  4NXM I;  5IT9 Q;  4DR5 I;  2V2Z A;  4WUB A;  4K0K E;  2GQ0 A;  2O1W A;  1IBK E;  2UUB E;  2HFS A;  4DU8 A;  4FWH A;  4JI0 I;  2ZIT A;  4IZJ D;  2E5L I;  4DPT A;  4LFA E;  4IZK B;  4UT4 A;  4X62 E;  4DV4 E;  2BM0 A;  2O1V A;  3J80 C;  1I94 E;  1Z0G A;  1ZXN A;  2PNM A;  4FWD A;  3WU4 A;  4HYM A;  3PYG A;  1BKN A;  4LF4 E;  3LNU A;  4WUC A;  1XHK A;  4DXL A;  2E1R A;  3P06 A;  5IWA E;  1XNQ I;  4EMD A;  2PNL A;  1H7S A;  1B63 A;  1A6F A;  2UXD I;  1HR0 I;  2VF3 A;  4JI8 E;  4X65 I;  1OJ4 A;  3ZKB A;  4B3S I;  2J7K A;  4FW9 A;  4DV6 E;  3WU3 A;  4GKJ I;  4P7A A;  2UXB I;  3J7A G;  4DV5 E;  1Z0E A;  4LF8 I;  4DV7 I;  3QT6 A;  2HK3 A;  4B3T E;  1N33 E;  4LFB E;  5LMN I;  2V2Q A;  2UXC I;  1N36 I;  1VIS A;  4FN5 A;  4DR4 E;  4OX9 I;  1S4E A;  2GS8 A;  4UTG A;  4JI0 E;  1FJG I;  3QT7 A;  1RR9 A;  4AQY I;  4X62 I;  4DV4 I;  1FNM A;  2HHH I;  4R1F A;  1NHJ A;  4IZJ A;  1USV A;  2HFU A;  4B3M E;  4P52 A;  1H74 A;  5A2Q C;  4DR6 I;  4DPY A;  4DV1 I;  1ZM4 A;  1H73 A;  2HK2 A;  3B78 A;  4DV3 I;  3ZZT A;  4LF4 I;  4KQV A;  4USK A;  2Z5B A;  5IWA I;  1XNQ E;  3B82 A;  1NHH A;  5BR8 I;  2DEJ A;  4DR3 I;  2LJP A;  4IZK A;  3JAM C;  1KVK A;  1QZR A;  2IOP A;  3HJC A;  4JI8 I;  2F4V E;  1MX0 A;  4X65 E;  4YHH I;  4IZJ B;  4DV6 I;  4B3S E;  4WUD A;  4X66 I;  3H4L A;  5L3J A;  4DV5 I;  4LF8 E;  4DV7 E;  3PRY A;  2O1U A;  3K1J A;  1N36 E;  1Z5A A;  4JI5 E;  4DR4 I;  3LPS A;  4OX9 E;  1J5E I;  2BM1 A;  2UU9 E;  3ZZ0 A;  5IT9 C;  2Z5B B;  1FJG E;  4AQY E;  4LF9 I;  2HHH E;  1KTV A;  3K85 A;  4B3M I;  1U2R A;  3HUL A;  2V34 A;  2WW4 A;  3QT8 A;  4DR6 E;  1N0V C;  4JI6 I;  4DV1 E;  3Q6M A;  4PU9 A;  4DV3 E;  2O1T A;  2EFG A;  5BR8 E;  4DR3 E;  5FLX Q;  4LF6 I;  4JG4 A;  1UEK A;  3J81 Q;  2F4V I;  3WU6 A;  2AJ4 A;  5FLX C;  4YHH E;  4X66 E;  3J81 C;  3M6A A;  1KKH A;  1XMQ I;  4LFC E;  3GON A;  4JI5 I;  5FWK A;  1J5E E;  3T1Y I;  2UU9 I;  4LF5 E;  1H7U A;  4JI2 E;  4FWG A;  1ZXM A;  2CGE A;  2IOQ A;  2CG9 A;  1Z59 A;  1IBL E;  1USU A;  2CZ9 A;  4DR2 E;  4LF9 E;  4DR1 I;  4X64 I;  1ZM3 A;  4NXN E;  1H72 C;  4JYA I;  1PVG A;  4ZVI A;  1IBM I;  4DUZ E;  4JI6 E;  4JV5 E;  2OI2 A;  3OTO E;  2UUA E;  1Z0W A;  3T1H I;  1Z5B A;  4USM A;  3PYE A;  4PRX A;  4LF6 E;  1FI4 A;  4XTJ A;  1DAR A;  1XNR E;  4B3R E;  1XMQ E;  4YY3 E;  4LFC I;  2UUC E;  4N3O A;  1Z0V A;  4DUY E;  3T1Y E;  5GME A;  1PIE A;  4LF5 I;  4M1K A;  3D4J A;  1N0U A;  1FWL A;  2A2C A;  3ZKD A;  4JI2 I;  4JI7 I;  4DPW A;  1FKA E;  1IBL I;  4Z7C A;  1N32 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...