4LF4I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf4I00
2ZITA 4DPXA 4NXNE 2HK3A 4LF4E 4DV4I 4FN5A 4PRXA 4JI3I 4B3SI 4DV6E 5GMEA 4DV0I 2BV3A 1N0VC 4DPYA 1Z0WA 1N36E 1NHJA 2V2VA 4DR7E 4DUYI 4JI2E 5IT9Q 2A2CA 3H4LA 4FWGA 4XTJA 2ZM6E 1XMQE 3CWVA 4JI8E 1NHIA 2V2QA 3ZM7A 3M6AA 4GKJI 4LF7I 1ZXNA 4KHPE 4DR2I 3PYEA 2XEXA 4EMDA 4FWHA 4P52A 1Z59A 2UUCI 4LF9E 4DPWA 5GMDA 4MYUA 4DU8A 2Q2EB 4LFAE 4Z7YA 4MYTA 4DR5E 2UXCI 2HK2A 3GONA 1I94E 4JI6E 4KQVA 5LMUE 1N0UA 4DR4E 4USKA 1IBLE 4DV3I 2E5LE 1Z0TA 1IBMI 1HNXE 4DUZE 3JAMC 4DR3E 1N32I 2UXDI 3J81C 4JI0E 1IBKE 4DR6I 4HACA 3F0NA 4B3TE 4NXME 1Z5BA 4DXLA 4UT4A 4JV5E 2UUBI 1B63A 4FWDA 3QT7A 1HR0I 2R3VA 1FWKA 4HY1A 4DV4E 2HFUA 4JI3E 1OJ4A 4B3SE 4DV0E 4DV1I 1J5EI 4RPFA 4HYMA 4JI7I 4LF6I 4DUYE 1ZM2A 4LFBI 1FWLA 4K0KI 3J7AM 3J7AG 1A6FA 1FJGI 1XNRI 1H73A 2HHHE 4GKJE 4LF7E 5A2QC 4DR2E 1ZXMA 2UUCE 3QT8A 3V5RA 4OX9I 1XMOI 1Z5AA 1N33I 1Z5CA 4DR1E 1Z0VA 3T1YI 2OI2A 2WW4A 4JYAI 2UU9I 4JI1I 2UXCE 1H74A 1KTVA 3ZKDA 2HHHI 2CZ9A 2BM1A 3LPSA 4DV3E 4B3MI 1HNWI 1MU5A 1IBME 3D4JA 4DR1I 4HACB 1XNQI 1N32E 5LL6R 2VQFI 3B82A 5IT9C 2UXDE 1KVKA 4R1FA 4DPUA 4DR6E 4YHHI 1Z0BA 3WU4A 1WUUA 5IWAI 2UUBE 5LMNI 4UTGA 1ZM9A 3OTOI 1HR0E 1K47A 1PKPA 1RR9A 3PYDA 4ZVIA 2UUAI 5FLXQ 4LF8E 1KKHA 4DV1E 1J5EE 3ZZTA 3V2UC 4X64I 4JI7E 4LF6E 1EA6A 4LFBE 2E1RA 2VQEI 4K0KE 4GKKI 4YY3I 1H72C 3PYFA 3T1HI 2HKEA 1FJGE 4WUDA 1XNRE 2NPFA 1DARA 4M1KA 2LJPA 5BR8I 3J80C 4LF8I 4DV7I 2HFSA 4USMA 4OX9E 1XMOE 1N33E 3ZZUA 4WUBA 1NHHA 1H7SA 1FNMA 2F4VI 1QZRA 5A2QQ 3T1YE 4JYAE 2UU9E 1Z0GA 4HXZA 1U2RA 4JI1E 4PRVA 2DEIA 1S4EA 4X62I 1BKNA 4B3ME 4DV5I 4JI4I 1N34I 1HNWE 4X65I 1XNQE 4JI5I 4Z7CA 4AQYI 1FKAE 2VQFE 3K17A 4X66I 2V8PA 4B3RI 4DV2I 2EFGA 3QT5A 4YHHE 3HULA 2UXBI 4LFCI 2VF3A 4URLA 1MX0A 5IWAE 3ZZ0A 5LMNE 3OTOE 3WU6A 1H7UA 2UUAE 1D6TA 4LF5I 4NXNI 4X64E 4LF4I 1RREA 2R42A 4DV6I 2VQEE 3WU5A 4GKKE 1XHKA 1NZ0A 1ELOA 3JAMQ 4ED4A 4YY3E 1N36I 2DEJA 5L3JA 4DR7I 3T1HE 4JI2I 3J81Q 3QT6A 2ZM6I 1Z0EA 5BR8E 3K1JA 4DV7E 1XMQI 4JI8I 1MG7A 1PIEA 4KHPI 4WUCA 3B78A 2GS8A 2BM0A 1UEKA 2F4VE 1EI1A 4I3HA 4LF9I 3J80Q 2V2ZA 1KIJA 3LTOA 2V34A 4LFAI 4PU9A 2X36A 4X62E 1PVGA 1HNZE 4DV5E 4DR5I 4JI4E 1I94I 1N34E 4JI6I 1S16A 5FLXC 5LMUI 4X65E 4DR4I 3WU3A 4JI5E 1IBLI 1Z0CA 1ZM3A 4AQYE 2HKJA 2A2DA 2E5LI 4X66E 4B3RE 4DV2E 4FW9A 1HNXI 1FI4A 1B62A 2ZBKB 3LNUA 2UXBE 4DUZI 4DR3I 3B8HA 1ZM4A 3PYGA 4P7AA 4LFCE 3ZKBA 1VISA 3Q1QA 1HNZI 4DPTA 4JG4A 2J7KA 4JI0I 1IBKI 4B3TI 2X7IA 4NXMI 4LF5E 4JV5I 2AJ4A 4DU7A
chains in the Genus database with same CATH superfamily
2ZITA 4DPXA 4NXNE 2HK3A 2CG9A 3P06A 4BA2A 4LF4E 4DV4I 4FN5A 4PRXA 4JI3I 1E3PA 4B3SI 5EKWA 4DV6E 3L7ZB 2NN6D 3KRNA 5GMEA 4LCHA 4DV0I 2BV3A 1N0VC 4DPYA 1Z0WA 5DNXA 1N36E 1NHJA 2V2VA 4DR7E 4DUYI 1Y4UA 4JI2E 5IT9Q 2A2CA 3H4LA 3GLLA 4U3DA 4MU1A 4FWGA 4XTJA 5K36E 2PNZB 5JEAB 2ZM6E 1XMQE 2JEBB 1R6LA 3CWVA 4JI8E 1NHIA 2IOPA 2V2QA 2WP8A 3Q6MA 3U1YA 1OYPA 3M6AA 4FW7A 3ZM7A 4LF7I 4GKJI 2BA0G 4LCFA 1ZXNA 4KHPE 5ELWA 4DR2I 3PYEA 2O3ZA 2XEXA 4EMDA 1Y4SA 4FWHA 4P52A 1Z59A 5DRPA 2UUCI 4LF9E 5JEAC 4FW3A 4DPWA 4MQYA 5GMDA 4MYUA 4DU8A 2C37A 2Q2EB 4LFAE 4FW5A 2PO0B 4IFDA 4Z7YA 4MYTA 2J65A 4MU4A 4DR5E 2UXCI 2GQ0A 2HK2A 3GONA 1I94E 4JI6E 4KQVA 2JE6B 5LMUE 1N0UA 4DR4E 4USKA 1IBLE 4N3OA 4FW6A 4OO1B 4DV3I 5JEAF 2E5LE 1Z0TA 1IBMI 1E3HA 5K36B 1HNXE 2WNRB 4DUZE 3JAMC 4DR3E 1OYSA 5DROA 1N32I 2UXDI 4OO1C 3J81C 4JI0E 1IBKE 4DR6I 4HACA 3F0NA 1Y6ZA 4B3TE 5K36C 4NXME 1Z5BA 4IS9A 4DXLA 4UT4A 4JV5E 2UUBI 1B63A 4FWDA 1YHCA 3QT7A 2R3VA 1FWKA 1HR0I 4HY1A 2NN6A 4DV4E 2HFUA 4JI3E 1OJ4A 4AIDA 4B3SE 1UDSA 4DV0E 4DV1I 1J5EI 4J3DA 4RPFA 2C39B 4OO1F 4HYMA 4JI7I 4LF6I 4DUYE 1ZM2A 3GCMA 4FW4A 2VESA 4LFBI 5K36F 1FWLA 4K0KI 3J7AM 2PO1B 5JEAD 5DRQA 3J7AG 4IZKB 1A6FA 1FJGI 1XNRI 1H73A 5C0XA 2HHHE 2PO2B 4IZJB 4GKJE 4LF7E 2PNLA 5A2QC 4DR2E 1ZXMA 1UDOA 3QT8A 3V5RA 2UUCE 1XMOI 4OX9I 1Z5AA 1N33I 1Z5CA 4DR1E 4OO1E 2C38A 1Z0VA 3T1YI 3DD6A 2OI2A 2WW4A 4JYAI 2UU9I 3PS3A 4JI1I 2UXCE 1H74A 1KTVA 2JEAB 3ZKDA 2HHHI 2CZ9A 5C0XD 2BM1A 3LPSA 3PS1A 4AM3A 4AIMA 3GMEA 4DV3E 4B3MI 4BA1A 2GO4A 2F1DA 1HNWI 5K36D 1MU5A 1IBME 3D4JA 2BR2B 4DR1I 4HACB 1XNQI 1Y60A 2Z5BB 5DNLA 1N32E 5LL6R 2VQFI 3B82A 5IT9C 2UXDE 2Z5CB 3P3CA 1KVKA 4R1FA 4DPUA 4DR6E 4YHHI 1Z0BA 3Q6NA 3P3GA 3WU4A 1WUUA 5IWAI 2UUBE 5LMNI 4UTGA 1ZM9A 3OTOI 1HR0E 3L7ZA 1K47A 1PKPA 4LOMA 1RR9A 4U3BA 3PYDA 3B4TA 3U1KA 4ZVIA 2UUAI 5FLXQ 4LF8E 1KKHA 3PRYA 4DV1E 1J5EE 3ZZTA 1USUA 3V2UC 4X64I 4JI7E 4MDTA 4LF6E 1EA6A 3H1CA 2IESA 5JEAA 4LFBE 2JEBA 4BA2B 4IFDE 2E1RA 3K85A 2VQEI 4K0KE 4GKKI 4YY3I 1H72C 3CDJA 3PYFA 3T1HI 2HKEA 1FJGE 4WUDA 1XNRE 4IZJD 2NPFA 1DARA 4M1KA 2LJPA 3J80C 5BR8I 4LF8I 4DV7I 2HFSA 4USMA 4OX9E 1XMOE 2PO0A 2O1VA 1N33E 3ZZUA 4WUBA 1NHHA 3PS2A 1H7SA 1FNMA 2F4VI 2WP8B 1QZRA 5A2QQ 3T1YE 4JYAE 4OKGA 2UU9E 1Z0GA 2JE6A 4OZEA 4HXZA 1U2RA 4JI1E 4PRVA 4OO1A 4BA1B 1Y5YA 2C37B 4LCGA 2DEIA 4NBQA 1S4EA 3NZKA 4X62I 1BKNA 5K36A 4B3ME 2WNRA 4DV5I 2NN6E 4JI4I 4IFDB 2IERA 3M85D 1N34I 1HNWE 4X65I 1XNQE 1YH8A 4JI5I 4Z7CA 4AQYI 1FKAE 2VQFE 3K17A 4X66I 1VI7A 2V8PA 4B3RI 4DV2I 4IFDC 2EFGA 3QT5A 4YHHE 3HULA 2UXBI 4LFCI 2VF3A 4URLA 1MX0A 5IWAE 3ZZ0A 2O1TA 4OO1D 5LMNE 5EL9A 3OTOE 1HK7A 5C0XE 1USVA 3WU6A 1H7UA 2C39A 2UUAE 1D6TA 4LF5I 2GO3A 4NXNI 4X64E 4LF4I 1UDNA 2PO1A 1RREA 4IFDF 2R42A 4DV6I 4IZKA 2NN6B 2VQEE 3WU5A 4GKKE 1XHKA 3UHMA 1NZ0A 1ELOA 2PO2A 4IZJA 4QNKA 4ED4A 3JAMQ 1R6MA 4YY3E 1XXEA 2DEJA 5L3JA 1N36I 4DR7I 3T1HE 4JI2I 2PNMA 2CGEA 3J81Q 3QT6A 2O1UA 1RHYA 2AE8A 3M7ND 2NN6C 2ZM6I 1Z0EA 5BR8E 2BA1D 3M85G 3K1JA 4DV7E 1XMQI 4JI8I 3CDIA 1MG7A 1PIEA 4KHPI 4WUCA 3B78A 4MU0A 2GS8A 4LPFA 2PNZA 2BM0A 2IOQA 1UEKA 2F4VE 3P3EA 5C0XB 1EI1A 4I3HA 4LF9I 2JEAA 3J80Q 2V2ZA 1KIJA 3LTOA 2V34A 5FWKA 4LFAI 4PU9A 3HJCA 2X36A 5C0XC 2C38B 4ISAA 2NN6F 4X62E 1PVGA 1HNZE 2BR2A 4IFDD 4DV5E 4DR5I 4JI4E 1I94I 2Z5EA 1N34E 1S16A 4JI6I 5FLXC 2Z5BA 3P76A 5LMUI 5DRRA 4X65E 1P42A 4DR4I 2Z5CA 1UDQA 3WU3A 4JI5E 1IBLI 2BA0D 1Z0CA 1ZM3A 4AQYE 4QNJA 2HKJA 2A2DA 2E5LI 4X66E 2CVEA 4B3RE 5JEAE 4DV2E 4FW9A 1HNXI 1FI4A 1B62A 2ZBKB 3LNUA 1OYRA 4DUZI 4DR3I 3B8HA 1ZM4A 3PYGA 2UXBE 4P7AA 4LFCE 3ZKBA 1VISA 5C0XF 3HKMA 3Q1QA 1HNZI 4DPTA 4JG4A 2J7KA 2JT2A 4JI0I 1IBKI 4GQUA 3M7NG 4B3TI 2X7IA 4NXMI 2BA1G 2O1WA 4LF5E 4JV5I 2AJ4A 4MU3A 4DU7A
chains in the Genus database with same CATH topology
2ZITA 4DPXA 4NXNE 2HK3A 2CG9A 3P06A 4LF4E 4DV4I 4FN5A 4PRXA 4JI3I 4B3SI 4DV6E 5GMEA 4DV0I 2BV3A 1N0VC 4DPYA 1Z0WA 1N36E 1NHJA 2V2VA 4DR7E 4DUYI 1Y4UA 4JI2E 5IT9Q 2A2CA 3H4LA 4FWGA 4XTJA 2ZM6E 1XMQE 3CWVA 4JI8E 1NHIA 2IOPA 2V2QA 3Q6MA 3ZM7A 3M6AA 4GKJI 4LF7I 1ZXNA 4KHPE 4DR2I 3PYEA 2XEXA 4EMDA 1Y4SA 4FWHA 4P52A 1Z59A 2UUCI 4LF9E 4DPWA 5GMDA 4MYUA 4DU8A 2Q2EB 4LFAE 4Z7YA 4MYTA 4DR5E 2UXCI 2GQ0A 2HK2A 3GONA 1I94E 4JI6E 4KQVA 5LMUE 1N0UA 4DR4E 4USKA 1IBLE 4N3OA 4DV3I 2E5LE 1Z0TA 1IBMI 1HNXE 4DUZE 3JAMC 4DR3E 1N32I 2UXDI 3J81C 4JI0E 1IBKE 4DR6I 4HACA 3F0NA 1Y6ZA 4B3TE 4NXME 1Z5BA 4DXLA 4UT4A 4JV5E 2UUBI 1B63A 4FWDA 3QT7A 2R3VA 1FWKA 1HR0I 4HY1A 4DV4E 2HFUA 4JI3E 1OJ4A 4B3SE 4DV0E 4DV1I 1J5EI 4RPFA 4HYMA 4JI7I 4LF6I 4DUYE 1ZM2A 4LFBI 1FWLA 4K0KI 3J7AM 3J7AG 4IZKB 1A6FA 1FJGI 1XNRI 1H73A 2HHHE 4IZJB 4GKJE 4LF7E 2PNLA 5A2QC 4DR2E 1ZXMA 2UUCE 3QT8A 3V5RA 4OX9I 1XMOI 1Z5AA 1N33I 1Z5CA 4DR1E 1Z0VA 3T1YI 2OI2A 2WW4A 4JYAI 2UU9I 4JI1I 2UXCE 1H74A 1KTVA 3ZKDA 2HHHI 2CZ9A 2BM1A 3LPSA 4DV3E 4B3MI 1HNWI 1MU5A 1IBME 3D4JA 4DR1I 4HACB 1XNQI 2Z5BB 1N32E 5LL6R 2VQFI 3B82A 5IT9C 2UXDE 2Z5CB 1KVKA 4R1FA 4DPUA 4DR6E 4YHHI 1Z0BA 3Q6NA 3WU4A 1WUUA 5IWAI 2UUBE 5LMNI 4UTGA 1ZM9A 3OTOI 1HR0E 1K47A 1PKPA 1RR9A 3PYDA 4ZVIA 2UUAI 5FLXQ 4LF8E 1KKHA 3PRYA 4DV1E 1J5EE 3ZZTA 1USUA 3V2UC 4X64I 4JI7E 4LF6E 1EA6A 4LFBE 2E1RA 3K85A 2VQEI 4K0KE 4GKKI 4YY3I 1H72C 3PYFA 3T1HI 2HKEA 1FJGE 4WUDA 1XNRE 4IZJD 2NPFA 1DARA 4M1KA 2LJPA 5BR8I 3J80C 4LF8I 4DV7I 2HFSA 4USMA 4OX9E 1XMOE 2O1VA 1N33E 3ZZUA 4WUBA 1NHHA 1H7SA 1FNMA 2F4VI 1QZRA 5A2QQ 3T1YE 4JYAE 2UU9E 1Z0GA 4HXZA 1U2RA 4JI1E 4PRVA 2DEIA 1S4EA 4X62I 1BKNA 4B3ME 4DV5I 4JI4I 1N34I 1HNWE 4X65I 1XNQE 4JI5I 4Z7CA 4AQYI 1FKAE 2VQFE 3K17A 4X66I 2V8PA 4B3RI 4DV2I 2EFGA 3QT5A 4YHHE 3HULA 2UXBI 4LFCI 2VF3A 4URLA 1MX0A 5IWAE 3ZZ0A 2O1TA 5LMNE 3OTOE 1HK7A 1USVA 3WU6A 1H7UA 2UUAE 1D6TA 4LF5I 4NXNI 4X64E 4LF4I 1RREA 2R42A 4DV6I 4IZKA 2VQEE 3WU5A 4GKKE 1XHKA 1NZ0A 1ELOA 4IZJA 3JAMQ 4ED4A 4YY3E 1N36I 2DEJA 5L3JA 4DR7I 3T1HE 4JI2I 2PNMA 2CGEA 3J81Q 3QT6A 2O1UA 2ZM6I 1Z0EA 5BR8E 3K1JA 4DV7E 1XMQI 4JI8I 1MG7A 1PIEA 4KHPI 4WUCA 3B78A 2GS8A 2BM0A 2IOQA 1UEKA 2F4VE 1EI1A 4I3HA 4LF9I 3J80Q 2V2ZA 1KIJA 3LTOA 2V34A 5FWKA 4LFAI 4PU9A 3HJCA 2X36A 4X62E 1PVGA 1HNZE 4DV5E 4DR5I 4JI4E 1I94I 2Z5EA 1N34E 1S16A 4JI6I 5FLXC 2Z5BA 5LMUI 4X65E 4DR4I 2Z5CA 3WU3A 4JI5E 1IBLI 1Z0CA 1ZM3A 4AQYE 2HKJA 2A2DA 2E5LI 4X66E 4B3RE 4DV2E 4FW9A 1HNXI 1FI4A 1B62A 2ZBKB 3LNUA 2UXBE 4DUZI 4DR3I 3B8HA 1ZM4A 3PYGA 4P7AA 4LFCE 3ZKBA 1VISA 3Q1QA 1HNZI 4DPTA 4JG4A 2J7KA 4JI0I 1IBKI 4B3TI 2X7IA 4NXMI 2O1WA 4LF5E 4JV5I 2AJ4A 4DU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  4DPX A;  4NXN E;  2HK3 A;  4LF4 E;  4DV4 I;  4FN5 A;  4PRX A;  4JI3 I;  4B3S I;  4DV6 E;  5GME A;  4DV0 I;  2BV3 A;  1N0V C;  4DPY A;  1Z0W A;  1N36 E;  1NHJ A;  2V2V A;  4DR7 E;  4DUY I;  4JI2 E;  5IT9 Q;  2A2C A;  3H4L A;  4FWG A;  4XTJ A;  2ZM6 E;  1XMQ E;  3CWV A;  4JI8 E;  1NHI A;  2V2Q A;  3ZM7 A;  3M6A A;  4GKJ I;  4LF7 I;  1ZXN A;  4KHP E;  4DR2 I;  3PYE A;  2XEX A;  4EMD A;  4FWH A;  4P52 A;  1Z59 A;  2UUC I;  4LF9 E;  4DPW A;  5GMD A;  4MYU A;  4DU8 A;  2Q2E B;  4LFA E;  4Z7Y A;  4MYT A;  4DR5 E;  2UXC I;  2HK2 A;  3GON A;  1I94 E;  4JI6 E;  4KQV A;  5LMU E;  1N0U A;  4DR4 E;  4USK A;  1IBL E;  4DV3 I;  2E5L E;  1Z0T A;  1IBM I;  1HNX E;  4DUZ E;  3JAM C;  4DR3 E;  1N32 I;  2UXD I;  3J81 C;  4JI0 E;  1IBK E;  4DR6 I;  4HAC A;  3F0N A;  4B3T E;  4NXM E;  1Z5B A;  4DXL A;  4UT4 A;  4JV5 E;  2UUB I;  1B63 A;  4FWD A;  3QT7 A;  1HR0 I;  2R3V A;  1FWK A;  4HY1 A;  4DV4 E;  2HFU A;  4JI3 E;  1OJ4 A;  4B3S E;  4DV0 E;  4DV1 I;  1J5E I;  4RPF A;  4HYM A;  4JI7 I;  4LF6 I;  4DUY E;  1ZM2 A;  4LFB I;  1FWL A;  4K0K I;  3J7A M;  3J7A G;  1A6F A;  1FJG I;  1XNR I;  1H73 A;  2HHH E;  4GKJ E;  4LF7 E;  5A2Q C;  4DR2 E;  1ZXM A;  2UUC E;  3QT8 A;  3V5R A;  4OX9 I;  1XMO I;  1Z5A A;  1N33 I;  1Z5C A;  4DR1 E;  1Z0V A;  3T1Y I;  2OI2 A;  2WW4 A;  4JYA I;  2UU9 I;  4JI1 I;  2UXC E;  1H74 A;  1KTV A;  3ZKD A;  2HHH I;  2CZ9 A;  2BM1 A;  3LPS A;  4DV3 E;  4B3M I;  1HNW I;  1MU5 A;  1IBM E;  3D4J A;  4DR1 I;  4HAC B;  1XNQ I;  1N32 E;  5LL6 R;  2VQF I;  3B82 A;  5IT9 C;  2UXD E;  1KVK A;  4R1F A;  4DPU A;  4DR6 E;  4YHH I;  1Z0B A;  3WU4 A;  1WUU A;  5IWA I;  2UUB E;  5LMN I;  4UTG A;  1ZM9 A;  3OTO I;  1HR0 E;  1K47 A;  1PKP A;  1RR9 A;  3PYD A;  4ZVI A;  2UUA I;  5FLX Q;  4LF8 E;  1KKH A;  4DV1 E;  1J5E E;  3ZZT A;  3V2U C;  4X64 I;  4JI7 E;  4LF6 E;  1EA6 A;  4LFB E;  2E1R A;  2VQE I;  4K0K E;  4GKK I;  4YY3 I;  1H72 C;  3PYF A;  3T1H I;  2HKE A;  1FJG E;  4WUD A;  1XNR E;  2NPF A;  1DAR A;  4M1K A;  2LJP A;  5BR8 I;  3J80 C;  4LF8 I;  4DV7 I;  2HFS A;  4USM A;  4OX9 E;  1XMO E;  1N33 E;  3ZZU A;  4WUB A;  1NHH A;  1H7S A;  1FNM A;  2F4V I;  1QZR A;  5A2Q Q;  3T1Y E;  4JYA E;  2UU9 E;  1Z0G A;  4HXZ A;  1U2R A;  4JI1 E;  4PRV A;  2DEI A;  1S4E A;  4X62 I;  1BKN A;  4B3M E;  4DV5 I;  4JI4 I;  1N34 I;  1HNW E;  4X65 I;  1XNQ E;  4JI5 I;  4Z7C A;  4AQY I;  1FKA E;  2VQF E;  3K17 A;  4X66 I;  2V8P A;  4B3R I;  4DV2 I;  2EFG A;  3QT5 A;  4YHH E;  3HUL A;  2UXB I;  4LFC I;  2VF3 A;  4URL A;  1MX0 A;  5IWA E;  3ZZ0 A;  5LMN E;  3OTO E;  3WU6 A;  1H7U A;  2UUA E;  1D6T A;  4LF5 I;  4NXN I;  4X64 E;  4LF4 I;  1RRE A;  2R42 A;  4DV6 I;  2VQE E;  3WU5 A;  4GKK E;  1XHK A;  1NZ0 A;  1ELO A;  3JAM Q;  4ED4 A;  4YY3 E;  1N36 I;  2DEJ A;  5L3J A;  4DR7 I;  3T1H E;  4JI2 I;  3J81 Q;  3QT6 A;  2ZM6 I;  1Z0E A;  5BR8 E;  3K1J A;  4DV7 E;  1XMQ I;  4JI8 I;  1MG7 A;  1PIE A;  4KHP I;  4WUC A;  3B78 A;  2GS8 A;  2BM0 A;  1UEK A;  2F4V E;  1EI1 A;  4I3H A;  4LF9 I;  3J80 Q;  2V2Z A;  1KIJ A;  3LTO A;  2V34 A;  4LFA I;  4PU9 A;  2X36 A;  4X62 E;  1PVG A;  1HNZ E;  4DV5 E;  4DR5 I;  4JI4 E;  1I94 I;  1N34 E;  4JI6 I;  1S16 A;  5FLX C;  5LMU I;  4X65 E;  4DR4 I;  3WU3 A;  4JI5 E;  1IBL I;  1Z0C A;  1ZM3 A;  4AQY E;  2HKJ A;  2A2D A;  2E5L I;  4X66 E;  4B3R E;  4DV2 E;  4FW9 A;  1HNX I;  1FI4 A;  1B62 A;  2ZBK B;  3LNU A;  2UXB E;  4DUZ I;  4DR3 I;  3B8H A;  1ZM4 A;  3PYG A;  4P7A A;  4LFC E;  3ZKB A;  1VIS A;  3Q1Q A;  1HNZ I;  4DPT A;  4JG4 A;  2J7K A;  4JI0 I;  1IBK I;  4B3T I;  2X7I A;  4NXM I;  4LF5 E;  4JV5 I;  2AJ4 A;  4DU7 A; 
#chains in the Genus database with same CATH topology
 2ZIT A;  4DPX A;  4NXN E;  2HK3 A;  2CG9 A;  3P06 A;  4BA2 A;  4LF4 E;  4DV4 I;  4FN5 A;  4PRX A;  4JI3 I;  1E3P A;  4B3S I;  5EKW A;  4DV6 E;  3L7Z B;  2NN6 D;  3KRN A;  5GME A;  4LCH A;  4DV0 I;  2BV3 A;  1N0V C;  4DPY A;  1Z0W A;  5DNX A;  1N36 E;  1NHJ A;  2V2V A;  4DR7 E;  4DUY I;  1Y4U A;  4JI2 E;  5IT9 Q;  2A2C A;  3H4L A;  3GLL A;  4U3D A;  4MU1 A;  4FWG A;  4XTJ A;  5K36 E;  2PNZ B;  5JEA B;  2ZM6 E;  1XMQ E;  2JEB B;  1R6L A;  3CWV A;  4JI8 E;  1NHI A;  2IOP A;  2V2Q A;  2WP8 A;  3Q6M A;  3U1Y A;  1OYP A;  3M6A A;  4FW7 A;  3ZM7 A;  4LF7 I;  4GKJ I;  2BA0 G;  4LCF A;  1ZXN A;  4KHP E;  5ELW A;  4DR2 I;  3PYE A;  2O3Z A;  2XEX A;  4EMD A;  1Y4S A;  4FWH A;  4P52 A;  1Z59 A;  5DRP A;  2UUC I;  4LF9 E;  5JEA C;  4FW3 A;  4DPW A;  4MQY A;  5GMD A;  4MYU A;  4DU8 A;  2C37 A;  2Q2E B;  4LFA E;  4FW5 A;  2PO0 B;  4IFD A;  4Z7Y A;  4MYT A;  2J65 A;  4MU4 A;  4DR5 E;  2UXC I;  2GQ0 A;  2HK2 A;  3GON A;  1I94 E;  4JI6 E;  4KQV A;  2JE6 B;  5LMU E;  1N0U A;  4DR4 E;  4USK A;  1IBL E;  4N3O A;  4FW6 A;  4OO1 B;  4DV3 I;  5JEA F;  2E5L E;  1Z0T A;  1IBM I;  1E3H A;  5K36 B;  1HNX E;  2WNR B;  4DUZ E;  3JAM C;  4DR3 E;  1OYS A;  5DRO A;  1N32 I;  2UXD I;  4OO1 C;  3J81 C;  4JI0 E;  1IBK E;  4DR6 I;  4HAC A;  3F0N A;  1Y6Z A;  4B3T E;  5K36 C;  4NXM E;  1Z5B A;  4IS9 A;  4DXL A;  4UT4 A;  4JV5 E;  2UUB I;  1B63 A;  4FWD A;  1YHC A;  3QT7 A;  2R3V A;  1FWK A;  1HR0 I;  4HY1 A;  2NN6 A;  4DV4 E;  2HFU A;  4JI3 E;  1OJ4 A;  4AID A;  4B3S E;  1UDS A;  4DV0 E;  4DV1 I;  1J5E I;  4J3D A;  4RPF A;  2C39 B;  4OO1 F;  4HYM A;  4JI7 I;  4LF6 I;  4DUY E;  1ZM2 A;  3GCM A;  4FW4 A;  2VES A;  4LFB I;  5K36 F;  1FWL A;  4K0K I;  3J7A M;  2PO1 B;  5JEA D;  5DRQ A;  3J7A G;  4IZK B;  1A6F A;  1FJG I;  1XNR I;  1H73 A;  5C0X A;  2HHH E;  2PO2 B;  4IZJ B;  4GKJ E;  4LF7 E;  2PNL A;  5A2Q C;  4DR2 E;  1ZXM A;  1UDO A;  3QT8 A;  3V5R A;  2UUC E;  1XMO I;  4OX9 I;  1Z5A A;  1N33 I;  1Z5C A;  4DR1 E;  4OO1 E;  2C38 A;  1Z0V A;  3T1Y I;  3DD6 A;  2OI2 A;  2WW4 A;  4JYA I;  2UU9 I;  3PS3 A;  4JI1 I;  2UXC E;  1H74 A;  1KTV A;  2JEA B;  3ZKD A;  2HHH I;  2CZ9 A;  5C0X D;  2BM1 A;  3LPS A;  3PS1 A;  4AM3 A;  4AIM A;  3GME A;  4DV3 E;  4B3M I;  4BA1 A;  2GO4 A;  2F1D A;  1HNW I;  5K36 D;  1MU5 A;  1IBM E;  3D4J A;  2BR2 B;  4DR1 I;  4HAC B;  1XNQ I;  1Y60 A;  2Z5B B;  5DNL A;  1N32 E;  5LL6 R;  2VQF I;  3B82 A;  5IT9 C;  2UXD E;  2Z5C B;  3P3C A;  1KVK A;  4R1F A;  4DPU A;  4DR6 E;  4YHH I;  1Z0B A;  3Q6N A;  3P3G A;  3WU4 A;  1WUU A;  5IWA I;  2UUB E;  5LMN I;  4UTG A;  1ZM9 A;  3OTO I;  1HR0 E;  3L7Z A;  1K47 A;  1PKP A;  4LOM A;  1RR9 A;  4U3B A;  3PYD A;  3B4T A;  3U1K A;  4ZVI A;  2UUA I;  5FLX Q;  4LF8 E;  1KKH A;  3PRY A;  4DV1 E;  1J5E E;  3ZZT A;  1USU A;  3V2U C;  4X64 I;  4JI7 E;  4MDT A;  4LF6 E;  1EA6 A;  3H1C A;  2IES A;  5JEA A;  4LFB E;  2JEB A;  4BA2 B;  4IFD E;  2E1R A;  3K85 A;  2VQE I;  4K0K E;  4GKK I;  4YY3 I;  1H72 C;  3CDJ A;  3PYF A;  3T1H I;  2HKE A;  1FJG E;  4WUD A;  1XNR E;  4IZJ D;  2NPF A;  1DAR A;  4M1K A;  2LJP A;  3J80 C;  5BR8 I;  4LF8 I;  4DV7 I;  2HFS A;  4USM A;  4OX9 E;  1XMO E;  2PO0 A;  2O1V A;  1N33 E;  3ZZU A;  4WUB A;  1NHH A;  3PS2 A;  1H7S A;  1FNM A;  2F4V I;  2WP8 B;  1QZR A;  5A2Q Q;  3T1Y E;  4JYA E;  4OKG A;  2UU9 E;  1Z0G A;  2JE6 A;  4OZE A;  4HXZ A;  1U2R A;  4JI1 E;  4PRV A;  4OO1 A;  4BA1 B;  1Y5Y A;  2C37 B;  4LCG A;  2DEI A;  4NBQ A;  1S4E A;  3NZK A;  4X62 I;  1BKN A;  5K36 A;  4B3M E;  2WNR A;  4DV5 I;  2NN6 E;  4JI4 I;  4IFD B;  2IER A;  3M85 D;  1N34 I;  1HNW E;  4X65 I;  1XNQ E;  1YH8 A;  4JI5 I;  4Z7C A;  4AQY I;  1FKA E;  2VQF E;  3K17 A;  4X66 I;  1VI7 A;  2V8P A;  4B3R I;  4DV2 I;  4IFD C;  2EFG A;  3QT5 A;  4YHH E;  3HUL A;  2UXB I;  4LFC I;  2VF3 A;  4URL A;  1MX0 A;  5IWA E;  3ZZ0 A;  2O1T A;  4OO1 D;  5LMN E;  5EL9 A;  3OTO E;  1HK7 A;  5C0X E;  1USV A;  3WU6 A;  1H7U A;  2C39 A;  2UUA E;  1D6T A;  4LF5 I;  2GO3 A;  4NXN I;  4X64 E;  4LF4 I;  1UDN A;  2PO1 A;  1RRE A;  4IFD F;  2R42 A;  4DV6 I;  4IZK A;  2NN6 B;  2VQE E;  3WU5 A;  4GKK E;  1XHK A;  3UHM A;  1NZ0 A;  1ELO A;  2PO2 A;  4IZJ A;  4QNK A;  4ED4 A;  3JAM Q;  1R6M A;  4YY3 E;  1XXE A;  2DEJ A;  5L3J A;  1N36 I;  4DR7 I;  3T1H E;  4JI2 I;  2PNM A;  2CGE A;  3J81 Q;  3QT6 A;  2O1U A;  1RHY A;  2AE8 A;  3M7N D;  2NN6 C;  2ZM6 I;  1Z0E A;  5BR8 E;  2BA1 D;  3M85 G;  3K1J A;  4DV7 E;  1XMQ I;  4JI8 I;  3CDI A;  1MG7 A;  1PIE A;  4KHP I;  4WUC A;  3B78 A;  4MU0 A;  2GS8 A;  4LPF A;  2PNZ A;  2BM0 A;  2IOQ A;  1UEK A;  2F4V E;  3P3E A;  5C0X B;  1EI1 A;  4I3H A;  4LF9 I;  2JEA A;  3J80 Q;  2V2Z A;  1KIJ A;  3LTO A;  2V34 A;  5FWK A;  4LFA I;  4PU9 A;  3HJC A;  2X36 A;  5C0X C;  2C38 B;  4ISA A;  2NN6 F;  4X62 E;  1PVG A;  1HNZ E;  2BR2 A;  4IFD D;  4DV5 E;  4DR5 I;  4JI4 E;  1I94 I;  2Z5E A;  1N34 E;  1S16 A;  4JI6 I;  5FLX C;  2Z5B A;  3P76 A;  5LMU I;  5DRR A;  4X65 E;  1P42 A;  4DR4 I;  2Z5C A;  1UDQ A;  3WU3 A;  4JI5 E;  1IBL I;  2BA0 D;  1Z0C A;  1ZM3 A;  4AQY E;  4QNJ A;  2HKJ A;  2A2D A;  2E5L I;  4X66 E;  2CVE A;  4B3R E;  5JEA E;  4DV2 E;  4FW9 A;  1HNX I;  1FI4 A;  1B62 A;  2ZBK B;  3LNU A;  1OYR A;  4DUZ I;  4DR3 I;  3B8H A;  1ZM4 A;  3PYG A;  2UXB E;  4P7A A;  4LFC E;  3ZKB A;  1VIS A;  5C0X F;  3HKM A;  3Q1Q A;  1HNZ I;  4DPT A;  4JG4 A;  2J7K A;  2JT2 A;  4JI0 I;  1IBK I;  4GQU A;  3M7N G;  4B3T I;  2X7I A;  4NXM I;  2BA1 G;  2O1W A;  4LF5 E;  4JV5 I;  2AJ4 A;  4MU3 A;  4DU7 A; 
#chains in the Genus database with same CATH homology
 2ZIT A;  4DPX A;  4NXN E;  2HK3 A;  2CG9 A;  3P06 A;  4LF4 E;  4DV4 I;  4FN5 A;  4PRX A;  4JI3 I;  4B3S I;  4DV6 E;  5GME A;  4DV0 I;  2BV3 A;  1N0V C;  4DPY A;  1Z0W A;  1N36 E;  1NHJ A;  2V2V A;  4DR7 E;  4DUY I;  1Y4U A;  4JI2 E;  5IT9 Q;  2A2C A;  3H4L A;  4FWG A;  4XTJ A;  2ZM6 E;  1XMQ E;  3CWV A;  4JI8 E;  1NHI A;  2IOP A;  2V2Q A;  3Q6M A;  3ZM7 A;  3M6A A;  4GKJ I;  4LF7 I;  1ZXN A;  4KHP E;  4DR2 I;  3PYE A;  2XEX A;  4EMD A;  1Y4S A;  4FWH A;  4P52 A;  1Z59 A;  2UUC I;  4LF9 E;  4DPW A;  5GMD A;  4MYU A;  4DU8 A;  2Q2E B;  4LFA E;  4Z7Y A;  4MYT A;  4DR5 E;  2UXC I;  2GQ0 A;  2HK2 A;  3GON A;  1I94 E;  4JI6 E;  4KQV A;  5LMU E;  1N0U A;  4DR4 E;  4USK A;  1IBL E;  4N3O A;  4DV3 I;  2E5L E;  1Z0T A;  1IBM I;  1HNX E;  4DUZ E;  3JAM C;  4DR3 E;  1N32 I;  2UXD I;  3J81 C;  4JI0 E;  1IBK E;  4DR6 I;  4HAC A;  3F0N A;  1Y6Z A;  4B3T E;  4NXM E;  1Z5B A;  4DXL A;  4UT4 A;  4JV5 E;  2UUB I;  1B63 A;  4FWD A;  3QT7 A;  2R3V A;  1FWK A;  1HR0 I;  4HY1 A;  4DV4 E;  2HFU A;  4JI3 E;  1OJ4 A;  4B3S E;  4DV0 E;  4DV1 I;  1J5E I;  4RPF A;  4HYM A;  4JI7 I;  4LF6 I;  4DUY E;  1ZM2 A;  4LFB I;  1FWL A;  4K0K I;  3J7A M;  3J7A G;  4IZK B;  1A6F A;  1FJG I;  1XNR I;  1H73 A;  2HHH E;  4IZJ B;  4GKJ E;  4LF7 E;  2PNL A;  5A2Q C;  4DR2 E;  1ZXM A;  2UUC E;  3QT8 A;  3V5R A;  4OX9 I;  1XMO I;  1Z5A A;  1N33 I;  1Z5C A;  4DR1 E;  1Z0V A;  3T1Y I;  2OI2 A;  2WW4 A;  4JYA I;  2UU9 I;  4JI1 I;  2UXC E;  1H74 A;  1KTV A;  3ZKD A;  2HHH I;  2CZ9 A;  2BM1 A;  3LPS A;  4DV3 E;  4B3M I;  1HNW I;  1MU5 A;  1IBM E;  3D4J A;  4DR1 I;  4HAC B;  1XNQ I;  2Z5B B;  1N32 E;  5LL6 R;  2VQF I;  3B82 A;  5IT9 C;  2UXD E;  2Z5C B;  1KVK A;  4R1F A;  4DPU A;  4DR6 E;  4YHH I;  1Z0B A;  3Q6N A;  3WU4 A;  1WUU A;  5IWA I;  2UUB E;  5LMN I;  4UTG A;  1ZM9 A;  3OTO I;  1HR0 E;  1K47 A;  1PKP A;  1RR9 A;  3PYD A;  4ZVI A;  2UUA I;  5FLX Q;  4LF8 E;  1KKH A;  3PRY A;  4DV1 E;  1J5E E;  3ZZT A;  1USU A;  3V2U C;  4X64 I;  4JI7 E;  4LF6 E;  1EA6 A;  4LFB E;  2E1R A;  3K85 A;  2VQE I;  4K0K E;  4GKK I;  4YY3 I;  1H72 C;  3PYF A;  3T1H I;  2HKE A;  1FJG E;  4WUD A;  1XNR E;  4IZJ D;  2NPF A;  1DAR A;  4M1K A;  2LJP A;  5BR8 I;  3J80 C;  4LF8 I;  4DV7 I;  2HFS A;  4USM A;  4OX9 E;  1XMO E;  2O1V A;  1N33 E;  3ZZU A;  4WUB A;  1NHH A;  1H7S A;  1FNM A;  2F4V I;  1QZR A;  5A2Q Q;  3T1Y E;  4JYA E;  2UU9 E;  1Z0G A;  4HXZ A;  1U2R A;  4JI1 E;  4PRV A;  2DEI A;  1S4E A;  4X62 I;  1BKN A;  4B3M E;  4DV5 I;  4JI4 I;  1N34 I;  1HNW E;  4X65 I;  1XNQ E;  4JI5 I;  4Z7C A;  4AQY I;  1FKA E;  2VQF E;  3K17 A;  4X66 I;  2V8P A;  4B3R I;  4DV2 I;  2EFG A;  3QT5 A;  4YHH E;  3HUL A;  2UXB I;  4LFC I;  2VF3 A;  4URL A;  1MX0 A;  5IWA E;  3ZZ0 A;  2O1T A;  5LMN E;  3OTO E;  1HK7 A;  1USV A;  3WU6 A;  1H7U A;  2UUA E;  1D6T A;  4LF5 I;  4NXN I;  4X64 E;  4LF4 I;  1RRE A;  2R42 A;  4DV6 I;  4IZK A;  2VQE E;  3WU5 A;  4GKK E;  1XHK A;  1NZ0 A;  1ELO A;  4IZJ A;  3JAM Q;  4ED4 A;  4YY3 E;  1N36 I;  2DEJ A;  5L3J A;  4DR7 I;  3T1H E;  4JI2 I;  2PNM A;  2CGE A;  3J81 Q;  3QT6 A;  2O1U A;  2ZM6 I;  1Z0E A;  5BR8 E;  3K1J A;  4DV7 E;  1XMQ I;  4JI8 I;  1MG7 A;  1PIE A;  4KHP I;  4WUC A;  3B78 A;  2GS8 A;  2BM0 A;  2IOQ A;  1UEK A;  2F4V E;  1EI1 A;  4I3H A;  4LF9 I;  3J80 Q;  2V2Z A;  1KIJ A;  3LTO A;  2V34 A;  5FWK A;  4LFA I;  4PU9 A;  3HJC A;  2X36 A;  4X62 E;  1PVG A;  1HNZ E;  4DV5 E;  4DR5 I;  4JI4 E;  1I94 I;  2Z5E A;  1N34 E;  1S16 A;  4JI6 I;  5FLX C;  2Z5B A;  5LMU I;  4X65 E;  4DR4 I;  2Z5C A;  3WU3 A;  4JI5 E;  1IBL I;  1Z0C A;  1ZM3 A;  4AQY E;  2HKJ A;  2A2D A;  2E5L I;  4X66 E;  4B3R E;  4DV2 E;  4FW9 A;  1HNX I;  1FI4 A;  1B62 A;  2ZBK B;  3LNU A;  2UXB E;  4DUZ I;  4DR3 I;  3B8H A;  1ZM4 A;  3PYG A;  4P7A A;  4LFC E;  3ZKB A;  1VIS A;  3Q1Q A;  1HNZ I;  4DPT A;  4JG4 A;  2J7K A;  4JI0 I;  1IBK I;  4B3T I;  2X7I A;  4NXM I;  2O1W A;  4LF5 E;  4JV5 I;  2AJ4 A;  4DU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...