4LF4I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf4I00
1XMQE 1FKAE 4JI2E 2R42A 1H7SA 4DPWA 1FWLA 4DR3E 3JAMQ 4LF8I 5L3JA 2UXBE 5BR8I 2UUAI 2A2CA 4AQYI 4PU9A 2BM0A 5LMNE 1XNRE 1FI4A 3ZZ0A 2HFUA 1MG7A 2UU9I 4GKKI 4Z7CA 4WUDA 4USKA 4LFBE 2HK3A 4DPYA 1EA6A 4DUZE 2VF3A 3T1YE 4LF7E 2BM1A 1IBLI 1HNWI 1N33E 1N0UA 4DV4I 5LMUE 4B3TE 4JYAI 4JI7E 4KHPE 1H7UA 4MYUA 4UT4A 4DV5I 1PVGA 4LF9I 4ZVIA 4HACB 2R3VA 3J80Q 3D4JA 2ZITA 4DXLA 3J80C 1Z59A 1N34E 4LF5E 2ZM6E 1HNXI 4RPFA 1IBME 4ED4A 1K47A 2A2DA 1FWKA 4DR1E 4DU7A 1Z5CA 1KIJA 1Z0EA 1XMQI 3WU5A 3ZZUA 3PYEA 4JI8I 1A6FA 3ZKDA 4DV2E 4JI2I 3PYDA 4R1FA 1VISA 4JG4A 4X62E 1Z0CA 4DR3I 1ZXMA 3ZM7A 4FN5A 2UUBE 1J5EI 2X36A 1ZM4A 2UXBI 2V8PA 2WW4A 5LMNI 1XNQE 4P7AA 2VQEE 1XNRI 1FNMA 2UXDE 4DV3I 1ELOA 1Z0BA 5FLXC 1RREA 2E1RA 1XMOI 2HHHE 2CZ9A 3LPSA 4JI3E 1B63A 3PYGA 2UXCE 4DR5E 1I94E 4HYMA 3T1YI 4B3SE 4LF7I 4PRVA 2HKEA 4MYTA 4DV0I 4YY3I 4DV7E 1RR9A 1DARA 1N33I 4X65I 5LMUI 4JI5E 2UUCE 4B3RE 1PIEA 1HNZE 1XHKA 3JAMC 2E5LI 5GMDA 4GKJI 4YHHE 4LF6E 4LF5I 4FWDA 2ZM6I 3LTOA 5A2QQ 4DR1I 4FW9A 4DR6I 4LFAE 1N32I 1H73A 1HR0I 4XTJA 4DR7I 4JI1E 2GS8A 3QT8A 1Z0GA 1ZXNA 4Z7YA 3Q1QA 4X62I 1ZM3A 4LF4I 1OJ4A 1Z5AA 4JI6I 4JV5E 4DV1I 2HK2A 4K0KE 4B3ME 4DPXA 4DV6I 3H4LA 4KQVA 4PRXA 4UTGA 4DUYE 1XNQI 2UXDI 3GONA 3QT5A 3ZZTA 2ZBKB 2V2QA 3WU3A 3LNUA 2XEXA 1NHIA 5IWAE 4HACA 4DR5I 1I94I 3M6AA 4NXME 1IBKE 5BR8E 2UUAE 4JI4E 4DV7I 1Z0TA 4JI5I 2UUCI 4B3RI 4JI0E 1HNZI 1N0VC 4YHHI 3T1HE 1KTVA 3V5RA 1NHHA 1MX0A 4OX9E 1EI1A 1HNWE 3OTOE 4LFAI 4LFBI 1QZRA 4DV4E 1N36E 4JI1I 3PYFA 4DUZI 2X7IA 4DR2E 4JV5I 4K0KI 2OI2A 2J7KA 4B3TI 1H74A 4JI7I 4KHPI 1Z0VA 1S4EA 1MU5A 1KKHA 5GMEA 4DUYI 4NXNE 2BV3A 3CWVA 1FJGE 2F4VE 2V2VA 2LJPA 1N34I 4JI8E 4M1KA 3WU4A 1UEKA 2HFSA 1IBMI 5A2QC 1NHJA 5IWAI 4DR4E 4I3HA 3F0NA 1J5EE 1Z5BA 4NXMI 1IBKI 4X64E 4X66E 2DEIA 4JI4I 4LFCE 4DV2I 1KVKA 3QT7A 1U2RA 2EFGA 4DU8A 4JI0I 2UUBI 4FWHA 4DV3E 4WUCA 2VQFE 1XMOE 2Q2EB 1S16A 3T1HI 4USMA 4P52A 3J7AM 2VQEI 4OX9I 1PKPA 5IT9Q 5IT9C 1D6TA 4DV0E 4WUBA 3V2UC 4YY3E 3OTOI 2HHHI 5LL6R 4X65E 1N36I 4JI3I 2UXCI 3B8HA 4LF8E 4B3SI 3ZKBA 1BKNA 2DEJA 4DR2I 2E5LE 4AQYE 4GKJE 1ZM9A 2V2ZA 3B82A 1B62A 3K17A 4DPUA 4HY1A 3K1JA 4NXNI 1NZ0A 2V34A 2UU9E 1FJGI 4GKKE 4DR6E 2F4VI 1N32E 4LF6I 1HR0E 4DPTA 1ZM2A 4DR7E 1WUUA 4FWGA 4HXZA 3B78A 1IBLE 4LF4E 4DR4I 4JI6E 4DV1E 4URLA 4X64I 3HULA 4X66I 4JYAE 4DV6E 4EMDA 4LFCI 2NPFA 4DV5E 4LF9E 1Z0WA 2AJ4A 3QT6A 5FLXQ 4B3MI 2VQFI 3WU6A 2HKJA 1HNXE 3J7AG 1H72C 3J81Q 3J81C
chains in the Genus database with same CATH superfamily
1XMQE 1FKAE 1USVA 3GMEA 4JI2E 2R42A 1H7SA 4DPWA 2C39A 2PNLA 4IFDF 1FWLA 4DR3E 3JAMQ 4LF8I 2PO0A 4MU3A 5L3JA 2UXBE 5BR8I 2UUAI 2A2CA 4AQYI 1E3HA 1R6LA 4PU9A 2BM0A 5LMNE 3M85D 1XNRE 5JEAE 1FI4A 3ZZ0A 4MDTA 3M85G 3P3CA 2HFUA 5ELWA 5K36E 4AIDA 1MG7A 2UU9I 5C0XE 4GKKI 4Z7CA 4WUDA 2F1DA 1Y4SA 4USKA 4LFBE 2HK3A 3U1KA 5JEAD 5K36D 4DPYA 1EA6A 4DUZE 2Z5BB 3L7ZB 2VF3A 3T1YE 4LF7E 5C0XD 2BM1A 1IBLI 3Q6MA 2BR2A 1HNWI 2CG9A 5JEAC 1N33E 1N0UA 4DV4I 5LMUE 4B3TE 5K36C 4JYAI 4JI7E 4KHPE 2CVEA 1H7UA 2GQ0A 4MYUA 4UT4A 5C0XC 1YH8A 5DRRA 4DV5I 1PVGA 4LF9I 4ZVIA 4LPFA 4HACB 2R3VA 5FWKA 3J80Q 3D4JA 4J3DA 2ZITA 4DXLA 3J80C 1Z59A 4IZJA 1HK7A 1N34E 4LF5E 3Q6NA 2ZM6E 3U1YA 1Y5YA 5EL9A 1HNXI 4RPFA 4QNKA 4OO1F 1IBME 4ED4A 1Y60A 2VESA 1K47A 2A2DA 1FWKA 5DRQA 4DR1E 4DU7A 1Z5CA 1KIJA 1Z0EA 1XMQI 3WU5A 3ZZUA 4IFDB 3PYEA 4JI8I 1A6FA 3ZKDA 2IESA 4DV2E 4JI2I 3PYDA 4R1FA 1VISA 4JG4A 4X62E 1Z0CA 4DR3I 1ZXMA 2JE6B 4FN5A 3ZM7A 2UUBE 4U3BA 1J5EI 2X36A 1ZM4A 2UXBI 2V8PA 2WW4A 4AIMA 2O3ZA 5LMNI 1XNQE 4P7AA 2VQEE 1XNRI 5DRPA 2NN6B 1FNMA 1UDQA 2UXDE 1VI7A 4DV3I 1ELOA 1Z0BA 4IZKA 2PO1B 5FLXC 1RREA 2E1RA 4OO1E 5K36F 1XMOI 2HHHE 2CZ9A 3LPSA 4MU4A 4JI3E 3PS1A 1B63A 3PYGA 2NN6A 2UXCE 4DR5E 1I94E 3H1CA 4HYMA 4AM3A 2JEAB 2O1WA 3T1YI 4B3SE 4LF7I 4OO1D 4OZEA 4PRVA 2HKEA 4MYTA 5DROA 4DV0I 4YY3I 4DV7E 1RR9A 1RHYA 1DARA 3P76A 4OKGA 4QNJA 1N33I 4X65I 5LMUI 4JI5E 2UUCE 4B3RE 4OO1C 1PIEA 1HNZE 1XXEA 1XHKA 2BA1D 3JAMC 2E5LI 5GMDA 4GKJI 4YHHE 4LF6E 4LF5I 4FWDA 2ZM6I 3LTOA 5A2QQ 1R6MA 4DR1I 4FW9A 4DR6I 1OYSA 4LFAE 1N32I 1H73A 1HR0I 4XTJA 3K85A 4DR7I 4JI1E 2GS8A 2PNMA 4FW3A 3QT8A 1Z0GA 1ZXNA 4Z7YA 5DNXA 3Q1QA 4X62I 1ZM3A 4LF4I 1OJ4A 1Z5AA 4JI6I 4JV5E 4DV1I 2HK2A 3UHMA 4K0KE 4B3ME 4DPXA 2JT2A 4DV6I 5JEAB 1OYPA 3H4LA 2Z5BA 3L7ZA 5K36B 4IZJD 4KQVA 4LCGA 4PRXA 4UTGA 4DUYE 1XNQI 4FW4A 4MU0A 5C0XB 4MU1A 2PNZB 4U3DA 2UXDI 3GONA 3QT5A 3ZZTA 2Z5CB 5JEAA 2ZBKB 2V2QA 3WU3A 3LNUA 2XEXA 1NHIA 5IWAE 4HACA 5C0XA 4DR5I 1I94I 3M6AA 2WNRB 4NXME 1IBKE 2J65A 5BR8E 2UUAE 4JI4E 4DV7I 4BA2B 1Z0TA 4JI5I 3HJCA 2UUCI 1UDOA 4B3RI 3CDJA 4JI0E 4IFDA 1HNZI 3B4TA 4LCHA 4LOMA 4BA1B 1N0VC 4BA2A 4YHHI 3PS3A 3T1HE 1KTVA 3V5RA 1NHHA 1MX0A 2JE6A 3NZKA 4OX9E 1EI1A 2O1VA 4MQYA 1HNWE 4GQUA 3OTOE 2C37B 2PO2B 4LFAI 4LFBI 1QZRA 4DV4E 1N36E 4JI1I 3PYFA 2C38B 4DUZI 2X7IA 2PO1A 4LCFA 3P06A 1P42A 3PRYA 5DNLA 4DR2E 3M7ND 4JV5I 4K0KI 2OI2A 2WP8B 3M7NG 2J7KA 4B3TI 1H74A 4JI7I 4KHPI 1Z0VA 3P3EA 2JEAA 3HKMA 1OYRA 1S4EA 1MU5A 1KKHA 5GMEA 2CGEA 2Z5EA 4DUYI 4NXNE 2BV3A 4OO1B 3CWVA 1FJGE 2BA1G 2C39B 1Y6ZA 2V2VA 2F4VE 2PO0B 2LJPA 1N34I 4JI8E 4M1KA 3WU4A 1UDNA 1UEKA 2HFSA 1IBMI 4OO1A 5A2QC 1NHJA 5IWAI 1USUA 2O1UA 4DR4E 2GO4A 4I3HA 3F0NA 1E3PA 1Z5BA 1J5EE 4NXMI 1IBKI 4X64E 3P3GA 4X66E 2DEIA 4JI4I 4LFCE 4DV2I 2IERA 1KVKA 3QT7A 1U2RA 2EFGA 4DU8A 4JI0I 2UUBI 4FWHA 4DV3E 4WUCA 2VQFE 1XMOE 1Y4UA 2BR2B 2Q2EB 4ISAA 1S16A 2NN6F 3CDIA 3T1HI 4USMA 4P52A 3J7AM 2VQEI 4OX9I 1PKPA 5IT9Q 4NBQA 5IT9C 1D6TA 2IOPA 4DV0E 3PS2A 4WUBA 3V2UC 4YY3E 4N3OA 5K36A 3OTOI 2HHHI 5LL6R 4IS9A 4X65E 1N36I 4JI3I 4IFDE 4IZJB 2PNZA 2UXCI 3B8HA 4LF8E 4B3SI 2Z5CA 3ZKBA 1BKNA 2DEJA 4DR2I 2E5LE 4FW5A 4AQYE 3GCMA 4IFDD 4GKJE 1ZM9A 3KRNA 2V2ZA 3B82A 1B62A 3K17A 2WNRA 4DPUA 4HY1A 3K1JA 4NXNI 1NZ0A 2V34A 2UU9E 4IFDC 1FJGI 4GKKE 2NN6E 4DR6E 2F4VI 1N32E 4LF6I 1HR0E 4DPTA 1ZM2A 4DR7E 1WUUA 4FWGA 4HXZA 3B78A 1IBLE 2NN6D 4LF4E 4DR4I 4JI6E 4BA1A 1YHCA 4DV1E 4URLA 2AE8A 4X64I 3HULA 4IZKB 4X66I 4JYAE 4DV6E 2JEBB 4EMDA 2NN6C 4LFCI 2NPFA 4DV5E 4LF9E 1Z0WA 5EKWA 2AJ4A 2C37A 2PO2A 3QT6A 4FW7A 3DD6A 5FLXQ 5JEAF 2O1TA 2IOQA 4B3MI 2VQFI 3WU6A 2HKJA 2JEBA 2C38A 2BA0D 1HNXE 2GO3A 3J7AG 5C0XF 1UDSA 2BA0G 4FW6A 1H72C 3J81Q 3GLLA 2WP8A 3J81C
chains in the Genus database with same CATH topology
1XMQE 1FKAE 1USVA 4JI2E 2R42A 1H7SA 4DPWA 2PNLA 1FWLA 4DR3E 3JAMQ 4LF8I 5L3JA 2UXBE 5BR8I 2UUAI 2A2CA 4AQYI 4PU9A 2BM0A 5LMNE 1XNRE 1FI4A 3ZZ0A 2HFUA 1MG7A 2UU9I 4GKKI 4Z7CA 4WUDA 4USKA 1Y4SA 4LFBE 2HK3A 4DPYA 1EA6A 4DUZE 2Z5BB 2VF3A 3T1YE 4LF7E 2BM1A 1IBLI 3Q6MA 1HNWI 2CG9A 1N33E 1N0UA 4DV4I 5LMUE 4B3TE 4JYAI 4JI7E 4KHPE 1H7UA 2GQ0A 4MYUA 4UT4A 4DV5I 1PVGA 4LF9I 4ZVIA 4HACB 2R3VA 5FWKA 3J80Q 3D4JA 2ZITA 4DXLA 3J80C 1Z59A 4IZJA 1HK7A 1N34E 4LF5E 3Q6NA 2ZM6E 1HNXI 4RPFA 1IBME 4ED4A 1K47A 2A2DA 1FWKA 4DR1E 4DU7A 1Z5CA 1KIJA 1Z0EA 1XMQI 3WU5A 3ZZUA 3PYEA 4JI8I 1A6FA 3ZKDA 4DV2E 4JI2I 3PYDA 4R1FA 1VISA 4JG4A 4X62E 1Z0CA 4DR3I 1ZXMA 3ZM7A 4FN5A 2UUBE 1J5EI 2X36A 1ZM4A 2UXBI 2V8PA 2WW4A 5LMNI 1XNQE 4P7AA 2VQEE 1XNRI 1FNMA 2UXDE 4DV3I 1ELOA 1Z0BA 4IZKA 5FLXC 1RREA 2E1RA 1XMOI 2HHHE 2CZ9A 3LPSA 4JI3E 1B63A 3PYGA 2UXCE 4DR5E 1I94E 4HYMA 2O1WA 3T1YI 4B3SE 4LF7I 4PRVA 2HKEA 4MYTA 4DV0I 4YY3I 4DV7E 1RR9A 1DARA 1N33I 4X65I 5LMUI 4JI5E 2UUCE 4B3RE 1PIEA 1HNZE 1XHKA 3JAMC 2E5LI 5GMDA 4GKJI 4YHHE 4LF6E 4LF5I 4FWDA 2ZM6I 3LTOA 5A2QQ 4DR1I 4FW9A 4DR6I 4LFAE 1N32I 1H73A 1HR0I 4XTJA 3K85A 4DR7I 4JI1E 2GS8A 2PNMA 3QT8A 1Z0GA 1ZXNA 4Z7YA 3Q1QA 4X62I 1ZM3A 4LF4I 1OJ4A 1Z5AA 4JI6I 4JV5E 4DV1I 2HK2A 4K0KE 4B3ME 4DPXA 4DV6I 3H4LA 2Z5BA 4IZJD 4KQVA 4PRXA 4UTGA 4DUYE 1XNQI 2UXDI 3GONA 3QT5A 3ZZTA 2Z5CB 2ZBKB 2V2QA 3WU3A 3LNUA 2XEXA 1NHIA 5IWAE 4HACA 4DR5I 1I94I 3M6AA 4NXME 1IBKE 5BR8E 2UUAE 4JI4E 4DV7I 1Z0TA 4JI5I 3HJCA 2UUCI 4B3RI 4JI0E 1HNZI 1N0VC 4YHHI 3T1HE 1KTVA 3V5RA 1NHHA 1MX0A 4OX9E 1EI1A 2O1VA 1HNWE 3OTOE 4LFAI 4LFBI 1QZRA 4DV4E 1N36E 4JI1I 3PYFA 4DUZI 2X7IA 3P06A 3PRYA 4DR2E 4JV5I 4K0KI 2OI2A 2J7KA 4B3TI 1H74A 4JI7I 4KHPI 1Z0VA 1S4EA 1MU5A 1KKHA 5GMEA 2CGEA 2Z5EA 4DUYI 4NXNE 2BV3A 3CWVA 1FJGE 1Y6ZA 2V2VA 2F4VE 2LJPA 1N34I 4JI8E 4M1KA 3WU4A 1UEKA 2HFSA 1IBMI 5A2QC 1NHJA 5IWAI 1USUA 2O1UA 4DR4E 4I3HA 3F0NA 1J5EE 1Z5BA 4NXMI 1IBKI 4X64E 4X66E 2DEIA 4JI4I 4LFCE 4DV2I 1KVKA 3QT7A 1U2RA 2EFGA 4DU8A 4JI0I 2UUBI 4FWHA 4DV3E 4WUCA 2VQFE 1XMOE 1Y4UA 2Q2EB 1S16A 3T1HI 4USMA 4P52A 3J7AM 2VQEI 4OX9I 1PKPA 5IT9Q 5IT9C 1D6TA 2IOPA 4DV0E 4WUBA 3V2UC 4YY3E 4N3OA 3OTOI 2HHHI 5LL6R 4X65E 1N36I 4JI3I 4IZJB 2UXCI 3B8HA 4LF8E 4B3SI 2Z5CA 3ZKBA 1BKNA 2DEJA 4DR2I 2E5LE 4AQYE 4GKJE 1ZM9A 2V2ZA 3B82A 1B62A 3K17A 4DPUA 4HY1A 3K1JA 4NXNI 1NZ0A 2V34A 2UU9E 1FJGI 4GKKE 4DR6E 2F4VI 1N32E 4LF6I 1HR0E 4DPTA 1ZM2A 4DR7E 1WUUA 4FWGA 4HXZA 3B78A 1IBLE 4LF4E 4DR4I 4JI6E 4DV1E 4URLA 4X64I 3HULA 4IZKB 4X66I 4JYAE 4DV6E 4EMDA 4LFCI 2NPFA 4DV5E 4LF9E 1Z0WA 2AJ4A 3QT6A 5FLXQ 2O1TA 2IOQA 4B3MI 2VQFI 3WU6A 2HKJA 1HNXE 3J7AG 1H72C 3J81Q 3J81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ E;  1FKA E;  4JI2 E;  2R42 A;  1H7S A;  4DPW A;  1FWL A;  4DR3 E;  3JAM Q;  4LF8 I;  5L3J A;  2UXB E;  5BR8 I;  2UUA I;  2A2C A;  4AQY I;  4PU9 A;  2BM0 A;  5LMN E;  1XNR E;  1FI4 A;  3ZZ0 A;  2HFU A;  1MG7 A;  2UU9 I;  4GKK I;  4Z7C A;  4WUD A;  4USK A;  4LFB E;  2HK3 A;  4DPY A;  1EA6 A;  4DUZ E;  2VF3 A;  3T1Y E;  4LF7 E;  2BM1 A;  1IBL I;  1HNW I;  1N33 E;  1N0U A;  4DV4 I;  5LMU E;  4B3T E;  4JYA I;  4JI7 E;  4KHP E;  1H7U A;  4MYU A;  4UT4 A;  4DV5 I;  1PVG A;  4LF9 I;  4ZVI A;  4HAC B;  2R3V A;  3J80 Q;  3D4J A;  2ZIT A;  4DXL A;  3J80 C;  1Z59 A;  1N34 E;  4LF5 E;  2ZM6 E;  1HNX I;  4RPF A;  1IBM E;  4ED4 A;  1K47 A;  2A2D A;  1FWK A;  4DR1 E;  4DU7 A;  1Z5C A;  1KIJ A;  1Z0E A;  1XMQ I;  3WU5 A;  3ZZU A;  3PYE A;  4JI8 I;  1A6F A;  3ZKD A;  4DV2 E;  4JI2 I;  3PYD A;  4R1F A;  1VIS A;  4JG4 A;  4X62 E;  1Z0C A;  4DR3 I;  1ZXM A;  3ZM7 A;  4FN5 A;  2UUB E;  1J5E I;  2X36 A;  1ZM4 A;  2UXB I;  2V8P A;  2WW4 A;  5LMN I;  1XNQ E;  4P7A A;  2VQE E;  1XNR I;  1FNM A;  2UXD E;  4DV3 I;  1ELO A;  1Z0B A;  5FLX C;  1RRE A;  2E1R A;  1XMO I;  2HHH E;  2CZ9 A;  3LPS A;  4JI3 E;  1B63 A;  3PYG A;  2UXC E;  4DR5 E;  1I94 E;  4HYM A;  3T1Y I;  4B3S E;  4LF7 I;  4PRV A;  2HKE A;  4MYT A;  4DV0 I;  4YY3 I;  4DV7 E;  1RR9 A;  1DAR A;  1N33 I;  4X65 I;  5LMU I;  4JI5 E;  2UUC E;  4B3R E;  1PIE A;  1HNZ E;  1XHK A;  3JAM C;  2E5L I;  5GMD A;  4GKJ I;  4YHH E;  4LF6 E;  4LF5 I;  4FWD A;  2ZM6 I;  3LTO A;  5A2Q Q;  4DR1 I;  4FW9 A;  4DR6 I;  4LFA E;  1N32 I;  1H73 A;  1HR0 I;  4XTJ A;  4DR7 I;  4JI1 E;  2GS8 A;  3QT8 A;  1Z0G A;  1ZXN A;  4Z7Y A;  3Q1Q A;  4X62 I;  1ZM3 A;  4LF4 I;  1OJ4 A;  1Z5A A;  4JI6 I;  4JV5 E;  4DV1 I;  2HK2 A;  4K0K E;  4B3M E;  4DPX A;  4DV6 I;  3H4L A;  4KQV A;  4PRX A;  4UTG A;  4DUY E;  1XNQ I;  2UXD I;  3GON A;  3QT5 A;  3ZZT A;  2ZBK B;  2V2Q A;  3WU3 A;  3LNU A;  2XEX A;  1NHI A;  5IWA E;  4HAC A;  4DR5 I;  1I94 I;  3M6A A;  4NXM E;  1IBK E;  5BR8 E;  2UUA E;  4JI4 E;  4DV7 I;  1Z0T A;  4JI5 I;  2UUC I;  4B3R I;  4JI0 E;  1HNZ I;  1N0V C;  4YHH I;  3T1H E;  1KTV A;  3V5R A;  1NHH A;  1MX0 A;  4OX9 E;  1EI1 A;  1HNW E;  3OTO E;  4LFA I;  4LFB I;  1QZR A;  4DV4 E;  1N36 E;  4JI1 I;  3PYF A;  4DUZ I;  2X7I A;  4DR2 E;  4JV5 I;  4K0K I;  2OI2 A;  2J7K A;  4B3T I;  1H74 A;  4JI7 I;  4KHP I;  1Z0V A;  1S4E A;  1MU5 A;  1KKH A;  5GME A;  4DUY I;  4NXN E;  2BV3 A;  3CWV A;  1FJG E;  2F4V E;  2V2V A;  2LJP A;  1N34 I;  4JI8 E;  4M1K A;  3WU4 A;  1UEK A;  2HFS A;  1IBM I;  5A2Q C;  1NHJ A;  5IWA I;  4DR4 E;  4I3H A;  3F0N A;  1J5E E;  1Z5B A;  4NXM I;  1IBK I;  4X64 E;  4X66 E;  2DEI A;  4JI4 I;  4LFC E;  4DV2 I;  1KVK A;  3QT7 A;  1U2R A;  2EFG A;  4DU8 A;  4JI0 I;  2UUB I;  4FWH A;  4DV3 E;  4WUC A;  2VQF E;  1XMO E;  2Q2E B;  1S16 A;  3T1H I;  4USM A;  4P52 A;  3J7A M;  2VQE I;  4OX9 I;  1PKP A;  5IT9 Q;  5IT9 C;  1D6T A;  4DV0 E;  4WUB A;  3V2U C;  4YY3 E;  3OTO I;  2HHH I;  5LL6 R;  4X65 E;  1N36 I;  4JI3 I;  2UXC I;  3B8H A;  4LF8 E;  4B3S I;  3ZKB A;  1BKN A;  2DEJ A;  4DR2 I;  2E5L E;  4AQY E;  4GKJ E;  1ZM9 A;  2V2Z A;  3B82 A;  1B62 A;  3K17 A;  4DPU A;  4HY1 A;  3K1J A;  4NXN I;  1NZ0 A;  2V34 A;  2UU9 E;  1FJG I;  4GKK E;  4DR6 E;  2F4V I;  1N32 E;  4LF6 I;  1HR0 E;  4DPT A;  1ZM2 A;  4DR7 E;  1WUU A;  4FWG A;  4HXZ A;  3B78 A;  1IBL E;  4LF4 E;  4DR4 I;  4JI6 E;  4DV1 E;  4URL A;  4X64 I;  3HUL A;  4X66 I;  4JYA E;  4DV6 E;  4EMD A;  4LFC I;  2NPF A;  4DV5 E;  4LF9 E;  1Z0W A;  2AJ4 A;  3QT6 A;  5FLX Q;  4B3M I;  2VQF I;  3WU6 A;  2HKJ A;  1HNX E;  3J7A G;  1H72 C;  3J81 Q;  3J81 C; 
#chains in the Genus database with same CATH topology
 1XMQ E;  1FKA E;  1USV A;  3GME A;  4JI2 E;  2R42 A;  1H7S A;  4DPW A;  2C39 A;  2PNL A;  4IFD F;  1FWL A;  4DR3 E;  3JAM Q;  4LF8 I;  2PO0 A;  4MU3 A;  5L3J A;  2UXB E;  5BR8 I;  2UUA I;  2A2C A;  4AQY I;  1E3H A;  1R6L A;  4PU9 A;  2BM0 A;  5LMN E;  3M85 D;  1XNR E;  5JEA E;  1FI4 A;  3ZZ0 A;  4MDT A;  3M85 G;  3P3C A;  2HFU A;  5ELW A;  5K36 E;  4AID A;  1MG7 A;  2UU9 I;  5C0X E;  4GKK I;  4Z7C A;  4WUD A;  2F1D A;  1Y4S A;  4USK A;  4LFB E;  2HK3 A;  3U1K A;  5JEA D;  5K36 D;  4DPY A;  1EA6 A;  4DUZ E;  2Z5B B;  3L7Z B;  2VF3 A;  3T1Y E;  4LF7 E;  5C0X D;  2BM1 A;  1IBL I;  3Q6M A;  2BR2 A;  1HNW I;  2CG9 A;  5JEA C;  1N33 E;  1N0U A;  4DV4 I;  5LMU E;  4B3T E;  5K36 C;  4JYA I;  4JI7 E;  4KHP E;  2CVE A;  1H7U A;  2GQ0 A;  4MYU A;  4UT4 A;  5C0X C;  1YH8 A;  5DRR A;  4DV5 I;  1PVG A;  4LF9 I;  4ZVI A;  4LPF A;  4HAC B;  2R3V A;  5FWK A;  3J80 Q;  3D4J A;  4J3D A;  2ZIT A;  4DXL A;  3J80 C;  1Z59 A;  4IZJ A;  1HK7 A;  1N34 E;  4LF5 E;  3Q6N A;  2ZM6 E;  3U1Y A;  1Y5Y A;  5EL9 A;  1HNX I;  4RPF A;  4QNK A;  4OO1 F;  1IBM E;  4ED4 A;  1Y60 A;  2VES A;  1K47 A;  2A2D A;  1FWK A;  5DRQ A;  4DR1 E;  4DU7 A;  1Z5C A;  1KIJ A;  1Z0E A;  1XMQ I;  3WU5 A;  3ZZU A;  4IFD B;  3PYE A;  4JI8 I;  1A6F A;  3ZKD A;  2IES A;  4DV2 E;  4JI2 I;  3PYD A;  4R1F A;  1VIS A;  4JG4 A;  4X62 E;  1Z0C A;  4DR3 I;  1ZXM A;  2JE6 B;  4FN5 A;  3ZM7 A;  2UUB E;  4U3B A;  1J5E I;  2X36 A;  1ZM4 A;  2UXB I;  2V8P A;  2WW4 A;  4AIM A;  2O3Z A;  5LMN I;  1XNQ E;  4P7A A;  2VQE E;  1XNR I;  5DRP A;  2NN6 B;  1FNM A;  1UDQ A;  2UXD E;  1VI7 A;  4DV3 I;  1ELO A;  1Z0B A;  4IZK A;  2PO1 B;  5FLX C;  1RRE A;  2E1R A;  4OO1 E;  5K36 F;  1XMO I;  2HHH E;  2CZ9 A;  3LPS A;  4MU4 A;  4JI3 E;  3PS1 A;  1B63 A;  3PYG A;  2NN6 A;  2UXC E;  4DR5 E;  1I94 E;  3H1C A;  4HYM A;  4AM3 A;  2JEA B;  2O1W A;  3T1Y I;  4B3S E;  4LF7 I;  4OO1 D;  4OZE A;  4PRV A;  2HKE A;  4MYT A;  5DRO A;  4DV0 I;  4YY3 I;  4DV7 E;  1RR9 A;  1RHY A;  1DAR A;  3P76 A;  4OKG A;  4QNJ A;  1N33 I;  4X65 I;  5LMU I;  4JI5 E;  2UUC E;  4B3R E;  4OO1 C;  1PIE A;  1HNZ E;  1XXE A;  1XHK A;  2BA1 D;  3JAM C;  2E5L I;  5GMD A;  4GKJ I;  4YHH E;  4LF6 E;  4LF5 I;  4FWD A;  2ZM6 I;  3LTO A;  5A2Q Q;  1R6M A;  4DR1 I;  4FW9 A;  4DR6 I;  1OYS A;  4LFA E;  1N32 I;  1H73 A;  1HR0 I;  4XTJ A;  3K85 A;  4DR7 I;  4JI1 E;  2GS8 A;  2PNM A;  4FW3 A;  3QT8 A;  1Z0G A;  1ZXN A;  4Z7Y A;  5DNX A;  3Q1Q A;  4X62 I;  1ZM3 A;  4LF4 I;  1OJ4 A;  1Z5A A;  4JI6 I;  4JV5 E;  4DV1 I;  2HK2 A;  3UHM A;  4K0K E;  4B3M E;  4DPX A;  2JT2 A;  4DV6 I;  5JEA B;  1OYP A;  3H4L A;  2Z5B A;  3L7Z A;  5K36 B;  4IZJ D;  4KQV A;  4LCG A;  4PRX A;  4UTG A;  4DUY E;  1XNQ I;  4FW4 A;  4MU0 A;  5C0X B;  4MU1 A;  2PNZ B;  4U3D A;  2UXD I;  3GON A;  3QT5 A;  3ZZT A;  2Z5C B;  5JEA A;  2ZBK B;  2V2Q A;  3WU3 A;  3LNU A;  2XEX A;  1NHI A;  5IWA E;  4HAC A;  5C0X A;  4DR5 I;  1I94 I;  3M6A A;  2WNR B;  4NXM E;  1IBK E;  2J65 A;  5BR8 E;  2UUA E;  4JI4 E;  4DV7 I;  4BA2 B;  1Z0T A;  4JI5 I;  3HJC A;  2UUC I;  1UDO A;  4B3R I;  3CDJ A;  4JI0 E;  4IFD A;  1HNZ I;  3B4T A;  4LCH A;  4LOM A;  4BA1 B;  1N0V C;  4BA2 A;  4YHH I;  3PS3 A;  3T1H E;  1KTV A;  3V5R A;  1NHH A;  1MX0 A;  2JE6 A;  3NZK A;  4OX9 E;  1EI1 A;  2O1V A;  4MQY A;  1HNW E;  4GQU A;  3OTO E;  2C37 B;  2PO2 B;  4LFA I;  4LFB I;  1QZR A;  4DV4 E;  1N36 E;  4JI1 I;  3PYF A;  2C38 B;  4DUZ I;  2X7I A;  2PO1 A;  4LCF A;  3P06 A;  1P42 A;  3PRY A;  5DNL A;  4DR2 E;  3M7N D;  4JV5 I;  4K0K I;  2OI2 A;  2WP8 B;  3M7N G;  2J7K A;  4B3T I;  1H74 A;  4JI7 I;  4KHP I;  1Z0V A;  3P3E A;  2JEA A;  3HKM A;  1OYR A;  1S4E A;  1MU5 A;  1KKH A;  5GME A;  2CGE A;  2Z5E A;  4DUY I;  4NXN E;  2BV3 A;  4OO1 B;  3CWV A;  1FJG E;  2BA1 G;  2C39 B;  1Y6Z A;  2V2V A;  2F4V E;  2PO0 B;  2LJP A;  1N34 I;  4JI8 E;  4M1K A;  3WU4 A;  1UDN A;  1UEK A;  2HFS A;  1IBM I;  4OO1 A;  5A2Q C;  1NHJ A;  5IWA I;  1USU A;  2O1U A;  4DR4 E;  2GO4 A;  4I3H A;  3F0N A;  1E3P A;  1Z5B A;  1J5E E;  4NXM I;  1IBK I;  4X64 E;  3P3G A;  4X66 E;  2DEI A;  4JI4 I;  4LFC E;  4DV2 I;  2IER A;  1KVK A;  3QT7 A;  1U2R A;  2EFG A;  4DU8 A;  4JI0 I;  2UUB I;  4FWH A;  4DV3 E;  4WUC A;  2VQF E;  1XMO E;  1Y4U A;  2BR2 B;  2Q2E B;  4ISA A;  1S16 A;  2NN6 F;  3CDI A;  3T1H I;  4USM A;  4P52 A;  3J7A M;  2VQE I;  4OX9 I;  1PKP A;  5IT9 Q;  4NBQ A;  5IT9 C;  1D6T A;  2IOP A;  4DV0 E;  3PS2 A;  4WUB A;  3V2U C;  4YY3 E;  4N3O A;  5K36 A;  3OTO I;  2HHH I;  5LL6 R;  4IS9 A;  4X65 E;  1N36 I;  4JI3 I;  4IFD E;  4IZJ B;  2PNZ A;  2UXC I;  3B8H A;  4LF8 E;  4B3S I;  2Z5C A;  3ZKB A;  1BKN A;  2DEJ A;  4DR2 I;  2E5L E;  4FW5 A;  4AQY E;  3GCM A;  4IFD D;  4GKJ E;  1ZM9 A;  3KRN A;  2V2Z A;  3B82 A;  1B62 A;  3K17 A;  2WNR A;  4DPU A;  4HY1 A;  3K1J A;  4NXN I;  1NZ0 A;  2V34 A;  2UU9 E;  4IFD C;  1FJG I;  4GKK E;  2NN6 E;  4DR6 E;  2F4V I;  1N32 E;  4LF6 I;  1HR0 E;  4DPT A;  1ZM2 A;  4DR7 E;  1WUU A;  4FWG A;  4HXZ A;  3B78 A;  1IBL E;  2NN6 D;  4LF4 E;  4DR4 I;  4JI6 E;  4BA1 A;  1YHC A;  4DV1 E;  4URL A;  2AE8 A;  4X64 I;  3HUL A;  4IZK B;  4X66 I;  4JYA E;  4DV6 E;  2JEB B;  4EMD A;  2NN6 C;  4LFC I;  2NPF A;  4DV5 E;  4LF9 E;  1Z0W A;  5EKW A;  2AJ4 A;  2C37 A;  2PO2 A;  3QT6 A;  4FW7 A;  3DD6 A;  5FLX Q;  5JEA F;  2O1T A;  2IOQ A;  4B3M I;  2VQF I;  3WU6 A;  2HKJ A;  2JEB A;  2C38 A;  2BA0 D;  1HNX E;  2GO3 A;  3J7A G;  5C0X F;  1UDS A;  2BA0 G;  4FW6 A;  1H72 C;  3J81 Q;  3GLL A;  2WP8 A;  3J81 C; 
#chains in the Genus database with same CATH homology
 1XMQ E;  1FKA E;  1USV A;  4JI2 E;  2R42 A;  1H7S A;  4DPW A;  2PNL A;  1FWL A;  4DR3 E;  3JAM Q;  4LF8 I;  5L3J A;  2UXB E;  5BR8 I;  2UUA I;  2A2C A;  4AQY I;  4PU9 A;  2BM0 A;  5LMN E;  1XNR E;  1FI4 A;  3ZZ0 A;  2HFU A;  1MG7 A;  2UU9 I;  4GKK I;  4Z7C A;  4WUD A;  4USK A;  1Y4S A;  4LFB E;  2HK3 A;  4DPY A;  1EA6 A;  4DUZ E;  2Z5B B;  2VF3 A;  3T1Y E;  4LF7 E;  2BM1 A;  1IBL I;  3Q6M A;  1HNW I;  2CG9 A;  1N33 E;  1N0U A;  4DV4 I;  5LMU E;  4B3T E;  4JYA I;  4JI7 E;  4KHP E;  1H7U A;  2GQ0 A;  4MYU A;  4UT4 A;  4DV5 I;  1PVG A;  4LF9 I;  4ZVI A;  4HAC B;  2R3V A;  5FWK A;  3J80 Q;  3D4J A;  2ZIT A;  4DXL A;  3J80 C;  1Z59 A;  4IZJ A;  1HK7 A;  1N34 E;  4LF5 E;  3Q6N A;  2ZM6 E;  1HNX I;  4RPF A;  1IBM E;  4ED4 A;  1K47 A;  2A2D A;  1FWK A;  4DR1 E;  4DU7 A;  1Z5C A;  1KIJ A;  1Z0E A;  1XMQ I;  3WU5 A;  3ZZU A;  3PYE A;  4JI8 I;  1A6F A;  3ZKD A;  4DV2 E;  4JI2 I;  3PYD A;  4R1F A;  1VIS A;  4JG4 A;  4X62 E;  1Z0C A;  4DR3 I;  1ZXM A;  3ZM7 A;  4FN5 A;  2UUB E;  1J5E I;  2X36 A;  1ZM4 A;  2UXB I;  2V8P A;  2WW4 A;  5LMN I;  1XNQ E;  4P7A A;  2VQE E;  1XNR I;  1FNM A;  2UXD E;  4DV3 I;  1ELO A;  1Z0B A;  4IZK A;  5FLX C;  1RRE A;  2E1R A;  1XMO I;  2HHH E;  2CZ9 A;  3LPS A;  4JI3 E;  1B63 A;  3PYG A;  2UXC E;  4DR5 E;  1I94 E;  4HYM A;  2O1W A;  3T1Y I;  4B3S E;  4LF7 I;  4PRV A;  2HKE A;  4MYT A;  4DV0 I;  4YY3 I;  4DV7 E;  1RR9 A;  1DAR A;  1N33 I;  4X65 I;  5LMU I;  4JI5 E;  2UUC E;  4B3R E;  1PIE A;  1HNZ E;  1XHK A;  3JAM C;  2E5L I;  5GMD A;  4GKJ I;  4YHH E;  4LF6 E;  4LF5 I;  4FWD A;  2ZM6 I;  3LTO A;  5A2Q Q;  4DR1 I;  4FW9 A;  4DR6 I;  4LFA E;  1N32 I;  1H73 A;  1HR0 I;  4XTJ A;  3K85 A;  4DR7 I;  4JI1 E;  2GS8 A;  2PNM A;  3QT8 A;  1Z0G A;  1ZXN A;  4Z7Y A;  3Q1Q A;  4X62 I;  1ZM3 A;  4LF4 I;  1OJ4 A;  1Z5A A;  4JI6 I;  4JV5 E;  4DV1 I;  2HK2 A;  4K0K E;  4B3M E;  4DPX A;  4DV6 I;  3H4L A;  2Z5B A;  4IZJ D;  4KQV A;  4PRX A;  4UTG A;  4DUY E;  1XNQ I;  2UXD I;  3GON A;  3QT5 A;  3ZZT A;  2Z5C B;  2ZBK B;  2V2Q A;  3WU3 A;  3LNU A;  2XEX A;  1NHI A;  5IWA E;  4HAC A;  4DR5 I;  1I94 I;  3M6A A;  4NXM E;  1IBK E;  5BR8 E;  2UUA E;  4JI4 E;  4DV7 I;  1Z0T A;  4JI5 I;  3HJC A;  2UUC I;  4B3R I;  4JI0 E;  1HNZ I;  1N0V C;  4YHH I;  3T1H E;  1KTV A;  3V5R A;  1NHH A;  1MX0 A;  4OX9 E;  1EI1 A;  2O1V A;  1HNW E;  3OTO E;  4LFA I;  4LFB I;  1QZR A;  4DV4 E;  1N36 E;  4JI1 I;  3PYF A;  4DUZ I;  2X7I A;  3P06 A;  3PRY A;  4DR2 E;  4JV5 I;  4K0K I;  2OI2 A;  2J7K A;  4B3T I;  1H74 A;  4JI7 I;  4KHP I;  1Z0V A;  1S4E A;  1MU5 A;  1KKH A;  5GME A;  2CGE A;  2Z5E A;  4DUY I;  4NXN E;  2BV3 A;  3CWV A;  1FJG E;  1Y6Z A;  2V2V A;  2F4V E;  2LJP A;  1N34 I;  4JI8 E;  4M1K A;  3WU4 A;  1UEK A;  2HFS A;  1IBM I;  5A2Q C;  1NHJ A;  5IWA I;  1USU A;  2O1U A;  4DR4 E;  4I3H A;  3F0N A;  1J5E E;  1Z5B A;  4NXM I;  1IBK I;  4X64 E;  4X66 E;  2DEI A;  4JI4 I;  4LFC E;  4DV2 I;  1KVK A;  3QT7 A;  1U2R A;  2EFG A;  4DU8 A;  4JI0 I;  2UUB I;  4FWH A;  4DV3 E;  4WUC A;  2VQF E;  1XMO E;  1Y4U A;  2Q2E B;  1S16 A;  3T1H I;  4USM A;  4P52 A;  3J7A M;  2VQE I;  4OX9 I;  1PKP A;  5IT9 Q;  5IT9 C;  1D6T A;  2IOP A;  4DV0 E;  4WUB A;  3V2U C;  4YY3 E;  4N3O A;  3OTO I;  2HHH I;  5LL6 R;  4X65 E;  1N36 I;  4JI3 I;  4IZJ B;  2UXC I;  3B8H A;  4LF8 E;  4B3S I;  2Z5C A;  3ZKB A;  1BKN A;  2DEJ A;  4DR2 I;  2E5L E;  4AQY E;  4GKJ E;  1ZM9 A;  2V2Z A;  3B82 A;  1B62 A;  3K17 A;  4DPU A;  4HY1 A;  3K1J A;  4NXN I;  1NZ0 A;  2V34 A;  2UU9 E;  1FJG I;  4GKK E;  4DR6 E;  2F4V I;  1N32 E;  4LF6 I;  1HR0 E;  4DPT A;  1ZM2 A;  4DR7 E;  1WUU A;  4FWG A;  4HXZ A;  3B78 A;  1IBL E;  4LF4 E;  4DR4 I;  4JI6 E;  4DV1 E;  4URL A;  4X64 I;  3HUL A;  4IZK B;  4X66 I;  4JYA E;  4DV6 E;  4EMD A;  4LFC I;  2NPF A;  4DV5 E;  4LF9 E;  1Z0W A;  2AJ4 A;  3QT6 A;  5FLX Q;  2O1T A;  2IOQ A;  4B3M I;  2VQF I;  3WU6 A;  2HKJ A;  1HNX E;  3J7A G;  1H72 C;  3J81 Q;  3J81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...