4LF4I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf4I00
3QT6A 1S16A 4JI3E 1D6TA 4LFBI 1DARA 3CWVA 1IBME 4YY3E 4DV2I 2HFSA 4DUZI 2LJPA 5BR8E 4X65E 2ZM6I 1H72C 1KVKA 3ZKDA 4GKJE 3JAMQ 1ZM9A 1QZRA 1KKHA 4DV3E 2UUBE 1IBKI 4B3RI 4UTGA 3J80C 4LF8E 3HULA 4DUZE 3PYDA 3LPSA 4JI7I 1Z0VA 4B3SE 2BM0A 4JI4I 1S4EA 1PIEA 2UXCE 4YHHI 1HR0I 2GS8A 1NHJA 4JI7E 1WUUA 4JYAE 4NXMI 2V8PA 2ZBKB 4MYUA 1N34I 4PU9A 4JI8E 1N0UA 2BM1A 4DR5I 4DU7A 4X64E 2F4VI 3GONA 4JI0I 2DEJA 3LNUA 4B3TI 2X36A 1XMOI 4LF6I 1Z59A 4GKJI 1MG7A 3K1JA 4KQVA 4K0KI 4DV6I 2R42A 4USMA 3M6AA 2DEIA 1FWLA 5A2QC 1A6FA 2J7KA 4Z7YA 4JI5I 4ED4A 1HNZE 4GKKE 1N33E 4B3MI 5IWAE 4P7AA 4DPXA 4EMDA 1OJ4A 4WUDA 4DR4I 1UEKA 3PYGA 1I94I 4HXZA 5IWAI 1ELOA 2UUBI 1U2RA 3T1HI 5IT9C 2UXDI 2E1RA 3V2UC 1Z5AA 4LF9E 5IT9Q 3ZZUA 4DR2I 4DR7E 2VQFE 4WUBA 1XMOE 3WU4A 3V5RA 1EA6A 3F0NA 4HACB 2UUCE 3D4JA 1N34E 4JI8I 3J80Q 4JI6I 2XEXA 4YY3I 3J81Q 4OX9I 2VQEI 4DR1E 2F4VE 1Z0BA 2VF3A 3ZZ0A 1N36I 3WU6A 2E5LI 4JI1E 2HFUA 4DV1E 4LFAI 1Z0EA 5A2QQ 4DV0I 4DV7I 2VQFI 1FKAE 3J7AM 4LF6E 4Z7CA 1HNXI 4DV1I 4LFAE 1BKNA 4JI5E 1XHKA 1J5EE 4LFCI 4DXLA 4B3SI 1H73A 1VISA 1N0VC 4WUCA 3ZM7A 1XNQI 1HNWE 2VQEE 2CZ9A 4DV4I 4NXNE 2HHHE 4KHPI 4HY1A 1B63A 4JG4A 4DR3E 2UXBE 4DPYA 2HK2A 3K17A 3J7AG 4DPWA 3OTOI 4OX9E 5FLXC 4KHPE 1FJGE 3B8HA 3ZZTA 4USKA 1HNZI 4GKKI 4B3TE 4LF8I 2V2QA 2UXDE 4LF4I 1J5EI 1H7SA 4LFCE 4P52A 4DR3I 1XMQI 4DPUA 4DV5E 4DR6I 1IBLI 1HNWI 5LMUE 4FW9A 4HYMA 4LF4E 3Q1QA 4RPFA 4MYTA 1ZXNA 5GMEA 4FWDA 2UUAI 2EFGA 1XNRE 1B62A 4M1KA 3T1YI 1NHIA 4DR5E 3PYEA 4HACA 2E5LE 4X66E 1I94E 2OI2A 1Z0TA 4NXNI 5BR8I 4X65I 4DV4E 2V2ZA 3T1YE 4JYAI 4ZVIA 4NXME 4AQYI 2X7IA 2Q2EB 2NPFA 4K0KE 1NZ0A 4JI2I 5LMNE 2ZITA 4DV3I 4R1FA 1IBLE 4DV0E 4DV7E 1IBKE 4DR6E 4JV5E 1ZXMA 2A2CA 3WU3A 1RR9A 4DR2E 4LFBE 3JAMC 3B78A 3B82A 1FI4A 4DV2E 4DUYE 2UXBI 4AQYE 1MU5A 1N32I 3LTOA 1KIJA 3T1HE 4URLA 3WU5A 1H7UA 1ZM3A 1RREA 1H74A 5LMUI 4LF7E 4X66I 4YHHE 1HR0E 2HHHI 4DR7I 4LF5E 4DV5I 2A2DA 4JI2E 3H4LA 1NHHA 4DU8A 4DV6E 3J81C 1Z0CA 1EI1A 3QT7A 4X64I 1PVGA 2ZM6E 2R3VA 3PYFA 4LF5I 2HKJA 4PRVA 1ZM4A 3ZKBA 1XMQE 1Z5BA 1PKPA 4FWHA 1ZM2A 2UUCI 1FJGI 4X62E 2UU9I 4FWGA 3OTOE 4B3ME 5FLXQ 4DPTA 4DR1I 1Z0GA 2HK3A 1XNRI 1FNMA 4FN5A 4X62I 5GMDA 4JI6E 2UXCI 4DR4E 1KTVA 1K47A 4B3RE 2V2VA 5L3JA 4JV5I 4UT4A 1N33I 5LMNI 4XTJA 2BV3A 1XNQE 4JI4E 2UUAE 4JI0E 4LF9I 2HKEA 1FWKA 1N32E 2V34A 2UU9E 2WW4A 1HNXE 4JI3I 3QT8A 4DUYI 1Z0WA 2AJ4A 5LL6R 4LF7I 1IBMI 4JI1I 3QT5A 1N36E 1MX0A 1Z5CA 4PRXA 4I3HA
chains in the Genus database with same CATH superfamily
3QT6A 2CVEA 4IFDC 1S16A 1Y6ZA 4JI3E 1D6TA 4FW6A 4LFBI 4N3OA 1DARA 3CWVA 1IBME 3P06A 4QNJA 4YY3E 4DV2I 2HFSA 4DUZI 2LJPA 5BR8E 4FW4A 4X65E 2ZM6I 2PO1B 1H72C 1KVKA 1OYPA 3ZKDA 4GKJE 3JAMQ 1ZM9A 2NN6F 4BA1A 1QZRA 5JEAC 1KKHA 3L7ZA 4DV3E 2UUBE 2O1TA 1IBKI 4ISAA 4B3RI 4UTGA 3J80C 1Y4SA 2O1VA 4LF8E 3HULA 1VI7A 4DUZE 5C0XF 3PYDA 3LPSA 3PS2A 4JI7I 5C0XD 1Z0VA 5DRQA 4B3SE 2BM0A 4JI4I 1S4EA 3CDJA 1PIEA 1UDOA 3U1KA 2UXCE 4AIDA 4YHHI 1HR0I 2GS8A 1NHJA 4JI7E 3Q6MA 1WUUA 4JYAE 4NXMI 2V8PA 2ZBKB 4MYUA 1N34I 4PU9A 4JI8E 3H1CA 1N0UA 2WP8B 4LCGA 2BM1A 4DR5I 3GMEA 4DU7A 4X64E 2C37A 2F4VI 3GONA 4JI0I 2DEJA 1UDSA 2JT2A 3LNUA 4B3TI 5DNXA 2X36A 1XMOI 2PNZB 1USVA 4LF6I 1Z59A 4GQUA 4GKJI 1MG7A 4LPFA 3K1JA 4KQVA 5DRPA 4DV6I 4K0KI 1RHYA 2R42A 4USMA 4OKGA 3M6AA 2DEIA 1FWLA 2O1WA 5A2QC 1A6FA 4IFDD 2J7KA 4Z7YA 4JI5I 4ED4A 1HNZE 4GKKE 1R6LA 1N33E 4B3MI 3U1YA 5IWAE 4P7AA 4OO1A 2AE8A 4DPXA 4EMDA 1OJ4A 4WUDA 4DR4I 1UEKA 3PS3A 3PYGA 1I94I 4HXZA 5IWAI 5C0XE 1ELOA 2Z5EA 2UUBI 5JEAF 1E3PA 5DNLA 2WNRA 1Y5YA 1U2RA 3T1HI 5IT9C 2JEBA 2UXDI 4IZKA 2CG9A 2E1RA 2JEAB 3V2UC 5C0XC 2PO1A 1Z5AA 4LF9E 5IT9Q 3ZZUA 4IFDE 2WNRB 4NBQA 3UHMA 4DR2I 4DR7E 2VQFE 2J65A 4IFDB 4WUBA 1XMOE 3WU4A 3V5RA 1EA6A 2JEBB 3P3CA 3F0NA 2PO0A 4HACB 4IZJA 2UUCE 3D4JA 4AM3A 5K36C 2Z5BB 1N34E 4JI8I 3PS1A 4LCHA 4IZJD 3J80Q 4JI6I 4OO1F 2XEXA 2NN6E 4YY3I 5JEAB 3J81Q 4IFDA 5C0XB 4OX9I 2VQEI 4DR1E 2GQ0A 2F4VE 1Z0BA 2VF3A 5DROA 4FW7A 2BA0G 2C38B 2IESA 4FW5A 3ZZ0A 4BA2B 4BA1B 3WU6A 1N36I 2E5LI 4JI1E 2HFUA 4DV1E 4LFAI 1Z0EA 2F1DA 3L7ZB 4IFDF 5A2QQ 2BA0D 2BR2A 4DV0I 4DV7I 2BA1D 2VQFI 1FKAE 3J7AM 4LF6E 4Z7CA 1HNXI 1Y60A 4U3DA 2JE6B 4DV1I 4LFAE 3GCMA 1BKNA 4JI5E 1XHKA 1J5EE 4LFCI 4DXLA 4B3SI 1H73A 1VISA 5EL9A 4OO1E 3ZM7A 1N0VC 4WUCA 1XNQI 1HNWE 2VQEE 2CZ9A 4DV4I 4U3BA 2BA1G 4NXNE 2HHHE 4LOMA 4KHPI 1UDQA 1B63A 4HY1A 4JG4A 4DR3E 2UXBE 4DPYA 3HKMA 1P42A 2HK2A 3K17A 3J7AG 1OYRA 4DPWA 3OTOI 4OX9E 5FLXC 4KHPE 1FJGE 4MU3A 4MU1A 3B8HA 2GO3A 3ZZTA 4USKA 1HNZI 4GKKI 4B3TE 4LF8I 2V2QA 2UXDE 4LF4I 4OO1D 2PO2A 1J5EI 1H7SA 4LFCE 4P52A 4DR3I 1XMQI 4J3DA 3KRNA 4DPUA 4DV5E 4DR6I 1IBLI 1HNWI 5LMUE 4IZKB 2JEAA 4FW9A 1USUA 4HYMA 4LF4E 5K36F 3Q1QA 4MU0A 2WP8A 4RPFA 3M7NG 2O3ZA 4MYTA 1ZXNA 5GMEA 4FWDA 4OO1B 1XXEA 2EFGA 2UUAI 1XNRE 2NN6B 5ELWA 1B62A 4AIMA 4M1KA 3T1YI 1NHIA 3CDIA 3M7ND 2PNZA 4DR5E 3PYEA 4HACA 2E5LE 4X66E 5DRRA 1I94E 3HJCA 3M85G 2OI2A 3PRYA 1Z0TA 4NXNI 4X65I 4DV4E 5BR8I 2V2ZA 3T1YE 2IERA 4JYAI 2IOQA 2PNLA 4ZVIA 4NXME 4OZEA 4AQYI 3M85D 3GLLA 1OYSA 2NN6C 5K36B 2X7IA 2Z5CA 2Q2EB 1Y4UA 2NN6D 2NPFA 4QNKA 4K0KE 1YH8A 1NZ0A 2PO0B 4IZJB 4JI2I 2JE6A 5LMNE 2ZITA 2Z5CB 4R1FA 4DV3I 2O1UA 4DV0E 4DV7E 1IBKE 1IBLE 4DR6E 4JV5E 2VESA 1ZXMA 2A2CA 3WU3A 1RR9A 4DR2E 4LFBE 3JAMC 3B78A 3B82A 3B4TA 1FI4A 4DV2E 4DUYE 2UXBI 4AQYE 1MU5A 3DD6A 4BA2A 5JEAE 1N32I 3LTOA 1KIJA 3T1HE 5K36E 3WU5A 4URLA 1H7UA 1ZM3A 1RREA 1H74A 5LMUI 4LF7E 4X66I 4YHHE 1HR0E 2HHHI 4DR7I 4LF5E 4DV5I 2A2DA 4JI2E 5C0XA 3H4LA 1NHHA 4DU8A 2PNMA 4DV6E 3J81C 1YHCA 1Z0CA 1E3HA 1EI1A 3QT7A 4X64I 1PVGA 2ZM6E 2R3VA 3PYFA 4LF5I 5JEAD 2BR2B 2HKJA 4PRVA 1ZM4A 3ZKBA 1XMQE 1Z5BA 1HK7A 1PKPA 4FWHA 2C39A 4MU4A 3P3EA 1ZM2A 4MDTA 2UUCI 1FJGI 4X62E 2UU9I 4FWGA 3OTOE 5FLXQ 4B3ME 4DPTA 4DR1I 4MQYA 1Z0GA 2HK3A 2C39B 4IS9A 1XNRI 2C37B 1FNMA 4FN5A 4X62I 5GMDA 4JI6E 2UXCI 4OO1C 4DR4E 4LCFA 2GO4A 1KTVA 1K47A 2IOPA 4B3RE 2V2VA 5L3JA 4JV5I 5K36A 4UT4A 5FWKA 1N33I 5LMNI 4XTJA 2BV3A 5K36D 5EKWA 1XNQE 5JEAA 1UDNA 2NN6A 4JI4E 1R6MA 2UUAE 3NZKA 4JI0E 4LF9I 2HKEA 3Q6NA 1FWKA 2CGEA 2C38A 3K85A 1N32E 2V34A 3P76A 2UU9E 2PO2B 2WW4A 1HNXE 4JI3I 3QT8A 4DUYI 1Z0WA 3P3GA 2AJ4A 5LL6R 4LF7I 1IBMI 4JI1I 3QT5A 1N36E 1MX0A 1Z5CA 4FW3A 4PRXA 2Z5BA 4I3HA
chains in the Genus database with same CATH topology
3QT6A 1S16A 1Y6ZA 4JI3E 1D6TA 4LFBI 4N3OA 1DARA 3CWVA 1IBME 3P06A 4YY3E 4DV2I 2HFSA 4DUZI 2LJPA 5BR8E 4X65E 2ZM6I 1H72C 1KVKA 3ZKDA 4GKJE 3JAMQ 1ZM9A 1QZRA 1KKHA 4DV3E 2UUBE 2O1TA 1IBKI 4B3RI 4UTGA 3J80C 1Y4SA 2O1VA 4LF8E 3HULA 4DUZE 3PYDA 3LPSA 4JI7I 1Z0VA 4B3SE 2BM0A 4JI4I 1S4EA 1PIEA 2UXCE 4YHHI 1HR0I 2GS8A 1NHJA 4JI7E 3Q6MA 1WUUA 4JYAE 4NXMI 2V8PA 2ZBKB 4MYUA 1N34I 4PU9A 4JI8E 1N0UA 2BM1A 4DR5I 4DU7A 4X64E 2F4VI 3GONA 4JI0I 2DEJA 3LNUA 4B3TI 2X36A 1XMOI 1USVA 4LF6I 1Z59A 4GKJI 1MG7A 3K1JA 4KQVA 4K0KI 4DV6I 2R42A 4USMA 3M6AA 2DEIA 1FWLA 2O1WA 5A2QC 1A6FA 2J7KA 4Z7YA 4JI5I 4ED4A 1HNZE 4GKKE 1N33E 4B3MI 5IWAE 4P7AA 4DPXA 4EMDA 1OJ4A 4WUDA 4DR4I 1UEKA 3PYGA 1I94I 4HXZA 5IWAI 1ELOA 2Z5EA 2UUBI 1U2RA 3T1HI 5IT9C 2UXDI 4IZKA 2CG9A 2E1RA 3V2UC 1Z5AA 4LF9E 5IT9Q 3ZZUA 4DR2I 4DR7E 2VQFE 4WUBA 1XMOE 3WU4A 3V5RA 1EA6A 3F0NA 4HACB 4IZJA 2UUCE 3D4JA 2Z5BB 1N34E 4JI8I 3J80Q 4IZJD 4JI6I 2XEXA 4YY3I 3J81Q 4OX9I 2VQEI 4DR1E 2GQ0A 2F4VE 1Z0BA 2VF3A 3ZZ0A 1N36I 3WU6A 2E5LI 4JI1E 2HFUA 4DV1E 4LFAI 1Z0EA 5A2QQ 4DV0I 4DV7I 2VQFI 1FKAE 3J7AM 4LF6E 4Z7CA 1HNXI 4DV1I 4LFAE 1BKNA 4JI5E 1XHKA 1J5EE 4LFCI 4DXLA 4B3SI 1H73A 1VISA 1N0VC 4WUCA 3ZM7A 1XNQI 1HNWE 2VQEE 2CZ9A 4DV4I 4NXNE 2HHHE 4KHPI 4HY1A 1B63A 4JG4A 4DR3E 2UXBE 4DPYA 2HK2A 3K17A 3J7AG 4DPWA 3OTOI 4OX9E 5FLXC 4KHPE 1FJGE 3B8HA 3ZZTA 4USKA 1HNZI 4GKKI 4B3TE 4LF8I 2V2QA 2UXDE 4LF4I 1J5EI 1H7SA 4LFCE 4P52A 4DR3I 1XMQI 4DPUA 4DV5E 4DR6I 1IBLI 1HNWI 5LMUE 4IZKB 4FW9A 1USUA 4HYMA 4LF4E 3Q1QA 4RPFA 4MYTA 1ZXNA 5GMEA 4FWDA 2UUAI 2EFGA 1XNRE 1B62A 4M1KA 3T1YI 1NHIA 4DR5E 3PYEA 4HACA 2E5LE 4X66E 1I94E 3HJCA 2OI2A 3PRYA 1Z0TA 4NXNI 5BR8I 4X65I 4DV4E 2V2ZA 3T1YE 4JYAI 2IOQA 2PNLA 4ZVIA 4NXME 4AQYI 2X7IA 2Z5CA 2Q2EB 1Y4UA 2NPFA 4K0KE 1NZ0A 4IZJB 4JI2I 5LMNE 2ZITA 4DV3I 2Z5CB 4R1FA 2O1UA 4DV0E 4DV7E 1IBKE 1IBLE 4DR6E 4JV5E 1ZXMA 2A2CA 3WU3A 1RR9A 4DR2E 4LFBE 3JAMC 3B78A 3B82A 1FI4A 4DV2E 4DUYE 2UXBI 4AQYE 1MU5A 1N32I 3LTOA 1KIJA 3T1HE 4URLA 3WU5A 1H7UA 1ZM3A 1RREA 1H74A 5LMUI 4LF7E 4X66I 4YHHE 1HR0E 2HHHI 4DR7I 4LF5E 4DV5I 2A2DA 4JI2E 3H4LA 1NHHA 4DU8A 2PNMA 4DV6E 3J81C 1Z0CA 1EI1A 3QT7A 4X64I 1PVGA 2ZM6E 2R3VA 3PYFA 4LF5I 2HKJA 4PRVA 1ZM4A 3ZKBA 1XMQE 1Z5BA 1HK7A 1PKPA 4FWHA 1ZM2A 2UUCI 1FJGI 4X62E 2UU9I 4FWGA 3OTOE 4B3ME 5FLXQ 4DPTA 4DR1I 1Z0GA 2HK3A 1XNRI 1FNMA 4FN5A 4X62I 5GMDA 4JI6E 2UXCI 4DR4E 1KTVA 1K47A 2IOPA 4B3RE 2V2VA 5L3JA 4JV5I 4UT4A 5FWKA 1N33I 5LMNI 4XTJA 2BV3A 1XNQE 4JI4E 2UUAE 4JI0E 4LF9I 2HKEA 3Q6NA 1FWKA 2CGEA 3K85A 1N32E 2V34A 2UU9E 2WW4A 1HNXE 4JI3I 3QT8A 4DUYI 1Z0WA 2AJ4A 5LL6R 4LF7I 1IBMI 4JI1I 3QT5A 1N36E 1MX0A 1Z5CA 4PRXA 2Z5BA 4I3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT6 A;  1S16 A;  4JI3 E;  1D6T A;  4LFB I;  1DAR A;  3CWV A;  1IBM E;  4YY3 E;  4DV2 I;  2HFS A;  4DUZ I;  2LJP A;  5BR8 E;  4X65 E;  2ZM6 I;  1H72 C;  1KVK A;  3ZKD A;  4GKJ E;  3JAM Q;  1ZM9 A;  1QZR A;  1KKH A;  4DV3 E;  2UUB E;  1IBK I;  4B3R I;  4UTG A;  3J80 C;  4LF8 E;  3HUL A;  4DUZ E;  3PYD A;  3LPS A;  4JI7 I;  1Z0V A;  4B3S E;  2BM0 A;  4JI4 I;  1S4E A;  1PIE A;  2UXC E;  4YHH I;  1HR0 I;  2GS8 A;  1NHJ A;  4JI7 E;  1WUU A;  4JYA E;  4NXM I;  2V8P A;  2ZBK B;  4MYU A;  1N34 I;  4PU9 A;  4JI8 E;  1N0U A;  2BM1 A;  4DR5 I;  4DU7 A;  4X64 E;  2F4V I;  3GON A;  4JI0 I;  2DEJ A;  3LNU A;  4B3T I;  2X36 A;  1XMO I;  4LF6 I;  1Z59 A;  4GKJ I;  1MG7 A;  3K1J A;  4KQV A;  4K0K I;  4DV6 I;  2R42 A;  4USM A;  3M6A A;  2DEI A;  1FWL A;  5A2Q C;  1A6F A;  2J7K A;  4Z7Y A;  4JI5 I;  4ED4 A;  1HNZ E;  4GKK E;  1N33 E;  4B3M I;  5IWA E;  4P7A A;  4DPX A;  4EMD A;  1OJ4 A;  4WUD A;  4DR4 I;  1UEK A;  3PYG A;  1I94 I;  4HXZ A;  5IWA I;  1ELO A;  2UUB I;  1U2R A;  3T1H I;  5IT9 C;  2UXD I;  2E1R A;  3V2U C;  1Z5A A;  4LF9 E;  5IT9 Q;  3ZZU A;  4DR2 I;  4DR7 E;  2VQF E;  4WUB A;  1XMO E;  3WU4 A;  3V5R A;  1EA6 A;  3F0N A;  4HAC B;  2UUC E;  3D4J A;  1N34 E;  4JI8 I;  3J80 Q;  4JI6 I;  2XEX A;  4YY3 I;  3J81 Q;  4OX9 I;  2VQE I;  4DR1 E;  2F4V E;  1Z0B A;  2VF3 A;  3ZZ0 A;  1N36 I;  3WU6 A;  2E5L I;  4JI1 E;  2HFU A;  4DV1 E;  4LFA I;  1Z0E A;  5A2Q Q;  4DV0 I;  4DV7 I;  2VQF I;  1FKA E;  3J7A M;  4LF6 E;  4Z7C A;  1HNX I;  4DV1 I;  4LFA E;  1BKN A;  4JI5 E;  1XHK A;  1J5E E;  4LFC I;  4DXL A;  4B3S I;  1H73 A;  1VIS A;  1N0V C;  4WUC A;  3ZM7 A;  1XNQ I;  1HNW E;  2VQE E;  2CZ9 A;  4DV4 I;  4NXN E;  2HHH E;  4KHP I;  4HY1 A;  1B63 A;  4JG4 A;  4DR3 E;  2UXB E;  4DPY A;  2HK2 A;  3K17 A;  3J7A G;  4DPW A;  3OTO I;  4OX9 E;  5FLX C;  4KHP E;  1FJG E;  3B8H A;  3ZZT A;  4USK A;  1HNZ I;  4GKK I;  4B3T E;  4LF8 I;  2V2Q A;  2UXD E;  4LF4 I;  1J5E I;  1H7S A;  4LFC E;  4P52 A;  4DR3 I;  1XMQ I;  4DPU A;  4DV5 E;  4DR6 I;  1IBL I;  1HNW I;  5LMU E;  4FW9 A;  4HYM A;  4LF4 E;  3Q1Q A;  4RPF A;  4MYT A;  1ZXN A;  5GME A;  4FWD A;  2UUA I;  2EFG A;  1XNR E;  1B62 A;  4M1K A;  3T1Y I;  1NHI A;  4DR5 E;  3PYE A;  4HAC A;  2E5L E;  4X66 E;  1I94 E;  2OI2 A;  1Z0T A;  4NXN I;  5BR8 I;  4X65 I;  4DV4 E;  2V2Z A;  3T1Y E;  4JYA I;  4ZVI A;  4NXM E;  4AQY I;  2X7I A;  2Q2E B;  2NPF A;  4K0K E;  1NZ0 A;  4JI2 I;  5LMN E;  2ZIT A;  4DV3 I;  4R1F A;  1IBL E;  4DV0 E;  4DV7 E;  1IBK E;  4DR6 E;  4JV5 E;  1ZXM A;  2A2C A;  3WU3 A;  1RR9 A;  4DR2 E;  4LFB E;  3JAM C;  3B78 A;  3B82 A;  1FI4 A;  4DV2 E;  4DUY E;  2UXB I;  4AQY E;  1MU5 A;  1N32 I;  3LTO A;  1KIJ A;  3T1H E;  4URL A;  3WU5 A;  1H7U A;  1ZM3 A;  1RRE A;  1H74 A;  5LMU I;  4LF7 E;  4X66 I;  4YHH E;  1HR0 E;  2HHH I;  4DR7 I;  4LF5 E;  4DV5 I;  2A2D A;  4JI2 E;  3H4L A;  1NHH A;  4DU8 A;  4DV6 E;  3J81 C;  1Z0C A;  1EI1 A;  3QT7 A;  4X64 I;  1PVG A;  2ZM6 E;  2R3V A;  3PYF A;  4LF5 I;  2HKJ A;  4PRV A;  1ZM4 A;  3ZKB A;  1XMQ E;  1Z5B A;  1PKP A;  4FWH A;  1ZM2 A;  2UUC I;  1FJG I;  4X62 E;  2UU9 I;  4FWG A;  3OTO E;  4B3M E;  5FLX Q;  4DPT A;  4DR1 I;  1Z0G A;  2HK3 A;  1XNR I;  1FNM A;  4FN5 A;  4X62 I;  5GMD A;  4JI6 E;  2UXC I;  4DR4 E;  1KTV A;  1K47 A;  4B3R E;  2V2V A;  5L3J A;  4JV5 I;  4UT4 A;  1N33 I;  5LMN I;  4XTJ A;  2BV3 A;  1XNQ E;  4JI4 E;  2UUA E;  4JI0 E;  4LF9 I;  2HKE A;  1FWK A;  1N32 E;  2V34 A;  2UU9 E;  2WW4 A;  1HNX E;  4JI3 I;  3QT8 A;  4DUY I;  1Z0W A;  2AJ4 A;  5LL6 R;  4LF7 I;  1IBM I;  4JI1 I;  3QT5 A;  1N36 E;  1MX0 A;  1Z5C A;  4PRX A;  4I3H A; 
#chains in the Genus database with same CATH topology
 3QT6 A;  2CVE A;  4IFD C;  1S16 A;  1Y6Z A;  4JI3 E;  1D6T A;  4FW6 A;  4LFB I;  4N3O A;  1DAR A;  3CWV A;  1IBM E;  3P06 A;  4QNJ A;  4YY3 E;  4DV2 I;  2HFS A;  4DUZ I;  2LJP A;  5BR8 E;  4FW4 A;  4X65 E;  2ZM6 I;  2PO1 B;  1H72 C;  1KVK A;  1OYP A;  3ZKD A;  4GKJ E;  3JAM Q;  1ZM9 A;  2NN6 F;  4BA1 A;  1QZR A;  5JEA C;  1KKH A;  3L7Z A;  4DV3 E;  2UUB E;  2O1T A;  1IBK I;  4ISA A;  4B3R I;  4UTG A;  3J80 C;  1Y4S A;  2O1V A;  4LF8 E;  3HUL A;  1VI7 A;  4DUZ E;  5C0X F;  3PYD A;  3LPS A;  3PS2 A;  4JI7 I;  5C0X D;  1Z0V A;  5DRQ A;  4B3S E;  2BM0 A;  4JI4 I;  1S4E A;  3CDJ A;  1PIE A;  1UDO A;  3U1K A;  2UXC E;  4AID A;  4YHH I;  1HR0 I;  2GS8 A;  1NHJ A;  4JI7 E;  3Q6M A;  1WUU A;  4JYA E;  4NXM I;  2V8P A;  2ZBK B;  4MYU A;  1N34 I;  4PU9 A;  4JI8 E;  3H1C A;  1N0U A;  2WP8 B;  4LCG A;  2BM1 A;  4DR5 I;  3GME A;  4DU7 A;  4X64 E;  2C37 A;  2F4V I;  3GON A;  4JI0 I;  2DEJ A;  1UDS A;  2JT2 A;  3LNU A;  4B3T I;  5DNX A;  2X36 A;  1XMO I;  2PNZ B;  1USV A;  4LF6 I;  1Z59 A;  4GQU A;  4GKJ I;  1MG7 A;  4LPF A;  3K1J A;  4KQV A;  5DRP A;  4DV6 I;  4K0K I;  1RHY A;  2R42 A;  4USM A;  4OKG A;  3M6A A;  2DEI A;  1FWL A;  2O1W A;  5A2Q C;  1A6F A;  4IFD D;  2J7K A;  4Z7Y A;  4JI5 I;  4ED4 A;  1HNZ E;  4GKK E;  1R6L A;  1N33 E;  4B3M I;  3U1Y A;  5IWA E;  4P7A A;  4OO1 A;  2AE8 A;  4DPX A;  4EMD A;  1OJ4 A;  4WUD A;  4DR4 I;  1UEK A;  3PS3 A;  3PYG A;  1I94 I;  4HXZ A;  5IWA I;  5C0X E;  1ELO A;  2Z5E A;  2UUB I;  5JEA F;  1E3P A;  5DNL A;  2WNR A;  1Y5Y A;  1U2R A;  3T1H I;  5IT9 C;  2JEB A;  2UXD I;  4IZK A;  2CG9 A;  2E1R A;  2JEA B;  3V2U C;  5C0X C;  2PO1 A;  1Z5A A;  4LF9 E;  5IT9 Q;  3ZZU A;  4IFD E;  2WNR B;  4NBQ A;  3UHM A;  4DR2 I;  4DR7 E;  2VQF E;  2J65 A;  4IFD B;  4WUB A;  1XMO E;  3WU4 A;  3V5R A;  1EA6 A;  2JEB B;  3P3C A;  3F0N A;  2PO0 A;  4HAC B;  4IZJ A;  2UUC E;  3D4J A;  4AM3 A;  5K36 C;  2Z5B B;  1N34 E;  4JI8 I;  3PS1 A;  4LCH A;  4IZJ D;  3J80 Q;  4JI6 I;  4OO1 F;  2XEX A;  2NN6 E;  4YY3 I;  5JEA B;  3J81 Q;  4IFD A;  5C0X B;  4OX9 I;  2VQE I;  4DR1 E;  2GQ0 A;  2F4V E;  1Z0B A;  2VF3 A;  5DRO A;  4FW7 A;  2BA0 G;  2C38 B;  2IES A;  4FW5 A;  3ZZ0 A;  4BA2 B;  4BA1 B;  3WU6 A;  1N36 I;  2E5L I;  4JI1 E;  2HFU A;  4DV1 E;  4LFA I;  1Z0E A;  2F1D A;  3L7Z B;  4IFD F;  5A2Q Q;  2BA0 D;  2BR2 A;  4DV0 I;  4DV7 I;  2BA1 D;  2VQF I;  1FKA E;  3J7A M;  4LF6 E;  4Z7C A;  1HNX I;  1Y60 A;  4U3D A;  2JE6 B;  4DV1 I;  4LFA E;  3GCM A;  1BKN A;  4JI5 E;  1XHK A;  1J5E E;  4LFC I;  4DXL A;  4B3S I;  1H73 A;  1VIS A;  5EL9 A;  4OO1 E;  3ZM7 A;  1N0V C;  4WUC A;  1XNQ I;  1HNW E;  2VQE E;  2CZ9 A;  4DV4 I;  4U3B A;  2BA1 G;  4NXN E;  2HHH E;  4LOM A;  4KHP I;  1UDQ A;  1B63 A;  4HY1 A;  4JG4 A;  4DR3 E;  2UXB E;  4DPY A;  3HKM A;  1P42 A;  2HK2 A;  3K17 A;  3J7A G;  1OYR A;  4DPW A;  3OTO I;  4OX9 E;  5FLX C;  4KHP E;  1FJG E;  4MU3 A;  4MU1 A;  3B8H A;  2GO3 A;  3ZZT A;  4USK A;  1HNZ I;  4GKK I;  4B3T E;  4LF8 I;  2V2Q A;  2UXD E;  4LF4 I;  4OO1 D;  2PO2 A;  1J5E I;  1H7S A;  4LFC E;  4P52 A;  4DR3 I;  1XMQ I;  4J3D A;  3KRN A;  4DPU A;  4DV5 E;  4DR6 I;  1IBL I;  1HNW I;  5LMU E;  4IZK B;  2JEA A;  4FW9 A;  1USU A;  4HYM A;  4LF4 E;  5K36 F;  3Q1Q A;  4MU0 A;  2WP8 A;  4RPF A;  3M7N G;  2O3Z A;  4MYT A;  1ZXN A;  5GME A;  4FWD A;  4OO1 B;  1XXE A;  2EFG A;  2UUA I;  1XNR E;  2NN6 B;  5ELW A;  1B62 A;  4AIM A;  4M1K A;  3T1Y I;  1NHI A;  3CDI A;  3M7N D;  2PNZ A;  4DR5 E;  3PYE A;  4HAC A;  2E5L E;  4X66 E;  5DRR A;  1I94 E;  3HJC A;  3M85 G;  2OI2 A;  3PRY A;  1Z0T A;  4NXN I;  4X65 I;  4DV4 E;  5BR8 I;  2V2Z A;  3T1Y E;  2IER A;  4JYA I;  2IOQ A;  2PNL A;  4ZVI A;  4NXM E;  4OZE A;  4AQY I;  3M85 D;  3GLL A;  1OYS A;  2NN6 C;  5K36 B;  2X7I A;  2Z5C A;  2Q2E B;  1Y4U A;  2NN6 D;  2NPF A;  4QNK A;  4K0K E;  1YH8 A;  1NZ0 A;  2PO0 B;  4IZJ B;  4JI2 I;  2JE6 A;  5LMN E;  2ZIT A;  2Z5C B;  4R1F A;  4DV3 I;  2O1U A;  4DV0 E;  4DV7 E;  1IBK E;  1IBL E;  4DR6 E;  4JV5 E;  2VES A;  1ZXM A;  2A2C A;  3WU3 A;  1RR9 A;  4DR2 E;  4LFB E;  3JAM C;  3B78 A;  3B82 A;  3B4T A;  1FI4 A;  4DV2 E;  4DUY E;  2UXB I;  4AQY E;  1MU5 A;  3DD6 A;  4BA2 A;  5JEA E;  1N32 I;  3LTO A;  1KIJ A;  3T1H E;  5K36 E;  3WU5 A;  4URL A;  1H7U A;  1ZM3 A;  1RRE A;  1H74 A;  5LMU I;  4LF7 E;  4X66 I;  4YHH E;  1HR0 E;  2HHH I;  4DR7 I;  4LF5 E;  4DV5 I;  2A2D A;  4JI2 E;  5C0X A;  3H4L A;  1NHH A;  4DU8 A;  2PNM A;  4DV6 E;  3J81 C;  1YHC A;  1Z0C A;  1E3H A;  1EI1 A;  3QT7 A;  4X64 I;  1PVG A;  2ZM6 E;  2R3V A;  3PYF A;  4LF5 I;  5JEA D;  2BR2 B;  2HKJ A;  4PRV A;  1ZM4 A;  3ZKB A;  1XMQ E;  1Z5B A;  1HK7 A;  1PKP A;  4FWH A;  2C39 A;  4MU4 A;  3P3E A;  1ZM2 A;  4MDT A;  2UUC I;  1FJG I;  4X62 E;  2UU9 I;  4FWG A;  3OTO E;  5FLX Q;  4B3M E;  4DPT A;  4DR1 I;  4MQY A;  1Z0G A;  2HK3 A;  2C39 B;  4IS9 A;  1XNR I;  2C37 B;  1FNM A;  4FN5 A;  4X62 I;  5GMD A;  4JI6 E;  2UXC I;  4OO1 C;  4DR4 E;  4LCF A;  2GO4 A;  1KTV A;  1K47 A;  2IOP A;  4B3R E;  2V2V A;  5L3J A;  4JV5 I;  5K36 A;  4UT4 A;  5FWK A;  1N33 I;  5LMN I;  4XTJ A;  2BV3 A;  5K36 D;  5EKW A;  1XNQ E;  5JEA A;  1UDN A;  2NN6 A;  4JI4 E;  1R6M A;  2UUA E;  3NZK A;  4JI0 E;  4LF9 I;  2HKE A;  3Q6N A;  1FWK A;  2CGE A;  2C38 A;  3K85 A;  1N32 E;  2V34 A;  3P76 A;  2UU9 E;  2PO2 B;  2WW4 A;  1HNX E;  4JI3 I;  3QT8 A;  4DUY I;  1Z0W A;  3P3G A;  2AJ4 A;  5LL6 R;  4LF7 I;  1IBM I;  4JI1 I;  3QT5 A;  1N36 E;  1MX0 A;  1Z5C A;  4FW3 A;  4PRX A;  2Z5B A;  4I3H A; 
#chains in the Genus database with same CATH homology
 3QT6 A;  1S16 A;  1Y6Z A;  4JI3 E;  1D6T A;  4LFB I;  4N3O A;  1DAR A;  3CWV A;  1IBM E;  3P06 A;  4YY3 E;  4DV2 I;  2HFS A;  4DUZ I;  2LJP A;  5BR8 E;  4X65 E;  2ZM6 I;  1H72 C;  1KVK A;  3ZKD A;  4GKJ E;  3JAM Q;  1ZM9 A;  1QZR A;  1KKH A;  4DV3 E;  2UUB E;  2O1T A;  1IBK I;  4B3R I;  4UTG A;  3J80 C;  1Y4S A;  2O1V A;  4LF8 E;  3HUL A;  4DUZ E;  3PYD A;  3LPS A;  4JI7 I;  1Z0V A;  4B3S E;  2BM0 A;  4JI4 I;  1S4E A;  1PIE A;  2UXC E;  4YHH I;  1HR0 I;  2GS8 A;  1NHJ A;  4JI7 E;  3Q6M A;  1WUU A;  4JYA E;  4NXM I;  2V8P A;  2ZBK B;  4MYU A;  1N34 I;  4PU9 A;  4JI8 E;  1N0U A;  2BM1 A;  4DR5 I;  4DU7 A;  4X64 E;  2F4V I;  3GON A;  4JI0 I;  2DEJ A;  3LNU A;  4B3T I;  2X36 A;  1XMO I;  1USV A;  4LF6 I;  1Z59 A;  4GKJ I;  1MG7 A;  3K1J A;  4KQV A;  4K0K I;  4DV6 I;  2R42 A;  4USM A;  3M6A A;  2DEI A;  1FWL A;  2O1W A;  5A2Q C;  1A6F A;  2J7K A;  4Z7Y A;  4JI5 I;  4ED4 A;  1HNZ E;  4GKK E;  1N33 E;  4B3M I;  5IWA E;  4P7A A;  4DPX A;  4EMD A;  1OJ4 A;  4WUD A;  4DR4 I;  1UEK A;  3PYG A;  1I94 I;  4HXZ A;  5IWA I;  1ELO A;  2Z5E A;  2UUB I;  1U2R A;  3T1H I;  5IT9 C;  2UXD I;  4IZK A;  2CG9 A;  2E1R A;  3V2U C;  1Z5A A;  4LF9 E;  5IT9 Q;  3ZZU A;  4DR2 I;  4DR7 E;  2VQF E;  4WUB A;  1XMO E;  3WU4 A;  3V5R A;  1EA6 A;  3F0N A;  4HAC B;  4IZJ A;  2UUC E;  3D4J A;  2Z5B B;  1N34 E;  4JI8 I;  3J80 Q;  4IZJ D;  4JI6 I;  2XEX A;  4YY3 I;  3J81 Q;  4OX9 I;  2VQE I;  4DR1 E;  2GQ0 A;  2F4V E;  1Z0B A;  2VF3 A;  3ZZ0 A;  1N36 I;  3WU6 A;  2E5L I;  4JI1 E;  2HFU A;  4DV1 E;  4LFA I;  1Z0E A;  5A2Q Q;  4DV0 I;  4DV7 I;  2VQF I;  1FKA E;  3J7A M;  4LF6 E;  4Z7C A;  1HNX I;  4DV1 I;  4LFA E;  1BKN A;  4JI5 E;  1XHK A;  1J5E E;  4LFC I;  4DXL A;  4B3S I;  1H73 A;  1VIS A;  1N0V C;  4WUC A;  3ZM7 A;  1XNQ I;  1HNW E;  2VQE E;  2CZ9 A;  4DV4 I;  4NXN E;  2HHH E;  4KHP I;  4HY1 A;  1B63 A;  4JG4 A;  4DR3 E;  2UXB E;  4DPY A;  2HK2 A;  3K17 A;  3J7A G;  4DPW A;  3OTO I;  4OX9 E;  5FLX C;  4KHP E;  1FJG E;  3B8H A;  3ZZT A;  4USK A;  1HNZ I;  4GKK I;  4B3T E;  4LF8 I;  2V2Q A;  2UXD E;  4LF4 I;  1J5E I;  1H7S A;  4LFC E;  4P52 A;  4DR3 I;  1XMQ I;  4DPU A;  4DV5 E;  4DR6 I;  1IBL I;  1HNW I;  5LMU E;  4IZK B;  4FW9 A;  1USU A;  4HYM A;  4LF4 E;  3Q1Q A;  4RPF A;  4MYT A;  1ZXN A;  5GME A;  4FWD A;  2UUA I;  2EFG A;  1XNR E;  1B62 A;  4M1K A;  3T1Y I;  1NHI A;  4DR5 E;  3PYE A;  4HAC A;  2E5L E;  4X66 E;  1I94 E;  3HJC A;  2OI2 A;  3PRY A;  1Z0T A;  4NXN I;  5BR8 I;  4X65 I;  4DV4 E;  2V2Z A;  3T1Y E;  4JYA I;  2IOQ A;  2PNL A;  4ZVI A;  4NXM E;  4AQY I;  2X7I A;  2Z5C A;  2Q2E B;  1Y4U A;  2NPF A;  4K0K E;  1NZ0 A;  4IZJ B;  4JI2 I;  5LMN E;  2ZIT A;  4DV3 I;  2Z5C B;  4R1F A;  2O1U A;  4DV0 E;  4DV7 E;  1IBK E;  1IBL E;  4DR6 E;  4JV5 E;  1ZXM A;  2A2C A;  3WU3 A;  1RR9 A;  4DR2 E;  4LFB E;  3JAM C;  3B78 A;  3B82 A;  1FI4 A;  4DV2 E;  4DUY E;  2UXB I;  4AQY E;  1MU5 A;  1N32 I;  3LTO A;  1KIJ A;  3T1H E;  4URL A;  3WU5 A;  1H7U A;  1ZM3 A;  1RRE A;  1H74 A;  5LMU I;  4LF7 E;  4X66 I;  4YHH E;  1HR0 E;  2HHH I;  4DR7 I;  4LF5 E;  4DV5 I;  2A2D A;  4JI2 E;  3H4L A;  1NHH A;  4DU8 A;  2PNM A;  4DV6 E;  3J81 C;  1Z0C A;  1EI1 A;  3QT7 A;  4X64 I;  1PVG A;  2ZM6 E;  2R3V A;  3PYF A;  4LF5 I;  2HKJ A;  4PRV A;  1ZM4 A;  3ZKB A;  1XMQ E;  1Z5B A;  1HK7 A;  1PKP A;  4FWH A;  1ZM2 A;  2UUC I;  1FJG I;  4X62 E;  2UU9 I;  4FWG A;  3OTO E;  4B3M E;  5FLX Q;  4DPT A;  4DR1 I;  1Z0G A;  2HK3 A;  1XNR I;  1FNM A;  4FN5 A;  4X62 I;  5GMD A;  4JI6 E;  2UXC I;  4DR4 E;  1KTV A;  1K47 A;  2IOP A;  4B3R E;  2V2V A;  5L3J A;  4JV5 I;  4UT4 A;  5FWK A;  1N33 I;  5LMN I;  4XTJ A;  2BV3 A;  1XNQ E;  4JI4 E;  2UUA E;  4JI0 E;  4LF9 I;  2HKE A;  3Q6N A;  1FWK A;  2CGE A;  3K85 A;  1N32 E;  2V34 A;  2UU9 E;  2WW4 A;  1HNX E;  4JI3 I;  3QT8 A;  4DUY I;  1Z0W A;  2AJ4 A;  5LL6 R;  4LF7 I;  1IBM I;  4JI1 I;  3QT5 A;  1N36 E;  1MX0 A;  1Z5C A;  4PRX A;  2Z5B A;  4I3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...