4LFBI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbI00
4LFAE 3ZZUA 2F4VI 1H72C 4JI6I 1KVKA 1PIEA 4GKJI 1XHKA 4DR1I 4LFBI 1KTVA 3Q1QA 4B3TI 2R42A 2UUAE 4GKKE 2GS8A 4WUDA 4DPUA 4DV5E 4XTJA 4DV1E 4K0KE 1N0UA 1FNMA 3J81Q 4GKJE 1Z5AA 1VISA 4DR1E 4LFBE 1ZM9A 4B3TE 5A2QQ 2UXCI 3QT7A 1FWLA 1EA6A 1OJ4A 4USKA 3T1HE 2ZITA 4LF8I 2UXDE 4LF4I 2UU9I 2A2DA 1XNQE 4B3MI 2HK3A 2ZM6I 4NXNI 4UT4A 4JI0I 3T1YE 3WU5A 1NZ0A 1Z0BA 4JI4I 1D6TA 3WU3A 1HNZI 2UUCI 4DPTA 4DPYA 3B82A 4DR4I 1HNWI 4X62E 4DPXA 1IBKE 1ZXNA 2HKEA 4LF8E 4DR3I 2UU9E 4YHHE 4DV4I 2ZM6E 4JV5E 1UEKA 1S4EA 4DUZI 5LMNE 1EI1A 4OX9I 4UTGA 1Z0TA 4X66I 1HR0I 2UUCE 4DV6I 4DR4E 2A2CA 4X64E 2VQFI 4DV7E 4JI7E 1FJGE 1Z0CA 1N36I 1NHHA 1N34E 1Z5BA 3WU4A 4NXMI 4DV4E 1FKAE 2BM0A 2OI2A 4OX9E 2HHHI 1HR0E 5IWAE 4R1FA 1Z0EA 4PU9A 2HKJA 1XMOE 3J81C 1IBMI 5IT9Q 4FWGA 2E1RA 1ZXMA 4LF7I 1XNRI 1N36E 2WW4A 3OTOI 1MU5A 1NHIA 1S16A 1N32I 4LF6E 3JAMQ 4NXME 4DR6E 5A2QC 2UXBE 4X65E 4DV0I 3V5RA 4DU7A 4JI3E 3LNUA 3QT8A 2E5LI 1FI4A 2F4VE 5FLXQ 3B78A 2EFGA 4AQYI 2V2ZA 1IBME 4JI6E 4LF9I 2HFSA 3K17A 3OTOE 3PYEA 2X36A 2HFUA 1B63A 4HYMA 1ZM3A 3ZKBA 4JI5I 5L3JA 4DV0E 4DR5I 3ZKDA 4URLA 4ED4A 1ZM2A 2DEJA 4AQYE 2BM1A 4B3SI 3V2UC 1N0VC 1N33I 2CZ9A 3GONA 3K1JA 3HULA 2UXCE 4M1KA 4RPFA 1HNXI 3WU6A 1H73A 1I94I 2UUBI 4LF4E 2DEIA 4P52A 1XMQI 4B3RI 4B3ME 1J5EI 1A6FA 4NXNE 4JI0E 2J7KA 1QZRA 4JI4E 4JI2I 1HNZE 4FN5A 1HNWE 1ZM4A 1H7SA 5IT9C 4JI8I 2ZBKB 2V34A 4Z7CA 3PYFA 4DR3E 1WUUA 3JAMC 5BR8I 1IBLI 4DR7I 1XMQE 4B3RE 1J5EE 4DV3I 2NPFA 1Z0VA 4DUZE 1KKHA 1Z0WA 4LF5I 1NHJA 4JI2E 3M6AA 4X66E 5FLXC 4DV6E 4YY3I 3PYDA 2VQFE 4EMDA 3CWVA 3PYGA 3QT6A 1U2RA 1MX0A 4KQVA 3J80Q 5GMDA 3D4JA 4DV3E 2UUAI 3B8HA 4GKKI 1FWKA 2VF3A 4JG4A 4LF5E 1ELOA 4DV5I 2HHHE 4DV1I 4K0KI 4DR2I 3J7AG 4YY3E 4FW9A 3H4LA 4LF7E 1XNRE 5GMEA 1Z0GA 2LJPA 1N32E 1PKPA 1KIJA 5LMUI 4HACA 1H74A 2V2VA 4HXZA 1Z5CA 3T1HI 3ZM7A 3ZZ0A 2UXDI 2AJ4A 4DUYI 4DV2I 2E5LE 1XNQI 2HK2A 4WUBA 4DR2E 1BKNA 3F0NA 3T1YI 4FWDA 4LF9E 2Q2EB 1B62A 2V2QA 3LTOA 5LMUE 4HACB 4PRXA 4X62I 1K47A 4ZVIA 4JI5E 2VQEI 3ZZTA 1IBKI 2XEXA 4DR5E 4DUYE 4DV2E 4YHHI 4JV5I 1DARA 5LMNI 4LFCI 4B3SE 3QT5A 1N33E 4I3HA 4WUCA 1H7UA 4Z7YA 4X64I 4DV7I 4JI7I 2V8PA 1FJGI 2VQEE 1HNXE 1N34I 1RREA 4JI1I 4JYAI 1MG7A 3J80C 1I94E 2UUBE 4KHPI 4HY1A 4MYUA 4LFCE 2X7IA 4LFAI 4PRVA 4DPWA 4FWHA 4MYTA 5IWAI 5LL6R 4DU8A 3J7AM 1XMOI 4USMA 4DXLA 4LF6I 4JI1E 4JI8E 4JYAE 1RR9A 4DR6I 2R3VA 2BV3A 4P7AA 4KHPE 1Z59A 5BR8E 2UXBI 1IBLE 4X65I 4DR7E 1PVGA 3LPSA 4JI3I
chains in the Genus database with same CATH superfamily
4OO1B 4LFAE 4BA1B 5C0XF 1Y4UA 4LPFA 5ELWA 3ZZUA 2F4VI 4OO1F 5K36C 2BR2A 1H72C 1E3PA 4JI6I 1KVKA 2PO0B 1PIEA 4GKJI 1XHKA 5FWKA 4DR1I 4LFBI 1KTVA 3Q1QA 4IZKA 5K36F 4B3TI 2R42A 4IFDE 2UUAE 3M85G 4GKKE 2GS8A 4WUDA 3GLLA 4BA2A 2BA1D 4DPUA 2BR2B 5DNXA 5DRPA 2C37A 5EL9A 4OKGA 4DV5E 4XTJA 1R6MA 4DV1E 4K0KE 1N0UA 1HK7A 1FNMA 3J81Q 1UDNA 2J65A 4GKJE 1Z5AA 1VISA 4DR1E 4LFBE 2VESA 1ZM9A 4OZEA 4B3TE 4NBQA 5A2QQ 2BA0D 2UXCI 3QT7A 1FWLA 3U1KA 1EA6A 1OJ4A 2Z5EA 2F1DA 4USKA 2WP8A 3T1HE 2NN6A 2ZITA 4LF8I 2UXDE 4LF4I 2UU9I 2A2DA 4AM3A 1XNQE 4B3MI 2HK3A 4U3BA 2ZM6I 4J3DA 4NXNI 4UT4A 4JI0I 3T1YE 3WU5A 1NZ0A 1Z0BA 2PNLA 4JI4I 2PNZB 1D6TA 3HKMA 4FW5A 4IZJA 2C38A 3WU3A 1HNZI 2UUCI 2BA1G 4DPTA 4DPYA 3B82A 4DR4I 1HNWI 4X62E 1RHYA 4AIMA 4DPXA 2WP8B 5JEAC 1IBKE 1ZXNA 2HKEA 4LF8E 3Q6NA 4DR3I 1YHCA 2UU9E 4YHHE 4DV4I 2ZM6E 4JV5E 1UEKA 1S4EA 3PS3A 2IOPA 4QNJA 2BA0G 4DUZI 5LMNE 5JEAF 5C0XA 1EI1A 4OO1A 4OX9I 4IZJB 4UTGA 4BA1A 1Z0TA 2C38B 4X66I 1HR0I 2UUCE 2IERA 4DV6I 4DR4E 2A2CA 3P06A 4MU3A 4X64E 2VQFI 4DV7E 4JI7E 1FJGE 1Z0CA 3UHMA 1N36I 5K36A 4N3OA 1NHHA 1N34E 1Z5BA 3WU4A 4NXMI 3GMEA 4DV4E 2Z5BA 2O1WA 2JT2A 1FKAE 2NN6D 4U3DA 5C0XB 2BM0A 3PS1A 2OI2A 4OX9E 2CGEA 4AIDA 2PNMA 2HHHI 1HR0E 5IWAE 4R1FA 1Z0EA 4PU9A 2HKJA 1XMOE 3J81C 1IBMI 5IT9Q 4FWGA 4IZJD 1ZXMA 2E1RA 2O1VA 4LF7I 1XNRI 5K36B 1N36E 2WW4A 4IFDC 3OTOI 3K85A 1MU5A 4FW3A 1NHIA 4FW6A 1S16A 3U1YA 4LF6E 3JAMQ 1N32I 4NXME 2PO1A 2Z5BB 4DR6E 5A2QC 4IFDB 2UXBE 1YH8A 4X65E 4DV0I 1R6LA 3V5RA 4DU7A 4JI3E 3M7NG 4IFDF 3LNUA 3QT8A 2E5LI 1FI4A 2F4VE 5FLXQ 3B78A 2EFGA 5C0XD 4AQYI 2V2ZA 4OO1D 1IBME 4MU4A 4JI6E 4LF9I 2HFSA 3K17A 3OTOE 3L7ZB 3PYEA 2X36A 2PO1B 2HFUA 5DRRA 1B63A 2PNZA 4HYMA 1ZM3A 3ZKBA 4JI5I 5L3JA 5K36D 4DV0E 4DR5I 3ZKDA 2GO4A 2O1TA 4URLA 1USVA 4LCHA 2AE8A 3KRNA 4ED4A 1ZM2A 2DEJA 4AQYE 2BM1A 1VI7A 4B3SI 3V2UC 1N0VC 5JEAA 1N33I 2CZ9A 3HJCA 3GONA 3K1JA 2IOQA 5EKWA 3HULA 2UXCE 4M1KA 3B4TA 4RPFA 1HNXI 4IS9A 3WU6A 1H73A 1I94I 1Y60A 2UUBI 4LF4E 4FW7A 2DEIA 4P52A 1XMQI 4B3RI 4B3ME 1J5EI 1A6FA 2GO3A 5JEAB 4NXNE 4JI0E 3CDJA 2J7KA 1P42A 1QZRA 4JI4E 4JI2I 1HNZE 3Q6MA 4FN5A 1HNWE 2C39A 1OYSA 1ZM4A 2NN6E 4LCFA 1H7SA 5IT9C 4JI8I 2ZBKB 2V34A 4Z7CA 3PYFA 4DR3E 1WUUA 3JAMC 2CG9A 5BR8I 1IBLI 4DR7I 1XMQE 4B3RE 1J5EE 4DV3I 2CVEA 2WNRB 2NPFA 2JEBA 3GCMA 4IFDA 1Z0VA 4DUZE 2O1UA 1KKHA 1Z0WA 4LF5I 1NHJA 4JI2E 3M6AA 4X66E 5JEAD 1OYRA 5FLXC 5DRQA 4DV6E 4YY3I 2C39B 3PYDA 2VQFE 4EMDA 3CWVA 3PYGA 3QT6A 1U2RA 1MX0A 2IESA 3H1CA 4KQVA 3J80Q 3CDIA 3NZKA 3L7ZA 4MQYA 5GMDA 3D4JA 1Y4SA 4DV3E 2UUAI 2JEBB 3B8HA 5C0XE 4GKKI 4OO1E 1FWKA 2VF3A 1OYPA 4JG4A 4LF5E 1ELOA 4DV5I 2HHHE 1UDQA 4DV1I 4K0KI 4DR2I 3J7AG 4YY3E 4MDTA 4FW9A 4LCGA 3H4LA 5K36E 4LF7E 1XNRE 5GMEA 2PO2A 1Z0GA 2LJPA 1N32E 1PKPA 1KIJA 5LMUI 4HACA 1H74A 3P3GA 2V2VA 4MU0A 4HXZA 1Z5CA 3T1HI 3ZM7A 3ZZ0A 2UXDI 2AJ4A 3P76A 4DUYI 4DV2I 2E5LE 1XNQI 2HK2A 4WUBA 4DR2E 4IFDD 1BKNA 3F0NA 3T1YI 4FWDA 4IZKB 4LF9E 5DNLA 2Q2EB 2PO2B 1B62A 1E3HA 2V2QA 3LTOA 4MU1A 5LMUE 4HACB 3PS2A 4PRXA 4X62I 1K47A 4ZVIA 4JI5E 4BA2B 2VQEI 3ZZTA 1IBKI 2XEXA 4DR5E 2C37B 5DROA 4LOMA 2JEAA 4DUYE 1Y6ZA 4DV2E 4YHHI 4JV5I 3P3EA 2JE6A 2GQ0A 1DARA 5LMNI 4LFCI 4B3SE 2WNRA 3QT5A 1N33E 4QNKA 4I3HA 1Y5YA 4WUCA 1H7UA 2NN6C 4Z7YA 4X64I 4DV7I 4JI7I 2V8PA 1FJGI 2VQEE 2NN6B 2JEAB 1N34I 1HNXE 1RREA 4FW4A 4JI1I 2NN6F 4JYAI 1MG7A 2JE6B 3J80C 1I94E 2UUBE 4KHPI 4HY1A 4MYUA 2Z5CA 5JEAE 4LFCE 4GQUA 2X7IA 4LFAI 1XXEA 4PRVA 1UDOA 4ISAA 4DPWA 4FWHA 4MYTA 5IWAI 5LL6R 3M85D 4DU8A 3M7ND 3J7AM 3PRYA 1XMOI 4USMA 2PO0A 4DXLA 3P3CA 5C0XC 4LF6I 4JI1E 4JI8E 4JYAE 1RR9A 1UDSA 3DD6A 4DR6I 4OO1C 2R3VA 2BV3A 4P7AA 4KHPE 1Z59A 2Z5CB 2O3ZA 5BR8E 2UXBI 1IBLE 1USUA 4X65I 4DR7E 1PVGA 3LPSA 4JI3I
chains in the Genus database with same CATH topology
4LFAE 1Y4UA 3ZZUA 2F4VI 1H72C 4JI6I 1KVKA 1PIEA 4GKJI 1XHKA 5FWKA 4DR1I 4LFBI 1KTVA 3Q1QA 4IZKA 4B3TI 2R42A 2UUAE 4GKKE 2GS8A 4WUDA 4DPUA 4DV5E 4XTJA 4DV1E 4K0KE 1N0UA 1HK7A 3J81Q 1FNMA 4GKJE 1Z5AA 1VISA 4DR1E 4LFBE 1ZM9A 4B3TE 5A2QQ 2UXCI 3QT7A 1FWLA 1EA6A 1OJ4A 2Z5EA 4USKA 3T1HE 2ZITA 4LF8I 2UXDE 4LF4I 2UU9I 2A2DA 1XNQE 4B3MI 2HK3A 2ZM6I 4NXNI 4UT4A 4JI0I 3T1YE 3WU5A 1NZ0A 1Z0BA 2PNLA 4JI4I 1D6TA 4IZJA 3WU3A 1HNZI 2UUCI 4DPTA 4DPYA 3B82A 4DR4I 1HNWI 4X62E 4DPXA 1IBKE 1ZXNA 2HKEA 4LF8E 3Q6NA 4DR3I 2UU9E 4YHHE 4DV4I 2ZM6E 4JV5E 1UEKA 1S4EA 2IOPA 4DUZI 5LMNE 1EI1A 4OX9I 4IZJB 4UTGA 1Z0TA 4X66I 1HR0I 2UUCE 4DV6I 4DR4E 2A2CA 3P06A 4X64E 2VQFI 4DV7E 4JI7E 1FJGE 1Z0CA 1N36I 4N3OA 1NHHA 1N34E 1Z5BA 3WU4A 4NXMI 4DV4E 2Z5BA 2O1WA 1FKAE 2BM0A 2OI2A 4OX9E 2CGEA 2PNMA 2HHHI 1HR0E 5IWAE 4R1FA 1Z0EA 4PU9A 2HKJA 1XMOE 3J81C 1IBMI 5IT9Q 2O1VA 1ZXMA 2E1RA 4FWGA 4IZJD 4LF7I 1XNRI 1N36E 2WW4A 3OTOI 3K85A 1MU5A 1NHIA 1S16A 1N32I 4LF6E 3JAMQ 4NXME 2Z5BB 4DR6E 5A2QC 2UXBE 4X65E 4DV0I 3V5RA 4DU7A 4JI3E 3LNUA 3QT8A 2E5LI 1FI4A 2F4VE 5FLXQ 3B78A 2EFGA 4AQYI 2V2ZA 1IBME 4JI6E 4LF9I 2HFSA 3K17A 3OTOE 3PYEA 2X36A 2HFUA 1B63A 4HYMA 1ZM3A 3ZKBA 4JI5I 5L3JA 4DV0E 4DR5I 3ZKDA 2O1TA 4URLA 1USVA 4ED4A 1ZM2A 2DEJA 4AQYE 2BM1A 4B3SI 3V2UC 1N0VC 1N33I 2CZ9A 3HJCA 3GONA 3K1JA 2IOQA 3HULA 2UXCE 4M1KA 4RPFA 1HNXI 3WU6A 1H73A 1I94I 2UUBI 4LF4E 2DEIA 4P52A 1XMQI 4B3RI 4B3ME 1J5EI 1A6FA 4NXNE 4JI0E 2J7KA 1QZRA 4JI4E 4JI2I 1HNZE 3Q6MA 4FN5A 1HNWE 1ZM4A 1H7SA 5IT9C 4JI8I 2ZBKB 2V34A 4Z7CA 3PYFA 4DR3E 1WUUA 3JAMC 2CG9A 5BR8I 1IBLI 4DR7I 1XMQE 4B3RE 1J5EE 4DV3I 2NPFA 1Z0VA 4DUZE 2O1UA 1KKHA 1Z0WA 4LF5I 1NHJA 4JI2E 3M6AA 4X66E 5FLXC 4DV6E 4YY3I 3PYDA 2VQFE 4EMDA 3CWVA 3PYGA 3QT6A 1U2RA 1MX0A 4KQVA 3J80Q 5GMDA 3D4JA 1Y4SA 4DV3E 2UUAI 3B8HA 4GKKI 1FWKA 2VF3A 4JG4A 4LF5E 1ELOA 4DV5I 2HHHE 4DV1I 4K0KI 4DR2I 3J7AG 4YY3E 4FW9A 3H4LA 4LF7E 1XNRE 5GMEA 1Z0GA 2LJPA 1N32E 1PKPA 1KIJA 5LMUI 4HACA 1H74A 2V2VA 4HXZA 1Z5CA 3T1HI 3ZM7A 3ZZ0A 2UXDI 2AJ4A 4DUYI 4DV2I 2E5LE 1XNQI 2HK2A 4WUBA 4DR2E 1BKNA 3F0NA 3T1YI 4FWDA 4IZKB 4LF9E 2Q2EB 1B62A 2V2QA 3LTOA 5LMUE 4HACB 4PRXA 4X62I 1K47A 4ZVIA 4JI5E 2VQEI 3ZZTA 1IBKI 2XEXA 4DR5E 4DUYE 1Y6ZA 4DV2E 4YHHI 4JV5I 2GQ0A 1DARA 5LMNI 4LFCI 4B3SE 3QT5A 1N33E 4I3HA 4WUCA 1H7UA 4Z7YA 4X64I 4DV7I 4JI7I 2V8PA 1FJGI 2VQEE 1N34I 1HNXE 1RREA 4JI1I 4JYAI 1MG7A 3J80C 1I94E 2UUBE 4KHPI 4HY1A 4MYUA 2Z5CA 4LFCE 2X7IA 4LFAI 4PRVA 4DPWA 4FWHA 4MYTA 5IWAI 5LL6R 4DU8A 3J7AM 3PRYA 1XMOI 4USMA 4DXLA 4LF6I 4JI1E 4JI8E 4JYAE 1RR9A 4DR6I 2R3VA 2BV3A 4P7AA 4KHPE 1Z59A 2Z5CB 5BR8E 2UXBI 1IBLE 1USUA 4X65I 4DR7E 1PVGA 3LPSA 4JI3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA E;  3ZZU A;  2F4V I;  1H72 C;  4JI6 I;  1KVK A;  1PIE A;  4GKJ I;  1XHK A;  4DR1 I;  4LFB I;  1KTV A;  3Q1Q A;  4B3T I;  2R42 A;  2UUA E;  4GKK E;  2GS8 A;  4WUD A;  4DPU A;  4DV5 E;  4XTJ A;  4DV1 E;  4K0K E;  1N0U A;  1FNM A;  3J81 Q;  4GKJ E;  1Z5A A;  1VIS A;  4DR1 E;  4LFB E;  1ZM9 A;  4B3T E;  5A2Q Q;  2UXC I;  3QT7 A;  1FWL A;  1EA6 A;  1OJ4 A;  4USK A;  3T1H E;  2ZIT A;  4LF8 I;  2UXD E;  4LF4 I;  2UU9 I;  2A2D A;  1XNQ E;  4B3M I;  2HK3 A;  2ZM6 I;  4NXN I;  4UT4 A;  4JI0 I;  3T1Y E;  3WU5 A;  1NZ0 A;  1Z0B A;  4JI4 I;  1D6T A;  3WU3 A;  1HNZ I;  2UUC I;  4DPT A;  4DPY A;  3B82 A;  4DR4 I;  1HNW I;  4X62 E;  4DPX A;  1IBK E;  1ZXN A;  2HKE A;  4LF8 E;  4DR3 I;  2UU9 E;  4YHH E;  4DV4 I;  2ZM6 E;  4JV5 E;  1UEK A;  1S4E A;  4DUZ I;  5LMN E;  1EI1 A;  4OX9 I;  4UTG A;  1Z0T A;  4X66 I;  1HR0 I;  2UUC E;  4DV6 I;  4DR4 E;  2A2C A;  4X64 E;  2VQF I;  4DV7 E;  4JI7 E;  1FJG E;  1Z0C A;  1N36 I;  1NHH A;  1N34 E;  1Z5B A;  3WU4 A;  4NXM I;  4DV4 E;  1FKA E;  2BM0 A;  2OI2 A;  4OX9 E;  2HHH I;  1HR0 E;  5IWA E;  4R1F A;  1Z0E A;  4PU9 A;  2HKJ A;  1XMO E;  3J81 C;  1IBM I;  5IT9 Q;  4FWG A;  2E1R A;  1ZXM A;  4LF7 I;  1XNR I;  1N36 E;  2WW4 A;  3OTO I;  1MU5 A;  1NHI A;  1S16 A;  1N32 I;  4LF6 E;  3JAM Q;  4NXM E;  4DR6 E;  5A2Q C;  2UXB E;  4X65 E;  4DV0 I;  3V5R A;  4DU7 A;  4JI3 E;  3LNU A;  3QT8 A;  2E5L I;  1FI4 A;  2F4V E;  5FLX Q;  3B78 A;  2EFG A;  4AQY I;  2V2Z A;  1IBM E;  4JI6 E;  4LF9 I;  2HFS A;  3K17 A;  3OTO E;  3PYE A;  2X36 A;  2HFU A;  1B63 A;  4HYM A;  1ZM3 A;  3ZKB A;  4JI5 I;  5L3J A;  4DV0 E;  4DR5 I;  3ZKD A;  4URL A;  4ED4 A;  1ZM2 A;  2DEJ A;  4AQY E;  2BM1 A;  4B3S I;  3V2U C;  1N0V C;  1N33 I;  2CZ9 A;  3GON A;  3K1J A;  3HUL A;  2UXC E;  4M1K A;  4RPF A;  1HNX I;  3WU6 A;  1H73 A;  1I94 I;  2UUB I;  4LF4 E;  2DEI A;  4P52 A;  1XMQ I;  4B3R I;  4B3M E;  1J5E I;  1A6F A;  4NXN E;  4JI0 E;  2J7K A;  1QZR A;  4JI4 E;  4JI2 I;  1HNZ E;  4FN5 A;  1HNW E;  1ZM4 A;  1H7S A;  5IT9 C;  4JI8 I;  2ZBK B;  2V34 A;  4Z7C A;  3PYF A;  4DR3 E;  1WUU A;  3JAM C;  5BR8 I;  1IBL I;  4DR7 I;  1XMQ E;  4B3R E;  1J5E E;  4DV3 I;  2NPF A;  1Z0V A;  4DUZ E;  1KKH A;  1Z0W A;  4LF5 I;  1NHJ A;  4JI2 E;  3M6A A;  4X66 E;  5FLX C;  4DV6 E;  4YY3 I;  3PYD A;  2VQF E;  4EMD A;  3CWV A;  3PYG A;  3QT6 A;  1U2R A;  1MX0 A;  4KQV A;  3J80 Q;  5GMD A;  3D4J A;  4DV3 E;  2UUA I;  3B8H A;  4GKK I;  1FWK A;  2VF3 A;  4JG4 A;  4LF5 E;  1ELO A;  4DV5 I;  2HHH E;  4DV1 I;  4K0K I;  4DR2 I;  3J7A G;  4YY3 E;  4FW9 A;  3H4L A;  4LF7 E;  1XNR E;  5GME A;  1Z0G A;  2LJP A;  1N32 E;  1PKP A;  1KIJ A;  5LMU I;  4HAC A;  1H74 A;  2V2V A;  4HXZ A;  1Z5C A;  3T1H I;  3ZM7 A;  3ZZ0 A;  2UXD I;  2AJ4 A;  4DUY I;  4DV2 I;  2E5L E;  1XNQ I;  2HK2 A;  4WUB A;  4DR2 E;  1BKN A;  3F0N A;  3T1Y I;  4FWD A;  4LF9 E;  2Q2E B;  1B62 A;  2V2Q A;  3LTO A;  5LMU E;  4HAC B;  4PRX A;  4X62 I;  1K47 A;  4ZVI A;  4JI5 E;  2VQE I;  3ZZT A;  1IBK I;  2XEX A;  4DR5 E;  4DUY E;  4DV2 E;  4YHH I;  4JV5 I;  1DAR A;  5LMN I;  4LFC I;  4B3S E;  3QT5 A;  1N33 E;  4I3H A;  4WUC A;  1H7U A;  4Z7Y A;  4X64 I;  4DV7 I;  4JI7 I;  2V8P A;  1FJG I;  2VQE E;  1HNX E;  1N34 I;  1RRE A;  4JI1 I;  4JYA I;  1MG7 A;  3J80 C;  1I94 E;  2UUB E;  4KHP I;  4HY1 A;  4MYU A;  4LFC E;  2X7I A;  4LFA I;  4PRV A;  4DPW A;  4FWH A;  4MYT A;  5IWA I;  5LL6 R;  4DU8 A;  3J7A M;  1XMO I;  4USM A;  4DXL A;  4LF6 I;  4JI1 E;  4JI8 E;  4JYA E;  1RR9 A;  4DR6 I;  2R3V A;  2BV3 A;  4P7A A;  4KHP E;  1Z59 A;  5BR8 E;  2UXB I;  1IBL E;  4X65 I;  4DR7 E;  1PVG A;  3LPS A;  4JI3 I; 
#chains in the Genus database with same CATH topology
 4OO1 B;  4LFA E;  4BA1 B;  5C0X F;  1Y4U A;  4LPF A;  5ELW A;  3ZZU A;  2F4V I;  4OO1 F;  5K36 C;  2BR2 A;  1H72 C;  1E3P A;  4JI6 I;  1KVK A;  2PO0 B;  1PIE A;  4GKJ I;  1XHK A;  5FWK A;  4DR1 I;  4LFB I;  1KTV A;  3Q1Q A;  4IZK A;  5K36 F;  4B3T I;  2R42 A;  4IFD E;  2UUA E;  3M85 G;  4GKK E;  2GS8 A;  4WUD A;  3GLL A;  4BA2 A;  2BA1 D;  4DPU A;  2BR2 B;  5DNX A;  5DRP A;  2C37 A;  5EL9 A;  4OKG A;  4DV5 E;  4XTJ A;  1R6M A;  4DV1 E;  4K0K E;  1N0U A;  1HK7 A;  1FNM A;  3J81 Q;  1UDN A;  2J65 A;  4GKJ E;  1Z5A A;  1VIS A;  4DR1 E;  4LFB E;  2VES A;  1ZM9 A;  4OZE A;  4B3T E;  4NBQ A;  5A2Q Q;  2BA0 D;  2UXC I;  3QT7 A;  1FWL A;  3U1K A;  1EA6 A;  1OJ4 A;  2Z5E A;  2F1D A;  4USK A;  2WP8 A;  3T1H E;  2NN6 A;  2ZIT A;  4LF8 I;  2UXD E;  4LF4 I;  2UU9 I;  2A2D A;  4AM3 A;  1XNQ E;  4B3M I;  2HK3 A;  4U3B A;  2ZM6 I;  4J3D A;  4NXN I;  4UT4 A;  4JI0 I;  3T1Y E;  3WU5 A;  1NZ0 A;  1Z0B A;  2PNL A;  4JI4 I;  2PNZ B;  1D6T A;  3HKM A;  4FW5 A;  4IZJ A;  2C38 A;  3WU3 A;  1HNZ I;  2UUC I;  2BA1 G;  4DPT A;  4DPY A;  3B82 A;  4DR4 I;  1HNW I;  4X62 E;  1RHY A;  4AIM A;  4DPX A;  2WP8 B;  5JEA C;  1IBK E;  1ZXN A;  2HKE A;  4LF8 E;  3Q6N A;  4DR3 I;  1YHC A;  2UU9 E;  4YHH E;  4DV4 I;  2ZM6 E;  4JV5 E;  1UEK A;  1S4E A;  3PS3 A;  2IOP A;  4QNJ A;  2BA0 G;  4DUZ I;  5LMN E;  5JEA F;  5C0X A;  1EI1 A;  4OO1 A;  4OX9 I;  4IZJ B;  4UTG A;  4BA1 A;  1Z0T A;  2C38 B;  4X66 I;  1HR0 I;  2UUC E;  2IER A;  4DV6 I;  4DR4 E;  2A2C A;  3P06 A;  4MU3 A;  4X64 E;  2VQF I;  4DV7 E;  4JI7 E;  1FJG E;  1Z0C A;  3UHM A;  1N36 I;  5K36 A;  4N3O A;  1NHH A;  1N34 E;  1Z5B A;  3WU4 A;  4NXM I;  3GME A;  4DV4 E;  2Z5B A;  2O1W A;  2JT2 A;  1FKA E;  2NN6 D;  4U3D A;  5C0X B;  2BM0 A;  3PS1 A;  2OI2 A;  4OX9 E;  2CGE A;  4AID A;  2PNM A;  2HHH I;  1HR0 E;  5IWA E;  4R1F A;  1Z0E A;  4PU9 A;  2HKJ A;  1XMO E;  3J81 C;  1IBM I;  5IT9 Q;  4FWG A;  4IZJ D;  1ZXM A;  2E1R A;  2O1V A;  4LF7 I;  1XNR I;  5K36 B;  1N36 E;  2WW4 A;  4IFD C;  3OTO I;  3K85 A;  1MU5 A;  4FW3 A;  1NHI A;  4FW6 A;  1S16 A;  3U1Y A;  4LF6 E;  3JAM Q;  1N32 I;  4NXM E;  2PO1 A;  2Z5B B;  4DR6 E;  5A2Q C;  4IFD B;  2UXB E;  1YH8 A;  4X65 E;  4DV0 I;  1R6L A;  3V5R A;  4DU7 A;  4JI3 E;  3M7N G;  4IFD F;  3LNU A;  3QT8 A;  2E5L I;  1FI4 A;  2F4V E;  5FLX Q;  3B78 A;  2EFG A;  5C0X D;  4AQY I;  2V2Z A;  4OO1 D;  1IBM E;  4MU4 A;  4JI6 E;  4LF9 I;  2HFS A;  3K17 A;  3OTO E;  3L7Z B;  3PYE A;  2X36 A;  2PO1 B;  2HFU A;  5DRR A;  1B63 A;  2PNZ A;  4HYM A;  1ZM3 A;  3ZKB A;  4JI5 I;  5L3J A;  5K36 D;  4DV0 E;  4DR5 I;  3ZKD A;  2GO4 A;  2O1T A;  4URL A;  1USV A;  4LCH A;  2AE8 A;  3KRN A;  4ED4 A;  1ZM2 A;  2DEJ A;  4AQY E;  2BM1 A;  1VI7 A;  4B3S I;  3V2U C;  1N0V C;  5JEA A;  1N33 I;  2CZ9 A;  3HJC A;  3GON A;  3K1J A;  2IOQ A;  5EKW A;  3HUL A;  2UXC E;  4M1K A;  3B4T A;  4RPF A;  1HNX I;  4IS9 A;  3WU6 A;  1H73 A;  1I94 I;  1Y60 A;  2UUB I;  4LF4 E;  4FW7 A;  2DEI A;  4P52 A;  1XMQ I;  4B3R I;  4B3M E;  1J5E I;  1A6F A;  2GO3 A;  5JEA B;  4NXN E;  4JI0 E;  3CDJ A;  2J7K A;  1P42 A;  1QZR A;  4JI4 E;  4JI2 I;  1HNZ E;  3Q6M A;  4FN5 A;  1HNW E;  2C39 A;  1OYS A;  1ZM4 A;  2NN6 E;  4LCF A;  1H7S A;  5IT9 C;  4JI8 I;  2ZBK B;  2V34 A;  4Z7C A;  3PYF A;  4DR3 E;  1WUU A;  3JAM C;  2CG9 A;  5BR8 I;  1IBL I;  4DR7 I;  1XMQ E;  4B3R E;  1J5E E;  4DV3 I;  2CVE A;  2WNR B;  2NPF A;  2JEB A;  3GCM A;  4IFD A;  1Z0V A;  4DUZ E;  2O1U A;  1KKH A;  1Z0W A;  4LF5 I;  1NHJ A;  4JI2 E;  3M6A A;  4X66 E;  5JEA D;  1OYR A;  5FLX C;  5DRQ A;  4DV6 E;  4YY3 I;  2C39 B;  3PYD A;  2VQF E;  4EMD A;  3CWV A;  3PYG A;  3QT6 A;  1U2R A;  1MX0 A;  2IES A;  3H1C A;  4KQV A;  3J80 Q;  3CDI A;  3NZK A;  3L7Z A;  4MQY A;  5GMD A;  3D4J A;  1Y4S A;  4DV3 E;  2UUA I;  2JEB B;  3B8H A;  5C0X E;  4GKK I;  4OO1 E;  1FWK A;  2VF3 A;  1OYP A;  4JG4 A;  4LF5 E;  1ELO A;  4DV5 I;  2HHH E;  1UDQ A;  4DV1 I;  4K0K I;  4DR2 I;  3J7A G;  4YY3 E;  4MDT A;  4FW9 A;  4LCG A;  3H4L A;  5K36 E;  4LF7 E;  1XNR E;  5GME A;  2PO2 A;  1Z0G A;  2LJP A;  1N32 E;  1PKP A;  1KIJ A;  5LMU I;  4HAC A;  1H74 A;  3P3G A;  2V2V A;  4MU0 A;  4HXZ A;  1Z5C A;  3T1H I;  3ZM7 A;  3ZZ0 A;  2UXD I;  2AJ4 A;  3P76 A;  4DUY I;  4DV2 I;  2E5L E;  1XNQ I;  2HK2 A;  4WUB A;  4DR2 E;  4IFD D;  1BKN A;  3F0N A;  3T1Y I;  4FWD A;  4IZK B;  4LF9 E;  5DNL A;  2Q2E B;  2PO2 B;  1B62 A;  1E3H A;  2V2Q A;  3LTO A;  4MU1 A;  5LMU E;  4HAC B;  3PS2 A;  4PRX A;  4X62 I;  1K47 A;  4ZVI A;  4JI5 E;  4BA2 B;  2VQE I;  3ZZT A;  1IBK I;  2XEX A;  4DR5 E;  2C37 B;  5DRO A;  4LOM A;  2JEA A;  4DUY E;  1Y6Z A;  4DV2 E;  4YHH I;  4JV5 I;  3P3E A;  2JE6 A;  2GQ0 A;  1DAR A;  5LMN I;  4LFC I;  4B3S E;  2WNR A;  3QT5 A;  1N33 E;  4QNK A;  4I3H A;  1Y5Y A;  4WUC A;  1H7U A;  2NN6 C;  4Z7Y A;  4X64 I;  4DV7 I;  4JI7 I;  2V8P A;  1FJG I;  2VQE E;  2NN6 B;  2JEA B;  1N34 I;  1HNX E;  1RRE A;  4FW4 A;  4JI1 I;  2NN6 F;  4JYA I;  1MG7 A;  2JE6 B;  3J80 C;  1I94 E;  2UUB E;  4KHP I;  4HY1 A;  4MYU A;  2Z5C A;  5JEA E;  4LFC E;  4GQU A;  2X7I A;  4LFA I;  1XXE A;  4PRV A;  1UDO A;  4ISA A;  4DPW A;  4FWH A;  4MYT A;  5IWA I;  5LL6 R;  3M85 D;  4DU8 A;  3M7N D;  3J7A M;  3PRY A;  1XMO I;  4USM A;  2PO0 A;  4DXL A;  3P3C A;  5C0X C;  4LF6 I;  4JI1 E;  4JI8 E;  4JYA E;  1RR9 A;  1UDS A;  3DD6 A;  4DR6 I;  4OO1 C;  2R3V A;  2BV3 A;  4P7A A;  4KHP E;  1Z59 A;  2Z5C B;  2O3Z A;  5BR8 E;  2UXB I;  1IBL E;  1USU A;  4X65 I;  4DR7 E;  1PVG A;  3LPS A;  4JI3 I; 
#chains in the Genus database with same CATH homology
 4LFA E;  1Y4U A;  3ZZU A;  2F4V I;  1H72 C;  4JI6 I;  1KVK A;  1PIE A;  4GKJ I;  1XHK A;  5FWK A;  4DR1 I;  4LFB I;  1KTV A;  3Q1Q A;  4IZK A;  4B3T I;  2R42 A;  2UUA E;  4GKK E;  2GS8 A;  4WUD A;  4DPU A;  4DV5 E;  4XTJ A;  4DV1 E;  4K0K E;  1N0U A;  1HK7 A;  3J81 Q;  1FNM A;  4GKJ E;  1Z5A A;  1VIS A;  4DR1 E;  4LFB E;  1ZM9 A;  4B3T E;  5A2Q Q;  2UXC I;  3QT7 A;  1FWL A;  1EA6 A;  1OJ4 A;  2Z5E A;  4USK A;  3T1H E;  2ZIT A;  4LF8 I;  2UXD E;  4LF4 I;  2UU9 I;  2A2D A;  1XNQ E;  4B3M I;  2HK3 A;  2ZM6 I;  4NXN I;  4UT4 A;  4JI0 I;  3T1Y E;  3WU5 A;  1NZ0 A;  1Z0B A;  2PNL A;  4JI4 I;  1D6T A;  4IZJ A;  3WU3 A;  1HNZ I;  2UUC I;  4DPT A;  4DPY A;  3B82 A;  4DR4 I;  1HNW I;  4X62 E;  4DPX A;  1IBK E;  1ZXN A;  2HKE A;  4LF8 E;  3Q6N A;  4DR3 I;  2UU9 E;  4YHH E;  4DV4 I;  2ZM6 E;  4JV5 E;  1UEK A;  1S4E A;  2IOP A;  4DUZ I;  5LMN E;  1EI1 A;  4OX9 I;  4IZJ B;  4UTG A;  1Z0T A;  4X66 I;  1HR0 I;  2UUC E;  4DV6 I;  4DR4 E;  2A2C A;  3P06 A;  4X64 E;  2VQF I;  4DV7 E;  4JI7 E;  1FJG E;  1Z0C A;  1N36 I;  4N3O A;  1NHH A;  1N34 E;  1Z5B A;  3WU4 A;  4NXM I;  4DV4 E;  2Z5B A;  2O1W A;  1FKA E;  2BM0 A;  2OI2 A;  4OX9 E;  2CGE A;  2PNM A;  2HHH I;  1HR0 E;  5IWA E;  4R1F A;  1Z0E A;  4PU9 A;  2HKJ A;  1XMO E;  3J81 C;  1IBM I;  5IT9 Q;  2O1V A;  1ZXM A;  2E1R A;  4FWG A;  4IZJ D;  4LF7 I;  1XNR I;  1N36 E;  2WW4 A;  3OTO I;  3K85 A;  1MU5 A;  1NHI A;  1S16 A;  1N32 I;  4LF6 E;  3JAM Q;  4NXM E;  2Z5B B;  4DR6 E;  5A2Q C;  2UXB E;  4X65 E;  4DV0 I;  3V5R A;  4DU7 A;  4JI3 E;  3LNU A;  3QT8 A;  2E5L I;  1FI4 A;  2F4V E;  5FLX Q;  3B78 A;  2EFG A;  4AQY I;  2V2Z A;  1IBM E;  4JI6 E;  4LF9 I;  2HFS A;  3K17 A;  3OTO E;  3PYE A;  2X36 A;  2HFU A;  1B63 A;  4HYM A;  1ZM3 A;  3ZKB A;  4JI5 I;  5L3J A;  4DV0 E;  4DR5 I;  3ZKD A;  2O1T A;  4URL A;  1USV A;  4ED4 A;  1ZM2 A;  2DEJ A;  4AQY E;  2BM1 A;  4B3S I;  3V2U C;  1N0V C;  1N33 I;  2CZ9 A;  3HJC A;  3GON A;  3K1J A;  2IOQ A;  3HUL A;  2UXC E;  4M1K A;  4RPF A;  1HNX I;  3WU6 A;  1H73 A;  1I94 I;  2UUB I;  4LF4 E;  2DEI A;  4P52 A;  1XMQ I;  4B3R I;  4B3M E;  1J5E I;  1A6F A;  4NXN E;  4JI0 E;  2J7K A;  1QZR A;  4JI4 E;  4JI2 I;  1HNZ E;  3Q6M A;  4FN5 A;  1HNW E;  1ZM4 A;  1H7S A;  5IT9 C;  4JI8 I;  2ZBK B;  2V34 A;  4Z7C A;  3PYF A;  4DR3 E;  1WUU A;  3JAM C;  2CG9 A;  5BR8 I;  1IBL I;  4DR7 I;  1XMQ E;  4B3R E;  1J5E E;  4DV3 I;  2NPF A;  1Z0V A;  4DUZ E;  2O1U A;  1KKH A;  1Z0W A;  4LF5 I;  1NHJ A;  4JI2 E;  3M6A A;  4X66 E;  5FLX C;  4DV6 E;  4YY3 I;  3PYD A;  2VQF E;  4EMD A;  3CWV A;  3PYG A;  3QT6 A;  1U2R A;  1MX0 A;  4KQV A;  3J80 Q;  5GMD A;  3D4J A;  1Y4S A;  4DV3 E;  2UUA I;  3B8H A;  4GKK I;  1FWK A;  2VF3 A;  4JG4 A;  4LF5 E;  1ELO A;  4DV5 I;  2HHH E;  4DV1 I;  4K0K I;  4DR2 I;  3J7A G;  4YY3 E;  4FW9 A;  3H4L A;  4LF7 E;  1XNR E;  5GME A;  1Z0G A;  2LJP A;  1N32 E;  1PKP A;  1KIJ A;  5LMU I;  4HAC A;  1H74 A;  2V2V A;  4HXZ A;  1Z5C A;  3T1H I;  3ZM7 A;  3ZZ0 A;  2UXD I;  2AJ4 A;  4DUY I;  4DV2 I;  2E5L E;  1XNQ I;  2HK2 A;  4WUB A;  4DR2 E;  1BKN A;  3F0N A;  3T1Y I;  4FWD A;  4IZK B;  4LF9 E;  2Q2E B;  1B62 A;  2V2Q A;  3LTO A;  5LMU E;  4HAC B;  4PRX A;  4X62 I;  1K47 A;  4ZVI A;  4JI5 E;  2VQE I;  3ZZT A;  1IBK I;  2XEX A;  4DR5 E;  4DUY E;  1Y6Z A;  4DV2 E;  4YHH I;  4JV5 I;  2GQ0 A;  1DAR A;  5LMN I;  4LFC I;  4B3S E;  3QT5 A;  1N33 E;  4I3H A;  4WUC A;  1H7U A;  4Z7Y A;  4X64 I;  4DV7 I;  4JI7 I;  2V8P A;  1FJG I;  2VQE E;  1N34 I;  1HNX E;  1RRE A;  4JI1 I;  4JYA I;  1MG7 A;  3J80 C;  1I94 E;  2UUB E;  4KHP I;  4HY1 A;  4MYU A;  2Z5C A;  4LFC E;  2X7I A;  4LFA I;  4PRV A;  4DPW A;  4FWH A;  4MYT A;  5IWA I;  5LL6 R;  4DU8 A;  3J7A M;  3PRY A;  1XMO I;  4USM A;  4DXL A;  4LF6 I;  4JI1 E;  4JI8 E;  4JYA E;  1RR9 A;  4DR6 I;  2R3V A;  2BV3 A;  4P7A A;  4KHP E;  1Z59 A;  2Z5C B;  5BR8 E;  2UXB I;  1IBL E;  1USU A;  4X65 I;  4DR7 E;  1PVG A;  3LPS A;  4JI3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...