4LFBI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbI00
4DPWA 1H72C 3J7AG 4Z7CA 2VF3A 1PKPA 2UXBI 1HR0I 4USMA 4LFBE 4DU8A 4DR7I 1J5EE 1Z0VA 4X62E 3HULA 1ZM4A 1B62A 2HHHE 4JI2I 5GMDA 2DEIA 4JI7E 1Z0BA 3GONA 2E5LI 4HACA 2UXCI 4OX9I 1I94E 1XMQI 4LF4I 3V5RA 4DV1E 1HNWI 4HY1A 3QT5A 4B3MI 1EA6A 4LFCI 4DUZI 2UUAE 3Q1QA 1RR9A 3T1HI 1FJGI 5IT9Q 3OTOE 2CZ9A 5LMUE 3J81C 4NXME 4JI3E 4R1FA 2V8PA 4MYTA 1K47A 4LF5I 1H7SA 1UEKA 4B3TE 4JYAE 1IBLE 4DR4E 5GMEA 1Z5CA 1N36I 4P7AA 4KQVA 2F4VE 2UUBI 1ZM9A 4YY3I 4X66E 3ZKDA 4DR6E 4DR3E 1J5EI 1WUUA 4DV3I 3QT8A 4DR1E 4YHHE 4DV6E 2E1RA 4MYUA 2DEJA 4DV2I 2LJPA 4LFAE 1Z5BA 2UUCI 4JV5E 4JI6E 1N33E 2VQEE 1ZM3A 4EMDA 2GS8A 3J7AM 1IBMI 3QT6A 4X65I 1N34E 3WU6A 3K1JA 4Z7YA 4B3SE 2A2CA 1VISA 4LF6E 4DV7I 4JI8I 1HNXI 2VQFE 3ZZTA 3B8HA 1KKHA 3PYFA 4FWHA 5BR8I 4GKKE 1XNRE 4DV5I 4GKJE 4WUDA 3M6AA 2V2ZA 3WU5A 2HKJA 1IBKE 4JI0I 2AJ4A 4KHPE 4LF9I 2UU9E 2HKEA 1S16A 1NHJA 4LF7I 3B78A 4URLA 4WUBA 1RREA 4LF8I 4JI5I 4WUCA 1Z0GA 4DV0E 4DV4E 5IWAE 4AQYI 1HNZI 1FKAE 4B3RI 1D6TA 3B82A 1XMOE 5L3JA 1N32E 3T1YI 3WU3A 4JI4I 4FWGA 1H74A 4K0KI 2HFUA 2ZM6I 4NXNE 5IT9C 4JI1E 1PIEA 1ZXNA 4I3HA 4DUYE 2BM1A 2EFGA 2NPFA 4DR5I 4X64E 3LTOA 3PYDA 1OJ4A 1XNQI 4DR2I 4PRVA 1Z59A 2BV3A 5LMNI 2V2QA 2UXBE 2UXDE 1HR0E 4HACB 4FW9A 4RPFA 1NHHA 4UTGA 4DR7E 4LFBI 4FN5A 2V34A 1PVGA 4X62I 2ZITA 4FWDA 4JG4A 4JI2E 2HHHI 4M1KA 4JI7I 2E5LE 2UXCE 4DPXA 4OX9E 1XMQE 4DV0I 1MU5A 1I94I 4LF4E 3ZKBA 1HNWE 4DV1I 4B3ME 2Q2EB 4LFCE 4DUZE 1ELOA 2UUAI 1FWKA 3D4JA 3T1HE 1FJGE 2R42A 1DARA 3OTOI 5LMUI 3V2UC 4XTJA 1Z0EA 3K17A 3ZZUA 1Z0CA 4HXZA 4NXMI 4JI3I 4LF5E 3ZZ0A 4B3TI 4JYAI 1Z0TA 1N36E 1IBLI 4DR4I 1KVKA 1Z5AA 2BM0A 1MG7A 3LNUA 2UUBE 2UXDI 5A2QQ 4YY3E 2F4VI 1EI1A 3CWVA 2HK3A 5A2QC 1Z0WA 4X66I 1KTVA 1S4EA 4DV3E 1XHKA 4DR6I 4DR3I 3F0NA 2X7IA 2R3VA 3PYGA 4DR1I 4YHHI 4DV6I 4HYMA 2OI2A 4DV2E 2UUCE 1FNMA 3WU4A 4LFAI 4JV5I 1H73A 4JI6I 1N33I 1IBME 2VQEI 3PYEA 4ZVIA 4X65E 1N34I 2X36A 1QZRA 2HK2A 1FWLA 4USKA 4B3SI 5LL6R 4DV7E 4JI8E 1HNXE 4LF6I 5BR8E 2VQFI 4DU7A 1KIJA 2WW4A 4GKKI 3H4LA 4DV5E 1MX0A 1ZM2A 1XNRI 3J81Q 1B63A 4GKJI 1ZXMA 4DPTA 4DPYA 1FI4A 4JI0E 4PRXA 1IBKI 4LF9E 4KHPI 2UU9I 2XEXA 4LF7E 1N0UA 4P52A 1BKNA 4UT4A 1U2RA 3JAMQ 4LF8E 4JI5E 3JAMC 1NHIA 2V2VA 2ZBKB 1H7UA 4AQYE 1NZ0A 1HNZE 4DV4I 4B3RE 5IWAI 3J80Q 2J7KA 3J80C 1XMOI 3LPSA 4ED4A 5FLXQ 3T1YE 4JI4E 3QT7A 1N32I 5FLXC 2A2DA 4K0KE 2ZM6E 2HFSA 4DXLA 4NXNI 4DPUA 4DR5E 3ZM7A 4JI1I 4DUYI 4X64I 1A6FA 1N0VC 1XNQE 4DR2E 4PU9A 5LMNE
chains in the Genus database with same CATH superfamily
4BA2A 5K36E 4DPWA 1H72C 3J7AG 3HJCA 4Z7CA 2VF3A 1PKPA 2UXBI 1Y4UA 1HR0I 4USMA 4BA1B 4LFBE 4DU8A 4DR7I 1J5EE 1Z0VA 4X62E 3HULA 2BA1D 1ZM4A 1B62A 2HHHE 2IOQA 4JI2I 3P76A 5GMDA 2DEIA 4JI7E 2JEAB 1Z0BA 3GONA 5JEAA 2E5LI 4HACA 2UXCI 3M85G 4OX9I 1I94E 1XMQI 4LF4I 1Y6ZA 2NN6F 3V5RA 1YH8A 4DV1E 2PO1A 1HNWI 4HY1A 3QT5A 1USVA 4B3MI 1EA6A 4MU1A 4LOMA 2PO0B 4LPFA 1R6MA 3CDIA 4LFCI 4DUZI 2UUAE 1R6LA 3Q1QA 1RR9A 3T1HI 4OO1D 1FJGI 5IT9Q 3OTOE 4J3DA 5C0XC 2CZ9A 5LMUE 5K36B 5DRPA 2WP8A 3J81C 4NXME 4JI3E 2WNRB 2PO2A 4R1FA 2C39A 2V8PA 4MYTA 4U3BA 1K47A 4LF5I 1H7SA 4IFDD 1UEKA 4MU3A 4B3TE 4JYAE 1IBLE 1P42A 4GQUA 4DR4E 5GMEA 1Z5CA 1N36I 4P7AA 4IZJB 1USUA 4KQVA 1UDOA 4LCHA 2F4VE 3GCMA 3U1KA 2UUBI 1ZM9A 4YY3I 4X66E 5EKWA 3ZKDA 4DR6E 3P3CA 4DR3E 2JE6A 2F1DA 1J5EI 1WUUA 4DV3I 3QT8A 4MU0A 4DR1E 4YHHE 1OYPA 4DV6E 2E1RA 3L7ZA 4MYUA 4OO1E 2DEJA 4IS9A 2O1TA 4DV2I 2LJPA 4LCFA 1Z5BA 4LFAE 2UUCI 1UDSA 4JV5E 2BR2A 4JI6E 1E3HA 5JEAD 1N33E 2VQEE 1ZM3A 4EMDA 2GS8A 3J7AM 1IBMI 4FW3A 3QT6A 4X65I 1N34E 4IFDE 3WU6A 3K1JA 5C0XF 4FW7A 4Z7YA 2GQ0A 4B3SE 2A2CA 3P06A 1VISA 2JEBA 4LF6E 4IZKB 4DV7I 4JI8I 1HNXI 2VQFE 3ZZTA 3B8HA 1KKHA 3PYFA 4FWHA 5BR8I 4GKKE 5K36C 1XNRE 4DV5I 4GKJE 4WUDA 3M6AA 2V2ZA 3WU5A 2NN6A 2HKJA 1IBKE 2O3ZA 4JI0I 2AJ4A 3M85D 1YHCA 4KHPE 5JEAE 4LF9I 2UU9E 5DRRA 2HKEA 4QNKA 4U3DA 2Z5BA 1S16A 1NHJA 1Y60A 2PNZB 4LF7I 1E3PA 3B78A 4URLA 1OYSA 2O1UA 4WUBA 1RREA 2CVEA 4LF8I 4OO1B 4JI5I 4WUCA 1Z0GA 4DV0E 3Q6NA 2J65A 4DV4E 4AM3A 5IWAE 4AQYI 1HNZI 1FKAE 4B3RI 5DRQA 1D6TA 3B82A 1XMOE 4IFDB 2BA0D 4LCGA 5L3JA 4BA2B 3P3EA 1N32E 4IZJA 3T1YI 3WU3A 4JI4I 4FWGA 2PNLA 1H74A 4K0KI 1Y4SA 5FWKA 1VI7A 2HFUA 2C38A 2ZM6I 4NXNE 5K36F 3B4TA 5IT9C 1PIEA 4JI1E 1ZXNA 4I3HA 4DUYE 2BM1A 2EFGA 2NPFA 4DR5I 5DNLA 4X64E 2BA0G 3LTOA 3PYDA 1OJ4A 3CDJA 2GO3A 1XNQI 4DR2I 1RHYA 4PRVA 1Z59A 2BV3A 5LMNI 2V2QA 2UXBE 2Z5CA 5JEAB 2UXDE 1HR0E 4HACB 2C37A 4FW9A 4RPFA 1NHHA 4UTGA 4DR7E 2NN6D 4LFBI 3UHMA 5C0XA 4FN5A 2V34A 2PO1B 4OKGA 1PVGA 4FW4A 3M7NG 4MU4A 4X62I 2ZITA 4NBQA 4FWDA 4JG4A 4JI2E 3PRYA 2HHHI 4OO1C 4M1KA 3HKMA 4JI7I 2CGEA 2E5LE 2UXCE 4DPXA 4OX9E 4AIDA 3PS1A 1XMQE 4DV0I 1Y5YA 1MU5A 1I94I 4OZEA 4BA1A 4LF4E 4AIMA 2WP8B 3ZKBA 4ISAA 1HNWE 4IFDC 4DV1I 2JT2A 2PO2B 2C39B 2IERA 4B3ME 3H1CA 2Q2EB 4LFCE 3NZKA 4DUZE 3PS3A 5ELWA 1ELOA 2UUAI 1FWKA 2NN6E 2JEAA 3D4JA 3T1HE 1FJGE 2R42A 1DARA 4MDTA 4FW5A 2Z5EA 3OTOI 2IESA 5LMUI 3V2UC 4XTJA 1Z0EA 3K17A 5DNXA 3DD6A 2JE6B 3ZZUA 1Z0CA 4HXZA 1XXEA 4NXMI 4JI3I 4LF5E 4N3OA 1HK7A 3ZZ0A 3L7ZB 3PS2A 2O1VA 2PO0A 4B3TI 4JYAI 1Z0TA 1N36E 1IBLI 5EL9A 5JEAC 4DR4I 2BR2B 1KVKA 1Z5AA 2BM0A 1MG7A 3LNUA 2UUBE 2UXDI 5A2QQ 4YY3E 2F4VI 4OO1F 1EI1A 3CWVA 5K36A 2HK3A 5A2QC 1Z0WA 4X66I 5C0XD 1KTVA 1S4EA 1XHKA 4DV3E 4DR6I 4DR3I 2O1WA 2WNRA 2AE8A 3F0NA 2X7IA 2R3VA 3PYGA 4DR1I 4YHHI 4FW6A 4DV6I 4HYMA 2JEBB 3KRNA 2OI2A 4IFDF 3P3GA 4DV2E 2UUCE 1FNMA 3WU4A 3GLLA 4LFAI 4JV5I 1H73A 3K85A 4JI6I 1N33I 1IBME 2VQEI 3PYEA 4ZVIA 4X65E 2CG9A 1N34I 2X36A 5DROA 2NN6B 1QZRA 2BA1G 2HK2A 3Q6MA 1FWLA 4USKA 4B3SI 1UDQA 5LL6R 4DV7E 4JI8E 1HNXE 4LF6I 2Z5BB 5BR8E 2VQFI 4DU7A 5C0XE 1KIJA 2WW4A 3M7ND 4GKKI 3H4LA 4DV5E 1MX0A 5JEAF 1ZM2A 1XNRI 3J81Q 1B63A 4GKJI 1ZXMA 4DPTA 4DPYA 1FI4A 4JI0E 4PRXA 1IBKI 4LF9E 4KHPI 3GMEA 4IZKA 2UU9I 2XEXA 4LF7E 2GO4A 1N0UA 4P52A 1BKNA 4UT4A 2VESA 1OYRA 1U2RA 3JAMQ 4LF8E 4JI5E 5K36D 3JAMC 1NHIA 2C38B 2V2VA 2ZBKB 1UDNA 1H7UA 4AQYE 1NZ0A 1HNZE 4DV4I 4B3RE 5IWAI 3J80Q 2J7KA 2PNMA 3J80C 4MQYA 1XMOI 3LPSA 4QNJA 4ED4A 2PNZA 4IZJD 5FLXQ 3T1YE 4JI4E 3QT7A 1N32I 5FLXC 2A2DA 4K0KE 2Z5CB 4OO1A 2ZM6E 2NN6C 2HFSA 2C37B 4DXLA 4NXNI 4DPUA 4DR5E 3ZM7A 4JI1I 5C0XB 2IOPA 4DUYI 4X64I 1A6FA 1N0VC 3U1YA 4DR2E 1XNQE 4PU9A 4IFDA 5LMNE
chains in the Genus database with same CATH topology
4DPWA 1H72C 3J7AG 3HJCA 4Z7CA 2VF3A 1PKPA 2UXBI 1Y4UA 1HR0I 4USMA 4LFBE 4DU8A 4DR7I 1J5EE 1Z0VA 4X62E 3HULA 1ZM4A 1B62A 2HHHE 2IOQA 4JI2I 5GMDA 2DEIA 4JI7E 1Z0BA 3GONA 2E5LI 4HACA 2UXCI 4OX9I 1I94E 1XMQI 4LF4I 1Y6ZA 3V5RA 4DV1E 1HNWI 4HY1A 3QT5A 1USVA 4B3MI 1EA6A 4LFCI 4DUZI 2UUAE 3Q1QA 1RR9A 3T1HI 1FJGI 5IT9Q 3OTOE 2CZ9A 5LMUE 3J81C 4NXME 4JI3E 4R1FA 2V8PA 4MYTA 1K47A 4LF5I 1H7SA 1UEKA 4B3TE 4JYAE 1IBLE 4DR4E 5GMEA 1Z5CA 1N36I 4P7AA 4IZJB 1USUA 4KQVA 2F4VE 2UUBI 1ZM9A 4YY3I 4X66E 3ZKDA 4DR6E 4DR3E 1J5EI 1WUUA 4DV3I 3QT8A 4DR1E 4YHHE 4DV6E 2E1RA 4MYUA 2DEJA 2O1TA 4DV2I 2LJPA 4LFAE 1Z5BA 2UUCI 4JV5E 4JI6E 1N33E 2VQEE 1ZM3A 4EMDA 2GS8A 3J7AM 1IBMI 3QT6A 4X65I 1N34E 3WU6A 3K1JA 4Z7YA 2GQ0A 4B3SE 2A2CA 3P06A 1VISA 4LF6E 4IZKB 4DV7I 4JI8I 1HNXI 2VQFE 3ZZTA 3B8HA 1KKHA 3PYFA 4FWHA 5BR8I 4GKKE 1XNRE 4DV5I 4GKJE 4WUDA 3M6AA 2V2ZA 3WU5A 2HKJA 1IBKE 4JI0I 2AJ4A 4KHPE 4LF9I 2UU9E 2HKEA 2Z5BA 1S16A 1NHJA 4LF7I 3B78A 4URLA 2O1UA 4WUBA 1RREA 4LF8I 4JI5I 4WUCA 1Z0GA 4DV0E 3Q6NA 4DV4E 5IWAE 4AQYI 1HNZI 1FKAE 4B3RI 1D6TA 3B82A 1XMOE 5L3JA 1N32E 4IZJA 3T1YI 3WU3A 4JI4I 4FWGA 2PNLA 1H74A 4K0KI 1Y4SA 5FWKA 2HFUA 2ZM6I 4NXNE 5IT9C 1PIEA 4JI1E 1ZXNA 4I3HA 4DUYE 2BM1A 2EFGA 2NPFA 4DR5I 4X64E 3LTOA 3PYDA 1OJ4A 1XNQI 4DR2I 4PRVA 1Z59A 2BV3A 5LMNI 2V2QA 2UXBE 2Z5CA 2UXDE 1HR0E 4HACB 4FW9A 4RPFA 1NHHA 4UTGA 4DR7E 4LFBI 4FN5A 2V34A 1PVGA 4X62I 2ZITA 4FWDA 4JG4A 4JI2E 3PRYA 2HHHI 4M1KA 4JI7I 2CGEA 2E5LE 2UXCE 4DPXA 4OX9E 1XMQE 4DV0I 1MU5A 1I94I 4LF4E 3ZKBA 1HNWE 4DV1I 4B3ME 2Q2EB 4LFCE 4DUZE 1ELOA 2UUAI 1FWKA 3D4JA 3T1HE 1FJGE 2R42A 1DARA 2Z5EA 3OTOI 5LMUI 3V2UC 4XTJA 1Z0EA 3K17A 3ZZUA 1Z0CA 4HXZA 4NXMI 4JI3I 4LF5E 4N3OA 1HK7A 3ZZ0A 2O1VA 4B3TI 4JYAI 1Z0TA 1N36E 1IBLI 4DR4I 1KVKA 1Z5AA 2BM0A 1MG7A 3LNUA 2UUBE 2UXDI 5A2QQ 4YY3E 2F4VI 1EI1A 3CWVA 2HK3A 5A2QC 1Z0WA 4X66I 1KTVA 1S4EA 4DV3E 1XHKA 4DR6I 4DR3I 2O1WA 3F0NA 2X7IA 2R3VA 3PYGA 4DR1I 4YHHI 4DV6I 4HYMA 2OI2A 4DV2E 2UUCE 1FNMA 3WU4A 4LFAI 4JV5I 1H73A 3K85A 4JI6I 1N33I 1IBME 2VQEI 3PYEA 4ZVIA 4X65E 2CG9A 1N34I 2X36A 1QZRA 2HK2A 3Q6MA 1FWLA 4USKA 4B3SI 5LL6R 4DV7E 4JI8E 1HNXE 4LF6I 2Z5BB 5BR8E 2VQFI 4DU7A 1KIJA 2WW4A 4GKKI 3H4LA 4DV5E 1MX0A 1ZM2A 1XNRI 3J81Q 1B63A 4GKJI 1ZXMA 4DPTA 4DPYA 1FI4A 4JI0E 4PRXA 1IBKI 4LF9E 4KHPI 4IZKA 2UU9I 2XEXA 4LF7E 1N0UA 4P52A 1BKNA 4UT4A 1U2RA 3JAMQ 4LF8E 4JI5E 3JAMC 1NHIA 2V2VA 2ZBKB 1H7UA 4AQYE 1NZ0A 1HNZE 4DV4I 4B3RE 5IWAI 3J80Q 2J7KA 2PNMA 3J80C 1XMOI 3LPSA 4ED4A 4IZJD 5FLXQ 3T1YE 4JI4E 3QT7A 1N32I 5FLXC 2A2DA 4K0KE 2Z5CB 2ZM6E 2HFSA 4DXLA 4NXNI 4DPUA 4DR5E 3ZM7A 4JI1I 4DUYI 2IOPA 4X64I 1A6FA 1N0VC 1XNQE 4DR2E 4PU9A 5LMNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPW A;  1H72 C;  3J7A G;  4Z7C A;  2VF3 A;  1PKP A;  2UXB I;  1HR0 I;  4USM A;  4LFB E;  4DU8 A;  4DR7 I;  1J5E E;  1Z0V A;  4X62 E;  3HUL A;  1ZM4 A;  1B62 A;  2HHH E;  4JI2 I;  5GMD A;  2DEI A;  4JI7 E;  1Z0B A;  3GON A;  2E5L I;  4HAC A;  2UXC I;  4OX9 I;  1I94 E;  1XMQ I;  4LF4 I;  3V5R A;  4DV1 E;  1HNW I;  4HY1 A;  3QT5 A;  4B3M I;  1EA6 A;  4LFC I;  4DUZ I;  2UUA E;  3Q1Q A;  1RR9 A;  3T1H I;  1FJG I;  5IT9 Q;  3OTO E;  2CZ9 A;  5LMU E;  3J81 C;  4NXM E;  4JI3 E;  4R1F A;  2V8P A;  4MYT A;  1K47 A;  4LF5 I;  1H7S A;  1UEK A;  4B3T E;  4JYA E;  1IBL E;  4DR4 E;  5GME A;  1Z5C A;  1N36 I;  4P7A A;  4KQV A;  2F4V E;  2UUB I;  1ZM9 A;  4YY3 I;  4X66 E;  3ZKD A;  4DR6 E;  4DR3 E;  1J5E I;  1WUU A;  4DV3 I;  3QT8 A;  4DR1 E;  4YHH E;  4DV6 E;  2E1R A;  4MYU A;  2DEJ A;  4DV2 I;  2LJP A;  4LFA E;  1Z5B A;  2UUC I;  4JV5 E;  4JI6 E;  1N33 E;  2VQE E;  1ZM3 A;  4EMD A;  2GS8 A;  3J7A M;  1IBM I;  3QT6 A;  4X65 I;  1N34 E;  3WU6 A;  3K1J A;  4Z7Y A;  4B3S E;  2A2C A;  1VIS A;  4LF6 E;  4DV7 I;  4JI8 I;  1HNX I;  2VQF E;  3ZZT A;  3B8H A;  1KKH A;  3PYF A;  4FWH A;  5BR8 I;  4GKK E;  1XNR E;  4DV5 I;  4GKJ E;  4WUD A;  3M6A A;  2V2Z A;  3WU5 A;  2HKJ A;  1IBK E;  4JI0 I;  2AJ4 A;  4KHP E;  4LF9 I;  2UU9 E;  2HKE A;  1S16 A;  1NHJ A;  4LF7 I;  3B78 A;  4URL A;  4WUB A;  1RRE A;  4LF8 I;  4JI5 I;  4WUC A;  1Z0G A;  4DV0 E;  4DV4 E;  5IWA E;  4AQY I;  1HNZ I;  1FKA E;  4B3R I;  1D6T A;  3B82 A;  1XMO E;  5L3J A;  1N32 E;  3T1Y I;  3WU3 A;  4JI4 I;  4FWG A;  1H74 A;  4K0K I;  2HFU A;  2ZM6 I;  4NXN E;  5IT9 C;  4JI1 E;  1PIE A;  1ZXN A;  4I3H A;  4DUY E;  2BM1 A;  2EFG A;  2NPF A;  4DR5 I;  4X64 E;  3LTO A;  3PYD A;  1OJ4 A;  1XNQ I;  4DR2 I;  4PRV A;  1Z59 A;  2BV3 A;  5LMN I;  2V2Q A;  2UXB E;  2UXD E;  1HR0 E;  4HAC B;  4FW9 A;  4RPF A;  1NHH A;  4UTG A;  4DR7 E;  4LFB I;  4FN5 A;  2V34 A;  1PVG A;  4X62 I;  2ZIT A;  4FWD A;  4JG4 A;  4JI2 E;  2HHH I;  4M1K A;  4JI7 I;  2E5L E;  2UXC E;  4DPX A;  4OX9 E;  1XMQ E;  4DV0 I;  1MU5 A;  1I94 I;  4LF4 E;  3ZKB A;  1HNW E;  4DV1 I;  4B3M E;  2Q2E B;  4LFC E;  4DUZ E;  1ELO A;  2UUA I;  1FWK A;  3D4J A;  3T1H E;  1FJG E;  2R42 A;  1DAR A;  3OTO I;  5LMU I;  3V2U C;  4XTJ A;  1Z0E A;  3K17 A;  3ZZU A;  1Z0C A;  4HXZ A;  4NXM I;  4JI3 I;  4LF5 E;  3ZZ0 A;  4B3T I;  4JYA I;  1Z0T A;  1N36 E;  1IBL I;  4DR4 I;  1KVK A;  1Z5A A;  2BM0 A;  1MG7 A;  3LNU A;  2UUB E;  2UXD I;  5A2Q Q;  4YY3 E;  2F4V I;  1EI1 A;  3CWV A;  2HK3 A;  5A2Q C;  1Z0W A;  4X66 I;  1KTV A;  1S4E A;  4DV3 E;  1XHK A;  4DR6 I;  4DR3 I;  3F0N A;  2X7I A;  2R3V A;  3PYG A;  4DR1 I;  4YHH I;  4DV6 I;  4HYM A;  2OI2 A;  4DV2 E;  2UUC E;  1FNM A;  3WU4 A;  4LFA I;  4JV5 I;  1H73 A;  4JI6 I;  1N33 I;  1IBM E;  2VQE I;  3PYE A;  4ZVI A;  4X65 E;  1N34 I;  2X36 A;  1QZR A;  2HK2 A;  1FWL A;  4USK A;  4B3S I;  5LL6 R;  4DV7 E;  4JI8 E;  1HNX E;  4LF6 I;  5BR8 E;  2VQF I;  4DU7 A;  1KIJ A;  2WW4 A;  4GKK I;  3H4L A;  4DV5 E;  1MX0 A;  1ZM2 A;  1XNR I;  3J81 Q;  1B63 A;  4GKJ I;  1ZXM A;  4DPT A;  4DPY A;  1FI4 A;  4JI0 E;  4PRX A;  1IBK I;  4LF9 E;  4KHP I;  2UU9 I;  2XEX A;  4LF7 E;  1N0U A;  4P52 A;  1BKN A;  4UT4 A;  1U2R A;  3JAM Q;  4LF8 E;  4JI5 E;  3JAM C;  1NHI A;  2V2V A;  2ZBK B;  1H7U A;  4AQY E;  1NZ0 A;  1HNZ E;  4DV4 I;  4B3R E;  5IWA I;  3J80 Q;  2J7K A;  3J80 C;  1XMO I;  3LPS A;  4ED4 A;  5FLX Q;  3T1Y E;  4JI4 E;  3QT7 A;  1N32 I;  5FLX C;  2A2D A;  4K0K E;  2ZM6 E;  2HFS A;  4DXL A;  4NXN I;  4DPU A;  4DR5 E;  3ZM7 A;  4JI1 I;  4DUY I;  4X64 I;  1A6F A;  1N0V C;  1XNQ E;  4DR2 E;  4PU9 A;  5LMN E; 
#chains in the Genus database with same CATH topology
 4BA2 A;  5K36 E;  4DPW A;  1H72 C;  3J7A G;  3HJC A;  4Z7C A;  2VF3 A;  1PKP A;  2UXB I;  1Y4U A;  1HR0 I;  4USM A;  4BA1 B;  4LFB E;  4DU8 A;  4DR7 I;  1J5E E;  1Z0V A;  4X62 E;  3HUL A;  2BA1 D;  1ZM4 A;  1B62 A;  2HHH E;  2IOQ A;  4JI2 I;  3P76 A;  5GMD A;  2DEI A;  4JI7 E;  2JEA B;  1Z0B A;  3GON A;  5JEA A;  2E5L I;  4HAC A;  2UXC I;  3M85 G;  4OX9 I;  1I94 E;  1XMQ I;  4LF4 I;  1Y6Z A;  2NN6 F;  3V5R A;  1YH8 A;  4DV1 E;  2PO1 A;  1HNW I;  4HY1 A;  3QT5 A;  1USV A;  4B3M I;  1EA6 A;  4MU1 A;  4LOM A;  2PO0 B;  4LPF A;  1R6M A;  3CDI A;  4LFC I;  4DUZ I;  2UUA E;  1R6L A;  3Q1Q A;  1RR9 A;  3T1H I;  4OO1 D;  1FJG I;  5IT9 Q;  3OTO E;  4J3D A;  5C0X C;  2CZ9 A;  5LMU E;  5K36 B;  5DRP A;  2WP8 A;  3J81 C;  4NXM E;  4JI3 E;  2WNR B;  2PO2 A;  4R1F A;  2C39 A;  2V8P A;  4MYT A;  4U3B A;  1K47 A;  4LF5 I;  1H7S A;  4IFD D;  1UEK A;  4MU3 A;  4B3T E;  4JYA E;  1IBL E;  1P42 A;  4GQU A;  4DR4 E;  5GME A;  1Z5C A;  1N36 I;  4P7A A;  4IZJ B;  1USU A;  4KQV A;  1UDO A;  4LCH A;  2F4V E;  3GCM A;  3U1K A;  2UUB I;  1ZM9 A;  4YY3 I;  4X66 E;  5EKW A;  3ZKD A;  4DR6 E;  3P3C A;  4DR3 E;  2JE6 A;  2F1D A;  1J5E I;  1WUU A;  4DV3 I;  3QT8 A;  4MU0 A;  4DR1 E;  4YHH E;  1OYP A;  4DV6 E;  2E1R A;  3L7Z A;  4MYU A;  4OO1 E;  2DEJ A;  4IS9 A;  2O1T A;  4DV2 I;  2LJP A;  4LCF A;  1Z5B A;  4LFA E;  2UUC I;  1UDS A;  4JV5 E;  2BR2 A;  4JI6 E;  1E3H A;  5JEA D;  1N33 E;  2VQE E;  1ZM3 A;  4EMD A;  2GS8 A;  3J7A M;  1IBM I;  4FW3 A;  3QT6 A;  4X65 I;  1N34 E;  4IFD E;  3WU6 A;  3K1J A;  5C0X F;  4FW7 A;  4Z7Y A;  2GQ0 A;  4B3S E;  2A2C A;  3P06 A;  1VIS A;  2JEB A;  4LF6 E;  4IZK B;  4DV7 I;  4JI8 I;  1HNX I;  2VQF E;  3ZZT A;  3B8H A;  1KKH A;  3PYF A;  4FWH A;  5BR8 I;  4GKK E;  5K36 C;  1XNR E;  4DV5 I;  4GKJ E;  4WUD A;  3M6A A;  2V2Z A;  3WU5 A;  2NN6 A;  2HKJ A;  1IBK E;  2O3Z A;  4JI0 I;  2AJ4 A;  3M85 D;  1YHC A;  4KHP E;  5JEA E;  4LF9 I;  2UU9 E;  5DRR A;  2HKE A;  4QNK A;  4U3D A;  2Z5B A;  1S16 A;  1NHJ A;  1Y60 A;  2PNZ B;  4LF7 I;  1E3P A;  3B78 A;  4URL A;  1OYS A;  2O1U A;  4WUB A;  1RRE A;  2CVE A;  4LF8 I;  4OO1 B;  4JI5 I;  4WUC A;  1Z0G A;  4DV0 E;  3Q6N A;  2J65 A;  4DV4 E;  4AM3 A;  5IWA E;  4AQY I;  1HNZ I;  1FKA E;  4B3R I;  5DRQ A;  1D6T A;  3B82 A;  1XMO E;  4IFD B;  2BA0 D;  4LCG A;  5L3J A;  4BA2 B;  3P3E A;  1N32 E;  4IZJ A;  3T1Y I;  3WU3 A;  4JI4 I;  4FWG A;  2PNL A;  1H74 A;  4K0K I;  1Y4S A;  5FWK A;  1VI7 A;  2HFU A;  2C38 A;  2ZM6 I;  4NXN E;  5K36 F;  3B4T A;  5IT9 C;  1PIE A;  4JI1 E;  1ZXN A;  4I3H A;  4DUY E;  2BM1 A;  2EFG A;  2NPF A;  4DR5 I;  5DNL A;  4X64 E;  2BA0 G;  3LTO A;  3PYD A;  1OJ4 A;  3CDJ A;  2GO3 A;  1XNQ I;  4DR2 I;  1RHY A;  4PRV A;  1Z59 A;  2BV3 A;  5LMN I;  2V2Q A;  2UXB E;  2Z5C A;  5JEA B;  2UXD E;  1HR0 E;  4HAC B;  2C37 A;  4FW9 A;  4RPF A;  1NHH A;  4UTG A;  4DR7 E;  2NN6 D;  4LFB I;  3UHM A;  5C0X A;  4FN5 A;  2V34 A;  2PO1 B;  4OKG A;  1PVG A;  4FW4 A;  3M7N G;  4MU4 A;  4X62 I;  2ZIT A;  4NBQ A;  4FWD A;  4JG4 A;  4JI2 E;  3PRY A;  2HHH I;  4OO1 C;  4M1K A;  3HKM A;  4JI7 I;  2CGE A;  2E5L E;  2UXC E;  4DPX A;  4OX9 E;  4AID A;  3PS1 A;  1XMQ E;  4DV0 I;  1Y5Y A;  1MU5 A;  1I94 I;  4OZE A;  4BA1 A;  4LF4 E;  4AIM A;  2WP8 B;  3ZKB A;  4ISA A;  1HNW E;  4IFD C;  4DV1 I;  2JT2 A;  2PO2 B;  2C39 B;  2IER A;  4B3M E;  3H1C A;  2Q2E B;  4LFC E;  3NZK A;  4DUZ E;  3PS3 A;  5ELW A;  1ELO A;  2UUA I;  1FWK A;  2NN6 E;  2JEA A;  3D4J A;  3T1H E;  1FJG E;  2R42 A;  1DAR A;  4MDT A;  4FW5 A;  2Z5E A;  3OTO I;  2IES A;  5LMU I;  3V2U C;  4XTJ A;  1Z0E A;  3K17 A;  5DNX A;  3DD6 A;  2JE6 B;  3ZZU A;  1Z0C A;  4HXZ A;  1XXE A;  4NXM I;  4JI3 I;  4LF5 E;  4N3O A;  1HK7 A;  3ZZ0 A;  3L7Z B;  3PS2 A;  2O1V A;  2PO0 A;  4B3T I;  4JYA I;  1Z0T A;  1N36 E;  1IBL I;  5EL9 A;  5JEA C;  4DR4 I;  2BR2 B;  1KVK A;  1Z5A A;  2BM0 A;  1MG7 A;  3LNU A;  2UUB E;  2UXD I;  5A2Q Q;  4YY3 E;  2F4V I;  4OO1 F;  1EI1 A;  3CWV A;  5K36 A;  2HK3 A;  5A2Q C;  1Z0W A;  4X66 I;  5C0X D;  1KTV A;  1S4E A;  1XHK A;  4DV3 E;  4DR6 I;  4DR3 I;  2O1W A;  2WNR A;  2AE8 A;  3F0N A;  2X7I A;  2R3V A;  3PYG A;  4DR1 I;  4YHH I;  4FW6 A;  4DV6 I;  4HYM A;  2JEB B;  3KRN A;  2OI2 A;  4IFD F;  3P3G A;  4DV2 E;  2UUC E;  1FNM A;  3WU4 A;  3GLL A;  4LFA I;  4JV5 I;  1H73 A;  3K85 A;  4JI6 I;  1N33 I;  1IBM E;  2VQE I;  3PYE A;  4ZVI A;  4X65 E;  2CG9 A;  1N34 I;  2X36 A;  5DRO A;  2NN6 B;  1QZR A;  2BA1 G;  2HK2 A;  3Q6M A;  1FWL A;  4USK A;  4B3S I;  1UDQ A;  5LL6 R;  4DV7 E;  4JI8 E;  1HNX E;  4LF6 I;  2Z5B B;  5BR8 E;  2VQF I;  4DU7 A;  5C0X E;  1KIJ A;  2WW4 A;  3M7N D;  4GKK I;  3H4L A;  4DV5 E;  1MX0 A;  5JEA F;  1ZM2 A;  1XNR I;  3J81 Q;  1B63 A;  4GKJ I;  1ZXM A;  4DPT A;  4DPY A;  1FI4 A;  4JI0 E;  4PRX A;  1IBK I;  4LF9 E;  4KHP I;  3GME A;  4IZK A;  2UU9 I;  2XEX A;  4LF7 E;  2GO4 A;  1N0U A;  4P52 A;  1BKN A;  4UT4 A;  2VES A;  1OYR A;  1U2R A;  3JAM Q;  4LF8 E;  4JI5 E;  5K36 D;  3JAM C;  1NHI A;  2C38 B;  2V2V A;  2ZBK B;  1UDN A;  1H7U A;  4AQY E;  1NZ0 A;  1HNZ E;  4DV4 I;  4B3R E;  5IWA I;  3J80 Q;  2J7K A;  2PNM A;  3J80 C;  4MQY A;  1XMO I;  3LPS A;  4QNJ A;  4ED4 A;  2PNZ A;  4IZJ D;  5FLX Q;  3T1Y E;  4JI4 E;  3QT7 A;  1N32 I;  5FLX C;  2A2D A;  4K0K E;  2Z5C B;  4OO1 A;  2ZM6 E;  2NN6 C;  2HFS A;  2C37 B;  4DXL A;  4NXN I;  4DPU A;  4DR5 E;  3ZM7 A;  4JI1 I;  5C0X B;  2IOP A;  4DUY I;  4X64 I;  1A6F A;  1N0V C;  3U1Y A;  4DR2 E;  1XNQ E;  4PU9 A;  4IFD A;  5LMN E; 
#chains in the Genus database with same CATH homology
 4DPW A;  1H72 C;  3J7A G;  3HJC A;  4Z7C A;  2VF3 A;  1PKP A;  2UXB I;  1Y4U A;  1HR0 I;  4USM A;  4LFB E;  4DU8 A;  4DR7 I;  1J5E E;  1Z0V A;  4X62 E;  3HUL A;  1ZM4 A;  1B62 A;  2HHH E;  2IOQ A;  4JI2 I;  5GMD A;  2DEI A;  4JI7 E;  1Z0B A;  3GON A;  2E5L I;  4HAC A;  2UXC I;  4OX9 I;  1I94 E;  1XMQ I;  4LF4 I;  1Y6Z A;  3V5R A;  4DV1 E;  1HNW I;  4HY1 A;  3QT5 A;  1USV A;  4B3M I;  1EA6 A;  4LFC I;  4DUZ I;  2UUA E;  3Q1Q A;  1RR9 A;  3T1H I;  1FJG I;  5IT9 Q;  3OTO E;  2CZ9 A;  5LMU E;  3J81 C;  4NXM E;  4JI3 E;  4R1F A;  2V8P A;  4MYT A;  1K47 A;  4LF5 I;  1H7S A;  1UEK A;  4B3T E;  4JYA E;  1IBL E;  4DR4 E;  5GME A;  1Z5C A;  1N36 I;  4P7A A;  4IZJ B;  1USU A;  4KQV A;  2F4V E;  2UUB I;  1ZM9 A;  4YY3 I;  4X66 E;  3ZKD A;  4DR6 E;  4DR3 E;  1J5E I;  1WUU A;  4DV3 I;  3QT8 A;  4DR1 E;  4YHH E;  4DV6 E;  2E1R A;  4MYU A;  2DEJ A;  2O1T A;  4DV2 I;  2LJP A;  4LFA E;  1Z5B A;  2UUC I;  4JV5 E;  4JI6 E;  1N33 E;  2VQE E;  1ZM3 A;  4EMD A;  2GS8 A;  3J7A M;  1IBM I;  3QT6 A;  4X65 I;  1N34 E;  3WU6 A;  3K1J A;  4Z7Y A;  2GQ0 A;  4B3S E;  2A2C A;  3P06 A;  1VIS A;  4LF6 E;  4IZK B;  4DV7 I;  4JI8 I;  1HNX I;  2VQF E;  3ZZT A;  3B8H A;  1KKH A;  3PYF A;  4FWH A;  5BR8 I;  4GKK E;  1XNR E;  4DV5 I;  4GKJ E;  4WUD A;  3M6A A;  2V2Z A;  3WU5 A;  2HKJ A;  1IBK E;  4JI0 I;  2AJ4 A;  4KHP E;  4LF9 I;  2UU9 E;  2HKE A;  2Z5B A;  1S16 A;  1NHJ A;  4LF7 I;  3B78 A;  4URL A;  2O1U A;  4WUB A;  1RRE A;  4LF8 I;  4JI5 I;  4WUC A;  1Z0G A;  4DV0 E;  3Q6N A;  4DV4 E;  5IWA E;  4AQY I;  1HNZ I;  1FKA E;  4B3R I;  1D6T A;  3B82 A;  1XMO E;  5L3J A;  1N32 E;  4IZJ A;  3T1Y I;  3WU3 A;  4JI4 I;  4FWG A;  2PNL A;  1H74 A;  4K0K I;  1Y4S A;  5FWK A;  2HFU A;  2ZM6 I;  4NXN E;  5IT9 C;  1PIE A;  4JI1 E;  1ZXN A;  4I3H A;  4DUY E;  2BM1 A;  2EFG A;  2NPF A;  4DR5 I;  4X64 E;  3LTO A;  3PYD A;  1OJ4 A;  1XNQ I;  4DR2 I;  4PRV A;  1Z59 A;  2BV3 A;  5LMN I;  2V2Q A;  2UXB E;  2Z5C A;  2UXD E;  1HR0 E;  4HAC B;  4FW9 A;  4RPF A;  1NHH A;  4UTG A;  4DR7 E;  4LFB I;  4FN5 A;  2V34 A;  1PVG A;  4X62 I;  2ZIT A;  4FWD A;  4JG4 A;  4JI2 E;  3PRY A;  2HHH I;  4M1K A;  4JI7 I;  2CGE A;  2E5L E;  2UXC E;  4DPX A;  4OX9 E;  1XMQ E;  4DV0 I;  1MU5 A;  1I94 I;  4LF4 E;  3ZKB A;  1HNW E;  4DV1 I;  4B3M E;  2Q2E B;  4LFC E;  4DUZ E;  1ELO A;  2UUA I;  1FWK A;  3D4J A;  3T1H E;  1FJG E;  2R42 A;  1DAR A;  2Z5E A;  3OTO I;  5LMU I;  3V2U C;  4XTJ A;  1Z0E A;  3K17 A;  3ZZU A;  1Z0C A;  4HXZ A;  4NXM I;  4JI3 I;  4LF5 E;  4N3O A;  1HK7 A;  3ZZ0 A;  2O1V A;  4B3T I;  4JYA I;  1Z0T A;  1N36 E;  1IBL I;  4DR4 I;  1KVK A;  1Z5A A;  2BM0 A;  1MG7 A;  3LNU A;  2UUB E;  2UXD I;  5A2Q Q;  4YY3 E;  2F4V I;  1EI1 A;  3CWV A;  2HK3 A;  5A2Q C;  1Z0W A;  4X66 I;  1KTV A;  1S4E A;  4DV3 E;  1XHK A;  4DR6 I;  4DR3 I;  2O1W A;  3F0N A;  2X7I A;  2R3V A;  3PYG A;  4DR1 I;  4YHH I;  4DV6 I;  4HYM A;  2OI2 A;  4DV2 E;  2UUC E;  1FNM A;  3WU4 A;  4LFA I;  4JV5 I;  1H73 A;  3K85 A;  4JI6 I;  1N33 I;  1IBM E;  2VQE I;  3PYE A;  4ZVI A;  4X65 E;  2CG9 A;  1N34 I;  2X36 A;  1QZR A;  2HK2 A;  3Q6M A;  1FWL A;  4USK A;  4B3S I;  5LL6 R;  4DV7 E;  4JI8 E;  1HNX E;  4LF6 I;  2Z5B B;  5BR8 E;  2VQF I;  4DU7 A;  1KIJ A;  2WW4 A;  4GKK I;  3H4L A;  4DV5 E;  1MX0 A;  1ZM2 A;  1XNR I;  3J81 Q;  1B63 A;  4GKJ I;  1ZXM A;  4DPT A;  4DPY A;  1FI4 A;  4JI0 E;  4PRX A;  1IBK I;  4LF9 E;  4KHP I;  4IZK A;  2UU9 I;  2XEX A;  4LF7 E;  1N0U A;  4P52 A;  1BKN A;  4UT4 A;  1U2R A;  3JAM Q;  4LF8 E;  4JI5 E;  3JAM C;  1NHI A;  2V2V A;  2ZBK B;  1H7U A;  4AQY E;  1NZ0 A;  1HNZ E;  4DV4 I;  4B3R E;  5IWA I;  3J80 Q;  2J7K A;  2PNM A;  3J80 C;  1XMO I;  3LPS A;  4ED4 A;  4IZJ D;  5FLX Q;  3T1Y E;  4JI4 E;  3QT7 A;  1N32 I;  5FLX C;  2A2D A;  4K0K E;  2Z5C B;  2ZM6 E;  2HFS A;  4DXL A;  4NXN I;  4DPU A;  4DR5 E;  3ZM7 A;  4JI1 I;  4DUY I;  2IOP A;  4X64 I;  1A6F A;  1N0V C;  1XNQ E;  4DR2 E;  4PU9 A;  5LMN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...