4LFBI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbI00
1ZM2A 2R42A 4WUCA 2UXCI 3LTOA 1PVGA 4DR1E 2BM0A 1J5EE 4MYUA 1B63A 1QZRA 3J7AG 5GMDA 1OJ4A 2HKJA 5IWAI 4Z7YA 3QT5A 1N0VC 4X62I 1ZXMA 4B3TE 1IBKI 4RPFA 2UXBE 1ELOA 3D4JA 1Z0BA 3PYFA 4DR1I 1J5EI 4FWDA 2AJ4A 3HULA 3QT8A 4B3MI 1Z0VA 1H72C 2VQEE 4DU8A 2DEJA 4B3TI 1NHHA 1B62A 1Z0WA 2HK3A 2ZBKB 4LF8I 4UTGA 1IBLE 4XTJA 3B78A 3ZZTA 4YY3I 4DR6E 3PYDA 3WU5A 2UUAE 1XMOE 3ZKDA 4X65E 2NPFA 4PRXA 5LMUI 5FLXQ 3WU3A 4DXLA 1BKNA 2F4VI 1Z0EA 4USMA 4JI7I 1DARA 4LF5I 1XNQE 4DPWA 4LF4I 3PYEA 4DR3E 1IBLI 4JI1E 2UUAI 2UUBE 4DV7E 1FI4A 4URLA 4DV3E 3QT6A 4WUBA 4FW9A 5FLXC 4X66E 5IT9Q 4B3SE 1KVKA 1EA6A 5BR8E 4R1FA 2VQFI 2HKEA 4NXME 3T1HE 4HYMA 4AQYE 1XNQI 3B8HA 1UEKA 4DR2I 1U2RA 4LF9I 2HHHI 4DUZE 1HNXE 3V2UC 2V34A 4JV5E 4YHHI 1FJGE 1N33I 4DV7I 4ZVIA 1KKHA 1NZ0A 4FWGA 1FKAE 1N32E 4M1KA 4DV2E 4OX9I 4PRVA 4DV4I 1HNWE 1NHIA 1H74A 4NXMI 1WUUA 4LFCE 1N0UA 1PIEA 1MU5A 4HXZA 2LJPA 4Z7CA 1N36E 4K0KE 5LMNI 3F0NA 4DPUA 4LFAE 1FJGI 2E5LE 1VISA 1HNZE 4P7AA 1KIJA 1N32I 4LF6E 5L3JA 2E1RA 4DR7E 2UU9I 2V2VA 5A2QQ 4JI8I 2V2ZA 2X7IA 4LFBE 1H7UA 1I94E 1XMQE 1N36I 1RR9A 2DEIA 4GKJE 2VF3A 2J7KA 2R3VA 1HNZI 3WU4A 4GKKE 4LF7E 4B3RE 4USKA 4DR7I 4FWHA 4HY1A 4WUDA 3ZM7A 4JI6E 1S4EA 2UXBI 4JYAE 1I94I 4JI3E 3J81Q 4DR4E 4KHPE 2UXDE 2ZM6E 3J80Q 1ZM3A 2BM1A 4LF7I 2WW4A 4JI4E 2VQEI 2A2DA 3OTOE 1KTVA 4JYAI 4JI3I 4DR6I 4UT4A 1XMOI 4DR4I 5LL6R 2UXDI 4X65I 2HK2A 3J80C 1MG7A 3J7AM 2Q2EB 4JI4I 4ED4A 1IBME 4DUYE 4DR3I 5GMEA 4JI1I 2UUBI 4HACB 4DV5E 4DV0E 2V8PA 4DV3I 3T1YE 2BV3A 4X66I 5IT9C 4B3SI 1A6FA 1Z5BA 5BR8I 3T1HI 2UXCE 4AQYI 1IBMI 1N34E 4DUYI 4DUZI 1HNXI 3V5RA 4JV5I 4JI0E 4PU9A 1Z5AA 4DV5I 2ZITA 5IWAE 4DV2I 3T1YI 1FWLA 1HR0E 4X62E 1IBKE 4JI5E 1D6TA 1HNWI 1H73A 4MYTA 4LFCI 4FN5A 4K0KI 4P52A 1N34I 4DU7A 4EMDA 4LFAI 4JI0I 2E5LI 1ZXNA 4B3ME 2HFUA 4LF6I 3LNUA 2GS8A 1HR0I 4NXNE 2EFGA 2OI2A 1Z0CA 4JI5I 5A2QC 1S16A 2UUCE 1H7SA 4LF8E 4LFBI 1XHKA 4YY3E 3ZKBA 3ZZ0A 1XMQI 4DPTA 1NHJA 4GKJI 1EI1A 1K47A 5LMUE 1ZM4A 3JAMQ 3PYGA 4GKKI 2F4VE 2CZ9A 3M6AA 4HACA 4B3RI 4JI7E 3K1JA 4NXNI 4LF5E 4DR5E 2UUCI 1Z5CA 4LF4E 4JI6I 4X64E 3J81C 4DPXA 4DV6E 4KHPI 2ZM6I 4JG4A 3LPSA 3JAMC 4DV1E 1Z0GA 4DPYA 2A2CA 2VQFE 1Z59A 4DR5I 4DR2E 4LF9E 2HHHE 2V2QA 3WU6A 3OTOI 1RREA 3QT7A 4YHHE 1N33E 4X64I 1XNRE 1MX0A 3K17A 4DV6I 4KQVA 4I3HA 3CWVA 3ZZUA 4OX9E 3H4LA 1Z0TA 1FNMA 4DV1I 4DV4E 3Q1QA 4JI2E 2XEXA 5LMNE 1XNRI 1ZM9A 1PKPA 1FWKA 3GONA 4DV0I 2UU9E 2X36A 3B82A 2HFSA 4JI8E 4JI2I
chains in the Genus database with same CATH superfamily
1E3PA 1ZM2A 5C0XF 2R42A 4WUCA 2UXCI 4MU1A 3LTOA 5C0XA 1PVGA 4IFDE 4DR1E 2O3ZA 2BM0A 1J5EE 2BA1G 4MYUA 1B63A 2JE6B 1QZRA 2NN6F 3J7AG 5GMDA 1OJ4A 2VESA 2NN6A 2HKJA 2PO2B 5IWAI 4Z7YA 3QT5A 1N0VC 4X62I 1ZXMA 3UHMA 4B3TE 1IBKI 4IZKA 4RPFA 3M85D 2UXBE 1ELOA 1VI7A 3D4JA 2PO1A 4MU3A 1Z0BA 3PYFA 3NZKA 4DR1I 1J5EI 1E3HA 4FWDA 5JEAC 2Z5CB 4OO1D 2BR2B 2AJ4A 3HULA 3QT8A 4B3MI 1Z0VA 1H72C 1YHCA 3L7ZB 2Z5BA 2VQEE 4DU8A 2DEJA 2JEBA 4B3TI 4QNKA 1NHHA 1B62A 1Z0WA 2HK3A 2ZBKB 4OO1F 5C0XB 4LF8I 4UTGA 1IBLE 4XTJA 3B78A 3ZZTA 4YY3I 4DR6E 4OO1A 3PYDA 3WU5A 2UUAE 1XMOE 4IZJD 3ZKDA 4BA2A 4X65E 2NPFA 2NN6B 1UDQA 4PRXA 5LMUI 5FLXQ 2GO3A 3WU3A 4DXLA 1BKNA 2F4VI 1Z0EA 3CDJA 4USMA 4JI7I 1DARA 1OYSA 4LF5I 2PO1B 4LCHA 1XNQE 1USUA 3GCMA 4IZJA 4DPWA 4LF4I 1YH8A 3PYEA 4DR3E 1IBLI 5DNLA 4JI1E 4FW5A 2UUAI 3K85A 2UUBE 4DV7E 4LCFA 1FI4A 4URLA 4DV3E 3QT6A 4WUBA 4ISAA 2O1WA 4FW9A 2JEAA 5FLXC 2IOQA 4X66E 5IT9Q 4B3SE 1KVKA 2JEBB 1EA6A 5BR8E 3M7NG 2F1DA 4R1FA 2VQFI 2HKEA 2CGEA 4NXME 3T1HE 4HYMA 4AQYE 1XNQI 3B8HA 1UEKA 4MQYA 4DR2I 1U2RA 4OO1B 4LF9I 5K36E 2HHHI 2IOPA 4DUZE 1HNXE 3V2UC 2V34A 2IESA 4JV5E 4YHHI 1FJGE 1N33I 4DV7I 4ZVIA 5DRQA 1KKHA 1NZ0A 1UDNA 4FWGA 5JEAD 1FKAE 1N32E 4M1KA 4DV2E 4OX9I 4PRVA 5EKWA 2IERA 2PO0A 4DV4I 1HNWE 1NHIA 1H74A 5K36C 4NXMI 1WUUA 4LFCE 1N0UA 4IZJB 1PIEA 1Y4SA 3CDIA 5JEAF 1MU5A 4GQUA 4HXZA 2LJPA 4Z7CA 1N36E 4K0KE 5JEAA 5LMNI 3F0NA 4DPUA 4LFAE 1FJGI 2E5LE 1VISA 2JEAB 1HNZE 4P7AA 1KIJA 2O1VA 1N32I 4LF6E 5L3JA 2E1RA 4DR7E 4QNJA 2UU9I 2V2VA 5A2QQ 4FW6A 4J3DA 4JI8I 2GQ0A 2V2ZA 2X7IA 4LFBE 2C39A 3B4TA 1H7UA 4IFDC 1I94E 1XMQE 1N36I 1RR9A 2DEIA 4GKJE 2VF3A 2J7KA 5DNXA 2R3VA 1HNZI 5C0XE 5DROA 3WU4A 4GKKE 4LF7E 4B3RE 3Q6MA 4N3OA 2PO0B 4USKA 2BA0D 4DR7I 4FWHA 4HY1A 2C37B 2NN6E 4WUDA 3ZM7A 4JI6E 1S4EA 2UXBI 4JYAE 5JEAB 2J65A 1I94I 4JI3E 3J81Q 1R6LA 4DR4E 4KHPE 1UDOA 2UXDE 1OYRA 2ZM6E 3J80Q 2Z5EA 1ZM3A 2BM1A 4LF7I 3HJCA 3DD6A 2AE8A 2WW4A 4JI4E 2VQEI 2C39B 3U1KA 1Y6ZA 1UDSA 2A2DA 5K36D 3OTOE 2PNMA 1KTVA 4JYAI 5ELWA 4JI3I 3M85G 4DR6I 4UT4A 1XMOI 4DR4I 5LL6R 2UXDI 3PS1A 4X65I 2CVEA 2HK2A 4OO1E 3J80C 3PRYA 1MG7A 1Y5YA 3J7AM 2Q2EB 4JI4I 4OKGA 3Q6NA 2WP8A 2BA1D 4ED4A 4IFDD 1IBME 2WNRB 4DUYE 4DR3I 1Y4UA 5GMEA 4JI1I 2UUBI 4HACB 4DV5E 4DV0E 2V8PA 4U3DA 4DV3I 4BA1A 3T1YE 2BV3A 4IFDF 4X66I 4LPFA 5IT9C 4B3SI 1A6FA 1Z5BA 5BR8I 4AIDA 3T1HI 2UXCE 4AQYI 4FW7A 3P06A 2C37A 5EL9A 1IBMI 1N34E 3PS3A 4DUYI 4DUZI 4NBQA 1HNXI 3V5RA 4AIMA 1XXEA 4JV5I 4JI0E 5C0XD 4PU9A 5DRRA 1Z5AA 4DV5I 2ZITA 5IWAE 3GLLA 4DV2I 3T1YI 1FWLA 1HR0E 4X62E 4MU4A 1IBKE 4JI5E 1RHYA 2NN6D 2WP8B 1D6TA 1OYPA 3U1YA 1HNWI 1H73A 4MYTA 4LFCI 1R6MA 4FN5A 5DRPA 3P3GA 4K0KI 4P52A 1N34I 3KRNA 2O1TA 4DU7A 4EMDA 4LFAI 4JI0I 2E5LI 5FWKA 2O1UA 1ZXNA 4LOMA 4BA1B 4B3ME 2HFUA 5JEAE 4LF6I 3LNUA 2GS8A 1HR0I 4IFDB 4NXNE 2EFGA 2OI2A 1Z0CA 4JI5I 1P42A 5A2QC 1S16A 2UUCE 2C38A 1H7SA 4LF8E 4LFBI 3P3EA 1XHKA 1Y60A 4YY3E 3ZKBA 3ZZ0A 1XMQI 4DPTA 5C0XC 1NHJA 2WNRA 4GKJI 1EI1A 1K47A 3M7ND 5LMUE 1ZM4A 3JAMQ 4FW4A 3PYGA 4GKKI 2F4VE 2CZ9A 3M6AA 4HACA 4B3RI 4JI7E 3K1JA 4NXNI 2NN6C 4LF5E 2CG9A 4DR5E 2UUCI 1Z5CA 3GMEA 4LF4E 3HKMA 4JI6I 4U3BA 4X64E 4IS9A 3J81C 4DPXA 4DV6E 4AM3A 4KHPI 2ZM6I 5K36F 3P3CA 4JG4A 4FW3A 3LPSA 4MU0A 3JAMC 4DV1E 2PNZA 5K36A 1Z0GA 4IZKB 2A2CA 4DPYA 2VQFE 2C38B 1Z59A 4DR5I 4DR2E 2BA0G 4LF9E 1USVA 2V2QA 2HHHE 3WU6A 3OTOI 1RREA 3QT7A 4YHHE 1N33E 4X64I 1XNRE 1MX0A 4OO1C 3K17A 4DV6I 4KQVA 2Z5BB 3CWVA 2JE6A 3H1CA 4I3HA 3ZZUA 4OX9E 3H4LA 4OZEA 1Z0TA 1FNMA 4MDTA 3PS2A 4DV1I 4LCGA 4DV4E 3Q1QA 4JI2E 2PO2A 4IFDA 2XEXA 3P76A 5LMNE 4BA2B 1XNRI 2GO4A 1ZM9A 1PKPA 1FWKA 3GONA 2PNZB 2Z5CA 2JT2A 4DV0I 5K36B 2UU9E 2BR2A 2X36A 2PNLA 2HFSA 3B82A 4JI8E 3L7ZA 4JI2I 1HK7A
chains in the Genus database with same CATH topology
1ZM2A 2R42A 4WUCA 2UXCI 3LTOA 1PVGA 4DR1E 2BM0A 1J5EE 4MYUA 1B63A 1QZRA 3J7AG 5GMDA 1OJ4A 2HKJA 5IWAI 4Z7YA 3QT5A 1N0VC 4X62I 1ZXMA 4B3TE 1IBKI 4IZKA 4RPFA 2UXBE 1ELOA 3D4JA 1Z0BA 3PYFA 4DR1I 1J5EI 4FWDA 2Z5CB 2AJ4A 3HULA 3QT8A 4B3MI 1Z0VA 1H72C 2Z5BA 2VQEE 4DU8A 2DEJA 4B3TI 1NHHA 1B62A 1Z0WA 2HK3A 2ZBKB 4LF8I 4UTGA 1IBLE 4XTJA 3B78A 3ZZTA 4YY3I 4DR6E 3PYDA 3WU5A 2UUAE 1XMOE 4IZJD 3ZKDA 4X65E 2NPFA 4PRXA 5LMUI 5FLXQ 3WU3A 4DXLA 1BKNA 2F4VI 1Z0EA 4USMA 4JI7I 1DARA 4LF5I 1XNQE 1USUA 4IZJA 4DPWA 4LF4I 3PYEA 4DR3E 1IBLI 4JI1E 2UUAI 3K85A 2UUBE 4DV7E 1FI4A 4URLA 4DV3E 3QT6A 4WUBA 2O1WA 4FW9A 5FLXC 2IOQA 4X66E 5IT9Q 4B3SE 1KVKA 1EA6A 5BR8E 4R1FA 2VQFI 2HKEA 2CGEA 4NXME 3T1HE 4HYMA 4AQYE 1XNQI 3B8HA 1UEKA 4DR2I 1U2RA 4LF9I 2HHHI 2IOPA 4DUZE 1HNXE 3V2UC 2V34A 4JV5E 4YHHI 1FJGE 1N33I 4DV7I 4ZVIA 1KKHA 1NZ0A 4FWGA 1FKAE 1N32E 4M1KA 4DV2E 4OX9I 4PRVA 4DV4I 1HNWE 1NHIA 1H74A 4NXMI 1WUUA 4LFCE 1N0UA 4IZJB 1PIEA 1Y4SA 1MU5A 4HXZA 2LJPA 4Z7CA 1N36E 4K0KE 5LMNI 3F0NA 4DPUA 4LFAE 1FJGI 2E5LE 1VISA 1HNZE 4P7AA 1KIJA 2O1VA 1N32I 4LF6E 5L3JA 2E1RA 4DR7E 2UU9I 2V2VA 5A2QQ 4JI8I 2GQ0A 2V2ZA 2X7IA 4LFBE 1H7UA 1I94E 1XMQE 1N36I 1RR9A 2DEIA 4GKJE 2VF3A 2J7KA 2R3VA 1HNZI 3WU4A 4GKKE 4LF7E 4B3RE 3Q6MA 4N3OA 4USKA 4DR7I 4FWHA 4HY1A 4WUDA 3ZM7A 4JI6E 1S4EA 2UXBI 4JYAE 1I94I 4JI3E 3J81Q 4DR4E 4KHPE 2UXDE 2ZM6E 3J80Q 2Z5EA 1ZM3A 2BM1A 4LF7I 3HJCA 2WW4A 4JI4E 2VQEI 1Y6ZA 2A2DA 3OTOE 2PNMA 1KTVA 4JYAI 4JI3I 4DR6I 4UT4A 1XMOI 4DR4I 5LL6R 2UXDI 4X65I 2HK2A 3J80C 3PRYA 1MG7A 3J7AM 2Q2EB 4JI4I 3Q6NA 4ED4A 1IBME 4DUYE 4DR3I 1Y4UA 5GMEA 4JI1I 2UUBI 4HACB 4DV5E 4DV0E 2V8PA 4DV3I 3T1YE 2BV3A 4X66I 5IT9C 4B3SI 1A6FA 1Z5BA 5BR8I 3T1HI 2UXCE 4AQYI 3P06A 1IBMI 1N34E 4DUYI 4DUZI 1HNXI 3V5RA 4JV5I 4JI0E 4PU9A 1Z5AA 4DV5I 2ZITA 5IWAE 4DV2I 3T1YI 1FWLA 1HR0E 4X62E 1IBKE 4JI5E 1D6TA 1HNWI 1H73A 4MYTA 4LFCI 4FN5A 4K0KI 4P52A 1N34I 2O1TA 4DU7A 4EMDA 4LFAI 4JI0I 2E5LI 5FWKA 2O1UA 1ZXNA 4B3ME 2HFUA 4LF6I 3LNUA 2GS8A 1HR0I 4NXNE 2EFGA 2OI2A 1Z0CA 4JI5I 5A2QC 1S16A 2UUCE 1H7SA 4LF8E 4LFBI 1XHKA 4YY3E 3ZKBA 3ZZ0A 1XMQI 4DPTA 1NHJA 4GKJI 1EI1A 1K47A 5LMUE 1ZM4A 3JAMQ 3PYGA 4GKKI 2F4VE 2CZ9A 3M6AA 4HACA 4B3RI 4JI7E 3K1JA 4NXNI 4LF5E 2CG9A 4DR5E 2UUCI 1Z5CA 4LF4E 4JI6I 4X64E 3J81C 4DPXA 4DV6E 4KHPI 2ZM6I 4JG4A 3LPSA 3JAMC 4DV1E 1Z0GA 4IZKB 2A2CA 4DPYA 2VQFE 1Z59A 4DR5I 4DR2E 4LF9E 1USVA 2V2QA 2HHHE 3WU6A 3OTOI 1RREA 3QT7A 4YHHE 1N33E 4X64I 1XNRE 1MX0A 3K17A 4DV6I 4KQVA 2Z5BB 3CWVA 4I3HA 3ZZUA 4OX9E 3H4LA 1Z0TA 1FNMA 4DV1I 4DV4E 3Q1QA 4JI2E 2XEXA 5LMNE 1XNRI 1ZM9A 1PKPA 1FWKA 3GONA 2Z5CA 4DV0I 2UU9E 2X36A 2PNLA 2HFSA 3B82A 4JI8E 4JI2I 1HK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM2 A;  2R42 A;  4WUC A;  2UXC I;  3LTO A;  1PVG A;  4DR1 E;  2BM0 A;  1J5E E;  4MYU A;  1B63 A;  1QZR A;  3J7A G;  5GMD A;  1OJ4 A;  2HKJ A;  5IWA I;  4Z7Y A;  3QT5 A;  1N0V C;  4X62 I;  1ZXM A;  4B3T E;  1IBK I;  4RPF A;  2UXB E;  1ELO A;  3D4J A;  1Z0B A;  3PYF A;  4DR1 I;  1J5E I;  4FWD A;  2AJ4 A;  3HUL A;  3QT8 A;  4B3M I;  1Z0V A;  1H72 C;  2VQE E;  4DU8 A;  2DEJ A;  4B3T I;  1NHH A;  1B62 A;  1Z0W A;  2HK3 A;  2ZBK B;  4LF8 I;  4UTG A;  1IBL E;  4XTJ A;  3B78 A;  3ZZT A;  4YY3 I;  4DR6 E;  3PYD A;  3WU5 A;  2UUA E;  1XMO E;  3ZKD A;  4X65 E;  2NPF A;  4PRX A;  5LMU I;  5FLX Q;  3WU3 A;  4DXL A;  1BKN A;  2F4V I;  1Z0E A;  4USM A;  4JI7 I;  1DAR A;  4LF5 I;  1XNQ E;  4DPW A;  4LF4 I;  3PYE A;  4DR3 E;  1IBL I;  4JI1 E;  2UUA I;  2UUB E;  4DV7 E;  1FI4 A;  4URL A;  4DV3 E;  3QT6 A;  4WUB A;  4FW9 A;  5FLX C;  4X66 E;  5IT9 Q;  4B3S E;  1KVK A;  1EA6 A;  5BR8 E;  4R1F A;  2VQF I;  2HKE A;  4NXM E;  3T1H E;  4HYM A;  4AQY E;  1XNQ I;  3B8H A;  1UEK A;  4DR2 I;  1U2R A;  4LF9 I;  2HHH I;  4DUZ E;  1HNX E;  3V2U C;  2V34 A;  4JV5 E;  4YHH I;  1FJG E;  1N33 I;  4DV7 I;  4ZVI A;  1KKH A;  1NZ0 A;  4FWG A;  1FKA E;  1N32 E;  4M1K A;  4DV2 E;  4OX9 I;  4PRV A;  4DV4 I;  1HNW E;  1NHI A;  1H74 A;  4NXM I;  1WUU A;  4LFC E;  1N0U A;  1PIE A;  1MU5 A;  4HXZ A;  2LJP A;  4Z7C A;  1N36 E;  4K0K E;  5LMN I;  3F0N A;  4DPU A;  4LFA E;  1FJG I;  2E5L E;  1VIS A;  1HNZ E;  4P7A A;  1KIJ A;  1N32 I;  4LF6 E;  5L3J A;  2E1R A;  4DR7 E;  2UU9 I;  2V2V A;  5A2Q Q;  4JI8 I;  2V2Z A;  2X7I A;  4LFB E;  1H7U A;  1I94 E;  1XMQ E;  1N36 I;  1RR9 A;  2DEI A;  4GKJ E;  2VF3 A;  2J7K A;  2R3V A;  1HNZ I;  3WU4 A;  4GKK E;  4LF7 E;  4B3R E;  4USK A;  4DR7 I;  4FWH A;  4HY1 A;  4WUD A;  3ZM7 A;  4JI6 E;  1S4E A;  2UXB I;  4JYA E;  1I94 I;  4JI3 E;  3J81 Q;  4DR4 E;  4KHP E;  2UXD E;  2ZM6 E;  3J80 Q;  1ZM3 A;  2BM1 A;  4LF7 I;  2WW4 A;  4JI4 E;  2VQE I;  2A2D A;  3OTO E;  1KTV A;  4JYA I;  4JI3 I;  4DR6 I;  4UT4 A;  1XMO I;  4DR4 I;  5LL6 R;  2UXD I;  4X65 I;  2HK2 A;  3J80 C;  1MG7 A;  3J7A M;  2Q2E B;  4JI4 I;  4ED4 A;  1IBM E;  4DUY E;  4DR3 I;  5GME A;  4JI1 I;  2UUB I;  4HAC B;  4DV5 E;  4DV0 E;  2V8P A;  4DV3 I;  3T1Y E;  2BV3 A;  4X66 I;  5IT9 C;  4B3S I;  1A6F A;  1Z5B A;  5BR8 I;  3T1H I;  2UXC E;  4AQY I;  1IBM I;  1N34 E;  4DUY I;  4DUZ I;  1HNX I;  3V5R A;  4JV5 I;  4JI0 E;  4PU9 A;  1Z5A A;  4DV5 I;  2ZIT A;  5IWA E;  4DV2 I;  3T1Y I;  1FWL A;  1HR0 E;  4X62 E;  1IBK E;  4JI5 E;  1D6T A;  1HNW I;  1H73 A;  4MYT A;  4LFC I;  4FN5 A;  4K0K I;  4P52 A;  1N34 I;  4DU7 A;  4EMD A;  4LFA I;  4JI0 I;  2E5L I;  1ZXN A;  4B3M E;  2HFU A;  4LF6 I;  3LNU A;  2GS8 A;  1HR0 I;  4NXN E;  2EFG A;  2OI2 A;  1Z0C A;  4JI5 I;  5A2Q C;  1S16 A;  2UUC E;  1H7S A;  4LF8 E;  4LFB I;  1XHK A;  4YY3 E;  3ZKB A;  3ZZ0 A;  1XMQ I;  4DPT A;  1NHJ A;  4GKJ I;  1EI1 A;  1K47 A;  5LMU E;  1ZM4 A;  3JAM Q;  3PYG A;  4GKK I;  2F4V E;  2CZ9 A;  3M6A A;  4HAC A;  4B3R I;  4JI7 E;  3K1J A;  4NXN I;  4LF5 E;  4DR5 E;  2UUC I;  1Z5C A;  4LF4 E;  4JI6 I;  4X64 E;  3J81 C;  4DPX A;  4DV6 E;  4KHP I;  2ZM6 I;  4JG4 A;  3LPS A;  3JAM C;  4DV1 E;  1Z0G A;  4DPY A;  2A2C A;  2VQF E;  1Z59 A;  4DR5 I;  4DR2 E;  4LF9 E;  2HHH E;  2V2Q A;  3WU6 A;  3OTO I;  1RRE A;  3QT7 A;  4YHH E;  1N33 E;  4X64 I;  1XNR E;  1MX0 A;  3K17 A;  4DV6 I;  4KQV A;  4I3H A;  3CWV A;  3ZZU A;  4OX9 E;  3H4L A;  1Z0T A;  1FNM A;  4DV1 I;  4DV4 E;  3Q1Q A;  4JI2 E;  2XEX A;  5LMN E;  1XNR I;  1ZM9 A;  1PKP A;  1FWK A;  3GON A;  4DV0 I;  2UU9 E;  2X36 A;  3B82 A;  2HFS A;  4JI8 E;  4JI2 I; 
#chains in the Genus database with same CATH topology
 1E3P A;  1ZM2 A;  5C0X F;  2R42 A;  4WUC A;  2UXC I;  4MU1 A;  3LTO A;  5C0X A;  1PVG A;  4IFD E;  4DR1 E;  2O3Z A;  2BM0 A;  1J5E E;  2BA1 G;  4MYU A;  1B63 A;  2JE6 B;  1QZR A;  2NN6 F;  3J7A G;  5GMD A;  1OJ4 A;  2VES A;  2NN6 A;  2HKJ A;  2PO2 B;  5IWA I;  4Z7Y A;  3QT5 A;  1N0V C;  4X62 I;  1ZXM A;  3UHM A;  4B3T E;  1IBK I;  4IZK A;  4RPF A;  3M85 D;  2UXB E;  1ELO A;  1VI7 A;  3D4J A;  2PO1 A;  4MU3 A;  1Z0B A;  3PYF A;  3NZK A;  4DR1 I;  1J5E I;  1E3H A;  4FWD A;  5JEA C;  2Z5C B;  4OO1 D;  2BR2 B;  2AJ4 A;  3HUL A;  3QT8 A;  4B3M I;  1Z0V A;  1H72 C;  1YHC A;  3L7Z B;  2Z5B A;  2VQE E;  4DU8 A;  2DEJ A;  2JEB A;  4B3T I;  4QNK A;  1NHH A;  1B62 A;  1Z0W A;  2HK3 A;  2ZBK B;  4OO1 F;  5C0X B;  4LF8 I;  4UTG A;  1IBL E;  4XTJ A;  3B78 A;  3ZZT A;  4YY3 I;  4DR6 E;  4OO1 A;  3PYD A;  3WU5 A;  2UUA E;  1XMO E;  4IZJ D;  3ZKD A;  4BA2 A;  4X65 E;  2NPF A;  2NN6 B;  1UDQ A;  4PRX A;  5LMU I;  5FLX Q;  2GO3 A;  3WU3 A;  4DXL A;  1BKN A;  2F4V I;  1Z0E A;  3CDJ A;  4USM A;  4JI7 I;  1DAR A;  1OYS A;  4LF5 I;  2PO1 B;  4LCH A;  1XNQ E;  1USU A;  3GCM A;  4IZJ A;  4DPW A;  4LF4 I;  1YH8 A;  3PYE A;  4DR3 E;  1IBL I;  5DNL A;  4JI1 E;  4FW5 A;  2UUA I;  3K85 A;  2UUB E;  4DV7 E;  4LCF A;  1FI4 A;  4URL A;  4DV3 E;  3QT6 A;  4WUB A;  4ISA A;  2O1W A;  4FW9 A;  2JEA A;  5FLX C;  2IOQ A;  4X66 E;  5IT9 Q;  4B3S E;  1KVK A;  2JEB B;  1EA6 A;  5BR8 E;  3M7N G;  2F1D A;  4R1F A;  2VQF I;  2HKE A;  2CGE A;  4NXM E;  3T1H E;  4HYM A;  4AQY E;  1XNQ I;  3B8H A;  1UEK A;  4MQY A;  4DR2 I;  1U2R A;  4OO1 B;  4LF9 I;  5K36 E;  2HHH I;  2IOP A;  4DUZ E;  1HNX E;  3V2U C;  2V34 A;  2IES A;  4JV5 E;  4YHH I;  1FJG E;  1N33 I;  4DV7 I;  4ZVI A;  5DRQ A;  1KKH A;  1NZ0 A;  1UDN A;  4FWG A;  5JEA D;  1FKA E;  1N32 E;  4M1K A;  4DV2 E;  4OX9 I;  4PRV A;  5EKW A;  2IER A;  2PO0 A;  4DV4 I;  1HNW E;  1NHI A;  1H74 A;  5K36 C;  4NXM I;  1WUU A;  4LFC E;  1N0U A;  4IZJ B;  1PIE A;  1Y4S A;  3CDI A;  5JEA F;  1MU5 A;  4GQU A;  4HXZ A;  2LJP A;  4Z7C A;  1N36 E;  4K0K E;  5JEA A;  5LMN I;  3F0N A;  4DPU A;  4LFA E;  1FJG I;  2E5L E;  1VIS A;  2JEA B;  1HNZ E;  4P7A A;  1KIJ A;  2O1V A;  1N32 I;  4LF6 E;  5L3J A;  2E1R A;  4DR7 E;  4QNJ A;  2UU9 I;  2V2V A;  5A2Q Q;  4FW6 A;  4J3D A;  4JI8 I;  2GQ0 A;  2V2Z A;  2X7I A;  4LFB E;  2C39 A;  3B4T A;  1H7U A;  4IFD C;  1I94 E;  1XMQ E;  1N36 I;  1RR9 A;  2DEI A;  4GKJ E;  2VF3 A;  2J7K A;  5DNX A;  2R3V A;  1HNZ I;  5C0X E;  5DRO A;  3WU4 A;  4GKK E;  4LF7 E;  4B3R E;  3Q6M A;  4N3O A;  2PO0 B;  4USK A;  2BA0 D;  4DR7 I;  4FWH A;  4HY1 A;  2C37 B;  2NN6 E;  4WUD A;  3ZM7 A;  4JI6 E;  1S4E A;  2UXB I;  4JYA E;  5JEA B;  2J65 A;  1I94 I;  4JI3 E;  3J81 Q;  1R6L A;  4DR4 E;  4KHP E;  1UDO A;  2UXD E;  1OYR A;  2ZM6 E;  3J80 Q;  2Z5E A;  1ZM3 A;  2BM1 A;  4LF7 I;  3HJC A;  3DD6 A;  2AE8 A;  2WW4 A;  4JI4 E;  2VQE I;  2C39 B;  3U1K A;  1Y6Z A;  1UDS A;  2A2D A;  5K36 D;  3OTO E;  2PNM A;  1KTV A;  4JYA I;  5ELW A;  4JI3 I;  3M85 G;  4DR6 I;  4UT4 A;  1XMO I;  4DR4 I;  5LL6 R;  2UXD I;  3PS1 A;  4X65 I;  2CVE A;  2HK2 A;  4OO1 E;  3J80 C;  3PRY A;  1MG7 A;  1Y5Y A;  3J7A M;  2Q2E B;  4JI4 I;  4OKG A;  3Q6N A;  2WP8 A;  2BA1 D;  4ED4 A;  4IFD D;  1IBM E;  2WNR B;  4DUY E;  4DR3 I;  1Y4U A;  5GME A;  4JI1 I;  2UUB I;  4HAC B;  4DV5 E;  4DV0 E;  2V8P A;  4U3D A;  4DV3 I;  4BA1 A;  3T1Y E;  2BV3 A;  4IFD F;  4X66 I;  4LPF A;  5IT9 C;  4B3S I;  1A6F A;  1Z5B A;  5BR8 I;  4AID A;  3T1H I;  2UXC E;  4AQY I;  4FW7 A;  3P06 A;  2C37 A;  5EL9 A;  1IBM I;  1N34 E;  3PS3 A;  4DUY I;  4DUZ I;  4NBQ A;  1HNX I;  3V5R A;  4AIM A;  1XXE A;  4JV5 I;  4JI0 E;  5C0X D;  4PU9 A;  5DRR A;  1Z5A A;  4DV5 I;  2ZIT A;  5IWA E;  3GLL A;  4DV2 I;  3T1Y I;  1FWL A;  1HR0 E;  4X62 E;  4MU4 A;  1IBK E;  4JI5 E;  1RHY A;  2NN6 D;  2WP8 B;  1D6T A;  1OYP A;  3U1Y A;  1HNW I;  1H73 A;  4MYT A;  4LFC I;  1R6M A;  4FN5 A;  5DRP A;  3P3G A;  4K0K I;  4P52 A;  1N34 I;  3KRN A;  2O1T A;  4DU7 A;  4EMD A;  4LFA I;  4JI0 I;  2E5L I;  5FWK A;  2O1U A;  1ZXN A;  4LOM A;  4BA1 B;  4B3M E;  2HFU A;  5JEA E;  4LF6 I;  3LNU A;  2GS8 A;  1HR0 I;  4IFD B;  4NXN E;  2EFG A;  2OI2 A;  1Z0C A;  4JI5 I;  1P42 A;  5A2Q C;  1S16 A;  2UUC E;  2C38 A;  1H7S A;  4LF8 E;  4LFB I;  3P3E A;  1XHK A;  1Y60 A;  4YY3 E;  3ZKB A;  3ZZ0 A;  1XMQ I;  4DPT A;  5C0X C;  1NHJ A;  2WNR A;  4GKJ I;  1EI1 A;  1K47 A;  3M7N D;  5LMU E;  1ZM4 A;  3JAM Q;  4FW4 A;  3PYG A;  4GKK I;  2F4V E;  2CZ9 A;  3M6A A;  4HAC A;  4B3R I;  4JI7 E;  3K1J A;  4NXN I;  2NN6 C;  4LF5 E;  2CG9 A;  4DR5 E;  2UUC I;  1Z5C A;  3GME A;  4LF4 E;  3HKM A;  4JI6 I;  4U3B A;  4X64 E;  4IS9 A;  3J81 C;  4DPX A;  4DV6 E;  4AM3 A;  4KHP I;  2ZM6 I;  5K36 F;  3P3C A;  4JG4 A;  4FW3 A;  3LPS A;  4MU0 A;  3JAM C;  4DV1 E;  2PNZ A;  5K36 A;  1Z0G A;  4IZK B;  2A2C A;  4DPY A;  2VQF E;  2C38 B;  1Z59 A;  4DR5 I;  4DR2 E;  2BA0 G;  4LF9 E;  1USV A;  2V2Q A;  2HHH E;  3WU6 A;  3OTO I;  1RRE A;  3QT7 A;  4YHH E;  1N33 E;  4X64 I;  1XNR E;  1MX0 A;  4OO1 C;  3K17 A;  4DV6 I;  4KQV A;  2Z5B B;  3CWV A;  2JE6 A;  3H1C A;  4I3H A;  3ZZU A;  4OX9 E;  3H4L A;  4OZE A;  1Z0T A;  1FNM A;  4MDT A;  3PS2 A;  4DV1 I;  4LCG A;  4DV4 E;  3Q1Q A;  4JI2 E;  2PO2 A;  4IFD A;  2XEX A;  3P76 A;  5LMN E;  4BA2 B;  1XNR I;  2GO4 A;  1ZM9 A;  1PKP A;  1FWK A;  3GON A;  2PNZ B;  2Z5C A;  2JT2 A;  4DV0 I;  5K36 B;  2UU9 E;  2BR2 A;  2X36 A;  2PNL A;  2HFS A;  3B82 A;  4JI8 E;  3L7Z A;  4JI2 I;  1HK7 A; 
#chains in the Genus database with same CATH homology
 1ZM2 A;  2R42 A;  4WUC A;  2UXC I;  3LTO A;  1PVG A;  4DR1 E;  2BM0 A;  1J5E E;  4MYU A;  1B63 A;  1QZR A;  3J7A G;  5GMD A;  1OJ4 A;  2HKJ A;  5IWA I;  4Z7Y A;  3QT5 A;  1N0V C;  4X62 I;  1ZXM A;  4B3T E;  1IBK I;  4IZK A;  4RPF A;  2UXB E;  1ELO A;  3D4J A;  1Z0B A;  3PYF A;  4DR1 I;  1J5E I;  4FWD A;  2Z5C B;  2AJ4 A;  3HUL A;  3QT8 A;  4B3M I;  1Z0V A;  1H72 C;  2Z5B A;  2VQE E;  4DU8 A;  2DEJ A;  4B3T I;  1NHH A;  1B62 A;  1Z0W A;  2HK3 A;  2ZBK B;  4LF8 I;  4UTG A;  1IBL E;  4XTJ A;  3B78 A;  3ZZT A;  4YY3 I;  4DR6 E;  3PYD A;  3WU5 A;  2UUA E;  1XMO E;  4IZJ D;  3ZKD A;  4X65 E;  2NPF A;  4PRX A;  5LMU I;  5FLX Q;  3WU3 A;  4DXL A;  1BKN A;  2F4V I;  1Z0E A;  4USM A;  4JI7 I;  1DAR A;  4LF5 I;  1XNQ E;  1USU A;  4IZJ A;  4DPW A;  4LF4 I;  3PYE A;  4DR3 E;  1IBL I;  4JI1 E;  2UUA I;  3K85 A;  2UUB E;  4DV7 E;  1FI4 A;  4URL A;  4DV3 E;  3QT6 A;  4WUB A;  2O1W A;  4FW9 A;  5FLX C;  2IOQ A;  4X66 E;  5IT9 Q;  4B3S E;  1KVK A;  1EA6 A;  5BR8 E;  4R1F A;  2VQF I;  2HKE A;  2CGE A;  4NXM E;  3T1H E;  4HYM A;  4AQY E;  1XNQ I;  3B8H A;  1UEK A;  4DR2 I;  1U2R A;  4LF9 I;  2HHH I;  2IOP A;  4DUZ E;  1HNX E;  3V2U C;  2V34 A;  4JV5 E;  4YHH I;  1FJG E;  1N33 I;  4DV7 I;  4ZVI A;  1KKH A;  1NZ0 A;  4FWG A;  1FKA E;  1N32 E;  4M1K A;  4DV2 E;  4OX9 I;  4PRV A;  4DV4 I;  1HNW E;  1NHI A;  1H74 A;  4NXM I;  1WUU A;  4LFC E;  1N0U A;  4IZJ B;  1PIE A;  1Y4S A;  1MU5 A;  4HXZ A;  2LJP A;  4Z7C A;  1N36 E;  4K0K E;  5LMN I;  3F0N A;  4DPU A;  4LFA E;  1FJG I;  2E5L E;  1VIS A;  1HNZ E;  4P7A A;  1KIJ A;  2O1V A;  1N32 I;  4LF6 E;  5L3J A;  2E1R A;  4DR7 E;  2UU9 I;  2V2V A;  5A2Q Q;  4JI8 I;  2GQ0 A;  2V2Z A;  2X7I A;  4LFB E;  1H7U A;  1I94 E;  1XMQ E;  1N36 I;  1RR9 A;  2DEI A;  4GKJ E;  2VF3 A;  2J7K A;  2R3V A;  1HNZ I;  3WU4 A;  4GKK E;  4LF7 E;  4B3R E;  3Q6M A;  4N3O A;  4USK A;  4DR7 I;  4FWH A;  4HY1 A;  4WUD A;  3ZM7 A;  4JI6 E;  1S4E A;  2UXB I;  4JYA E;  1I94 I;  4JI3 E;  3J81 Q;  4DR4 E;  4KHP E;  2UXD E;  2ZM6 E;  3J80 Q;  2Z5E A;  1ZM3 A;  2BM1 A;  4LF7 I;  3HJC A;  2WW4 A;  4JI4 E;  2VQE I;  1Y6Z A;  2A2D A;  3OTO E;  2PNM A;  1KTV A;  4JYA I;  4JI3 I;  4DR6 I;  4UT4 A;  1XMO I;  4DR4 I;  5LL6 R;  2UXD I;  4X65 I;  2HK2 A;  3J80 C;  3PRY A;  1MG7 A;  3J7A M;  2Q2E B;  4JI4 I;  3Q6N A;  4ED4 A;  1IBM E;  4DUY E;  4DR3 I;  1Y4U A;  5GME A;  4JI1 I;  2UUB I;  4HAC B;  4DV5 E;  4DV0 E;  2V8P A;  4DV3 I;  3T1Y E;  2BV3 A;  4X66 I;  5IT9 C;  4B3S I;  1A6F A;  1Z5B A;  5BR8 I;  3T1H I;  2UXC E;  4AQY I;  3P06 A;  1IBM I;  1N34 E;  4DUY I;  4DUZ I;  1HNX I;  3V5R A;  4JV5 I;  4JI0 E;  4PU9 A;  1Z5A A;  4DV5 I;  2ZIT A;  5IWA E;  4DV2 I;  3T1Y I;  1FWL A;  1HR0 E;  4X62 E;  1IBK E;  4JI5 E;  1D6T A;  1HNW I;  1H73 A;  4MYT A;  4LFC I;  4FN5 A;  4K0K I;  4P52 A;  1N34 I;  2O1T A;  4DU7 A;  4EMD A;  4LFA I;  4JI0 I;  2E5L I;  5FWK A;  2O1U A;  1ZXN A;  4B3M E;  2HFU A;  4LF6 I;  3LNU A;  2GS8 A;  1HR0 I;  4NXN E;  2EFG A;  2OI2 A;  1Z0C A;  4JI5 I;  5A2Q C;  1S16 A;  2UUC E;  1H7S A;  4LF8 E;  4LFB I;  1XHK A;  4YY3 E;  3ZKB A;  3ZZ0 A;  1XMQ I;  4DPT A;  1NHJ A;  4GKJ I;  1EI1 A;  1K47 A;  5LMU E;  1ZM4 A;  3JAM Q;  3PYG A;  4GKK I;  2F4V E;  2CZ9 A;  3M6A A;  4HAC A;  4B3R I;  4JI7 E;  3K1J A;  4NXN I;  4LF5 E;  2CG9 A;  4DR5 E;  2UUC I;  1Z5C A;  4LF4 E;  4JI6 I;  4X64 E;  3J81 C;  4DPX A;  4DV6 E;  4KHP I;  2ZM6 I;  4JG4 A;  3LPS A;  3JAM C;  4DV1 E;  1Z0G A;  4IZK B;  2A2C A;  4DPY A;  2VQF E;  1Z59 A;  4DR5 I;  4DR2 E;  4LF9 E;  1USV A;  2V2Q A;  2HHH E;  3WU6 A;  3OTO I;  1RRE A;  3QT7 A;  4YHH E;  1N33 E;  4X64 I;  1XNR E;  1MX0 A;  3K17 A;  4DV6 I;  4KQV A;  2Z5B B;  3CWV A;  4I3H A;  3ZZU A;  4OX9 E;  3H4L A;  1Z0T A;  1FNM A;  4DV1 I;  4DV4 E;  3Q1Q A;  4JI2 E;  2XEX A;  5LMN E;  1XNR I;  1ZM9 A;  1PKP A;  1FWK A;  3GON A;  2Z5C A;  4DV0 I;  2UU9 E;  2X36 A;  2PNL A;  2HFS A;  3B82 A;  4JI8 E;  4JI2 I;  1HK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...