4LFBI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbI00
1FJGI 5BR8E 4LF5E 4P52A 2VQFI 4DR7E 4B3TE 4PRVA 4DV1I 1KVKA 4JI6I 2HFUA 2ZM6I 2X7IA 3CWVA 4NXNI 1XMOI 5GMDA 1ZXNA 2V2ZA 4LF7E 3HULA 4LF8E 2UXDI 5LMNI 1IBLE 2UUBE 4I3HA 4X64I 1XNRE 4JI1I 4PU9A 4DV5I 2V2QA 1KKHA 1N33E 4JI6E 4WUDA 1N32I 1ZM4A 2DEIA 4EMDA 4DR4E 1N34E 4Z7CA 4DR5E 1PVGA 1NHHA 4HACB 1A6FA 5A2QC 1N36E 2NPFA 1Z5CA 4X64E 3V2UC 3J80C 4JI8E 1HNZE 4JI3I 1HR0E 1N34I 4DV5E 4MYTA 4B3RE 4JI7I 3T1HE 4GKJE 3ZKBA 3J80Q 2VQEI 1N32E 3WU4A 4LFBE 4DR2E 2GS8A 4ZVIA 4JI0E 2UXCI 4B3RI 2UUCI 3QT6A 1ZM2A 4DPXA 4JI2I 4JI8I 3ZM7A 1HNZI 1HR0I 4DUYE 3K1JA 3J81C 4DR6E 4R1FA 2AJ4A 4DV6E 1Z0CA 2UU9E 1PIEA 3B82A 4K0KE 2V34A 1J5EE 4LF6I 4JYAE 4URLA 1PKPA 4JI4I 1FWKA 4HACA 2A2CA 4DR3E 2HKEA 4KQVA 4XTJA 4UTGA 1XNQI 4WUCA 2HK2A 1Z0GA 3ZZ0A 3J7AM 4X62E 4DPYA 4GKKE 5IWAI 1NHJA 2LJPA 4PRXA 2BM0A 4DV2I 2V2VA 2HK3A 4DV7E 5A2QQ 4DU8A 4LFCE 3PYFA 4KHPE 3ZZUA 4JI3E 1HNWI 2UXBI 3WU6A 1Z59A 1Z0TA 1BKNA 1MG7A 2R42A 1EA6A 4JI5E 4GKKI 1ELOA 1FWLA 4DU7A 4YY3I 1Z0BA 2HKJA 4JI0I 2UXCE 4JI1E 2HFSA 1IBMI 4JG4A 1I94E 4NXME 2E5LE 1K47A 1FNMA 4K0KI 1HNWE 1XHKA 3WU5A 4USMA 4OX9I 4YY3E 1B63A 2VF3A 3K17A 2WW4A 4DV1E 2OI2A 3J81Q 4DR7I 1ZM9A 4DPTA 4DPWA 4AQYE 4B3ME 3Q1QA 3J7AG 4UT4A 3PYGA 3QT5A 4DV2E 1VISA 1MU5A 5IWAE 4LF4I 4DV3E 4LFBI 1N33I 4M1KA 1WUUA 4DR2I 1Z0VA 4B3SI 4OX9E 4FWGA 3OTOE 3ZKDA 4AQYI 1N0VC 3H4LA 4DV3I 3D4JA 4LFCI 2UU9I 5BR8I 1D6TA 1XMOE 1NHIA 4P7AA 4LFAE 4DUZE 4DV6I 5LMUI 4LF9E 4DXLA 1ZM3A 2E5LI 2HHHE 3F0NA 2ZM6E 4HYMA 2DEJA 2X36A 4MYUA 3ZZTA 1KIJA 1KTVA 2F4VI 1XNRI 4YHHE 1HNXE 4DR3I 4LFAI 1FI4A 1QZRA 4NXMI 4HY1A 5FLXC 2R3VA 4FN5A 5IT9Q 1H73A 2HHHI 2XEXA 4YHHI 1HNXI 5FLXQ 1ZXMA 1RR9A 4JI5I 1S16A 3LPSA 1N36I 2BV3A 4LF5I 1N0UA 1FJGE 1J5EI 4B3TI 1H7UA 3OTOI 2UUAE 4X65E 4FWHA 1U2RA 1S4EA 4DV0E 4DPUA 3LTOA 2J7KA 4B3SE 2V8PA 4X62I 1H7SA 1I94I 2UXDE 3B8HA 1Z5BA 4LF7I 1IBLI 1XNQE 1H72C 1EI1A 5LMNE 2A2DA 4JI2E 4HXZA 1FKAE 4X65I 4Z7YA 4DV7I 2UUCE 4X66I 4RPFA 4DR1I 3WU3A 4DR6I 3LNUA 2ZBKB 4FW9A 1MX0A 4DR5I 2UUAI 5LL6R 3QT8A 3T1YE 4USKA 4B3MI 2CZ9A 5GMEA 3V5RA 4FWDA 2BM1A 4DR1E 2ZITA 1IBME 2VQFE 1IBKE 4WUBA 4JI7E 3T1HI 4X66E 1XMQI 4GKJI 3B78A 1H74A 5IT9C 4LF8I 2UUBI 3PYDA 5L3JA 4DV4E 2Q2EB 4LF9I 2VQEE 4DV0I 1Z0EA 1XMQE 1UEKA 1B62A 5LMUE 1IBKI 4ED4A 4DUYI 1RREA 1DARA 3M6AA 3GONA 3JAMC 2UXBE 4KHPI 3PYEA 4JV5I 3QT7A 2F4VE 2E1RA 4NXNE 4DR4I 2EFGA 1Z5AA 3JAMQ 4DV4I 4JI4E 4LF4E 1NZ0A 4LF6E 4JYAI 1Z0WA 3T1YI 1OJ4A 4JV5E 4DUZI
chains in the Genus database with same CATH superfamily
1FJGI 5BR8E 4LF5E 4P52A 2VQFI 5K36D 4DR7E 4B3TE 3U1YA 4PRVA 2BA0G 4DV1I 1KVKA 4JI6I 2HFUA 2ZM6I 2X7IA 2BA0D 3CWVA 4NXNI 1XMOI 4LPFA 5GMDA 1ZXNA 2V2ZA 4LF7E 3HULA 2PO1A 4LF8E 2UXDI 2AE8A 5LMNI 1IBLE 2UUBE 4I3HA 4X64I 2GO3A 1XNRE 4JI1I 4PU9A 4DV5I 5K36A 5JEAE 2C38B 2V2QA 3GCMA 1KKHA 1N33E 4IFDC 4JI6E 1P42A 4WUDA 2BA1G 1N32I 1ZM4A 4FW6A 2DEIA 3M85G 5K36E 5JEAB 2O1UA 4EMDA 3GLLA 4DR4E 1N34E 2PNMA 4Z7CA 4DR5E 1PVGA 1NHHA 4HACB 1A6FA 5A2QC 2IERA 3P3GA 1N36E 2NPFA 1Z5CA 4X64E 3V2UC 3J80C 4MU3A 4JI8E 3L7ZA 1HNZE 3P06A 4JI3I 1Y6ZA 1HR0E 3PS3A 1YH8A 1N34I 4DV5E 4MYTA 5C0XD 4B3RE 3DD6A 3T1HE 4JI7I 2O1TA 4GKJE 4FW7A 3ZKBA 5DRPA 3K85A 3J80Q 2VQEI 1N32E 4OO1B 3CDJA 4OKGA 3WU4A 4LFBE 5DNLA 5JEAD 4MU4A 4DR2E 2GS8A 4ZVIA 4JI0E 2UXCI 4FW5A 4U3BA 4B3RI 2UUCI 3QT6A 1ZM2A 4DPXA 4MU1A 2PNZA 4JI2I 1UDSA 2CG9A 3NZKA 4JI8I 3ZM7A 1HNZI 3P76A 1HR0I 2NN6C 4DUYE 3K1JA 3J81C 2WP8A 4DR6E 4R1FA 2O1WA 3Q6MA 2Z5EA 4IZKB 2AJ4A 4DV6E 1Z0CA 4IFDD 2UU9E 1PIEA 3B82A 3UHMA 1E3PA 2V34A 4K0KE 5K36B 1J5EE 4LF6I 4JYAE 4URLA 1PKPA 3Q6NA 4JI4I 3KRNA 1FWKA 4HACA 2A2CA 2C37A 4DR3E 2HKEA 4J3DA 2JT2A 4KQVA 4XTJA 4UTGA 1XNQI 4WUCA 4IFDE 2HK2A 1Z0GA 3ZZ0A 3J7AM 4X62E 4DPYA 4GKKE 4BA2B 5EKWA 5JEAC 5IWAI 4LCFA 1NHJA 2LJPA 4PRXA 2BM0A 4NBQA 4DV2I 2V2VA 2GQ0A 2HK3A 4QNJA 2IOPA 4OO1E 4DV7E 5C0XC 5A2QQ 4GQUA 2PO0A 3B4TA 4DU8A 4LFCE 2NN6A 3PYFA 4KHPE 3ZZUA 4JI3E 1HNWI 2JE6B 4AM3A 2UXBI 1Y5YA 5C0XA 2PO2B 5K36F 1USVA 3WU6A 1Z59A 1Z0TA 1BKNA 1MG7A 2R42A 1EA6A 4JI5E 5EL9A 4GKKI 1ELOA 3M7NG 1FWLA 4DU7A 4YY3I 2JEAB 1Z0BA 5JEAA 2HKJA 4JI0I 2UXCE 4JI1E 2HFSA 1IBMI 4JG4A 1I94E 4NXME 2E5LE 1K47A 2IOQA 1FNMA 1OYSA 4K0KI 1RHYA 1HNWE 4LCHA 2PO2A 1XHKA 3WU5A 4ISAA 4USMA 4OX9I 4YY3E 1B63A 2VF3A 3K17A 2WW4A 4DV1E 2OI2A 3J81Q 4FW4A 5DNXA 5JEAF 4DR7I 1ZM9A 4DPTA 4DPWA 4AQYE 4B3ME 3Q1QA 3J7AG 4UT4A 3PYGA 5DRRA 3QT5A 4DV2E 1VISA 3P3CA 3PS2A 1MU5A 5IWAE 4LF4I 2CGEA 4DV3E 4LFBI 1N33I 4M1KA 1WUUA 4DR2I 1Z0VA 3U1KA 4B3SI 3HKMA 4OX9E 4FWGA 1OYPA 1Y4UA 3OTOE 3ZKDA 4AQYI 3H1CA 1N0VC 3H4LA 4IZKA 3P3EA 5C0XE 4DV3I 3D4JA 4LFCI 2UU9I 5BR8I 4OO1C 1D6TA 1XMOE 1NHIA 4P7AA 4DUZE 4LFAE 4DV6I 3PS1A 3HJCA 4OO1F 5LMUI 2O3ZA 4LF9E 2JEBA 4DXLA 1ZM3A 5C0XB 1XXEA 2JE6A 5DRQA 2E5LI 2HHHE 3CDIA 4IS9A 3F0NA 2ZM6E 4HYMA 2DEJA 2NN6B 4MQYA 1USUA 2Z5BB 2X36A 4MYUA 3ZZTA 1KIJA 4IFDF 1KTVA 1VI7A 2F4VI 1XNRI 4YHHE 1HNXE 4DR3I 4LFAI 1FI4A 1QZRA 4BA1A 4NXMI 4HY1A 5FLXC 2R3VA 2CVEA 4FN5A 5IT9Q 1H73A 2HHHI 2O1VA 2XEXA 4YHHI 1HNXI 5FLXQ 2Z5CA 5DROA 2C39B 1ZXMA 1RR9A 2F1DA 3PRYA 4JI5I 1S16A 3M85D 3LPSA 1N36I 2BV3A 2PO0B 4LF5I 1N0UA 2VESA 1FJGE 1J5EI 4AIDA 4B3TI 2NN6F 4FW3A 2WP8B 1H7UA 3OTOI 2UUAE 4X65E 4FWHA 4IFDB 1U2RA 1S4EA 1R6MA 4DV0E 2NN6D 4DPUA 1YHCA 1UDQA 3LTOA 2J7KA 4B3SE 2V8PA 4X62I 1H7SA 1I94I 2UXDE 3B8HA 1Z5BA 4MDTA 4LF7I 1IBLI 2PNZB 4IZJB 1XNQE 1Y4SA 1H72C 4IZJA 1EI1A 5LMNE 2A2DA 4JI2E 4HXZA 1FKAE 2PNLA 5ELWA 4Z7YA 4X65I 4DV7I 2UUCE 4X66I 2JEBB 4LOMA 1E3HA 4RPFA 4DR1I 3WU3A 4OO1A 4IFDA 4N3OA 4DR6I 3LNUA 1UDOA 4BA1B 2ZBKB 4FW9A 5K36C 1MX0A 4DR5I 2UUAI 5LL6R 3QT8A 2IESA 3T1YE 4USKA 4B3MI 4OZEA 3M7ND 3L7ZB 4MU0A 2CZ9A 4U3DA 5GMEA 1UDNA 3V5RA 4FWDA 2BM1A 2C39A 4DR1E 2NN6E 2ZITA 4IZJD 1IBME 4AIMA 2VQFE 1IBKE 2WNRB 2GO4A 4WUBA 4LCGA 4JI7E 3T1HI 4X66E 1XMQI 4GKJI 1R6LA 3B78A 1H74A 5IT9C 4QNKA 4LF8I 2UUBI 4BA2A 1Y60A 3PYDA 5L3JA 4DV4E 2Q2EB 4LF9I 2Z5BA 2VQEE 4DV0I 1Z0EA 2BR2B 1XMQE 1UEKA 1B62A 5LMUE 1HK7A 1IBKI 4ED4A 4DUYI 2PO1B 1RREA 2BR2A 1DARA 3M6AA 3GONA 3JAMC 2UXBE 2BA1D 4KHPI 3PYEA 4JV5I 3QT7A 2F4VE 2E1RA 4NXNE 4OO1D 3GMEA 4DR4I 5FWKA 2JEAA 2EFGA 1Z5AA 3JAMQ 4DV4I 2C38A 4JI4E 2WNRA 4LF4E 1NZ0A 2J65A 4LF6E 4JYAI 1OYRA 2C37B 2Z5CB 1Z0WA 3T1YI 1OJ4A 5C0XF 4JV5E 4DUZI
chains in the Genus database with same CATH topology
1FJGI 5BR8E 4LF5E 4P52A 2VQFI 4DR7E 4B3TE 4PRVA 4DV1I 1KVKA 4JI6I 2HFUA 2ZM6I 2X7IA 3CWVA 4NXNI 1XMOI 5GMDA 1ZXNA 2V2ZA 4LF7E 3HULA 4LF8E 2UXDI 5LMNI 1IBLE 2UUBE 4I3HA 4X64I 1XNRE 4JI1I 4PU9A 4DV5I 2V2QA 1KKHA 1N33E 4JI6E 4WUDA 1N32I 1ZM4A 2DEIA 2O1UA 4EMDA 4DR4E 1N34E 2PNMA 4Z7CA 4DR5E 1PVGA 1NHHA 4HACB 1A6FA 5A2QC 1N36E 2NPFA 1Z5CA 4X64E 3V2UC 3J80C 4JI8E 1HNZE 3P06A 4JI3I 1Y6ZA 1HR0E 1N34I 4DV5E 4MYTA 4B3RE 3T1HE 4JI7I 2O1TA 4GKJE 3ZKBA 3K85A 3J80Q 2VQEI 1N32E 3WU4A 4LFBE 4DR2E 2GS8A 4ZVIA 4JI0E 2UXCI 4B3RI 2UUCI 3QT6A 1ZM2A 4DPXA 4JI2I 2CG9A 4JI8I 3ZM7A 1HNZI 1HR0I 4DUYE 3K1JA 3J81C 4DR6E 4R1FA 2O1WA 3Q6MA 2Z5EA 4IZKB 2AJ4A 4DV6E 1Z0CA 2UU9E 1PIEA 3B82A 4K0KE 2V34A 1J5EE 4LF6I 4JYAE 4URLA 1PKPA 3Q6NA 4JI4I 1FWKA 4HACA 2A2CA 4DR3E 2HKEA 4KQVA 4XTJA 4UTGA 1XNQI 4WUCA 2HK2A 1Z0GA 3ZZ0A 3J7AM 4X62E 4DPYA 4GKKE 5IWAI 1NHJA 2LJPA 4PRXA 2BM0A 4DV2I 2V2VA 2GQ0A 2HK3A 2IOPA 4DV7E 5A2QQ 4DU8A 4LFCE 3PYFA 4KHPE 3ZZUA 4JI3E 1HNWI 2UXBI 1USVA 3WU6A 1Z59A 1Z0TA 1BKNA 1MG7A 2R42A 1EA6A 4JI5E 4GKKI 1ELOA 1FWLA 4DU7A 4YY3I 1Z0BA 2HKJA 4JI0I 2UXCE 4JI1E 2HFSA 1IBMI 4JG4A 1I94E 4NXME 2E5LE 1K47A 2IOQA 1FNMA 4K0KI 1HNWE 1XHKA 3WU5A 4USMA 4OX9I 4YY3E 1B63A 2VF3A 3K17A 2WW4A 4DV1E 2OI2A 3J81Q 4DR7I 1ZM9A 4DPTA 4DPWA 4AQYE 4B3ME 3Q1QA 3J7AG 4UT4A 3PYGA 3QT5A 4DV2E 1VISA 1MU5A 5IWAE 4LF4I 2CGEA 4DV3E 4LFBI 1N33I 4M1KA 1WUUA 4DR2I 1Z0VA 4B3SI 4OX9E 4FWGA 1Y4UA 3OTOE 3ZKDA 4AQYI 1N0VC 3H4LA 4IZKA 4DV3I 3D4JA 4LFCI 2UU9I 5BR8I 1D6TA 1XMOE 1NHIA 4P7AA 4DUZE 4LFAE 4DV6I 3HJCA 5LMUI 4LF9E 4DXLA 1ZM3A 2E5LI 2HHHE 3F0NA 2ZM6E 4HYMA 2DEJA 1USUA 2Z5BB 2X36A 4MYUA 3ZZTA 1KIJA 1KTVA 2F4VI 1XNRI 4YHHE 1HNXE 4DR3I 4LFAI 1FI4A 1QZRA 4NXMI 4HY1A 5FLXC 2R3VA 4FN5A 5IT9Q 1H73A 2HHHI 2O1VA 2XEXA 1HNXI 4YHHI 5FLXQ 2Z5CA 1ZXMA 1RR9A 3PRYA 4JI5I 1S16A 3LPSA 1N36I 2BV3A 4LF5I 1N0UA 1FJGE 1J5EI 4B3TI 1H7UA 3OTOI 2UUAE 4X65E 4FWHA 1U2RA 1S4EA 4DV0E 4DPUA 3LTOA 2J7KA 4B3SE 2V8PA 4X62I 1H7SA 1I94I 2UXDE 3B8HA 1Z5BA 4LF7I 1IBLI 1XNQE 4IZJB 1Y4SA 1H72C 4IZJA 1EI1A 5LMNE 2A2DA 4JI2E 4HXZA 1FKAE 2PNLA 4X65I 4Z7YA 4DV7I 2UUCE 4X66I 4RPFA 4DR1I 3WU3A 4N3OA 4DR6I 3LNUA 2ZBKB 4FW9A 1MX0A 4DR5I 2UUAI 5LL6R 3QT8A 3T1YE 4B3MI 4USKA 2CZ9A 5GMEA 3V5RA 4FWDA 2BM1A 4DR1E 4IZJD 2ZITA 1IBME 2VQFE 1IBKE 4WUBA 4JI7E 3T1HI 4X66E 1XMQI 4GKJI 3B78A 1H74A 5IT9C 4LF8I 2UUBI 3PYDA 5L3JA 4DV4E 2Q2EB 4LF9I 2Z5BA 2VQEE 4DV0I 1Z0EA 1XMQE 1UEKA 1B62A 5LMUE 1HK7A 1IBKI 4ED4A 4DUYI 1RREA 1DARA 3M6AA 3GONA 3JAMC 2UXBE 4KHPI 3PYEA 4JV5I 3QT7A 2F4VE 2E1RA 4NXNE 4DR4I 5FWKA 2EFGA 1Z5AA 3JAMQ 4DV4I 4JI4E 4LF4E 1NZ0A 4LF6E 4JYAI 2Z5CB 1Z0WA 3T1YI 1OJ4A 4JV5E 4DUZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG I;  5BR8 E;  4LF5 E;  4P52 A;  2VQF I;  4DR7 E;  4B3T E;  4PRV A;  4DV1 I;  1KVK A;  4JI6 I;  2HFU A;  2ZM6 I;  2X7I A;  3CWV A;  4NXN I;  1XMO I;  5GMD A;  1ZXN A;  2V2Z A;  4LF7 E;  3HUL A;  4LF8 E;  2UXD I;  5LMN I;  1IBL E;  2UUB E;  4I3H A;  4X64 I;  1XNR E;  4JI1 I;  4PU9 A;  4DV5 I;  2V2Q A;  1KKH A;  1N33 E;  4JI6 E;  4WUD A;  1N32 I;  1ZM4 A;  2DEI A;  4EMD A;  4DR4 E;  1N34 E;  4Z7C A;  4DR5 E;  1PVG A;  1NHH A;  4HAC B;  1A6F A;  5A2Q C;  1N36 E;  2NPF A;  1Z5C A;  4X64 E;  3V2U C;  3J80 C;  4JI8 E;  1HNZ E;  4JI3 I;  1HR0 E;  1N34 I;  4DV5 E;  4MYT A;  4B3R E;  4JI7 I;  3T1H E;  4GKJ E;  3ZKB A;  3J80 Q;  2VQE I;  1N32 E;  3WU4 A;  4LFB E;  4DR2 E;  2GS8 A;  4ZVI A;  4JI0 E;  2UXC I;  4B3R I;  2UUC I;  3QT6 A;  1ZM2 A;  4DPX A;  4JI2 I;  4JI8 I;  3ZM7 A;  1HNZ I;  1HR0 I;  4DUY E;  3K1J A;  3J81 C;  4DR6 E;  4R1F A;  2AJ4 A;  4DV6 E;  1Z0C A;  2UU9 E;  1PIE A;  3B82 A;  4K0K E;  2V34 A;  1J5E E;  4LF6 I;  4JYA E;  4URL A;  1PKP A;  4JI4 I;  1FWK A;  4HAC A;  2A2C A;  4DR3 E;  2HKE A;  4KQV A;  4XTJ A;  4UTG A;  1XNQ I;  4WUC A;  2HK2 A;  1Z0G A;  3ZZ0 A;  3J7A M;  4X62 E;  4DPY A;  4GKK E;  5IWA I;  1NHJ A;  2LJP A;  4PRX A;  2BM0 A;  4DV2 I;  2V2V A;  2HK3 A;  4DV7 E;  5A2Q Q;  4DU8 A;  4LFC E;  3PYF A;  4KHP E;  3ZZU A;  4JI3 E;  1HNW I;  2UXB I;  3WU6 A;  1Z59 A;  1Z0T A;  1BKN A;  1MG7 A;  2R42 A;  1EA6 A;  4JI5 E;  4GKK I;  1ELO A;  1FWL A;  4DU7 A;  4YY3 I;  1Z0B A;  2HKJ A;  4JI0 I;  2UXC E;  4JI1 E;  2HFS A;  1IBM I;  4JG4 A;  1I94 E;  4NXM E;  2E5L E;  1K47 A;  1FNM A;  4K0K I;  1HNW E;  1XHK A;  3WU5 A;  4USM A;  4OX9 I;  4YY3 E;  1B63 A;  2VF3 A;  3K17 A;  2WW4 A;  4DV1 E;  2OI2 A;  3J81 Q;  4DR7 I;  1ZM9 A;  4DPT A;  4DPW A;  4AQY E;  4B3M E;  3Q1Q A;  3J7A G;  4UT4 A;  3PYG A;  3QT5 A;  4DV2 E;  1VIS A;  1MU5 A;  5IWA E;  4LF4 I;  4DV3 E;  4LFB I;  1N33 I;  4M1K A;  1WUU A;  4DR2 I;  1Z0V A;  4B3S I;  4OX9 E;  4FWG A;  3OTO E;  3ZKD A;  4AQY I;  1N0V C;  3H4L A;  4DV3 I;  3D4J A;  4LFC I;  2UU9 I;  5BR8 I;  1D6T A;  1XMO E;  1NHI A;  4P7A A;  4LFA E;  4DUZ E;  4DV6 I;  5LMU I;  4LF9 E;  4DXL A;  1ZM3 A;  2E5L I;  2HHH E;  3F0N A;  2ZM6 E;  4HYM A;  2DEJ A;  2X36 A;  4MYU A;  3ZZT A;  1KIJ A;  1KTV A;  2F4V I;  1XNR I;  4YHH E;  1HNX E;  4DR3 I;  4LFA I;  1FI4 A;  1QZR A;  4NXM I;  4HY1 A;  5FLX C;  2R3V A;  4FN5 A;  5IT9 Q;  1H73 A;  2HHH I;  2XEX A;  4YHH I;  1HNX I;  5FLX Q;  1ZXM A;  1RR9 A;  4JI5 I;  1S16 A;  3LPS A;  1N36 I;  2BV3 A;  4LF5 I;  1N0U A;  1FJG E;  1J5E I;  4B3T I;  1H7U A;  3OTO I;  2UUA E;  4X65 E;  4FWH A;  1U2R A;  1S4E A;  4DV0 E;  4DPU A;  3LTO A;  2J7K A;  4B3S E;  2V8P A;  4X62 I;  1H7S A;  1I94 I;  2UXD E;  3B8H A;  1Z5B A;  4LF7 I;  1IBL I;  1XNQ E;  1H72 C;  1EI1 A;  5LMN E;  2A2D A;  4JI2 E;  4HXZ A;  1FKA E;  4X65 I;  4Z7Y A;  4DV7 I;  2UUC E;  4X66 I;  4RPF A;  4DR1 I;  3WU3 A;  4DR6 I;  3LNU A;  2ZBK B;  4FW9 A;  1MX0 A;  4DR5 I;  2UUA I;  5LL6 R;  3QT8 A;  3T1Y E;  4USK A;  4B3M I;  2CZ9 A;  5GME A;  3V5R A;  4FWD A;  2BM1 A;  4DR1 E;  2ZIT A;  1IBM E;  2VQF E;  1IBK E;  4WUB A;  4JI7 E;  3T1H I;  4X66 E;  1XMQ I;  4GKJ I;  3B78 A;  1H74 A;  5IT9 C;  4LF8 I;  2UUB I;  3PYD A;  5L3J A;  4DV4 E;  2Q2E B;  4LF9 I;  2VQE E;  4DV0 I;  1Z0E A;  1XMQ E;  1UEK A;  1B62 A;  5LMU E;  1IBK I;  4ED4 A;  4DUY I;  1RRE A;  1DAR A;  3M6A A;  3GON A;  3JAM C;  2UXB E;  4KHP I;  3PYE A;  4JV5 I;  3QT7 A;  2F4V E;  2E1R A;  4NXN E;  4DR4 I;  2EFG A;  1Z5A A;  3JAM Q;  4DV4 I;  4JI4 E;  4LF4 E;  1NZ0 A;  4LF6 E;  4JYA I;  1Z0W A;  3T1Y I;  1OJ4 A;  4JV5 E;  4DUZ I; 
#chains in the Genus database with same CATH topology
 1FJG I;  5BR8 E;  4LF5 E;  4P52 A;  2VQF I;  5K36 D;  4DR7 E;  4B3T E;  3U1Y A;  4PRV A;  2BA0 G;  4DV1 I;  1KVK A;  4JI6 I;  2HFU A;  2ZM6 I;  2X7I A;  2BA0 D;  3CWV A;  4NXN I;  1XMO I;  4LPF A;  5GMD A;  1ZXN A;  2V2Z A;  4LF7 E;  3HUL A;  2PO1 A;  4LF8 E;  2UXD I;  2AE8 A;  5LMN I;  1IBL E;  2UUB E;  4I3H A;  4X64 I;  2GO3 A;  1XNR E;  4JI1 I;  4PU9 A;  4DV5 I;  5K36 A;  5JEA E;  2C38 B;  2V2Q A;  3GCM A;  1KKH A;  1N33 E;  4IFD C;  4JI6 E;  1P42 A;  4WUD A;  2BA1 G;  1N32 I;  1ZM4 A;  4FW6 A;  2DEI A;  3M85 G;  5K36 E;  5JEA B;  2O1U A;  4EMD A;  3GLL A;  4DR4 E;  1N34 E;  2PNM A;  4Z7C A;  4DR5 E;  1PVG A;  1NHH A;  4HAC B;  1A6F A;  5A2Q C;  2IER A;  3P3G A;  1N36 E;  2NPF A;  1Z5C A;  4X64 E;  3V2U C;  3J80 C;  4MU3 A;  4JI8 E;  3L7Z A;  1HNZ E;  3P06 A;  4JI3 I;  1Y6Z A;  1HR0 E;  3PS3 A;  1YH8 A;  1N34 I;  4DV5 E;  4MYT A;  5C0X D;  4B3R E;  3DD6 A;  3T1H E;  4JI7 I;  2O1T A;  4GKJ E;  4FW7 A;  3ZKB A;  5DRP A;  3K85 A;  3J80 Q;  2VQE I;  1N32 E;  4OO1 B;  3CDJ A;  4OKG A;  3WU4 A;  4LFB E;  5DNL A;  5JEA D;  4MU4 A;  4DR2 E;  2GS8 A;  4ZVI A;  4JI0 E;  2UXC I;  4FW5 A;  4U3B A;  4B3R I;  2UUC I;  3QT6 A;  1ZM2 A;  4DPX A;  4MU1 A;  2PNZ A;  4JI2 I;  1UDS A;  2CG9 A;  3NZK A;  4JI8 I;  3ZM7 A;  1HNZ I;  3P76 A;  1HR0 I;  2NN6 C;  4DUY E;  3K1J A;  3J81 C;  2WP8 A;  4DR6 E;  4R1F A;  2O1W A;  3Q6M A;  2Z5E A;  4IZK B;  2AJ4 A;  4DV6 E;  1Z0C A;  4IFD D;  2UU9 E;  1PIE A;  3B82 A;  3UHM A;  1E3P A;  2V34 A;  4K0K E;  5K36 B;  1J5E E;  4LF6 I;  4JYA E;  4URL A;  1PKP A;  3Q6N A;  4JI4 I;  3KRN A;  1FWK A;  4HAC A;  2A2C A;  2C37 A;  4DR3 E;  2HKE A;  4J3D A;  2JT2 A;  4KQV A;  4XTJ A;  4UTG A;  1XNQ I;  4WUC A;  4IFD E;  2HK2 A;  1Z0G A;  3ZZ0 A;  3J7A M;  4X62 E;  4DPY A;  4GKK E;  4BA2 B;  5EKW A;  5JEA C;  5IWA I;  4LCF A;  1NHJ A;  2LJP A;  4PRX A;  2BM0 A;  4NBQ A;  4DV2 I;  2V2V A;  2GQ0 A;  2HK3 A;  4QNJ A;  2IOP A;  4OO1 E;  4DV7 E;  5C0X C;  5A2Q Q;  4GQU A;  2PO0 A;  3B4T A;  4DU8 A;  4LFC E;  2NN6 A;  3PYF A;  4KHP E;  3ZZU A;  4JI3 E;  1HNW I;  2JE6 B;  4AM3 A;  2UXB I;  1Y5Y A;  5C0X A;  2PO2 B;  5K36 F;  1USV A;  3WU6 A;  1Z59 A;  1Z0T A;  1BKN A;  1MG7 A;  2R42 A;  1EA6 A;  4JI5 E;  5EL9 A;  4GKK I;  1ELO A;  3M7N G;  1FWL A;  4DU7 A;  4YY3 I;  2JEA B;  1Z0B A;  5JEA A;  2HKJ A;  4JI0 I;  2UXC E;  4JI1 E;  2HFS A;  1IBM I;  4JG4 A;  1I94 E;  4NXM E;  2E5L E;  1K47 A;  2IOQ A;  1FNM A;  1OYS A;  4K0K I;  1RHY A;  1HNW E;  4LCH A;  2PO2 A;  1XHK A;  3WU5 A;  4ISA A;  4USM A;  4OX9 I;  4YY3 E;  1B63 A;  2VF3 A;  3K17 A;  2WW4 A;  4DV1 E;  2OI2 A;  3J81 Q;  4FW4 A;  5DNX A;  5JEA F;  4DR7 I;  1ZM9 A;  4DPT A;  4DPW A;  4AQY E;  4B3M E;  3Q1Q A;  3J7A G;  4UT4 A;  3PYG A;  5DRR A;  3QT5 A;  4DV2 E;  1VIS A;  3P3C A;  3PS2 A;  1MU5 A;  5IWA E;  4LF4 I;  2CGE A;  4DV3 E;  4LFB I;  1N33 I;  4M1K A;  1WUU A;  4DR2 I;  1Z0V A;  3U1K A;  4B3S I;  3HKM A;  4OX9 E;  4FWG A;  1OYP A;  1Y4U A;  3OTO E;  3ZKD A;  4AQY I;  3H1C A;  1N0V C;  3H4L A;  4IZK A;  3P3E A;  5C0X E;  4DV3 I;  3D4J A;  4LFC I;  2UU9 I;  5BR8 I;  4OO1 C;  1D6T A;  1XMO E;  1NHI A;  4P7A A;  4DUZ E;  4LFA E;  4DV6 I;  3PS1 A;  3HJC A;  4OO1 F;  5LMU I;  2O3Z A;  4LF9 E;  2JEB A;  4DXL A;  1ZM3 A;  5C0X B;  1XXE A;  2JE6 A;  5DRQ A;  2E5L I;  2HHH E;  3CDI A;  4IS9 A;  3F0N A;  2ZM6 E;  4HYM A;  2DEJ A;  2NN6 B;  4MQY A;  1USU A;  2Z5B B;  2X36 A;  4MYU A;  3ZZT A;  1KIJ A;  4IFD F;  1KTV A;  1VI7 A;  2F4V I;  1XNR I;  4YHH E;  1HNX E;  4DR3 I;  4LFA I;  1FI4 A;  1QZR A;  4BA1 A;  4NXM I;  4HY1 A;  5FLX C;  2R3V A;  2CVE A;  4FN5 A;  5IT9 Q;  1H73 A;  2HHH I;  2O1V A;  2XEX A;  4YHH I;  1HNX I;  5FLX Q;  2Z5C A;  5DRO A;  2C39 B;  1ZXM A;  1RR9 A;  2F1D A;  3PRY A;  4JI5 I;  1S16 A;  3M85 D;  3LPS A;  1N36 I;  2BV3 A;  2PO0 B;  4LF5 I;  1N0U A;  2VES A;  1FJG E;  1J5E I;  4AID A;  4B3T I;  2NN6 F;  4FW3 A;  2WP8 B;  1H7U A;  3OTO I;  2UUA E;  4X65 E;  4FWH A;  4IFD B;  1U2R A;  1S4E A;  1R6M A;  4DV0 E;  2NN6 D;  4DPU A;  1YHC A;  1UDQ A;  3LTO A;  2J7K A;  4B3S E;  2V8P A;  4X62 I;  1H7S A;  1I94 I;  2UXD E;  3B8H A;  1Z5B A;  4MDT A;  4LF7 I;  1IBL I;  2PNZ B;  4IZJ B;  1XNQ E;  1Y4S A;  1H72 C;  4IZJ A;  1EI1 A;  5LMN E;  2A2D A;  4JI2 E;  4HXZ A;  1FKA E;  2PNL A;  5ELW A;  4Z7Y A;  4X65 I;  4DV7 I;  2UUC E;  4X66 I;  2JEB B;  4LOM A;  1E3H A;  4RPF A;  4DR1 I;  3WU3 A;  4OO1 A;  4IFD A;  4N3O A;  4DR6 I;  3LNU A;  1UDO A;  4BA1 B;  2ZBK B;  4FW9 A;  5K36 C;  1MX0 A;  4DR5 I;  2UUA I;  5LL6 R;  3QT8 A;  2IES A;  3T1Y E;  4USK A;  4B3M I;  4OZE A;  3M7N D;  3L7Z B;  4MU0 A;  2CZ9 A;  4U3D A;  5GME A;  1UDN A;  3V5R A;  4FWD A;  2BM1 A;  2C39 A;  4DR1 E;  2NN6 E;  2ZIT A;  4IZJ D;  1IBM E;  4AIM A;  2VQF E;  1IBK E;  2WNR B;  2GO4 A;  4WUB A;  4LCG A;  4JI7 E;  3T1H I;  4X66 E;  1XMQ I;  4GKJ I;  1R6L A;  3B78 A;  1H74 A;  5IT9 C;  4QNK A;  4LF8 I;  2UUB I;  4BA2 A;  1Y60 A;  3PYD A;  5L3J A;  4DV4 E;  2Q2E B;  4LF9 I;  2Z5B A;  2VQE E;  4DV0 I;  1Z0E A;  2BR2 B;  1XMQ E;  1UEK A;  1B62 A;  5LMU E;  1HK7 A;  1IBK I;  4ED4 A;  4DUY I;  2PO1 B;  1RRE A;  2BR2 A;  1DAR A;  3M6A A;  3GON A;  3JAM C;  2UXB E;  2BA1 D;  4KHP I;  3PYE A;  4JV5 I;  3QT7 A;  2F4V E;  2E1R A;  4NXN E;  4OO1 D;  3GME A;  4DR4 I;  5FWK A;  2JEA A;  2EFG A;  1Z5A A;  3JAM Q;  4DV4 I;  2C38 A;  4JI4 E;  2WNR A;  4LF4 E;  1NZ0 A;  2J65 A;  4LF6 E;  4JYA I;  1OYR A;  2C37 B;  2Z5C B;  1Z0W A;  3T1Y I;  1OJ4 A;  5C0X F;  4JV5 E;  4DUZ I; 
#chains in the Genus database with same CATH homology
 1FJG I;  5BR8 E;  4LF5 E;  4P52 A;  2VQF I;  4DR7 E;  4B3T E;  4PRV A;  4DV1 I;  1KVK A;  4JI6 I;  2HFU A;  2ZM6 I;  2X7I A;  3CWV A;  4NXN I;  1XMO I;  5GMD A;  1ZXN A;  2V2Z A;  4LF7 E;  3HUL A;  4LF8 E;  2UXD I;  5LMN I;  1IBL E;  2UUB E;  4I3H A;  4X64 I;  1XNR E;  4JI1 I;  4PU9 A;  4DV5 I;  2V2Q A;  1KKH A;  1N33 E;  4JI6 E;  4WUD A;  1N32 I;  1ZM4 A;  2DEI A;  2O1U A;  4EMD A;  4DR4 E;  1N34 E;  2PNM A;  4Z7C A;  4DR5 E;  1PVG A;  1NHH A;  4HAC B;  1A6F A;  5A2Q C;  1N36 E;  2NPF A;  1Z5C A;  4X64 E;  3V2U C;  3J80 C;  4JI8 E;  1HNZ E;  3P06 A;  4JI3 I;  1Y6Z A;  1HR0 E;  1N34 I;  4DV5 E;  4MYT A;  4B3R E;  3T1H E;  4JI7 I;  2O1T A;  4GKJ E;  3ZKB A;  3K85 A;  3J80 Q;  2VQE I;  1N32 E;  3WU4 A;  4LFB E;  4DR2 E;  2GS8 A;  4ZVI A;  4JI0 E;  2UXC I;  4B3R I;  2UUC I;  3QT6 A;  1ZM2 A;  4DPX A;  4JI2 I;  2CG9 A;  4JI8 I;  3ZM7 A;  1HNZ I;  1HR0 I;  4DUY E;  3K1J A;  3J81 C;  4DR6 E;  4R1F A;  2O1W A;  3Q6M A;  2Z5E A;  4IZK B;  2AJ4 A;  4DV6 E;  1Z0C A;  2UU9 E;  1PIE A;  3B82 A;  4K0K E;  2V34 A;  1J5E E;  4LF6 I;  4JYA E;  4URL A;  1PKP A;  3Q6N A;  4JI4 I;  1FWK A;  4HAC A;  2A2C A;  4DR3 E;  2HKE A;  4KQV A;  4XTJ A;  4UTG A;  1XNQ I;  4WUC A;  2HK2 A;  1Z0G A;  3ZZ0 A;  3J7A M;  4X62 E;  4DPY A;  4GKK E;  5IWA I;  1NHJ A;  2LJP A;  4PRX A;  2BM0 A;  4DV2 I;  2V2V A;  2GQ0 A;  2HK3 A;  2IOP A;  4DV7 E;  5A2Q Q;  4DU8 A;  4LFC E;  3PYF A;  4KHP E;  3ZZU A;  4JI3 E;  1HNW I;  2UXB I;  1USV A;  3WU6 A;  1Z59 A;  1Z0T A;  1BKN A;  1MG7 A;  2R42 A;  1EA6 A;  4JI5 E;  4GKK I;  1ELO A;  1FWL A;  4DU7 A;  4YY3 I;  1Z0B A;  2HKJ A;  4JI0 I;  2UXC E;  4JI1 E;  2HFS A;  1IBM I;  4JG4 A;  1I94 E;  4NXM E;  2E5L E;  1K47 A;  2IOQ A;  1FNM A;  4K0K I;  1HNW E;  1XHK A;  3WU5 A;  4USM A;  4OX9 I;  4YY3 E;  1B63 A;  2VF3 A;  3K17 A;  2WW4 A;  4DV1 E;  2OI2 A;  3J81 Q;  4DR7 I;  1ZM9 A;  4DPT A;  4DPW A;  4AQY E;  4B3M E;  3Q1Q A;  3J7A G;  4UT4 A;  3PYG A;  3QT5 A;  4DV2 E;  1VIS A;  1MU5 A;  5IWA E;  4LF4 I;  2CGE A;  4DV3 E;  4LFB I;  1N33 I;  4M1K A;  1WUU A;  4DR2 I;  1Z0V A;  4B3S I;  4OX9 E;  4FWG A;  1Y4U A;  3OTO E;  3ZKD A;  4AQY I;  1N0V C;  3H4L A;  4IZK A;  4DV3 I;  3D4J A;  4LFC I;  2UU9 I;  5BR8 I;  1D6T A;  1XMO E;  1NHI A;  4P7A A;  4DUZ E;  4LFA E;  4DV6 I;  3HJC A;  5LMU I;  4LF9 E;  4DXL A;  1ZM3 A;  2E5L I;  2HHH E;  3F0N A;  2ZM6 E;  4HYM A;  2DEJ A;  1USU A;  2Z5B B;  2X36 A;  4MYU A;  3ZZT A;  1KIJ A;  1KTV A;  2F4V I;  1XNR I;  4YHH E;  1HNX E;  4DR3 I;  4LFA I;  1FI4 A;  1QZR A;  4NXM I;  4HY1 A;  5FLX C;  2R3V A;  4FN5 A;  5IT9 Q;  1H73 A;  2HHH I;  2O1V A;  2XEX A;  1HNX I;  4YHH I;  5FLX Q;  2Z5C A;  1ZXM A;  1RR9 A;  3PRY A;  4JI5 I;  1S16 A;  3LPS A;  1N36 I;  2BV3 A;  4LF5 I;  1N0U A;  1FJG E;  1J5E I;  4B3T I;  1H7U A;  3OTO I;  2UUA E;  4X65 E;  4FWH A;  1U2R A;  1S4E A;  4DV0 E;  4DPU A;  3LTO A;  2J7K A;  4B3S E;  2V8P A;  4X62 I;  1H7S A;  1I94 I;  2UXD E;  3B8H A;  1Z5B A;  4LF7 I;  1IBL I;  1XNQ E;  4IZJ B;  1Y4S A;  1H72 C;  4IZJ A;  1EI1 A;  5LMN E;  2A2D A;  4JI2 E;  4HXZ A;  1FKA E;  2PNL A;  4X65 I;  4Z7Y A;  4DV7 I;  2UUC E;  4X66 I;  4RPF A;  4DR1 I;  3WU3 A;  4N3O A;  4DR6 I;  3LNU A;  2ZBK B;  4FW9 A;  1MX0 A;  4DR5 I;  2UUA I;  5LL6 R;  3QT8 A;  3T1Y E;  4B3M I;  4USK A;  2CZ9 A;  5GME A;  3V5R A;  4FWD A;  2BM1 A;  4DR1 E;  4IZJ D;  2ZIT A;  1IBM E;  2VQF E;  1IBK E;  4WUB A;  4JI7 E;  3T1H I;  4X66 E;  1XMQ I;  4GKJ I;  3B78 A;  1H74 A;  5IT9 C;  4LF8 I;  2UUB I;  3PYD A;  5L3J A;  4DV4 E;  2Q2E B;  4LF9 I;  2Z5B A;  2VQE E;  4DV0 I;  1Z0E A;  1XMQ E;  1UEK A;  1B62 A;  5LMU E;  1HK7 A;  1IBK I;  4ED4 A;  4DUY I;  1RRE A;  1DAR A;  3M6A A;  3GON A;  3JAM C;  2UXB E;  4KHP I;  3PYE A;  4JV5 I;  3QT7 A;  2F4V E;  2E1R A;  4NXN E;  4DR4 I;  5FWK A;  2EFG A;  1Z5A A;  3JAM Q;  4DV4 I;  4JI4 E;  4LF4 E;  1NZ0 A;  4LF6 E;  4JYA I;  2Z5C B;  1Z0W A;  3T1Y I;  1OJ4 A;  4JV5 E;  4DUZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...