4LFBI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbI00
1I94E 4LF4I 1DARA 4JG4A 1HNWE 3HULA 2ZITA 3B8HA 3J7AG 1FJGI 4LF6I 1IBKE 1N33E 1WUUA 3ZM7A 2E5LE 4B3SE 2UXCE 4MYTA 5LMNE 3QT7A 1Z0GA 4USKA 1NHHA 2BV3A 1FJGE 4X64E 1Z5CA 2V2ZA 3GONA 1S16A 4LFBI 4FW9A 2AJ4A 2CZ9A 4DUZI 1RREA 3Q1QA 4DV7I 1ZM3A 2BM0A 3JAMQ 1IBME 3CWVA 2HK2A 4DU8A 1ZM4A 1Z0VA 4YHHI 4HYMA 3LNUA 4I3HA 3ZKDA 4DR4E 4HACB 4JI5E 5IT9Q 4DR5I 2Q2EB 4B3RE 2J7KA 4B3RI 1MU5A 3T1YI 3J80C 1FI4A 5FLXC 4JI5I 4DR4I 4DV1I 4X66E 4KQVA 4JI7E 4P7AA 4JI8E 4LF7I 3JAMC 1Z0EA 2UXDI 2VF3A 4DV4I 2NPFA 4JYAE 3J81Q 2VQFE 4DUYE 1PKPA 2HFSA 1Z59A 4ED4A 3WU5A 1FWLA 2F4VE 1FKAE 5LMNI 4DV2E 4UTGA 4EMDA 1N33I 1IBKI 1ZXMA 1B62A 4NXMI 2VQEI 4FWDA 1FWKA 4DR1E 4JI1E 1NHIA 4DR2E 4LF5I 3V5RA 1H74A 3OTOI 4X66I 1XMOE 4DV1E 4LF9I 4ZVIA 4DV5I 1U2RA 5L3JA 1B63A 2R42A 4WUCA 3T1YE 3PYDA 3K17A 4JI3I 4JI2I 1N34E 1K47A 2UXBE 1HNXE 1N0VC 1N36I 1H72C 4GKJE 1XNRE 2WW4A 3B82A 4FWGA 4K0KI 4LFAI 5BR8I 1H73A 4GKKI 4DPTA 4X65I 1XMQE 1HR0I 1KVKA 4WUDA 4AQYI 5IWAE 5FLXQ 1N0UA 4DUZE 2E1RA 1XHKA 2HK3A 5A2QQ 4DR7I 1BKNA 1Z0CA 4X64I 1NZ0A 4DV0E 1ZM2A 3LTOA 2HHHE 4DU7A 3T1HE 4DV3I 2ZM6I 2UXCI 4X62E 4PRXA 4B3SI 4LFCE 2E5LI 3F0NA 3B78A 4OX9I 4LFCI 1N32E 2ZM6E 4URLA 4DR3E 4FWHA 5LMUI 4JI4I 5LL6R 4YY3I 2UUBE 1MG7A 2UUAI 4WUBA 4R1FA 4JI6E 4AQYE 1HNZE 1IBLI 4B3ME 2UU9E 3PYEA 1XMQI 5BR8E 3J80Q 1MX0A 1OJ4A 2V2VA 1XNRI 4GKJI 3LPSA 5A2QC 1N36E 1UEKA 2UU9I 2GS8A 4HY1A 4B3TE 3QT5A 2BM1A 2HFUA 4LF8E 3J7AM 1XNQI 2UUAE 2LJPA 1PVGA 1Z0TA 4LF9E 3D4JA 4Z7CA 4YY3E 2UUBI 2UUCE 3OTOE 5IT9C 2V8PA 5GMEA 3WU6A 4JV5E 2ZBKB 4LF5E 2HKJA 3WU3A 4USMA 4FN5A 2V2QA 5GMDA 2DEJA 4JI0I 4OX9E 3PYFA 4NXME 4MYUA 1J5EE 1J5EI 3ZZ0A 1RR9A 3V2UC 4DV6I 4HXZA 4HACA 4X62I 3T1HI 1Z5BA 4DR6E 4DV0I 1KTVA 2HKEA 2VQFI 4DUYI 1ZXNA 2A2CA 4DR7E 2X7IA 4PU9A 3ZKBA 1Z0BA 4UT4A 3ZZUA 4DV4E 4P52A 5IWAI 2A2DA 2UXDE 4X65E 4GKKE 4B3TI 4JI8I 4LF7E 4DPWA 1EA6A 4K0KE 3J81C 2EFGA 2UXBI 1D6TA 1FNMA 2DEIA 4JI2E 1KKHA 1HNZI 4JI6I 1VISA 4YHHE 1QZRA 2V34A 1IBMI 4DR2I 4DXLA 4JI4E 3H4LA 4DV7E 3ZZTA 4DR6I 4DR1I 2X36A 4DR3I 2VQEE 1N32I 4DV6E 1S4EA 4DPYA 4PRVA 1H7SA 1ELOA 4DV2I 3M6AA 4JI0E 2F4VI 4DV3E 3WU4A 2HHHI 4LF6E 4JV5I 4XTJA 4JYAI 1PIEA 2UUCI 1HNWI 4LF4E 2R3VA 1I94I 3K1JA 1XNQE 4NXNI 4LF8I 1EI1A 4JI7I 1HR0E 1A6FA 1H7UA 4LFAE 4DPUA 4KHPE 3PYGA 1Z5AA 2XEXA 1HNXI 3QT6A 1IBLE 4B3MI 1N34I 4RPFA 4Z7YA 4DR5E 4DPXA 4JI3E 4KHPI 4DV5E 1Z0WA 1XMOI 4M1KA 2OI2A 5LMUE 1ZM9A 1NHJA 1KIJA 4NXNE 3QT8A 4JI1I 4LFBE
chains in the Genus database with same CATH superfamily
1I94E 4LF4I 1DARA 4LCFA 4JG4A 1HNWE 3HULA 2ZITA 3B8HA 3J7AG 1FJGI 4LF6I 1IBKE 5JEAD 1N33E 1WUUA 3ZM7A 2E5LE 4B3SE 2UXCE 4MYTA 5K36D 5LMNE 3QT7A 1Z0GA 4USKA 5C0XA 1NHHA 5EKWA 2BV3A 2O1TA 1FJGE 5DROA 1Z5CA 4X64E 4MU1A 2V2ZA 2Z5EA 3GONA 1S16A 5DRPA 4LFBI 4FW9A 2AJ4A 2JE6A 2PNLA 4IZJD 2CZ9A 4J3DA 4LCGA 2BA1D 4U3DA 5DRQA 4DUZI 1RREA 5DRRA 2O3ZA 3Q1QA 4IFDD 4IFDA 2GO4A 2NN6A 4DV7I 1ZM3A 2BM0A 3JAMQ 1IBME 3CWVA 2HK2A 4DU8A 1ZM4A 1Z0VA 4YHHI 4HYMA 3LNUA 4I3HA 3ZKDA 4DR4E 4HACB 5C0XE 4JI5E 4QNJA 5IT9Q 4DR5I 2PO2A 2Q2EB 4B3RE 2J7KA 4B3RI 1MU5A 3GCMA 3T1YI 3J80C 1FI4A 5FLXC 2VESA 4JI5I 2CG9A 4DR4I 4DV1I 4OO1C 4X66E 4KQVA 4JI7E 2AE8A 4P7AA 4AIMA 4JI8E 4LF7I 4IFDB 3GMEA 3JAMC 1Z0EA 2UXDI 2BA0G 5JEAC 2VF3A 4DV4I 2NPFA 4JYAE 3U1KA 4IFDC 2PO0A 3J81Q 5K36C 2VQFE 4DUYE 1PKPA 2GQ0A 2HFSA 4BA2A 4OO1E 1OYPA 1Z59A 1USVA 4ED4A 4AM3A 3WU5A 1FWLA 2F4VE 1UDOA 1FKAE 1Y4UA 5LMNI 1XXEA 4DV2E 2C37A 2C38A 4UTGA 4EMDA 1N33I 3HKMA 1IBKI 1ZXMA 2JEBB 1B62A 4NXMI 2VQEI 4FWDA 2NN6B 4IFDE 4FW7A 1FWKA 4DR1E 4JI1E 4N3OA 2JE6B 2WP8A 1NHIA 2PO0B 4DR2E 4LF5I 3V5RA 1H74A 3OTOI 4X66I 1XMOE 4DV1E 4LF9I 4ZVIA 4DV5I 1U2RA 5L3JA 1B63A 2R42A 2Z5BA 4LCHA 4WUCA 3T1YE 5K36A 3PYDA 3K17A 4JI3I 4JI2I 4OO1D 1N34E 1K47A 2UXBE 3CDIA 1HNXE 1N0VC 1N36I 1H72C 1E3HA 2BA1G 4GKJE 1XNRE 2WW4A 3B82A 4FWGA 4QNKA 4K0KI 4LFAI 4ISAA 3P06A 5BR8I 2PO2B 4IZJA 1H73A 2WNRB 4MDTA 4DPTA 4X65I 1XMQE 1HR0I 4GKKI 1KVKA 2PNZA 4WUDA 4AQYI 4AIDA 5IWAE 2CVEA 5FLXQ 1N0UA 4DUZE 2E1RA 1XHKA 2HK3A 4FW3A 5A2QQ 4DR7I 1BKNA 1Y5YA 2NN6E 1Z0CA 4X64I 2IERA 4IZJB 1NZ0A 4DV0E 1ZM2A 3LTOA 2HHHE 4DU7A 3PS3A 1OYRA 3T1HE 4DV3I 2ZM6I 5C0XD 2UXCI 4X62E 4PRXA 5ELWA 4B3SI 4LFCE 4LOMA 2E5LI 1VI7A 5C0XB 3F0NA 3B78A 2Z5BB 4OX9I 4LFCI 1N32E 3P76A 2ZM6E 4URLA 4DR3E 1UDSA 4FWHA 5LMUI 4FW5A 3H1CA 4FW6A 2CGEA 4JI4I 5LL6R 2C39A 4YY3I 3Q6MA 2UUBE 2O1WA 2WNRA 2JT2A 1MG7A 2UUAI 4WUBA 4R1FA 4JI6E 3HJCA 3K85A 4AQYE 3M85G 1HNZE 4FW4A 1IBLI 4B3ME 2UU9E 2C37B 2NN6F 3CDJA 3PYEA 1XMQI 5BR8E 3J80Q 1MX0A 1OJ4A 2V2VA 1XNRI 4GKJI 3LPSA 5A2QC 1N36E 1UEKA 2UU9I 1UDNA 2GS8A 4HY1A 4B3TE 3QT5A 2BM1A 3M7NG 2HFUA 4LF8E 2O1VA 3J7AM 1XNQI 2UUAE 2LJPA 2JEAB 1PVGA 1Z0TA 4LF9E 3D4JA 2IOPA 4Z7CA 4YY3E 2UUBI 2UUCE 3OTOE 5IT9C 2V8PA 4IZKB 5GMEA 3WU6A 4JV5E 2ZBKB 2NN6D 1YH8A 4LF5E 5JEAE 2HKJA 3KRNA 3WU3A 4USMA 3GLLA 4FN5A 2V2QA 5GMDA 2DEJA 4MU0A 4JI0I 5FWKA 4OX9E 3PYFA 4NXME 4NBQA 4MYUA 1J5EE 5DNLA 1J5EI 3ZZ0A 1Y60A 2PO1A 1RR9A 3V2UC 4DV6I 4HXZA 4U3BA 4HACA 2BR2B 4X62I 5K36F 3T1HI 1Z5BA 3Q6NA 3L7ZA 4IFDF 2IESA 4DR6E 4DV0I 3M7ND 1KTVA 5K36B 2HKEA 2VQFI 4DUYI 1ZXNA 2A2CA 4DR7E 2X7IA 4PU9A 4MU4A 1Z0BA 3ZKBA 4OZEA 4UT4A 4OO1B 3ZZUA 4DV4E 3L7ZB 1USUA 4OKGA 2Z5CA 4P52A 5IWAI 2A2DA 2UXDE 4OO1F 4X65E 4GKKE 4B3TI 4JI8I 5EL9A 4LF7E 4DPWA 1EA6A 3B4TA 3P3EA 1R6MA 4K0KE 3J81C 1HK7A 2NN6C 4LPFA 2EFGA 2UXBI 4BA1B 1D6TA 1FNMA 2DEIA 1Y4SA 4JI2E 1KKHA 4MU3A 1HNZI 5DNXA 4JI6I 1OYSA 1VISA 5K36E 2C39B 2O1UA 4YHHE 1QZRA 2V34A 2JEAA 1IBMI 4DR2I 4DXLA 4JI4E 3H4LA 4DV7E 3ZZTA 4DR6I 4DR1I 2X36A 4DR3I 3PRYA 5C0XF 3M85D 2VQEE 1N32I 4DV6E 2J65A 1S4EA 4DPYA 3P3GA 5JEAF 1RHYA 4PRVA 2JEBA 1H7SA 1ELOA 3P3CA 1Y6ZA 4DV2I 2C38B 3M6AA 4JI0E 4BA1A 2F4VI 5JEAB 4DV3E 3WU4A 2HHHI 4LF6E 4JV5I 3UHMA 4BA2B 3U1YA 4XTJA 4JYAI 1PIEA 2UUCI 1HNWI 4LF4E 2R3VA 1I94I 2Z5CB 2IOQA 3K1JA 1XNQE 1R6LA 4NXNI 4LF8I 4OO1A 2PNMA 2PNZB 1EI1A 1E3PA 3PS2A 5C0XC 4JI7I 4GQUA 1HR0E 3NZKA 1A6FA 4IS9A 5JEAA 1H7UA 4LFAE 4DPUA 2BA0D 4KHPE 3PYGA 1Z5AA 2XEXA 1HNXI 2BR2A 3QT6A 2GO3A 1IBLE 4B3MI 1N34I 4RPFA 2PO1B 3PS1A 4Z7YA 4DR5E 4DPXA 4JI3E 4KHPI 4DV5E 1Z0WA 1XMOI 4M1KA 2OI2A 5LMUE 2WP8B 1YHCA 1ZM9A 3DD6A 4MQYA 1NHJA 2F1DA 1KIJA 1P42A 4IZKA 1UDQA 4NXNE 3QT8A 4JI1I 4LFBE
chains in the Genus database with same CATH topology
1I94E 4LF4I 1DARA 4JG4A 1HNWE 3HULA 2ZITA 3B8HA 3J7AG 1FJGI 4LF6I 1IBKE 1N33E 1WUUA 3ZM7A 2E5LE 4B3SE 2UXCE 4MYTA 5LMNE 3QT7A 1Z0GA 4USKA 1NHHA 2BV3A 2O1TA 1FJGE 4X64E 1Z5CA 2V2ZA 2Z5EA 3GONA 1S16A 4LFBI 4FW9A 2AJ4A 4IZJD 2PNLA 2CZ9A 4DUZI 1RREA 3Q1QA 4DV7I 1ZM3A 2BM0A 3JAMQ 1IBME 3CWVA 2HK2A 4DU8A 1ZM4A 1Z0VA 4YHHI 4HYMA 3LNUA 4I3HA 3ZKDA 4DR4E 4HACB 4JI5E 5IT9Q 4DR5I 2Q2EB 4B3RE 2J7KA 4B3RI 1MU5A 3T1YI 3J80C 1FI4A 5FLXC 4JI5I 2CG9A 4DR4I 4DV1I 4X66E 4KQVA 4JI7E 4P7AA 4JI8E 4LF7I 3JAMC 1Z0EA 2UXDI 2VF3A 4DV4I 2NPFA 4JYAE 3J81Q 2VQFE 4DUYE 1PKPA 2GQ0A 2HFSA 1Z59A 1USVA 4ED4A 3WU5A 1FWLA 2F4VE 1FKAE 1Y4UA 5LMNI 4DV2E 4UTGA 4EMDA 1N33I 1IBKI 1ZXMA 1B62A 4NXMI 2VQEI 4FWDA 1FWKA 4DR1E 4JI1E 4N3OA 1NHIA 4DR2E 4LF5I 3V5RA 1H74A 3OTOI 4X66I 1XMOE 4DV1E 4LF9I 4ZVIA 4DV5I 1U2RA 5L3JA 1B63A 2R42A 2Z5BA 4WUCA 3T1YE 3PYDA 3K17A 4JI3I 4JI2I 1N34E 1K47A 2UXBE 1HNXE 1N0VC 1N36I 1H72C 4GKJE 1XNRE 2WW4A 3B82A 4FWGA 4K0KI 4LFAI 3P06A 5BR8I 4IZJA 1H73A 4GKKI 4DPTA 4X65I 1XMQE 1HR0I 1KVKA 4WUDA 4AQYI 5IWAE 5FLXQ 1N0UA 4DUZE 2E1RA 1XHKA 2HK3A 5A2QQ 4DR7I 1BKNA 1Z0CA 4X64I 4IZJB 1NZ0A 4DV0E 1ZM2A 3LTOA 2HHHE 4DU7A 3T1HE 4DV3I 2ZM6I 2UXCI 4X62E 4PRXA 4B3SI 4LFCE 2E5LI 3F0NA 3B78A 2Z5BB 4OX9I 4LFCI 1N32E 2ZM6E 4URLA 4DR3E 4FWHA 5LMUI 2CGEA 4JI4I 5LL6R 4YY3I 2UUBE 3Q6MA 2O1WA 1MG7A 2UUAI 4WUBA 4R1FA 4JI6E 3HJCA 3K85A 4AQYE 1HNZE 1IBLI 4B3ME 2UU9E 3PYEA 1XMQI 5BR8E 3J80Q 1MX0A 1OJ4A 2V2VA 1XNRI 4GKJI 3LPSA 5A2QC 1N36E 1UEKA 2UU9I 2GS8A 4HY1A 4B3TE 3QT5A 2BM1A 2HFUA 4LF8E 2O1VA 3J7AM 1XNQI 2UUAE 2LJPA 1PVGA 1Z0TA 4LF9E 3D4JA 2IOPA 4Z7CA 4YY3E 2UUBI 2UUCE 3OTOE 5IT9C 2V8PA 4IZKB 5GMEA 3WU6A 4JV5E 2ZBKB 4LF5E 2HKJA 3WU3A 4USMA 4FN5A 2V2QA 5GMDA 2DEJA 4JI0I 5FWKA 4OX9E 3PYFA 4NXME 4MYUA 1J5EE 1J5EI 3ZZ0A 1RR9A 3V2UC 4DV6I 4HXZA 4HACA 4X62I 3T1HI 1Z5BA 3Q6NA 4DR6E 4DV0I 1KTVA 2HKEA 2VQFI 4DUYI 1ZXNA 2A2CA 4DR7E 2X7IA 4PU9A 3ZKBA 1Z0BA 4UT4A 3ZZUA 4DV4E 1USUA 2Z5CA 4P52A 5IWAI 2A2DA 2UXDE 4X65E 4GKKE 4B3TI 4JI8I 4LF7E 4DPWA 1EA6A 4K0KE 3J81C 1HK7A 2EFGA 2UXBI 1D6TA 1FNMA 2DEIA 1Y4SA 4JI2E 1KKHA 1HNZI 4JI6I 1VISA 2O1UA 4YHHE 1QZRA 2V34A 1IBMI 4DR2I 4DXLA 4JI4E 3H4LA 4DV7E 3ZZTA 4DR6I 4DR1I 2X36A 4DR3I 3PRYA 2VQEE 1N32I 4DV6E 1S4EA 4DPYA 4PRVA 1H7SA 1ELOA 1Y6ZA 4DV2I 3M6AA 4JI0E 2F4VI 4DV3E 3WU4A 2HHHI 4LF6E 4JV5I 4XTJA 4JYAI 1PIEA 2UUCI 1HNWI 4LF4E 2R3VA 1I94I 2Z5CB 2IOQA 3K1JA 1XNQE 4NXNI 4LF8I 2PNMA 1EI1A 4JI7I 1HR0E 1A6FA 1H7UA 4LFAE 4DPUA 4KHPE 3PYGA 1Z5AA 2XEXA 1HNXI 3QT6A 1IBLE 4B3MI 1N34I 4RPFA 4Z7YA 4DR5E 4DPXA 4JI3E 4KHPI 4DV5E 1Z0WA 1XMOI 4M1KA 2OI2A 5LMUE 1ZM9A 1NHJA 1KIJA 4IZKA 4NXNE 3QT8A 4JI1I 4LFBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 E;  4LF4 I;  1DAR A;  4JG4 A;  1HNW E;  3HUL A;  2ZIT A;  3B8H A;  3J7A G;  1FJG I;  4LF6 I;  1IBK E;  1N33 E;  1WUU A;  3ZM7 A;  2E5L E;  4B3S E;  2UXC E;  4MYT A;  5LMN E;  3QT7 A;  1Z0G A;  4USK A;  1NHH A;  2BV3 A;  1FJG E;  4X64 E;  1Z5C A;  2V2Z A;  3GON A;  1S16 A;  4LFB I;  4FW9 A;  2AJ4 A;  2CZ9 A;  4DUZ I;  1RRE A;  3Q1Q A;  4DV7 I;  1ZM3 A;  2BM0 A;  3JAM Q;  1IBM E;  3CWV A;  2HK2 A;  4DU8 A;  1ZM4 A;  1Z0V A;  4YHH I;  4HYM A;  3LNU A;  4I3H A;  3ZKD A;  4DR4 E;  4HAC B;  4JI5 E;  5IT9 Q;  4DR5 I;  2Q2E B;  4B3R E;  2J7K A;  4B3R I;  1MU5 A;  3T1Y I;  3J80 C;  1FI4 A;  5FLX C;  4JI5 I;  4DR4 I;  4DV1 I;  4X66 E;  4KQV A;  4JI7 E;  4P7A A;  4JI8 E;  4LF7 I;  3JAM C;  1Z0E A;  2UXD I;  2VF3 A;  4DV4 I;  2NPF A;  4JYA E;  3J81 Q;  2VQF E;  4DUY E;  1PKP A;  2HFS A;  1Z59 A;  4ED4 A;  3WU5 A;  1FWL A;  2F4V E;  1FKA E;  5LMN I;  4DV2 E;  4UTG A;  4EMD A;  1N33 I;  1IBK I;  1ZXM A;  1B62 A;  4NXM I;  2VQE I;  4FWD A;  1FWK A;  4DR1 E;  4JI1 E;  1NHI A;  4DR2 E;  4LF5 I;  3V5R A;  1H74 A;  3OTO I;  4X66 I;  1XMO E;  4DV1 E;  4LF9 I;  4ZVI A;  4DV5 I;  1U2R A;  5L3J A;  1B63 A;  2R42 A;  4WUC A;  3T1Y E;  3PYD A;  3K17 A;  4JI3 I;  4JI2 I;  1N34 E;  1K47 A;  2UXB E;  1HNX E;  1N0V C;  1N36 I;  1H72 C;  4GKJ E;  1XNR E;  2WW4 A;  3B82 A;  4FWG A;  4K0K I;  4LFA I;  5BR8 I;  1H73 A;  4GKK I;  4DPT A;  4X65 I;  1XMQ E;  1HR0 I;  1KVK A;  4WUD A;  4AQY I;  5IWA E;  5FLX Q;  1N0U A;  4DUZ E;  2E1R A;  1XHK A;  2HK3 A;  5A2Q Q;  4DR7 I;  1BKN A;  1Z0C A;  4X64 I;  1NZ0 A;  4DV0 E;  1ZM2 A;  3LTO A;  2HHH E;  4DU7 A;  3T1H E;  4DV3 I;  2ZM6 I;  2UXC I;  4X62 E;  4PRX A;  4B3S I;  4LFC E;  2E5L I;  3F0N A;  3B78 A;  4OX9 I;  4LFC I;  1N32 E;  2ZM6 E;  4URL A;  4DR3 E;  4FWH A;  5LMU I;  4JI4 I;  5LL6 R;  4YY3 I;  2UUB E;  1MG7 A;  2UUA I;  4WUB A;  4R1F A;  4JI6 E;  4AQY E;  1HNZ E;  1IBL I;  4B3M E;  2UU9 E;  3PYE A;  1XMQ I;  5BR8 E;  3J80 Q;  1MX0 A;  1OJ4 A;  2V2V A;  1XNR I;  4GKJ I;  3LPS A;  5A2Q C;  1N36 E;  1UEK A;  2UU9 I;  2GS8 A;  4HY1 A;  4B3T E;  3QT5 A;  2BM1 A;  2HFU A;  4LF8 E;  3J7A M;  1XNQ I;  2UUA E;  2LJP A;  1PVG A;  1Z0T A;  4LF9 E;  3D4J A;  4Z7C A;  4YY3 E;  2UUB I;  2UUC E;  3OTO E;  5IT9 C;  2V8P A;  5GME A;  3WU6 A;  4JV5 E;  2ZBK B;  4LF5 E;  2HKJ A;  3WU3 A;  4USM A;  4FN5 A;  2V2Q A;  5GMD A;  2DEJ A;  4JI0 I;  4OX9 E;  3PYF A;  4NXM E;  4MYU A;  1J5E E;  1J5E I;  3ZZ0 A;  1RR9 A;  3V2U C;  4DV6 I;  4HXZ A;  4HAC A;  4X62 I;  3T1H I;  1Z5B A;  4DR6 E;  4DV0 I;  1KTV A;  2HKE A;  2VQF I;  4DUY I;  1ZXN A;  2A2C A;  4DR7 E;  2X7I A;  4PU9 A;  3ZKB A;  1Z0B A;  4UT4 A;  3ZZU A;  4DV4 E;  4P52 A;  5IWA I;  2A2D A;  2UXD E;  4X65 E;  4GKK E;  4B3T I;  4JI8 I;  4LF7 E;  4DPW A;  1EA6 A;  4K0K E;  3J81 C;  2EFG A;  2UXB I;  1D6T A;  1FNM A;  2DEI A;  4JI2 E;  1KKH A;  1HNZ I;  4JI6 I;  1VIS A;  4YHH E;  1QZR A;  2V34 A;  1IBM I;  4DR2 I;  4DXL A;  4JI4 E;  3H4L A;  4DV7 E;  3ZZT A;  4DR6 I;  4DR1 I;  2X36 A;  4DR3 I;  2VQE E;  1N32 I;  4DV6 E;  1S4E A;  4DPY A;  4PRV A;  1H7S A;  1ELO A;  4DV2 I;  3M6A A;  4JI0 E;  2F4V I;  4DV3 E;  3WU4 A;  2HHH I;  4LF6 E;  4JV5 I;  4XTJ A;  4JYA I;  1PIE A;  2UUC I;  1HNW I;  4LF4 E;  2R3V A;  1I94 I;  3K1J A;  1XNQ E;  4NXN I;  4LF8 I;  1EI1 A;  4JI7 I;  1HR0 E;  1A6F A;  1H7U A;  4LFA E;  4DPU A;  4KHP E;  3PYG A;  1Z5A A;  2XEX A;  1HNX I;  3QT6 A;  1IBL E;  4B3M I;  1N34 I;  4RPF A;  4Z7Y A;  4DR5 E;  4DPX A;  4JI3 E;  4KHP I;  4DV5 E;  1Z0W A;  1XMO I;  4M1K A;  2OI2 A;  5LMU E;  1ZM9 A;  1NHJ A;  1KIJ A;  4NXN E;  3QT8 A;  4JI1 I;  4LFB E; 
#chains in the Genus database with same CATH topology
 1I94 E;  4LF4 I;  1DAR A;  4LCF A;  4JG4 A;  1HNW E;  3HUL A;  2ZIT A;  3B8H A;  3J7A G;  1FJG I;  4LF6 I;  1IBK E;  5JEA D;  1N33 E;  1WUU A;  3ZM7 A;  2E5L E;  4B3S E;  2UXC E;  4MYT A;  5K36 D;  5LMN E;  3QT7 A;  1Z0G A;  4USK A;  5C0X A;  1NHH A;  5EKW A;  2BV3 A;  2O1T A;  1FJG E;  5DRO A;  1Z5C A;  4X64 E;  4MU1 A;  2V2Z A;  2Z5E A;  3GON A;  1S16 A;  5DRP A;  4LFB I;  4FW9 A;  2AJ4 A;  2JE6 A;  2PNL A;  4IZJ D;  2CZ9 A;  4J3D A;  4LCG A;  2BA1 D;  4U3D A;  5DRQ A;  4DUZ I;  1RRE A;  5DRR A;  2O3Z A;  3Q1Q A;  4IFD D;  4IFD A;  2GO4 A;  2NN6 A;  4DV7 I;  1ZM3 A;  2BM0 A;  3JAM Q;  1IBM E;  3CWV A;  2HK2 A;  4DU8 A;  1ZM4 A;  1Z0V A;  4YHH I;  4HYM A;  3LNU A;  4I3H A;  3ZKD A;  4DR4 E;  4HAC B;  5C0X E;  4JI5 E;  4QNJ A;  5IT9 Q;  4DR5 I;  2PO2 A;  2Q2E B;  4B3R E;  2J7K A;  4B3R I;  1MU5 A;  3GCM A;  3T1Y I;  3J80 C;  1FI4 A;  5FLX C;  2VES A;  4JI5 I;  2CG9 A;  4DR4 I;  4DV1 I;  4OO1 C;  4X66 E;  4KQV A;  4JI7 E;  2AE8 A;  4P7A A;  4AIM A;  4JI8 E;  4LF7 I;  4IFD B;  3GME A;  3JAM C;  1Z0E A;  2UXD I;  2BA0 G;  5JEA C;  2VF3 A;  4DV4 I;  2NPF A;  4JYA E;  3U1K A;  4IFD C;  2PO0 A;  3J81 Q;  5K36 C;  2VQF E;  4DUY E;  1PKP A;  2GQ0 A;  2HFS A;  4BA2 A;  4OO1 E;  1OYP A;  1Z59 A;  1USV A;  4ED4 A;  4AM3 A;  3WU5 A;  1FWL A;  2F4V E;  1UDO A;  1FKA E;  1Y4U A;  5LMN I;  1XXE A;  4DV2 E;  2C37 A;  2C38 A;  4UTG A;  4EMD A;  1N33 I;  3HKM A;  1IBK I;  1ZXM A;  2JEB B;  1B62 A;  4NXM I;  2VQE I;  4FWD A;  2NN6 B;  4IFD E;  4FW7 A;  1FWK A;  4DR1 E;  4JI1 E;  4N3O A;  2JE6 B;  2WP8 A;  1NHI A;  2PO0 B;  4DR2 E;  4LF5 I;  3V5R A;  1H74 A;  3OTO I;  4X66 I;  1XMO E;  4DV1 E;  4LF9 I;  4ZVI A;  4DV5 I;  1U2R A;  5L3J A;  1B63 A;  2R42 A;  2Z5B A;  4LCH A;  4WUC A;  3T1Y E;  5K36 A;  3PYD A;  3K17 A;  4JI3 I;  4JI2 I;  4OO1 D;  1N34 E;  1K47 A;  2UXB E;  3CDI A;  1HNX E;  1N0V C;  1N36 I;  1H72 C;  1E3H A;  2BA1 G;  4GKJ E;  1XNR E;  2WW4 A;  3B82 A;  4FWG A;  4QNK A;  4K0K I;  4LFA I;  4ISA A;  3P06 A;  5BR8 I;  2PO2 B;  4IZJ A;  1H73 A;  2WNR B;  4MDT A;  4DPT A;  4X65 I;  1XMQ E;  1HR0 I;  4GKK I;  1KVK A;  2PNZ A;  4WUD A;  4AQY I;  4AID A;  5IWA E;  2CVE A;  5FLX Q;  1N0U A;  4DUZ E;  2E1R A;  1XHK A;  2HK3 A;  4FW3 A;  5A2Q Q;  4DR7 I;  1BKN A;  1Y5Y A;  2NN6 E;  1Z0C A;  4X64 I;  2IER A;  4IZJ B;  1NZ0 A;  4DV0 E;  1ZM2 A;  3LTO A;  2HHH E;  4DU7 A;  3PS3 A;  1OYR A;  3T1H E;  4DV3 I;  2ZM6 I;  5C0X D;  2UXC I;  4X62 E;  4PRX A;  5ELW A;  4B3S I;  4LFC E;  4LOM A;  2E5L I;  1VI7 A;  5C0X B;  3F0N A;  3B78 A;  2Z5B B;  4OX9 I;  4LFC I;  1N32 E;  3P76 A;  2ZM6 E;  4URL A;  4DR3 E;  1UDS A;  4FWH A;  5LMU I;  4FW5 A;  3H1C A;  4FW6 A;  2CGE A;  4JI4 I;  5LL6 R;  2C39 A;  4YY3 I;  3Q6M A;  2UUB E;  2O1W A;  2WNR A;  2JT2 A;  1MG7 A;  2UUA I;  4WUB A;  4R1F A;  4JI6 E;  3HJC A;  3K85 A;  4AQY E;  3M85 G;  1HNZ E;  4FW4 A;  1IBL I;  4B3M E;  2UU9 E;  2C37 B;  2NN6 F;  3CDJ A;  3PYE A;  1XMQ I;  5BR8 E;  3J80 Q;  1MX0 A;  1OJ4 A;  2V2V A;  1XNR I;  4GKJ I;  3LPS A;  5A2Q C;  1N36 E;  1UEK A;  2UU9 I;  1UDN A;  2GS8 A;  4HY1 A;  4B3T E;  3QT5 A;  2BM1 A;  3M7N G;  2HFU A;  4LF8 E;  2O1V A;  3J7A M;  1XNQ I;  2UUA E;  2LJP A;  2JEA B;  1PVG A;  1Z0T A;  4LF9 E;  3D4J A;  2IOP A;  4Z7C A;  4YY3 E;  2UUB I;  2UUC E;  3OTO E;  5IT9 C;  2V8P A;  4IZK B;  5GME A;  3WU6 A;  4JV5 E;  2ZBK B;  2NN6 D;  1YH8 A;  4LF5 E;  5JEA E;  2HKJ A;  3KRN A;  3WU3 A;  4USM A;  3GLL A;  4FN5 A;  2V2Q A;  5GMD A;  2DEJ A;  4MU0 A;  4JI0 I;  5FWK A;  4OX9 E;  3PYF A;  4NXM E;  4NBQ A;  4MYU A;  1J5E E;  5DNL A;  1J5E I;  3ZZ0 A;  1Y60 A;  2PO1 A;  1RR9 A;  3V2U C;  4DV6 I;  4HXZ A;  4U3B A;  4HAC A;  2BR2 B;  4X62 I;  5K36 F;  3T1H I;  1Z5B A;  3Q6N A;  3L7Z A;  4IFD F;  2IES A;  4DR6 E;  4DV0 I;  3M7N D;  1KTV A;  5K36 B;  2HKE A;  2VQF I;  4DUY I;  1ZXN A;  2A2C A;  4DR7 E;  2X7I A;  4PU9 A;  4MU4 A;  1Z0B A;  3ZKB A;  4OZE A;  4UT4 A;  4OO1 B;  3ZZU A;  4DV4 E;  3L7Z B;  1USU A;  4OKG A;  2Z5C A;  4P52 A;  5IWA I;  2A2D A;  2UXD E;  4OO1 F;  4X65 E;  4GKK E;  4B3T I;  4JI8 I;  5EL9 A;  4LF7 E;  4DPW A;  1EA6 A;  3B4T A;  3P3E A;  1R6M A;  4K0K E;  3J81 C;  1HK7 A;  2NN6 C;  4LPF A;  2EFG A;  2UXB I;  4BA1 B;  1D6T A;  1FNM A;  2DEI A;  1Y4S A;  4JI2 E;  1KKH A;  4MU3 A;  1HNZ I;  5DNX A;  4JI6 I;  1OYS A;  1VIS A;  5K36 E;  2C39 B;  2O1U A;  4YHH E;  1QZR A;  2V34 A;  2JEA A;  1IBM I;  4DR2 I;  4DXL A;  4JI4 E;  3H4L A;  4DV7 E;  3ZZT A;  4DR6 I;  4DR1 I;  2X36 A;  4DR3 I;  3PRY A;  5C0X F;  3M85 D;  2VQE E;  1N32 I;  4DV6 E;  2J65 A;  1S4E A;  4DPY A;  3P3G A;  5JEA F;  1RHY A;  4PRV A;  2JEB A;  1H7S A;  1ELO A;  3P3C A;  1Y6Z A;  4DV2 I;  2C38 B;  3M6A A;  4JI0 E;  4BA1 A;  2F4V I;  5JEA B;  4DV3 E;  3WU4 A;  2HHH I;  4LF6 E;  4JV5 I;  3UHM A;  4BA2 B;  3U1Y A;  4XTJ A;  4JYA I;  1PIE A;  2UUC I;  1HNW I;  4LF4 E;  2R3V A;  1I94 I;  2Z5C B;  2IOQ A;  3K1J A;  1XNQ E;  1R6L A;  4NXN I;  4LF8 I;  4OO1 A;  2PNM A;  2PNZ B;  1EI1 A;  1E3P A;  3PS2 A;  5C0X C;  4JI7 I;  4GQU A;  1HR0 E;  3NZK A;  1A6F A;  4IS9 A;  5JEA A;  1H7U A;  4LFA E;  4DPU A;  2BA0 D;  4KHP E;  3PYG A;  1Z5A A;  2XEX A;  1HNX I;  2BR2 A;  3QT6 A;  2GO3 A;  1IBL E;  4B3M I;  1N34 I;  4RPF A;  2PO1 B;  3PS1 A;  4Z7Y A;  4DR5 E;  4DPX A;  4JI3 E;  4KHP I;  4DV5 E;  1Z0W A;  1XMO I;  4M1K A;  2OI2 A;  5LMU E;  2WP8 B;  1YHC A;  1ZM9 A;  3DD6 A;  4MQY A;  1NHJ A;  2F1D A;  1KIJ A;  1P42 A;  4IZK A;  1UDQ A;  4NXN E;  3QT8 A;  4JI1 I;  4LFB E; 
#chains in the Genus database with same CATH homology
 1I94 E;  4LF4 I;  1DAR A;  4JG4 A;  1HNW E;  3HUL A;  2ZIT A;  3B8H A;  3J7A G;  1FJG I;  4LF6 I;  1IBK E;  1N33 E;  1WUU A;  3ZM7 A;  2E5L E;  4B3S E;  2UXC E;  4MYT A;  5LMN E;  3QT7 A;  1Z0G A;  4USK A;  1NHH A;  2BV3 A;  2O1T A;  1FJG E;  4X64 E;  1Z5C A;  2V2Z A;  2Z5E A;  3GON A;  1S16 A;  4LFB I;  4FW9 A;  2AJ4 A;  4IZJ D;  2PNL A;  2CZ9 A;  4DUZ I;  1RRE A;  3Q1Q A;  4DV7 I;  1ZM3 A;  2BM0 A;  3JAM Q;  1IBM E;  3CWV A;  2HK2 A;  4DU8 A;  1ZM4 A;  1Z0V A;  4YHH I;  4HYM A;  3LNU A;  4I3H A;  3ZKD A;  4DR4 E;  4HAC B;  4JI5 E;  5IT9 Q;  4DR5 I;  2Q2E B;  4B3R E;  2J7K A;  4B3R I;  1MU5 A;  3T1Y I;  3J80 C;  1FI4 A;  5FLX C;  4JI5 I;  2CG9 A;  4DR4 I;  4DV1 I;  4X66 E;  4KQV A;  4JI7 E;  4P7A A;  4JI8 E;  4LF7 I;  3JAM C;  1Z0E A;  2UXD I;  2VF3 A;  4DV4 I;  2NPF A;  4JYA E;  3J81 Q;  2VQF E;  4DUY E;  1PKP A;  2GQ0 A;  2HFS A;  1Z59 A;  1USV A;  4ED4 A;  3WU5 A;  1FWL A;  2F4V E;  1FKA E;  1Y4U A;  5LMN I;  4DV2 E;  4UTG A;  4EMD A;  1N33 I;  1IBK I;  1ZXM A;  1B62 A;  4NXM I;  2VQE I;  4FWD A;  1FWK A;  4DR1 E;  4JI1 E;  4N3O A;  1NHI A;  4DR2 E;  4LF5 I;  3V5R A;  1H74 A;  3OTO I;  4X66 I;  1XMO E;  4DV1 E;  4LF9 I;  4ZVI A;  4DV5 I;  1U2R A;  5L3J A;  1B63 A;  2R42 A;  2Z5B A;  4WUC A;  3T1Y E;  3PYD A;  3K17 A;  4JI3 I;  4JI2 I;  1N34 E;  1K47 A;  2UXB E;  1HNX E;  1N0V C;  1N36 I;  1H72 C;  4GKJ E;  1XNR E;  2WW4 A;  3B82 A;  4FWG A;  4K0K I;  4LFA I;  3P06 A;  5BR8 I;  4IZJ A;  1H73 A;  4GKK I;  4DPT A;  4X65 I;  1XMQ E;  1HR0 I;  1KVK A;  4WUD A;  4AQY I;  5IWA E;  5FLX Q;  1N0U A;  4DUZ E;  2E1R A;  1XHK A;  2HK3 A;  5A2Q Q;  4DR7 I;  1BKN A;  1Z0C A;  4X64 I;  4IZJ B;  1NZ0 A;  4DV0 E;  1ZM2 A;  3LTO A;  2HHH E;  4DU7 A;  3T1H E;  4DV3 I;  2ZM6 I;  2UXC I;  4X62 E;  4PRX A;  4B3S I;  4LFC E;  2E5L I;  3F0N A;  3B78 A;  2Z5B B;  4OX9 I;  4LFC I;  1N32 E;  2ZM6 E;  4URL A;  4DR3 E;  4FWH A;  5LMU I;  2CGE A;  4JI4 I;  5LL6 R;  4YY3 I;  2UUB E;  3Q6M A;  2O1W A;  1MG7 A;  2UUA I;  4WUB A;  4R1F A;  4JI6 E;  3HJC A;  3K85 A;  4AQY E;  1HNZ E;  1IBL I;  4B3M E;  2UU9 E;  3PYE A;  1XMQ I;  5BR8 E;  3J80 Q;  1MX0 A;  1OJ4 A;  2V2V A;  1XNR I;  4GKJ I;  3LPS A;  5A2Q C;  1N36 E;  1UEK A;  2UU9 I;  2GS8 A;  4HY1 A;  4B3T E;  3QT5 A;  2BM1 A;  2HFU A;  4LF8 E;  2O1V A;  3J7A M;  1XNQ I;  2UUA E;  2LJP A;  1PVG A;  1Z0T A;  4LF9 E;  3D4J A;  2IOP A;  4Z7C A;  4YY3 E;  2UUB I;  2UUC E;  3OTO E;  5IT9 C;  2V8P A;  4IZK B;  5GME A;  3WU6 A;  4JV5 E;  2ZBK B;  4LF5 E;  2HKJ A;  3WU3 A;  4USM A;  4FN5 A;  2V2Q A;  5GMD A;  2DEJ A;  4JI0 I;  5FWK A;  4OX9 E;  3PYF A;  4NXM E;  4MYU A;  1J5E E;  1J5E I;  3ZZ0 A;  1RR9 A;  3V2U C;  4DV6 I;  4HXZ A;  4HAC A;  4X62 I;  3T1H I;  1Z5B A;  3Q6N A;  4DR6 E;  4DV0 I;  1KTV A;  2HKE A;  2VQF I;  4DUY I;  1ZXN A;  2A2C A;  4DR7 E;  2X7I A;  4PU9 A;  3ZKB A;  1Z0B A;  4UT4 A;  3ZZU A;  4DV4 E;  1USU A;  2Z5C A;  4P52 A;  5IWA I;  2A2D A;  2UXD E;  4X65 E;  4GKK E;  4B3T I;  4JI8 I;  4LF7 E;  4DPW A;  1EA6 A;  4K0K E;  3J81 C;  1HK7 A;  2EFG A;  2UXB I;  1D6T A;  1FNM A;  2DEI A;  1Y4S A;  4JI2 E;  1KKH A;  1HNZ I;  4JI6 I;  1VIS A;  2O1U A;  4YHH E;  1QZR A;  2V34 A;  1IBM I;  4DR2 I;  4DXL A;  4JI4 E;  3H4L A;  4DV7 E;  3ZZT A;  4DR6 I;  4DR1 I;  2X36 A;  4DR3 I;  3PRY A;  2VQE E;  1N32 I;  4DV6 E;  1S4E A;  4DPY A;  4PRV A;  1H7S A;  1ELO A;  1Y6Z A;  4DV2 I;  3M6A A;  4JI0 E;  2F4V I;  4DV3 E;  3WU4 A;  2HHH I;  4LF6 E;  4JV5 I;  4XTJ A;  4JYA I;  1PIE A;  2UUC I;  1HNW I;  4LF4 E;  2R3V A;  1I94 I;  2Z5C B;  2IOQ A;  3K1J A;  1XNQ E;  4NXN I;  4LF8 I;  2PNM A;  1EI1 A;  4JI7 I;  1HR0 E;  1A6F A;  1H7U A;  4LFA E;  4DPU A;  4KHP E;  3PYG A;  1Z5A A;  2XEX A;  1HNX I;  3QT6 A;  1IBL E;  4B3M I;  1N34 I;  4RPF A;  4Z7Y A;  4DR5 E;  4DPX A;  4JI3 E;  4KHP I;  4DV5 E;  1Z0W A;  1XMO I;  4M1K A;  2OI2 A;  5LMU E;  1ZM9 A;  1NHJ A;  1KIJ A;  4IZK A;  4NXN E;  3QT8 A;  4JI1 I;  4LFB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...