4LFBI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfbI00
3V5RA 4DR6E 2F4VI 4DR5E 4M1KA 1I94I 1BKNA 2F4VE 4AQYI 1NHHA 1Z5AA 1I94E 3D4JA 4AQYE 4OX9I 4DR4I 4JI0I 1H7UA 4ED4A 3QT8A 3ZZ0A 4DR3I 4DXLA 5L3JA 4DR4E 1EA6A 2ZM6I 4DR3E 1H7SA 2ZM6E 3F0NA 3WU6A 5FLXQ 2Q2EB 2V34A 4PRVA 5LMNI 1RR9A 2V2ZA 2HFUA 1VISA 3K17A 3QT6A 2E1RA 4HXZA 4DV6I 4FWGA 4DV6E 3JAMQ 1Z59A 1Z0EA 4X65I 4MYUA 1HNXI 1N36I 4X65E 1HNXE 1N36E 1XMOI 1RREA 1ZXMA 4B3TI 1HNWI 1XMOE 4B3TE 1HNWE 4DPWA 1Z0CA 2DEIA 3B78A 5IT9Q 1N0VC 5IWAI 4DR2I 5IWAE 2HKJA 4DU8A 4DR2E 1ELOA 3J81Q 1QZRA 4JI3I 1N34I 4JI8E 3J80Q 2VQFI 4FN5A 2A2DA 4WUDA 4JI3E 1N34E 3Q1QA 2VQFE 2BM0A 3J7AG 1UEKA 2ZITA 4HACA 3B8HA 1MU5A 2UU9I 1H73A 1N33I 4HACB 4DR1I 3T1HE 1KKHA 4DV1E 2UU9E 1D6TA 4DR7I 1N33E 4DR1E 4DR7E 1U2RA 2V2VA 1ZM3A 2HK3A 1FWKA 4LF6E 4X62I 4B3MI 4DV3I 3OTOI 1J5EI 4X62E 4B3ME 4YY3I 4DV3E 3OTOE 4DR5I 1J5EE 4YY3E 4DPTA 4I3HA 5FLXC 3M6AA 4JI4I 4B3RI 2CZ9A 2WW4A 1XNQI 4JI4E 2E5LE 4B3RE 1KTVA 1MG7A 1XMQI 1XNQE 4WUBA 4DV2E 4DV0I 1XMQE 4HYMA 4LF8E 4GKKI 3JAMC 3PYGA 4DV0E 4JG4A 4GKKE 4DV7I 4WUCA 3B82A 1ZM4A 4DV7E 3ZKDA 1OJ4A 3K1JA 4P52A 1K47A 1FKAE 4FWDA 3V2UC 2BM1A 2VQEI 4FWHA 2VQEE 4R1FA 2HK2A 4FW9A 5IT9C 1S4EA 4LFAI 4GKJI 1NHJA 4LFBI 4LFAE 4B3SI 4GKJE 3J81C 1MX0A 4NXNI 4Z7YA 4X66E 4JI7I 3QT5A 4LFBE 4B3SE 3J80C 4YHHI 5GMDA 1XNRI 4JI7E 4NXNE 2R42A 4KHPI 4YHHE 1XNRE 4USMA 4UT4A 1NHIA 4KHPE 5A2QQ 2HHHI 4DUYI 2X7IA 1S16A 4PRXA 2UUCI 2HHHE 4DUYE 4LF5I 4JI8I 2LJPA 5LMUI 2UUCE 4LF5E 1IBMI 5LMUE 1IBKI 2HFSA 3WU3A 1IBME 2V2QA 3CWVA 1KVKA 4NXME 1IBKE 4MYTA 2X36A 2A2CA 1H72C 3J7AM 3T1HI 4DV1I 3WU4A 4JYAI 4JYAE 1PVGA 4LF6I 1FJGI 2EFGA 3LTOA 1FJGE 1Z0GA 5BR8I 1B63A 2UXDI 4DPYA 5BR8E 2UXDE 4JV5I 4JV5E 4HY1A 1ZM9A 3PYFA 1WUUA 2UXCI 1ZM2A 4LFCI 2E5LI 3ZZUA 1Z0WA 2UXCE 4K0KI 4LFCE 2HKEA 4K0KE 4DV2I 4LF8I 3ZKBA 4Z7CA 2NPFA 1HR0I 4DU7A 4PU9A 4USKA 2XEXA 1H74A 3WU5A 1HR0E 1FNMA 4X64I 4OX9E 1B62A 4EMDA 4JI2I 4JI0E 4X64E 2GS8A 3ZM7A 4JI2E 1Z0BA 4JI5I 3LNUA 4DPXA 4JI5E 4RPFA 4LF4I 1Z0VA 2BV3A 1XHKA 4LF4E 5LMNE 4DV4I 5A2QC 1A6FA 4UTGA 4DUZI 5GMEA 2VF3A 3ZZTA 1Z5CA 2ZBKB 4DV4E 2UUBI 4URLA 4X66I 1Z5BA 4DUZE 2UUBE 4DV5I 1EI1A 2R3VA 2UXBI 4DV5E 2UXBE 1HNZI 3QT7A 4P7AA 4ZVIA 1N0UA 1HNZE 3HULA 4DPUA 3GONA 1FI4A 4NXMI 4XTJA 1N32I 4LF9I 1N32E 4LF9E 1PKPA 2DEJA 5LL6R 3T1YI 1Z0TA 1NZ0A 3PYEA 3PYDA 1IBLI 1FWLA 3T1YE 1KIJA 2OI2A 1IBLE 2V8PA 3H4LA 2J7KA 2AJ4A 2UUAI 4JI6I 4JI1I 4LF7I 1ZXNA 3LPSA 2UUAE 4JI6E 1PIEA 4JI1E 4LF7E 4KQVA 1DARA 4DR6I
chains in the Genus database with same CATH superfamily
3PS2A 3V5RA 4DR6E 2F4VI 4DR5E 4M1KA 4IZJB 4MU3A 1I94I 2C37A 1BKNA 4IFDB 2F4VE 4AQYI 1NHHA 1Z5AA 1I94E 3D4JA 4AQYE 4OX9I 4DR4I 4JI0I 1H7UA 4ED4A 3GLLA 2C37B 3QT8A 3ZZ0A 4AIMA 4DR3I 3GMEA 4DXLA 5L3JA 5K36F 4DR4E 4FW3A 1EA6A 2C39A 2JEBA 2ZM6I 4DR3E 4IS9A 4LOMA 5JEAE 1H7SA 2ZM6E 3F0NA 2C39B 2JEBB 3WU6A 5FLXQ 2Q2EB 2V34A 4PRVA 5LMNI 1RR9A 4FW5A 4U3DA 2V2ZA 2CG9A 2HFUA 1VISA 3K17A 3QT6A 2E1RA 4HXZA 4DV6I 2CVEA 2GO3A 4FWGA 1Y5YA 4DV6E 3JAMQ 1Z59A 1Z0EA 5K36E 4X65I 3M85D 4MYUA 4OO1D 1HNXI 1N36I 4X65E 3PS1A 1HNXE 1P42A 1Y60A 1N36E 1XMOI 1RREA 1ZXMA 4B3TI 4OKGA 1HNWI 5C0XB 1XMOE 4B3TE 1HNWE 4DPWA 4MQYA 2BR2A 1Z0CA 2C38A 2DEIA 3B78A 5IT9Q 1N0VC 5IWAI 2NN6C 2BR2B 2Z5BA 2C38B 1Y4SA 4DR2I 5IWAE 2HKJA 1RHYA 4DU8A 4DR2E 2Z5BB 1ELOA 3J81Q 1QZRA 5ELWA 4JI3I 1N34I 4JI8E 3J80Q 2VQFI 4FN5A 2A2DA 4WUDA 4JI3E 1N34E 3Q1QA 3KRNA 2VQFE 4MU1A 2BM0A 3J7AG 1UEKA 5JEAD 2ZITA 4HACA 3P3GA 3B8HA 1MU5A 2UU9I 3U1YA 4LCGA 1H73A 1N33I 3L7ZA 4HACB 4DR1I 3T1HE 1KKHA 4DV1E 2UU9E 5DROA 1D6TA 4DR7I 1N33E 3CDIA 3Q6NA 4DR1E 4DR7E 1U2RA 2V2VA 3L7ZB 1ZM3A 2HK3A 1FWKA 5K36D 4LF6E 4X62I 4B3MI 4DV3I 3OTOI 1J5EI 4X62E 4B3ME 4YY3I 4DV3E 3OTOE 4DR5I 1J5EE 4YY3E 1Y4UA 2NN6F 2VESA 3P06A 4DPTA 4FW4A 1YH8A 2O1VA 2PO0A 4I3HA 5FLXC 4IFDC 3M6AA 4JI4I 2JT2A 2O1WA 2CZ9A 2WW4A 5EKWA 2PO0B 1XNQI 4JI4E 4B3RI 2E5LE 4B3RE 1E3HA 1KTVA 1MG7A 1XMQI 3HJCA 1XNQE 4WUBA 4DV2E 4DV0I 1XMQE 4HYMA 4LF8E 4GKKI 3JAMC 4OO1A 5C0XE 3PYGA 4DV0E 4JG4A 4GKKE 4DV7I 4WUCA 3B82A 1ZM4A 2NN6E 4DV7E 4OO1B 1OYSA 4QNJA 3ZKDA 4IZKA 1OJ4A 3K1JA 3H1CA 4P52A 2IOPA 4IZJD 1K47A 1FKAE 4FWDA 3V2UC 2BM1A 2BA0D 2VQEI 4FWHA 4LCFA 2VQEE 2O3ZA 4MU0A 4R1FA 1R6LA 2HK2A 4FW9A 5IT9C 1S4EA 4LFAI 4GKJI 1NHJA 1UDNA 4LFBI 4LFAE 3M85G 4B3SI 4U3BA 2WNRA 4GKJE 3J81C 1MX0A 4NXNI 4Z7YA 4X66E 4JI7I 3QT5A 3DD6A 5C0XC 4LFBE 4B3SE 4IFDF 3J80C 5JEAA 5GMDA 4YHHI 1XNRI 4JI7E 4NXNE 5EL9A 2PO2A 2R42A 4KHPI 2WNRB 4YHHE 3P3CA 1XNRE 4USMA 1NHIA 4UT4A 4KHPE 5A2QQ 2HHHI 4DUYI 2X7IA 5JEAB 1S16A 2PO2B 4PRXA 2UUCI 2HHHE 4DUYE 4LF5I 4JI8I 3Q6MA 2LJPA 5LMUI 2UUCE 2Z5EA 4J3DA 2Z5CA 4LF5E 2GQ0A 1IBMI 3M7ND 5LMUE 5DRQA 1IBKI 2HFSA 3WU3A 1IBME 2V2QA 3CWVA 1KVKA 4NXME 1IBKE 2Z5CB 5K36A 4FW7A 4MYTA 2X36A 2A2CA 5C0XD 1H72C 3J7AM 3T1HI 4DV1I 4IFDE 2GO4A 3WU4A 2O1UA 5K36B 2PO1A 1UDOA 2NN6D 2AE8A 1Y6ZA 2BA1D 4JYAI 1VI7A 2PO1B 2PNZA 2CGEA 4JYAE 1PVGA 4LF6I 2PNLA 1FJGI 5DRPA 2EFGA 3LTOA 4AIDA 1FJGE 1Z0GA 2BA1G 1OYRA 5BR8I 1B63A 5C0XF 2UXDI 4DPYA 5BR8E 2WP8A 2UXDE 4JV5I 4JV5E 4HY1A 1ZM9A 3PYFA 1WUUA 2UXCI 1ZM2A 4LFCI 2JEAA 2E5LI 3ZZUA 1Z0WA 2UXCE 4K0KI 3P76A 4LFCE 4IZJA 3HKMA 2IOQA 2HKEA 3GCMA 4K0KE 4DV2I 2JEAB 4LF8I 5DRRA 3ZKBA 4Z7CA 2NPFA 1HR0I 4DU7A 4PU9A 4USKA 2XEXA 1H74A 3WU5A 1HR0E 1FNMA 3P3EA 2F1DA 4X64I 4QNKA 4OX9E 1B62A 1OYPA 4EMDA 4JI2I 4X64E 4JI0E 2GS8A 4OO1C 2IESA 3ZM7A 4JI2E 4IFDD 1Z0BA 2PNMA 4GQUA 5DNXA 4JI5I 2JE6A 3LNUA 4ISAA 4IZKB 4DPXA 4JI5E 1USUA 4OZEA 4RPFA 4LF4I 1Z0VA 2J65A 2BV3A 1XHKA 2JE6B 1HK7A 4LF4E 4N3OA 5LMNE 4DV4I 5A2QC 2BA0G 1A6FA 4UTGA 4DUZI 5GMEA 2VF3A 3ZZTA 4AM3A 1Z5CA 2ZBKB 4DV4E 2UUBI 4URLA 4X66I 3B4TA 1Z5BA 4DUZE 4LCHA 2UUBE 4DV5I 1EI1A 2R3VA 2UXBI 4DV5E 4MU4A 4NBQA 5FWKA 2UXBE 1UDQA 5C0XA 1HNZI 2IERA 3QT7A 4P7AA 4ZVIA 1N0UA 1HNZE 1XXEA 2NN6A 3HULA 5JEAC 4DPUA 3GONA 3U1KA 1FI4A 4MDTA 4NXMI 2NN6B 4XTJA 1N32I 4LF9I 4BA2A 1N32E 4LF9E 4OO1F 3M7NG 1PKPA 4BA2B 2DEJA 5LL6R 4LPFA 3T1YI 5K36C 1Z0TA 1NZ0A 3PRYA 3PYEA 5DNLA 4FW6A 3PYDA 1IBLI 1FWLA 3T1YE 1KIJA 1UDSA 2OI2A 3NZKA 1IBLE 2V8PA 3H4LA 2PNZB 1YHCA 3CDJA 4BA1A 2J7KA 1USVA 3PS3A 3UHMA 3K85A 4OO1E 2AJ4A 2UUAI 4JI6I 1R6MA 4BA1B 4JI1I 4LF7I 1ZXNA 2WP8B 3LPSA 2UUAE 4JI6E 1PIEA 4JI1E 4LF7E 4KQVA 5JEAF 1DARA 2O1TA 4IFDA 4DR6I 1E3PA
chains in the Genus database with same CATH topology
3V5RA 4DR6E 2F4VI 4DR5E 4M1KA 4IZJB 1I94I 1BKNA 2F4VE 4AQYI 1NHHA 1Z5AA 1I94E 3D4JA 4AQYE 4OX9I 4DR4I 4JI0I 1H7UA 4ED4A 3QT8A 3ZZ0A 4DR3I 4DXLA 5L3JA 4DR4E 1EA6A 2ZM6I 4DR3E 1H7SA 2ZM6E 3F0NA 3WU6A 5FLXQ 2Q2EB 2V34A 4PRVA 5LMNI 1RR9A 2V2ZA 2CG9A 2HFUA 1VISA 3K17A 3QT6A 2E1RA 4HXZA 4DV6I 4FWGA 4DV6E 3JAMQ 1Z59A 1Z0EA 4X65I 4MYUA 1HNXI 1N36I 4X65E 1HNXE 1N36E 1XMOI 1RREA 1ZXMA 4B3TI 1HNWI 1XMOE 4B3TE 1HNWE 4DPWA 1Z0CA 2DEIA 3B78A 5IT9Q 1N0VC 5IWAI 2Z5BA 1Y4SA 4DR2I 5IWAE 2HKJA 4DU8A 4DR2E 2Z5BB 1ELOA 3J81Q 1QZRA 4JI3I 1N34I 4JI8E 3J80Q 2VQFI 4FN5A 2A2DA 4WUDA 4JI3E 1N34E 3Q1QA 2VQFE 2BM0A 3J7AG 1UEKA 2ZITA 4HACA 3B8HA 1MU5A 2UU9I 1H73A 1N33I 4HACB 4DR1I 3T1HE 1KKHA 4DV1E 2UU9E 1D6TA 4DR7I 1N33E 3Q6NA 4DR1E 4DR7E 1U2RA 2V2VA 1ZM3A 2HK3A 1FWKA 4LF6E 4X62I 4B3MI 4DV3I 3OTOI 1J5EI 4X62E 4B3ME 4YY3I 4DV3E 3OTOE 4DR5I 1J5EE 4YY3E 1Y4UA 3P06A 4DPTA 2O1VA 4I3HA 5FLXC 3M6AA 4JI4I 2O1WA 2CZ9A 2WW4A 1XNQI 4B3RI 4JI4E 2E5LE 4B3RE 1KTVA 1MG7A 1XMQI 3HJCA 1XNQE 4WUBA 4DV2E 4DV0I 1XMQE 4HYMA 4LF8E 4GKKI 3JAMC 3PYGA 4DV0E 4JG4A 4GKKE 4DV7I 4WUCA 3B82A 1ZM4A 4DV7E 3ZKDA 4IZKA 1OJ4A 3K1JA 4P52A 2IOPA 4IZJD 1K47A 1FKAE 4FWDA 3V2UC 2BM1A 2VQEI 4FWHA 2VQEE 4R1FA 2HK2A 4FW9A 5IT9C 1S4EA 4LFAI 4GKJI 1NHJA 4LFBI 4LFAE 4B3SI 4GKJE 3J81C 1MX0A 4NXNI 4Z7YA 4X66E 4JI7I 3QT5A 4LFBE 4B3SE 3J80C 4YHHI 5GMDA 1XNRI 4JI7E 4NXNE 2R42A 4KHPI 4YHHE 1XNRE 4USMA 4UT4A 1NHIA 4KHPE 5A2QQ 2HHHI 4DUYI 2X7IA 1S16A 4PRXA 2UUCI 2HHHE 4DUYE 4LF5I 4JI8I 3Q6MA 2LJPA 5LMUI 2UUCE 2Z5EA 4LF5E 2Z5CA 2GQ0A 1IBMI 5LMUE 1IBKI 2HFSA 3WU3A 1IBME 2V2QA 3CWVA 1KVKA 4NXME 1IBKE 2Z5CB 4MYTA 2X36A 2A2CA 1H72C 3J7AM 3T1HI 4DV1I 3WU4A 2O1UA 1Y6ZA 4JYAI 2CGEA 4JYAE 1PVGA 4LF6I 2PNLA 1FJGI 2EFGA 3LTOA 1FJGE 1Z0GA 5BR8I 1B63A 2UXDI 4DPYA 5BR8E 2UXDE 4JV5I 4JV5E 4HY1A 1ZM9A 3PYFA 1WUUA 2UXCI 1ZM2A 4LFCI 2E5LI 3ZZUA 1Z0WA 2UXCE 4K0KI 4LFCE 4IZJA 2IOQA 2HKEA 4K0KE 4DV2I 4LF8I 3ZKBA 4Z7CA 2NPFA 1HR0I 4DU7A 4PU9A 4USKA 2XEXA 1H74A 3WU5A 1HR0E 1FNMA 4X64I 4OX9E 1B62A 4EMDA 4JI2I 4JI0E 4X64E 2GS8A 3ZM7A 4JI2E 1Z0BA 2PNMA 4JI5I 3LNUA 4IZKB 4DPXA 4JI5E 1USUA 4RPFA 4LF4I 1Z0VA 2BV3A 1XHKA 1HK7A 4LF4E 4N3OA 5LMNE 4DV4I 5A2QC 1A6FA 4UTGA 4DUZI 5GMEA 2VF3A 3ZZTA 1Z5CA 2ZBKB 4DV4E 2UUBI 4URLA 4X66I 1Z5BA 4DUZE 2UUBE 4DV5I 1EI1A 2R3VA 2UXBI 4DV5E 5FWKA 2UXBE 1HNZI 3QT7A 4P7AA 4ZVIA 1N0UA 1HNZE 3HULA 4DPUA 3GONA 1FI4A 4NXMI 4XTJA 1N32I 4LF9I 1N32E 4LF9E 1PKPA 2DEJA 5LL6R 3T1YI 1Z0TA 1NZ0A 3PRYA 3PYEA 3PYDA 1IBLI 1FWLA 3T1YE 1KIJA 2OI2A 1IBLE 2V8PA 3H4LA 2J7KA 1USVA 3K85A 2AJ4A 2UUAI 4JI6I 4JI1I 4LF7I 1ZXNA 3LPSA 2UUAE 4JI6E 1PIEA 4JI1E 4LF7E 4KQVA 1DARA 2O1TA 4DR6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5R A;  4DR6 E;  2F4V I;  4DR5 E;  4M1K A;  1I94 I;  1BKN A;  2F4V E;  4AQY I;  1NHH A;  1Z5A A;  1I94 E;  3D4J A;  4AQY E;  4OX9 I;  4DR4 I;  4JI0 I;  1H7U A;  4ED4 A;  3QT8 A;  3ZZ0 A;  4DR3 I;  4DXL A;  5L3J A;  4DR4 E;  1EA6 A;  2ZM6 I;  4DR3 E;  1H7S A;  2ZM6 E;  3F0N A;  3WU6 A;  5FLX Q;  2Q2E B;  2V34 A;  4PRV A;  5LMN I;  1RR9 A;  2V2Z A;  2HFU A;  1VIS A;  3K17 A;  3QT6 A;  2E1R A;  4HXZ A;  4DV6 I;  4FWG A;  4DV6 E;  3JAM Q;  1Z59 A;  1Z0E A;  4X65 I;  4MYU A;  1HNX I;  1N36 I;  4X65 E;  1HNX E;  1N36 E;  1XMO I;  1RRE A;  1ZXM A;  4B3T I;  1HNW I;  1XMO E;  4B3T E;  1HNW E;  4DPW A;  1Z0C A;  2DEI A;  3B78 A;  5IT9 Q;  1N0V C;  5IWA I;  4DR2 I;  5IWA E;  2HKJ A;  4DU8 A;  4DR2 E;  1ELO A;  3J81 Q;  1QZR A;  4JI3 I;  1N34 I;  4JI8 E;  3J80 Q;  2VQF I;  4FN5 A;  2A2D A;  4WUD A;  4JI3 E;  1N34 E;  3Q1Q A;  2VQF E;  2BM0 A;  3J7A G;  1UEK A;  2ZIT A;  4HAC A;  3B8H A;  1MU5 A;  2UU9 I;  1H73 A;  1N33 I;  4HAC B;  4DR1 I;  3T1H E;  1KKH A;  4DV1 E;  2UU9 E;  1D6T A;  4DR7 I;  1N33 E;  4DR1 E;  4DR7 E;  1U2R A;  2V2V A;  1ZM3 A;  2HK3 A;  1FWK A;  4LF6 E;  4X62 I;  4B3M I;  4DV3 I;  3OTO I;  1J5E I;  4X62 E;  4B3M E;  4YY3 I;  4DV3 E;  3OTO E;  4DR5 I;  1J5E E;  4YY3 E;  4DPT A;  4I3H A;  5FLX C;  3M6A A;  4JI4 I;  4B3R I;  2CZ9 A;  2WW4 A;  1XNQ I;  4JI4 E;  2E5L E;  4B3R E;  1KTV A;  1MG7 A;  1XMQ I;  1XNQ E;  4WUB A;  4DV2 E;  4DV0 I;  1XMQ E;  4HYM A;  4LF8 E;  4GKK I;  3JAM C;  3PYG A;  4DV0 E;  4JG4 A;  4GKK E;  4DV7 I;  4WUC A;  3B82 A;  1ZM4 A;  4DV7 E;  3ZKD A;  1OJ4 A;  3K1J A;  4P52 A;  1K47 A;  1FKA E;  4FWD A;  3V2U C;  2BM1 A;  2VQE I;  4FWH A;  2VQE E;  4R1F A;  2HK2 A;  4FW9 A;  5IT9 C;  1S4E A;  4LFA I;  4GKJ I;  1NHJ A;  4LFB I;  4LFA E;  4B3S I;  4GKJ E;  3J81 C;  1MX0 A;  4NXN I;  4Z7Y A;  4X66 E;  4JI7 I;  3QT5 A;  4LFB E;  4B3S E;  3J80 C;  4YHH I;  5GMD A;  1XNR I;  4JI7 E;  4NXN E;  2R42 A;  4KHP I;  4YHH E;  1XNR E;  4USM A;  4UT4 A;  1NHI A;  4KHP E;  5A2Q Q;  2HHH I;  4DUY I;  2X7I A;  1S16 A;  4PRX A;  2UUC I;  2HHH E;  4DUY E;  4LF5 I;  4JI8 I;  2LJP A;  5LMU I;  2UUC E;  4LF5 E;  1IBM I;  5LMU E;  1IBK I;  2HFS A;  3WU3 A;  1IBM E;  2V2Q A;  3CWV A;  1KVK A;  4NXM E;  1IBK E;  4MYT A;  2X36 A;  2A2C A;  1H72 C;  3J7A M;  3T1H I;  4DV1 I;  3WU4 A;  4JYA I;  4JYA E;  1PVG A;  4LF6 I;  1FJG I;  2EFG A;  3LTO A;  1FJG E;  1Z0G A;  5BR8 I;  1B63 A;  2UXD I;  4DPY A;  5BR8 E;  2UXD E;  4JV5 I;  4JV5 E;  4HY1 A;  1ZM9 A;  3PYF A;  1WUU A;  2UXC I;  1ZM2 A;  4LFC I;  2E5L I;  3ZZU A;  1Z0W A;  2UXC E;  4K0K I;  4LFC E;  2HKE A;  4K0K E;  4DV2 I;  4LF8 I;  3ZKB A;  4Z7C A;  2NPF A;  1HR0 I;  4DU7 A;  4PU9 A;  4USK A;  2XEX A;  1H74 A;  3WU5 A;  1HR0 E;  1FNM A;  4X64 I;  4OX9 E;  1B62 A;  4EMD A;  4JI2 I;  4JI0 E;  4X64 E;  2GS8 A;  3ZM7 A;  4JI2 E;  1Z0B A;  4JI5 I;  3LNU A;  4DPX A;  4JI5 E;  4RPF A;  4LF4 I;  1Z0V A;  2BV3 A;  1XHK A;  4LF4 E;  5LMN E;  4DV4 I;  5A2Q C;  1A6F A;  4UTG A;  4DUZ I;  5GME A;  2VF3 A;  3ZZT A;  1Z5C A;  2ZBK B;  4DV4 E;  2UUB I;  4URL A;  4X66 I;  1Z5B A;  4DUZ E;  2UUB E;  4DV5 I;  1EI1 A;  2R3V A;  2UXB I;  4DV5 E;  2UXB E;  1HNZ I;  3QT7 A;  4P7A A;  4ZVI A;  1N0U A;  1HNZ E;  3HUL A;  4DPU A;  3GON A;  1FI4 A;  4NXM I;  4XTJ A;  1N32 I;  4LF9 I;  1N32 E;  4LF9 E;  1PKP A;  2DEJ A;  5LL6 R;  3T1Y I;  1Z0T A;  1NZ0 A;  3PYE A;  3PYD A;  1IBL I;  1FWL A;  3T1Y E;  1KIJ A;  2OI2 A;  1IBL E;  2V8P A;  3H4L A;  2J7K A;  2AJ4 A;  2UUA I;  4JI6 I;  4JI1 I;  4LF7 I;  1ZXN A;  3LPS A;  2UUA E;  4JI6 E;  1PIE A;  4JI1 E;  4LF7 E;  4KQV A;  1DAR A;  4DR6 I; 
#chains in the Genus database with same CATH topology
 3PS2 A;  3V5R A;  4DR6 E;  2F4V I;  4DR5 E;  4M1K A;  4IZJ B;  4MU3 A;  1I94 I;  2C37 A;  1BKN A;  4IFD B;  2F4V E;  4AQY I;  1NHH A;  1Z5A A;  1I94 E;  3D4J A;  4AQY E;  4OX9 I;  4DR4 I;  4JI0 I;  1H7U A;  4ED4 A;  3GLL A;  2C37 B;  3QT8 A;  3ZZ0 A;  4AIM A;  4DR3 I;  3GME A;  4DXL A;  5L3J A;  5K36 F;  4DR4 E;  4FW3 A;  1EA6 A;  2C39 A;  2JEB A;  2ZM6 I;  4DR3 E;  4IS9 A;  4LOM A;  5JEA E;  1H7S A;  2ZM6 E;  3F0N A;  2C39 B;  2JEB B;  3WU6 A;  5FLX Q;  2Q2E B;  2V34 A;  4PRV A;  5LMN I;  1RR9 A;  4FW5 A;  4U3D A;  2V2Z A;  2CG9 A;  2HFU A;  1VIS A;  3K17 A;  3QT6 A;  2E1R A;  4HXZ A;  4DV6 I;  2CVE A;  2GO3 A;  4FWG A;  1Y5Y A;  4DV6 E;  3JAM Q;  1Z59 A;  1Z0E A;  5K36 E;  4X65 I;  3M85 D;  4MYU A;  4OO1 D;  1HNX I;  1N36 I;  4X65 E;  3PS1 A;  1HNX E;  1P42 A;  1Y60 A;  1N36 E;  1XMO I;  1RRE A;  1ZXM A;  4B3T I;  4OKG A;  1HNW I;  5C0X B;  1XMO E;  4B3T E;  1HNW E;  4DPW A;  4MQY A;  2BR2 A;  1Z0C A;  2C38 A;  2DEI A;  3B78 A;  5IT9 Q;  1N0V C;  5IWA I;  2NN6 C;  2BR2 B;  2Z5B A;  2C38 B;  1Y4S A;  4DR2 I;  5IWA E;  2HKJ A;  1RHY A;  4DU8 A;  4DR2 E;  2Z5B B;  1ELO A;  3J81 Q;  1QZR A;  5ELW A;  4JI3 I;  1N34 I;  4JI8 E;  3J80 Q;  2VQF I;  4FN5 A;  2A2D A;  4WUD A;  4JI3 E;  1N34 E;  3Q1Q A;  3KRN A;  2VQF E;  4MU1 A;  2BM0 A;  3J7A G;  1UEK A;  5JEA D;  2ZIT A;  4HAC A;  3P3G A;  3B8H A;  1MU5 A;  2UU9 I;  3U1Y A;  4LCG A;  1H73 A;  1N33 I;  3L7Z A;  4HAC B;  4DR1 I;  3T1H E;  1KKH A;  4DV1 E;  2UU9 E;  5DRO A;  1D6T A;  4DR7 I;  1N33 E;  3CDI A;  3Q6N A;  4DR1 E;  4DR7 E;  1U2R A;  2V2V A;  3L7Z B;  1ZM3 A;  2HK3 A;  1FWK A;  5K36 D;  4LF6 E;  4X62 I;  4B3M I;  4DV3 I;  3OTO I;  1J5E I;  4X62 E;  4B3M E;  4YY3 I;  4DV3 E;  3OTO E;  4DR5 I;  1J5E E;  4YY3 E;  1Y4U A;  2NN6 F;  2VES A;  3P06 A;  4DPT A;  4FW4 A;  1YH8 A;  2O1V A;  2PO0 A;  4I3H A;  5FLX C;  4IFD C;  3M6A A;  4JI4 I;  2JT2 A;  2O1W A;  2CZ9 A;  2WW4 A;  5EKW A;  2PO0 B;  1XNQ I;  4JI4 E;  4B3R I;  2E5L E;  4B3R E;  1E3H A;  1KTV A;  1MG7 A;  1XMQ I;  3HJC A;  1XNQ E;  4WUB A;  4DV2 E;  4DV0 I;  1XMQ E;  4HYM A;  4LF8 E;  4GKK I;  3JAM C;  4OO1 A;  5C0X E;  3PYG A;  4DV0 E;  4JG4 A;  4GKK E;  4DV7 I;  4WUC A;  3B82 A;  1ZM4 A;  2NN6 E;  4DV7 E;  4OO1 B;  1OYS A;  4QNJ A;  3ZKD A;  4IZK A;  1OJ4 A;  3K1J A;  3H1C A;  4P52 A;  2IOP A;  4IZJ D;  1K47 A;  1FKA E;  4FWD A;  3V2U C;  2BM1 A;  2BA0 D;  2VQE I;  4FWH A;  4LCF A;  2VQE E;  2O3Z A;  4MU0 A;  4R1F A;  1R6L A;  2HK2 A;  4FW9 A;  5IT9 C;  1S4E A;  4LFA I;  4GKJ I;  1NHJ A;  1UDN A;  4LFB I;  4LFA E;  3M85 G;  4B3S I;  4U3B A;  2WNR A;  4GKJ E;  3J81 C;  1MX0 A;  4NXN I;  4Z7Y A;  4X66 E;  4JI7 I;  3QT5 A;  3DD6 A;  5C0X C;  4LFB E;  4B3S E;  4IFD F;  3J80 C;  5JEA A;  5GMD A;  4YHH I;  1XNR I;  4JI7 E;  4NXN E;  5EL9 A;  2PO2 A;  2R42 A;  4KHP I;  2WNR B;  4YHH E;  3P3C A;  1XNR E;  4USM A;  1NHI A;  4UT4 A;  4KHP E;  5A2Q Q;  2HHH I;  4DUY I;  2X7I A;  5JEA B;  1S16 A;  2PO2 B;  4PRX A;  2UUC I;  2HHH E;  4DUY E;  4LF5 I;  4JI8 I;  3Q6M A;  2LJP A;  5LMU I;  2UUC E;  2Z5E A;  4J3D A;  2Z5C A;  4LF5 E;  2GQ0 A;  1IBM I;  3M7N D;  5LMU E;  5DRQ A;  1IBK I;  2HFS A;  3WU3 A;  1IBM E;  2V2Q A;  3CWV A;  1KVK A;  4NXM E;  1IBK E;  2Z5C B;  5K36 A;  4FW7 A;  4MYT A;  2X36 A;  2A2C A;  5C0X D;  1H72 C;  3J7A M;  3T1H I;  4DV1 I;  4IFD E;  2GO4 A;  3WU4 A;  2O1U A;  5K36 B;  2PO1 A;  1UDO A;  2NN6 D;  2AE8 A;  1Y6Z A;  2BA1 D;  4JYA I;  1VI7 A;  2PO1 B;  2PNZ A;  2CGE A;  4JYA E;  1PVG A;  4LF6 I;  2PNL A;  1FJG I;  5DRP A;  2EFG A;  3LTO A;  4AID A;  1FJG E;  1Z0G A;  2BA1 G;  1OYR A;  5BR8 I;  1B63 A;  5C0X F;  2UXD I;  4DPY A;  5BR8 E;  2WP8 A;  2UXD E;  4JV5 I;  4JV5 E;  4HY1 A;  1ZM9 A;  3PYF A;  1WUU A;  2UXC I;  1ZM2 A;  4LFC I;  2JEA A;  2E5L I;  3ZZU A;  1Z0W A;  2UXC E;  4K0K I;  3P76 A;  4LFC E;  4IZJ A;  3HKM A;  2IOQ A;  2HKE A;  3GCM A;  4K0K E;  4DV2 I;  2JEA B;  4LF8 I;  5DRR A;  3ZKB A;  4Z7C A;  2NPF A;  1HR0 I;  4DU7 A;  4PU9 A;  4USK A;  2XEX A;  1H74 A;  3WU5 A;  1HR0 E;  1FNM A;  3P3E A;  2F1D A;  4X64 I;  4QNK A;  4OX9 E;  1B62 A;  1OYP A;  4EMD A;  4JI2 I;  4X64 E;  4JI0 E;  2GS8 A;  4OO1 C;  2IES A;  3ZM7 A;  4JI2 E;  4IFD D;  1Z0B A;  2PNM A;  4GQU A;  5DNX A;  4JI5 I;  2JE6 A;  3LNU A;  4ISA A;  4IZK B;  4DPX A;  4JI5 E;  1USU A;  4OZE A;  4RPF A;  4LF4 I;  1Z0V A;  2J65 A;  2BV3 A;  1XHK A;  2JE6 B;  1HK7 A;  4LF4 E;  4N3O A;  5LMN E;  4DV4 I;  5A2Q C;  2BA0 G;  1A6F A;  4UTG A;  4DUZ I;  5GME A;  2VF3 A;  3ZZT A;  4AM3 A;  1Z5C A;  2ZBK B;  4DV4 E;  2UUB I;  4URL A;  4X66 I;  3B4T A;  1Z5B A;  4DUZ E;  4LCH A;  2UUB E;  4DV5 I;  1EI1 A;  2R3V A;  2UXB I;  4DV5 E;  4MU4 A;  4NBQ A;  5FWK A;  2UXB E;  1UDQ A;  5C0X A;  1HNZ I;  2IER A;  3QT7 A;  4P7A A;  4ZVI A;  1N0U A;  1HNZ E;  1XXE A;  2NN6 A;  3HUL A;  5JEA C;  4DPU A;  3GON A;  3U1K A;  1FI4 A;  4MDT A;  4NXM I;  2NN6 B;  4XTJ A;  1N32 I;  4LF9 I;  4BA2 A;  1N32 E;  4LF9 E;  4OO1 F;  3M7N G;  1PKP A;  4BA2 B;  2DEJ A;  5LL6 R;  4LPF A;  3T1Y I;  5K36 C;  1Z0T A;  1NZ0 A;  3PRY A;  3PYE A;  5DNL A;  4FW6 A;  3PYD A;  1IBL I;  1FWL A;  3T1Y E;  1KIJ A;  1UDS A;  2OI2 A;  3NZK A;  1IBL E;  2V8P A;  3H4L A;  2PNZ B;  1YHC A;  3CDJ A;  4BA1 A;  2J7K A;  1USV A;  3PS3 A;  3UHM A;  3K85 A;  4OO1 E;  2AJ4 A;  2UUA I;  4JI6 I;  1R6M A;  4BA1 B;  4JI1 I;  4LF7 I;  1ZXN A;  2WP8 B;  3LPS A;  2UUA E;  4JI6 E;  1PIE A;  4JI1 E;  4LF7 E;  4KQV A;  5JEA F;  1DAR A;  2O1T A;  4IFD A;  4DR6 I;  1E3P A; 
#chains in the Genus database with same CATH homology
 3V5R A;  4DR6 E;  2F4V I;  4DR5 E;  4M1K A;  4IZJ B;  1I94 I;  1BKN A;  2F4V E;  4AQY I;  1NHH A;  1Z5A A;  1I94 E;  3D4J A;  4AQY E;  4OX9 I;  4DR4 I;  4JI0 I;  1H7U A;  4ED4 A;  3QT8 A;  3ZZ0 A;  4DR3 I;  4DXL A;  5L3J A;  4DR4 E;  1EA6 A;  2ZM6 I;  4DR3 E;  1H7S A;  2ZM6 E;  3F0N A;  3WU6 A;  5FLX Q;  2Q2E B;  2V34 A;  4PRV A;  5LMN I;  1RR9 A;  2V2Z A;  2CG9 A;  2HFU A;  1VIS A;  3K17 A;  3QT6 A;  2E1R A;  4HXZ A;  4DV6 I;  4FWG A;  4DV6 E;  3JAM Q;  1Z59 A;  1Z0E A;  4X65 I;  4MYU A;  1HNX I;  1N36 I;  4X65 E;  1HNX E;  1N36 E;  1XMO I;  1RRE A;  1ZXM A;  4B3T I;  1HNW I;  1XMO E;  4B3T E;  1HNW E;  4DPW A;  1Z0C A;  2DEI A;  3B78 A;  5IT9 Q;  1N0V C;  5IWA I;  2Z5B A;  1Y4S A;  4DR2 I;  5IWA E;  2HKJ A;  4DU8 A;  4DR2 E;  2Z5B B;  1ELO A;  3J81 Q;  1QZR A;  4JI3 I;  1N34 I;  4JI8 E;  3J80 Q;  2VQF I;  4FN5 A;  2A2D A;  4WUD A;  4JI3 E;  1N34 E;  3Q1Q A;  2VQF E;  2BM0 A;  3J7A G;  1UEK A;  2ZIT A;  4HAC A;  3B8H A;  1MU5 A;  2UU9 I;  1H73 A;  1N33 I;  4HAC B;  4DR1 I;  3T1H E;  1KKH A;  4DV1 E;  2UU9 E;  1D6T A;  4DR7 I;  1N33 E;  3Q6N A;  4DR1 E;  4DR7 E;  1U2R A;  2V2V A;  1ZM3 A;  2HK3 A;  1FWK A;  4LF6 E;  4X62 I;  4B3M I;  4DV3 I;  3OTO I;  1J5E I;  4X62 E;  4B3M E;  4YY3 I;  4DV3 E;  3OTO E;  4DR5 I;  1J5E E;  4YY3 E;  1Y4U A;  3P06 A;  4DPT A;  2O1V A;  4I3H A;  5FLX C;  3M6A A;  4JI4 I;  2O1W A;  2CZ9 A;  2WW4 A;  1XNQ I;  4B3R I;  4JI4 E;  2E5L E;  4B3R E;  1KTV A;  1MG7 A;  1XMQ I;  3HJC A;  1XNQ E;  4WUB A;  4DV2 E;  4DV0 I;  1XMQ E;  4HYM A;  4LF8 E;  4GKK I;  3JAM C;  3PYG A;  4DV0 E;  4JG4 A;  4GKK E;  4DV7 I;  4WUC A;  3B82 A;  1ZM4 A;  4DV7 E;  3ZKD A;  4IZK A;  1OJ4 A;  3K1J A;  4P52 A;  2IOP A;  4IZJ D;  1K47 A;  1FKA E;  4FWD A;  3V2U C;  2BM1 A;  2VQE I;  4FWH A;  2VQE E;  4R1F A;  2HK2 A;  4FW9 A;  5IT9 C;  1S4E A;  4LFA I;  4GKJ I;  1NHJ A;  4LFB I;  4LFA E;  4B3S I;  4GKJ E;  3J81 C;  1MX0 A;  4NXN I;  4Z7Y A;  4X66 E;  4JI7 I;  3QT5 A;  4LFB E;  4B3S E;  3J80 C;  4YHH I;  5GMD A;  1XNR I;  4JI7 E;  4NXN E;  2R42 A;  4KHP I;  4YHH E;  1XNR E;  4USM A;  4UT4 A;  1NHI A;  4KHP E;  5A2Q Q;  2HHH I;  4DUY I;  2X7I A;  1S16 A;  4PRX A;  2UUC I;  2HHH E;  4DUY E;  4LF5 I;  4JI8 I;  3Q6M A;  2LJP A;  5LMU I;  2UUC E;  2Z5E A;  4LF5 E;  2Z5C A;  2GQ0 A;  1IBM I;  5LMU E;  1IBK I;  2HFS A;  3WU3 A;  1IBM E;  2V2Q A;  3CWV A;  1KVK A;  4NXM E;  1IBK E;  2Z5C B;  4MYT A;  2X36 A;  2A2C A;  1H72 C;  3J7A M;  3T1H I;  4DV1 I;  3WU4 A;  2O1U A;  1Y6Z A;  4JYA I;  2CGE A;  4JYA E;  1PVG A;  4LF6 I;  2PNL A;  1FJG I;  2EFG A;  3LTO A;  1FJG E;  1Z0G A;  5BR8 I;  1B63 A;  2UXD I;  4DPY A;  5BR8 E;  2UXD E;  4JV5 I;  4JV5 E;  4HY1 A;  1ZM9 A;  3PYF A;  1WUU A;  2UXC I;  1ZM2 A;  4LFC I;  2E5L I;  3ZZU A;  1Z0W A;  2UXC E;  4K0K I;  4LFC E;  4IZJ A;  2IOQ A;  2HKE A;  4K0K E;  4DV2 I;  4LF8 I;  3ZKB A;  4Z7C A;  2NPF A;  1HR0 I;  4DU7 A;  4PU9 A;  4USK A;  2XEX A;  1H74 A;  3WU5 A;  1HR0 E;  1FNM A;  4X64 I;  4OX9 E;  1B62 A;  4EMD A;  4JI2 I;  4JI0 E;  4X64 E;  2GS8 A;  3ZM7 A;  4JI2 E;  1Z0B A;  2PNM A;  4JI5 I;  3LNU A;  4IZK B;  4DPX A;  4JI5 E;  1USU A;  4RPF A;  4LF4 I;  1Z0V A;  2BV3 A;  1XHK A;  1HK7 A;  4LF4 E;  4N3O A;  5LMN E;  4DV4 I;  5A2Q C;  1A6F A;  4UTG A;  4DUZ I;  5GME A;  2VF3 A;  3ZZT A;  1Z5C A;  2ZBK B;  4DV4 E;  2UUB I;  4URL A;  4X66 I;  1Z5B A;  4DUZ E;  2UUB E;  4DV5 I;  1EI1 A;  2R3V A;  2UXB I;  4DV5 E;  5FWK A;  2UXB E;  1HNZ I;  3QT7 A;  4P7A A;  4ZVI A;  1N0U A;  1HNZ E;  3HUL A;  4DPU A;  3GON A;  1FI4 A;  4NXM I;  4XTJ A;  1N32 I;  4LF9 I;  1N32 E;  4LF9 E;  1PKP A;  2DEJ A;  5LL6 R;  3T1Y I;  1Z0T A;  1NZ0 A;  3PRY A;  3PYE A;  3PYD A;  1IBL I;  1FWL A;  3T1Y E;  1KIJ A;  2OI2 A;  1IBL E;  2V8P A;  3H4L A;  2J7K A;  1USV A;  3K85 A;  2AJ4 A;  2UUA I;  4JI6 I;  4JI1 I;  4LF7 I;  1ZXN A;  3LPS A;  2UUA E;  4JI6 E;  1PIE A;  4JI1 E;  4LF7 E;  4KQV A;  1DAR A;  2O1T A;  4DR6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...